1K6EA

Complex of hydrolytic haloalkane dehalogenase linb from sphingomonas paucimobilis ut26 with 1,2-propanediol (product of dehalogenation of 1,2-dibromopropane) at 1.85a
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
295
structure length
295
Chain Sequence
SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords HALOALKANE DEHALOGENASE
publication title Haloalkane dehalogenase LinB from Sphingomonas paucimobilis UT26: X-ray crystallographic studies of dehalogenation of brominated substrates.
pubmed doi rcsb
source organism Sphingomonas paucimobilis
total genus 108
structure length 295
sequence length 295
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2001-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1k6eA00
1BU8A 1XRMA 1N5MA 3NGMA 4UFNA 2QUAA 1QIJA 4IH9A 3STXA 3DQZA 3I2GA 4M0FA 1BCRA 2HA5A 1XRLA 3DKKA 3G7NA 3VDXA 4J0GA 1FSSA 5EHQA 3IB3A 4KRYA 4Z49A 3BWXA 4MYDA 4KR0A 5C81A 1EDBA 4JNCA 4W9RA 1MN6A 2AJLI 3GA7A 1THGA 5AHXA 5C7YA 3FOBA 3OPMA 3H2JA 2XMZA 1TAHA 4UBIA 1CUGA 1AGYA 1ZD4A 4C6HA 3DJYA 3B12A 1DWQA 3FYTA 4NVRA 1E66A 1QO9A 3I2JA 4HVTA 2QR5A 5AJHA 4X91A 3WK6A 1L7RA 4X6XA 3QITA 4F21A 1ODSA 4U2CA 4N5IX 4UHCA 3QH4A 4MWSA 4FNGA 2WFLA 4Q3LA 3KSRA 5AKHA 4DMHA 3FCYA 4FLEA 5JAHA 5KWIA 2B61A 2ZYSA 3F96A 3H0CA 5CBKA 4ARBA 1W75A 2ACKA 5LZ5A 1W6RA 2CJPA 4X85A 3EQ7A 4G8DA 1XRRA 5SYNA 2B20A 2RIPA 3VVMA 4P08A 4UHDA 1XZMA 4MQMA 5DYWA 1F6WA 1ZIXA 5HFNA 1QIKA 4BDSA 2XUKA 4Y7DA 3QM1A 4KAFA 1MX1A 3H2KA 1GPKA 4B9AA 4QDZA 2JGJA 2O2IA 2XLBA 4ZWNA 1XLWA 2WM2A 3AUKA 2Z8XA 3R3XA 5JD5A 2WHPB 3ZV7A 3DYVA 3R3YA 2R11A 1XRPA 1UXOA 1EI9A 2QXTA 3FAKA 3BJRA 3A70A 4V2IA 4KJXA 4X94A 3LP5A 4AX4A 4B80A 1YAJA 3R3VA 4QDUA 3AINA 4MYSA 2WSLA 1WB5A 1TKRA 3MUNA 1J2EA 3H04A 4J3JA 3FYUC 2WG2A 2BGRA 4CIAA 5JZSA 1CRLA 2GYWA 3H2IA 5CH3A 1CVLA 5AM4A 1X2EA 4LKOA 4FDMA 1YAHA 4BC0A 2OAEA 3MUOA 1XZKA 3G0GA 4F0JA 2V97A 3STVA 5CW2A 2WIJA 3WJ1A 1DINA 5EIHA 3U1TA 1WOMA 1QFMA 2I3ZA 1SOMA 3OOSA 4X6YA 3WZLA 2JGFA 4XWGA 1XZGA 4BATA 4P92A 3QMVA 4KRXA 2H1IA 3GROA 2GYVA 2ORYA 5AP9A 5T4EA 3WKEA 5AK4A 1EA5A 5DYTA 4UBJA 5HFAA 4WDRA 5BOVA 4KAJA 1UK9A 3FNBA 5LLSA 3VXKA 2Q0XA 1A8UA 3C6XA 4FKBA 3U0VA 2VATA 4U2DA 5AK5A 1LZLA 1O6FA 3AILA 2I78A 3O95A 2QMQA 5CT6A 1XZBA 4Y2JA 1C7JA 5K3DA 2WKWA 3FLEA 1JKMA 2GBGA 5HF9A 3TEJA 1CLEA 3WWOA 5IKXA 3UUFA 5AKGA 4WFJA 1R9NA 5FXMA 4LYEA 5CURA 4DMCA 1PV1A 1DX6A 1TCBA 2Z3ZA 4HTAA 4MQLA 3QPCA 4QNNA 1HPLA 2WJ4A 1JJIA 2DSNA 3O4HA 1IZ8A 1VZ2A 2XE4A 2Y2VA 1QGED 2WG0A 1WHTA 1DTEA 5ALHA 3HC7A 2QVBA 1W76A 1QFSA 3I6YA 2XQIA 3HZOA 1Z68A 2OGSA 3WKBA 1R9MA 2WIKA 1IUOA 3DLTA 1CUJA 2OGTA 2HA0A 1Q83A 2QT9A 4YASA 3HEAA 1Y37A 4KYVA 4UBMA 3V9AA 5A71A 5DJ5A 4WFKA 1ZI9A 1GZ7A 3WL8A 4TGLA 4QA9A 1ZD5A 3RARA 4UHEA 4J0CA 4UHBA 2WIGA 3C87A 1CUAA 1A8QA 3D2CA 4W63A 4IH4A 4AMYA 2XLCA 3HACA 3WZMA 4KEAA 1QTIA 1E8DA 4M0MA 4AB1A 2XB6A 4J0HA 4FNMA 1YS1X 5K3FA 1ISPA 1TCAA 1AUOA 1C4XA 1I6WA 4TPKA 3ZLUA 1GQRA 3AIOA 2WFLB 4ROTA 5JAOA 1UZAA 5AI9A 1U4NA 3KWJA 2PPLA 3DL4A 4OYYA 2BUCA 4HS9A 4LIPD 1JU3A 4UHFA 3O9MA 3PUIA 3WWDA 4H7HA 2XT0A 3STYA 4RNCA 4IQ4A 2HL6A 1DT5A 4W1RA 2XMBA 4DSAA 4J03A 1LZKA 1UOOA 3K2IA 1CUVA 1O6GA 5JADA 1BRTA 4C4XA 2AJBA 3C8HA 5JZBA 5FPPA 4LYDA 4EB0A 2LIPA 1DQYA 4NZZA 1B41A 1LPNA 1FFEA 1LLFA 4GI1A 4HRXA 4PSDA 1M33A 3H19A 4HRYA 1ZICA 2OGZA 3IUJA 5IH7A 4ZREA 5HKAA 1YB6A 2WU4A 4XJVA 2XMSA 4OYLA 1X2BA 4E46A 2RI6A 3G0DA 2WIFA 2ZJFA 2OQVA 2CUTA 2FUKA 2CKMA 1P0IA 4L9AA 1BN7A 3WL6A 4H0CA 5D7BA 1H2YA 1XZLA 4QWMA 3IUMA 4J0DA 5T4FA 4BAZA 4K5QA 5IVHA 4DIUA 5LZ4A 4ZXFA 1KU6A 1TRHA 2XQGA 3N2ZB 2DHEA 4AO7A 3I6MA 4WY5A 4X00A 4OU5A 1CUUA 1QLWA 4PV7A 2WIDA 4ZGBA 4BB0A 5HZGA 3D4LA 4X95A 2WTMA 4RGYA 2PKYX 4X90A 5E4TA 3V1MA 3S2ZA 1P0PA 3LS2A 3CCBA 5CTAA 2GZRA 2QXUA 4Y2UA 4BE9A 4XVCA 1ZJ5A 4AMZA 5LZ8A 2WFZA 4FFVA 5AK3A 2WTNA 3SWWA 2YASA 1CQZA 1QO7A 5ALWA 2G5PA 2J4FA 1Q84A 4G5XA 3C45A 4P9NA 1YA8A 4BRSA 3D5EA 4U2EA 2XUJA 3OG9A 3WIBA 4X6UA 4AZ0A 2OQIA 4OU4A 3R41A 5ALOA 3G02A 3IA2A 5E2IA 1VKHA 5EFZA 4CG2A 4I3FA 2OG1A 4QDOA 4MWTA 2WUFA 1J06A 4Y2RA 3BF7A 3JYHA 3Q8WA 5AI5A 1GPLA 1X70A 1W52X 3ESAA 3G9XA 1THTA 4DTCA 1IUPA 3YASA 2XMGA 5JIBA 5D3KA 1IMJA 1B6GA 2HRQA 5I8PA 1KU0A 1UOQA 2XUPA 5ALZA 2PM8A 3QMMA 1EHYA 3OTQA 2VAXA 2VQ6A 1CUEA 5FOQA 1MT3A 4E15A 1UWCA 3R40A 3UMJA 4H35A 1FFCA 2DHDA 1MTZA 1LPMA 2DQZA 4H7IA 2BKLA 1E3QA 2BJHA 4UBOA 4DNQA 2PU5A 4H7FA 2BCEA 2XQFA 5AI8A 4RPCA 4YPVA 1R1DA 1W4LA 5ALDA 4X97A 4CI9A 3FWHA 3G9ZA 4YX9A 3BIXA 1VJ5A 4PF1A 5D3ZA 5AKZA 4AO8A 5JYCA 4Y2SA 3EQ9A 5HF5A 3NWOA 5AM3A 1XQYA 2QM0A 2OLEA 4DSZA 2DCMA 2ROQA 4FFWA 1CUCA 5ALYA 2B9VA 3DCNA 3I2KA 5JAUA 4FTWA 4C89A 1CEXA 3MGAA 7YASA 1CUFA 2VTVA 3JW8A 2AJCA 2WU3A 4OCZA 4H18A 2JEYA 2CEKA 4AZ3A 3ZLTA 2OXEA 1CFJA 2EDCA 1OILA 2YYSA 1OCEA 1H2XA 5K3BA 1K4YA 4KAAA 4PQEA 3UUEA 4INZA 5AIBA 2JGLA 1VA5A 2XDWA 1CIJA 2DFPA 5A7GA 4AN0A 5JD4A 2XUDA 1QJ4A 5CT4A 2C5FA 4F5ZA 1ZJ4A 2PSDA 3KDAA 5HQ3A 3W2TA 4OD0A 4H7DA 1JJFA 4DGQA 1CUBA 5EIAA 1AX9A 3TRDA 4N8EA 1C7IA 1JT2A 2XUOA 4FBLA 3WK7A 3R0VA 3KXPA 3VJLA 1XKTA 3C5WP 1LPOA 5DTJA 4BCBA 4Q34A 3H17A 1K6EA 1EDDA 