1K6EA

Complex of hydrolytic haloalkane dehalogenase linb from sphingomonas paucimobilis ut26 with 1,2-propanediol (product of dehalogenation of 1,2-dibromopropane) at 1.85a
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
295
structure length
295
Chain Sequence
b'SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HALOALKANE DEHALOGENASE
publication title Haloalkane dehalogenase LinB from Sphingomonas paucimobilis UT26: X-ray crystallographic studies of dehalogenation of brominated substrates.
pubmed doi rcsb
source organism Sphingomonas paucimobilis
molecule tags Hydrolase
total genus 108
structure length 295
sequence length 295
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2001-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1k6eA00
2XLCA 4EY8A 3UUEA 3ZV7A 4FBLA 3D2CA 2PM8A 3BIXA 1IUNA 1HQDA 5KWIA 1Y37A 4Q3OA 1ZJ5A 4HZGA 2WIDA 5HFAA 4Y2VA 4MEAA 3M83A 2PVSA 2H7YA 5AO9A 2ZYRA 4MWSA 1UK8A 5HQ3A 3VVLA 4HXFB 5AI8A 2ZYHA 4DNQA 2RGUA 3C5WP 2XUQA 1MT3A 5LYYA 4BDTA 2HADA 3WWOA 2OGTA 3A70A 2G4LA 3BE8A 3WK5A 4LIPD 3G8YA 1JMYA 1K4YA 2VJAA 4FBMA 4B0OA 2G5TA 2PU5A 1K8QA 5DNWA 3HLKA 1XRLA 1C7JA 4LXIA 1ZOIA 5K5EA 4CG2A 5AKEA 2QJRA 4B6GA 4C4ZA 4UHDA 4BATA 3ILSA 5JYCA 5AKLA 2K2QB 4FLMA 1S8OA 4YK7A 1EHYA 1SOMA 5AJHA 5DJ5A 1C7IA 2XUFA 2VQ6A 4DNPA 1LPMA 1QLWA 1N1MA 2RONA 2XMDA 4QDOA 3H17A 4DNFA 3WK7A 1TQHA 1L7AA 1E8MA 5BWBA 1QIEA 5AK4A 1CUJA 2FJPA 4HXGA 4X91A 2HA7A 4C6HA 1CUBA 4AQDA 2VT7A 1QONA 4AN1A 3WJ2A 2OCGA 4BP8A 1LPNA 1BRTA 4DSAA 1GT6A 5AM5A 5ISMA 1QFSA 3WK9A 1EXWA 5JASA 2E3JA 2O2HA 5IVIA 3VISA 2WTNA 5LP1A 5AICA 2RAUA 3H2JA 4UHFA 4INZA 3DQZA 1YB7A 3ZLUA 2PKYX 2QS9A 4FLEA 3WKEA 4LHEA 4QLAA 4ETWA 1FFBA 1EDDA 5EHXA 3BJMA 4N5HX 4Y2XA 5J3JA 3B3QA 5AP9A 2OGZA 4W1PA 2VEOA 3JWEA 4GHWA 5FXMA 1XZEA 5K3EA 3DLTA 4KE7A 3DDUA 3C6YA 3QMVA 4FLFA 4I3FA 3F98A 5H3HA 3W9UA 5HCUA 3HJUA 2Q0XA 4OD0A 1ZICA 3EBLA 5CURA 5EHQA 2ACEA 1GKLA 5C8XA 3FCXA 4X6YA 3G0CA 3QM1A 4DTCA 1XZGA 4NS4A 2ACKA 4YASA 4D9JA 1EI9A 4Y2YA 1J07A 1UOPA 5A7HA 5I9IA 2WSLA 3WWCA 1TK3A 1E5TA 2QT9A 1YA4A 1AKNA 5AM4A 1QOZA 4DNOA 3PICA 4DSZA 3A6ZA 3D59A 3F8SA 4OPMA 3WZLA 2DSNA 3C43A 5BOVA 4BYMA 4UBIA 1YCDA 2AJ8A 3NOXA 1YA8A 4W9RA 4BVKA 3WK6A 5KREA 4NMWA 2RIPA 1XZDA 1HDEA 2WHQA 3I6YA 3OTQA 3H1BA 3FOBA 2CZQA 1H2ZA 3FYTA 3TEJA 4BZZA 5ALGA 3H2GA 5K3CA 5BWCA 5K3AA 4IH1A 4WJLA 2Y6VA 3H19A 5CT9A 2Y2UA 5ALZA 3K9BA 2VAVA 4ITVA 2HRRA 2XMRA 1CUDA 4UBLA 1WHSA 2DHDA 5JAPA 1WPXA 3H0CA 1QZ3A 1U8EA 1NU6A 5AM1A 3FVTA 4HTAA 3P2MA 4ARBA 3R0VA 2O2IA 3B5EA 4MXDA 4AZ0A 2CMFA 3HI4A 2AJCA 5ALRA 3L1IA 2IIVA 4GDMA 4X6XA 3DOHA 4K6KA 5EHNA 3HC7A 3AJAA 2XMCA 1QIIA 1CEXA 4QWWA 1KU6A 3O4IA 1TAHA 1CRLA 1TKRA 3TRDA 5HKAA 1ODTC 5DNVA 3B12A 5CW2A 1VZ3A 3QITA 1ZGBA 3QPDA 5AOAA 5EIEA 2X76A 2HFKA 4MWTA 3FLBA 4UFOA 3WL5A 4JYMA 3AZPA 3I1IA 4W1SA 5ALIA 4X97A 4BAZA 3FSGD 1ISPA 5ALQA 5IH7A 4B7ZA 4GBGA 3O9MA 4H77A 5LLSA 2GZRA 1HLGA 4B0PA 2XUOA 3D2BA 3RM3A 5FV4A 1DT5A 6YASA 4QLOA 2P8SA 1ZJ4A 1WB4A 4GEGA 2XUGA 2PU7A 1R1DA 5DTJA 5SYMA 1CQWA 3UMJA 3I2IA 1XKLA 3A2NA 3D7RA 3H1AA 1ORVA 5LZ7A 2GBGA 3VVMA 5JAOA 3IB3A 5I7UA 4H0CA 2BFNA 1YS1X 2Y1KA 5K3FB 2Z3WA 1D07A 1G5FA 2JGIA 4J0JA 1RYYA 2XT0A 3AINA 3VJMA 4V2IA 3WZMA 4S0XA 4XVCA 4ROTA 3QVMA 2RHWA 3BJRA 1DX4A 2QKYA 3CCCA 4NZZA 4KAAA 1CFJA 3FLAA 1CUZA 2VSQA 3KWFA 2HL6A 2OXEA 2WUFA 4CFSA 2FJ0A 1LPSA 2HU8A 3ESBA 3G9XA 5LZ9A 4QDUA 1VXRA 4EY6A 1YAHA 5AKXA 2W6CX 2BUBA 2WJ6A 4RNCA 2BGNA 1XZAA 2JEZA 1R4ZA 2ZJFA 1CUFA 3T52A 2PSJA 3M81A 4PSCA 2C5GA 4PSDA 5YASA 3PF9A 4WCVA 3OPMA 1XRPA 3D3NA 2I3ZA 1U4NA 3W04A 5AIBA 1CQZA 4J0GA 4A16A 2WHPA 2XQJA 2WKWA 3DYIA 4JYPA 1FFAA 4Q34A 4ZRDA 3FYUB 2R11A 1R9NA 4FFVA 4C89A 2IITA 1SFRA 2CEKA 2ES4A 4MJ3A 4AB1A 5K3BA 2QR5A 3D4LA 4E11A 4TVKA 1Y7HA 3E4DA 4KACA 2WQZA 4EUSA 5AKYA 1YSCA 3YASA 1W6RA 4U2DA 1AC5A 3DOIA 4ZXFA 5AHXA 3TJMA 3VJKA 2V9ZA 2XUPA 1ZI6A 1EA5A 1AGYA 3FLEA 1EK2A 5ALLA 2WM2A 1A8UA 4H7FA 1BN6A 3SWWA 2OPHA 1XQYA 3KOOA 2WFMA 3PDCA 4X93A 2OCIA 2VTVA 4LXGA 1B6GA 4UHEA 2ECFA 2JEYA 4GI1A 2XMZA 2XUAA 3I28A 1X2BA 4B82A 1XZKA 2WG2A 3DCNA 3PUIA 4AO8A 3FAKA 2OLEA 2OCKA 3AIMA 3WKAA 2WJ4A 4QNNA 1J2EA 1TRHA 3QPCA 4B9EA 1EVQA 2XMGA 2PSHA 2BKLA 2OAGA 5E2IA 5CH5A 1DT3A 5LZ5A 3D2AA 3I2JA 4B84A 3I1YA 1DX6A 3WK4A 4I19A 2ZSHA 1OCEA 5T4FA 3SC2A 2VA9A 5F4ZA 1F8UA 1DWQA 1MO2A 1JU3A 5EIAA 3KSRA 1QGED 3I6MA 3G0GA 2HA5A 1JT2A 5EI5A 3I2GA 1P0QA 3LS2A 1UOQA 3HACA 3STUA 3DYVA 2HFJA 3IIIA 2ZJ6A 5ALUA 3A2LA 5LZ2A 1THGA 4CIAA 3HXKA 5JIBA 3FBWA 1LPAB 2D5LA 3ESCA 4U2CA 4BE9A 5T4EA 2HIHA 4Y2JA 4BCCA 3ED1A 4W1QA 2AJLI 4DMFA 1MAAA 4IQ4A 2WG1A 5DYWA 4C4XA 2WJ3A 5LZ4A 2WIJA 1SCQA 2XLBA 4UHCA 4FKBA 4M0EA 3ICVA 1CUHA 2C0QA 4N5IX 5D3KA 4RGYA 5ALOA 2CKMA 1CUIA 1CPYA 1F6WA 3O95A 3WLAA 2XDWA 3WL7A 3O4HA 3WL8A 3N2ZB 4IHAA 2J4CA 2BCEA 4U2GA 5CT6A 4JEIA 1LLFA 2AJDA 3MVEA 3DNMA 4Y2QA 1XROA 4J7AA 3LCRA 4C88A 4UHBA 5AOCA 1KU0A 3KXPA 5ALXA 5E4JA 4L3WA 1T4MA 3LIIA 4TGLA 1MN6A 2VATA 1A8QA 3WIBA 1JJFA 3AZQA 1BCRA 3HSSA 1CR6A 1QJ4A 3OURA 4KAJA 5CXXA 2X5XA 4BE4A 2PBLA 3C45A 3DS8A 2WIFA 1XLVA 2QUBA 3LLCA 2QJWA 3G9UA 5ALEA 1B41A 3BWXA 