1K6EA

Complex of hydrolytic haloalkane dehalogenase linb from sphingomonas paucimobilis ut26 with 1,2-propanediol (product of dehalogenation of 1,2-dibromopropane) at 1.85a
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
295
structure length
295
Chain Sequence
SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Haloalkane dehalogenase LinB from Sphingomonas paucimobilis UT26: X-ray crystallographic studies of dehalogenation of brominated substrates.
pubmed doi rcsb
source organism Sphingomonas paucimobilis
molecule tags Hydrolase
molecule keywords HALOALKANE DEHALOGENASE
total genus 108
structure length 295
sequence length 295
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2001-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1k6eA00
4OU4A 4MEAA 4HXGA 3C6XA 3G9TA 3DCNA 4INZA 3D59A 5I8PA 2EDCA 3O4HA 1LZKA 1MPXA 1Y7HA 4X91A 4WY5A 2ZYRA 4UHFA 2BCEA 5JD5A 4KAFA 3LIIA 3MUOA 1MX5A 4B83A 3N0TA 2PSDA 4NMWA 4LXHA 2WM2A 4FKBA 1R9MA 1P0PA 3DYVA 4GHWA 5JZSA 1NU8A 5A7HA 3G0IA 4YX9A 1XZKA 3STVA 5BOVA 4LYDA 4OCZA 5CURA 2XUGA 3K6KA 4CFSA 1XQVA 3CCBA 2YASA 4Y9SA 1JJIA 5ALLA 2PPLA 4MYDA 3H0CA 2WU3A 5AIAA 4BYMA 4H7FA 4OPMA 5KREA 4AQDA 4AMZA 3NGMA 4HTAA 5CH3A 5FRDA 2PX6A 2WG2A 3RM3A 1YA4A 4DMFA 2Y2UA 1VA4A 3DQZA 5A7FA 2IITA 4ZV9A 3DKRA 4Y2RA 1BU8A 2HADA 2QT9A 1CUVA 5ALHA 4QLOA 3GFFA 5LZ2A 1H2YA 4FLEA 4H18A 5T4EA 4FWBA 2G63A 4HXEB 4KEAA 5EGNA 2J4FA 5AI0A 5K3FB 1J06A 2VT7A 5AK6A 2QMQA 2XMSA 3OC0A 4ZRDA 1UT6A 1MNQA 3W2TA 1N5MA 2J3DA 4N8DA 1CLEA 1XFDA 4UBKA 2Y1KA 2PSEA 1USWA 5LIPA 1FFCA 5AK4A 5HQ3A 3WMRA 3ZWQA 4B81A 3LP5A 4UBMA 5HQ3B 5CBKA 4QEKA 4U2GA 4UFPA 1VXOA 4UBNA 4FOLA 4RE6A 2WKWA 4JH0A 3HC7A 2Y6VA 3UUFA 4J0CA 5E4JA 2WILA 3WK9A 4C89A 4G9EA 4FMPA 1QJ4A 4ROTA 4DSAA 4JUIA 1YB7A 4HAIA 4Q3LA 3VXKA 3C8HA 4A23A 4XVCA 5HKBA 3U1TA 3F8SA 5JATA 1HLGA 2J4CA 3LIPA 1N8SA 3NWOA 4MJ3A 2GZRA 2NW6A 2HHAA 1MAAA 1DU4A 3ESDA 4AB1A 3I2HA 4OSEA 5CXXA 4QZVA 2RHTA 2Z8XA 5AM2A 5H3HA 1ZICA 1XKTA 5CXUA 5BWCA 5FPPA 1QLWA 1G4HA 3SK0A 4H7JA 2JEYA 2WTNA 4GXNA 2K2QB 4EZIA 4OU5A 1C4XA 2ZSHA 4QLAA 1WPRA 2Y2VA 1UK7A 2RI6A 5EHZA 3QYJA 1Y37A 3NUZA 3F9CA 4DNOA 2PBLA 1LBSA 5ALMA 5AK5A 1QFMA 1QONA 2VF2A 4BVLA 3WWEA 5DYYA 3T4UA 2QKYA 2AJDA 3WA7A 4KRXA 3AZOA 4X6YA 4UHEA 1BCSA 1A8QA 2WSLA 1LPMA 2BKLA 3KXPA 3AJAA 4WFJA 1KEZA 4LHEA 2V98A 4CCYB 4ARAA 3ESBA 4WDRA 2OCGA 3I2JA 3R3UA 2XUFA 5EIEA 1XZLA 2PVSA 1XRLA 2VJBA 4UBJA 2ZYIA 1CR6A 3IVMA 3DYIA 3G7NA 1UXOA 1XZHA 4OB8A 3IUQA 1AX9A 4H77A 4AO6A 1N1MA 1ZGCA 1DWQA 4BAGA 5AM1A 5IVIA 3PFCA 4AO7A 2WHPB 5AKLA 2DHEA 2H9YA 2HA4A 5HFNA 4FBLA 4C01A 5ALPA 2QJRA 4P9NA 5DJ5A 3G9ZA 5AOCA 1W52X 3H2HA 5ALFA 1IVYA 3D2AA 2GBFA 4G8BA 3FNBA 4L0CA 1THTA 4X6UA 4ZI5A 1W4LA 2P8SA 2XQKA 1DX4A 1A8UA 3WK5A 4Y2QA 3EIOA 1BN7A 3I2FA 1FSSA 1X2EA 4BZWA 1K63A 3H19A 5HK8A 4DIUA 3P2MA 5JAUA 3FAKA 1GZ7A 2V97A 3PICA 1QOZA 4JYMA 3DLTA 2B61A 2X5XA 1MN6A 4GECA 2XMQA 3D4LA 1ACLA 3HSSA 4F60A 1CUZA 3O4JA 1P0QA 1VZ3A 2H7CA 3WLAA 5AHXA 4W1RA 3KWFA 1JT2A 2VQ6A 1IUPA 3WWOA 5C7YA 2YYSA 4G4IA 2OCLA 4WCVA 4AX4A 5JAOA 4B80A 4J0IA 5K3DA 4B9AA 5JANA 1Q0ZA 1E3QA 2OCIA 2DQZA 3STWA 3GZJA 2OXEA 1LBTA 4Y2PA 5AKHA 2W22A 4OB6A 2WUGA 3FVTA 3IULA 1MX1A 3NOXA 2GZSA 3WQHA 5J3JA 2WG1A 3AZPA 4BRSA 5JZ9A 1MU0A 3OOSA 4CG3A 2G5PA 3I6YA 5LZ7A 3V48A 4CG2A 4LIPD 4H7IA 3WYDA 3WK6A 3G02A 3A6ZA 5HF8A 2PU7A 5HK9A 2QUBA 3DNMA 1X2BA 1H2WA 3WL7A 4ZGBA 4X6XA 4JEIA 5I7UA 4BAUA 3WIOA 4W1PA 5HKAA 3G9XA 3BIXA 2GBCA 1YAHA 1NU6A 5AM5A 3RLIA 5AH0A 1BE0A 1L7AA 1UK6A 2ECFA 4IH9A 5AIBA 3DKKA 2C5FA 3B3QA 3VISA 3R0VA 5LYYA 2WIDA 5C8ZA 1WOMA 2R11A 5D3KA 1H2XA 5ALUA 1QZ3A 4FTWA 3DD5A 3FLBA 3SC2A 1EX9A 1XRRA 3V1MA 3H2GA 5K3CA 1PJAA 5C8VA 2O7VA 3RKSA 3YASA 4BRZA 2O2HA 2OQVA 3IUMA 4DMKA 1QTIA 3BE8A 1EI9A 1CQWA 1QIKA 2WFLA 5YASA 2JGMA 1CUGA 4JYPA 4Y2TA 3D2BA 1LLFA 1Q84A 4BP8A 4W1SA 1EK2A 3WJ2A 3Q8WA 5AOAA 4KE6A 5ALIA 4U2DA 2CUTA 1XZEA 5AI4A 5ALDA 4LXGA 4E14A 4DSZA 2VAVA 2B4KA 3STXA 1JFRA 3C6ZA 3HXKA 4Q3KA 1SFRA 1C7IA 1DQYA 4P92A 2WTMA 1ZD2P 4NZZA 2HA2A 1TKRA 4C87A 1ZJ4A 4GW3A 1GXSA 4UHHA 4K6HA 4E46A 3GBSA 3A2NA 4CIBA 4UHDA 1EVQA 3SX4A 1O6GA 2WUFA 2RHWA 1XZAA 4HXFB 1MJ5A 4A5SA 3W9UA 3DL4A 1X70A 4W9RA 3C45A 5EFZA 2DCMA 2DR0A 2ZJ7A 1Z68A 2XQJA 5LZ5A 4F21A 3E1GA 5FPQA 4EY7A 2RGUA 5AKGA 4DGQA 1CPYA 1VXRA 2QXTA 2OPHA 5LZ4A 3IB3A 2WG0A 4Y2UA 5FUMA 2Y6UA 2O2IA 2Z5GA 3JYHA 1HPLA 1F6WA 4N5HX 4BCBA 1L7RA 1CRLA 4B6GA 5I9IA 3R40A 