1P0QA 1ZD3A 5LIPA 3EIOA 2I3DA 2C0QA 2JEZA 3GUUA 4TVKA 4B84A 4BTVA 5ALFA 5DNVA 1JFRA 2HU7A 4I19A 2VJBA 2HIHA 1UT6A 1ACJA 1EVQA 5LKRA 2RONA 5CT9A 2RAUA 2QJRA 1QIHA 1KEZA 1MAHA 4Y2VA 2BGNA 3BE8A 5DNUA 3I6ZA 5AM0A 1VZ3A 4WDQA 4K6KA 2Z5GA 5ALTA 3EF3A 4EY7A 4DMKA 3TJMA 1F0NA 2BUBA 3AFIA 3QVMA 1JMYA 3D59A 2OCIA 3M3DA 1QIFA 3H2HA 4AO6A 1BROA 1SCQA 4BP9A 2H7XA 2Z8ZA 2WJ3A 4H7JA 3PFCA 3A6ZA 5EI5A 2H7CA 2VEOA 4G9GA 1TQHA 2G4LA 2G5TA 1EVEA 3FVTA 3HRHA 5AOAA 2CMFA 1VA4A 1XQWA 5ALUA 5ESRA 1XQVA 1H2WA 2GYUA 1IZ7A 1XZHA 5EIEA 3Q0TA 1QIMA 2XMDA 3WA6A 4AXBA 2WUDA 2RGUA 1CUYA 2B4KA 5CMLA 3WWPA 2ZSIA 5JASA 4W1PA 4J0JA 2X76A 2DR0A 1VOTA 4GWLA 3SK0A 1AZWA 5JATA 2XMRA 2ZYRA 2ES4A 5C8VA 2QZPA 5AOBA 2ZYHA 3FLBA 3W9UA 2W22A 2O2HA 5IVKA 4KE6A 4PNZA 2HFKA 4RE5A 4F60A 1EDEA 3FBWA 5AIAA 1NX9A 1DWPA 1VE6A 2GBCA 3WK5A 4H7KA 5ALKA 2QJWA 4Q05A 4B81A 1MX9A 3M82A 2XMQA 3M81A 4HXEB 3AZOA 1RYYA 1TCCA 4P93A 4EHBA 1QIGA 1G66A 2BAGA 2PSEA 1U8EA 3VJKA 4WY8A 4BCDA 4PO3X 1BS9A 3DOIA 1LPSA 1A88A 4WCVA 3I1IA 1EINA 1XZCA 2OCLA 3E3AA 2NW6A 3WMRA 2XMCA 1WPXA 4Y9SA 3GFFA 5BV7A 1ZIYA 4U2FA 4OB8A 2VJCA 5EHZA 3GELA 3W05A 5HF8A 3V1KA 2JGIA 3H1AA 3PUHA 4J7AA 6YASA 4ARAA 3EQ8A 1EK2A 1WB6A 4G9EA 2DQYA 4Q3OA 1P0MA 2ZSHA 3HABA 5CXUA 2QS9A 4Y2PA 1UK7A 1H23A 2PU7A 4BRZA 3C6ZA 4C88A 2FJPA 4KE9A 1K8QA 3CCCA 1Y7HA 4IHAA 1U65A 3SC2A 4UBKA 5A62A 4MEBA 2K2QB 3WYNA 2WLSA 5AI4A 2WHRA 2VT7A 3VISA 2CB9A 3HSSA 4LXHA 5ALXA 1LBSA 5LZ2A 2XQJA 4UFOA 4H77A 1VXRA 3ZLVA 1N5RA 3WIOA 1NU8A 4GHWA 5HQ3B 3F97A 5DNWA 3CN7A 3K6KA 5YASA 3MVEA 4Q1VA 4J0KA 1ZI8A 2VJAA 4Y2XA 5H3HA 1MPXA 3ANTA 1XZEA 3H1BA 1H22A 2C58A 5AKLA 3C43A 3R3ZA 4EUSA 3D2AA 4BTLA 1HDEA 3IDAA 5JANA 1CQWA 3C6BA 4JYPA 5T4HA 4G8CA 2PUHA 1NU6A 2J4CA 3GZJA 3OC0A 1L7QA 3WKCA 5KREA 1DX4A 3CXUA 3WYDA 2HA6A 4DNFA 1XRQA 2WJ6A 4B9EA 4C4YA 5CT8A 2PL5A 4Q82A 3L1HA 4Q3KA 1Y7IA 4CG3A 2PX6A 4BYMA 2GBFA 3WK9A 2UZ0A 3ILSA 4GXNA 2ZJ6A 3ESDA 5CXXA 1LGYA 5FUMA 1RP1A 4XX1A 1SCKA 1EB8A 5ALEA 1YR2A 4CCYA 4ITVA 3I2FA 1UKBA 3BIWA 3E1GA 3O4JA 2YH2A 1MX5A 1XZIA 3ESBA 4HZGA 4AN1A 3LCRA 3BF8A 4QDTA 5AM1A 2PSJA 5F4ZA 3O0DA 4C4ZA 4BE4A 2HA2A 1ZOIA 3H2GA 4OB6A 5E4YA 4KE7A 3I1YA 3I2HA 2QKYA 3O4GA 2HFJA 5CT5A 2P8SA 3B5EA 3WWCA 4OSEA 3P2MA 2VF2A 3HLKA 5KWJA 3WK8A 4BBZA 1XLUA 2D5LA 3DD5A 4ZV7A 2XUFA 3ZI7A 3HXKA 1LBTA 4A16A 4FBMA 3LLCA 5FP0A 4FOLA 5T4BA 5C8XA 2Y2UA 5AM2A 1DWOA 2I03A 4GW3A 1XZFA 4S0XA 3QBJA 2WUGA 4BDTA 4L0CA 3ICWA 4MXDA 2E3JA 3FSGA 2O7RA 3V48A 1WCYA 3ZWQA 2FX5A 5JZ9A 1HKHA 1YCDA 1BE0A 4JUIA 2EEPA 4B82A 1W1IA 1XLVA 5K5EA 2PSFA 1XZAA 5LP1A 4H7EA 3IUNA 2HU5A 5AO9A 5EHNA 3X3HA 4EY4A 5JARA 3A2MA 1WHSA 3PI6A 3DL7A 3PICA 5FKJA 5ISMA 1HL7A 5ALSA 5K3AA 3QPDA 3IIIA 4A23A 1CUSA 5IVDA 5FDFA 2C5GA 3ICVA 2YXPX 3F98A 1OXMA 2HHAA 3D3NA 4CFSA 4EBBA 5FRDA 1R88A 4GBGA 1LPBB 4UBNA 5ALVA 4LHEA 2JBWA 3EBLA 1PJAA 2GBIA 2XI4A 2WUEA 1RWQA 1SC9A 3PF9A 3GBSA 3STUA 3DS8A 2OCGA 3D7RA 2PVSA 4CIBA 5K3FB 4G8BA 2BUAA 1WM1A 2WILA 3OURA 3VVLA 1IVYA 1XZDA 1LNSA 4C87A 4WFIA 5HK8A 5LYYA 4I4CA 4HXGA 3HI4A 4BVKA 5ALJA 1PFQA 1A7UA 2PSHA 1GXSA 1BEEA 2XUAA 1MO2A 1QONA 2VJDA 4W1SA 3G9UA 5HCUA 4N8DA 5BWCA 3RLIA 4JH0A 5AH0A 3DOHA 1E8NA 4X3CA 2FJ0A 3HJUA 4BCCA 3TGLA 2V98A 4X92A 3IURA 2WG1A 3FCXA 4QLAA 1F8UA 3WJ2A 4EY6A 5AI6A 3H18A 5ALNA 2Y6UA 5EGNA 3LIIA 1R50A 4IO0A 1DT3A 4DLNA 1CUHA 5C8ZA 2HA7A 1AC5A 2PBLA 4BVJA 4UHHA 5AICA 5D6OA 4FLMA 3G9TA 1FFDA 2WFMA 3PFBA 4Y2YA 4B0PA 3SX4A 5ALGA 5LZ7A 2HM7A 4QWWA 1UK8A 3D0KA 1IUNA 4BAGA 2HADA 4EY5A 5AKYA 5ALQA 3M83A 1F0PA 1TK3A 1ZD2P 3WL5A 5FLKA 4BC1A 2QOEA 1CR6A 1FJ2A 4CCYB 5AKXA 4DNOA 3W9BA 1VLQA 1YS2X 4E14A 2XUHA 2PUJA 5I7UA 3FYUA 4DYHA 4CCWA 1R3DA 5ALRA 3KOOA 3A2LA 3BL8A 5A7HA 1FFBA 5AKKA 4QDXA 4K2AA 4B0OA 1LPPA 3L1JA 3AIMA 5FV4A 4MJ3A 4B7ZA 1CUXA 3O9VA 2X8BA 4D9JA 1N8SA 3F9CA 2IIVA 4QEKA 3FSGD 4QZVA 3IUQA 5BWBA 1ACLA 1K63A 1QIEA 1E89A 5AKEA 1K5PA 1QIDA 2V9ZA 3W06A 3C6YA 1JU4A 1CPYA 1JI3A 5JAPA 4B6GA 4EZIA 5DYYA 3ED1A 5AOCA 2WQZA 3WQHA 2V96A 5K3EA 3ZPXA 2W6CX 1GT6A 3BDIA 2VSQA 3DDUA 1J1IA 2OAGA 3G8YA 3AIKA 5KBYA 1XQXA 4G1FA 5ALMA 1CUWA 3R3UA 4JYMA 1G4HA 2R8BA 4OB7A 1JMKC 3C8DA 1XFDA 4QE3A 2G63A 1TIBA 1T2NA 2J3DA 5J3JA 4MEAA 4LXGA 5AKIA 1Q0RA 1T4MA 1EK1A 4L72A 5AKJA 1Q0ZA 3IVMA 4G4IA 2JGKA 4FHZA 1YASA 4ETWA 2QRUA 1BEZA 2AXEA 4HXFB 5ALLA 3QYJA 1UK6A 1CUDA 4UPDA 4RE6A 3E0XA 3BDVA 4GLBA 3I2IA 3T4UA 4X93A 2C0PA 3FVRA 3KD2A 3AJAA 1UFOA 4NS4A 5FPQA 2H7YA 4AQDA 1A8SA 3G0CA 1ZGBA 2HA3A 5JD6A 2O7VA 2QUBA 4XIIA 2EDAA 1BCSA 1AQLA 4A5SA 1EB9A 4DMFA 1HQDA 4G4GA 1WPRA 2XUGA 4B83A 1CV2A 3F8SA 5A7FA 2GZSA 1AURA 4O08A 4X7BA 4JEIA 3LIPA 2ZJ7A 4EA6A 1ORWA 1FFAA 4K6GA 3WKAA 3WWEA 3HYSA 3VKFA 1YB7A 1EX9A 3QZUA 3STTA 5ALPA 4UUQA 5DLPA 1UKCA 5CRIA 4YK7A 1SFRA 4N8SA 5HK9A 1J07A 4DM7A 1E5TA 4PSUA 4PW0A 2JF0A 1H2ZA 1YA4A 5CH8A 5E4JA 2VA9A 2WHQA 2AJ8A 1EXWA 4BZZA 1USWA 3A2NA 3I28A 3ANSA 1WB4A 2X5XA 4BP8A 1QE3A 3WA7A 4KE8A 3S8YA 1G5FA 1GKKA 1XRNA 3RK4A 2CZQA 2HU8A 3DNMA 1ETHA 1JJBA 2JGEA 1GKLA 4UFPA 1DU4A 3PE6A 5EHXA 2Y6VA 2J3QA 5IVIA 1VE7A 4B85A 3DYIA 2OPHA 3D2BA 3W04A 2AJDA 4ZI5A 4IH1A 3FLAA 4UBLA 4E11A 3PF8A 3WKDA 3NUZA 