5HF8A 4BAUA 2BUAA 1XZHA 5CXUA 1HL7A 3STXA 4BVJA 1MNAA 2WILA 5JARA 3QMWA 3ZI7A 2IX9A 1P0MA 3L1HA 1QE3A 1XQVA 4HRYA 2RHTA 4H7JA 4MEBA 3FNBA 4TPKA 3JW8A 1W1IA 5FDFA 3W9BA 4Y2UA 4CCYB 2G63A 4EZIA 5C81A 4AMZA 4QDTA 4GLBA 4CG1A 3KWJA 3W06A 2YXPX 1YS2X 2QXTA 3V9AA 2YH2A 3UUFA 1XFDA 2HU7A 1W4LA 1UK7A 5K3FA 4FOLA 4K6HA 3R3WA 1JJBA 4BDSA 5HFNA 3T4UA 4B81A 5FRDA 4K5QA 4BAGA 4OU4A 1P0PA 1OILA 1UZAA 4BB0A 3AUKA 1N5RA 4AMYA 2WFLB 1QO9A 4EHBA 5AKGA 1ZD5A 2FX5A 4Q05A 4WFKA 4BCDA 3GFFA 1DQZA 1AZWA 4H7DA 5ALJA 4M0FA 5HK8A 1LZLA 2LIPA 4PW0A 2DQZA 2EEPA 2YASA 4EBBA 1GPLA 1E3QA 4DLNA 3U0VA 3BXPA 1YAJA 2WUDA 1UKCA 3NUZA 4OYYA 1HPLA 5A71A 4JUIA 2PSFA 2HA2A 3G9TA 3WJ1A 4BRSA 4F0JA 4CG3A 4EY4A 5AM0A 5I8PA 5JAHA 2WUEA 1R9MA 4FHZA 5SYNA 4F21A 2HA3A 3HZOA 4BTLA 2GYVA 2XQGA 5HQ3B 4G4JA 1EH5A 5ALTA 5FLKA 1BCSA 4J3JA 3LP5A 3C70A 3V1MA 4AXBA 3V48A 3EF3A 2J3QA 5ALDA 2WTMA 3I6ZA 3O9VA 4KE8A 1FFDA 1W75A 4DMHA 5LIPA 3OG9A 3GROA 1XLUA 5A62A 2JF0A 4H7IA 4UHHA 5FOQA 2Y6UA 4B83A 4OUKX 4FMPA 3C6BA 2HM7A 4P92A 3I2FA 5ALFA 3N0TA 1RP1A 2GBCA 3IA2A 5E4YA 2I03A 3A2MA 2QUAA 4ZREA 5HZGA 5ALVA 3C6ZA 4BRZA 4RE5A 1BROA 4C4YA 3JYHA 1JI3A 2I78A 4H35A 3ZPXA 1Q83A 1XRRA 2WG0A 4OB7A 3WA6A 2OG1A 3G7NA 3AZOA 4FNMA 2C58A 1UFOA 3H2HA 4H7EA 1DWOA 3EQ8A 5JADA 4XWGA 1IZ8A 3WWDA 1FSSA 4U2EA 4QA9A 2XUDA 1ZGCA 1U2EA 3SX4A 4X7BA 4FFWA 2WU3A 4UBJA 1CUXA 4OB8A 1BU8A 3HABA 1R3DA 1HKHA 5IVHA 4AX4A 3R3VA 1AMNA 4B85A 4OU5A 4KYVA 4OCZA 3ZLTA 5HF9A 3E1GA 1JKMA 4BZWA 1BN7A 3K2IA 3QPAA 4QZVA 3WMRA 1OXMA 2DFPA 4HAIA 4KEAA 5AI6A 2OCLA 4LKOA 2QZPA 4G8DA 4UFNA 3RK4A 5ALSA 3KD2A 3I2KA 1MNQA 1K6EA 1L7RA 5AOBA 3C8DA 3VJLA 3PUHA 3PFCA 1O6GA 5AI9A 2Z5GA 2CBGA 2GBIA 2XMQA 2XMSA 1VKHA 2XMBA 4P9NA 3S8YA 4KR0A 4UBNA 1IMJA 4X85A 2HA4A 1YB6A 1E8DA 2Z3ZA 5A7GA 3I2HA 1LBTA 3STWA 1TCAA 2XQKA 4BC0A 4DMKA 2PPLA 4GECA 3ESDA 2H1IA 2JBWA 1K5PA 2XB6A 4OSEA 3U1TA 2BUCA 3O4JA 1XZBA 2QRUA 3IVMA 4HVTA 2H7CA 1QIMA 5ALHA 1LPBB 2XUHA 1RWQA 1QIFA 4CCWA 1QTIA 2VF2A 3FSGA 2B20A 2BJHA 3V1KA 3WKCA 3MUOA 2C7BA 1EDEA 1FFCA 1ZIXA 3G0IA 1NU8A 3OC0A 1VZ2A 2YYSA 5DLPA 5JD6A 2CB9A 1SCIA 2PUHA 1LPOA 3WKBA 1UKBA 2V97A 4Q1VA 1MX1A 1XZLA 4J0KA 3H04A 3HYSA 4UFPA 5D7BA 7YASA 4OYLA 2V96A 1M33A 2DCMA 2B61A 2X8BA 4BBZA 2JGMA 5KBYA 1T2NA 1UWCA 5EFZA 5ALPA 4X3CA 4N8DA 1LZKA 2QXUA 4QE3A 3IDAA 1MU0A 3MGAA 5A6VA 4J0DA 5ALKA 1AX9A 1DTEA 4CCYA 2V98A 5T4HA 3WYDA 1ZD3A 1EB9A 5D3ZA 5ALNA 5T4BA 3PF8A 2PSDA 5AKZA 4DIUA 5FKJA 3R3ZA 5DWDA 1JJIA 1VE6A 1QIGA 5ALMA 1MAHA 5DYTA 4EY7A 5JAUA 4U2FA 1Q84A 3WWPA 1MJ5A 4YX9A 1CUAA 5ALYA 2BGRA 2OQIA 3R40A 5HF6A 4XJVA 4C01A 1EVEA 3EQ9A 4Z49A 1J1IA 2HRQA 4HRXA 5AIAA 1XZCA 2NW6A 5KWJA 4YPVA 3O0DA 3KDAA 1EB8A 2WUGA 1CIJA 2H9YA 5CT4A 4QDZA 2H7XA 5FPPA 4FWBA 5IKXA 1G42A 4KRYA 3CCBA 4MYSA 2HA0A 2B9VA 4G1FA 1QIKA 1UT6A 4H7KA 4EB0A 4GXNA 1HBJA 1VLQA 4HXEB 3E3AA 4IO0A 4PQEA 1DQYA 4ZV9A 2BAGA 4E14A 3ZWQA 1IVYA 2GYWA 4UUQA 1U65A 3HRHA 5LKRA 1CUVA 3ANSA 1CUEA 3Q8WA 4MYDA 4KRXA 1ODSA 3DD5A 1XZMA 5HK9A 3FCYA 3QYJA 1PJAA 3BL8A 5DTIA 1P0IA 3H2IA 2WIKA 1E8NA 2OAEA 1W76A 3DKRA 4BC1A 3CN9A 4Y2TA 1QIDA 1C4XA 2B4KA 3WK8A 2HHAA 4PO3X 4N8SA 1K63A 5AKKA 1F0PA 4CI9A 5FUMA 1EX9A 3GBSA 3IUMA 2XQFA 1MX5A 1XZJA 2W22A 4ZGBA 4P93A 1TIBA 1Q0ZA 4ARAA 1QTRA 2VJBA 3PE6A 2QMQA 1CUSA 1DU4A 4G5XA 4J03A 4ZWNA 3ESAA 4BTVA 1UK9A 3BIWA 4H7HA 2XUKA 4WFJA 3L1JA 3RARA 2PUJA 4WY5A 2XUJA 2WHPB 1JU4A 1SC9A 5A7FA 1ZIYA 5JZSA 5A2GA 4DMCA 1CUYA 2XE4A 1XRNA 3PI6A 5JZ9A 2QVBA 5CBKA 1TCBA 3WYNA 4UBOA 1PFQA 1DWPA 1WB6A 3V1NA 4C87A 1ACLA 4ZI5A 1MX9A 4WDRA 5K3DA 2ZYIA 4X95A 3Q0TA 4IH4A 4JH0A 1VXOA 3O4GA 3AFIA 1GZ7A 3ANTA 1CVLA 4WFIA 1MPXA 1Q0RA 4KAFA 1H23A 1UOOA 3NWOA 3IULA 4Y2RA 2QM0A 2VT6A 1CUWA 3NGMA 5AI0A 4G4IA 5EIHA 3G0BA 1G4HA 4X90A 3WA7A 2DQYA 4AN0A 5LKAA 3F9CA 4PNZA 4RPCA 4L9AA 2PL5A 1BEZA 1XZIA 4U2BA 1H22A 5AK6A 1EINA 2HDWA 3GELA 4G4GA 1J06A 1XZFA 1MTZA 3FVRA 3AIOA 3BDVA 1ODCA 2XQIA 2VAXA 3M3DA 1VA5A 1WHTA 3FYUC 5CRIA 4AZ3A 5JATA 4GW3A 2J4FA 3R3XA 4L72A 4DM7A 1UXOA 1EDBA 3LIPA 4UBMA 4X92A 3W2TA 1NX9A 4AO7A 2JGEA 2JGKA 1VA4A 4KJXA 3AIKA 1QIJA 4PF1A 4Q3KA 2ORYA 4Y2PA 5AI5A 4W1RA 5D6OA 2RI6A 3WQHA 3EQ7A 4PV7A 5AKHA 2WU4A 1ZD2P 3VKFA 5CMLA 3IBTA 2ZVDA 3STVA 5CTAA 3G0DA 1BE0A 1UKAA 2EDAA 1FFEA 5C8ZA 4FNGA 3IURA 3DKKA 3RKSA 1AURA 4QWMA 1ETHA 4XX1A 3DL7A 2D0DA 4F5ZA 3G9ZA 3CN7A 4FTWA 3C5VA 1JFRA 3FYUA 3C8HA 2AJBA 1LPPA 3VXKA 4X6UA 4UBKA 5AI4A 1GQSA 4MQLA 1ZD4A 3OM8A 1GQRA 4H18A 1XRMA 3GUUA 4X94A 2C0PA 4PSUA 4A23A 3H2KA 1AUOA 1EK1A 2C5FA 1N5MA 4X71A 4WDQA 3PFBA 3F67A 3TGLA 5ESRA 2HU5A 2ZJ7A 3D0KA 2QOEA 5CT8A 1E66A 2PSEA 2WFZA 1WPRA 1XKTA 3H18A 2ROQA 1ACJA 4KE9A 3V1LA 5FP0A 2XI4A 1ZI8A 4P08A 3R41A 1CUUA 2JGJA 3F96A 2J3DA 1GKKA 1E89A 1BS9A 2C4HA 4J0IA 2Z8XA 3CXUA 1G66A 2O7VA 2GYUA 4K2AA 2XUIA 4B80A 2GBFA 1YASA 5DYYA 5JALA 4DYHA 5AH0A 2VJCA 3M82A 2JIDA 1R50A 1A7UA 4W63A 2ZYSA 5JZBA 3QH4A 2JGLA 4GWLA 3E0XA 2OQVA 3DEAA 3WWEA 5CH3A 1LNSA 3F97A 2CJPA 3WIOA 5C8VA 4G8BA 4BP9A 5FPQA 3IUJA 3WI7A 2Z8ZA 4N8EA 1CUCA 1WOMA 5AK3A 5C7YA 5JD5A 5JD4A 4M0MA 3VDXA 5CH8A 4J0HA 3EIOA 3D5EA 1USWA 2WIGA 2ONCA 3QMMA 1Z68A 3SK0A 1THTA 2WLSA 