5DNVA 3I6MA 1ZOIA 4W63A 2W6CX 4DNQA 5SYNA 3AILA 5DNWA 1CEXA 2XUKA 4L72A 1ZD5A 2IX9A 3DL7A 4H7EA 3QVMA 5JYCA 1UKCA 5ALTA 3OPMA 1AMNA 2RONA 2C0QA 1MT3A 3QM1A 2XMBA 4FFWA 5C81A 4WDQA 1VKHA 2PSHA 5CMLA 1XLVA 1P0MA 2C4HA 2YXPX 4X92A 4TPKA 1AC5A 3WJ1A 1I6WA 1TCAA 4UHBA 4B84A 3IURA 3FBWA 1Q83A 4ZWNA 4XIIA 3AZQA 5ALJA 2Z3ZA 1W75A 2HIHA 2X8BA 1ZIYA 3WKAA 2QRUA 3QMWA 2R8BA 1EHYA 4KJXA 4QDOA 2C5GA 2WIKA 4AMYA 1XZJA 4UBIA 5JD4A 5K3BA 5A71A 3W04A 2XUIA 2VAXA 1XRQA 4EY8A 4KRYA 3PF8A 4DMCA 2ZSIA 4WFIA 1Y7IA 5T4BA 3V1NA 1UK9A 3SWWA 4K2AA 1WCYA 1R88A 1K8QA 5CH8A 2V96A 4G8DA 1H22A 4G8CA 1E5TA 4Y2VA 1EINA 1EDEA 2XQGA 2B20A 4HS9A 4M0FA 1CV2A 1B41A 1G5FA 3FSGA 5JZBA 3C6BA 1JJFA 3FCYA 1HKHA 2BUCA 1MO2A 1EH5A 2AJBA 3EQ8A 3V9AA 1QIJA 4EA6A 5DTIA 3H1BA 2PSFA 5EIAA 4PQEA 3ED1A 1BROA 5CT5A 3BDVA 2OAEA 3H18A 2WFLB 4TVKA 1K5PA 2HU5A 2OGZA 4A16A 1M33A 4DNFA 3IUJA 2PKYX 5AKEA 3ESCA 2CEKA 5ALGA 4MWSA 2DHCA 2WU4A 4U2BA 2XMZA 5AI9A 2GBGA 5CRIA 3HLKA 4ITVA 5ALXA 5HF9A 1TCBA 3HEAA 3F67A 2AXEA 1GKKA 1F0PA 1XRNA 3UUEA 1LPAB 4L3WA 2HA5A 2I3DA 4FNGA 3HRHA 4EB0A 5IVKA 3VJKA 1TCCA 3ZLUA 5JARA 3IIIA 1FFBA 1R3DA 1GPKA 1XZGA 3ICVA 1HDEA 1GQSA 2HA3A 3FWHA 3WK7A 1VE6A 1VJ5A 4I4CA 1RYYA 1ZJ5A 2HRQA 4X95A 4PF1A 4X00A 1LZLA 4U2CA 1XQXA 3IBTA 2JGFA 1XRPA 2XUHA 1JKMA 1GGVA 1JU3A 4J3JA 3S8YA 4G9GA 1JMKC 3F97A 4AO8A 1DQZA 5FOQA 4LKOA 4QE3A 4DTCA 4B0OA 1YB6A 2BGRA 3H2JA 3PUIA 4TGLA 4UBLA 4K5QA 1N5RA 2QTBA 3FVRA 4E11A 2QZPA 3ICWA 1HL7A 4CG1A 4PW0A 3FYUC 1YR2A 3ANSA 4GBGA 1S8OA 1U8EA 1LNSA 2XLBA 1QIGA 2J3QA 5AKZA 1LPSA 1DT5A 3A2MA 3E0XA 4O08A 3AIMA 3QPCA 1THGA 1IZ7A 5AM4A 1TK3A 3HZOA 1B6GA 4Q34A 4XX1A 4B0PA 3FOBA 1GKLA 1XRMA 4BC0A 2XUPA 2DQYA 2HM7A 4EBBA 2HDWA 1W1IA 1K6EA 2GYVA 2XT0A 3AIOA 5ESRA 4G4JA 5ALNA 2HU7A 1BEZA 3L1IA 1AURA 5AI6A 3O9MA 1OILA 4C4XA 4IQ4A 5DWDA 2PL5A 5E4YA 4OD0A 1XKLA 4YPVA 3QMMA 2BUAA 5E4TA 5JIBA 3LCRA 2VJCA 4X7BA 1CIJA 4FDMA 3QZUA 4NVRA 5F4ZA 4N8EA 5D7BA 4ETWA 2QM0A 3C6YA 4FFVA 3D0KA 4WJLA 1WHSA 5DYTA 1EVEA 4KE7A 2D5LA 4BC1A 2VJAA 5AM3A 1IZ8A 3L1HA 1XQWA 2PM8A 1R4ZA 2C0PA 2AJCA 3V1LA 4X90A 4Q1VA 1F8UA 3HJUA 4F0JA 4I19A 1Q0RA 4DYHA 3TJMA 3G0GA 3UMJA 4KAAA 3JWEA 5K3FA 2QR5A 3IA2A 2XQIA 3BL8A 4KE8A 3QPDA 2BFNA 3O0DA 3EBLA 1D07A 3O4IA 3B5EA 2JGJA 5AOBA 1T2NA 3IUNA 1CUXA 1J07A 1EA5A 2BGNA 1G42A 3WYNA 4BCDA 2H7YA 2OAGA 4ZV7A 4DNPA 1QIMA 1U65A 3I2IA 5DLPA 5FP0A 3W05A 3I28A 4HVTA 5HFAA 1K4YA 3M82A 5D6OA 1QO7A 4JNCA 5EHNA 4UHCA 4QDXA 1A7UA 1YSCA 3WKCA 5T4HA 4KE9A 4Q82A 4X97A 3M3DA 2WQZA 2ACKA 2PUJA 1IMJA 2IIVA 4I3FA 1U2EA 2XQFA 3I1IA 1VLQA 2QS9A 3VDXA 1C7JA 4HRXA 4BBZA 1UOQA 5ALEA 3FLEA 1TQHA 1QGED 1EXWA 4MEBA 3OM8A 4X93A 1SCKA 4FBMA 4H7HA 2WIFA 1A88A 1CQZA 3PE6A 4J0JA 1WM1A 4FNMA 4U2FA 2XUDA 3WZLA 2JF0A 3L1JA 4BP9A 2E3JA 5A62A 1ETHA 4G4GA 3F98A 5ALQA 3WKBA 3D3NA 3QPAA 3C8DA 4QWWA 4C88A 4OB7A 5IVDA 5IH7A 1CUWA 1CUCA 5AJHA 5DNUA 3K9BA 6YASA 2GYUA 5EHQA 5ALZA 5KWJA 4Q3OA 1CUJA 4BAZA 4KYVA 3C5VA 1QIDA 1RP1A 2YH2A 3O9VA 1IUOA 1J1IA 4ZREA 3EF3A 3G0CA 5EI5A 4C4ZA 3KSRA 5KBYA 5LKRA 3QITA 4N5IX 1VOTA 1R1DA 2XMCA 1T4MA 4P08A 4PSDA 4MYSA 3G0DA 4GWLA 1A8SA 4B9EA 1KU0A 2UZ0A 4C4YA 2ES4A 5HZGA 2C7BA 1WB6A 3AUKA 3WWCA 3HYSA 1LPOA 5LZ8A 1EB9A 1ACJA 3WKDA 4MQMA 5AKXA 4AZ3A 2FUKA 1DINA 2XMDA 5T4FA 4KACA 3BF8A 2EDAA 3BF7A 4K6KA 5D3ZA 1CUEA 2WHQA 4RPCA 2FJPA 4L9AA 5FKJA 3ESAA 1E8MA 2VEOA 4FLMA 3FSGD 1R9NA 3TGLA 5AK3A 2QUAA 1UFOA 2WUEA 2AJ8A 3G8YA 1ORWA 5LZ9A 4UFNA 1CUAA 5AM0A 4MXDA 4FLFA 2O2GA 3MGAA 3DOIA 2Z3WA 1FJ2A 3WZMA 3JW8A 1MAHA 2JGLA 3WA6A 4DMHA 1YA8A 3VKFA 2VSQA 3WL8A 3U0VA 3OURA 1HQDA 5IKXA 5C8XA 2X76A 2HFJA 3R3YA 4M0MA 2VA9A 2PUHA 1PV1A 2BAGA 1UKAA 4B82A 5KWIA 4GI1A 2QJWA 3M83A 1W76A 1XLUA 4S0XA 4J0DA 2I78A 2PSJA 2QXUA 2LIPA 2V9ZA 5DYWA 2C58A 3TEJA 4BTVA 2FJ0A 1EB8A 4WFKA 3A70A 5HF6A 1LPBB 1R50A 1RWQA 5A7GA 2CB9A 1XZFA 2VTVA 4Y2XA 3IDAA 4EY4A 4LYEA 2XUJA 3LLCA 5K3AA 3WK8A 3ZI7A 4KAJA 3FLAA 1XQYA 5A6VA 4H35A 5JALA 4UPDA 3KWJA 2WUDA 3PF9A 1EDDA 3A2LA 3AFIA 4W1QA 1JI3A 1MNAA 3BDIA 5ALSA 4ZXFA 5EIHA 3K2IA 4WY8A 1XROA 3T52A 3D5EA 4QDTA 4YASA 4IH1A 3H04A 5LP1A 1YCDA 3C70A 1MTZA 1OXMA 2JIDA 2RIPA 2OG1A 4X3CA 1F0NA 2OQIA 4XJVA 3ZLVA 4CI9A 4J7AA 5FXMA 5AI8A 1XLWA 5HF5A 2WHRA 4UFOA 7YASA 3EQ9A 2XDWA 4BZZA 1UZAA 3R3ZA 5CT8A 1ZGBA 1SCIA 3W9BA 3BJMA 1TRHA 3F96A 3D2CA 1QFSA 1ISPA 2ORYA 2XUOA 5CH5A 1BEEA 3WK4A 1XZIA 1LPPA 4BDTA 4G5XA 2AJLI 1ZI6A 5AKYA 3ZV7A 3KDAA 1QE3A 1ODTC 2XI4A 3LS2A 