3JWEA 2HRRA 3RKSA 1CUIA 4M0EA 5SYMA 5LKAA 2IITA 4BAUA 2WHPA 2XQKA 3AZPA 3FYUB 4GEGA 4HAIA 5JALA 1UOPA 3AZQA 4LXIA 3L1IA 1G42A 2DHCA 2RHTA 1YSCA 1ZI6A 4GDMA 3B3QA 1VXOA 2ONCA 3NOXA 3E4DA 4BZWA 1L7AA 3STWA 4FLFA 1S8OA 4W1QA 4KACA 2VAVA 2IX9A 3V1LA 1MNQA 1QOZA 5HF6A 1CUZA 4U2GA 4C01A 1QZ3A 3WL7A 1R4ZA 2ZYIA 5AK6A 1GGVA 3DKRA 4DNPA 1GQSA 2VT6A 1ORVA 3IBTA 4BVLA 2RHWA 3WLAA 1HBJA 1DQZA 2C7BA 1U2EA 4FMPA 2OCKA 2QTBA 1QIIA 3F67A 5LZ9A 1ODTC 1XKLA 3IULA 4X71A 3RM3A 1GPNA 3WK4A 3G0IA 4FWBA 3WI7A 4L3WA 3C5VA 4K6HA 2C4HA 4U2BA 4NMWA 4EY8A 2BFNA 4GECA 1MU0A 5I9IA 3BJMA 1EH5A 4Y2TA 1HLGA 2ACEA 5HKBA 1AMNA 1BN6A 4G4JA 4WJLA 3PDCA 4Y2QA 3VJMA 4CG1A 1SCIA 1UKAA 3OM8A 5K3CA 3T52A 3O4IA 2ECFA 5ALIA 3KWFA 1ODCA 1MJ5A 4PSCA 3R3WA 4OPMA 2ZVDA 3ESCA 1N1MA 1MNAA 2HDWA 1XZJA 2H9YA 3QPAA 4ZRDA 5DTIA 3N0TA 3BXPA 5DWDA 3DEAA 2JGMA 2CBGA 2Y1KA 3V1NA 2HA4A 2JIDA 5AI0A 4J0IA 1LPAB 2O2GA 2Z3WA 4ZV9A 1E8MA 1ZGCA 4OUKX 1XROA 2D0DA 5A2GA 1MAAA 1QTRA 3QMWA 2XUQA 3C70A 5A6VA 3CN9A 4N5HX 1D07A 5AM5A 3G0BA 4QLOA 5CH5A 3K9BA 2XUIA 1AKNA
chains in the Genus database with same CATH superfamily
1BU8A 1YFZA 2GD2A 3FCEA 3JSXA 4H6WA 4JU9A 2J7PD 1FRQA 2IPNA 4CIYA 4LRYA 1BG6A 2JLCA 3ASYA 2KWIA 3E61A 1BCSB 4ITRC 4II7A 4UFNA 5H70A 2QUAA 3CUYA 4KLNA 4X20A 2FZ5A 5DBEX 4RHUA 3I2GA 5FYDA 1JLLA 4P54A 2Y0DA 3RF6A 1CZHA 2EU8A 4XGQA 3T7JA 4DC0A 4LF8B 1K7FB 1KVTA 2JGNA 2QIOA 1TM2A 1ZN2A 2VJKA 3UMMA 2O6HA 3PZRA 3L7JA 4XRGA 3LAWA 4IRMA 1JLRA 2BSAA 4I5FA 5IAGA 4ZMBA 3KTAB 5I8WA 3IB3A 3GI1A 4I8XA 2WF5A 1Y98A 4MVCA 2YZKA 4KR0A 3LY7A 1NN1A 4DLTA 1AMOA 4RV5A 3CNEA 3PXXA 4AX8A 1GR0A 1A4UA 2QG9A 2P2GA 3SXJA 3BTSA 3N3AC 5DM4A 2QUZA 2EWWA 2O3RA 1KRHA 3RJ5A 2JJ2D 2C4NA 1RJFA 2AJLI 2B99A 2I34A 2VF4X 3BFVA 4MCJA 3MAGA 1THGA 1X92A 4LQCA 4DLYA 3BD8A 4WZAB 3OPMA 1QLJA 3TKYA 1I6KA 1KJQA 1TT5A 5LP6A 2QSYA 4UNRA 4WQMA 1NP3A 3UBMA 1U04A 4UZSA 1CUGA 1U2PA 1ZD4A 4C6HA 1K7XB 5TMEA 2HO4A 1A8HA 3KOYA 1BD4A 3K4HA 3TQFA 4GGMX 2WAAA 3B9QA 1RVDA 3OY2A 3I2JA 4NU6A 2VRNA 3AM3A 1B15A 5AJHA 2FWPA 4X91A 1IN5A 2GB4A 3ZDAA 2F1RA 2IDKA 3Q3CA 3ZGYA 1W1WA 2ZAMA 3G2KA 4WD3A 3TLAA 2OHVA 4QASA 2J3KA 1HTTA 2IOFA 1BC5A 4EO4A 4XLZA 5AJVB 3TYXA 2XRFA 2YJGA 2H0QA 2ORWA 3JQ8B 3R1IA 2TECE 4N39A 3O47A 1E2PA 4X65B 4GKJB 4QUKA 5AKHA 1BX1A 3I72A 1COZA 2H1HA 4TZ6A 4ATNA 1QP4A 5CCXA 2A94A 3M3HA 4AZTA 1G59A 4E33A 3BWBA 3NPAA 2X2FA 5IKEA 4PG4A 4JZYA 1GFSA 4BN5A 1U0HC 4OQEA 5J58A 3D6AA 3OD1A 2OFXA 1UL1X 1K3TA 1LSUA 2AMYA 3EODA 5B1DA 4EPVA 2IYLD 2CLOB 1H42A 5CBKA 5D86A 2QPLA 1YMVA 2ACKA 3WBFA 1KWGA 1ENPA 2FZEA 4HNHA 1Y34E 2V4MA 5C8YB 1ZN8A 5LZ5A 4QU9A 1NZDA 1VGQA 4I9FA 3W5IA 1VJTA 1W0KA 3GGCA 1XRJA 3VR4A 3MJFA 4P22A 1UPBA 3MK31 4X85A 2O2YA 3N6VA 4NF2A 5FTWA 3UV7A 2SKEA 4R51A 1XRRA 2QU8A 3IP3A 2JIPA 4BJ1A 2NTVA 4ZEVA 2RIPA 4PG6A 1WU7A 4DA0A 1WUKS 2D5BA 1CZOA 2OC9A 3LXXA 3VTFA 4UHDA 3SF0A 4REQB 4D25A 1F6WA 5FTNA 1IHPA 1QIKA 2EXXA 1AO3A 4G0NA 4LDPA 4OY3A 1OVGA 1KQNA 4GP6A 2G76A 3X0DA 2YVAA 1RZUA 2BKXA 1E9FA 1PRYA 1BXRB 5DRTA 1PJSA 1YB1A 1VMAA 3N58A 1IEVA 2GZ3A 3EZGA 3PC3A 4MQ4A 4EY3A 3Q7QA 1QCYA 3TPCA 1MP0A 3MWDA 3P2IA 6REQA 4PTLA 3ZD7A 4A2WA 1NW8A 1G7CA 3FWNA 3ID6C 3DJFA 3JALA 3WB2A 4EKYA 3H9BA 2QPTA 4TZKA 3B6IA 1EAYA 1FQOA 1MCZA 5BO5A 4HGQA 2QM8A 4PVCA 1GPKA 4IDGA 4NZ9A 1WDMA 4YACA 4B9AA 5L45A 1CF4A 4B4VA 1TA4A 2JGJA 4IHJB 4IUBS 4QDZA 4ZOAA 5EVJA 5GPBA 5KOHB 4AUEA 2QZ4A 3MFQA 1XLWA 2CB0A 1Y42X 3L7MA 4ZVMA 3TR0A 1U0LA 3MIZA 4G89A 1USGA 3TDKA 2W2LA 1YE5A 2QTVA 3EEBA 2X22A 2Z8XA 5HILA 2PE5A 1D0SA 3OO1A 3T8YA 4I2VA 3FH0A 1HLPA 2R11A 3UK6A 4R0MA 1UXOA 1WU8A 4QXQA 3ACBA 3D54D 4U0JA 3RKUA 1XTRA 2VSYA 1BQEA 2GT1A 3HVKA 4W8HA 2WYWA 4YRQA 3L41A 1D6JA 1UXGA 3SEZA 5EMLA 3ZK9A 4YMVA 1GTRA 1JR6A 3EUEA 3UXHA 4TWRA 5DULA 3D8NA 1TAQA 1EFKA 4V2IA 4W5TA 2PS3A 1RP7A 1V4BA 4E1BA 1SHUX 1QB7A 1D2AA 1NMQA 4X94A 2AW5A 4DZRA 1YAJA 4N1AA 1P5RA 4QDUA 3BH7A 1P7YA 3KOZA 4BFSA 4BNDB 4CMEA 5IKMA 5DGHA 4JA2A 2DBYA 2FN7A 5DBOA 1R0BA 2GQ0A 4A03A 4MH0R 4YP7A 3UTDA 1XE3A 4GT1A 2G5GX 1MEEA 4DUGD 2DBRA 2HCFA 3VX4A 2IYEA 1ZD1A 1GQFA 2LCFA 4OH1A 1GNPA 1E7MA 2XX3A 1QHFA 3EW7A 1SXJE 4MUHA 3LZ6A 4BQFA 4I99A 4KO2S 5JZSA 1Y7LA 2JLZA 1YJXA 2HZBA 4WNAA 3MTGA 2GYWA 1Y9AA 1XJQA 2OZLB 3E5MA 3OX2A 4AL4A 1IN8A 3MCVA 3Q88A 2P2CA 3CUSA 1GUZA 4FYXA 4NJEB 3I0MA 1F4PA 3MTQA 1L4UA 5AM4A 2Q28A 2WNHA 2WF6A 4LE1A 2DPMA 2NV6A 4OHPA 3T9BA 4A15A 4FDMA 4KHPB 3Q8MA 4M54A 2WJGA 2HLNA 4LYGA 4X63A 2OAEA 3HB0A 3KTOA 1JEOA 3MUOA 3NGLA 4GRAA 2NO9A 2P0YA 1C2YA 1N7GA 1R4NA 2BR3A 2Q4EA 1ZJJA 4PRZA 3S29A 4DJ5X 4EPXA 2P27A 4XA8A 2O4UX 2PBZA 4HWGA 1QYRA 2GCNA 4U9IS 1DQRA 4BX3A 3N0WA 3CLTC 3KR9A 1U2SA 2V97A 1JW9B 3KO8A 1QORA 1N6LA 1NQUA 2XYRA 1I32A 4IIGA 4MKXA 4U9HS 3ZW9A 4Q3DA 4YQFA 5IHXA 2A1TS 1G3UA 2QM7A 2PQ2A 2WA2A 4EQZA 4HL6A 3R24A 3U1TA 1AHPA 2ZB8A 3R9IA 1G20A 1U4OA 1LDYA 1WOMA 3L4JA 1QFMA 1NYTA 1HYBA 4DR4B 2OD2A 2BFEB 4RHCA 1DUIA 4XRRA 3FOEC 2I91A 4X6YA 3DWEX 5HE9A 3WZLA 4CODB 3ER9A 5JVDF 3O7MA 2JGFA 2G0TA 4EFLA 4LWOA 3A28A 5KYXA 1EFPA 1XFAA 1XTQA 4KZPA 5I4CA 10MHA 5JYBA 2AVNA 3BQNB 2ZXUA 3MJEA 4FCWA 2QG6A 1TFRA 3O83A 1QAMA 2AMLA 1AKVA 2DPYA 