3MUNA 4MQMA 1O6FA 5AM3A 2WHRA 4EA6A 4E46A 5EHZA 1QO7A 5LZ8A 3DJYA 1Y7IA 4FDMA 1ORWA 4Q3LA 2DR0A 2EDCA 4B9AA 3X3HA 2AXEA 5AM2A 3OOSA 3QZUA 1VE7A 2HA6A 2JGFA 4NVRA 2Y2VA 3GA7A 4QDXA 5E4TA 4EY5A 1F0NA 3IUNA 2ZSIA 2UZ0A 4IH9A 1N8SA 1PV1A 2G5PA 1JMKC 1AQLA 4WY8A 3C6XA 2QTBA 4I4CA 5DNUA 1BEEA 4G8CA 3ZLVA 5AKJA 5IVDA 3BDIA 3R3YA 4JNCA 2DHEA 1X2EA 1DINA 3FWHA 4Q82A 4UPDA 4XIIA 3R3UA 1TCCA 1YR2A 2VJDA 2I3DA 4HS9A 1LGYA 3RLIA 1GXSA 5HF5A 1SCKA 3BF8A 1A88A 3K6KA 4QEKA 3WKDA 4G9EA 1VOTA 4OB6A 3WL6A 4BVLA 1WM1A 4LXHA 3S2ZA 3GZJA 1A8SA 4Y9SA 5JANA 4G9GA 1CV2A 2OGSA 1QIHA 5ALWA 2R8BA 1W52X 5BV7A 1IZ7A 1QFMA 4J0CA 1KEZA 4RE6A 4L0CA 5HKBA 5AKIA 1H2XA 1IUOA 4X00A 4BCBA 2PX6A 3STYA 4A5SA 4K6GA 2FUKA 1R88A 1WCYA 4LYDA 2CUTA 4Y7DA 5EGNA 4CIBA 1LBSA 1ZI9A 4F60A 1X70A 4AO6A 1L7QA 2O7RA 4ZV7A 1UK6A 1XQWA 1XQXA 1GPKA 3W05A 1VJ5A 4E15A 5IVKA 4O08A 1XLWA 4LYEA 3HEAA 1FJ2A 3QBJA 3STTA 2O2GA 3AILA 1IUPA 2DHCA 2WFLA 1H2YA 1CUGA 4DGQA 1GPNA 3IUQA 1H2WA 3C87A 2GZSA 3BF7A 1I6WA 4Y2SA 3DL4A 1CLEA 3G02A 3ICWA 4KE6A 5AK5A 5CT5A 1WB5A 1GGVA 1XRQA
chains in the Genus database with same CATH superfamily
4WBNF 4JC0A 4EY8A 1T3HA 2J7KA 3EXFA 4JLOA 3UUEA 4BKPA 3GBPA 2HH9A 2EX4A 4RFVA 4RNDB 1FLNA 1OU4A 2I2WA 4RHUA 1W88B 3HJBA 1DG9A 1HEYA 1ZUNB 3OCVA 2PRIA 4V0NA 2GF9A 2W37A 3LDFA 3USZA 2ZR8A 4ARZA 1PFYA 3I5MA 4H3HB 3QJGA 2VH2A 1XVTA 1TA4A 4LY9A 4WXHA 4XD7A 4A0RA 4R69A 2C1EA 5BWMA 2I2DA 1UPFA 2OK7A 1ZBQA 2AS0A 2V5VA 3GHYA 4FUQA 4HYEA 4L78A 4TMKA 4UQPA 3T7TA 1GYQA 4BNVA 1B2LA 3WIEA 1V3QE 2WIDA 3P9XA 3H13A 4JA0A 3UFXA 1FTGA 2H5IA 3IUBA 1KAOA 3TVTA 4WZZA 1BE8A 1NXQA 1C50A 3JWIA 2PVSA 1CT9A 3KEOA 1EQUA 4IZHA 1E9FA 4J1SA 2FCRA 5KMGA 2I4TA 4KMRA 3DAOA 4G6ZA 4H4EA 4MTLA 5EG5A 3ZY5A 4AAYA 4YMUA 5AI8A 3Q0EA 2XXAB 4S3MA 1M7HA 2F1KA 3GFBA 2XUQA 4LV6A 2WM8A 2BZSA 1MT3A 3BCSA 1RJWA 4U39A 4C06A 2KM1A 4IIEA 1YOVA 1F8YA 2AOUB 4YUYA 3V42A 2C97A 3A70A 3ZKAA 2ZRIA 1D1SA 4INJA 2L17A 5JI3E 4LIPD 5I9TA 1UBRS 1MQ9A 4ZQGA 1P2TA 3WDMA 4BV9A 3B6ZA 1Q1NA 4JITA 1OA0A 4YWJA 1JMYA 3HWX1 1W36B 4INPA 3OQHA 4ED9A 2EJWA 2WRZA 4A6EA 4CL3A 3OFSA 2VKQA 3PVSA 1ITZA 4LNUB 4G97A 2ADMA 2FKNA 1C8VB 3NHZA 3C7DB 3W34A 3KS9A 3KPVA 3KO8A 4JLNA 1VPEA 1H66A 1WMFA 5CFNA 2QAGB 1VL5A 4BKMA 2CK3D 2F8TA 5BV8A 2OT3B 3ZHQA 3THYA 3A14A 4LXIA 2Q0QA 1MB4A 4AMBA 5K5EA 3WQRA 3NETA 1KSFX 4ZAYA 4CG2A 1S7CA 3ZJVA 3OTWA 5FLYA 5SICE 1U04A 2GRAA 1I4LD 1XMXA 3DBHA 3LU1A 2VF5X 5LQCA 1ZGGA 1G1AA 3VHLB 4MX8A 4X6LA 1ESEA 2QJRA 1TYBE 1E2IA 3SN6A 3ULKA 4CKCA 4P2BA 4CIVA 2DPLA 3AOEC 3IAM1 2EKZA 3KCQA 3MS7A 2B1GA 2H07A 5JYCA 4R0NA 4AIRA 2ZWAA 2P3QA 4G5QA 4KG7A 1O1YA 2NTEA 1O0CA 1FW6A 5KYGA 4DWOA 3RUPA 1FVOA 1GG2A 4O4HA 1O97D 5KAPA 1TZBA 2PS0A 1S2GA 3IV7A 1LPMA 4NJMB 1AO3A 1IWBB 2IL1A 1AZLA 2QRQA 1N2ZA 3RASA 4IS3A 1RM3A 1XAJA 3H6KA 2RONA 2WKSA 4WJZA 5DMHA 1L4YA 2XMDA 3QVGB 2H2AA 5AXCA 1Q0TA 4QDOA 1P7WA 4QU8A 4C03A 1X3SA 3H17A 3LFHA 4DNFA 2I7VA 1GNTA 7REQB 4IOJA 1Z63A 3OUTA 3HWSA 2YHUA 1TQHA 5LFAA 2HHJA 2WLTA 4BO5A 3OMWA 2V6FA 2L82A 1E8MA 1E6CA 1YE5A 2A9KA 4FB4A 5AK4A 8OHMA 4WSOA 2HEGA 3NWBA 3EVFA 4ZAVA 5TB5A 1FUIA 3W90A 2HA7A 4QUHA 4LJKA 5CIWA 1W5FA 5E6RA 1CP3A 3K2QA 1A76A 2BGJA 4J07A 4AQDA 3KIPA 4BNKA 4YREA 4HUTA 4P6VF 3KR0A 4EHDA 5BW8A 5KYUB 4HGPA 1V9CA 4FYPA 4MJLA 1Y4AE 1LPNA 3GN2A 2IS4A 1A82A 3JQRA 4F2WA 5JSYA 2OORC 3FPCA 1G20A 2AYXA 4MO9A 4DSAA 4DIBA 5AM5A 1IATA 1PL8A 1P61B 3L7BA 5KNBD 3F5FA 1DRVA 4H6PA 3PTAA 1HQKA 3GAFA 3IELA 3PCTA 4OATA 2B8TA 1KARA 1KERA 2AQ8A 3JQ7B 3I64A 2W6JA 3PWKA 3L6CA 2E3JA 2O2HA 4RADA 1DCMA 3WBKA 1K7EB 4X64B 3VBEA 3VU9B 2F8MA 3PITA 2E4YA 4U63A 4EG8A 5EVCA 3H2JA 1PL6A 3LL7A 1XKXA 3L0YA 2WVGA 1S02A 3EW9A 3AESA 1BXZA 4HVAA 1X1RA 3SZMA 4V0KA 2NXNA 4WVFA 1SVUA 4E2XA 2AUMA 4LHEA 5EXDA 2B3TA 3N58A 4L85A 2Y1EA 4GRIA 1JHOA 2NTYC 5IN4A 4F3KA 5JAZA 1PJBA 1YS4A 5EHXA 1PT9A 4LF6B 1F9AA 2QW1A 3BJMA 4N5HX 4Y2XA 2WPDA 4MVJD 1T0IA 2GCEA 2BFPA 4FE3A 2I6QA 2OGZA 1QYDA 2PN1A 1QFJA 3DMGA 3GUVA 3JWEA 4W1PA 1GP2A 1QCYA 2FPRA 2I65A 2I6XA 3DLTA 4KE7A 3DDUA 4LRQA 3QMVA 2GARA 4FLFA 4PQGA 3ZWAA 2KLHA 4MUYA 4DCUA 4RZQA 1H2FA 1DXHA 2VNAA 1SC6A 2BKAA 2ZVJA 5H3HA 2LCFA 4YY3B 1Q7BA 2OZPA 5HCUA 1T8WA 3HJTA 2XF8A 1U80A 2A58A 1G0NA 4LGYA 5G0UA 4OD0A 5TARA 5JXWA 4L22A 5LLDA 1IRIA 2PUWA 1E0SA 2DG2A 1IM8A 3MMXA 5K6RA 3Q0IA 2ACEA 1GKLA 3OESA 1XTVA 4WXYB 1BXGB 5EWLA 5C8XA 5DNAA 1AZSC 3RU3A 2ACKA 1P2BA 3KTAB 1T5BA 4WL0A 5FPHA 3TM4A 3WGZA 2DUJA 4PC7A 2ZB8A 3KKQA 4DKJA 3ZQ6A 1ULAA 3PU6A 1KFBB 3WWCA 5IK2A 2FHPA 4OYRA 4XYMA 4YJGA 3Q3GE 5FNVB 2MDTA 4NCKA 5AM4A 2W6ID 2XOXA 3JRXA 1LS6A 2ST1A 1Y3FE 5THXA 2JA2A 3WLRA 1LJUA 1BJTA 2BR5A 3J81A 2QTZA 3D02A 3GPLA 1XU7A 3USCS 3A6ZA 1JQBA 1RYBA 4DCGA 2FTKE 2ZUBA 4CLRA 2QW0X 3O73A 3D8TA 3SZLA 4E09A 3DMRA 4L5AA 5HUJA 2Z3VA 4MYHA 1JJ7A 4Y6QA 3EJWA 2RB5A 2PAAA 3PPYA 2DH5A 4UBIA 3CF4G 4FCTA 1TKCA 1YCDA 4R1UA 4QSHA 3O75A 3NUQA 5LMNB 1K89A 3NOXA 3E9CA 2FEXA 2HWKA 2XRZA 4DEXA 3I2YX 4E51A 1K7XB 4I8XA 1Z18A 4AD8A 1S3SA 4NV1A 3ZCVA 4BHTA 5KJFA 4Z1MD 2YFYA 2FV8A 4RVNA 5A4DA 2VDRB 3EEQA 4WKPA 5JCZA 5KREA 3EUWA 3R0QA 1X39A 1JF8A 1E94E 1ZVQA 4FC7A 4U8HA 1TZCA 4OFBA 