1K6EA

Complex of hydrolytic haloalkane dehalogenase linb from sphingomonas paucimobilis ut26 with 1,2-propanediol (product of dehalogenation of 1,2-dibromopropane) at 1.85a
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
295
structure length
295
Chain Sequence
SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HALOALKANE DEHALOGENASE
publication title Haloalkane dehalogenase LinB from Sphingomonas paucimobilis UT26: X-ray crystallographic studies of dehalogenation of brominated substrates.
pubmed doi rcsb
source organism Sphingomonas paucimobilis
molecule tags Hydrolase
total genus 108
structure length 295
sequence length 295
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2001-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1k6eA00
3VVMA 4G4JA 1JFRA 1THTA 1XZGA 2AJLI 4DIUA 1WB5A 1TIBA 3D0KA 3D7RA 3FBWA 4X92A 5AIBA 5FXMA 3FYUB 5DYTA 4PNZA 3DDUA 4G8CA 2P8SA 1XZBA 5IVIA 2ORYA 3VJMA 3R3ZA 5AOAA 4U2CA 2ECFA 1LPNA 1K63A 3AINA 2RI6A 5ALXA 4RE6A 1CUEA 5AH0A 1E8DA 4NMWA 2HL6A 1I6WA 4CCYB 4Y7DA 1MNAA 4G1FA 1USWA 3MUOA 4DNOA 3FCXA 4Q3KA 4J0HA 4WCVA 5AK3A 2X76A 2GYWA 3LLCA 1BN7A 3HJUA 1CUWA 2W6CX 2YH2A 2PUJA 2PPLA 3AZPA 4YASA 1E66A 4N8DA 3KD2A 4JEIA 1QIJA 2AJCA 4TGLA 3D3NA 3A2MA 1XZEA 4G4GA 1ZJ5A 3CN9A 2CKMA 1QIDA 2XMSA 3G0IA 1BCSA 3LIIA 1W4LA 3S2ZA 2HFJA 2WSLA 2GBCA 5DNUA 4F5ZA 2JGFA 1VXRA 1QOZA 3KWJA 3R0VA 3GUUA 1JJFA 3AZOA 1XZCA 4X94A 1BROA 4AZ0A 5FPQA 1QIKA 3U0VA 5ALYA 1MPXA 4AQDA 2ACKA 4GXNA 1QZ3A 1J06A 4CI9A 4Y2SA 3D2CA 2BUBA 5AM4A 1CIJA 4LYDA 1CEXA 3QMWA 1H2ZA 3PUIA 2HFKA 2XUQA 2B4KA 4BC1A 1W76A 4H7JA 1GT6A 2Z3ZA 4Y9SA 1B41A 1CVLA 1WB4A 5FLKA 1CUAA 2DR0A 1XZFA 4HRXA 1EVEA 4O08A 3FCYA 4NZZA 2OPHA 5CURA 1QFSA 3RARA 3ZV7A 1J2EA 3F97A 3PF9A 3TGLA 2WHRA 5CXXA 1GPNA 5LP1A 4YX9A 1PV1A 5CT5A 4BE4A 3KSRA 2VA9A 2DQYA 5AKIA 2QUBA 2VEOA 3ESCA 5K3CA 2CJPA 1DWOA 4X00A 1DU4A 2WTMA 1YCDA 3G9ZA 4MYDA 5E4YA 4BCDA 5CRIA 5T4EA 4C88A 3Q0TA 3STVA 4LYEA 2BCEA 3V1KA 2R11A 1IZ8A 1O6GA 5JAPA 5HFAA 2CBGA 2PX6A 1AZWA 3QMMA 5LKAA 2XT0A 1H2YA 1RYYA 2ZYHA 2GBFA 1ZD5A 4IHAA 5AP9A 5CT9A 3N0TA 1WCYA 4BAUA 1K6EA 1EVQA 1VE6A 5K3AA 5CBKA 3WJ1A 5EIEA 4QZVA 1GXSA 2XUHA 1AUOA 4IH9A 3A2LA 1QGED 4KE7A 2ZYRA 5AIAA 5AKKA 1R9MA 1CUJA 2WU4A 3HABA 2WM2A 2V9ZA 3BE8A 5JD4A 2I3DA 4X95A 2OGZA 1EX9A 1JMKC 5AKYA 1XRLA 2QZPA 3X3HA 2HHAA 4CG3A 4F21A 4KRYA 1C4XA 4FTWA 1K5PA 5EHXA 4P93A 3WZMA 4HXFB 4H0CA 4FFWA 5EGNA 4UBNA 1M33A 1WM1A 5ALWA 2WUFA 4UBIA 4JH0A 1W1IA 2VAXA 4J03A 4X97A 4PSCA 4U2GA 3D5EA 4Y2UA 5ALIA 3EIOA 4DTCA 5JYCA 1SOMA 3OTQA 3CXUA 4DMCA 1LZLA 4ETWA 3VXKA 3HACA 3AIMA 2QXUA 2WQZA 4X71A 2OCIA 5KBYA 3G9XA 3AZQA 3H1BA 5BOVA 3DQZA 1EDEA 3STXA 5ALLA 1DWPA 3T4UA 2C7BA 4QDOA 1X2BA 5T4BA 1YA8A 4N8EA 4ROTA 4U2EA 4EA6A 3QMVA 3H19A 2ZSIA 4QA9A 1XZHA 4FLFA 3IUQA 1VA5A 1EK1A 3PF8A 5K3FA 1Q0ZA 5ALUA 1S8OA 2XUKA 4G5XA 3PUHA 1MX5A 3WL6A 1VOTA 1KEZA 3ZPXA 2Y6VA 1JI3A 3GROA 2WIJA 2E3JA 1XKTA 1IUNA 3STTA 1A8UA 2WIDA 3BJMA 4Z49A 3I1YA 1UK6A 4P9NA 3FVTA 4NS4A 1MTZA 4E46A 4GHWA 1ODCA 1YS2X 3DYIA 4WFKA 3IIIA 1FSSA 3B5EA 1F8UA 1QONA 3CCCA 1QE3A 4ZV9A 2WJ4A 5D3ZA 1YS1X 2G5TA 3ESDA 3DS8A 2XQJA 1KU6A 4ZREA 3U1TA 3IVMA 2JGLA 5C8VA 2H7CA 2RONA 2XUAA 2OCGA 1F0NA 1CUBA 5JALA 4JYPA 5ALVA 4EHBA 4FDMA 5JAUA 2WUDA 1ZIXA 2BAGA 3LIPA 3DOHA 3I28A 5AI9A 2VF2A 4H7KA 2W22A 3G9TA 3H1AA 1EB9A 2HU8A 5A7HA 4OB6A 3EQ8A 1XZIA 4UBLA 3R3VA 3BJRA 2XI4A 2C4HA 2AJDA 2WFLB 4ZWNA 3DL7A 3V1LA 3AIKA 1JKMA 3IUNA 3QYJA 2WILA 1BEZA 3C6YA 1W6RA 1K4YA 2B9VA 2G63A 1AKNA 3O9MA 2XDWA 2OGTA 3I1IA 1E8MA 3QVMA 3WWEA 1LLFA 4N5HX 5AK4A 3YASA 1DTEA 1ZGBA 4BDTA 4OU5A 2HU7A 2D5LA 3MGAA 2PL5A 3VDXA 4UFOA 4AMYA 1ZI8A 3V9AA 1VJ5A 4UUQA 3WIBA 4LXIA 2JGKA 1TCBA 3WK6A 4Y2VA 1WPRA 1NU6A 5SYNA 4TPKA 4GLBA 4ARBA 2VT6A 4X91A 5AI6A 4DNQA 3IUJA 1F0PA 2VJAA 3E3AA 1ETHA 4HRYA 4QNNA 5DYYA 5D6OA 2O2HA 4KYVA 4FFVA 1ZD2P 2O2IA 2WKWA 4Q05A 1AGYA 4H7HA 4IO0A 3I2KA 3E4DA 5LYYA 5LZ5A 2WFMA 2V98A 4Q3OA 1ZI9A 4QEKA 4EBBA 1LPPA 2FUKA 4I3FA 4J0KA 4W1SA 4Y2YA 4B9AA 3O4GA 1QJ4A 3HYSA 1E3QA 3KDAA 1CRLA 5FDFA 4UBKA 3S8YA 4BCBA 4PQEA 4OB8A 1R50A 1HPLA 2XUGA 3QPDA 1UOPA 1MJ5A 4GWLA 2I78A 5DYWA 3C6XA 2ZSHA 5EFZA 2HRQA 5AKLA 2VQ6A 2WG2A 1UWCA 2WIFA 1BS9A 2HA0A 2WJ6A 4U2FA 4K6GA 3WI7A 3G0GA 4QE3A 4WFIA 2CB9A 1N5RA 4HS9A 3VJKA 1QIHA 2ZJ6A 3C87A 4XVCA 4Y2RA 4X6YA 3WK9A 3STWA 2ONCA 2WG1A 3C5VA 1EI9A 4BATA 1R3DA 1CUZA 1EH5A 1LNSA 5AKGA 1XQVA 3WA6A 1BN6A 4C89A 5CH5A 1JT2A 1YR2A 4UPDA 2DFPA 5ALTA 2D0DA 2O7RA 2VATA 1DT3A 1GGVA 1G42A 5JANA 4MWSA 5K3DA 2V96A 3K9BA 4P08A 2DQZA 3IB3A 4C4YA 3ZWQA 5E2IA 3HLKA 3RK4A 1EA5A 1H2XA 1QO9A 3VJLA 4C6HA 3QPAA 2QMQA 1UT6A 2ES4A 3WZLA 5ALPA 2DHCA 4L3WA 3K2IA 3A6ZA 4OCZA 3IA2A 3NGMA 3FYTA 3MUNA 3F9CA 4KE6A 1CUGA 5EHQA 3BIXA 5E4JA 3WWPA 3D2AA 4CG2A 1SCQA 1VA4A 3GELA 2DCMA 1U8EA 2VSQA 3G7NA 1CV2A 3WA7A 1QLWA 3STUA 3EQ7A 4F0JA 3SK0A 1H2WA 1P0PA 3HXKA 5YASA 5KREA 1QO7A 2EDAA 3FSGA 3VKFA 1UXOA 4BYMA 5A71A 1WHSA 2QUAA 4AB1A 3NUZA 4PW0A 2K2QB 4AXBA 3EBLA 3KWFA 1R88A 1OILA 5AOBA 2XUPA 2Y1KA 3PICA 5DNWA 4X3CA 2QRUA 5A62A 2RHTA 1P0IA 5JIBA 5BV7A 3FAKA 4UFNA 3NWOA 1HDEA 