3KE8A 1CJVC 3L0DA 4LHZA 2QR3A 4HN9A 2NUAA 4MVJA 4ZT6A 3T3DA 1YS4A 1BE6A 3T1OA 1DDIA 2HT1A 1C1XB 3HJHA 1UK9A 4D8TA 3FNBA 1L4HA 5EJMA 1RCUA 5LLSA 3CZ9A 4P4SB 5AW4A 1A8UA 1ZUD1 2BGJA 4OGGA 2ANBA 7REQB 3U0VA 2VATA 3NWJA 1KJZA 5AK5A 2JLBA 2FG7C 1LZLA 2C5EA 2ZPAA 3OICA 2AOXA 4RQBA 4E3WA 4EHLA 3HE3A 4F84A 3RFTA 1S7GA 2JDIA 1O6FA 2D5AA 3AILA 5LU8A 3D2LA 4LXQA 3ZLJA 1J25A 1IIBA 4G0MA 4IIEA 3ZU5A 4D7AA 3VR4H 5JJBA 3D6UA 5CT6A 4YNBA 1X15A 3EXFA 3ON5A 3KU4A 1K8RA 2JRLA 1TOAA 2WKWA 2BN4A 2X23A 3FLEA 3N3BC 4JC0A 3TLBA 1Z0DA 3UHPA 1XXHB 2IYXA 4J0FA 3NNNA 3PNMA 4DA7A 4XYLA 3EY4A 4N0EA 4WFJA 3RVBA 4A8JC 4LYEA 1CX9B 4BLUA 2G4CA 5DN6A 5AXAA 5TC4A 3U49A 4B6OA 4EHIA 2R1VB 4Y9TA 1HPLA 2WJ4A 3RFXA 1JQEA 2WABA 2IXDA 3I9V1 4QAQA 5DCWA 1I4EB 3TIIA 4OJMX 4U6SA 3N05A 4DMUB 4Z9YA 2XE4A 4S1NA 4E07A 3GLGA 2XTJA 1SXGA 1SBYA 2IP1A 3IDQA 3RV4A 1CDOA 2JHAA 2ZSEA 4Z4QA 1QGED 1Z88A 1WHTA 2DY0A 3HBMA 4BX9A 2ZAYA 3HP7A 1L7PA 3ZR4B 5KSOA 2QVBA 4CKZA 5TJHA 1ZGJA 4NS1A 1PZFA 3I6YA 3VYWA 2H54A 3P45A 3RS9A 1B00A 2NYVA 2NZUG 4C7OB 1JG3A 4ZCLA 4HDQB 5DISB 1CC1S 1TVCA 2IGBA 1H2FA 1ECCA 1LA2A 3DVRX 1IUOA 3DLTA 1KFJB 2CLEB 4WH0A 3PQ8A 3L1UA 1T3SA 3BK7A 1NV9A 3REGA 1ZBDA 2CLIB 3OCCA 4BV2A 4YASA 3TI9A 4KYVA 4UBMA 1AV7A 3EIXA 1YZVA 4WCFB 2JLRA 3KJGA 2ZCUA 4KWTA 5DJ5A 3RRFA 5B53A 2OP1A 3K2QA 1MA0A 4HUTA 5B55A 3EIUA 1XWIA 4KN5A 3U39A 2X4IA 2C78A 2ZI5A 5C9ZA 3FPBA 3WL8A 4GPIB 3NHYA 1GQYA 4GSKA 3N2YA 4FUTA 3G7UA 1UPCA 5AVVA 4NEGA 4QA9A 1ZD5A 4PHHA 4CMJA 1R6BX 2CDCA 3CRZA 4AJNA 3HA3A 4CGYA 1U1DA 4Q1BA 1T2DA 1RPAA 1MB2A 1T5SA 1L4KA 4AC9A 4YRJA 1U8FO 1E4VA 5HYVA 3HCDA 2IKSA 3DVAB 2FSFA 4NMMA 4AIRA 4OQDA 3SAJA 1DV2A 3NBMA 4ZYUA 4IJQA 2PT9A 4C7VA 4DT1A 2AQHA 2NUPB 3E35A 1CUAA 3C3JA 3NHAA 1A8QA 2HHLA 1DFIA 3BRSA 3FMOB 3GAAA 4URWR 2A5GA 4ZAWA 5AUQA 3TRKA 3UC9A 3PJFA 3HJNA 3HACA 1UWVA 2XGSA 3C3XA 5TF4A 2BEUA 1GTVA 3MRXA 4LJ9A 1QTIA 1K8ZB 4M0MA 5DM2A 1V11B 2XDYA 5DGDA 1BHQ1 3Q7TA 3FPJA 5K3FA 4D5EA 1PL6A 4GSLA 2D7JA 3KPUA 2BDEA 5IT4A 5CFLA 5AVUA 2AN5A 5DNDA 3AIOA 3FDXA 1U7WA 1YVDA 4KSBA 1RJEA 1UZAA 1XWWA 2IH5A 3PQ3A 3ICCA 4NIMA 2QMEA 2PPLA 1D2RA 4KQEA 2BUCA 4XSHA 4MO2A 1VCOA 3LXRA 1EGQA 3G8AA 3M1AA 3Q8XB 4GZ3A 2PXAA 4HS9A 4IIVA 4KXLA 4C30A 1M8FA 1N2JA 1JFSA 3ECCA 2XE7A 4NBLA 1D2EA 3KDSE 1QS0B 2A5JA 1FU7A 1KK1A 2L19A 3NM5A 4PE5B 3QTBA 2AG1A 4G5YA 4R69A 5FPYA 4R98A 4IV0A 3STYA 5JY1A 3PT9A 3LUAA 1A2OA 4PIPA 1E2KA 4IQ4A 4XD2A 3HH8A 5HFJA 3TL2A 1XVVA 2NAFA 1HE5A 2GGSA 2AR9A 1Y89A 4Q19A 2VVTA 3TVTA 3LRXA 4J03A 5KQRA 4QDJA 2JJ2A 4R4JA 3WLHA 3ZUPA 4CEHB 3Q72A 1CUVA 5JADA 5FR2A 1BMQA 3CLKA 1BRTA 3BWDD 1LC0A 3PXDA 4ERXA 5TPZA 3QFRA 4A9AA 3RSOA 4JLUA 3UYKA 3C8HA 5AW5A 3W3AD 4F2HA 3L0SA 4M1TA 1ISJA 3BCHA 3ZDEA 1CP2A 1E4EB 2DULA 1VJRA 2KBEA 4GDFA 2N46A 3WNZA 1G55A 3PHBE 4DHEA 2DB3A 1ZGZA 2RHOA 3T99A 1FYVA 2F7SA 2VLIA 4FOTA 1NURA 1QGDA 2X6RA 4M0PA 1L5HB 1Z29A 4WLVA 3GUHA 4MVJH 3TBKA 1L8AA 3G23A 4P81A 4TMZA 1KYXA 3TWOA 1HNXB 1FFEA 3K32A 3L0PA 4LWQA 1J23A 5FAXA 5IX8A 3GA0A 1D03A 5DM1A 3I64A 1SUPA 3A6KA 5FLXA 2G0AA 3VZCA 2OGZA 2PRKA 4KPGA 4PM4A 4A27A 5BPHA 5HKAA 2VN8A 4TXNA 1YB6A 2WU4A 3JU3A 2PT6A 2QZ9A 5I51A 1KSJA 4KIJA 4MEJA 1TVKA 3DVSX 1VPLA 5D5QA 1KRXA 2B4TO 221PA 2J9RA 2M9MA 2HAEA 2IS6A 2IP4A 3KR1A 4FZJA 2IIBA 4RABA 1EXVA 2ZRHA 1BW9A 4TV8F 2H2IA 2Y1GA 2QLNA 3OX3A 2WIFA 2HXSA 1DOAA 5E8RA 3UY4A 2R00A 3QUSA 5C4IA 5BMVB 2FUKA 1UR5A 1W87A 4UXIA 2IA5A 3BORA 1XUOA 3TLGA 3Q40A 1T8UA 2IEZA 2RGXA 1KH2A 4QD3A 2JD2A 4FYMA 5LQMA 4XQCA 1FRFS 3EVDA 1AKYA 2NYRA 2GWRA 1TT7A 2E18A 1YR3A 1H9AA 3EGOA 3FTNA 4K9QA 3I8XA 4LYFA 3UKJA 4YXWD 1XZLA 3JYPA 3IUMA 4RELA 5IF9A 3RUCA 4J0DA 5T4FA 2I1VB 4BHTA 4Q4JB 3CHYA 3JQAB 1R0ZA 3DHNA 4G0PA 4MWGA 5LZ4A 1XDWA 3B89A 3ZHVA 1JT9A 2BLLA 1SVLA 4HYEA 4P53A 1TJ5A 1GVHA 4LZAA 1UJ5A 1TYEB 2UDPA 1UJNA 4BVAA 1FNSA 1IPFA 1F12A 1N2SA 3FSJX 3O94A 1K89A 5ICCA 4X00A 3O8CA 1F2UA 1U11A 3HVIA 4H4DA 2EQAA 2P8JA 4PLHA 2ZJBA 2VDVE 4LJ5A 4PV7A 2B8JA 5HXAA 3RYCA 3IYLW 4M9XA 1UBHS 1TCVA 2KMLA 3GGSA 1DEKA 4TXHA 2ZIEA 4KK3A 5HZKA 4KIFA 1RDFA 3M5WA 1V7PC 4E6PA 3FWYA 2I7CA 3DHYA 4O4JB 3RADC 3OFSA 3KFVA 3KQKA 5BSHA 3RGWS 4NFSA 2Q99A 9ABPA 1MEOA 1Z18A 2GZHA 4OGLA 1PNQA 2QZZA 4X95A 1BXZA 4BFWA 1WPQA 4EX6A 1FOEB 2IYPA 1SK9A 2WD7A 3MM4A 3NC1C 4P34A 1YRLA 3RUPA 1A1VA 1U3GA 1QDUA 2FN3A 2VNKA 3HWSA 3UK0A 1RWMA 1E1YA 3H8SA 5CDGA 5KYNA 5E4TA 3PZBA 3NHFA 1PNVA 2CVFA 2WYOA 2XYGA 4Y1GA 1KYVA 1X8XA 1V7CA 2JKVA 4JT4A 4RKFA 5CTAA 1IBMB 3H5AA 1MR3F 1Q22A 4IXTA 3ABOB 3VSEA 3O8OA 1NM5A 1WUYA 2X9NA 3H2ZA 1RYMA 2QXUA 2BFMA 2JAOA 4I1PA 1YQEA 2HDHA 4B2PA 3NHLA 3PWKA 2AN4A 5DZSA 5F77A 4EMSA 2ZR7A 1ZGGA 4AMZA 4NZOA 1T6BY 1HORA 4HCJA 4G37A 3N2GA 5BYBA 1XK7A 4AJEA 1G291 5F3DA 3I5AA 3NUGA 3VZPA 4HX2A 4YUXA 5EMKA 1SURA 2WRZA 3W7BA 1A5ZA 3M2TA 3FPAA 3DUFB 2X41A 3R5TA 1ZZEA 4FSDA 5TJ9A 2R47A 5HRUA 2F3RA 2A84A 4FVTA 3FPCA 4BWVA 4WLEA 3HCEA 2HNKA 1P4RA 3CEJA 2AQKA 2YJZA 3WLMA 4RDXA 3N53A 4ZCMA 1UC8A 1IHXA 3JY6A 4IIXA 5KVAA 3I61A 3IPXA 3A2KA 2WLTA 2CFTA 3CX7A 4YP1A 4TXLA 2A4MA 3HKBA 1U0FA 2HOQA 3F9IA 3PKJA 2JBHA 4LRWA 1VKHA 5EFZA 4NCHA 5BXYA 3TNYA 2OO5C 2UZIR 3K20A 4CG2A 