4Q05A 1EDBA 2CMFA 1CFJA 4Y2YA 2HA0A 2D0DA 4QDZA 1CVLA 1QIFA 4H0CA 4Y2SA 4OUKX 3WI7A 3X3HA 3DJYA 1J2EA 1YS2X 4BE4A 3GROA 5ALVA 4UBOA 3HI4A 3VVLA 1SCQA 2CZQA 2HA7A 2O7RA 1UOOA 1BN6A 1ZD3A 2WFZA 1JJBA 4BB0A 1E8DA 4PSCA 5AI5A 1GT6A 1DWOA 3M81A 1ZIXA 2WJ3A 1QO9A 1P0IA 3VJMA 2XMRA 4AN1A 4EHBA 1WB4A 1FFEA 3DOHA 1L7QA 3GA7A 2VATA 4ARBA 2WIGA 1CUHA 3EQ7A 1E66A 1SC9A 1YAJA 1NX9A 4BTLA 4RGYA 2ONCA 2WFMA 2JGKA 4H7KA 2QVBA 1VZ2A 4U2EA 4EUSA 3FCXA 1SOMA 1QIEA 2ZJFA 4P93A 4PV7A 1HBJA 3ILSA 4X94A 4Y2JA 5FLKA 5FDFA 1BCRA 3CXUA 3FYUB 4V2IA 2JBWA 1AKNA 3H2IA 5ALRA 5BWBA 1XZMA 4X71A 2ZYHA 4HRYA 4YK7A 2I03A 3WIBA 2CKMA 1IUNA 4BDSA 4H7DA 2H1IA 4BE9A 1KU6A 2HFKA 3V1KA 4M0EA 1BRTA 3B12A 1AUOA 4NS4A 4EY5A 4BATA 2HL6A 3R3VA 5JADA 1MX9A 5AICA 1GPLA 3WL6A 3BWXA 3C43A 1G66A 3CN7A 3KOOA 1LGYA 5ALWA 1ORVA 2G4LA 4BVKA 1UWCA 1GPNA 1PFQA 4RNCA 3H1AA 5ALYA 1FFDA 2WJ6A 2B9VA 4J0GA 1AQLA 2DFPA 3STTA 3GELA 2JEZA 4EY6A 3STYA 1DTEA 1WHTA 1UK8A 3HABA 5CW2A 5JAPA 1ZD4A 5ALOA 3BJRA 3WL5A 5K3EA 1H2ZA 1VE7A 4N8SA 4UUQA 3R3WA 3H2KA 2QOEA 1ODSA 2H7XA 3FYTA 1QIIA 5E2IA 5HCUA 2XUAA 1VA5A 2PU5A 2Z8ZA 3DDUA 1AGYA 2XE4A 2WJ4A 3AIKA 3D7RA 3FYUA 3MUNA 1EK1A 1QIHA 4QNNA 2OLEA 1YS1X 4Z49A 2ZYSA 4FHZA 4QWMA 3CN9A 5JASA 1CUYA 1FFAA 2RAUA 4E15A 3WWDA 3O95A 2VJDA 1XZBA 1YASA 5FV4A 2OCKA 1UOPA 2XB6A 3RK4A 4IO0A 2WIJA 5A2GA 3DEAA 4PNZA 2XMGA 5EHXA 5AP9A 2BJHA 4IH4A 4F5ZA 2Q0XA 3STUA 5LKAA 2WLSA 2ZVDA 3ANTA 3Q0TA 4KR0A 5AKKA 1WPXA 1H23A 2OGTA 3PDCA 2WHPA 5IVHA 1DT3A 3C5WP 3MVEA 4G1FA 5JD6A 1JMYA 1CUIA 2OGSA 3VVMA 5CT9A 3TRDA 1GQRA 4QA9A 2HA6A 4CIAA 5K5EA 4J03A 1AZWA 1ZI8A 3I2KA 4MWTA 5CT4A 4DLNA 2GBIA 3GUUA 3HACA 4IHAA 3DS8A 1W6RA 4OYYA 4OYLA 3BXPA 4CCWA 1CUSA 3PUHA 1UKBA 3H17A 4Y7DA 4J0KA 1TIBA 4K6GA 4BCCA 2DSNA 1DWPA 3I2GA 4GDMA 4B7ZA 4DM7A 3C87A 2HU8A 3QH4A 2XLCA 3N2ZB 3ZPXA 2I3ZA 4J0HA 2JGEA 1E8NA 5AO9A 3PFBA 5CT6A 3WKEA 3R3XA 4LXIA 2HRRA 2ACEA 3WWPA 1LPNA 4D9JA 2XUQA 1ZI9A 5ALKA 2EEPA 3AINA 4MQLA 4BVJA 5JAHA 3CCCA 2ROQA 3G9UA 4CCYA 3O4GA 4XWGA 1WB5A 3KD2A 2BUBA 5BV7A 1OCEA 4B85A 3OTQA 1XZCA 3ZLTA 4PSUA 3I6ZA 4GEGA 1BS9A 1E89A 4QDUA 1CUFA 4RE5A 2G5TA 3E3AA 5AKJA 2GYWA 5CTAA 3BIWA 3I1YA 2ZJ6A 5SYMA 1TAHA 2JGIA 4GLBA 2FX5A 3QBJA 4AXBA 1U4NA 1CUUA 2CBGA 3W06A 3OG9A 1CUDA 1CUBA 3PI6A 1XZDA 2CJPA 3S2ZA 3G0BA 3E4DA 2VT6A 3RARA 4C6HA 2DHDA 4AZ0A 5DTJA 4PO3X 1DX6A 1O6FA 5LLSA 3QMVA 5AKIA 3R41A 4AN0A 1ODCA 1QTRA 3VJLA 1JU4A 4X85A 5ISMA 4HZGA
chains in the Genus database with same CATH superfamily
1A95A 2ISCA 1G17A 4G5QA 4GDFA 3GT3A 1W34A 3L1UA 1Y4SA 5KYVA 5I3ZA 4H59A 3OPXA 3G1TA 3QXCA 4OY3A 4B6SA 3IP1A 5CM8B 3ETGA 3M1IA 1R00A 2KLHA 3KFVA 3DLHA 4RMIA 1HOTA 2G4CA 2AJTA 1J6UA 1RQPA 3MLAA 2EDCA 1Z4LA 3B7GA 4GIBA 4MGZR 3VFDA 4ID3A 4IIJF 4DLWA 3SIRA 2QXYA 4GO1A 4HQOA 4XWWA 1MBZA 3P4YA 2GM9A 3OETA 3BOSA 4I08A 4Z0NA 2OHGA 1U2GC 1DFIA 1W5TA 3H99A 1BYUA 4JI8B 2MSNA 1VKOA 3EZ2A 4PNPA 5ARCA 3WIUA 2YFQA 4UUPA 2VQFB 4FCTA 2ZYRA 3KEMA 3FNFA 3H4VA 4CKBA 5F5NA 2PRSA 4XW2A 3OEED 4KAFA 3MUOA 1IY8A 1UC8A 3QVTA 5A2QA 4DF3A 4MAAA 4NMWA 5KVVA 2FQ1A 3F5SA 2V8BA 3FNGA 4LXHA 1Q44A 2CF5A 5CDFA 1EFCA 3U81A 1YR7A 3BMNB 1N2CB 4FKBA 5LUBA 1R9MA 1P0PA 2JA2A 1KHTA 1DE0A 4DMLA 1P29A 3DE0X 3NHKA 5AVRA 1D3AA 5A5DA 2EKZA 3MWFA 5KOJA 3A9SA 2P68A 1T26A 1XZKA 4N49A 1CDDA 3IDFA 3TX2A 1FFXA 4TTRA 3WYCA 4CEJB 2DWCA 3U3JA 4IOLA 4EJSB 2XOXA 1BOFA 5CURA 3ZJ5A 3AHHA 1K7CA 1T3LA 1XP5A 1XQVA 3AHJA 4F6CA 2CNWA 4V3CA 4FYWA 1PDWA 4WJKB 5CM2Z 3ZH9B 1PP4A 1DQPA 1AKUA 2PPLA 4DQ0A 5JD3A 3OZ7A 5FF9A 4JJEA 5C1IA 4EVIA 2ZI3A 1JLRA 4X62B 2WP8J 4MYDA 4MYHA 1TZ2A 5CPFA 4F6RB 4DLUA 2AMYA 3LJKA 3M6VA 4H7FA 1V2GA 2C2HA 3E27A 4QFDA 4WASA 2HQ1A 3A36A 2PK3A 3S8MA 4P33A 1DBQA 5AW4A 3BH7A 1NT4A 3ZNOA 4I55B 3O4RA 1MX3A 4OHXA 4AUEA 7MHTA 1DKOA 5C7LO 4ZDKA 4AQDA 4RS3A 3DUWA 5FH9A 3OZSA 1GN9A 3O4VA 4Q1BA 4AMZA 3NGMA 2W48A 3BGWA 4LK2A 1PEKE 2FY8A 4HTAA 2E2WA 1K7XB 1JEYB 1TA4A 4GR9A 1QYIA 4H3VA 4KMOA 3ICOA 1CB0A 4P82A 4M9SA 1NDUA 5ERYA 4UE2A 5JMTA 1DIOB 1XV5A 1EFRA 1JQ3A 4MKRA 4ZCTA 2WG2A 4PYNA 2RSLA 3LT0A 3ANYB 4AY2A 2NPIA 2V3CC 3H13A 4CHGA 2A4KA 1DI0A 1RTKA 4V2UA 5KTNA 1ZM4A 3Q7SA 5LNK6 4R83A 2I7XA 1W1WA 4UMVA 4PPNA 3N28A 1HDYA 2CDAA 1XLTA 5KEIA 4ECAA 2GZHA 4DRXB 2VPQA 3R24A 3AW8A 4JB3A 4QLOA 2JIZA 1EE1A 1KJYA 4OQXA 4E5PA 3GFFA 5LQKA 3RYHA 1OI2A 4CMCA 4B87A 1M8JA 2P6MA 2IS6A 2ZBGA 4W9NC 1S2MA 2F8MA 2G63A 3E3MA 3MWEB 2O8CB 3OIWA 1SVSA 2J4FA 1K6MA 3DB1A 4DA6A 2VT7A 