2BGRA 2GBIA 4G4IA 3FYUA 4H7FA 3TRDA 3DD5A 1W52X 1T2NA 3ZLVA 1HKHA 3H17A 2QS9A 3I2FA 1ACLA 3PFBA 4ZI5A 1YB7A 4Y2TA 5JZSA 1UK8A 4QLOA 4X6UA 2VAVA 2QKYA 5C8ZA 5IKXA 2WUEA 7YASA 4CCYA 2ZYSA 5LIPA 3ZI7A 3W9UA 1A88A 4H7DA 4Y2PA 4LKOA 3F67A 5CT6A 4F60A 4C4XA 3ICVA 4H7IA 2FJ0A 3GBSA 2R8BA 3C8HA 3WWDA 4RGYA 4J0JA 2C0QA 3C8DA 3O4JA 3OPMA 5LZ2A 4FKBA 4B0OA 3OOSA 5AJHA 3DYVA 3RM3A 1THGA 3F96A 5K3FB 1DQZA 1O6FA 1WHTA 5ALQA 1MO2A 1Q0RA 4S0XA 5HFNA 3IBTA 5IVHA 3DLTA 3OM8A 4WDQA 4X93A 4J0GA 1EK2A 5AKXA 3PE6A 4J0IA 2C58A 4H7EA 5AK5A 1A7UA 5HK9A 1CUXA 2AJ8A 5AM5A 1JMYA 5JATA 5J3JA 1H23A 1TQHA 5H3HA 1T4MA 2HA6A 1DX6A 2QM0A 2QJWA 2RIPA 5HF5A 2VJBA 4N5IX 1XRNA 4B0PA 1ISPA 4W9RA 1JU4A 2WHPB 3HEAA 1ZIYA 2XMZA 4FBMA 2BUAA 4Y2XA 5AICA 1AQLA 5LZ4A 4BZZA 5DLPA 1F6WA 3A70A 2XMBA 3D4LA 2HA3A 3R3XA 4GEGA 1GKKA 4MEAA 3V1MA 3H0CA 1U4NA 2OQVA 2XMQA 5CT8A 3BF8A 2PBLA 4CIAA 2VJDA 2QT9A 3DKRA 4K6KA 1LBSA 1J1IA 2X8BA 3WYDA 4M0EA 2CZQA 1AX9A 1CFJA 2VTVA 5LKRA 2PSEA 4RNCA 3WMRA 1TCCA 4QLAA 5CH3A 5ALRA 3W2TA 3M81A 3QBJA 2I03A 4INZA 4DLNA 3D59A 3AJAA 1BRTA 1UFOA 2JGMA 4LHEA 2H9YA 2ACEA 4EY8A 4DMFA 5JASA 4Y2QA 5ALOA 2HA4A 1OCEA 2OG1A 1L7AA 4FNGA 1SC9A 2J3QA 2EEPA 3GZJA 4OPMA 5HF8A 4B7ZA 5A6VA 4H18A 2XQGA 1XLWA 4AO7A 5JD6A 5DTJA 4Q1VA 2CUTA 4IH4A 1LZKA 2JGJA 1L7RA 3CN7A 5ALDA 1QIIA 2Y2VA 1XQWA 4OUKX 2NW6A 2JBWA 3W05A 4RPCA 3GFFA 3QH4A 2G4LA 2WJ3A 4EY5A 2AXEA 4OU4A 2ROQA 4X7BA 5DWDA 3R40A 3WIOA 4OB7A 1LPAB 2XUIA 3IDAA 5AKZA 1VXOA 5C7YA 5IVDA 1FFDA 2BUCA 3HI4A 4G8DA 5HKAA 5ALFA 3WK5A 1XZJA 5AM2A 4AN0A 3I6ZA 2J4FA 2PM8A 4MWTA 2WTNA 4BP9A 2C5FA 3FWHA 5ALMA 4CCWA 4OD0A 3FNBA 2YYSA 1SCKA 1EHYA 1JJIA 2AJBA 1MX1A 4CG1A 1J07A 2XB6A 4HZGA 2DHDA 1ZICA 3WL8A 2XQIA 3SC2A 4KJXA 3IURA 5AM1A 1JU3A 4AO8A 3DJYA 2Z5GA 3G0CA 4QDXA 1YASA 1CR6A 3F8SA 5JARA 1CUYA 2PSJA 1ZJ4A 2VT7A 4X6XA 4MEBA 2ZJFA 2V97A 3R3UA 2ZJ7A 4LIPD 5ALKA 3H2IA 1EINA 1UKCA 3C6BA 2WHQA 3O95A 1LPSA 4M0MA 1IUPA 3I6YA 5LLSA 3C70A 3PI6A 3WK7A 4HTAA 4BVJA 4IH1A 2GYVA 4E14A 3C6ZA 4Y2JA 3M3DA 3ZLUA 1HBJA 4UFPA 3LS2A 5LZ7A 3V1NA 5K3EA 2O7VA 3DNMA 3WL5A 1XZAA 3WJ2A 3N2ZB 1XZMA 3ILSA 2PUHA 4HVTA 4EZIA 4W1RA 3DEAA 4KAJA 5CXUA 2QR5A 2IITA 4B80A 4MYSA 2GZRA 1LPBB 1AURA 2HA7A 1IVYA 1SFRA 2OCLA 4BVLA 1QTIA 3WK8A 3HRHA 1A8SA 5AKHA 1ZD4A 3W9BA 3WKDA 3FOBA 4V2IA 5AI4A 2PVSA 4YK7A 5T4HA 4A5SA 3WKAA 4BAZA 3G8YA 5FKJA 2OLEA 4K5QA 2ZYIA 5CTAA 5EHNA 1UKBA 1XRMA 4DNFA 3I2JA 4KACA 2PSHA 2QXTA 5HQ3A 2WIGA 4KAAA 1YA4A 4QDTA 2H1IA 3WKBA 4K6HA 3G9UA 1UK9A 2Y2UA 1Q83A 1WOMA 3G0DA 4GECA 3DCNA 5JAOA 1MX9A 5K3BA 2WFLA 3R3WA 5HF6A 2HRRA 4B81A 5AI5A 4PSUA 2PU5A 3WWOA 1ZD3A 5AHXA 1UOOA 2OQIA 1TKRA 2CEKA 4FWBA 3PDCA 2O2GA 3QPCA 3STYA 3H04A 3WQHA 4UBJA 4BVKA 4WDRA 2HM7A 4JNCA 5AM3A 1E8NA 4E11A 1VE7A 3MVEA 5AKEA 2XUJA 4D9JA 1XQYA 3FLBA 1BE0A 4KR0A 1R1DA 5HK8A 3A2NA 2XUDA 2PU7A 5JZ9A 4DMHA 1FJ2A 4PV7A 1VKHA 1K8QA 1N5MA 1HQDA 1MT3A 4ZV7A 1GZ7A 4BB0A 1ODTC 2J4CA 4XIIA 2OAGA 3H2GA 4ITVA 1X2EA 2HIHA 5JZBA 5AK6A 3FLEA 5F4ZA 1UOQA 5HKBA 1NX9A 4GDMA 2HADA 1JJBA 3JWEA 5ESRA 1MN6A 1Y7HA 1AC5A 5ALEA 4FHZA 1EDDA 5D3KA 3JYHA 1B6GA 1Y37A 2Q0XA 2WG0A 3Q8WA 4BRZA 5CMLA 3FLAA 5FP0A 3I2IA 5ALJA 3M82A 4BAGA 4OYYA 1ZOIA 4PSDA 2RHWA 5ALHA 3L1HA 2C5GA 3G0BA 3BF7A 5IVKA 4RE5A 1YSCA 3HZOA 1DQYA 4EUSA 3O4HA 5HCUA 2B20A 3QZUA 4QDUA 1HL7A 5DJ5A 2Z3WA 2JGEA 3AILA 3AIOA 2WUGA 3RLIA 4UBMA 4H77A 3WWCA 2QTBA 3C43A 4WY5A 3PFCA 4UHBA 1EB8A 5FPPA 4I19A 1ACJA 1UZAA 5I9IA 5FV4A 3AFIA 4EB0A 1TRHA 3G02A 1IMJA 3QITA 3H2KA 3T52A 2LIPA 1LPOA 1LGYA 2XUFA 4A16A 4GI1A 4AZ3A 1XZDA 3P2MA 1EDBA 2XLCA 2PSFA 4B82A 2JIDA 1CUHA 1MU0A 1XQXA 3ICWA 4KRXA 3I2HA 4J7AA 4YPVA 2DSNA 2OXEA 4ARAA 3HSSA 2UZ0A 2HU5A 1XRRA 2JEYA 3F98A 4XJVA 1R4ZA 5AO9A 2VJCA 4AX4A 2Y6UA 1CQZA 4DSAA 1MAHA 5C81A 4W1PA 1MNQA 1UKAA 3E1GA 3BL8A 3R41A 4IQ4A 1Z68A 1XFDA 2C0PA 4MQMA 1AMNA 4B83A 1ORWA 4J0DA 2XMDA 5FUMA 1RP1A 2GBGA 4BDSA 1IZ7A 1QIMA 1G5FA 2JEZA 2QJRA 3BDVA 2XMCA 3O0DA 2JF0A 5EHZA 5EIAA 2X5XA 3FSGD 4Q3LA 2WFZA 4J0CA 1DT5A 2XLBA 5I8PA 5AM0A 2WLSA 3M83A 3OC0A 1FFCA 3L1JA 3WL7A 4UHHA 5JAHA 5BWBA 5D7BA 3WYNA 3CCBA 2XMGA 4BP8A 2XE4A 5DNVA 1GPLA 5EI5A 3WK4A 3H18A 3O4IA 3B3QA 1DINA 3WLAA 2J3DA 3VVLA 3R3YA 5IH7A 4EY7A 2OAEA 4JUIA 4B84A 2PSDA 1TCAA 5I7UA 1YAHA 1XRPA 4QWWA 1GKLA 2I3ZA 4XX1A 1D07A 3K6KA 3O9VA 4HXEB 4X85A 4ZRDA 6YASA 4CIBA 2QOEA 2XUOA 4MQLA 4LXHA 1FFAA 4WFJA 2GZSA 4BCCA 3B12A 2G5PA 1CUIA 4MJ3A 1CQWA 2H7XA 4BC0A 5ISMA 3UUFA 2EDCA 1L7QA 1E5TA 3WKCA 4CFSA 4DGQA 5HF9A 1U2EA 1QIFA 3AUKA 3E0XA 3TJMA 4EY6A 4L0CA 3D2BA 1BEEA 5JADA 1XROA 1Q84A 3ZLTA 4OSEA 1QIEA 5FOQA 3BWXA 1DWQA 1QIGA 2QVBA 5AI0A 1TAHA 4X90A 4WY8A 2JGIA 4PF1A 2OCKA 1C7IA 1H22A 3I6MA 3FVRA 1OXMA 5AKJA 3HC7A 4L9AA 4XWGA 1EXWA 2GYUA 4U2BA 3JW8A 2OGSA 4B9EA 1HLGA 4KE8A 4KEAA 1VZ2A 3BIWA 3H2HA 4AMZA 2RAUA 2BGNA 1BCRA 5BWCA 2HDWA 2YASA 4K2AA 1YB6A 2WIKA 2BKLA 1RWQA 4QDZA 2RGUA 4UHDA 1ODSA 3C5WP 3BDIA 4U2DA 3ANSA 3SX4A 2FX5A 5AI8A 1CUSA 1MAAA 1XRQA 1XZKA 1N8SA 1PFQA 2HA5A 4LXGA 1G66A 3EQ9A 2Z8ZA 3EF3A 1G4HA 2WHPA 5CH8A 4N8SA 1LBTA 5KWJA 3OURA 4FBLA 2DHEA 2HA2A 1CPYA 2XMRA 1ZGCA 1QFMA 3DOIA 4DMKA 4UHEA 4MXDA 