8LDHA 4MUKA 5L4LA 1VJ0A 2FDRA 2OG1A 3DZJA 3V4FA 3NP9A 4BO6A 2J9GA 3S5JA 1FUYB 4HT3B 4M76B 4UJ5A 3K1JA 4XIJA 4AYWA 2VHTA 4GXQA 3S0JA 3ADKA 3JYHA 1WVIA 3KXIA 1CIPA 3KR2A 4JODA 4NG5A 3SBOA 1XMOB 4ZVVA 1X70A 1SUWA 4EW2A 4IEFB 3G9XA 1HYGA 1Y7PA 1GYRA 4MVYA 1KEVA 1ZQ1A 1NW7A 4HLDA 2NPFA 4TTSA 3L7DA 4AURA 3YASA 2AMJA 1XYYA 1PUJA 5E38A 1Y9JA 3GLFA 1DAMA 1RKBA 1TVEA 3ESZA 3GEHA 1OSNA 5D3KA 1ESCA 3IQEA 1JFLA 2PD3A 3O2QB 2NX2A 1QP8A 5SYAA 4LECA 1SKYB 1IMJA 2HRQA 1W0JD 1I4LD 2J0UB 2XNDA 5G41A 5L7WA 2BV3A 1BA3A 3K1AA 3KNZA 4S2EA 3WNBA 2MMCA 4X1IB 4S1TA 1C14A 1G5TA 3BKXA 3HVJA 3ETLA 4IZIA 3ZHUA 2VQ6A 4E15A 2QTRA 1E60A 1L8LA 1NDHA 3KSUA 3UF0A 1AOXA 1HOXA 2XKAA 5C80A 4ZTUB 4L1KA 3H11A 1GZ6A 3M5DA 5IN5A 2HQ1A 3W1EA 1V35A 2ZT5A 2VHUA 3EIWA 3RT7A 1V25A 3U3RA 5U1PA 4P7BA 2ZZKA 3GFOA 3TQRA 1W4BA 3WRXC 1Y80A 2FB9A 1FFCA 3LP6A 1MTZA 4OHKA 1OPXA 1SKUA 1U2DA 2VP5A 3Q4GA 1C7QA 3GFRA 1ZH4A 1LPMA 1JWAB 5LC1A 4D3YA 5BYAA 3R0XA 4AM8A 4HF7A 1NJ5A 1WCV1 4XYEA 4RTOA 3G9QA 4DWVA 4MV5A 1OLUA 3ETDA 4TUYA 3G68A 2HRDA 1W73A 2W4IA 1MVLA 2J48A 3BT7A 2B78A 2BCEA 3D43A 3Q6NA 3DLAA 3IKMB 3NWBA 4H7FA 2GD6A 3PFNA 4RFVA 3WLEA 5CHEA 4NV1A 4RADA 4CLRA 2CWDA 4RPCA 4DBLE 1MO3A 3DTNA 5EJ6A 1RMQA 1YI0A 1Q7CA 2VZ9A 1N9ZA 4L5BA 3I05A 3SSOA 2GN0A 4ME6A 2Z9CA 1N8NA 5WRFA 2BI7A 3TW8A 3MJHA 4YX9A 2UUCB 3BIXA 3AVYA 3N2NA 1RHQA 3SSNA 4B7AA 4PF1A 5D3ZA 5AKZA 5IUNC 2H2GA 2YS7A 4MJ7A 2XZOA 4LGCA 3AQ4A 1QPBA 4XM0A 4WCFC 4E2FA 2YCBA 1G8YA 4J7CA 1NXOA 3OEHD 4RD3A 1XHLA 4ZKDA 7ABPA 6ADHA 3MMSA 1CYDA 2P1DA 1ITZA 3D6MA 1DG3A 3AWIA 3JQFA 2ID9A 4LGMA 2ZS7A 3RG2A 3KEOA 1Q2UA 1SVWA 3AF2A 1C4WA 4DSZA 2DCMA 1YO6A 4LJSA 1C7FA 1YB4A 2CMHA 4FFWA 3V8EA 2UUBB 1WZNA 1ZRNA 3I9FA 4U9UA 4BS9A 4ZJPA 3H5VA 3PXBA 2COEA 2IPAB 2CXPA 4CUZA 4GPEA 3AFNA 2WJZB 5JAUA 4WK6A 2B82A 2H4HA 4TTRA 4ZVQA 3G2PA 1MC4A 1SVMA 5SV2A 4FT2A 1DBVO 2R1UA 1HDYA 4GRIA 1G8KA 4HAVA 1K8XB 3AEUB 4NARA 4BTLA 2DH6A 4QPPA 3PUJA 2R6DA 1N2CA 1GZVA 1TCUA 3QUTA 3LDHA 2OXEA 4CU2A 4FW8A 4DN6A 8OHMA 5IABA 3S6JA 1OILA 2YYSA 3UK7A 1NI3A 2IEBA 3E1KA 4BGUA 1TLFA 3DV0B 2G6BA 2WZBA 1AZSC 1X7XA 2XBUA 1T34A 3UUEA 2PD4A 2ICAA 1LNQA 5AIBA 3CYFA 1V5EA 2CNWA 1PEYA 1T9AA 1Z45A 1Y8RB 2DE0X 3C4VA 5BVHB 4JVLA 4CIDA 5BV1A 3DE5X 4JC4A 4JLBA 1VPWA 2F1JA 2XDWA 4NMHA 3N9IA 2QD2A 3FDZA 1EBBA 4F4DA 4AN0A 5CAEB 2IZ0A 1PL0A 3AMVA 4J7UA 4RPIA 1X1DA 5F52A 1K5DA 3T9AA 2PWZA 3CLVA 2YY7A 3QFFA 1OLXB 3KDAA 1T6XA 5EIBD 1YR8A 3H4TA 1ANKA 1E2LA 2OHFA 4MLPA 1G3RA 4OD0A 3W2TA 2O8BB 2IV2X 1RRKA 3AEZA 1JN0A 1N6IA 2X2OA 2PQ0A 4PCAA 5AXCA 4RA9B 3H6KA 1XF9A 4RD0A 4D4MA 5HUQA 3Q98A 3UGKA 2MMGA 3OLQA 4B5KA 5FD8A 5AVQA 4FB5A 5LUAA 3PHHA 1DO8A 3OIUA 4CNBA 2EARA 1FX0A 1YHYA 3RPEA 3C39A 1ARZA 4NZPA 1G6KA 1U3WA 4Y8VA 4ERNA 2O7QA 3G5TA 4V0SA 3WK7A 1G3IA 1KVRA 1RE0A 2OL4A 1GFIA 4HVCA 1JHZA 2H06A 1J9EA 1XKTA 1DPFA 3KTFA 4S0ZA 4JB3A 5EXEA 1PAUA 3Q9SA 4AROA 1U2TA 4OBXA 4PIVA 3LDGA 4BO8A 4NPCA 4GUAA 1CFZA 1WNFA 1P0QA 2YUIA 3OOWA 4LHXA 2IU6A 4MR8B 4NENA 2ATEA 4R8KA 1TW3A 2XHEA 2G8NA 2ZP1A 5TVKA 1FZQA 1NE7A 1WE2A 2C0QA 4KGZA 5D87A 1OFUX 3GUUA 4TVKA 1IU9A 4YQYA 3VVCA 1ZOSA 4EB6A 1CRQA 4KQGA 4B40A 4BLTA 3WGLA 5DNVA 1LI4A 3NB0A 1YBVA 5ELXA 2Z08A 1JFRA 1L7VC 1CY0A 4I19A 4JEUA 1B2RA 1D2CA 2YWCA 3Q6MA 3OJ0A 3DZHA 3PNQA 1GFZA 1NJ1A 2AXQA 2YRFA 4C7BA 2IYTA 5F76A 1FYXA 5BP7A 3DEJA 4BWFB 2C9YA 2Q3HA 3ZWKA 1V8OA 2OE2A 3I1JA 3OE7D 4NOKA 3T5DA 3ZWVA 4ER7A 3F2IA 3T4EA 1Y5IA 4TL8A 4HX5A 1KFBB 3L05A 1YQUA 1YR7A 3C8MA 2AFHA 3EVFA 3B82A 2Q6KA 4MS4B 1RC0A 3IDZA 3SY8A 3ZE7A 4KQ9A 5JMTA 1PX2A 4ZYZA 1RYBA 2QMHA 4MRMA 5ELMA 2E87A 4JWTA 1JSCA 5G0TA 4DCSA 3QF4B 2Z5GA 3QX8A 3QLVC 5ALTA 1S6YA 4KUGA 4NOJA 3LQYA 4DMKA 3RW9A 5JT1A 5DFAA 1SCNE 2J3HA 2HWXA 1OHHA 2FPUA 4C6SA 5ICEA 4J43A 2AOTB 1GA1A 5JS2A 1JMYA 1DG1G 2FOIA 4W5WA 5EJFA 5GONB 5MDHA 2OCIA 3M1LA 1NBWB 4W82A 5EE3A 3TFWA 3QQPA 1ZH6A 1QIFA 3BRQA 4JKIA 1QR6A 1M10A 1UZMA 3B8EA 2GEVA 3FDIA 3H2HA 4B7CA 4CMKA 1YNOA 1BROA 3PB3A 4N03A 2D74A 3ZWAA 2CCJA 1PSWA 3DFMA 2WJ3A 3F4BA 2DY1A 2UZ1B 4H7JA 4KC0A 3PFCA 1GV0A 3LY8A 3A6ZA 3ZE2B 4QBKA 2YZ2A 3B51X 4M49A 4EI9A 5EI5A 2H7CA 3TBFA 2X77A 3LI2A 3LRPA 1D9ZA 2G1JA 2VPQA 1EVKA 3PGVA 4Z0PA 4LRUA 2G4LA 3SFTA 4KXMA 5K0BA 4CCSA 3P19A 4Q3NA 3HGTA 3JQBA 4Q37A 3TOZA 1QH8B 5DLEA 1CEEA 3KYBA 3T06B 4Q7EA 4DC9A 2ESRA 4Y2GA 1GG9A 1YD7A 3HFJA 4QJ5A 2QVGA 5C7OO 4FEAA 3L4BA 1XYVA 3LHSA 3SXUB 4HOYA 4D42A 3E7XA 4WKGA 5T64A 1YIAA 2WF7A 4RK0A 2CUNA 3HBFA 3UHFA 3SLKA 4AZ0B 3HHEA 4WADA 4GUDA 1T0HB 3FKQA 3TNFA 3W6PA 2I87A 1FDVA 1QIMA 1CHDA 1D1PA 4ILEA 4MW5A 3QU2A 3WA6A 4NULA 4G85A 2JLSA 2WUDA 5KX5B 2WJHA 2Z6AA 4GG1A 5EAIA 3NBFA 1AM4D 1LK5A 4G97A 4XIFA 3F46A 3WWPA 2BEWA 2NNLD 2L69A 5FA8A 1PJZA 2AHRA 2YWRA 1LTHR 2X76A 1P62B 3ZHOA 3QVLA 4GWLA 1RI1A 3I9MA 3IMEA 3S70A 5LLTA 3KSAC 1ULZA 4Y6PA 4C1NA 2XMRA 4UDNA 1C7ZA 2ES4A 4FFBA 2A86A 2C4UA 2R0QC 3SE7A 2QZPA 1VBNA 1NATA 1JQJC 1X19A 1A2QA 2GF0A 4E5KA 3NBXX 2O2ZA 3V1TC 4LTMA 1ISIA 2WC1A 4KE6A 4U5QA 2UVDA 2JKZA 5F33A 1EPUA 3RRXA 4YBRA 2GPWA 2ZRBA 1CD5A 2IYQA 2ACVA 3L8MA 3LYLA 1K6XA 1G9TA 3CZMA 3FYCA 2C4KA 1P2VA 1OU0A 3DZ8A 3QLUC 3Q85A 3A4VA 4F60A 4RCVA 