4E0BA 2E5FA 4OHZA 2RE8A 2YINC 4AZWA 3WB0A 1XZDA 2YICA 5FOVA 2XYPA 1WAMA 3V6MA 2UXCB 1KZYC 1IY8A 2P9HA 1VHLA 4HZUA 4A0FA 2AMYA 4HQLA 5HRAA 4BQNA 2AE1A 4PRZA 2IP1A 1TIKA 3BE4A 5CK5A 3OTQA 2PJZA 5H1YA 2IPNA 1TAQA 1WMSA 3BXEA 4INOA 3JQBA 2EF0A 3K1ZA 2Q1UA 2RHJA 3E82A 1Y8CA 1SBQA 4U6NA 1R6UA 4BNHA 5A2QA 2MHCA 4EVSA 1G7CA 1ZQ9A 2J0VA 1WBBA 3K9BA 3RYIB 5C31A 2R87A 1RQNA 2JIZD 1E2MA 1GJRA 3EUAA 4FFBA 5FI3A 4Z0TA 4A8TA 4LDPA 4CL0A 5DTEA 4D8YA 3RH0A 5DWVA 1FFXB 1C4KA 3F3MA 3VH1A 1UXHA 1NNEA 2E9SA 5TGDA 1PJSA 2JBAB 3GFPA 3G3EA 1WPXA 4OAOA 2ZB4A 5FLEX 4LJLA 4RO0A 4Z9XA 1A8HA 5AM1A 4H1HA 1YJXA 4EB8A 3FWZA 3P32A 2QMOA 2Q6LA 3GA0A 1AGXA 2R6FA 1IC6A 3M6UA 2BFAA 3VR3A 3MJSA 4G4SO 4JB0A 5JDCA 3TW4A 4XFJA 4COOA 1J21A 1ISJA 1M8FA 3EAGA 2VF4X 3GFRA 3OIGA 4AZTA 3EGDA 3RBVA 2D7DA 3PX7A 4XR9A 2O2IA 3UJNA 4AZ0A 3R7WB 5BVHA 4IQ0A 4MHSA 3ROFA 3AVYA 1HE1C 4CEHA 1V7ZA 2EEZA 5K09A 4YQYA 4FD2A 1IK6A 5ALRA 1TQ2A 3L1IA 4JL6A 5G53C 3V33A 3M8KA 1KR5A 3QP9A 2KJQA 3E84A 2AW3A 2KMLA 3HUDA 3L3BA 3MTEA 1KI9A 1XDDA 1ZOSA 1K6JA 1Q1AA 1NUTA 1YQQA 2CSUA 3LXUX 3O1LA 5L3RA 4DJTA 1HEUA 2NO5A 4L4UA 1YJAA 3NLLA 2JHFA 2BFDB 2XMCA 1Q2XA 2QL7A 5E9JA 5EQTA 3CX7A 2B7LA 1E3DA 4ALMA 4DXAA 1CEXA 1AQNA 4PCVA 2NVOA 3QIVA 3Q85A 1Y6JA 1I7LA 4N0EA 4ZOAA 3D5QA 1G9TA 4Q1EA 4LAFA 1JHVA 1M5UA 1YL6A 4X7RA 1UZUA 3U1VA 1Z7WA 4DCMA 4ND5A 4Q5IA 3H4MA 1NY5A 4QOIA 5H3CA 5DNVA 4ZCIA 4XI9A 1J0XO 1EFCA 4IIGA 4A15A 4LBZA 5F7XA 2G40A 2XDQA 3OOJA 4PLFA 2VVTA 4JBLA 4BNDB 4S05A 3DVRX 1U6JA 4QYXA 4JR1A 4RVCA 2R44A 2VDLB 1IH8A 3T9BA 3RBXA 5I7OA 2QUIA 3NP9A 1H5QA 4M0UA 2O59A 3JZFA 3K8YA 4JLWA 4CKEA 2CUKA 4D9GA 5BSFA 5KYWA 4YT5A 4YMSA 1TU0A 1YQTA 2GXSA 2HJRA 5EIEA 3Q3EA 1PFVA 1M2JA 4CZ2A 1COWD 3LDGA 2ZIAA 2QRLA 4UFOA 1JFTA 4AI6A 2XITA 1P2FA 3I1IA 2DBZA 2Z8YA 2EBWA 3AO0B 1EGMB 3C4QA 4O2BF 3V6LA 1JDUA 1LBEA 3R1IA 4C7KA 1N9GB 4G2TA 2FPUA 3OT1A 2HMYB 2HGZA 2DPHA 4JP3A 5IBRA 3LK6A 3OT5A 1TJNA 3Q15C 2XWQA 3R23A 5F3RA 2X77A 1GZUA 1VJCA 5IH7A 5IJZA 4ZEVA 4AUKA 3JQCA 2I8LA 4OKNA 1OTXA 2WSSD 3LKBA 5JBNA 2QWXA 1JFFA 5HKOA 3UMRA 5LLSA 4A0QA 1BRMA 4E1AA 3BRCA 3BB1A 4JJ6A 1W0KD 5AJUA 2NTJA 3ZY2A 3D8UA 5IDQA 2GJ8A 3O8RA 4QLOA 5HJ7A 5CJJA 3OIUA 2PU7A 1R1DA 4V24A 5SYMA 3EF0A 2YQ4A 1P1HA 3WFIA 1Y8ZA 2AN9A 2W2MA 2RGRA 2YZKA 4IVRA 1CDDA 2PFSA 1S2OA 2CNWA 1YDGA 1XTIA 1EFPA 3WWZA 4DRYA 3F46A 4C7MA 3WGTA 2E4UA 5JTTA 2J0EA 2Q21A 2FPGA 1U2GA 2GBGA 1JR4A 3FA2A 5I7RA 2ZP1A 5EWJA 1YI1A 3IB3A 1YGYA 4L3OA 3B38A 3K92A 4H0CA 4I4TA 2FWIA 3TPCA 4DABA 2BFNA 4PLPA 4JP8A 2CBZA 4L0MA 4C0BA 5AVWA 3FDJA 5LQNA 3AUTA 4IO1A 2LR0A 2DTDA 4JC5A 3WGKA 4J0JA 5FT9A 1SXJE 4LWZA 4DV3B 5H68A 4V2IA 1Z2EA 3EDYA 2B2NA 3ZD8A 2MWMA 3IDSA 1BDIA 4JK3A 4FQ5A 2EATA 1UODA 4NFHA 4KK3A 3T3MB 5K8UA 2UV8A 2C9MA 2EFHB 2GO7A 4ROTA 1MH9A 2RHWA 2ZXEA 3MT9A 4RWEA 4QUKA 4UOZA 4C20A 1DX4A 4WVLA 1TDJA 2OQRA 4EG5A 5FWNA 3QK7A 2LGJA 4NZZA 1Y7LA 4KAAA 5KAMA 2BONA 2Q3BA 2HJGA 3FLAA 2K6GA 5FNZA 3K0HA 3LPLA 1X1QA 2O14A 4OH7A 1X1BA 3VSDA 4B4DA 2A2ZA 4QDJA 1G18A 2VSQA 1T43A 5A3SA 5JSZB 1HNNA 2HL6A 2OXEA 2WUFA 3L6EA 4K9PA 1HMYA 1I51A 1XD2A 3NXSA 2IYZA 4WZAA 4KIUA 3GT7A 2FJ0A 3ONWA 2G4CA 3K32A 1LPSA 4YGXB 4NV0A 3ESBA 3G9XA 3S8MA 5LZ9A 4RCYA 4QDUA 3UF0A 2JAOA 3UXEA 5AKXA 1QG2A 4M8NE 3ZOZA 3O21A 3SZOA 5ETJA 1PJCA 1RXWA 4JU8A 1XZAA 3W6UA 3QJYA 1V16B 3UPTA 4PYMA 2B6NA 3ZI4A 4AF6A 4ZDJA 1GSAA 3UWDA 3QLVC 5TEVA 2ZS9A 3LCVB 1MVNA 2GCPA 3FGNA 4L51A 4JUFA 4YB8A 1IZ9A 5BRJA 1FFHA 4DC9A 4V0LA 1H0SA 1HRDA 2C5SA 3ESRA 4WCVA 4B8ZA 1CJKC 3HM9A 1S96A 3BCRA 4S1NA 2W48A 1DG3A 3C15C 3DLCA 4WK4B 2OFPA 3TOXA 4EO9A 1CIPA 2AN1A 5LYJA 3BRWA 2EW1A 1V7PC 2OM2A 1I6KA 1RWXA 1WL8A 2W4IA 3C7AA 3KSDO 4GFDA 3HZRA 2C95A 4US1R 5D5HA 3O4RA 4IUYA 4MWDA 1P5ZB 1WCV1 2HLPA 1NIJA 3IQGX 1NGSA 4NBKA 3WRXA 3S8EA 2P6OA 4Q4AA 1BDJA 2XQJA 5C7OO 1E2UA 1K6XA 4N3BA 3W78A 4ZO4A 1WULS 3C3XA 3MT8A 1EBUA 5CHEA 3CNLA 3ZW8A 1RADA 2ESRA 4Q4LA 3FUWA 1H69A 4WUTA 3QXXA 1R9NA 2Q4RA 4TROA 3PLAE 1X7HA 4MQEA 4XAQA 1I2ZA 1WDTA 1Y4UA 1VIMA 4OP2A 5EIWA 2GZAA 3F9RA 1P5HA 4NCJA 4H3KB 2IBTA 5LQKA 3EXHC 1ZR4A 4RPJA 3TDNA 4AB1A 5LDHA 2JFFA 5LB4A 3BK2A 4O4LA 4WI1A 1ADCA 1J24A 1LH0A 3AP1A 3OETA 2GVZC 3BS4A 3IKTA 2P11A 1A9ZA 2JI4A 3ZR4B 3V8PA 3DFFA 2Q9BA 4IUCS 2YIJA 4P4GA 5JXIA 1C9NA 4D98A 4TVKA 5JG7A 2Q2WA 3DO6A 3VNVA 1GZVA 1H05A 1R0CA 4V0OA 3TM5A 2WQZA 4EUSA 1QV9A 1O94D 1SC4A 3VGJA 1QV7A 1AQYA 3OZFA 1V8PA 1E60A 4BVGA 3SMQA 5TRTA 1OTYA 2HJWA 1CY8A 2D54A 3HWWA 3UK6A 1RJGA 2QN6A 3MYYA 3OZTA 4XRRA 5AHXA 3UAXA 1QHXA 2Z8YM 1OX6A 2NUTA 2H8GA 3AONB 2GK7A 1XF9A 2WEKA 2XUPA 3QOFA 4FFRA 4IF6A 4KPGA 3CR3C 1EA5A 4ZV4A 4EITA 3CRZA 1VPLA 2A94A 2ZPUA 1L8OA 2ZUSA 1CY1A 3IEIA 3Q5GA 4OMDA 4QPDA 4JX9A 4G23A 3OZCA 4KIWA 3T7KA 1NR1A 5DBEX 4IIJB 2YFKA 4B2PA 1IXKA 2ZR0A 3KOOA 3AQ4A 2HQBA 2WYHA 5HJEA 3T7DA 2JD0A 2DT8A 4LXGA 4ID3A 4KO8A 1XEWY 2I54A 2Z2KA 1QGZA 2ECFA 2JEYA 1E5XA 3S2SA 1OPRA 4ESVA 3F6PA 3HZHA 3PDIA 4NYJQ 1WTAA 1XZKA 4ESEA 4RHTA 4ENWA 2VBFA 1XK7A 3FMPB 2N1MA 3DMFA 4JI6B 3DMYA 4OKIA 1YVUA 1WBJB 4AO8A 3DUFB 4K26A 4I4NA 4ZQHA 1G17A 1SU7A 5K0NA 1UBLS 5KOIA 4DMGA 1AS0A 3MLBA 4OXRA 5LQAA 3QELB 5HRCA 1K3TA 