1DX4A 5SYMA 4W63A 4NVRA 5CT4A 3LP5A 2IIVA 5E4TA 4FOLA 5K5EA 4B6GA 5CW2A 3DKKA 4ZGBA 4FLEA 3H2JA 4HAIA 1FFEA 4HXGA 5JD5A 4UHFA 2H7YA 4EY4A 1UK7A 5C8XA 1GQSA 5HQ3B 1TK3A 4KE9A 1W75A 2WU3A 4QWMA 4W1QA 5ALGA 1NU8A 4OYLA 5LZ8A 4TVKA 4KAFA 4PO3X 5T4FA 1P0MA 4G9GA 4Q82A 3KOOA 3OG9A 2BFNA 5A2GA 3VISA 5A7FA 4B85A 4C4ZA 3I2GA 1CUCA 1XZLA 4ZXFA 3GA7A 4Q34A 3L1IA 1ORVA 1VLQA 2BJHA 4JYMA 1CUDA 2CMFA 1X70A 1SCIA 3QM1A 3NOXA 3ESBA 1KU0A 4GBGA 4FLMA 4A23A 4G8BA 3TEJA 4DYHA 4G9EA 3FYUC 5A7GA 1IUOA 2Z8XA 1GPKA 3ESAA 2ZVDA 5FRDA 4BE9A 1N1MA 1BU8A 1Y7IA 1GQRA 4GW3A 5DTIA 1R9NA 4AO6A 1C7JA 2XQKA 4DM7A 2XQFA 1A8QA 1CLEA 4BRSA 1QTRA 4FMPA 4J3JA 3SWWA 2B61A 3LCRA 4BZWA 4BTLA 1P0QA 3UUEA 1CUUA 3W04A 1PJAA 1XLVA 1CUVA 4AN1A 4DNPA 3UMJA 4I4CA 4H35A 5KWIA 2IX9A 5ALZA 1XLUA 4WJLA 3ANTA 3WKEA 1ZI6A 1FFBA 1WPXA 4BBZA 3IUMA 4UBOA 2PKYX 4UHCA 2FJPA 3KXPA 4P92A 5LZ9A 4DSZA 4M0FA 4FNMA 1U65A 5HZGA 3IULA 3ED1A 5EIHA 1YAJA 4C01A 5ALNA 3BXPA 5AOCA 3RKSA 2YXPX 1VZ3A 1E89A 1XKLA 3DL4A 5ALSA 4L72A 4E15A 4C87A 3W06A 1WB6A 3C45A 3V48A 1CUFA 1LPMA 4BTVA
chains in the Genus database with same CATH superfamily
3RLFA 5FYQA 5AD1A 1AMUA 1CKEA 3LMKA 5FUQA 1IM8A 1C14A 1THTA 2GCGA 2AJLI 4Z9FA 4ALIA 1DGQA 3FBWA 1WCV1 2SHKA 4QICA 4X92A 1Z0UA 2JAQA 3RV4A 3ZU4A 4B2IA 3AJDA 5JHHB 1H4QA 4WUVA 4HLQB 1JKJA 3WNDA 2PH3A 5HZKA 3PC2A 4LF5B 2BFFA 5IXYA 3NATA 4WE3A 3DMPA 3L4BC 4MUXA 4PAOA 3WOHA 4PNZA 2ZU6A 3DDUA 3JD4A 4U0KA 3KJIA 7MDHA 4XGIA 1SUAA 3FXAA 3N3BC 5M29A 4Q4HB 1P2SA 5L40A 1OW3B 2FOLA 2V6MA 4HH4A 2AK3A 4DA4A 621PA 4XM2A 1BRMA 4P7JA 4BUCA 2ECFA 1L4EA 2XZPA 5LWQA 1OFVA 2HBQA 2Z3VA 2H0RA 5JVDA 4D3XA 3GD5A 5LNK1 3QVGA 3UJHA 1E3WA 4OGKA 3KXIA 3V8EA 1SZCA 1EFAA 2WK1A 3TLBA 3QHPA 4WZAB 3TNLA 1SEPA 1K1EA 3BEOA 1E2UA 5GVRA 3RTGA 3F5DA 1C8KA 3BYZA 4FWIB 4NMWA 2GN2A 3ZDXB 4XYLA 3CLTC 1DAEA 3QKSB 4J90A 4WLUA 1OYVA 2LKDA 2FCAA 1BH6A 1GLGA 4QGBA 1ZHOA 1TO6A 1EIZA 3CUSA 4DUYB 1X7HA 2A6PA 1ZDMA 3RRXA 1NVVQ 1GUDA 3RHZA 3S40A 2D7DA 1BOFA 5ECGC 3QVTA 1UC5B 4K0RA 4YMIA 3QYPA 5L7YA 1QYIA 1X3LA 2QLMA 3GAZA 3GUHA 5BN3B 4OQMA 1II8B 2X76A 4RZSA 3ZOKA 3WGUA 1QF6A 2IZ7A 3ABIA 1UMDB 3LDFA 5EJ4A 3DHVA 2VNAA 1FTWA 3UMBA 4HQNA 1QR2A 4UOEA 4YBRA 3HJUA 1CUWA 1LLCA 1TPYA 3DV0A 3JCZA 4GZ6A 4P0QB 2IP1A 3W4KA 1GL7A 4OREX 5IJAA 1O57A 2O3SA 3IRUA 3PC8C 2ZCVA 1XUOA 4JKYA 5GM2A 4MQFB 4ZYUA 1ZRMA 1Q7GA 3O2SB 4X54A 2IYPA 1KDOA 1EFTA 2NYUA 3H4MA 5IFLA 3N5CA 4M3NA 2O5VA 2YN4A 5HKLA 3VSBA 5AQ1A 3NAQA 4EQ6B 4Z4EA 3D3NA 3I01M 3R3HA 3BHJA 4O25A 3VR6H 5B64A 5G2OA 1MRZA 3OX3A 4C0LA 1R37A 2OORC 1Z26A 1ZJ5A 3CN9A 3FTPA 3FNIA 1U9JA 2AVNA 2FPGA 3G2JA 2CLEB 4X65B 1C0PA 5JMWA 4E31A 2CKMA 4E7PA 1QIDA 3DBIA 3TH5A 2GN6A 1RACA 3RC8A 3CUTA 3S2ZA 2ZUTA 1K7CA 4DBZA 2Z1MA 1H3EA 2GMWA 4HJXA 3DKIA 4BWYA 2FA9A 4D9GA 1YDWA 1QDUA 2LCFA 1OH7A 1FJXA 3L4EA 4Q39A 3T9DA 4F5ZA 4M36A 1DG9A 1JEOA 1Z0ZA 4YLEA 3RKUA 3VSEA 4B6FA 3DWEX 3ADBA 2OM2A 4AN4A 5IASA 3UJCA 4QD3A 3CY6A 3DAYA 1TYBE 4DUGD 1OMOA 5CCEA 2C95A 3D1JA 4PRKA 4ZCTA 1JDBB 2XWJI 3AUJB 3R7DA 4B6QA 3M5PA 1XZQA 2J09A 2O06A 1JZTA 3UWDA 2E2WA 2H29A 3ND6A 5CITA 1UEJA 1V6CA 2QM8A 3R0VA 4KBGA 4LYAA 4Y0AA 1IDN1 4NBWA 1J1ZA 2ZIXA 4LVCA 1PZHA 3CRW1 1LH0A 1PLLA 1P80A 2G25A 1CT9A 2H11A 3B8HA 2VZ8A 4LRTB 4M37A 2UVQA 4X94A 4LGYA 4AZ0A 3NVAA 3RGWS 3N6VA 1IOVA 2Q0HA 3QI7A 1X1SA 3U0VA 3K2QA 3HPQA 1OKKA 1E1LA 3ZY6A 3ZJ4A 3RRBA 4AQDA 4BV9A 2JGDA 4HNVA 1ZR2A 3A28A 2YS6A 4DBLC 2DPXA 1QZ3A 3I9KA 2HQOA 2XWBF 4BVHA 5AJZA 4CI9A 1LBEA 1RI2A 4BGUA 2Y3IA 3D2CA 3N2GB 2Q7OE 5EEHA 1XK6A 2DJ5A 3HBAA 4HDOB 3S7ZA 4C5BA 4Q9KA 1CIJA 4LYDA 1CZUA 4B4VA 3DAGA 3FIUA 4FOTA 4EG5A 3JATA 2ZM6B 3KAPA 2BJVA 5A6SB 1XXHB 2FPIA 4UVDA 5JPIA 1UMKA 2UAGA 1DMSA 2AI2A 4R3WA 5B4UA 1H4TA 2Z3ZA 2M6RA 2V6IA 1ZXXA 5F9FA 2Y0CA 4CL8A 4JB0A 1QRDA 1CUAA 1XZFA 1T9ZA 3CE6A 5IG2A 3U5ZB 1EVEA 3B2EA 5FV7A 2PL9A 3BGVA 3G1UA 2C7OA 4CM9A 4HSEA 4EUFA 3D8RA 1FUUA 2V7VA 4KN9S 2W42A 3PFWO 1A2OA 2P3OA 5A4AA 3K1JA 1QFSA 3FLMA 2IGBA 4TMZA 3SHWA 2QLBA 2ZS7A 4FONA 2YBEA 4ML3A 5FYDA 5IWAB 3TQHA 2ZYVX 3EEBA 3QELB 1ZG3A 1I1HA 3FG9A 2P2ZA 3A4YA 1E6KA 3SX0A 4L8FA 3JD3A 2EJTA 2VS1A 3M6MD 5C52B 1GVNB 4ND8A 3KU1A 5CT5A 5I7HA 1GZDA 2G7MC 4QTXA 2FWJA 3NDRA 4ZYVA 1PNTA 1ULAA 1FUEA 2YWCA 3KSRA 3PIRA 4R4JA 4YXFA 3O8LA 4D8TA 2AZMA 2GXUA 1ND6A 2VEOA 3G6KA 1D2HA 5KVCA 3MJVA 3UAOA 1FTYA 2EFJA 4X00A 3EZ7A 1U3WA 3NHSA 4UJ3A 2C2HA 3OY7A 1GL9B 4FBGA 2ZYUX 2EKPA 4AYTA 5JY6A 4I0WB 1QANA 3IGFA 3LDUA 1NWCA 1Q0UA 3KAJA 5LLDA 4YT2A 3Q3GE 4QQ8A 5REQA 3B8EA 3AF0A 4FR2A 4UCFA 1LBHA 2EJBA 4K9PA 4LYEA 5F76A 3LPCA 4K03A 2JI6A 2V4MA 3CGWA 3KZ1E 2A0WA 4UUOA 4W5NA 4M1KA 4EEZA 3QEAZ 3MWKA 1M0TA 2OUIA 3EIUA 2QAGB 3REGA 2CBGA 5BSWA 5BWNA 3U4QA 1QKIA 1SBZA 4JHLA 5EE9A 2PX6A 1AZWA 1QV6A 1BVYF 1X7WA 3D4IA 5LKAA 3MWDA 2FMKA 4TKMA 5H59A 3U16A 4Z9AA 1ZXBA 4MP6A 4PYNA 4UKDA 1RLMA 2G4VA 4IHAA 2PCJA 4P7BA 1VIYA 3GUCA 4Q1CA 1XTRA 4AMBA 1ADBA 4N4AA 1WCYA 1B0PA 3W3ZB 5JNLA 4BQIA 3PHJA 4BAUA 1DAFA 2HSZA 2AFHA 1E1RA 4EVRA 3OLQA 1VE6A 1SURA 2QLJA 3P9SA 3QYAA 3OPYI 4HDMA 4UTOA 5B12A 3AL0C 3SD7A 2DBVO 2FQWA 3DXXA 5EIEA 3U09A 4MS4B 5CEJA 3OFKA 4X1YA 1UL1X 1C9YA 