4MWGA 2WU1A 2EG5A 1G41A 2YY7A 3G2PA 5BUQA 3LYLA 3NHWA 3F71A 2J9GA 2YX1A 4LFCB 4HAZA 1U28C 4YLYA 2YY6A 2H3EA 4HQRA 1NDQA 1RAEA 2DJ5A 4HNHA 5FHQA 2F9MA 1RYDA 1X1TA 4FHGA 3O1JC 1UT6A 4LYFA 4CDGA 3LHDA 1HEUA 1E92A 1F9AA 4IKOA 4CTJA 3ZW9A 4LNAA 5FFFA 4U7HA 3EXHB 4YV1A 4GR4A 1TFUA 3COWA 2IZZA 4KQKA 3ROQA 2YDYA 3CWQA 4NMLA 4N8DA 2OMEA 1Q0LA 1KEWA 4H6VA 4O6VA 1JAIA 4WKOA 4C4TA 1COWA 5TB5A 1F2UB 2QTHA 1XTQA 2Z43A 2RGNA 2VLBA 3PGXA 3R4CA 4HO1X 4NBWA 2Y1EA 4P3YA 2ZULA 1JLMA 4MWDA 3CEPB 2L82A 3AVOA 3HSKA 4R9VA 3WYGA 4DXDA 1S3IA 2GCOA 1NT2A 4MLZA 3X1ZA 4D5GA 1K9SA 2VC2B 5LIPA 5I9SA 5JAZA 1NUHA 1PTJA 3NORA 3KPWA 4XASA 2HWWA 3GUVA 1DV1A 4FK8A 5CVEA 3ZWQA 3TLXA 1SG0A 5D01A 3LP5A 3EVNA 2IVFA 2O20A 1A5TA 2Z5FA 4RAOA 2AFIB 2EQBA 5JMOA 3T5DA 5G4KB 1IAQA 4EY3A 2GRJA 2YDXA 3IPRA 2WTBA 3G2NA 3RROA 3TW8A 2YJGA 4UFPA 4RTQA 3PGMA 1NUAA 4FQ7A 2H1FA 2XGGA 1TT5B 4RE6A 4RF5A 1ISMA 1GZ6A 1VMEA 2XDYA 2ZJZA 5DYNA 2PUAA 2WW8A 2Y6VA 3UUFA 1E94E 1LFAA 2FPGA 4OQQA 1N0WA 1SBCA 2WILA 1J22A 4J0CA 5E4JA 3TQCA 4FMPA 1MV5A 1UUFA 4GOND 2FW9A 3DM5A 3U3DA 1QJ4A 3PXXA 4EZEA 1M3SA 4PAOA 5LOVF 3FOWA 4QQRA 4JWTA 2QRHA 4JUIA 5ES4B 2ZRGA 2Z5LA 1P1RA 4HI0E 1WOYA 4HAIA 3F9RA 4UNRA 4I4TF 3PD0A 2DUUA 3VH2A 1S2DA 4IZOA 1P1FA 1KDYA 3HLYA 3VU3A 1L5MA 1SKYB 4N7BA 1FXWA 1WEHA 1EXVA 2VBGA 2PMEA 3IAUA 3F8SA 5JATA 1IPEA 1Y5RA 2O5EA 4TSKA 4RDIA 3O8OB 5F5XA 4CI0B 3IGFA 2AFVA 4MJ3A 4HBGA 1NBOA 2GZRA 4Z51A 3SBEA 2C8KA 3C3YA 1CJSA 1P31A 4G1VA 4P3KA 5EWMB 2GN0A 3LBFA 4F85A 1PZHA 2FZ5A 1H2EA 1FTWA 1PL6A 1RCUA 1HYEA 2HHAA 5EIBD 4AB1A 3LU1A 3GEDA 1M6VA 1BW9A 3L3BA 2NO9A 4YRLA 5T64A 1X7XB 3O82A 3OM9A 4AS3A 4UNIA 1L3IA 4HX9A 5EKSA 4JC0A 3LM8A 1NW6A 4JP3A 1TJ3A 1T9GR 1ZICA 2GD2A 3BMCB 3LO8A 2IH4A 2QD5A 1CZOA 2PT5A 2Q5IA 1Y9ZA 1S6YA 4R1NA 1YC2A 3L77A 2OMKA 2J4DA 4L16A 3U48A 4YCLA 2R6AA 1ILEA 1YZFA 1FJXA 2VP9A 4KGDA 1NXTA 2ZS7A 3W8NA 1AVTA 1W29A 1L5SA 4RH1A 3KEOA 3VGJA 4B6FA 1IWPB 1VMAA 4QFCA 2P78A 2IQ5A 2VP2A 3RRYA 3RC1A 4C7VA 3WJ7A 3MUEA 4QLAA 4Z2AA 1UK7A 4BLOA 3ADCA 1A0OA 1ZESA 3ZXXA 3CM0A 1KMHB 3S70A 3UAGA 1Z0JA 3J81k 1NP3A 2NU6A 3F9CA 3ZJVA 1YTUA 4NRDA 3RU9A 2ENWA 3SS7X 1ZVJA 1ISIA 1RXIA 1ZIPA 3L7LA 4NEGA 2JAHA 5ALMA 1UBHS 3L07A 4AWAA 2MIIA 4LJ8A 3QLTA 4OI0A 2C61A 2EFHB 3NVKI 3CC8A 4BFCA 3AR2A 2FHPA 2XRMA 1IXSB 4RTSA 3T6KA 2WSSA 3WA7A 2DKNA 2PGLA 5GJBA 4DN6A 4UHEA 1HG1A 1TAGA 4EYGA 1F48A 3HXLA 3F3KA 5KWSA 5REQB 2AH5A 1BCSA 4ROSA 1Q21A 2IYSA 1W2WB 2Y0PA 4V38A 2WSLA 3O2NA 1I4WA 2GRAA 4J0EA 5GZ1A 3GRZA 4DCVA 4AJPA 2P2ZA 3AJAA 1UDAA 3CNBA 1OREA 3HGQA 3I05A 4WFJA 1JHAA 1KEZA 4LHEA 4AMGA 2A9PA 2BI4A 2NG1A 3ZIUA 2V98A 4U7DA 2OBFA 4GI2A 3KKNA 5DI3B 4PZEA 4QG7A 3E4CA 1IBRA 4FEGA 4ARAA 1WZUA 2PFKA 1A9ZA 3B2EA 1KEKA 3JTMA 3DVAA 5HIJA 1Y3AA 6CHYA 2NO4A 2J9ZB 4QQNA 4Z3KA 4KRGA 4OHKA 3RAEC 4Q9AA 1A9RA 1OW3B 2W0SA 1Q11A 2XUFA 4DLLA 1C9JA 2AFRA 3NR2A 1ZKDA 1HZZC 4GP9A 1DTWA 3GJ0A 1C7RA 3IVMA 3EQ2A 4IPTA 2ZRLA 5K51A 3DEFA 3QNMA 2P30A 3WICA 4TLEA 4I6EA 3PC3A 4RXMA 3ENQA 3SEFA 3PLRA 4CLDA 1T1EA 3IUQA 3L6EA 1ZH2A 1O2DA 4AK9A 3E1KA 4PZUA 3I5MA 4TWRA 3FIUA 2FQYA 3WAGA 4I50B 2OO7A 1JJAA 4G2TA 4NHEA 3DMYA 4NATA 1GU0A 5F9FA 5AM1A 1JYEA 1SVKA 2A9VA 3OFKA 4WZBE 2GD0A 2D7DA 5AVXA 5DK6A 4Q9IA 2SECE 4CDRA 1YBFA 4RPLA 2Q21A 1X86B 3IRVA 3ZKWB 2G8LA 2DHEA 2AFHB 3ILVA 1V39A 4XM0A 5LC1A 2ZITA 1WTCA 2HA4A 1Q16A 3F6YA 5HFNA 3W3AH 3ITDA 1CD5A 1GARA 2G04A 5I3CA 4XGNA 5CVCA 4C01A 5HZKA 5ALPA 1DTWB 2UUAB 3BE4A 2QJRA 3PNQA 1A9PA 1MCZA 2OLKA 2ZRDA 4WE3A 3GEEA 4YJ3F 1P2TA 1KK3A 5AOCA 1EFRD 3ZI4A 4DT1B 3KRTA 1W52X 3KB1A 5ALFA 1J00A 1GJRA 2Y0BA 1OZAA 1M1NA 3EVEA 1QH0A 3N8KA 2VOEA 1C4KA 3WP0A 1CZUA 4B6QA 2GJ4A 4NF2A 2A59A 4EVSA 3F2IA 1Q91A 3TNYA 2BIFA 1V8FA 3IP3A 3OCCA 2BELA 4ZQHA 2O57A 5A4IS 1YRBA 2XRYA 3KDSE 4PS0A 5I9BA 2Q0QA 1QKIA 2Q3DA 5B5SA 4QYIA 2C5EA 1Q15A 5LU8A 4OMFG 2FOLA 3I2FA 1X2EA 2CMDA 2ZG6A 3OFSA 4BFUA 4KHPB 2BKAA 1K63A 3ZE2B 1Z35A 3ADKA 2DLNA 2VPXA 1SCUA 1XNGA 3OQHA 4FCVA 3TX6A 1XZ8A 3EDRA 3OJXA 5FFMA 1V1RA 4UZEA 5HK8A 2EVWX 4EJ2A 2ZPTX 3LA6A 4DIUA 3OX2A 4FCCA 1ONBA 3FAKA 1GZ7A 3BJZA 4P7FA 2HBQA 3INNA 3PFKA 1NVWQ 2QE7A 2V0CA 1UBRS 2WHEA 1ISSA 1U3CA 4Y9RA 4G1UC 3B13B 3EW7A 1AK9A 1T24A 5K0GA 1FFSA 3S2YA 5CB0A 1XU9A 3DLTA 1W5BA 2B61A 3W5JA 4ZMSA 3G82C 5JLAA 4L8WB 2X5XA 4X8LA 4DDMA 4RTMA 3ABZA 2XMQA 3R0XA 1B0AA 1X94A 5K3OA 3D0QA 1ACLA 1JWBB 3L4KA 3MTAA 2JFFA 3AI3A 4BQQA 3T12A 4DA0A 4HDAA 1ADFA 1K8ZB 1OI7A 5JHGB 3RV4A 4OQFA 2QSZA 