4RLHA 2H5LA 3DBRB 3OJOA 2VSOA 3QPCA 1SWWA 4B9EA 4EYSA 3K5IA 2I4OA 1V45E 2BKLA 2E4XA 4ANFA 1YFLA 3SC6A 2POCA 4PX3A 1ONOA 2CJXA 3V8MA 1PR6A 4GGMX 5CH5A 2QN7A 2XGOA 2H1FA 3KJQA 5LZ5A 5JNTA 1E7MA 3KJXA 3QUAA 3D2AA 4L15A 2AW5A 3I2JA 3SAJA 3WBJA 4I14A 3ND9A 1P7VA 2V54A 3EGXA 5EP1A 1MC5A 3F6BX 3QVJA 3JAKA 4IDCA 1T5OA 5LMZA 2A5YB 1M2GA 5J4YA 4IBOA 4IIUA 3RUIA 2YW9A 3SC2A 1U2ZA 3MJEA 3EARA 5DF1A 4GZMA 4NYJR 2ZJYA 4LY3A 5F4ZA 4KQIA 4LHXA 3VDMA 5TT0A 1KZHA 2CCKA 4L5YA 4YRSA 1F8UA 3NV9A 1WXHA 4MW6A 4MWOA 3DTNA 3HVJA 2FMFA 3ZBQA 1ZSNA 1D4FA 3I6MA 2W93A 1UKEA 2D8MA 1JT2A 3AFOA 3AHFA 4P7GA 3ILVA 2Y1GA 2JLYA 1UOQA 4HNQA 1KQGA 3STUA 4O4HF 1IJFA 1BGWA 3SBOA 1W48A 3DYVA 1SRRA 3AM3A 1NL3A 3L8HA 4ZVSA 4MZXA 5J4KA 2M98A 1WA5A 5JRDS 1NXWA 2HWWA 1JIVA 3RT9A 2ZJ6A 3V4RA 3JZAA 4BO0A 2SKEA 3ZUGA 5AW9A 3DVAB 1W4CA 4CIAA 2DFLA 2H51A 4LN1A 2GZDA 2DOKA 3HXKA 3ZDQA 5JIBA 3FBWA 1J7KA 1JLLA 3MCAA 2R1ZA 1IQRA 1GL9B 4TSFD 4ARCA 1LPAB 1HFKA 2QRNA 3KBBA 3ASYA 4ARIA 2Z95A 3A6KA 1WIWA 1TECE 4M0PA 4YV7A 4A03A 5T4EA 4EQ6A 2HIHA 1QHNA 2BEVA 3R6DA 2AJLI 4YJHB 1XD8A 2Q29A 1MAAA 4RSRA 1NVFA 5CYOA 4C43A 2Q2QA 4BFYA 4NOMA 3U13A 4C4XA 1VKZA 2WIJA 4M0EA 2R2AA 3DXZA 1CD5A 1U02A 2RAPA 2BSAA 4NATA 3RSCA 1IG3A 3FCSB 2C04A 4GYJA 1H6CA 3QKSB 5IZCA 3NAZA 1DIAA 4ER7A 2Q5QA 4C0SA 2XVYA 3PBKA 1KQFA 1HT2E 2GX6A 3RANA 1U1IA 1CUIA 1CPYA 4XIGS 4B6RA 5JNLA 5KX5A 2QVZX 1JX6A 2J0UB 2GLXA 3ZOKA 1G7TA 4YRCA 3KJEA 4G5RA 4S12A 5KYKA 4OHCA 1GYRA 4ZD6A 3UNXA 3OZGA 2HDHA 2HMUA 3CRNA 4N76A 2N75A 4N0QA 4MPTA 1QNFA 2B21A 4LJAA 5F1YA 3GPIA 1CJTC 4NNJA 3UK0A 2NPOA 4MDFA 4CUKA 2CNKA 1G8YA 2YY5A 3GDOA 4QJBA 4XDYA 3U9SA 4BVAA 1KWKA 1FFWA 1NMXA 3IB6A 3W8FA 1CP2A 1UM8A 3ZWPA 5BW4A 1WF3A 4D9BA 3UTCA 3W4JA 5EXTA 5AW6A 1XROA 1R8QA 2JHPA 4LX8A 4FEYA 4DSUA 2G77B 3WGJA 2O6LA 2A1IA 3JWHA 3LCRA 3IUPA 3MYRA 1KBOA 3BZUA 4ON9A 1TEXA 1U99A 1UWVA 4QBHA 4R1OA 2OFXA 4Y6GB 4ZJZA 3RVRA 1CNFA 1KMHA 4BNTA 3AF4A 1B42A 2WW8A 5CPFA 4ALIA 3P9SA 4UOEA 3B20A 1XVLA 2HF7A 3ZWBA 1OROA 2JJ2A 1JLMA 1HUQA 2HYDA 3MNFA 5E38A 3QSGA 3U3ZA 4D3SA 1ARZA 1MN6A 3UAWA 2ZRQA 2HCRA 4FS8A 1NE2A 2QJFA 2VATA 4LWPA 4TV9B 4BO8A 2GEVA 3B7GA 4IZOA 3M4XA 2I99A 4LRUA 1HO3A 1TJYA 2QI9F 3AZQA 2PD4A 2GN6A 2ADFA 2HK9A 2HLHA 2YHSA 5KC8A 3TOZA 3P2EA 2JFGA 4XR4A 2V4UA 2WC1A 4C2TA 4KAJA 4WK0B 4RMIA 5HPYB 3AKZA 2XTMA 4DR1B 1PQ4A 4BE4A 3M4JA 3JV7A 4CR6A 3BB4A 2HT1A 1QSGA 1XI2A 3JU3A 4XB1A 1KAMA 4K9OA 3WL4A 2WIFA 1DKQA 3QLJA 5CFRA 5F2NA 5EMKA 4NHEA 4CHTA 1DOHA 3MJTA 2VOJA 4I9HA 1W4ZA 3E5NA 1AHPA 3MT7A 2XWJI 1QK3A 3W6OA 3LH5A 2IIQA 3BWXA 3NHBA 3OJCA 3DEIA 2BH2A 4BAUA 1QO0D 1S2IA 3SBDA 1E9RA 2JRLA 2JIMA 1Z45A 5SZKB 2BCGY 1PJRA 3WLJA 1JLHA 1XVVA 1J33A 1A8PA 1KQOA 2H16A 2NVUA 4FYHA 5JARA 3L0SA 3ZI7A 1SXHA 1XPUA 4U4AA 2XDYA 2E4AA 2IX9A 2YMPA 3M6FA 4J7XA 2BFBB 2FKAA 3KZOA 4R1NA 1ENYA 5FTMA 3UW1A 4AM8A 4ZMBA 5BUCA 2QM3A 2QP9X 2L69A 1PE0A 3LBHA 1SK9A 1XJWA 5JR3A 1Y3HA 3UA3A 1LD3A 5L40A 1PK7A 3MHTA 1A4IA 5F76A 3KQVA 1VKOA 4LJ4A 2RHTA 1RZRD 2LNDA 2NPIA 2QJOA 3PX3A 1W5EA 2MJLA 4E5MA 1H65A 2Y76A 4TPKA 3JD0A 1TK2A 3TW0A 5TC4A 1NLMA 2AKAB 1ECGA 1AHHA 4UEWA 1WQ4A 1DAMA 3VSBA 2GKGA 2XX3A 5JMTA 2BBSA 4K9QA 4YLEA 3GLGE 1TAUA 3LWNA 1CE8A 4HTFB 4O3FA 5T57A 5H4HA 4EZIA 5C81A 4AMZA 4AG5A 1YQGA 3TZQA 4GM1A 1OA1A 5K8LA 5BMVB 2IHZA 1FF9A 1Y8AA 4PTLA 4AJJA 4CUZA 1E9CA 3L7YA 1RFGE 2ZREA 4GYWA 1G2IA 3KWJA 1NMQA 3W06A 3QFHA 4D99A 2YXPX 1Q95A 4ZQEA 1YI0A 2QF7A 4JY7A 3RWOA 1CS0A 4JYCA 1S4QA 2YXEA 3RFVA 5C5IA 1P0FA 4EABA 1I2BA 5KU1A 2NV2B 1PWHA 4LOLA 4MYUA 1OAKA 4S2UA 3RJ5A 1T15A 3V4OA 2ODNA 5HMLA 2HU7A 2O2DA 3LWBA 3VYRB 4WCDA 3R20A 1FVHA 5WRFA 3IKJA 2ZVQX 1RM0A 2OXFA 3ENQA 2PZ8A 1QGUA 2H9AA 2Q4TA 3K35A 3V7FA 4F5EA 2K2WA 2K7FA 3W8RA 1TVKB 1KJWA 2FOXA 1BWPA 2OSVA 4LZJA 2CK3A 3K09A 2VK8A 2MCFA 4J7UA 3LQYA 13PKA 4K5QA 5AQ1A 2J33A 4EJSB 3OOHA 2WM9B 1LSJA 4CCSA 3QFFA 4YYEA 1JQ5A 2J3IA 2NVBA 3W5IA 3AEKB 4JMPA 3IMEA 2HW8A 5JY1A 3E2IA 1X9GA 4PGGA 2VS1A 3OEYA 2DBYA 4E3WA 5JPDA 3ZDAA 4EEKA 4O02B 3S1SA 4AMYA 2A5GA 2VFAA 2A4KA 2GWRA 3OTHA 2DULA 2IY7A 1NHGA 4NJEB 5AKGA 3FTNA 3RLFA 3WTCA 1K7SN 4KGDA 4P3OA 3HNRA 4BU1A 1ORHA 3LXMA 4ZQFA 5JHGB 1FJXA 4IWNA 4BCDA 5BPFA 1E1QA 2CLMB 5B58T 1PSDA 1DQZA 1BMDA 4J29A 4UAVA 1L5LA 4IJQA 4ZYZA 4ND6A 4CF7A 2IHNA 4XTRA 1D2MA 1BKYA 3DM5A 1E4YA 1K2WA 3DEKA 4M0FA 4ROSA 5ALJA 2AOTA 4CQNA 1A5AB 2BF7A 1O0BA 4B47A 1T1JA 1ZK4A 1V3VA 3ANLA 4YP0A 2DB3A 1XEFA 4WCFA 1OC4A 2AJTA 5CDFA 1E3QA 1MHPA 3SIXA 1LW6E 2IP2A 3UWKA 4DLNA 4EATA 4OIMA 2DQSA 2WUDA 4R41A 4UEQA 4WK2B 3HDGA 4HAZA 2BSXA 4OM7A 1SUDA 3K6RA 4QBGB 4ZAZA 1FYEA 1HPLA 1YU9A 2Z09A 1SUEA 3C97A 2ACWA 3CX6A 1F38A 2BRUC 2HSEA 2G72A 2X3FA 2NG1A 4II7A 1KWGA 3N3AC 4QEDA 1FRVA 3FFXA 2PGIA 2PSFA 2VNSA 3DDZX 3M4NA 5EMHA 4Z0HO 2V6MA 5C32A 4CG3A 2Q0SA 1L7BA 2RHLA 1P19A 3TW6A 3TZ6A 1G8HA 1EVJA 1T9DA 1V9SA 1QDUA 3BORA 4KXLA 5GAJA 4WFQA 4YMIA 3RS8A 1JE0A 3H1EA 4LK2A 4DV1B 5C3UA 4PQFA 1YFZA 1YXMA 2Z9CA 5HSGA 1EWTA 5FPSA 4CDMA 3ONNA 4FHZA 2R751 4DJEC 5IKEA 4I50B 2P1DA 1MVLA 2HLDD 4OHOA 1AKRA 4ZVUA 3AB8A 3A06A 2FXVA 2X7XA 3EVDA 3ND5A 5GGXA 1L1FA 3I52A 1AMUA 3GCZA 3NHWA 2QGNA 2W2VA 5HNKA 