3G8BA 4G56A 3EWIA 3BJEA 2Q29A 4O59O 3Q6IA 4QRHA 3U49A 4D82A 3F6BX 4FIDA 4IH9A 1ULUA 1VE3A 4P33A 2Y93A 1KI3A 2JIOA 1NDHA 1BCRB 2FMFA 4PIMA 4D4IA 1WG8A 2QE7A 2QD5A 2O3UA 4YAEA 3LCMA 1UBSB 4KI7A 1QGED 4KE7A 2NU8A 4DCNA 1S2IA 3KQHA 4FZVA 3EZXA 3EXEA 3Q7PA 1HI9A 4NJEA 3MWLA 5AIAA 4DTIA 3F1KA 3WRYA 3C24A 2NIPA 3FWNA 3GC6A 3LUGA 4QATA 4CT0A 3AGQA 7GPBA 3FKSD 2IUSA 3PHCA 4OO3A 4P81A 1NRJB 1NFQA 3DH0A 3A6LA 1YZUA 1AXGA 4D5GA 4A9AA 3HHPA 1U3UA 2FVXA 3E8MA 1JMKC 1RW4A 4UQLA 1H6CA 1RBYA 3WDKA 2D4AA 3SVLA 4ZQEA 5C80A 1XRLA 1YHZA 4UM7A 2BLNA 1T5TA 2HXGA 2NSDA 2FSSA 3I9NA 2HHAA 4KU4A 3KRTA 5AVOA 4M99A 3WR5A 4B8YA 4F21A 4DG9A 4QSHA 2RG7A 4KRYA 1RPTA 3HP1A 4L50A 3VFDA 1NUPA 3M4YA 3DBHB 3KSDO 4H0CA 2FW6A 3M34A 5FA6A 4D9BA 3ND9A 4PG5A 2IYTA 1EFKA 1CTQA 2D2EA 1WU8A 2NZYA 4NDAA 3EXG1 4UM8B 2YIVX 4BEBA 4UVGA 2WUFA 2VHCA 4UBIA 1C30B 5EJIA 3KB2A 2JPDA 3DE2X 1R4NA 2VAXA 2XHEA 4ANFA 4Q4AB 4G9BA 3CUKA 2EFGA 3CEMA 4CKCA 5LDHA 3TRFA 4M38A 3R0IA 2WIBA 4X97A 2JFYA 3SOPA 3BCHA 4U2GA 3ADCA 3FD8A 2J41A 1Q44A 2C9ZA 4QUKA 3C3KA 4L8VA 4MB2A 1PJBA 3OTQA 3CVUA 3CXUA 1CNFA 3U48A 3HJGA 4DMCA 4UM9B 1ID8A 2IOYA 4ETWA 3VXKA 4JB2A 3AIMA 3L8GA 4X71A 2WQZA 1YK0A 2OCIA 1ZLXA 4XDGA 2R00A 1N7HA 2HPHA 2DZDA 3I4FA 2PA3A 2P1DA 2EIHA 2PYIA 1MA0A 3PHBE 1LJ8A 4TZTA 3HWX1 5B3AA 4C7XA 4E13A 1GARA 2ZE6A 4NE7A 5H9VA 1IHUA 4CEIB 1T1RA 1FTGA 1YJAA 1SPBS 1ZBDA 2C7BA 2OBLA 3IAS1 4ASUA 2XTMA 5AW6A 4QDOA 4R05A 1ZGJA 2DOKA 1R18A 2W83A 1WDLA 1Y5LA 2RE8A 1RQPA 4YP6A 2BFDA 4BPBA 3JZFA 2W9XA 3QWFA 3IPRA 3JYLA 2G9ZA 4N8EA 5KMGB 5B37A 4Y2HA 1K08A 4EA6A 2UKDA 1U9IC 1GNQA 2WWTA 4KQ6A 3VUFA 4FGJA 2RAVA 1OY1A 2X2OA 1KOJA 4C9BA 1XZHA 3IUQA 2A58A 3A7DA 3BXGA 3CJQA 4JOQA 2H0AA 3AW9A 3PB3A 3PF8A 2Q3EA 4PWZA 3TKAA 5BW4A 4NAVA 1Q0ZA 3BZWA 2J1LA 1BH2A 4RETA 4D74A 3EUAA 1CX9B 2CLFB 1TM4E 3T1OA 2DBZA 2PMKA 1XN1A 3LLVA 1VSUA 2C3OA 4N3BA 3FMOB 3JPYA 1TMKA 1T36B 4B3IA 2EFHB 4R2LA 5KOJB 5L53A 1AGPA 3WL6A 1BJKA 1OASA 1RBMA 1TYCA 3M4XA 4F11A 1VOTA 4P4GA 1W0KD 1B8UA 1JI3A 2CVFA 2II6A 4JCCA 4JVLA 5IH3A 4IUBS 4EQZA 1QVVA 1FU8A 3NHLA 1A9ZA 4BFYA 2VDMB 1FYWA 4K9KA 3AVVA 1A8UA 3GUYA 2A9JA 1BEUB 4QG7A 4D43A 3IEMA 1Y81A 5T64A 2H2HA 2Q6LA 1Z62A 4BZXA 4KUHA 1USGA 2G9RA 4M21A 3H2YA 2BEWA 4P9NA 3FGPA 3PUYA 4BO6A 2WU0A 3ZNQA 2F1RA 3SQOA 1Y8QA 3UV7A 1E9SA 2BTQA 3FCAA 3OAAD 2H1FA 1MOPA 5KTNA 1W4CA 5LL6P 5IMBA 5LXTF 3R74A 5CA1A 3RJ5A 1U1EA 2WWHA 3ZN2A 4MB6A 3IQXA 1CCWA 4KYTA 5F5XA 3B1VA 5TJ9A 4K88A 3UMFA 5LYJB 2XKBA 4MW0A 4J07A 4X3PA 1F8UA 1FPQA 2JJ2D 3EAFA 3USCS 3DT8A 3H11A 5IAKA 2PLFA 1QONA 4UHKA 2JHFA 5DTMA 4EYOA 2XXAA 1DBSA 4GUDA 1KEEB 2AFRA 2FRDC 3GA5A 1YXMA 5D3ZA 3ESDA 5AOVA 4C0KA 3NBFA 2XQJA 3A58B 4UEQA 3WWZA 3LJKA 1Z3IX 4RTKA 2OZPA 1KS2A 3KWLA 3WYCA 2QYTA 3ZHCA 1TM7E 5KHAA 2KBFA 2Y1GA 1W34A 2GAAA 5AW7A 4DV5B 1POWA 2C03A 3K6RA 1KU6A 4ZREA 2IDKA 2AZDA 2CDRA 3K8ZA 4ICIA 1UBKS 2P5YA 4XQGA 3IJRA 2P68A 2Q7DA 3VGPA 4B3HA 3T12A 1OD6A 3PGKA 2DGDA 2FDXA 1F0NA 2Q1YA 4BECA 2X23A 2XEXA 1FFGA 2J0UB 2IEIA 4QLBA 4UZEA 1N7JA 5IHXA 1NNLA 3CG0A 4GGOA 4URUR 4EIWA 1F2TA 2WYUA 3QVWA 4QNMA 1G8SA 2HPZA 5KAMA 2VLIA 1JFLA 2CGEA 2YN0A 4FDMA 3RQSA 4ZHQF 3DMNA 5J2UA 5IP5A 3NAMA 4QM7A 3LIPA 3QV2A 3AJ8A 3ZCQA 1VPEA 1XTUA 1E60A 2GHRA 1J56A 3OP4A 1TD1A 1OB2A 3G9TA 1VMKA 4I66A 3RROA 1D1SA 2Y1DA 4WN9B 3GJQA 3TTVA 3OEEA 2A0XA 3FE2A 3HU2A 3MWGA 4U7PB 4BFTA 1PYGA 1SUPA 5A7HA 2PZLA 2QN1A 3K2EA 1S2GA 5KTPA 1JBKA 3FUUA 3V34A 3THSA 3EQ8A 1X1DA 3PNLA 5ENDA 2RKWA 5I8ZA 4YJHA 1ZUNB 4UBLA 1PV4A 4LZOA 3LSTA 1HM5A 3KOXA 3RJ9A 3BJRA 4Q9DA 3BK2A 2QTCA 4EHFA 1D4OA 2C4HA 2AJDA 4I1SA 2WVGA 2C4VA 5A0VA 3BMOA 4JUCA 1KXJA 1VYTA 1JKMA 4BVAA 3ADDA 1GPDG 2GBLC 5DCLA 2OFFA 1ISSA 2OKCA 5JFTA 3FZYA 3T38A 4J0QA 4X5OA 3C6YA 1D09A 2O8DB 3SJBA 2PWAA 4FZJA 4S35A 1W6RA 2HT6A 1K4YA 1NXPA 3SZUA 1K9SA 3PC4A 5ED4A 3LG2A 3OMXA 4OP1A 2PPVA 3DA8A 4DN6A 3RAFC 1GKYA 1PW5A 5AUOB 1NVEA 2A3NA 2OGTA 3I1IA 4ZAYA 4DDUA 4Z4GA 3ZBTA 4AY6A 4GE3A 1A95A 2GO7A 5COAA 4EHJA 2ZBUA 5GM1A 1QRRA 2NYVA 1DX9A 4N5HX 6Q21A 1N2OA 2R8PA 1S0UA 4OBXA 2BFAA 3T5GA 3L8CA 4C4SA 1C81A 1ZGBA 4LG1A 1PKEA 3W8RA 4F4DA 1WD7A 4LCBA 1MP0A 2Q3LA 2JCSA 1RWWA 2D5LA 1CY8A 3CNLA 2VJOA 2EBHX 1GOTA 4JOSA 1P2VA 3VHRA 4F96A 2K87A 2EYQA 3RC1A 2FZ4A 1XMSA 3VDXA 1LSUA 1PR6A 1SKBA 4ZOQI 4GL2A 3UHOA 3F5MA 3QU4A 4B33A 3VHXB 4IG4A 3N28A 4YRZA 3IEUA 1Q57A 1ZI8A 1TMGE 4A8HA 4AZSA 2CVPA 1J2TA 2O2YA 4LYYA 4EYSA 4L5JA 4URFA 3OTOB 4REMA 2C4UA 4LF6B 2JGKA 4L6CA 2VR1A 1XDUA 4L4SA 4YCDA 3G5LA 3SE0A 1SVIA 1MB9A 4UD6A 4WKOA 2AOTB 4Y2VA 7ADHA 4RHFA 1VL2A 1WPRA 3KTOA 4UW9A 2VT6A 5KC9A 1Q12A 3FSJX 3IUJA 5AI6A 2B4RO 3K09A 3P9ZA 1ZU5A 1N0VC 2VJAA 2B6HA 1L5VA 5FOUA 3RYIB 5KYXB 4QPJC 5D6OA 3CRVA 4N9QA 1U3GA 4XW2A 1TM2A 2Q4DA 2RCNA 1I4OA 1U5BA 2NO0A 1JR3E 1P7WA 2ERYA 3JAKB 4FFVA 4HDCA 4DZZA 1ZLYA 1DBQA 1DIGA 2O2IA 4JN6B 1BE8A 1RQ2A 3GJSA 1UMCA 4MQ4A 1IWOA 3I4CA 4YLGA 5I7RA 4R84A 2IYXA 3U3DA 3DEIA 4BO3A 4E94A 4EKYA 1ZCFA 3RS5A 4EG8A 4Q05A 2LBPA 2W2VA 3S55A 4M98A 4MIOA 4HHEA 4LCEA 1E2MA 2Q5HA 4FX2A 4DY4A 4CMGA 1QR6A 5FLEX 2GAFA 1G63A 3VU9B 5I7OA 1G1AA 1O96A 1IIRA 1JSRA 1DIBA 2Z2YA 4J2TA 4P98A 1LNZA 4K6FA 