2V45A 3HV0A 2QPAA 4MHOA 4HN4B 1PF7E 4TL9A 1K3UB 2WVGA 3G2JA 1DZIA 1DXYA 2B1JA 3AHDA 1JNYA 2NUBA 4C0HA 3WLAA 5AHXA 3PFGA 2XYPA 1F06A 1UKVY 2C78A 3TNJA 3L4BC 1Y3DE 4JLSA 3JYLA 4K26A 4RTKA 4NH0A 5LMZA 5GOTA 1R8XA 3DLIA 4XIJA 1E6CA 2JS7A 4G4IA 3KAQA 4TLDA 2PX8A 3JYNA 3OU7A 2NLOA 3LE8A 4G24A 4ZDJA 2Q9UA 3O26A 1ZZGA 1KAEA 2VK1A 3I8SA 4NESA 1QYDA 3IR6A 3NVDA 2RBEA 3MTGA 1WDTA 4HCJA 2HPHA 5BYJA 1KQFA 4FYXA 5AR1A 5SY4A 4J0IA 5DT9A 4BP3A 1T9CA 2B69A 3H5WA 1QGYA 1VP9A 5JCPA 3PQ7A 2HK8A 5EGSA 4B6OA 4MSUA 1Y9JA 1BDBA 4B9AA 5JANA 3U61B 1Q0ZA 1E3QA 2BV3A 3GFTA 5JI2E 4TTIA 5I7OA 5C5CA 1VSQA 3CLKA 3H4TA 2DQZA 4I36A 3U31A 2C4UA 3WGVA 3GZJA 3C2QA 4Y2PA 2RGRA 4OB6A 3PUKA 3ROGA 4IIFA 4I1VA 4CM6A 2LKDA 3VHLB 3TSOA 5GVRA 3R7BA 4C2UA 3FVTA 4PNEA 4Z0TA 1MX1A 1P6XA 3OD1A 3NOXA 5DO9A 5LLTA 1I0IA 4HPWA 2IYAA 3PHHA 1Q1GA 3F8WA 3K8ZA 1U0LA 2RJNA 1P7WA 3N0WA 3VO9A 5J3JA 1V37A 2WG1A 4BRSA 4JAVC 4CR7A 3A2KA 3A9WA 3U19A 1Q0TA 1YS6A 4LDZA 1YFZA 3LXMA 5K99A 2OESA 5ITZA 1XTZA 2E9SA 4PR0A 3LQ2A 1AUVA 3RAPR 4MUJA 1RYEA 2G5PA 2W4IA 2A5GA 4LIPD 2QTNA 3X0DA 3OZAA 4QGGA 1E4YA 3EG9B 3HB5X 1ZVMA 3NAQA 1IJBA 1CULC 1RHUA 5G1PA 1DUIA 4QTUB 2PU7A 5DCUA 4MP8A 5HK9A 4CEHB 4TYQA 1XYVA 2FU5C 3UIEA 1TTPB 2CFRA 4PC7A 2AG1A 1JBQA 1H2WA 3KG2A 2IODA 1YZVA 4V0OA 1Q6ZA 4FYMA 4R4JA 4ZVNA 3V2HA 4W5HA 4X6XA 4CMEC 5EMLA 2BFEA 1ES9A 2CNWD 1PR4A 1VCMA 8LDHA 2BFBA 2GKGA 1U8YA 2Q7DA 5BUZA 1JH9A 3MCVA 1EFVA 3I23A 3S55A 1JRLA 3WNDA 2YJ6A 4PIPA 2IV2X 2ZW9A 1SNYA 2DPGA 3G9XA 4MVJP 1A7KA 2GHIA 2QENA 3EXHA 4M7PA 4KIGA 4MRVA 1CEQA 2GMWA 4PX3A 1YAHA 5EVCA 4CXMA 1CERA 1VJGA 2IIQA 1CVRA 4RD3A 3VUFA 1D1QA 4I14A 2Y71A 4CDMA 2NVUA 4OH7A 5JXJA 2VDWB 3BH6A 2QDXA 1A2BA 3DFKA 3MW8A 5K2MA 3QBEA 1BE0A 1ZCJA 3QVWA 5D51S 2ECFA 4YXWA 3RSHA 3AF3A 3DKKA 4XJSA 4JS0A 1TUBB 4UTOA 3DBRA 2ZUDA 4FS3A 4RY2A 1F5SA 2I6TA 3JY6A 4A73A 3B3QA 1KOLA 3IQEA 1NV8A 3MINB 4U2KA 3CB4A 4CR6A 1X7YA 1TM1E 4FHEA 2AYZA 2R11A 4KQXA 4M1MA 4EGSA 1U02A 4HMOA 3HV2A 1TYZA 1PZMA 1Z08A 4UAGA 4C6TB 4DR5B 4FJ1A 1MXFA 4IXNA 4PYKA 4DXHA 3EPRA 4CV2A 5D85A 1IOWA 1G19A 4CQJA 2XRZA 4HPXB 1KYIA 2PJRA 3KZ1E 2O59A 5KOIA 5FAKA 4ZOAA 3CUYA 3FLBA 4FTWA 4LY0A 2Q2QA 5CB8A 3FYHA 3COPA 5BYBA 3K05A 1RJDA 1YL5A 1LNZA 3MBOA 1BGVA 3LQ4A 3QVOA 1DKUA 4IIDA 4MS3B 1VMKA 2IK8A 2R7AA 4C0KA 2AWNA 3H2GA 4L1KA 1CJUC 5K3CA 5LIRA 1KYQA 1NQAO 2BY4A 4OTZA 5DLDA 3TTSA 2C1XA 4D3DA 4E7OA 4RL4A 3F6EX 2C82A 5BQPA 2VA8A 4BLWA 5GINE 1TEXA 1WLSA 1JZTA 1WXIA 4KXUA 3RKSA 1ZA2A 2Q3MA 2GZ3A 1X0VA 1E5DA 2J5XA 2Q1XA 5GGXA 3C7CB 1PR2A 2O2HA 2YFKA 4LVCA 3YASA 1KSJA 3IUMA 4BRZA 5LLDA 4KVZA 2OORA 2X5KO 1PL8A 1QTIA 1V8ZA 2JIPA 2OBNA 4HWKA 2H5JA 1NMYA 3DZBA 3EZ9A 2JCXA 4LYGA 3LWBA 5DHSA 1JWLA 1OTXA 4X5OA 1GVNB 3EVZA 1S9DA 1KAOA 5T7BA 4FM9A 2OENG 1TIPA 5HQTA 3U7HB 2UXCB 5YASA 1I2BA 3B20A 4D6YA 2GBLC 3PC4A 4H1TA 1VCHA 2IPMA 4R54A 4ZK6A 1RPJA 3CKYA 3CLSD 3I58A 5JEEA 2HWXA 4Z1MD 3CCFA 1EK2A 1NKSA 4NH4A 3S7TA 3WJ2A 3QI2A 3ESRA 4MQBA 1KZ9A 5AOAA 3W2FA 1WU7A 4BMYA 2H1CA 2WAMA 3PGA1 1XQ6A 3NTXA 4BO9A 5G53C 3AETA 2CUTA 3ODPA 1Y8AA 3IP5A 3Q2OA 4JLAA 4DWOA 1MQAA 5LJIA 4LXGA 4DSZA 5TXGA 1BWSA 3SXUB 3CVXA 1K06A 4NCIA 3RC8A 3EDQA 3STXA 3D6JA 2I6SA 3PX2A 1KK0A 3IODA 3NC1C 4HEQA 3ODGA 5A04A 2HU2A 2J6IA 2RGYA 3KPVA 2WTMA 4BFVA 2HA2A 1A9XB 3A06A 3KLPX 2IOFA 3FRHA 5JCJD 2PANA 3O2JA 3OM1A 3Q7RA 3RU3A 4K9DA 4UHHA 3HUTA 1KE2A 3NTQA 4QGFA 3I53A 2JH8A 4D26A 3LUFA 1ZA1A 2GWRA 4P3PA 3S2GA 1FL9A 2HLDA 1C81A 1BXRA 1GXSB 4FW9A 2VRCD 3ACCA 5J58A 1E58A 1KAHA 2AGVA 1KZ7B 3AVPA 4ZPJA 4BO4A 4DGSA 4J7UA 4XQCA 1XZAA 2ZTSA 2JH3A 2FFJA 2GILA 1T1IA 3Q6IA 3BXEA 2CNBA 4YMHA 1M34B 4Q9LA 4JLOA 2VF7A 2W43A 4CZ2A 4CEHA 3H8JA 3FLMA 4W9RA 1JU9A 1BA3A 1UMBB 2EJVA 3BYZA 3K31A 2JJYA 5EFZA 8ADHA 2A0YA 3K35A 4R68A 2KB0A 1TNDA 4RW0A 5CDHA 3E1GA 3VKHA 4D3ZA 1NBAA 3MWJA 1C30B 4OHOA 4ER3A 5FWDA 1X1BA 1BIFA 1PV2A 2RGUA 4NJEB 1CK4A 5U4XA 3KL2A 4WTOA 1CPYA 3S28A 3FMPB 2NT3A 5JQGB 4FUQA 3OPYA 1DCMA 2GK4A 3HP1A 4LV6A 4W7IA 1ZMXA 5FUMA 1T1RA 4YNBA 1GG2A 2EYUA 3RTEA 5HWSA 3UJAA 4C2AA 2Z5GA 2LE0A 2ODNA 3BH0A 3TI9A 1BMTA 2W71A 5MFZA 2P40A 3NHBA 4EL0A 3JYHA 3TZCA 1HPLA 3PC7A 2HF7A 5AOVA 1WG8A 4DIFA 4BCBA 5L3SA 3JASB 1NRIA 1KO1A 2B1IA 2E4YA 2HZ7A 2XCOA 3GJ8A 2BGJA 3R3SA 4LE1A 3ROXA 4B6GA 3BD8A 3R40A 4XDYA 2IH2A 3D7MA 2IXGA 3QTLA 4FKMA 3OJWA 2RGGA 5EZ6B 4X84A 4XZ3A 2H52A 4TYWA 4NOJA 3I1JA 2W6CX 4OATA 4B43A 2W6JD 2ECQA 3CXRA 3X2EA 2D1TA 2ZWMA 3KKKA 3WYAA 2FDRA 5C5DA 