1VHJA 1BCSA 1QQBA 5HHTA 4EFDA 3EH2A 4R8RA 4ZI3A 2BTQB 3EBPA 4W6ZA 3RIXA 5AUQA 4BMDA 4F5WA 5JU6A 4TXMA 2B1IA 3V1MA 3GGPA 4AXBA 1R9JA 2C1XA 3EF3A 4KHPB 1SN7A 1QQ6A 2IFTA 2J5BA 3I6ZA 5TQ0B 1XK6A 1OGIA 1U0GA 2OZEA 1GG5A 2F1HA 2ATXA 2PHZA 1ZOOA 2VL7A 3RODA 3URKA 5CVEA 4KI7A 1UZNA 1KBQA 3SYNA 1SXJB 4LRYA 3L46A 3OG9A 3GROA 1L2TA 4MVJA 1X0VA 1XLUA 2PKQP 5A62A 3UIEA 3KKMA 121PA 1RHUA 3CH5A 3OE7A 1WO8A 4DAEA 3FCCA 3JQDA 5IFLA 1T8RA 3HADA 2FRXA 5CDUA 3L01A 2UYQA 3OA2A 5GIOE 5FL7D 1XP5A 4CMIB 1FNDA 3F2IA 3C6BA 3I2FA 3ZNNA 4I4TF 1DQSA 2AMFA 3BSYA 3KJGA 3N0TA 4HYYA 2WF7A 4PO9A 4QT0A 3U7QB 1GR0A 3FMOB 5F12A 5JC8A 2UYYA 1ELOA 2WE8A 3EODA 5IJ0B 3S1AA 4ZN6A 2QUAA 4G0YA 4ZREA 5TF0A 5CLJA 4HK4A 3OE1A 1TTTA 1PEYA 5LQMA 2A35A 2YY7A 4M6WA 5BO5A 4JT4A 3SZUA 1QDEA 2JFPA 1HL3A 1KVRA 2BFCB 2DMRA 1NQAO 4N5DA 4D4GA 1KK2A 4C4YA 1CVRA 4HNAA 3HVKA 1G63A 3CEHA 4AG3A 4JBYA 5ERXA 4FHDA 2H1SA 1M1XB 1W5AA 1U1GA 2H3HA 2UYHA 3IEXA 1YZTA 3T9EA 3E8SA 3WA6A 4JJFA 2OG1A 2W6IA 3QWAA 4Q19A 1O9HA 4J75A 4LTMA 5CEFA 2XVAA 2VBIA 3AU9A 3G7NA 4KDFA 5EZQA 2XAAA 2AOXA 1BXRB 3O31A 3LX4A 2NYVA 1AGPA 2C7GA 1NY6A 2P9EA 3VPDA 5KJ6A 2O5EA 3HDJA 3H2HA 3GRPA 4NZYA 1U3WA 3L5KA 4OHFA 1C0LA 3OU7A 4JYBA 3LOPA 1X15A 3EQ8A 3IQXA 5DBIA 3ZHZA 2WT9A 1Q3TA 4KIGA 3BRSA 5IZ4A 1Z7BA 1IZ8A 2YIVX 4ZPJA 4YBRA 3T34A 4IDBA 2R1UA 2HRBA 4FE4A 1FSSA 4U2EA 5A4JA 1NBHA 2RBKA 2XUDA 1ZGCA 2IV7A 4Z1MA 4X7BA 2WU3A 4FJ1A 4UBJA 3V7YA 3PHLA 1PDVA 2YHIA 3ABSB 1Z0ZA 4V0MA 4XLZA 3AMVA 5EWMA 1E9VA 3RKRA 3E70C 2O05A 2VQ3A 4IXWA 1WEKA 2PUFA 3THWA 5JDIA 2W8BB 2EFYA 1VPDA 2GVDC 3EEYA 4CMKA 1OFUA 621PA 3REQA 2Q5HA 4X1IA 2NQTA 3KYDA 2XNHA 3VTFA 1Z28A 1SCUB 2CC2A 5SY9A 1IN6A 2G0TA 1BMFD 1CZKA 2KWIA 3G17A 3NX4A 3R3VA 1Z2PX 1UPBA 4YP5A 3WQQA 5LYJF 3UW3A 4OCZA 1OPXA 1JKMA 3SXJA 1FP7A 1RRMA 3K2IA 3QPAA 1AKEA 4XE5A 4BZWA 2XB2A 1KRXA 2ORED 2X22A 4YYZA 1STOA 5L6MB 4QZVA 4A82A 1Y34E 3ISVA 4QYMA 1JQDA 3WMRA 5CD9A 5C46F 1KOGA 4Y98A 1N3LA 2GBLA 4BUCA 2SKCA 1W88A 1CS4C 1P7ZA 3H5VA 4HAIA 2ILTA 4QQFA 1VE9A 2V7QD 5DM4A 2AD5A 1H1TA 2A9FA 3UYLA 3KOMA 3ZVLA 4UFNA 1F1BA 3UOGA 5M04A 1OW3B 2C5BA 2JCXA 4HDKB 4YTEA 1IY9A 3I2KA 3BE5A 2YYZA 4RJIA 3F5DA 4L7QA 2CV1A 2V0CA 2COEA 1Q0LA 2HAEA 3PC4A 4ITRC 1EWVA 3RTCA 3L0OA 5D8DA 1L7RA 2R8YA 3A6LA 3FKQA 2NYUA 1TF2A 3Q5EA 4M2LA 4XSHA 1J8QA 2W6NA 3C8DA 4N39A 3VJLA 2DWCA 2EF1A 2W42A 2G0AA 4KBFA 5IT0A 1FTWA 4O4LF 1KVUA 2X40A 4EEXA 3MMSA 4YAWA 4RK4A 3MJ4A 2JVIA 2IE0A 2H63A 2VP5A 1JSRA 3IIMA 3L7DA 4BMSA 2XXAA 1O6GA 3Q6MA 3ISJA 3A4NA 2Z5GA 1JQAA 2CXHA 3A6FA 2PX4A 2W2KB 5H4GA 5IT4A 4NCNA 1OLSB 4HNGA 4UARA 1KY4A 1VKHA 2JHCA 1M1YA 3B48A 3G5UA 4D25A 4TWJA 3RR2A 1T13A 3AVXA 3GPCA 5LBTA 4GR9A 3NANA 2OM6A 4B31A 2HA4A 2ZI4A 1O95A 2P5UA 1K98A 3N6XA 4RPIA 3NG1A 2FUG6 3OUZA 1E8DA 1VIDA 2AN3A 2Z3ZA 3CH7A 3JAWB 4PZ9A 1GQFA 4KSCA 3E22B 3ASUA 5FBWB 5KPDA 1N4DA 3N5CA 3OP4A 4LNUA 3GV0A 1HE2A 1OGYA 1WV1A 2EJBA 2JVJA 4W9NC 2NUAB 1RYMA 5HP4A 1IHYA 1EE9A 1LBTA 3TZKA 1OWOA 1RIIA 1VMKA 3WGGA 4B2LA 1Q6ZA 1YK1A 4CLEA 3PEFA 2J3HA 2XQKA 3ZWYA 2AG8A 3H5WA 2OUIA 5EP2A 4FYYA 3QYPA 4UHJA 4F2PA 2RCYA 3KOXA 3KVVA 1KVTA 4BRUA 1G3RA 5A4IS 3U31A 3C3JA 4BN4A 3RK1A 3BT7A 2XYQA 3LHSA 421PA 3FPJA 2ENUA 4KQ6A 1VCMA 5DHTA 3VU1A 1ISIA 5I8ZA 4D8TA 1B16A 3WB1A 4WIAA 1QGOA 2G9RA 2IPOA 3IVMA 3AI7A 4DUZB 3QW4B 4MVJM 3HU5A 4F6LA 4K8OA 1NDHA 4AJEA 4D42A 5ILGA 3MTQA 5ALHA 1MORA 5CITA 3IEVA 4HEA6 1OV4A 3KJHA 3HR7A 3VAAA 4RV5A 1QIFA 2G76A 2F4VB 2X9VA 2GFHA 2PCJA 2VF2A 4U7GA 1H3FA 1TE2A 3TGPA 1NPDA 1SVMA 1SKYE 3BGSA 3PJEA 1PW7A 4MGKR 3MTIA 3SE7A 2B20A 4EF6A 3L4JA 1QP0A 3OQVA 4LV5B 3QVGA 1WSBA 1MB3A 3JQ8B 3Q10A 4TTJA 1NRWA 4WT7A 2C7RA 3CE6A 2C7BA 1OZAA 2WSSA 4NK4A 5AJYA 1JIKA 7REQA 3RWMB 3GA5A 4XGIA 3FDZB 3T06B 3I34X 1URPA 1N2XA 1JLRA 3MJVA 1P5FA 2GXUA 1YA6A 1W0KA 2YYSA 4U0JA 4P33A 1JFLA 1MIHA 5CR9A 3KU1A 4ZU3A 4U00A 1QCDA 4NJOA 4B44A 3PC6A 4NAVA 1SU4A 4Y30A 3TOSA 3ZHYA 3FSJX 3RRYA 4ACAA 3G1TA 2PUDA 2PZEA 3ZYCA 1UFVA 3IR5A 1HE3A 4UAUA 3TNFA 5KYUA 1UKBA 5DLEA 4Q1VA 2BBTA 2GERA 4GOND 3SNKA 1JHZA 4BQEA 2YUIA 2ZR7A 5ELXA 1MX1A 1XZLA 4EMSA 1D1PA 4E88A 3OX4A 2QN1A 2JAHA 3H04A 2VRCA 1J9ZA 1HY3A 1UDCA 2ZT7A 3D4IA 1YE3A 3DP7A 3HYSA 3R0XA 4UFPA 4ZEMA 4YJ2B 3JQ7A 3J80A 2GLUA 3RW9A 2DJIA 4CNBA 4P31A 1KEEB 1M33A 2DCMA 3VU9A 5AW8A 3RFUA 4F04A 5KZMB 1C4WA 3AYXB 4DCOA 1PLJA 5KBYA 1B8PA 4JUDX 1UWCA 5EFZA 4BGUA 4UNSA 1BMTA 1LZKA 1RLIA 1U3DA 2NQ8A 4I66A 4QXOA 3GZ4A 3IDAA 3P94A 4HRAA 4K86A 3MWFA 2P0EA 1JG7A 1B26A 4ZO9A 5EY5B 1R8YA 4BU0A 1F5SA 3HBLA 4CTJA 4UU8A 4YNBA 2XT6A 4JBHA 4J0DA 2IU3A 1EG7A 2IIPA 4CCYA 4F38A 5I3ZA 1HDIA 1FUUA 1SIOA 2D5CA 1X7XB 5FFMA 3EZGA 3I4FA 5BN5B 1P5RA 3EG9B 5T4HA 1B6SA 4AYWA 2OFFA 4C14A 2PMEA 1UFKA 1WU8A 4Z7JA 3JQFC 4DWWA 2Q1TA 1RMYA 4XJXA 3U44B 5D3ZA 3EMKA 2RKOA 4DR5B 1N6KA 1T36B 2DWUA 4BX0A 4O2AB 5DBGA 3THOA 5KX5F 5DNEA 2PSDA 3FVVA 2IYWA 3UMVA 4EI7A 5BT9A 5DWDA 5KQRA 5IJWA 3AEUB 1FY2A 1T4BA 3IUYA 4JN6B 1OIWA 4YFYA 2BH9A 2PRZA 1QIGA 4N03A 2XNDA 2XWBF 1M0SA 1QUEA 4FEGA 4GMGA 5I9NA 2VJKA 2F43B 3TIGA 4ZQBA 3VR5D 1BXGA 1GAQA 2HZ7A 2YZNA 4FX5A 5F64A 3VPAA 4IKEA 1U7TA 4F93B 1Q84A 3KTAA 4G26A 2QM8A 