5AIAA 2BHRA 5KTTA 1Q6YA 2YIVX 1U7ZA 1I7LA 3ORFA 3H0KA 1Q7EA 4HN4B 4MVJG 4XUCA 1VE6A 4K9SA 3F0TA 4BQIA 1G9XA 1JB1A 2IV7A 4Z1MD 3BWVA 5K0NA 1RZ3A 1MZPA 3WK5A 4AS1A 1A7JA 3LH5A 4QUGA 2OHXA 4H7KA 1PT6A 2V7GA 4ZCQA 4PU0A 4M88A 5I5GA 3D8HA 1YL6A 3FHCB 4MUYA 2NU7B 2V0NA 2GJ8A 4FMBB 3T3MB 4C4SA 1OTHA 5EZ6B 1DAEA 1WUHS 2VUTA 4HG2A 3GRUA 4TWBA 4ZVNA 2SECE 3DMFA 4B46A 5L7YA 3AZOA 2WD8A 3WOHA 4WN9A 2BHLA 4DLSA 2TRSB 1C9EA 2O59A 1JLLB 2D4AA 1SUSA 1UBFA 4GC9A 1KDTA 4KWIA 1DB3A 1PBTA 2J07A 2XKBA 4P93A 4PSVA 4YLEA 5DMHA 3RUFA 2RARA 1F8YA 1U94A 4QELA 4EHBA 1ZUWA 2Q4DA 2PYDA 4D0GA 2C29D 4WN3A 3FWPA 4BCDA 3SBDA 1T13A 4CQJA 3GAMA 4MTCA 1A88A 1PE0A 4Q5IA 1EWYA 5EZQA 1OREA 1HZZC 1CKEA 1JR2A 3AHJA 5LBIA 4AI6A 1IWOA 1RJWA 4ZVSA 2G88A 3A6FA 1J2TA 2PX4A 1K5HA 3FNFA 3W9SA 3HFGA 3JD1A 3VPXA 4Z4IA 2OCLA 3IKTA 5SZJA 1EMDA 3W3AH 3X1WA 2QB5A 4ZVKA 4F6LA 2O1XA 4O2BB 5LP6F 2V0GA 4OB8A 1E1QA 3MGGA 3ICQB 3IKJA 3IP5A 4X64B 1N7HA 4WZBB 5EINA 5GJCA 3W05A 3W5UA 3LLSA 1TT5B 2IQ5A 4N40A 5DBHX 4C7JA 2WTBA 2ZI4A 3H1AA 4XX0A 1SU4A 3PUHA 3VTZA 5LQDA 1UPUA 2ISQA 4ARAA 2XY4A 1RI4A 4B6FA 2BBWA 1YI8A 1TJ3A 2NZXA 2F59A 2Z1DA 3L84A 4WI1A 2R6ZA 4CIVA 1UPXA 1I36A 3FZYA 3NHSA 2YXNA 2Z56A 2QS9A 3DBRB 3H9EO 1UK7A 4KI0A 1V2HE 2IHBA 2PU7A 4BNZA 2PD6A 4MGYR 1SVNA 3AI2A 4BRZA 4Q6WA 3HM9A 3C6ZA 4M0LA 4Q9AA 1YZHA 1U99A 1UZNA 2VJPA 3A4YA 3AXTA 5E0OA 4DSOA 3U7EB 3AF0A 3LBYA 4PX5A 1EAMA 1P6XA 3B70A 2NXNA 4KE9A 4TMYA 4TWIA 4TXMA 1PQYA 5J23A 4GLFA 1Z25A 1C9JA 3A1DA 2QX8A 5I7FA 3KVOA 5J2TA 1PW7A 1HXHA 1YULA 4XSVA 1U0JA 3V80A 4IHAA 4RD1A 1ORRA 1ZC4A 2VYND 2EBFX 4HQRA 2FXVA 4UC0A 4UBKA 1X13A 5HGXA 1NLMA 3PX3A 2JIZD 2O1SA 4MEBA 5A62A 5HP4A 4B6SA 3VU0A 2ZU6A 2OYCA 3T6KA 2V7WA 2WHRA 2CGEA 2VT7A 3SM9A 5TR9A 1ZJ6A 3VISA 4BNFA 3AV3A 3P9QA 1KO7A 2IZZA 4NPHA 4O8ZA 3PWTA 2OV2A 1SELA 1BHJA 2QN8A 3N39C 3QNMA 2MT9A 2OBXA 1J42A 1Z9BA 2DBVO 3D7SA 3IA7A 4KO4S 5ALXA 1R7RA 3U3DA 5B7PA 5CITA 1MT0A 2CLHB 2O3JA 3H13A 4MHSA 2OLKA 4TMFA 4WECA 3LRTA 1LI7A 1V2GA 4XVHA 4XQ0A 1W4CA 4DJDC 1YS6A 2EX0A 1GU7A 2XQJA 3IVCA 3TSAA 1CQIA 2FK8A 4H77A 5AUNB 2DUJA 3T1HB 1Y6ZA 3E2IA 5BV0A 3ZIAD 3WIOA 2OKCA 2NVUA 1NU8A 2QDKA 4GHWA 1T2AA 3LF1A 1AUXA 3SS8A 1KZ9A 4YO8A 4GRDA 4AJPA 3GZ4A 5DNWA 3CN7A 1XPJA 3CWCA 4LEIA 3A25A 3RQIA 4EATA 5KTPA 2RSLA 1RRFA 1VPEA 4V03A 2FSSA 1W85B 2BHNA 1GA6A 5LB2A 1M1NB 2NIPA 1TGVA 1V5IA 3GLIB 3ANTA 2DVMA 3FGZA 2X6QA 3IO3A 4IGIA 1FYFA 3ADDA 4QQ8A 3WRYA 1YS9A 3DR5A 3PP8A 1JQ3A 4YCDA 3EC7A 2JEOA 2QXYA 5G1NA 3MWDB 4HDOB 4QUHA 3PPXA 3AOEA 1V3QE 4WLUA 3BE6A 3HA2A 2F8LA 3NJ4A 4RVHA 4WBNB 5E7MA 1T2EA 2PVCA 2X2PA 6Q21A 3GEEA 3C6BA 3IKLA 2VFAA 2I8AA 2NO1A 2Z5VA 4YMWA 5T4HA 1OC4A 5EWJA 1YL7A 3AJDA 1ZUNA 2LDXA 3QIVA 3V32A 3WLPA 5ICFA 4P98A 4DANA 1N2GA 1OBHA 1ISMA 4PO1A 4EL5A 2QI9C 4KP7A 1L7QA 1L5WA 2EF0A 3MQ4A 4OHCA 2PTGA 2P9QA 3VHXB 2AK2A 3ND8A 1UINA 3MA0A 3VSAA 3WYDA 4K6OA 2E4YA 3E48A 3G5LA 1CJBA 3IE0A 2HTEA 2NTJA 3GWZA 3JD4A 5IWCA 3R8FA 1QQBA 2ZRLA 1RTTA 2HWWA 2HA6A 4HV4A 2FHPA 4IIJF 3D31A 4O2RA 2IEGA 2XYHA 1AKMA 2WJ6A 3F5QA 2G1KA 2GCOB 5CT8A 3T34A 3A6JA 5LQUA 2V3CC 4BMNA 1U8UA 3EVAA 1R0WA 4E4TA 5FOVA 1ORIA 2IPOA 5ICGA 4QBTA 3FOWA 2PX6A 1QVVA 1B6RA 5KNBD 2PBRA 4RJIA 2BSXA 4KXVA 1NVBA 2PXCA 1M6YA 2ZJAA 4QPZA 1E7YA 4ZDIA 2W2MA 1NMXA 3B1JA 4TTVA 5HFNA 3HR8A 2ZJ6A 1HDXA 2BEKA 4L5AA 5EKDA 4CKYA 5HOEA 3HXQA 3VDNB 4IDFA 3SZMA 5FUMA 2J30A 3AFGA 4WNAB 1I3LA 2FF5A 4BNHA 2YICA 3UAVA 1BYIA 4KB5A 1SCKA 3ONVA 3QKUA 1X7YA 3L8DA 1MOZA 2V5AA 2HMTA 1KJIA 3L6BA 3ORRA 4ITVA 4QQKA 2WAOA 5F35A 5J9FA 4S3MA 4DJTA 1ZEMA 1TK2A 1OXKB 3AU8A 1CE8B 4D4GA 2Y8EA 4UATA 3UB2A 1XD2A 3BIWA 4HGYA 1P7PA 4S12A 1EUZA 1JAZA 1U98A 3C8UA 1ZN9A 4UTRA 2G3YA 4TLLB 3U80A 1XZIA 2CCGA 4HZGA 1G18A 5M04A 5AM1A 621PA 5TMPA 2PSJA 4KFTA 4FGZA 5GMOA 3TR5A 4C0LA 2NUTA 3EPRA 4Y3UA 4ZOQI 1JA0A 2G07A 2ODTX 2GAJA 2FFBA 5I9MA 3VYRB 4FMCF 4YRBA 1ZOIA 4OB6A 1E3JA 1NVMB 1RSZA 2WTEA 4UHKA 5J4LA 4S04A 1F0KA 2GO1A 3U3KA 1V4VA 2OAQ1 3TLYA 2QKYA 2X0KA 3O4GA 1M2HA 5HJ5A 1BKYA 4TRMA 5CT5A 3DEZA 3EN0A 5F5LA 5FUXA 3ZDXB 3CE6A 3B5EA 5KC8A 1MDFA 3DXYA 2BGLA 4OSEA 1U1CA 4D9EA 3UJCA 1BHSA 1DX9A 3BFKA 3DULA 3HLKA 1GRQA 2RGBA 1IOVA 2DSTA 1BA2A 4X7PA 4WIAA 1EFRA 3QJ5A 1KKLA 2J87A 1E77A 1F8XA 3GMIA 1H0RA 3EDMA 3PCXA 2ODPA 4D98A 3AUXA 3ITKA 5JEDA 4U02A 3JQGA 5EZYB 5T5QA 3W5BA 1NUUA 3BAFA 4MLDA 4JI5B 3ELDA 1YDEA 1ESNA 1NY6A 2RDMA 3K09A 1T9GR 5FOSA 2VTBB 2XUFA 1RAFA 4GBED 3H87A 5LA6B 4HYYA 2Q4TA 5TB5A 4MVJF 3ZI7A 4BFUA 3GJTA 5LJIA 4TRRA 3T0FA 1V1RA 3BZBA 4JP8A 3OH8A 6ABPA 1CY4A 4XSGA 2QRHA 2VWGA 5L3QB 2WQ6A 1DUVG 5C1BA 3KKQA 3M1YA 3U7IA 1KOGA 4KL8S 2ZAOA 4O63O 2FH5B 4CM1A 1DLJA 1ZXBA 1VRCA 2CFIA 5T4BA 5K2OA 3IQXA 4MWDA 4DPMA 5C8XA 1KEEB 3OOJA 1VCMA 2I03A 5FFFA 1O57A 4HAOA 1N0WA 4RANA 4OAOA 1H2RS 3HV0A 1JIJA 3D8SA 4DIFA 3EVNA 4OI4A 1PL8A 3QBJA 4L0CA 1VL0A 4FGKA 1E1NA 4A0HA 5GAJA 4WV3A 4BB5A 1SC1A 4G0OA 5EZ5A 4N5DA 1FQJA 3NXSA 3QU4A 1YV9A 4KO3S 1UMDB 2XRYA 4EQ6B 1Y3AA 4JI1B 2BFDA 2I54A 1WCYA 3ZWQA 1WVMA 2FX5A 3KWMA 5C3MA 3K0CC 3FOAA 1HKHA 3H16A 1EA7A 4RORA 2RH8A 5AMXA 1ZU4A 4OHOA 4PC3A 1C3OA 3PENA 4WA8A 4JUIA 4ZVRA 3T7KA 2FG6C 2XGMA 