5COAA 2RI0A 3RCBA 5EYPB 1PJ8A 2VHQA 5E1BA 5H0IA 5E6UA 1PFKA 3TR5A 3OQMA 1R15A 3QX7A 1CEXA 4ND3A 5J2TF 1L5ZA 4D9GA 1N6LA 2JZCA 5EMJA 2NZUG 4CJXA 4D97A 5AW2A 5JEDA 3GZ4A 1SHUX 3MD0A 3FJOA 3INTA 4Z99A 1Q7EA 2ZYTX 3TQQA 1FLVA 3LQFA 1KZHA 4EATA 3HJHA 3LP6A 4B6PA 4ETMA 1EJBA 1UP6A 1ZMOA 3L8GA 2GCEA 4DJDC 2DOKA 1QHIA 1WMDA 1Q74A 3CU5A 4QOJA 5KNLA 4N5NA 3TLEA 1J2JA 1EYZA 2PEZA 3K73O 4G5OA 3MINA 3FHTA 2GZDA 4HWTA 4DJFC 1W85A 3QVMA 4JT8A 4LZAA 4RZUA 5B57C 5JYCA 3KB6A 4ZODA 2P1RA 2I9KA 4ERNA 5CCDA 3URMA 4HUQA 1XNJA 4BX9A 3LCCA 2QAGB 1JWAB 1Q17A 2X1HA 3SEQA 5KVSA 1OH6A 1LF0A 1LVGA 2XMBA 1XMPA 3GEHA 1WUIS 4FFWA 5IYZB 4WDQA 2EBUA 1TK9A 1M8FA 2IUSA 1YBHA 1U7ZA 4YMLA 5JDIC 3UGJA 5HTKA 3UAZA 1RKBA 1XLVA 3PDJA 2QSYA 3AF5A 3JD1A 3N05A 3PGJA 4K46A 4K7JA 2QW8A 5FCDA 3W1VA 3IMCA 1AH2A 4WECA 2C20A 3A6GA 4CM8B 4HB3A 4KQMA 4OM7A 2YZ7A 4TPKA 3E5MA 3IOYA 3O8DA 4RBNA 2NUTA 4D79A 5J2UA 2O8BB 4O5OA 2X41A 3GMDA 4C0BA 4MAMA 1O4VA 4FI3F 1GV1A 2B0JA 1UC9A 2FE1A 3U62A 5ALJA 3JTEA 2HIHA 3RC7A 3IEVA 3QEKA 4MW7A 4NENA 5IEJA 3WKAA 3Q6MA 3WLKX 1P7PA 3PCRB 3KOYA 5BNZA 3IC5A 1SD5A 1KYXA 1L7XA 1EGQA 2FW1A 5BV2P 1LI5A 3C5EA 3U44A 1BGXT 4D4KA 1CETA 2RAPA 4Q47A 5BQOA 2QI9C 2HMUA 4RSMA 3T1VA 4AMYA 3IKMB 1VTKA 1R27A 2EZ4A 3T5TA 1L7MA 1C8LA 1XZJA 4UBIA 1XFAA 3B6KA 3ZGOA 2C2XA 3GFVA 3KBOA 2GSDA 3LPDA 4M9UA 2X40A 3NOVA 5G40A 4EPRA 1J21A 1SELA 4XPZA 3DAGA 4CDNA 5B58T 3HDHA 2UZ1A 2JAOA 1OA1A 4ZEVA 2GPJA 5HS6A 4KRYA 2O7SA 1C3VA 3BA1A 2CLKB 2IEYA 2ZFUA 3T41A 5FJIA 1EQ2A 2L42A 2P9EA 3S7ZA 2W2LA 4B2PA 4BO8A 2XZTA 5CIQA 3A6PC 3HCBA 4O2BF 2QPOA 1JIXA 3JAWA 2CT8A 1WCYA 1C30A 3NX4A 3NM6B 3C3MA 3LYAA 4MKXA 1K8QA 4X1IB 4R0NA 5B2EA 5ICEA 4GZ6A 2V96A 5HX7A 2J5KA 3VSBA 1IJKA 4PZCA 4UCQA 4ZU1X 3Q7IA 3E03A 3N3AC 4UPVA 421PA 2OXRA 2EF1A 2J07A 4PGGA 4G07A 1EDEA 2XQGA 2IS2A 3KLMX 2YRXA 3TI7A 3GJ6A 4M0FA 4FMDF 1NTOA 3TDKA 1U2DC 3RTGA 1GRRA 3TGWA 3WB2A 3OZIA 4OHRA 5KYXA 3DPSA 1VMIA 3I92A 1CZHA 2XGSA 1BXRB 3QUTA 4KC0A 5FOVA 4B32A 3P26A 4CYMA 1TEHA 2ODBA 3I32A 3MWYW 1FP2A 3JQEA 1K0UA 4J1QA 4N3AA 2GDZA 1P74A 2JI4A 1UAYA 5ALVA 3U5TA 1WB9A 1IQ0A 4IUYA 1FVHA 3LDAA 3O75A 3ZE0B 1ECJA 3B1YA 2FN4A 2G88A 2DU8A 3K4QA 5CDYA 4WKNA 3V9AA 3M2TA 1QIJA 1FUEA 4C03A 4KQ1A 1H8ED 2O1SA 5KTYA 4EA6A 4Q7MB 4IW3B 3QFFA 1DAKA 1KGDA 3H1BA 3G13A 1PZXA 3KQSA 5A3SA 3MMXA 1FS4A 4OL0A 1S3FA 1ONOA 2HBYA 3D8RA 4PQEA 3DDZX 2EJBA 4OKSA 4QPJC 5DX0A 2Q2VA 2DPMA 5GONB 3BRCA 2BONA 2FYTA 3HYLA 4ARSA 3H18A 2V7VA 4OHVA 4TVKA 1L4EA 3FB1A 1YGYA 3RYIA 1HKUA 4D45A 2AMVA 1K5PA 2QG9A 4B73A 2DQKA 2OWDA 3DMTA 2W7TA 4DLZA 3ZOKA 5TLSA 2JLWA 3EMVA 3RT1A 4A16A 1SCUB 2ODWA 4CU5A 1RRPA 1E7WA 2BJWA 1Z88A 3CVOA 4IIGA 1JHRA 3TUZC 5CG2A 4GPIB 4UOEA 1XU7A 3KXDA 3GFPA 2M6KA 3ONNA 5HZHA 1E79D 3D0OA 2OCAA 3JQGB 3KV1A 3QLJA 4FIZA 1OH7A 1J9EA 2N42A 3GEPA 4ZJYA 4KIJA 1IQPA 1XALA 1R5JA 2AN1A 3IPAA 2B8WA 2HSEA 1SU8A 3ESCA 3KUXA 3ORSA 1YI0A 4GR5A 4H1VA 4KDFA 1MEOA 3GJTA 5E9WA 3TSCA 1JFTA 3E22B 3NBKA 2WU4A 3ZU2A 2VWQA 3RRZA 1DCTA 1MJHA 1KQOA 5FOTA 3SSMA 4O4LB 1K68A 4K0RA 1HFEL 2WJAA 3OO1A 2IU0A 3HLKA 4FEEA 1MUUA 2BLNA 2H48A 1U2RA 2IYPA 1VBMA 3FGZA 1M6WA 3QSGA 1T5LA 2JHAA 1EQUA 4PPGA 5BSUA 1VLVA 2R8EA 3WGTA 2UXBB 3DDOA 1EX7A 3GLHE 1VPLA 1PQYA 1L4YA 3D6UA 3KT3A 5I7VA 1TCBA 5IJ9B 3A1CA 4G09A 4RORA 2ID7A 1OU4A 3F67A 3NIDB 2C7VA 1GKKA 2VDNB 1GZDA 2FEPA 3HVJA 3DH0A 3EASA 3O8OA 2CLCX 3JZMA 1LPAB 3RUHA 4A15A 5K0ZA 3O1HB 2WWRA 4MVJD 5FUVA 1V9LA 4L3WA 3FF4A 5EMHA 2I3DA 4EKEA 3NBAA 1OX5A 2VPYA 2OXCA 1UXHA 3RF7A 3W9YA 3ZQ4A 2E4UA 4I1OA 4KXYA 4XWKA 1JIJA 3OWXA 4YJFB 2P67A 4LOJA 4NCKA 1RQNA 4WIAA 4LQCA 1BGWA 1CTQA 4P54A 4IDPA 3I5UA 5K8UA 3IIIA 4E2FA 4NCHA 2DLDA 1V8PA 4RHXA 4TS9A 2CDBA 2PUEA 5KTKA 2FJUA 3GAFA 2Q5HA 1EFDN 1PYDA 3WK7A 1TD9A 1VJ5A 2NO7A 2KQUA 4I4CA 1RYYA 5LP6A 1IHOA 1A9SA 3ZWPA 4AKEA 1NZFA 2H4WA 2CYCA 3IT2A 3ILHA 1Z22A 2BLLA 2AR9A 2C8LA 1XXLA 3IBTA 2DR2A 3H16A 1XRPA 3UMYA 3UB3A 1GGVA 3Q72A 2ZR0A 2Y1GA 1FLAA 5AW0A 1HL3A 1E1RD 3M0EA 4J3JA 3S8YA 4G9GA 4EI8A 1OJ7A 1JMKC 3X1DA 4AO8A 1DEHA 4B5KA 5HJ5A 4L0MA 4L4XA 16PKA 1VG8A 2BZ0A 2FZWA 4IDFA 1K8RA 2HMVA 4LKOA 4N03A 2OD9A 4NV3A 2GCPA 4Y6RA 3RS9A 5C2JB 5CDGA 5B3JC 1UFVA 4MIEA 1W4BA 1K4KA 4Y2HA 4DTCA 2QJTA 2BGRA 3AHCA 5EQDA 4A26A 1PJ3A 2B4QA 4JXJA 3HWX1 4K5QA 1I94B 3IQZA 1JQAA 1E2FA 1LKZA 1JKFA 1I1NA 3F78A 3ONDA 3L8HA 2Q5OA 1H2FA 2OOSA 4Z7OB 4NFSA 5ITWA 4DDVA 4PW0A 5BWLA 2X8AA 5FLEX 1AQYA 4U7JA 1YR2A 2VP0A 3ANSA 2IZ0A 4EVQA 