2QYTA 4KX3A 2CHEA 1NJ2A 2PA0A 3PA8A 3ECAA 3PV0A 4MPPA 5EJFA 1BYIA 4YRBA 5HJ5A 2OQIA 4F8EA 5FPKA 4XJVA 1KZGB 4PC1A 1EVEA 5IP5A 3E7DA 5DLYA 4OHBA 5T5QA 2V7VA 5F5XA 1XA3A 4LSMA 4P7FA 1JA9A 4KNVA 5FNVA 4NU0A 1ETUA 1DSSG 2X6RA 1E2NA 3OJWA 5DP1A 3TZCA 5B53A 1K5HA 2C4VA 2RHBA 3QI2A 4G65A 4RFSB 3U4AA 2A9OA 1VIVA 3C48A 1AUVA 1E6MA 2RARA 2WICA 3AY0A 3RTGA 3TSCA 3ZW9A 4AYTA 4JXXA 4FWBA 5DN6D 4IJWA 4Y0VA 5I7WA 3E9RA 5BR8B 1GCAA 3RS7A 3UC5A 1QQTA 3Q12A 4JJKA 1SBTA 3Q3HA 2O1WA 5A1JA 4KRYA 1OV6A 2ZUFA 3CCBA 3QY0A 2QY6A 4KNYA 1T3LA 3C4JA 4NNOA 2HA0A 5B3KA 3QF7A 4E4RA 2YIDA 1Z4KA 1UT6A 4E5PA 4MV3A 1M67A 2ZBPA 4A26A 2XBMA 1JECA 2GPSA 3NHMA 4JB3A 4KRGA 1M2NA 3DZBA 3TL3A 4EM6A 1Z16A 3CVJA 3EE6A 4TTAA 4BVFA 4NE9A 2GM9A 4MI1A 5IMSA 3NEJA 4IO0A 3EOAI 4PQEA 4CEIB 2C3YA 4R2KA 2PG3A 1DQYA 1KK1A 4MPDA 2WV7A 3IP5A 2YR0A 4Y6RA 4ZV9A 3RB8A 4AIIA 4EENA 4CQJA 1QCCA 5B3AA 3UMYA 2EHDA 3KKNA 3R0IA 4LI3X 1YDHA 3NDBB 2GCNA 4OUDB 5LKRA 1CUVA 2ZGVA 3ANSA 3AJDA 3LBNA 3Q8WA 1U2DA 2FR8C 1SCJA 4MYDA 4D9HA 3I62A 3FNQA 3LQRA 3EXEB 4KRXA 5EJMA 1XZMA 4MA4A 2OCAA 1PT8A 4NU8X 3GLGB 3RYIA 4IKOA 1JT9A 2FI1A 4PYNA 5H7XA 2BF4A 3EQ2A 2C3UA 4X7PA 5DTIA 1BDBA 3OSZA 2ILVA 2WIKA 4AUNA 4MUBA 2OAEA 3FFBA 5ULLA 3TLEA 4LDZA 4EARA 1FFXA 4RTKA 1BGVA 4CMHA 3QF4B 1RLUA 1V5FA 3DKRA 3PHHA 4A0HA 1R5OA 2JBAA 1CWUA 3ASZA 5EMJA 2B4KA 2O4CA 4PO3X 2R96A 2OMKA 2D2FA 1ZMXA 2EFEB 1VPVA 2PZBA 3RSOA 5HM6A 3PIDA 1RI3A 4Q9JA 3ZHTA 3DAGA 2FEMA 5M2QA 4PR3A 1V8BA 4EYKA 7ADHA 5FUMA 4HSEA 5EGSA 5EVJA 5FEUA 3ZH9B 3LA8A 4FHEA 1GZ3A 1VBKA 2YWEA 3PL5A 4LBYA 4CV3A 1E2GA 3BGVA 2YZGA 4ZARA 2QPTA 3LWDA 3R7WA 5CVDA 5KI6A 2JLWA 2D1FA 2HMAA 1LLQA 3C5CA 4KXXA 3RVPA 3HY6A 1R4NA 2VJYA 4OLJA 3FMGA 4X8MA 2Q4DA 3RI3A 1TUIA 3B6EA 2MSDB 4NPCA 3IBFA 1MX5A 1XZJA 5EKUA 4C7XA 5L4NA 1G9SA 1ECLA 1SCAA 1VHDA 2HBRA 1B43A 1R10A 1E61A 2HXSA 1LS1A 1NXSA 1R8JA 1QVZA 2GHTA 2QLBA 3WDLA 4WJKB 3AEQB 1QTRA 4MARA 3P52A 1OBHA 2BFDA 2QIPA 4FOPA 5FB3A 2IU0A 2L0XA 2JLUA 4GI7A 2QMQA 1DU4A 2Z58A 2ZSKA 4G5XA 3LUDA 4LZWA 3K1AB 4J03A 2Y1FA 3CWCA 2GD0A 3MBKA 5GOZA 5TEWA 2OC4A 3QA3E 4OGGA 1X7YA 5JNUA 3BIWA 5EZ5A 4I3HA 3WTBA 3RJZA 2HI0A 2OSBA 2WVHA 1U8AA 4MA0A 1FL9A 4GOMD 3L1JA 4WFJA 3S4YA 5E2AA 5IXYA 4LF9B 1K9VF 3QWFA 1YJ8A 4K88A 4LHVA 2PQ6A 3L6RA 3NWJA 4WLEA 4BNDA 1LU9A 1RS0A 5A7FA 1ZIYA 1G6Q1 1GRRA 3UHFA 5C8DA 2AZMA 4DMCA 1NVDA 2GRUA 4MLDA 3VC1A 2C8LA 4E6EA 3SDZA 1MIOB 4FMDF 1JU9A 4UJ5A 1RTTA 3CU5A 1FSZA 3MD9A 3B2NA 1REQB 3U3DA 1PVVA 1WUKS 1H0RA 3I76A 4QYSA 4AJNA 5PNTA 3SQMA 2QVBA 1TCBA 4XSVA 4MQFB 1GUDA 1DWPA 1I01A 1WB6A 1X3LA 3GN1A 2VPWA 1N9GA 4MS3B 2N42A 3EVNA 4ZI5A 3GJ3A 1T8TA 2BY4A 3AUUA 5K3DA 1UPAA 3GRVA 3MS4A 4QQRA 3Q0TA 1AS3A 4X95A 1Q44A 4BQOA 3M1IA 4OHRA 1JKIA 1NXTA 2H4ZA 3DZFA 1X7WB 1BJRE 5ARDA 1IDN1 3AHJA 1KO1A 4C78A 3AFIA 3Q6IA 5CFPA 2GJAA 3O6VA 3UM9A 2P1ZA 3OZVA 4WFIA 1PCXA 5GTDA 2BKUA 3IP3A 4NS1A 2ZUCA 4OGWA 1YR1A 4TSFA 1H23A 1ATIA 1UOOA 1CJBA 2YN4A 3ORQA 3UHAA 4RA6A 5A0VA 1WXQA 5JFTA 2IYQA 4HLCA 4UE6A 1AXGA 1QFZA 4KMMA 5J43A 3CVXA 2QM0A 3T5GA 3LG2A 2VT6A 1NBME 4MGZR 3OY2A 1K75A 4Y6PA 2FMIA 1NF2A 1NN1A 1GILA 4B7AA 2XNCA 3H8SA 4E31A 5B7NA 4ABTA 3U56A 1TO2E 1G8GA 4RDHA 3F8WA 5TNXA 4KQ1A 3GVHA 5I01A 4YXWD 3DZDA 1PNQA 4BMXA 2FSVC 3OWHA 5LKAA 4UVHA 5FOXA 1MTOA 2ZBQA 3RU7A 3ET4A 3NJ4A 2IWHA 5E7IA 1SRQA 4PNZA 1IXZA 1E3JA 3DG9A 4L9AA 1L8AA 1RWKA 1Z2AA 4HI0E 4XASA 1OGJA 4U2BA 3QUSA 2YNMC 5DSXA 1H22A 2AN5A 2JLRA 1I2MA 1K0FA 2OHGA 2YWGA 4MH0R 5AK6A 1LC0A 5DXFA 3P0IA 3NONA 2NX2A 2VQFB 2BFFB 1M2VB 2BKXA 3GELA 3GXBA 3ZHOA 1VHWA 4LMPA 4BNLA 4UCWA 1P9NA 3B8HA 1KKMA 1GAJA 3L1VA 4GQBA 1PEAA 5DW0A 1KDVA 3ROQA 4AT1A 2YVAA 3DB2A 4ZMSA 4XWTA 2HF2A 1BU5A 1MTZA 2XYGA 4TQ9A 3OTIA 3OZAA 5KC9A 3F71A 2XQIA 3CSUA 2NYRA 2F7SA 5FWDA 1MAVA 1X38A 3MEQA 3ZHBA 1E6UA 4A8HA 3M3DA 1B7GO 2CNLA 4AYXA 1P9LA 4ZHQF 3T9CA 3HYNA 1JZSA 2YY6A 2CVQA 1JSZA 5LP6B 3A1SA 1UQRA 2XE8A 1GUBA 3AI2A 3BMXA 5CRIA 1QF7A 5DHPA 1D9XA 1LUAA 2GHQA 1SUCA 3KSMA 3IRUA 3LZDA 5LUBA 2O48X 3BYZA 3ZN2A 3RC9A 1DLIA 1HLDA 3SHWA 1Z0UA 4QGAA 3R3XA 4L72A 4DM7A 1UXOA 5JSZA 4OLAA 5EERA 3TO5A 2WWGA 1PX2A 4O63O 1OU0A 2NACA 1B6TA 1FA9A 3EEIA 3WYCA 1ISRA 3ZWDA 3A7DA 4ASUD 1ADYA 2Y77A 3V32A 2Z2IA 4PF1A 1R5JA 4UPEA 1M8PA 3AG5A 2JA1A 4AF8A 5HKKD 3MUFA 1Z37A 4W1RA 2DLNA 2GD6A 3F6SA 3CH6A 3QA9A 4JVNA 3TRHA 1I0IA 1MDBA 2WU0A 2FRDA 3QKRB 4J9VA 3NBXX 1ZJ6A 3HVHA 4JJAA 1V16A 4KUHA 1NMYA 1J5PA 1NX6A 2WHYA 3FPGA 3K1TA 4PONA 2WU4A 1E77A 1GTRA 1EP1B 4PPFA 3HB9A 4FCVA 5H83A 2W2NA 3W0LB 5HW0A 4ZI7B 1RJEA 2ZVDA 4FGJA 3STVA 3RT7A 2C4WA 1QGDA 1SZJG 3U6KA 1IN8A 1L3BA 5DEIA 3G0DA 3LZCA 5FBRB 3QE9Y 4GP7A 3ZCRA 2VNJA 3L8MA 4OO3A 3NIBA 1L4FA 1ONPA 3WMGA 4NLLA 1JHXA 2C2ZA 4MW5A 3BWEA 3DKVA 3IURA 3EVTA 1V8FA 2IEDA 3NEPX 1QFXA 4UUOA 4AROA 1GFWA 1UMCB 1A2KC 2GH1A 2ZPAA 4JLMA 3PNPA 4P81A 1QO0A 2HQ1A 1ZH2A 2I6UA 3NTOA 1AMNA 1E1NA 4XX1A 1K7FB 5IULC 4TMWA 2D0DA 4F5ZA 3CLKA 2WKPA 3TQOA 3W1EA 4BVEA 5EWLB 4KR6A 3AVQA 1G41A 1JFRA 2BZ1A 3LM8A 1U9JA 4MJXA 521PA 4CCAA 3U60B 4LMAA 3VKUA 2WSMA 2H2IA 3L4EA 3VPCA 4OY3A 2XWSA 1C3VA 5LQUA 2QTCA 1ZD4A 3OPYI 3OM8A 1GNQA 1KZ7B 1GQRA 4H18A 1UP7A 