5I5EA 2XGSA 2GXQA 3TTYA 3HB4X 4Q3OA 1ZI9A 4QEKA 1PGQA 3KVNA 4Q4JA 3VH4A 2PN1A 4NCBA 2YV2A 4GMFA 4IIDA 1HNXB 1SHTX 3Q7SA 3EIQA 3P94A 4KH0A 3W5BA 2NXEA 2WD7A 3LBYA 4TV8A 1E0JA 2GN4A 1FX1A 4TM7A 3EZ9A 1ES9A 1JL3A 4FS3A 4BJ5A 1A4IA 2OHXA 5K9ZA 3O4GA 4LGVA 2ZRFA 3IMCA 4F1WA 1X7XB 3UFXB 1E3QA 4LV8B 3VNBA 4FE3A 1MD9A 2BI7A 4F8JA 2VBGA 3WV5A 3IP1A 4AZTA 3OE4A 4HGZA 5FL7A 2NQTA 4ZZ2A 1AU9A 1UBUS 3G2KA 4X60A 4DA8A 2WYWA 3F2IA 2WMOB 2WNIA 4PQEA 4OB8A 3HUEA 4CM8B 4D8UA 3LKDA 1VDZA 2PGAA 4DBLE 4MK4A 4IDFA 3PC6A 1IXYA 1YB5A 1RLUA 2J3HA 3FPHA 4FU0A 3U0BA 2DWCA 3HY4A 2JLQA 4RD3A 1HPLA 3LTNC 3GEHA 1W1UA 2F3TA 3CYFA 5DCYA 2XUGA 3QPDA 3TVDA 1P7CA 1MB4A 5EHGA 4B75A 3ANXA 4M7OA 1R12A 1GNPA 1TK2A 2YZ7A 5HIIA 4GWLA 5KSYA 1B8PA 2B5VA 3RUFA 2HCJB 1VKZA 5K0SA 4XYBA 3PJEA 5DYWA 5TQ2B 3W9YA 1SG9A 2ZJZA 3BA6A 3DZCA 4IYRA 4X3OA 5IW8A 4BMPB 4JLUA 4BGIA 4CT5A 5KOHB 4ZTBA 4Q37A 2HRQA 1XCLA 2ANBA 3IELA 2WIFA 2H8KA 2WG2A 1BS9A 2HA0A 2WJ6A 4XCVA 4PLVA 3TCNA 2OEPA 1HY3A 1Z39A 3O4RA 1A9TA 4RD0A 2SBTA 4ZVQA 3X1XA 4RLSA 1PWEA 1XD2A 1CQIA 1HNZB 5EE5B 1XMIA 5HCNA 3WI7A 1QAQA 2JEOA 4RPHA 2ZSUA 3BTVA 3KQVA 4WFIA 3IE0A 1KDVA 2VT2A 3OEWA 4PC2A 4MHTA 1IJFA 4FP9A 3OKCA 4NFSA 1B7GO 3EH1A 5AXBA 2DF8A 2EX1A 1YZHA 3GPBA 2CUKA 4G1BA 4WOCA 3JR3A 4BLSA 1TTTA 1E9DA 2L19A 3GDGA 1U9CA 1Z6ZA 1SBHA 4M7RA 4MLDA 1ZK2A 2C96A 2IU4A 1H8HA 2JIMA 3RJZA 3T3MB 4HT3B 4XVCA 2NLOA 3QKTA 2IV2X 2Q2OA 2FX2A 4GVXA 3RYHA 3UN1A 4OAPA 3V7FA 3BBLA 4KFTA 3ZHRA 3FHJA 2WG1A 2PV7A 4HLDA 1VSBA 3GCDA 1B6RA 3VA7A 4BATA 3MWYW 1R3DA 1NJ5A 2X0KA 2OOKA 3BPSA 4P5EA 1N2JA 4TL9A 5B7NA 4YJ2A 5JO9A 5CX1B 4AZ3B 1EH5A 1GTG1 1NX6A 3GLVA 3I2YX 3BFVA 3WXMA 2B34A 1I2DA 2GJKA 4C2UA 4ZO8A 5AKGA 5B6IA 4LBZA 4W8HA 2P7HA 1TZCA 3B38A 3JTMA 1Q50A 1A2BA 1SC4A 1UWKA 3AVTA 3TIIA 3UEOA 3U19A 2R9VA 4HVAA 3AFGA 2WUWE 3EWAA 1OPRA 3P71T 3T7TA 4CL3A 2ZM5A 2VDKB 2D0DA 3B1FA 2AOVA 2ZSJA 2Q0QA 3NXKA 4ZT5A 1JFSA 2HQ1A 1E6EA 5JCZA 3K70B 2YHUA 2R5WA 1DT3A 1GGVA 4HR7A 4S1VA 5L8VA 1NXSA 3L0BA 2C2XA 3L7KA 4YO7A 3VX3A 4B2YA 2V8BA 4PHHA 4G09A 4YYZA 1OFTA 1R15A 1VBFA 1XALA 1Z5ZA 3PVZA 4LHWA 3ZBPA 3IB3A 3ZWQA 3PEFA 5BQPA 4MZDA 2A9QA 2GEFA 5DLDA 1TL7C 4KXXA 3GGOA 1NJ1A 5IBCA 4NXMB 4FYXA 1CSEE 3LYHA 4ZTUB 4QASA 1FQKA 3RK4A 3LDAA 1T8PA 5IULC 5JSZA 8AT1A 2GR9A 3L6RA 3TFWA 5BNZA 1QKJA 421PA 1EA5A 1OI2A 1QO9A 1GAQA 1XTBA 2PS9A 2QMQA 3NMUF 5DV9A 3HMKA 5GZ6A 5A3RA 4G0VA 2M98A 5ALPA 2OUKA 2Q4OA 4KV7A 3K2IA 3A6ZA 3U56A 2D6FA 1VMIA 3UJ9A 1NVMB 3DMGA 4N9WA 5FX2A 1E18A 2HQSA 3IA2A 3WMFA 4IZ6A 3HYLA 1KAEA 2P5TB 3SYMA 3MJTA 1SB8A 1Q95A 1Y4DE 3GDFA 4OXRA 2NSJA 5J2TB 3UNXA 3WBJA 1T0IA 4KE6A 2NU9B 1DL5A 1Z2EA 2JKVA 4LJ7A 1YE3A 3RVJA 4I4NA 5KYUB 1RDFA 3BIXA 4MX8A 4C20A 2AZTA 4KP7A 1WXWA 3BHMA 4HDQB 4EKIA 4D46A 3E22A 2BMJA 5FJIA 2H3EA 3RBXA 2IX3A 4NP6A 4R8LA 1MXFA 3N8KA 3D8TA 4MS1B 1XNGA 4CG2A 1SCQA 5HIMA 2OO3A 1TM1E 3SP1A 2GAJA 3IMKA 1CV2A 5DU2A 1B0UA 1QVRA 2CD9A 2CZGA 3RFXA 3STUA 4TKUA 4MVYA 2HHJA 2R60A 5EVJA 5T8KC 5TJHA 4F0JA 5FWXB 4DV6B 4MDEA 1KMHB 5YASA 1QO7A 2EDAA 3FSGA 3LA6A 2IZ6A 4K9MA 4KH1A 1E1QD 1ORRA 1LTQA 5HOEA 4E5PA 1P29A 4YP1A 2Z30A 2R6AA 2CXPA 2FSGA 2HUNA 1U98A 1CZNA 3PFKA 1YONA 1GQYA 1U8FO 3LC0A 4AXBA 3KWFA 4Z6KA 4OGWA 4XWTA 4QGHA 4IINA 5AOBA 3CCFA 2XUPA 5DNWA 3F0TA 4YDHB 5KINB 3EMVA 3PHLA 3TZKA 4GM0A 5F3WB 2QRUA 1X7DA 3OE7D 2OGWA 1V7PC 1VJ0A 3QKIA 2OBXA 4J9UE 1UC9A 1HG1A 1PJ2A 2H5JA 2QYSA 2RHTA 2NAFA 3ZOZA 5EKSA 4NOMA 3I45A 3DVAA 3NG1A 4B3RB 2FF5A 1A9OA 2H4FA 2ZCJA 4OQDA 4QBGB 5DP2A 4WXYB 5I8WA 2D0OB 1HDEA 1SHJA 3OKAA 2OBBA 2O5EA 2GBIA 1V6AA 3KLOA 2CN1A 4G4IA 2A8YA 3FYUA 5FBQB 4Z0TA 4IDEA 1V3VA 4YCJA 5ADVA 3DD5A 1I2ZA 2CNDA 6CHYA 1SG0A 1T2NA 3ZLVA 3JQAB 3NTRA 1S8AA 2ZPTX 5KU1A 5IKOA 3DVLA 3I2FA 3HUTA 4XPIB 1PJTA 5DTEA 1Q0QA 1XVAA 2ZQ5A 4C43A 3FTNA 1QPBA 1DC3A 1YB7A 1DTWA 4OQEA 3BXHA 3RVNA 1DXHA 3WB2A 1WSAA 4HUTA 2AUTA 4QLOA 5AVXA 4DV0B 3G0OA 1T6NA 4GAEA 1RHUA 2YW9A 4Q4LA 4DR7B 2DWQA 4KITB 3CSSA 3HZZA 3SFTA 1I80A 4P38A 1DUVG 5TMDA 1YB1A 2F7SA 2VK4A 1I4DD 1V1MB 1WDTA 2O5RA 1SCJA 2GSWA 3FDJA 1GA1A 2V74B 3ZWDA 1Q77A 3DSRA 4LHXA 5HTKA 5FA8A 2ZYSA 5IEBA 4YPOA 1GFSA 5KS2A 1L8LA 3DEHA 4LE2A 3F67A 1P6UA 4BO0A 3FYCA 3STHA 1TUBA 3GVPA 4KXFB 5CT6A 4YRGA 4PO9A 4N0QA 4U3JB 5IYZA 4BRUA 3IPLA 3E9DA 3ELBA 2PG3A 4WT7A 2FJ0A 2R2AA 1SHLA 4FCWA 3VOAA 3A1UA 3GBSA 3PJRA 2OA0A 4YI5A 1V3TA 3H4VA 3R9XA 2HLDA 3D0QA 4NBSA 1PJZA 4YCSA 4FGSA 4AYWA 4OXIA 2C0QA 2D74A 3C8DA 4DY6A 3SQXA 4RA6B 4G86A 2FWIA 1QLHA 1UAYA 3G79A 2ZRMA 4Q7QA 1E3EA 2OMKA 2QGNA 4NZMA 1F51E 3KG2A 1J00A 1MGPA 2WE8A 2AOXA 4BQQA 4RDXA 1I1QB 1Q19A 3SYNA 1T2CA 3CKYA 3DO8A 1T5BA 3I58A 1K7SN 1UIRA 2X14A 3ODPA 4B0OA 4YJFB 1HDZA 3ULKA 3S5UA 3DYVA 1OA1A 4H08A 1BYIA 2I4MA 3F96A 3BERA 2JFFA 5B36A 4KPEC 4Y6QA 3BSYA 4HF7A 1PJ4A 2ZRLA 4LY9A 3VPBA 1DQZA 2CHVA 2G67A 5HP4A 1O6FA 2FP4A 4FUTA 1M8KA 5DE3A 3RJTA 1UKVY 3KU4A 1NWHA 4K28A 6REQA 1EP9A 2YVUA 1Q0RA 3B6IA 4M46A 4R8RA 4YJKA 5KYTA 1NUUA 3AF6A 1JWLA 3TW4A 4AKIA 2VHTA 3JD1A 1E2KA 2VK1A 1MMFB 4A0FA 2L17A 1BDBA 1I51A 2FMIA 2XV1A 1NQUA 3TQFA 2GERA 3U37A 3DLTA 4EFMA 1AN9A 3JARB 4AU1A 3HM9A 4OP2A 3A1DA 1YNSA 1V7QA 