2MSCB 1S8OA 3WDSA 3GU3A 2P2NA 3IDZA 2EJUA 5I9MA 4E94A 3ENZA 2Z2XA 5IBPA 3THXB 5CM9C 1RFGE 2YJZA 4QAQA 2Y1WA 3ESYA 4QXPA 4A2PA 3KKEA 1QU3A 3A1SA 3LI2A 2J67A 3P52A 4M87A 2GESA 4Q39A 1GAEO 1NVTA 2B1RA 2X4IA 4Z4EA 4O08A 1B15A 4JD5A 3R5KA 4RENA 3AIMA 3ZU3A 4TKVB 2O8CA 2OV1A 1IZ7A 5BW8A 2VEDA 2WF5A 3H3XA 4CU2A 4JT9A 3N8NA 3KJGA 4Q34A 1Z2AA 4LHSA 3NGXA 1DC6A 2OR3A 3OE4A 4D80A 2N9UA 4FZRA 1EBFA 3GDOA 1XRMA 3SXJA 5B12A 2Z09A 4GSYA 4BC0A 5BN3B 5GJCA 1FEZA 3KKQA 4MQUA 2CW5A 1IOLA 2ADOA 3DV0B 3RS7A 1P5RA 1AD2A 2HDWA 2YV1A 2QN9A 3A4MA 3GRRA 1JIKA 1FBNA 1P2FA 4UREA 4EKDA 5TV2A 1W1IA 3W7VA 1RZRD 1UAAA 3QI7A 1E2NA 2XT0A 2OZKA 3FGOA 2NSJA 1U3UA 3PFWO 4KMRA 4KLAA 3UJNA 1TMOA 1IJEA 3P45A 1OWNA 1WKBA 2IHUA 1XRSB 2Q6OA 4G4JA 4P4NA 5F78A 5ALNA 4C3ZA 1J90A 1KR2A 2RHMA 4DPKA 1OB5A 3DMDA 4RGQA 1BEZA 3L1IA 5LPNA 4RA9A 2VSFA 5AI6A 3O9MA 3OQVA 4GM4A 5EXPA 5IDYA 4TKVA 2Z2JA 4DR7B 3D3JA 4KYIB 4MQFA 4QL3A 4EHHA 4EX6A 2BFMA 2OVFA 3OEEA 4YAEA 3AWDA 3IVGA 3HCWA 2RKWA 4JX9A 3KXLA 3FA2A 3C1AA 4NU6A 5C80A 4FQ5A 3WNBA 1LSUA 1DLJA 1XKLA 2I7DA 4BBAA 2CNLA 1NYLA 5ECWA 2BEKA 2CCGA 2OZPA 2W2TA 3A4LA 4M36A 3T5MA 3ZE6A 2C5BA 3N2YA 3NDPA 2FX3A 3QEJA 4MP6A 4RLSA 2I7VA 4TTSA 3O8RA 1AHHA 3LT2A 2BEVB 2GM3A 3CRNA 3SZLA 4I55F 3QMMA 4IV8A 4UNNA 4F84A 5IBCA 1Y9DA 1DFGA 2W00A 5E4TA 3NFYA 2ZR9A 2VJCA 3LCRA 2G80A 5DSZA 2DVMA 2Q7XA 3HUDA 4ETNA 2CWWA 2QB5A 4N8EA 1ECPA 1V2HE 3R5JA 1FW6A 2OZVA 3CS3A 5BVHA 1S01A 1PUIA 1SC3A 2O1WA 2RJ3A 3OC6A 3HCEA 4LJKA 4QGHA 3W8FA 4FFVA 4JVLA 4KR9A 5TGZA 1U5BA 2PBFA 4MGIR 5F9HA 3T9FA 3CG0A 1FU4A 2C59A 2BSAA 2ST1A 3D0KA 3KOMA 3V8EA 4WJLA 2XEDA 1NJSA 5DYTA 3V2GA 2D5LA 2B7CA 4PSVA 3VYSB 2JK1A 2ZAYA 4ZAWA 2BBTA 4PHFA 4EZBA 4LYYA 4BO1A 2BRUC 3H9GA 2RHHA 3R20A 4Y1EA 2NMVA 2R7KA 1VIVA 3CKKA 4N0DA 3K8QA 4XX0A 4F45A 2VHUA 3R8CA 3GJYA 5AVTA 2OHXA 3ETDA 4X90A 1FNBA 2F1HA 4XVQA 5H4GA 3AT1A 3TUJC 5C4IA 2IHTA 1WIWA 1L5FA 3GY0A 3P94A 5IHXA 1EXDA 3F4LA 1F8UA 2GEJA 1E9EA 2GPAA 5FAXA 1X1CA 4F0JA 2XZLA 3QV1A 5KQGA 4I19A 1FRFS 4M86A 1ESNA 1AUPA 3WRXA 4LF8B 1XDZA 3NQ41 1NNUA 4PX2A 3FCOA 3UMJA 2QU7A 3AOGA 4O0LA 4KGVA 1J0AA 5K3FA 2QR5A 3L6OO 1ORTA 2JLRA 3GN2A 1QOPB 2V7PA 3BL8A 3PKJA 4G5RA 1RYBA 4ND1A 3ND6A 5IT5A 5CXQA 3EDMA 1WZIA 5B1HA 1FFHA 2GXSA 2OV3A 5K0TA 4DV2B 3O0DA 3EBLA 4CFYA 3PGKA 4TL6A 1II9A 2BGLA 1AKQA 1LJLA 1FTSA 3B5EA 4RV5A 2JGJA 1Z3IX 5FHRA 3KQYA 1A8IA 3A1UA 2GX6A 3IPXA 4GFDA 1RU3A 1G42A 2YFYA 2ZIEA 4H17A 3ZWMA 4JB2A 4BASA 1GL9B 4G1MB 4XFJA 5IXYA 2HAEA 3DPIA 1MC5A 1ULAA 2IXDA 4GC9A 4LRUA 1OU0A 3HLTA 5KDOA 1D7AA 5H82A 2J7PD 4O4JA 1B14A 1PNTA 1I3MA 1QJCA 1P9LA 2GEVA 4QTZA 3MTJA 4V02A 1Q95A 4WT7A 3E53A 3K2EA 2KM1A 3JPWA 4QVIA 5DLPA 5EIOA 5FP0A 2PR7A 1L7EA 2QTMA 3ACBA 3KSZO 4GZMA 4EQZA 1K4YA 5D6OA 1BHQ1 5ICCA 1QO7A 1OZ0A 1LDEA 1KERA 1XEWX 3GDGA 4B6RA 4PYJA 1XTKA 3C1UA 1S5PA 3CUWA 3H5AA 1WY7A 2CLSA 1YSCA 3H2ZA 4C1NA 2ECPA 3B85A 3MMZA 1ECBA 3V34A 1X7WB 3DEIA 2D7CA 2RGWA 1SOWA 2I6QA 2R1ZA 3RYCB 2BFPA 2NUPA 3MMNA 5EINA 4BJ6A 4ALMA 4W6ZA 4W4TA 1NOJA 2ACKA 1DOAA 2PUJA 4MVJA 5REQA 3W2HA 5M7EA 1JYFA 3W5CA 4ISBA 1IMJA 3AO0B 3M6AA 3OZWA 4I3FA 4X41A 1N2GA 5FUBA 4B3CA 5JO0A 4TYNA 2QS9A 2PX5A 1CZRA 4L51A 4QLBA 4HRXA 4ZAXA 1UOQA 3FFTA 3FLEA 4DLBA 5LDDC 1DLIA 4I46A 4G8JA 2XZDA 1GR0A 3NH9A 1JEDA 1Y6QA 1AUXA 1EXWA 3TJRA 3OM8A 3Q8MA 2VHZA 3SHVA 4YIKA 1JIQA 4FBMA 4C04A 2WICA 3OU6A 3E7XA 3K3PA 3Q3EA 5EZYA 3U3MA 4D4LA 3IBCA 2CXXA 2Y0DA 1ESZA 4ZAVA 4D4HA 2D4AA 2WIFA 3R5FA 3UMCA 1A88A 3CZCA 3F74A 3HWSA 2D2FA 2JJ8A 4HZIA 4MI6A 1ISRA 5JDCA 4TTVA 4XFDA 2PX3A 4M8SA 4U0KA 3PEUA 2XUDA 3UQYS 3U09A 3I0NA 1E61A 1M5TA 3L8MA 4HB4A 3I37X 4TRJA 4BP9A 1JVBA 2ZI7A 5BQXA 4DT1A 1QANA 5A62A 1Q1NA 2IHVA 1ZXLA 4LJ9A 2E5WA 4Q4JA 1V4VA 2CYBA 3GYBA 4LDQA 4WBNA 3F98A 4GH5A 3FIJA 5ALQA 3F6PA 4RVFA 2PS0A 4L7QA 2CHGA 2R68A 2O14A 1IY2A 5T57A 4ZI7B 4UTRA 2AL7A 3E18A 1DAHA 1RI1A 2UYYA 1XJWA 4LNUA 4UVDA 3SN6A 1FX1A 1F8XA 2FPMA 3FG9A 2OYCA 2EFJA 4N3GA 2Y0CA 3SX0A 3I2YX 4QWWA 2Q1SA 3PS9A 3ND8A 2ZANA 4UE3S 1MENA 2AK2A 1MG0A 4DAEA 1ZSNA 3M9LA 1UIMA 1J99A 1NNSA 1O57A 4M83A 3D3WB 1SCAA 1QC5B 3K9BA 1IY0A 1SBYA 2G1KA 1RM4A 2GYUA 2QWXA 5EHQA 3DTNA 4IVPA 4Q3OA 4C76A 3NBZC 1SQGA 3NKLA 4TMYA 1IM8A 1HQYE 2NT4A 4R16A 3TVDA 2V1UA 1WXGA 5IN4A 3DO8A 5TJ9A 3C5VA 1QIDA 1E59A 1JSZA 2ZSDA 3CWCA 3KVOA 4JI2B 5BWNA 1R66A 3OIYA 1XNQB 4ZZ0A 2NSDA 3CE9A 2UKDA 1JDTA 1KEEB 2WMNB 1IUOA 1U04A 1V26A 2YXEA 3GF4A 4I8IA 5AVUA 1EZ4A 1RWVA 4QOGA 1Z0AA 