2ERXA 1BC5A 1LTHR 1D2RA 1YZKA 3LFUA 3WO1A 4ZOLB 3L8ZA 1RZRA 5DHRA 1XRMA 2YRWA 3MB8A 4Y0NA 4TUYB 3FWNA 2C0PA 4DUGD 4UXJA 2QIOA 4A23A 2PMFA 3FOFC 1PT7A 1P45A 2OZKA 4QYTA 1AUOA 2Q2OA 1BVRA 2P6UA 3NORA 4N5NA 5IH3A 1L4KA 4BFXA 6Q21A 1N5MA 1SIBE 1ZCFA 5DHAA 3P9RA 1EJ2A 3PT9A 5ERYA 4GPIB 4NDAA 3QU7A 4KSYA 2F3PA 4L5CA 4L4SA 2ZK7A 5ER9A 1V43A 1EE1A 1UADA 1UP6A 3BIOA 4M7PA 4RY8A 3TINA 4MI9A 3TRKA 2QD4A 5E2BA 3ROMA 4DA8A 3KAKA 4YUWA 1IBRA 1PQUA 2WWHA 3RIYA 5E1DA 4EW6A 1SA0B 1KTVA 3LRXA 3TG2A 4PG8A 4UVGA 2R1VB 4UVEA 3H9CA 4JLSA 1GUYA 2V5AA 2Q3HA 3FSEA 4G0UA 4BLTA 3GH1A 1CY0A 1XMVA 1QP8A 2PTHA 1QAOA 1RHKA 2X1MA 1WB9A 1LSOA 3ZV3A 3A9UA 1AF7A 3B1JA 4XQEA 4FW8A 1W2WB 4KAXA 4PZCA 4U7WA 1E32A 3CW2A 3K7EA 1ACJA 2GZ3A 4JELA 4RORA 1DXQA 2ZAYA 3I0NA 4IIJA 1E1MA 1DDIA 1MLDA 2VHEA 2ZE7A 3T3NA 3IT0A 3MWKA 1ZI8A 4E08A 2JW5A 4IGKA 4DQUA 2DFDA 4V3BA 1IIBA 2QRKA 5DIFA 1B00A 5A3QA 1YVEI 4IS2A 2F3SA 3O1HB 4F4JA 1F3OA 1NTOA 1ZDMA 1GM5A 2C5LA 3HJNA 2GKOA 3L0PA 2PY6A 2EX1A 1VMDA 4R2MA 1E89A 3A1FA 1BCRB 4FK8A 4IDQA 4K2HA 3DUFA 4BMOB 1JH9A 3KFLA 2VZLA 3H3FA 3I04A 3RROA 4FGLA 1SVKA 4DCSA 1VG1A 5DASA 4YMLA 3V2GA 3QELA 1SIUA 1GSHA 3CXUA 3DBRA 5T8KA 5D2CA 1TW3A 4HDQB 3GNSA 2Y9PB 4B80A 1CY7A 2OY0A 1CY4A 3N2KA 4K6OA 1T8UA 2KE5A 4BP1A 1IY1A 1YDMA 4TL6A 2IKSA 2AG6A 4O4JB 3O03A 3HMQA 3B6IA 5AH0A 1WCIB 2C4KA 3SBXA 2VWGA 3I1FA 2PVPA 3O7WA 3W2FA 2JIDA 1CCWA 1G8FA 1XMIA 2VXBA 4HDRB 4WNCA 5LXTB 2C07A 3O8CA 1CU1A 3CEMA 1Q21A 1F2VA 1QHFA 4EHNA 1HYEA 4CHGA 2W6PA 2ZYGA 2LDXA 3PPVA 1XBTA 2P0YA 2ZWOA 2VZ9A 3Q2KA 2EW2A 1HYQA 3KOUA 3WISA 4B45A 4DCVA 3TSYA 5CH3A 3WWEA 4I36A 1O89A 3DV9A 4DV7B 1H4VB 3WIOA 5C8VA 2A9JA 5IC4A 4DYDA 2C61A 1KO7A 1RZUA 4I55B 2RKWA 3BRQA 1GIAA 4FFPA 2X5NA 4LXXA 3IUJA 3U7IA 3Q2IA 4KQEA 5JLAA 4AQYB 1DE0A 5JJIA 4CM3A 1EFKA 1XA0A 2Z8ZA 3AJ9A 1DJLA 1WOMA 1W2GA 3GWZA 4IWYA 4QTZA 4ZYWA 4AKGA 1JQEA 3CLSD 4ZRMA 3U7RA 1A9QA 2ID9A 1YFJA 1M6WA 3TB4A 1NF8A 4FS3A 3ROXA 3UJHA 2ZTSA 3I53A 4BX2A 1RT9A 4F6RA 1LRKA 2V7GA 4UM9B 3DVAA 3IEPA 4P38A 1KPIA 1VB3A 2W2QA 4QGBA 1MQAA 4O2LA 1N0HA 2H7VA 3HRKA 4I1YA 1RI4A 4KYUA 3AT1A 2BI8A 3HCAA 1MD9A 3VDNB 2E89A 2Q6IA 2GCOB 2P6RA 2M1ZA 4L16A 3NC4A 1TU4A 1OHHD 3JWPA 1MFZA 1OWLA 1QO7A 3AEZA 2OLJA 2ZR9A 4YJHA 1SNYA 5LZ8A 4EPRA 2OD2A 1Z5ZA 4JSTA 4JC4A 1S3GA 4MWGA 3LF1A 5F1OA 2NYAA 2CZGA 2HGSA 1FYFA 4M38A 4PZPA 4NMMA 3OQIB 1WETA 3W6ZA 2KBEA 4HH3C 4NZNA 1SXPA 3BQ9A 3QKSA 3QZUA 4NFSA 5I47A 4KTTE 1UBOS 4RZUA 1IOZA 2XVMA 2ZT6A 4JROA 4QDXA 3ZC3A 4MDHA 3SHOA 2P65A 4A8JC 2YKGA 5FL7A 2JLQA 5DHSA 2R1TA 3ZY6A 4XOUA 2OGUA 3D6AA 3MM4A 1NNUA 1KIMA 3OFJA 2X8AA 2JAUA 3BEDA 3IUNA 1MKYA 2VDQB 1T5SA 4B1FA 3DLBA 2D5IA 1BW9B 3FJ1A 5DNDA 4QOSA 4M8IA 5BNZA 1XCPA 4KQMA 3NM5A 3EZFA 2ZE8A 1JMKC 3FPAA 1ZRSA 4CKWB 3M1YA 2GAFA 3LC7O 4HNSA 3FM9A 1AQLA 4LXTA 3GRCA 3MBIA 4WY8A 5C7IO 2IYSA 2NZWA 3W5VA 4G8CA 1D4AA 5DNUA 1PJ4A 2EGHA 4UREA 1OH6A 4R5HA 2X0FA 4CRWB 4XIFA 3BDIA 2PANA 5IVDA 4F46A 2P2CA 3PRHA 3BMOB 1X2EA 2XOEA 4Q82A 2LKDA 3GRAA 4XIIA 5GV7A 4DUYB 1LB1B 2IUSA 3HBAA 4LJRA 4F9FA 1TCCA 2YN2A 4KUEA 4P1ZA 4WHMA 1J8FA 1DJOA 2C9BA 2WWYA 4ZCPA 5BWLA 2I3DA 1NVVQ 4JFAA 1DOZA 2QV0A 1JDBC 4F84A 2R85A 1SVLA 4FOSA 3RTDA 4AWXA 4QHTA 4ER0A 1XWWA 4TV9A 2VPYA 2REXB 3I4LA 1NW8A 2VO1A 4BV2A 1UT5A 3BF8A 5LUAA 3TPZA 2HK6A 3K6KA 1QG0A 3DFKA 1DFIA 5JCOA 3ZK7A 3PC8A 3CO5A 3MMNA 1FXWA 1Z6GA 4FGSA 3OMXA 3KLBA 1ZNYA 3UV7A 4R3NA 4AJPA 1CQPA 3OHMA 4OB6A 3H5NA 3UB4A 2OHHA 3WL6A 1A5TA 2WSYB 1GZ5A 4JKOA 3CJTA 4BEJA 3DHEA 3D6HA 4B6OA 3SQDA 3G0HA 1ULSA 2FPSA 4MQ6A 5T6MA 2FMUA 1A8SA 4Y9SA 5JANA 1DAFA 1RRGA 1Q6YA 3B13B 3BN3A 3PHJA 3QU4A 4HDOB 5FNVF 3TCXB 2VJOA 3X2FA 2AKYA 1GGEA 4RTLA 4RD3A 2A78A 1CEQA 1DO8A 3BAZA 5AHRA 4JEUA 1U11A 1BMFA 1L9XA 3GVXA 3NC1C 3VNRA 3KQOA 4OI0A 1XAIA 1NVVR 1BQ3A 3K0AB 2PWBA 5FEMA 5BV1A 3SVTA 1IIRA 1NT2A 4ZQIA 1XMOB 4L9SA 1T6BY 4J0CA 1EM8B 1T9BA 1WMBA 4OI1A 1V4NA 2NT4A 1N2EA 3U26A 4XWWA 1BS1A 4IMPA 1EVKA 4ARUA 2YYYA 4G41A 1X13A 4CTNA 1P4SA 1CFZA 1S4MA 4RE6A 3WHLA 4EDHA 1BFKA 2DUUA 1JALA 1DI0A 2BFBA 4TWAA 3ZX4A 2QLLA 2VAWA 3K72B 1NDUA 2V7QA 3KLOA 3TQFA 5LJIA 2IYXA 1NPTO 3STYA 4RXUA 4IIVA 4I1OA 4NU6A 4D92A 4PHFA 1QHIA 5LWQA 2I7DA 2FUKA 3NFRA 5EN4A 2E82A 1VSTA 1ZK0A 2J07A 4P32A 4C4SA 1ADFA 1E96A 4HP8A 3G2MA 3NPMA 3P2YA 3CPJB 3P20A 3PXBA 4AMUA 1C7EA 4F4UA 3R9KA 2CFCA 4EHJA 2NM0A 1Z15A 2HREA 2PS3A 2WHEA 1QAQA 5J2UB 5LQDA 2YQZA 4P34A 5C18A 3OPQA 1PG2A 3L5OA 4MB0A 4ZCSA 3T15A 3DMTC 3I58A 4QRHA 1RRFA 1YZQA 4HTFA 4ND8B 1GUZA 2OV8A 1K4KA 2V74B 3T6KA 4YDQA 3ZCSA 4TMFA 2ANBA 1SZPA 4J4HA 3FYHA 1IOWA 5CEEA 4DZZA 1NFFA 1R6AA 1GFIA 1QYWA 2WF9A 4PSAA 4LCJA 3KZ1E 4QELA 2QZSA 5CA0B 1QBGA 2UVQA 2ZSJA 3OU6A 3BWDD 3B52X 1O0SA 1RC1A 1RQGA 2H54A 4HVLA 3EFOB 4ZPXA 2ZTVA 5B4TA 5B64A 1L7QA 1MO3A 2O7RA 5AK0A 1AQ6A 2BEJA 2OP0A 4NOKA 1ID8A 2Q41A 3ZGVA 1NIPA 4HB0A 5LNK1 1Z7EA 4BO1A 1Y98A 4OHVA 2ODAA 4YRPA 2QTVB 1TVKA 2X13A 4L9WA 3UANA 3K71B 4DSOA 3CLTD 1M6YA 2FEWB 3DE7X 4KGZA 2FCAA 4E15A 2D2VA 4MW0A 5L7TA 4C6RA 1ZHFA 5K0BA 2PBZA 1FCJA 1Z4IA 2V55B 3O26A 4EPWA 1ECCA 1B73A 5CFZA 1YB2A 3W7VA 4RLSA 3K8QA 3HUFA 2WQ7A 5J1TB 1G3MA 3AEKA 2C2HA 4KWHA