2EEPA 4LCBA 3GMTA 4JUFA 1TXGA 5KTSA 2IYUA 4ZD6A 4DLWA 5BN1A 5K5EA 4FWIB 4YJGA 4BKOA 3GLGB 1TMGE 2MHCA 4H7EA 4MQBA 4ZCTA 3X3HA 2OMEA 2YRWA 3GZTB 4RY0A 4M8IA 4K81B 3LUHA 3CY6A 1Q7RA 4JQSA 5CA0B 3W8DA 4GQIA 4HWRA 4RLSA 3GRPA 3TNJA 4XD7A 4E32A 2HMWA 4PHFA 2YMLA 1WHSA 1QFZA 4L6AA 3TIGA 1L5QA 1N0UA 4JI3B 1JAXA 1Z83A 3UMFA 4F91B 4QATA 1MIOB 3EVEA 4Q1EA 2ETXA 2BDTA 2Q21A 5ISMA 1C9KA 3GFVA 3SLRA 4EAAA 3DWFA 1TE2A 5D85A 5IM4F 4AWXA 5LQJA 1E7SA 3BE4A 3IPCA 4DBVO 3CJRA 2DWUA 5E1MA 2C5GA 1MOQA 3N5KA 4TKLA 4CDNA 2TMGA 1Z6GA 3ZXUB 4KLZA 1TPZA 1LDEA 3V4RA 1EP9A 4N6NA 1OX4A 5B4VA 2JA2A 3T0IA 4YREA 4YMLA 1DIOB 2FSIA 3F98A 5FORA 1QYVA 1SXJD 3A6LA 4B3XA 4UEWA 2X0DA 3VO1A 2XD9A 1HSOA 3GZNA 4QTTB 2Z0MA 5H3CA 2C2XA 2Y1EA 4CFSA 5FUQA 4IJVA 2IWRA 3UYLA 4QULA 1M2OB 1M1YE 3A05A 3F7TA 2GF2A 2ZR0A 3EFHA 3UK1A 1ZJWA 5FRDA 4CUKA 1J8YF 2HBRA 2JCVA 1YJ5A 4S1PA 1F2VA 2XE8A 4LHEA 5G53C 1RQXA 2AEFA 3EBLA 3JQ7A 4F9FA 2C04A 4IOMA 2EP5A 4OQZA 4MI3A 3VV3A 3MOIA 2AZTA 2WUEA 3FCUB 1I51A 3LUCA 2ZJOA 3R6DA 4KIGA 5B3JC 3QEBZ 5DTEA 5FPHA 5JXIA 2BR5A 4NLLA 3FCCA 2H29A 3P9RA 4P0TA 4NYJR 4Z1MA 3SKXA 5BSVA 3VC1A 5TGTA 3DS8A 5JCPA 3KT8A 3NX4A 2W6ZA 4FKZA 5EXPA 1JS1X 3JAWB 3Q7RA 5IPFA 1ZIPA 1ZLXA 2GR9A 3S3TA 3KHTA 2HU2A 4TLDA 4F46A 4CIBA 1BOOA 5JCOA 5BNWA 1OLSA 5K3FB 2NU6A 3QX7A 4G8BA 3TAXA 1OFGA 2AI3A 2XGOA 3H05A 1WM1A 3OURA 2PKEA 1OXSC 3V7UA 5DEIA 2V7QA 2OILA 5CYOA 5A9SA 1UFRA 1IVYA 1XZQA 2WTUA 4OHYA 1XZDA 3DFIA 3J7TA 3N0XA 1WS6A 2JS7A 1KK3A 5HK8A 4AS3A 3GNQA 2EZ4A 3HY4A 4ZICA 2ZCJA 5FH9A 4UE3S 3N2EA 3R7NA 4BVKA 1SXJB 1RRMA 2J3IA 2AKEA 3A0RB 2NV2B 5ALJA 1K6IA 3R76A 1P2GA 2R5NA 1OGYA 3L02A 2N42A 3OU2A 3TOSA 1A7UA 2XAAA 4GFDA 1N3YA 1HWYA 4KV9A 4OKNA 1NUPA 4OAPA 5ENVA 4DWOA 3PXEA 4R3WA 1MW9X 1PK7A 3HWWA 2J0SA 4M1OA 2ZAIA 1I3MA 2AXPA 1A4IA 4RVNA 4W99A 3GG9A 3V7NA 1WKVA 4M99A 3USES 4FZ3A 2XCTB 3TR6A 1FP7A 2P5SA 5JEEA 3EPLA 1SCBA 4AULA 1X9GA 1OH8A 1PJTA 4AK9A 3LPAA 5F2KA 2YVUA 4X1OA 4U8GA 3N86A 3G9UA 5L3RA 2CK3A 4NYIR 3IAFA 1RHKA 2W2KA 3AUYA 3INRA 3A6EA 1T9HA 5IN4A 4JKOA 3RLIA 2WA1A 3AL2A 5JSKA 1XTSA 3DOHA 3IT2A 3RANA 3DE7X 3NHWA 1YZUA 1PG5A 3FOCA 3OCZA 4X3CA 2PDAA 3P5BA 2FFQA 3B3AA 4YVFA 5ESDA 1G4AE 3U1VA 1I9GA 4BGVA 4NCAA 3K9LA 4MJLA 1MB4A 3HCFA 4REMA 3CLUD 4X92A 4YP0A 3SXPA 4XQEA 3FCXA 4HH1A 4QLAA 4RPLA 1KE2A 1AUVA 1F8UA 4DZZA 3CR7A 5B4TA 1XCOA 3C3YA 5G1OA 1TYZA 3DPUA 2LKCA 4X3PA 1O9BA 3T1TA 4LDRA 1HQCA 4M38A 3RHFA 2JK1A 1SKAA 2X0JA 4TTPA 3WQRA 3RC1A 3EXIB 2ZIVB 4GYJA 3LGAA 1T24A 2PLRA 1X0XA 1IRIA 3DV9A 2Y6UA 4UREA 5C7IO 4FHFA 1QCDA 4DG9A 1VLMA 3PYXA 1Z5ZA 4L78A 4IG9A 1LF5A 2VYNA 2YV5A 1GEEA 2ZGVA 3DOFA 1BE1A 4Y1EA 1CUHA 3K9HA 1FL9A 1KP2A 1V47A 3I2YX 3QFSA 3VR1A 5C8ZA 2J9XB 2TMKA 3KXKA 1P5HA 2JGRA 1VE1A 2PBLA 4ND2A 1D7AA 3GCDA 5AICA 2QD4A 4BVBA 2O05A 5A5EA 5CFQA 4LF7B 4MRVA 3DUWA 2BF4A 1D09A 1JF8A 2QLJA 1KQPA 4IGAA 3REQB 4F5YA 1NQVA 2Y1FA 1FX1A 1RE1A 3IQWA 3P9CA 1RQRA 4IF6A 1SC3A 3HR7A 4MR7B 3UWPA 2B1RA 1ADGA 1NMYA 2OQ2A 2Q0SA 3A9RA 1JG2A 3DZKA 3PFBA 1IXRC 3PQEA 3QKSB 4B0PA 3VR0A 9MHTA 1UBNA 2JGDB 3QE3A 4F92B 5HM8A 4B6RA 2W6JD 4J6FA 2YFYA 4GVLA 3RCBA 2C88A 4R1PA 1Y9DA 4N3BA 2PKRA 2QF7A 5ALGA 4E2WA 3ZX5A 2VO1A 5GZ3A 1JG6A 1K3FA 2VYQA 1C0KA 3RI3A 4PWZA 3SEFA 2HM7A 4P5DA 3I8OA 1OFTA 1EQ2A 1EP1B 3D0KA 1IUNA 3R6WA 4UAVA 4RZUA 5DHAA 4CN8A 2PUFA 1KXZA 3SPXA 4F72A 4FHEA 2CHUA 1M2WA 1T5OA 2LXNA 1F0PA 4HWSA 2BGWA 1BWQA 1F2UB 5FLKA 1C8KA 1UDRA 4EJ2A 4II3A 2QOEA 3UXMA 1M7HA 3KOMA 4DCTA 5DX1A 3QWIA 2NP6A 1FP4A 1CR6A 1FJ2A 5AKXA 3WTCA 2RGNA 5IJ9A 1NT2A 1Y5MA 4MROA 3O21A 1IJKA 2YY5A 1C5KA 1QB8A 2H8GA 3CF2A 1Z6XA 4GOLD 1VIMA 1I7NA 4E5YA 2BCJQ 1F6DA 4LXXA 1R3DA 2EJVA 2QUHA 4MX8A 4CCWA 3WMGA 2ZJZA 4YMHA 1T8SA 4WOBA 1NI5A 5AKKA 3ZCPA 2DRIA 2Z4SA 3DMRA 3EC2A 3K96A 3WGHA 4B0OA 3IAUA 2YJ3A 1C7RA 3X1XA 3U09A 2Y9MB 1KAGA 1XQ1A 1KY3A 2OBYA 1BMFD 1U0OC 5G4KB 5FV4A 4MJ3A 3O9VA 1TQ2A 4KPFC 3AVVA 3F9CA 4OI1A 2WMNB 3ZI4A 1KPIA 2IIVA 1E18A 2BI4A 2WHXA 4NAHA 3MWKA 4H6PA 4G1UC 2AE2A 3FSGD 5LZ7A 4LNAA 3OFVA 3EWSA 1QVWA 2PX0A 1PP4A 2JCXA 3O8OB 3RBZA 1SIWA 1J0BA 5ARCA 1WQ3A 4XR4A 3GAFA 1YL5A 3VPSA 3VHLB 4Z3KA 3PGLA 3PI7A 4N5MA 4KVGA 3UFXB 1PFYA 1IM2A 3GBVA 1E89A 5KNBA 1PGNA 1DLIA 1J24A 3FNHA 4GBMA 5IT0A 2G09A 1T2FA 1NF9A 2V9ZA 3W06A 1Y1RA 4HAYA 1IXKA 4JL8A 1JQAA 1RWNA 1JU4A 4F4CA 1IXZA 1CPYA 1JI3A 4D9CA 5JAPA 1E3MA 3C5CA 3D7NA 4IL5A 5H3LA 4RTPA 2W37A 3R7DA 1T9BA 1UT8A 4L8FA 4I3GA 1XNRB 3FB4A 4D4JA 3QE2A 5TS3A 4Z0HO 1S3GA 2WV7A 4GSYA 3ED1A 4JT8A 5CW1A 3WQHA 3GQBA 1OV4A 2CMDA 2BFCA 2V96A 3FHOA 3I30X 2EGGA 3T5PA 2ZULA 1DTWA 2BKAA 5GADl 2W6CX 4YCMA 4WSOA 3HUUA 3V1UA 2JG3A 1D6SA 1JYSA 1KI6B 4YAFA 3CZPA 3DR3A 1N3LA 1JHXA 4R1OA 1CY2A 4F4IA 1FUUA 4IV8A 3ANXA 3TNLA 2JW5A 7GPBA 3G8YA 1JUDA 2PS9A 1Z34A 3AIKA 3C14C 1OYYA 3F6BX 2F3SA 5D6NA 1I1QB 2A5DA 1KVSA 3U19A 1LSSA 1ORTA 3BMNB 2BGIA 1WSDA 1YRYE 4FGWA 2SCUA 3IP6A 4GR4A 2Q7DA 4NXNB 4QTZA 4ZPXA 2V7XA 3L4EA 1I0IA 2X4GA 3ISJA 4GMGA 2AN3A 3UPTA 2BH2A 2H2AA 4R41A 1PTJC 3DTVA 1X9HA 3T1VA 2QRJA 2W8BA 3KXDA 3VC2A 1XFDA 1RLMA 4JITA 2ST1A 1A9PA 3BRWD 4N5NA 1HE1C 4QE3A 1B1AA 5EMMA 5L3SA 2J9FB 3PKZA 4FFNA 5J3JA 