4K87A 1DUSA 3DTVD 3BXOA 3KQLA 2W6ZA 4NQZA 3IDFA 4NJMB 4WESB 4Z7JA 5JC8A 1E0DA 1TQ2A 1GCAA 3IV6A 4PLZA 1O8BA 2FR0A 3VU1A 5LYJF 4J0IA 1C9DB 4H7EA 5AK5A 4TXJA 1IBLB 3CLRC 3ZGZA 3G2PA 2AJ8A 5AM5A 1JMYA 3MJHA 1A9YA 3ZUGA 4UNSA 2M6SA 1C4KA 1FQJA 2FTKE 1OKKD 1U4OA 4MDHA 4XD2A 3MBKA 4D57A 521PA 1G3IA 5BR1A 3QVUA 4UNNA 4GX1A 4YRQA 2JFQA 5EC8A 3L4JA 1U0BB 3HK2A 5HA5A 1AHPA 4UQOA 4N5IX 1XRNA 4BJ3A 1CJBA 2AI3A 4RZXA 5FTNA 4A0SA 5M2QA 2O4CA 4MIYA 3UHJA 3BAZA 1PDOA 2JRLA 2I87A 1IWBB 2ZUWA 3L4BA 4P4LA 3Q11A 3BMXA 1AGNA 4J8PA 3S8EA 2LW7A 2XMZA 3F6RA 2PJZA 5T3UA 1RADA 3DWGA 1JFFB 2FSIA 3G2OA 1QQBA 3AEUB 4BJ1A 2J5KA 2PBZA 5IN4A 1E1CA 4Y2XA 4XVRA 5AICA 2IYNA 2PX2A 2VDOB 3SBXA 5HS6A 2XYQA 4B46A 4MCAA 2R1TB 3RYFB 2X0JA 3A70A 3JALA 2C83A 3LSYA 1ZITA 4HP8A 5FUXA 4QPDA 2AMYA 3QKRA 4GXTA 3R3XA 2K6GA 3I05A 2GK7A 5SY9A 5TS3A 4A82A 4GEGA 2FOIA 1CJTC 2QIOA 2MWMA 3GFQA 4UC0A 3OCCA 3P0IA 4MEAA 3GLHE 4QTUB 4UU0A 4ZMRA 1OFUA 2EHDA 4BMXA 1B23P 3MCUA 4M55A 4AIIA 2Q45A 1XA4A 2Q07A 2XMQA 3D3WB 4HEA6 3BF8A 4NV1A 3LUHA 4GZ5A 1I3LA 4TMXA 5CT8A 4DRXA 3E9NA 4CIAA 2VJDA 2FEMA 5K0FA 5B30A 1LBSA 2ATIA 4MVJP 2G6BA 1RHKA 4JI3B 4LTNA 1NN3A 5TR9A 3VYRB 2NTJA 4KWTA 3GLGE 2J85A 2W2QA 2F3RA 3N39C 3N58A 4M0EA 1CFJA 5B1EA 1WULS 1XGKA 3ENZA 2FE4A 4A91A 5I7EA 2VDLB 3E15A 3VKHA 1IU9A 1R6VA 1KY5A 1ZIPA 2H5EA 2P9FA 1BGVA 4C22A 1JF8A 3WLPA 4B6PA 3ICOA 5ARBA 1Z4QA 3GRFA 1SNYA 3QHAA 3T3DA 3EG9A 2VK2A 1MC1A 1WMSA 3PC8A 3SS9X 1GY8A 5HXAA 2BSQA 2PWZA 3NETA 2QT0A 4DLUA 4F4IA 1T8WA 2K5UA 1IN6A 1JR3A 3C1TA 2EX4A 4R1PA 3RAEC 3THRA 4WLOA 4ZYLA 3I30X 2I03A 4XI9A 4A1FA 3EIWA 4INZA 4ETMA 1Y8ZA 1O54A 1E3SA 3FFBA 3TEMA 4UE2A 1HURA 3X44A 4BY9E 1ZL0A 2I6SA 1Y9ZA 3ZHYA 3GPDG 3AJAA 1BRTA 1NJSA 1P5HA 1VIMA 1Y5MA 3NHYA 4UZSA 3O38A 3EQ2A 3WIUA 1IY9A 2OORA 4C2BA 2J0SA 4LHEA 1N6LA 2G82A 1L5NA 3VHQA 3PRHA 2IK8A 4EY8A 2QTZA 3GJ0A 4DMFA 4RPJA 2C4MA 2O8FA 1CETA 2ODTX 2V7XA 4OH7A 2NUPA 3ZXUB 1C9MA 1N5OX 1NV8A 1PBTA 2VQFB 3ONFA 4RFLA 2QD3A 3KOZA 2YDXA 4WAUA 1QUFA 1K4MA 1KSGA 4BQFA 3HPRA 5JTUA 1E1RD 1G8PA 4JL6A 1Z34A 3N2KB 2YXEA 4HDKB 5D86A 1SC9A 2J3QA 1G7SA 1EFCA 5A4IS 1E79A 4JLSA 1SKMA 2HNBA 3HVIA 4B2LA 3NDPA 4EENA 3B48A 3TW8B 1PIWA 3C98A 4BNTA 2VC2B 5C2JB 4C5AA 3T0IA 4AO7A 1N77A 3GEGA 5JD6A 1IRIA 2OP1A 4RSGA 3U4DA 2Z4TA 1DC6A 4IH4A 1LZKA 3V32A 2DFVA 3Q0IA 4MIKA 2JGJA 1L7RA 1PV2A 2PV0A 4JEUA 4A5OA 5I9NA 2QJOA 1JDVA 2AOUB 1L4BA 4II7A 1MVOA 1YS4A 1KYWA 1Z5VA 2W58A 5CDGA 2IPXA 2QVCA 4OUKX 2C04A 2D06A 5TS2A 1FDOA 3OZTA 3Q7IA 4QXPA 5BUQA 3IVXA 2PUTA 1IBMB 5AVZA 3D8SA 1Q1ZA 3RVPA 3Q1KA 1J0DA 1E2EA 2VRWA 1AHIA 4JR1A 4EAQA 4EH1A 3QH4A 1RI4A 3PQ2A 2P67A 4TWIA 3MWJA 2YIJA 1FZTA 2GD2A 4U4AA 4FYWA 1J23A 1KQOA 5DWDA 3GEEA 4XD7A 5GOTA 2PNFA 2V4UA 3EGCA 3TBKA 1E3JA 3H5NA 5K4HA 4KWHA 1VXOA 5BQOA 1QS0B 4BBPA 1WF3A 1S3FA 5IVDA 2E4VA 4F5WA 1FK8A 1KNQA 2QG9A 3IAEA 3KHSA 4O4HB 3QG1A 1Z07A 4CLOA 1X92A 1FDVA 2I7VA 3KHKA 3V4OA 2BV3A 5F52A 2X9QA 4FD2A 4TTVA 5J63A 1XZJA 4P22A 3FPCA 5TGZA 2PUEA 2N1MA 4EAAA 4AN0A 1V1RB 2JGAA 2JBHA 2J4FA 4NBLA 4AG5A 2M1XA 1DEXA 1XTJA 3IDSA 4GPZA 4NABA 5BT8A 3AEQB 3QFHA 3FDZB 2WVJA 3NXSA 1VG9B 3JZDA 3E05A 1CNEA 3ZV6A 3K9GA 3NHMA 1GCIA 3PJDA 2WW8A 1E6MA 1KORA 4P0PB 4P54A 4RTPA 4OQFA 5BURA 3CH4B 1WETA 1F7VA 2ANCA 1JEDA 1W7AA 2GZAA 3DFKA 2GF0A 3KTAA 3TBHA 1JJIA 5LMNB 2GILA 2GASA 1R64A 2AJBA 3OSZA 4L5CA 1UZLA 2XB6A 4MJXA 5TF4A 4A8TA 4L27A 4ASUD 2YQ4A 1FX0B 1VFNA 3O1IC 2JCYA 4K3UA 4L5IA 1SKQA 3GJ6A 3LXUX 1M7GA 3P97A 3T7DA 2GA8A 1G98A 3CVYA 2DTDA 1YI0A 5AM1A 1LSSA 4ZQIA 5B4VA 1FDTA 1JU3A 4FIZA 2QM3A 3CZ4A 4GOMD 1C0LA 3LFTA 2CHGA 4AO8A 3EZNA 2QRNA 5FTKA 4EFDA 3EEFA 5K8JB 2ZT8A 5JJIA 4JEHA 4UTXA 4JT4A 2J45A 3IP6A 2O2DA 3TTXA 4CLXA 3BD6A 1U99A 4CLRA 1DKUA 3S2UA 5K0GA 1XCJA 1CR6A 2JA2A 3KS9A 1B26A 1U0GA 5J59A 2PSJA 3ZCUA 2HJWA 4YREA 1IHPA 4E5YA 4GPIB 2VCEA 2JLRA 4DLZA 2X8JB 4X6XA 1YC5A 2LIVA 2PMEA 1G0NA 2P2LA 1ISMA 4FN4A 4GI3A 2YJNA 3GMDA 4GWKA 4MEBA 4PZAA 1T3GA 3KJXA 4HYEA 1I4TD 4JWTA 4IXDA 5FPTA 3TZBA 3VUEA 4AY3A 3PHHA 3HE3A 2R48A 2WTAA 2X41A 4RY9A 1XXHE 4OX9Y 1HFEL 3IQGX 3QJYA 2SNIE 5IJ9B 4GOXA 1GILA 1XXLA 3NH6A 4CTKA 4TTQA 3O95A 2WHQA 4RZHA 2BJWA 3UMYA 2ZTMA 3D5TA 3QK7A 3BRSA 1EWQA 2F1IA 1F3LA 4AUEA 1O97D 3E9EA 3WISA 2PGJA 1DEHA 2V1XA 2VRBA 4M7WA 2YINC 2GYVA 1AV6A 4DR3B 3PFGA 1D3AA 2IELA 4JGIA 5GOZA 1Q1BA 3LY9A 3OF2A 5G02A 2D3WA 5CAEB 3HV2A 1PR1A 4PZDA 3BIOA 1SQSA 4J7XA 1JGTA 4OSPA 4CIDA 4HUJA 1TEXA 4RCVA 1NUSA 5SY6A 1X1BA 4WNCA 1PT6A 4KBYA 2IH5A 3LS2A 2RGBA 5LZ7A 4OFWA 4UUNA 3VQTA 3LVRE 4MCHA 5D3MB 5B7GA 1NR5A 2WPDA 3S7TA 1SG6A 5JS7A 3DNMA 3LWBA 4ZZIA 2YNMD 2XW6A 4YJDA 1E3TA 1RFLA 3WFZA 1A5AB 5F73A 4BLVA 5KTSA 2QZ4A 3WMXA 4ZI2A 2IV3A 2CF5A 1LLDA 5IHPA 3DEAA 5JCPA 3I0NA 4YCCA 3HKDA 1TMOA 4RPGA 5DCWA 4NR0A 3V4VB 1KVUA 4BFZA 4Y6LA 2Q3HA 1PS8A 4INOA 3ZW7A 1GDHA 4LXUA 2VP5A 3A6DA 2GUGA 4K9QA 4NBRA 4MYSA 4XPZA 2JIQA 2X2EA 4IHJA 3T7IA 4B80A 1RRFA 4M0DA 1GUBA 1N1EA 2BFPA 3OESA 2P9JA 3PNKA 1RQXA 3Q9LA 1JXAA 3I5UA 1SFRA 1QHGA 2ZKLA 1RPZA 1H9AA 2FPPB 2RGCA 5C8DA 1NYLA 1B73A 1V5IA 4DPLA 4KQFA 1A8SA 3GH1A 5J2TF 3VNUA 4LVOA 5KDLA 1UT8A 5TIIA 2J5RA 1XD8A 3I61A 