4UUBA 5HSGA 4KJZA 2UXDB 1ZK2A 3EMVA 3DBLA 2IPXA 4DZTA 5AKIA 1MO4A 2H1RA 3RUHA 3SJUA 1KGDA 2RJOA 3SDSA 1QKJA 5J2UA 5KAPA 1GLNA 1XBTA 3ESRA 3ZZUA 3D5TA 1P1CA 2Z2YA 2VCYA 3MWEA 1BDJA 1WD5A 3U37A 2IS2A 1Q0ZA 3TTWA 4MRAA 1DKOA 1FU4A 4L0MA 4EMBA 2AZDA 3IVMA 3GL9A 1YDFA 3FMVA 1DFGA 1IH8A 4V24A 3W90A 4UQPA 2JGKA 5IG2A 3EDRA 4ETWA 2BZSA 5EPOA 1GUYA 3GJQA 2RJNA 4MVJM 4TLEA 1ABEA 4EF4A 5ULLA 3IT0A 4CM9D 1CNMA 3MJDA 2A1UA 1KYIA 2R6JA 1WY5A 3R0ZA 1GCGA 4ADSG 3GJ5A 4NEQA 3UATA 2PLAA 4GLBA 4K0RA 4TUYF 1GGMA 1MIHA 2RKOA 1YDMA 1OLUB 2O0JA 4BMSA 5L40A 2JJ8A 3JTEA 5FA5A 1O5TA 1T25A 2RCYA 4LYHA 4C0AC 5AWFC 4CFYA 4NS4A 5NULA 2RC6A 4AQDA 4QOFA 5CD9A 3K1TA 1QX3A 3CPHA 3O93A 2ZU0C 5F12A 2FNAA 4YHBA 3KVVA 2GPBA 2NVWA 3R3HA 3EY9A 4OJQA 3R5KA 1C0LA 4YAJA 5C4MA 2I6TA 2AMVA 3FLMA 1J2RA 2C92A 4PLFA 3RBXA 4DDKA 4NI5A 4L9WA 5A4IS 3P9SA 2O7VA 1KHHA 2VF5X 5FI0B 4U7DA 2ET6A 3JASA 1T5HX 1C50A 2H2HA 2QUKA 3EPJA 2G36A 4TN1A 5KKAA 2XNHA 2BT4A 1H6DA 3DFFA 3RUDA 3ZH9B 4D92A 4NBVA 4JL6A 3BB4A 3QE9Y 1KBZA 1Z7EA 2HLHA 1ZRSA 4BL5A 3QX3A 1YKFA 1GAQA 5E6UB 3UW1A 2K2WA 2NZJA 4CL2A 3KQSA 4YJHA 4EI8A 3EGWA 3S1AA 2PV0A 2Q5EA 3K35A 1KY2A 3T9CA 3WBBA 4OEHA 3ER8A 2LUOA 1V8BA 2JHCA 1AQ6A 1RR6A 1Y9ZA 3ITDA 2DFKB 4AKHA 1F4VA 3E3NA 3EUWA 4BNTA 2FX2A 2PHZA 4R2WA 4IDAA 3AF1A 3DBHA 1V26A 1P45A 3AUAA 1HR0B 1KOFA 3LF2A 1QRRA 2OORC 2I22A 2GZMA 2VHXA 3C85A 3KEQA 4RKWA 3SZOA 4RF3A 2QRVB 4BWGA 3E05A 5JFTA 1V16A 1C1DA 5EE9A 4K6GA 1C9NA 3EMKA 4OQQA 3WKAA 3WLKX 3GV0A 3HYSA 4BXOB 5JSFA 1YB7A 1GXSB 1O77A 2IZ5A 3GQVA 2X1HA 3QZUA 2FU5C 3BWYA 4TWJA 3K0EA 4C0XA 4UUQA 4PG5A 4DB4A 3BMQB 3K6JA 3ZCQA 3HO6A 4YK7A 2R60A 4XQGA 1M6NA 1N2XA 5JBQA 5BSEA 1X7XB 5AXBA 1E2EA 4N8SA 1KEUA 1Y33E 1EWVA 1NPTO 3QEAZ 1KARA 1D5WA 3ND7A 1KS2A 3LQ2A 1NQWA 4LOLA 1A7KA 1FDRA 2H16A 2JFXA 1B3BA 2N9UA 3OJFA 1SXJC 4HDKB 4LMBA 4J1TC 4IZHA 4GEKA 4UUPA 4F96A 5KNBH 4HNQA 4YHHB 3ZVKA 4EJSB 4IDPA 1O8BA 2P0AA 1X7WA 1YA4A 3AYZB 4YRFA 3PJRA 1Q3TA 1K7EB 5KYYA 1C30B 2H1CA 3SQMA 1JH8A 4LJRA 3H9GA 2O20A 2YJ5A 4NCBA 5F98A 2ZBRA 1EXWA 1TD1A 2ECKA 3ZYCA 1USWA 3H8WA 2DHRA 3A2NA 2QAIA 4PSKA 3ANSA 4Y98A 1TIKA 3MCTA 4FE7A 2UYQA 2FWNA 1WQ4A 3TZHA 1OZGA 4GICA 4CU5A 7ADHA 3QKTA 2UZ4A 2IYZA 4XCQA 3CPJB 5IXYA 1X1BA 1RPJA 5DHQA 1FX0B 5F3WB 4JXXA 3RJMA 5CCBA 3M0EA 1HYQA 1N6NA 4H7PA 3KB6A 2VAPA 1KC1A 3B53X 5JD3A 1C3LA 2B9EA 4UZEA 1O8CA 3MTEA 2VZEA 1A9RA 2HJRA 2R7NA 4HDMB 1GKKA 1OXTA 4JSYA 4MUIA 5K6RA 2Q1WA 1R5BA 1AKWA 1UBCA 3PVSA 1RYDA 2QTWB 3GJXC 4JR2A 4L22A 4NFYA 1EUCA 3RK4A 2VEDA 4EP1A 2H5IA 1OIVA 2BFBA 2HU8A 4OA8A 2I2CA 5TSDA 1WUJS 4BLRA 1JJBA 1VYUA 4BO9A 4EB6B 3BK2A 1RFGE 2IU4A 3EBOA 4TL7A 4WESA 4WERA 1VRVA 3MCAA 3T3GA 5KTKA 1R6TA 1PO7A 3EHDA 1RYHA 3I92A 3KEMA 1ONBA 4M83A 1GDHA 2H6EA 3NG1A 5FBWB 1J9ZA 1HY3A 2Y6VA 3A26A 1II9A 4J2HA 4B3CA 1NPDA 4R1LA 4ASUD 4C21A 3KYCB 5SY6A 3RTAA 1I7SB 1ND5A 2FKAA 1PK8A 1GU0A 1SG9A 4PAQA 4W7IA 2DCUA 2GI4A 4MYRA 2G9NA 3TO5A 4QJIA 3ZQUA 3F78A 4Q4AA 3W04A 5JRZA 4I4TA 1BJRE 1L8QA 3U6KA 2QX6A 3D6HA 1KQOA 4MRMB 4NQZA 3CLSC 3PGXA 4JQZA 1YMQA 5LYJB 3GJ0A 4KRFA 3BBLA 2QORA 1SA0A 3AHHA 1KC3A 5HKKD 1QGYA 3FLAA 5FDFA 5LQAA 3ZE9A 4DJFC 3PF8A 4Z5XA 4FB4A 3NUZA 3JWEA 3UG7A 4YT4A 2E4XA 5JO0A 3RK1A 2JIOA 1QM5A 3GPIA 5LU9A 5B3AA 5E3JA 5SYMA 1G8FA 3CLUC 4KQ1A 1X8JA 2OHIA 2D06A 4OHRA 1RW4A 2WJWA 2WHPA 3AZPA 1XZPA 3BHIA 3FYUB 3PXCX 4FYHA 3T1QA 3X43A 2B8EA 1W9HA 3GDHA 5JALA 1YRAA 3EA4A 3L1IA 4Q3CA 2CT8A 2FZGA 2G0NA 4O4JF 3B3QA 4HLQB 1OXBB 4RS3A 5ED4A 4BZWA 4FLFA 1LSJA 5BSKA 2VUSA 2EX4A 1H2BA 2ZJ3A 3HN7A 1LRJA 1F5NA 2YDXA 2I99A 4W1QA 3M4XA 3MHPA 3EH2A 3RIEA 1PEKE 1RXEA 1ZUHA 2VAVA 2IX9A 3JWJA 1QE5A 1Q3HA 2ARKA 2BI8A 2FPMA 1W5FA 3LCVB 3OZTA 4P31A 4A2PA 2RG7A 1H8HD 3L18A 3HB7A 4HGRA 3H4IA 4J91A 2XPCA 3HLYA 4UU1A 4YECA 5HF6A 4UQLA 1YVPA 3WHKA 1KTVA 2D1SA 1QZ3A 1PT7A 2IYSA 3H1PA 5EWMA 4Z1OA 1GGVA 3EFBA 4DNPA 1FFWA 2VHQA 3WLTA 4BNVA 3HYTA 1FY2A 1HFWA 1C7EA 4R84A 3U7QB 1J97A 2CXQA 2OYSA 2W2NA 3D3WA 2EKDA 3IBTA 3KAQA 1XF1A 4NBSA 2HDOA 2P4SA 1OKKD 2QLBA 2R8OA 2XRMA 4FYKA 2MSEB 4ZDJA 2DERA 4D3SA 3EGEA 2QVYX 2HR1A 1GZ5A 1EFVB 4F9TA 3ZCSA 1TUEA 3W5HA 2AD1A 3B1XA 3EXG1 1JB9A 1GPBA 2X4LA 4TKUB 1NM5C 3UPDA 5D1HA 2ZSJA 3MHTA 1XAIA 2YZGA 3E53A 3FJYA 2CV2A 4ACBA 2X0NA 5I8ZA 3RS8A 5HVNA 1ZEJA 5JRDS 3SU8A 5JZOA 3P0FA 1IVSA 1GWNA 4YP5A 1SR8A 1HDRA 4TV9B 4RZQA 1JHQA 1H65A 4OQLA 5F4BA 3RK0A 4DG5A 4ML3A 1S2OA 2JFFA 2NZ2A 3WIUA 1QRSA 4BFYA 2JGAA 1DKPA 5U4QA 4TLMB 4FDAA 3BHMA 4FFBB 4JHXA 2BFNA 3MS4A 4H3KB 5FEUA 1MU0A 2IXGA 3UMGA 1I01A 1R8JA 3DZIA 1FNNA 3EGXA 5BNFA 3BJMA 3SMVA 3WBKA 1NAHA 3DF7A 2CC2A 1F8FA 4Y2TA 2M6RA 1SD5A 4PZEA 4BBAA 1TA9A 1Z06A 2Q9CA 4FIZA 5PGMA 4QSMA 3U26A 5HKBA 1AMNA 3URKA 5GJBA 3ISVA 1XTTA 3IO5A 1JDNA 1SPBS 4KQ6A 3TRHA 1BMTA 1GT91 3P2JA 1UKAA 5K3CA 3CJQA 4IFEA 2B0CA 2PEYA 4JDUA 4A0FA 2B21A 3O4IA 1ZBQA 1M34E 2O07A 4F5EA 5L3ZA 421PA 3Q1LA 1MJ5A 2PH7A 3NI2A 2VUUA 4PSCA 4AG5A 2C61A 2HJHA 1Z7YA 1Z2NX 2C82A 1BKSB 2VCHA 1GRRA 2QX7A 4TL6A 4CXMA 2D7CA 5LQSA 1A95A 4KMOA 2V6JA 5FWXA 1F1BA 2ZVDA 4PCUA 1QQTA 1ZIOA 1MNAA 3Q11A 4ENVA 1PNTA 2HDWA 4Q4HB 5GV7A 2COKA 5H9VA 4UOZA 3WAGA 2YVL<