5J43A 2AUMA 4OI2A 1XDWA 4V2IA 5IWCA 2OQRA 3D3QA 4EYGA 2IOFK 1HSZA 3QNMA 5BOSA 5BMVA 4OLBA 4W8GA 4TXNA 1W73A 2ZI3A 4FMCF 2ZJ0A 4Z4QA 4BAZA 5FWNA 3A14A 3JWHA 3G8YA 5FKJA 1UODA 2FQQA 3M6LA 4K5QA 2ZYIA 2FW0A 2IYQA 1MJFA 3GN1A 1RRCA 3VOBA 4CN8A 3ZE1B 3NALA 1ZWLA 4WJKB 1AZLA 4H2DA 1ZAYA 2ZIVB 3H86A 4KR9A 3CVOA 4KACA 1E5LA 3Q3VA 3UMGA 4ZVUA 3WSVA 3MS4A 2WIGA 2KYRA 4CNQA 3ECCA 4KAAA 3DM5A 3PGLA 4OM8A 1QHNA 2BH2A 3IMFA 1U9IA 3KYDB 4WFQA 1ORDA 2GOYA 2YVLA 3UHFA 2AW5A 4HQKA 1EK5A 4GRIA 1S8FA 2KS6A 4JZYA 4D9EA 2NUTB 3G9UA 5EE1A 1RWBA 4ZICA 3R8FA 3A9RA 1Q83A 3WP0A 1E7SA 3T1YB 3DCNA 4NU5A 4ZCQA 3SF8B 3ZLJA 4FPXA 1MX9A 2B7LA 2WJHA 1P62B 4DA9A 4Q5IA 3FBGA 4MKFA 3MFQA 2WFLA 1LXCA 4UUMA 3R3WA 2YRWA 4OL0A 5HF6A 1S7GA 4UXJA 5K0LA 3TEFA 4I08A 4C0JA 1MQ8B 2HRRA 3M1LA 1RRVA 3FI0A 4QO8A 5LQRA 1MO5A 1Y48E 4B81A 1H65A 1W94A 1XEXB 4PSUA 4CIVA 3DYBA 4F5DA 4AY2A 5J4HA 3ZZ0A 2HIGA 3Q9NA 1EXNA 1PVVA 4D2IA 4PX5A 1ZD3A 1SQ0A 2DFDA 1UOOA 3F73A 5AVWA 3JX9A 3HVJA 3CLUD 3D54D 4S1NA 4C7OB 3PDCA 3S4YA 3MGCA 1P1JA 2HF2A 3VHLB 3GNTA 1TYZA 4XJXA 3UPUA 5E0KB 2ZETA 4FE4A 2GTIA 3BMQB 3WMWA 2GHQA 3QTTA 3HKEA 2BBTA 1CD5A 1I9GA 4NEHB 1M9NA 3U61B 4UUBA 1ZGAA 1T5LA 3I23A 1A9SA 1L5RA 2R1VA 1NY6A 4NCKA 5BRNA 5AM3A 5JROA 4U7JA 2F55A 1DJOA 1GAEO 3T3IA 1VIVA 1NJ6A 2Q2NA 4Y30A 5JMPA 3TW0A 5AUPB 1QO0A 1VSTA 5B3LA 5JMOA 1U2PA 1RLJA 4H16A 4LRWA 2BDTA 2OZKA 4XDYA 2XUJA 4XUDA 5KNBH 5LD2B 3EW7A 2JIBA 2V7PA 2H1SA 3FLBA 4LGMA 5SZJA 3T6KA 3UK0A 5CW1A 4LNUB 3LYUA 4F9EA 2IPAB 3ITNA 1OXBB 5LA6B 3KJZA 1ML3A 3CLVA 3PENA 4MUAA 5HK8A 3WIDA 5BT9A 1ZCJA 1FBNA 1ORHA 4NOJA 2XUDA 4CKBB 1FXUA 1RZUA 2B8TA 4K26A 1Z4KA 2ONJA 1VB3A 4AF6A 2FUG1 4DMHA 1J0XO 1DP4A 3HRIA 4PV7A 4RHEA 4PX9A 2Z57A 3UGTA 4ER0A 3T3GA 4X62B 5HM8A 1P2UA 2NADA 2H18A 3LLMA 2ZB4A 2HCRA 4Z2YA 1U8XX 1N5MA 3NJ4A 4HH3C 3QFTA 1TXGA 1NW5A 5KQGA 1ORTA 4YP9A 3KFVA 3O03A 4ARCA 2I91A 5DTRA 3NBZC 3FGOA 4TTRA 2B92A 5DGIA 4XIIA 4Z99A 3KSBC 4MUNA 3IQWA 3TD9A 1IY0A 1PZNA 3H2GA 3G6WA 2IYWA 3VC7A 3O4VA 2YVKA 3K9WA 2HBZA 2E89A 2ZLBA 2YJ4A 3I76A 4BV3A 5EJ6A 1HXHA 4FZ5A 2HK9A 1TB4A 5JZBA 5AK6A 5AHRA 1UOQA 3EEOA 5F78A 5FTLA 4IGAA 5DRYA 1NQVA 2A35A 1G3QA 1JQ3A 4Q9IA 4GDMA 4LMBA 2R6HA 2CHEA 3LUCA 4QEZA 3GLHA 4ZT3A 3KBBA 5JE8A 4O4IA 4XJSA 5JS1A 1ZUIA 3HGTA 3G5UA 4OY3A 5ERXA 1O95C 1AC5A 1KO7A 2B5OA 2AIRA 3HI6A 1BFKA 3B5IA 4FHZA 4K8OA 1ESCA 3MQFA 2DQSA 3ETDA 1YVUA 2RGGA 3BICA 3OOHA 4MVJE 5D01A 1DJNA 4BNKA 4X20A 2R7MA 3DG9A 1I3MA 3F90A 4PXAA 3PBKA 1NOIA 3GLGA 4GSYA 3NDIA 1ZCBA 1G6KA 1GNSA 1AV7A 1M2JA 2Q0XA 2V4ZA 4P0TA 4QTYA 2JVKA 2GBLA 4PHTA 4UASA 5CMLA 1X39A 5EHIA 4WXRA 1TEVA 3OHMA 1S3SA 4QGGA 1GXSB 3FLAA 2ZWOA 16PKA 3R7FA 4YH1A 4PFJA 4UMEA 4JI0B 2ZWAA 4OLJA 3S1AA 2EZTA 1PSWA 4OYYA 2BP7A 3JASB 2Q5EA 1OXXK 2H16A 2VHEA 2NPIA 1REQA 1OBCA 5BUSA 1ZESA 3BF7A 2AMVA 4L78A 1P61B 2A9KA 3BXEA 1R10A 3BKXA 1UDWA 3HZOA 4G01B 5C7OO 3EXIB 1G16A 1DQYA 2YZ2A 5A1TA 2HIMA 5HCUA 3F3KA 2ZYAA 1X1TA 3OIYA 4I50B 5ILGA 5HR5A 4Q7EA 1IEVA 2DYKA 5JDIC 1HL7A 3HLTA 4NE9A 1AS2A 4O4LA 1PR0A 5J58A 1ZK1A 4IXTA 1D4AA 1XNRB 3IEPA 3KIPA 3KJHA 4D41A 2UUPA 4UBMA 3AR5A 4OQXA 4RTRA 1XOIA 2G07A 3JQ8B 2O6LA 4MWCA 4JUAA 4K6OA 1HYGA 4F85A 3PTLA 3GGPA 5MDHA 3I0MA 1E0AA 1XDGA 4OQYA 5DBIA 2QTBA 1H8HD 5GTDA 2PMDA 1X7GA 1JG7A 1ACJA 1FTSA 1UZAA 4GLFA 2X13A 1U28C 8LDHA 5I9IA 3K0KA 3OJEA 3L5KA 3V6LA 2ZUDA 3GVHA 5F12A 4QU0A 3ENKA 3ROPA 3AFIA 2WKPA 3A27A 1CEQA 1TRHA 2WJAA 4OHVA 4S0ZA 4EB0A 4MWOA 4W5WA 3A1VA 1BKSB 5KVQA 3IPXA 4LTDA 3L84A 4TV9A 4RD1A 4XUCA 1LPOA 2OHFA 4TWAA 2ZT7A 3IPCA 1AQ6A 1P6XA 2G0AA 2BGIA 4R9UC 1NI5A 4KQWA 4GI1A 2VF7A 1OX4B 3B7GA 4W8OA 4MHSA 1QJCA 3P2MA 1RXEA 2H51A 4PSKA 3ER8A 4RH0A 1M2HA 3WL3A 2D7JA 1XBTA 1NBAA 2V9PA 3Q5GA 4MR8B 1DSSG 4DL9A 5L4NA 3AJEA 3HDVA 3KQYA 4DMMA 2JIDA 1WXHA 5LMCA 2J3IA 4B35A 5COQA 3IAAA 3ICWA 2ZBQA 3M5DA 1E3IA 4IKPA 2VDVE 4KRXA 4WSOA 5DGHA 5LM3A 5I6DA 1QU2A 5CU7A 2HSDA 4EFNA 4G37A 2HMYB 3RUPA 1JDNA 1JIXA 3BGIA 2OXEA 1UMDA 3MCZA 5J4VA 1ATZA 1U0SY 4RY0A 3AB8A 5PGMA 3HSSA 4D4GA 4UNPA 3ZJYA 4E5SA 3R7SA 1QC5B 1NQTA 2H2IA 3QSGA 4XJVA 1JSLA 2GEJA 4MQBA 4GBED 3OBBA 1MFZA 2I2AA 2ZRKA 1JPVA 2QL7A 2VJCA 5HUJA 4AX4A 2YR0A 1UINA 3KVRA 1YQQA 4OJNA 5JWOA 5DHUA 1K5HA 2X4IA 3MLBA 3OEHA 5AR1A 2YWFA 2PVPA 1MNQA 2DP4E 1A76A 3E1GA 2NO7A 3KZXA 3R41A 3LBAA 4IS3A 5DEOA 3TLCA 1JDUA 1RJ9B 1M8PA 2LVBA 2OV8A 4RX1A 3R75A 5CD9A 1AMNA 3UGJA 4NEQA 1QM5A 5KVVA 1X7YA 3G8DA 2R0QC 4FSDA 1T9HA 2H06A 1AE1A 4BNUA 1RMQA 3FDIA 4NULA 2HRCA 3K1TA 4ETIA 1I7QB 3ROZA 1QIMA 3BE5A 3OU2A 1VPVA 3ZXSA 2QJRA 4PQFA 2YHSA 4F2GA 3MCAA 2W43A 2ZUBA 4HX5A 4EZEA 1IHYA 3GRCA 3E9ZA 4BXOB 1EDZA 2BOVA 2M6KA 3R20A 4E70A 2NMVA 1G5TA 2I4NA 4R3NA 1M2WA 3U4MA 2OZLA 3FSGD 3RC3A 4IGKA 2WFZA 3NBKA 1QG0A 4F93B 1N2GA 4CKZA 3TQRA 4C2AA 2PRSA 3EYAA 5HIJA 3H84A 4R81A 5TVGA 2AZXA 1XTSA 2J4DA 5C35A 1NONA 1OE0A 1ZK4A 3O2NA 2K7FA 5AM0A 1VLLA 4DADA 3NTXA 1GPWB 2QL5A 2WLSA 3T54A 3TRJA 2H4WA 3KLNA 4DAEA 4G5FA 2HTEA 1EWVA 3ENVA 4ROSA 2UXBB 3BG5A 3L1JA 4ER6A 2PUCA 5F1KA 1ZNXA 2PLRA 1ADYA 2AJTA 2GHIA 3DZHA 4Y98A 1CQXA 5D7BA 3F4BA 2EFDB 3CCBA 3RIMA 3UJNA 2VWGA 3A11A 3PT9A 3KTFA 1M6YA 4PC3A 3CRZA 4PLGA 4UCQA 5D00A 4FQ5A 3BFPA 4GQAA 3LU1A 4O4HF 4V3BA 1FFXA 3QENA 5EOVA 4YP7A 4KK4A 1TECE 2B7BA 5HE9A 4BO2A 3O4IA 3WYAA 1DINA 3WLAA 2PBRA 4PGAA 3WOVA 1FUIA 1JHZA 1XXHA 1U0EA 5AJYA 2BMAA 4CN9A 3PR1A 2HJVA 4EY7A 3O3CA 2GX6A 4J49A 5KKCA 4D1YA 2ZIZA 1RXIA 1J09A 3DEYX 1ZU4A 3IHKA 3ORQA 3EASA 3NT5A 5DXJA 4L28A 3RSCA 5DHPA 1QGAA 3C5HA 4HATA 3TLGB 1T6YA 1Z06A 4ZO6A 1ZJZA 4MAMA 5TPZA 4CIBA 4S04A 5L3SB 4QBIA 1NW6A 2AKEA 3UYLA 1LWOA 2PS1A 1H1LA 1F8XA 2IYYA 2JGRA 3LWNA 4B74A 4YR7A 4HADA 2XGJA 4WFJA 2GZSA 3W8NA 3CG4A 3ZUPA 2XYPA 4WQMA 3THWB 1QGUA 2NO6A 1CQWA 2H7XA 2CJWA 4MYCA 4CM1A 3IJEB 3AUTA 1SHKA 3OQPA 2IHKA 1L7QA 3BDAA 1E6UA 4HNAA 4L85A 5ICGA 3TQIA 2AR7A 3N5KA 3K1AA 1SBNE 5CHEA 4KO4S 4CFSA 5E9QA 2OOSA 1SK9A 2FX3A 4DGQA 2Q1UA 3OU6A 1QIFA 5LBTA 4U39A 3CLHA 1TZMA 1NM5C 5FBKA 2HLDD 3GLFB 13PKA 4RTSA 2BYTA 4KQGA 5F9MA 1XL0A 3Q10A 4FYIA 4MOWA 1BEEA 1CF4A 2W6MA 3RSFA 5JADA 2UZ1B 1WDMA 4W6ZA 1JW9B 1Q84A 1VE1A 1OH8A 4OSEA 5LOVB 2FOXA 2DY1A 1F9EA 1KEVA 4O5OA 4KCGA 2E9SA 4HDNB 3T5CA 4QG3A 2H2FA 3BWXA 2XTZA 4P3PA 3DZJA 2LGJA 4HAZA 1H05A 1JNXX 5I9BA 1RZRA 3JWGA 4U6QA 5KWVA 3SJZA 1DRVA 2FWPA 4BJ6A 4C1BA 4WZ6A 2PQMA 1JIKA 4X1KB 1K2VN 2DFKB 3Q41A 4MZXA 4X90A 4B6SA 4ADSG 1T25A 5KNCH 2JGIA 4FGZA 4WW0A 2LE0A 4CKXA 3ERCA 2EVWX 4GMGA 5F21A 3P7MA 5DIFA 1AF7A 4BL5A 3IBSA 1XKQA 1KO5A 3BGSA 3LY8A 1V8ZA 2B2XA 3FVRA 3HGMA 3KUUA 3OOYA 5AKJA 1NG1A 2MOKA 4H1TA 4L9AA 2P0AA 5T8KA 2Q49A 4WNAB 3VU8A 1XTZA 5JW6A 4FK8A 3JZAA 2WA2A 4CUZA 1X38A 5DHAA 4MS4A 3COWA 3HQ4O 2X0IA 5B7PA 4KE8A 2WTBA 3KQWA 3MF4A 4NBNA 1DQRA 3R8XA 2CV1A 4HGRA 4MAFA 4UUAA 2OO7A 2E4YA 2AV6A 3IUBA 3N8NA 4RKQA 2I4IA 4XFDA 2EU8A 4PICA 4AMZA 3NP7A 4GYKA 4G0XA 4P31A 1BCRA 5EIWA 2OCXA 4P4TA 3CSUA 3C0KA 4BUJA 4QUHA 1JU9A 2HDWA 3THYA 3WLLA 1WXFA 2RFLA 4BO8A 1YB6A 3ETLA 1Y4SA 2VWPA 4CR7A 1JKFA 1HZZC 1OI3A 4NFYA 2WIKA 5BRAA 1EP1B 2YY7A 1RWQA 3JQGB 1X7ZB 1ZMXA 4Z1OA 3SBOA 1UDBA 2RGUA 2FEKA 1XAIA 4UHDA 1KI6B 2BELA 1UM9A 3KL2A 4IP0A 2IXEA 3ANSA 4L7QA 2HO5A 4B6OA 3QQ5A 3HDTA 1CUSA 1XZKA 1UPTA 1N8SA 2WF7A 1PFQA 4BLOA 5C51B 1RZVA 2HA5A 4ENWA 3ENQA 4I4TA 4BMDA 1M7HA 2P9GA 1YTLA 4EDFA 4F6RB 1N8TA 4ESEA 2WHPA 2XT6A 5F7ZA 1N1DA 2ZVPX 3BIFA 1Y5RA 2Q5CA 2AW3A 3N0XA 1B74A 3W8EA 1YA6A 5CH8A 4YB8A 3RIGA 2ODEA 4N8SA 4Z86A 5JZMA 1RT9A 4Y9UA 1AB5A 2XKKA 2P9TA 4JEMA 4R0VA 4RFSA 3WGMA 3RGGA 3CX6A 1S6YA 2MYPA 3HCDA 5E7MA 3SCZA 2JHGA 5DM1A 4RZ2A 5H82A 2DHEA 3CLTD 1B2RA 3I9FA 1NF2A 2Z43A 1ZGCA 3OQNA 4JI5B 4XOUA 1MOSA 3VVBA 2Y77A 4Q4AA 2ZITA 3CF4G 3UC5A 1M6NA 4ZZ3A 1XVVA 5LQSA 3CF6R 2ZIGA 2RH8A 4AQYB 1HRDA 3DOFA 4NE2A 1DX4A 2ZPUA 3TIGA 2PKWA 4TMVA 1HH4A 5FWYB 4ZRMA 1KE2A 1RWOA 3T5BA 3ZGOA 4JP5A 4R8KA 3B3AA 1XTPA 3UJBA 1EHIA 3ZHUA 4B6GA 1RLOA 3DKKA 2OHVA 4OK3A 3TPZA 2RGAA 1J5PA 4BO5A 1EFPB 1BYUA 3GX1A 3ZVLA 2FN7A 5CB4B 1SZPA 1IBRA 2AEFA 4F9FA 2E7ZA 2H7YA 1I6MA 4WXMA 1PGJA 1ETUA 2F1HA 2Q3JA 4MW9A 4F4HA 1FTNA 4L5YA 1JR3D 4BBJA 4RSHA 3U17A 4DJAA 4TS9A 2EV9A 4ZOLB 4FSXA 1JXOA 1D2NA 2V6FA 3HM2A 5HQ3B 3PA6A 2QTFA 3IHLA 2FV8A 3C3XA 1QYCA 2CDNA 4GMKA 4HQLA 3UB3A 1I2BA 2PGLA 2XE6A 4GZ3A 3ZW8A 5IT0A 1UPBA 3S2FA 1EVKA 1MIHA 1AHHA 2CMDA 5AESA 5LZ8A 1KJIA 4PFQA 4TVKA 1KERA 4C2TA 4KAFA 3EY9A 1ZEJA 2JAPA 5TSDA 5NULA 1B42A 5M04A 3BWVA 1GG5A 2QTAA 2CXXA 4Q82A 1EGMB 1LSJA 1R8XA 5G1PA 3X1YA 5I51A 4U8GA 1JDZA 2B6NA 2LDBA 4G2TA 4AJPA 2NQ8A 3F74A 2YRFA 4YI3A 1QHHB 3DXFA 2QW0X 5DULA 3E9QA 1UC8A 1FNCA 4EL0A 5A7FA 1ONPA 4HWTA 2IXGA 2P2NA 4ZAFA 1E79D 4NYJR 1P2BA 3B2QA 1CUCA 1OXVA 1XZLA 3B9QA 3PQ7A 4C08A 5AK0A 1FDRA 4IOJA 2I9PA 3LQ4A 4LYHA 4QAQA 3UVEA 3SXUB 3L1IA 3GEPA 1PNRA 5T41A 3L7YA 4ZAZA 4YRMA 3KYCA 1X1EA 2DLCX 3QVXA 2CWWA 3IBCA 1XCOA 5IDQA 4HCJA 2VF8A 1H1TA 1TQ6A 1A82A 2PR7A 2Q99A 2CMFA 1ABEA 2W2XA 4MVJA 4B79A 1G59A 3FPGA 5LA6F 5HYVA 1E9CA 2OE2A 1SCIA 2VJMA 2G5GX 1KOLA 3NOXA 4BTEA 3H0KA 3CX7A 3V2HA 3KJQA 2BRUC 1G60A 2QSUA 2WNSA 3L7OA 4RWEA 1KU0A 4OK5A 1HNNA 4G0WA 2XDAA 4OKIA 4GBGA 1KJ8A 1X9IA 4L07A 2BFWA 5EP1A 5KWSA 4G8BA 4A73A 1PNOA 4F3YA 5A5DA 2Q8NA 1PFYA 5EJFA 3C3CA 1C7QA 3P5SA 4NARA 5IZCC 3EXFA 2JH8A 5A7GA 1TUIA 5LYJA 2JI8A 4EGAA 1XRJA 1GPKA 3ESAA 2Z09A 4X1IB 5FRDA 4BE9A 2EJUA 4WI1A 5LD2C 1BU8A 4GH5A 3QBEA 4C4PA 2Z8YA 1RKUA 4PZLA 3A4IA 1Z38A 3L05A 4WOKA 3UBTA 5EYPA 1EU1A 1E9AA 2XBMA 4B44A 2A5FA 5LU8A 2AMFA 3Q3HA 5F5NA 3O8OA 3ZWXA 2OZEA 3DL0A 3EQZA 3M6IA 3K5WA 1R9NA 3ZIUA 3AI2A 5L3ZA 4DOMA 5JJBA 5KNCA 1W8IA 3FETA 2HJ9A 6ABPA 1Q0HA 4BRSA 3BK1A 3EFHA 1X6VA 3HNRA 2Y1XA 3LCRA 2QVXX 1WR8A 4IV0A 4OIMA 2C2GA 3CZCA 2P4QA 5AJTA 5JSQA 4GQIA 4W5OA 1DVRA 4M76B 3B51X 1NA5A 5KTYA 4WN3A 4AN1A 2IV7A 1EQAA 1SBIA 2FSPA 5CLQA 4KVAA 2O14A 5TDHA 3W0LB 4I4CA 4YGXB 3FYDA 3ZXYA 4E7OA 4TROA 3M1AA 3QPUA 4EW1A 1T5SA 4H35A 4JC5A 3X1KA 2IX9A 4I36A 1EUDB 1CY1A 5ALZA 1Z8NA 3EF0A 5CXQA 2H9AA 4Y1FA 3P1JA 5L7WA 3BWYA 4ALLA 3KVVA 3PE4A 3R7WA 4ZGWA 4OVKA 1QVWA 2I0FA 3H9GA 4KMRA 1S7CA 5BW6B 5LQUA 3HA5A 2Q5QA 3MMXA 1BGXT 2WQ7A 2QNBA 2G09A 4MO9A 1WPXA 2HGZA 5G0VA 4PG8A 3PX7A 3X43A 1GZSA 3HS3A 1PQYA 5TMEA 2EQBA 3K7EA 1YO6A 5A4DA 2Z08A 3KXPA 2PX4A 4TYNA 1JE0A 1A5TA 1HC7A 2C59A 4LJKA 4WZZA 5EXDA 1LW7A 3DLPX 2BI8A