4UD6A 1N6NA 4QBGB 2X2PA 4EQ6B 2YXBA 3EF3A 1SUCA 4EYEA 3L06A 5EI5A 5FYQA 2O8FA 3RIYA 3UJ3X 1W35A 5JH7B 1QK5A 4RYLA 2XBLA 5K4AA 1Z5ZA 3GLHA 4OHYA 3UV7A 5BSWA 2PXHA 1VE9A 1T5DX 3OQIB 4AVYA 1XMSA 1PAUA 3AG5A 2WQ7A 4ZOLF 1C0LA 1HYHA 4G37A 4JIMA 4LJAA 1MO6A 2CV2A 1VOTA 3ZCTA 4BVGA 3MJRA 4OX9Y 2GCOB 3KTDA 2ZXUA 1R1DA 2VWHA 1MEEA 4PTYA 1UBKS 4R05A 1KMQA 3GHYA 3CLVA 1IJFA 1CDEA 3OOHA 5IUKC 4Z5XA 4MVYA 4R6WA 3V3TA 3BMOA 1DV2A 2Y9MB 4RPJA 4MDYA 4PSDA 5C8YF 3MMSA 1A8SA 1YKGA 5G1NA 1KY2A 1QWSA 2G3YA 5F52A 4M1EA 4TM8A 2JEOA 1E3JA 2V4UA 2ES4A 4GRIA 3CGGA 5EEHA 4U9HS 1HGXA 4WNYA 5AQ1A 5HZGA 2ZIFA 4WOKA 1XCPA 3JD0A 3TQHA 5ERXA 2PKEA 4PGHA 4L02A 5LMUB 1UWKA 2F1IA 1R0KA 2C2MA 4INOA 1WO8A 4U39A 3WWCA 1Y6GA 4RSGA 5B4TA 3OKCA 2PYDA 3GGCA 2AC2A 3P5SA 3VNRA 3WKDA 5FA8A 4MQMA 5AKXA 4JLPA 2IHNA 5FOXA 1GKYA 1WXFA 1AQNA 2IY7A 3D0RA 4MITA 3KZXA 3E9DA 1PSWA 2AC4A 1GFSA 3WX0A 3BF7A 3HU5A 2ZBVA 1ANKA 2HGZA 1RAAA 4H1UA 1N5LA 2BSQA 1TO6A 4AULA 2ZB4A 1KQPA 2FJPA 3LPCA 3DFFA 4YRBA 2DHQA 2ATXA 3IPLA 1UEXC 1E8MA 2XYQA 3SC3A 5K0BA 4ZO8A 1JAHA 1NIPA 2VNKA 3BK2A 3HJRA 4I6GA 3WG9A 5IRCD 2YMPA 4JYAB 4HQ0A 3FSGD 4LTMA 2YVAA 2CNOA 2CLLB 1U0FA 1W0KA 2CUKA 5K4GA 1R9NA 2WT9A 3TGLA 3GJZA 3L18A 3Q98A 2BTEA 1NJ8A 2PA3A 3HYCA 3DBVO 1PR5A 4GX1A 3T61A 1MJNA 2VO1A 2C2WA 1E2DA 2O2YA 2WUEA 5LMCA 1LJ8A 1QKJA 1ORWA 3VR3D 3VZQA 3IIEA 1VRWA 1U0EA 3KSDO 3CVYA 2CDCA 4UFNA 3F3YA 4MXDA 3TD9A 3CF4A 5HTOA 3N6RA 1EFUA 3DOOA 3MGAA 3AF4A 4M60A 5L95A 1PGNA 2FV8A 3THXA 1MAHA 3IEPA 1X7WA 4PVDA 1TMGE 1YCHA 2ZR8A 4Y0VA 1SVWA 5G0TA 1ZL2A 3TDNA 4IP0A 2P7HA 4PRZA 2QZZA 2FDCA 1CCWA 2E4AA 2WVHA 5DHQA 2G9NA 3SGLA 2UYHA 3PSHA 1FYFA 3WL8A 3EQ6A 2NO0A 2Q46A 3U0VA 3OURA 4J6FA 4HJXA 5E6RA 1IU9A 3AJDA 4O29A 4P38A 3PPWA 1ABFA 2X4LA 1Y9AA 2AZMA 4UKDA 3NPAA 5CFRA 1QE5A 4OGGA 5HIKA 2Q4DA 5JT1A 5CNKA 2O50A 2NWQA 3I04M 1RQGA 4EA9A 2VA9A 1WUTA 4Z1OA 5HM6A 3LOPA 4BZPA 1PV1A 5DOZA 4LFBB 4LCJA 2R5WA 1OAOC 1N2CA 1C3XA 2QTZA 1LC3A 4WW0A 3Q2IA 4PRYA 4IVQA 2AF3C 1BO6A 1OTHA 1XX6A 3KB8A 4O8ZA 3OY7A 1PBNA 3HJFA 1D6MA 2JW5A 3VBCA 1NFFA 4B5LA 1XTRA 1W76A 2JAWA 2ODTX 1Z83A 1W25A 5FNVA 2IWRA 3O0TA 1RZUA 2ZSBA 1I7LA 1KL7A 3L7OA 4JA0A 2HT1A 1Q57A 5JJIA 3D43A 1YQTA 2DC1A 2I78A 1GP2A 2A3RA 1GITA 4M89A 4IRXA 5F33A 1SCDA 2M98A 5DYWA 1KO8A 5H68A 5JY6A 1JLHA 1MA3A 1U9JA 1U0NA 1E9RA 4ZALA 3W4IA 2OBYA 2ZRIA 4FFMA 1POXA 4I99A 4N5MA 1BVRA 5K20A 3GGGA 2VYVA 3TPFA 2VHJA 5GJWC 1PQ4A 5IK2D 2DY1A 3IQDB 4WFKA 1N2EA 4BTEA 3EK2A 4MV3A 1HTTA 4HDSA 2NVBA 3QXGA 5G0WA 2VJQA 3JVEA 3SXUA 1K89A 2VQDA 1K92A 1Z5VA 3MWEA 1OXXK 2VBCA 1E63A 1LV8A 1XZFA 2Q4OA 3JR7A 4CN9A 4Y2XA 1J33A 5FUYA 3V42A 1WCWA 4P5EA 1Z12A 1A50B 4D46A 3ZDAA 1IVNA 1G20E 3FZNA 4HNRA 4Z8YA 4ZAFA 1VJ0A 4O4IB 2XUJA 1LW6E 1KMCA 1BHJA 1GKIA 3BFKA 3WK8A 3ZI7A 2CUZA 4KJZA 5H9WA 1NF3A 2C5SA 3HXTA 5GPBA 2CXQA 4H35A 4V0LA 1GGMA 2R96A 4K6MA 2FI1A 4TKLA 3UXHA 4EOGA 1KQGA 5FA6A 2QN1A 3I4FA 3MAJA 5EL0A 3PF9A 4YP9A 1D5CA 1UC4B 2ZRHA 1EDDA 1Z3CA 4MV4A 4MVJF 1DRJA 3A2LA 4NYIQ 2EBFX 1Y82A 1A7AA 3AFIA 3D4PA 1YI8A 3LW7A 2ZPUA 4KGZA 4W1QA 4BKPA 3GQBB 5ALSA 1CZLA 1WEKA 1L4KA 2P27A 3ELUA 2DY0A 4IZ6A 4II7A 4PLZA 3TNFA 1UANA 4MVJG 2FAXA 1T36B 4ESOA 3CNHA 4QDTA 5BSGA 4OLFA 3OLWA 4XOIA 2EL9A 2COUA 2B6HA 1WSAA 3LO5A 4K9MA 4WV3A 1EXMA 4ZVLA 3GLFE 1NBMA 3RFUA 4RF3A 4C4SA 3WFZA 4YRFA 3CVVA 3IO3A 4U7GA 5BV1A 3NHPA 4Q3NA 4K05A 5CHYA 2YIDA 2I66A 2W83A 2WNHA 4KAXA 5ELLA 2PUTA 1NAHA 4UJ5A 3KR1A 3ZGZA 1YCDA 2ON6A 2RG1A 3C70A 4IIJA 1V3QE 1Z82A 4EJSC 3IJ5A 2QQFA 3QEBZ 3HWWA 2MYPA 1ICEA 3OP1A 1OA0A 3NHAA 3NO4A 1Z4MA 1K8YB 1ODIA 1SG6A 4HDQB 4XJVA 5LWQA 3BRSA 1D9ZA 1B0ZA 2XGOA 2YZ2A 1PKXA 3RUEA 1DCKA 3W4JA 3RSQA 3TQFA 1E6KA 1FP7A 3BJIC 2FG7C 4ZYUA 3R5HA 1UPAA 1VJDA 1XLWA 4BV2A 2C8JA 2VYCA 1SCBA 1Z16A 3EXG1 4AZTA 2FDXA 4JASB 2HWKA 4M98A 2O8DA 1UZAA 4QICA 4AF8A 5BQ3A 2E0IA 5EC8A 1JQLB 4K6FA 2BMDA 5IULC 3QJYA 3SI7A 4HWGA 5DT2A 3LVBA 4O2AB 3AFNA 4FKZA 4J90A 5CIYA 1MB9A 5H8WA 1RM0A 3T0FA 2QM7A 1QP8A 2OILA 4Q7LA 4F92B 3F96A 1MO3A 2C9OA 1OFHA 1QFSA 2PS3A 2VS1A 3IBSA 5B36A 2XTMA 2XUOA 3T9BA 1BEEA 3EIXA 2OZEA 2GAOA 3WK4A 1TIKA 1EEXB 4ND8B 1XZIA 3DW3X 2JGAA 2ZRQA 2GFIA 1OYWA 2AJLI 4UU1A 2LWIA 3ZHYA 2HMSA 4RZ3A 1XF9A 1UBUS 2IF2A 2A5DA 4EKNB 5KYTA 3I62A 3T3OA 1LDYA 2V7GA 1RLUA 4JGIA 2JAPA 5BYKA 4MGKR 3KDAA 4Y9DA 3HCFA 3BBPA 2NXJA 2W6ID 2H1VA 5ELMA 4BNZA 3DTVA 1RRGA 3HY3A 2V65A 1LLDA 1AUQA 2OK7A 3NBFA 5IXSA 1VC2A 5CAEB 1MB0A 5HBGA 2LUOA 2WJGA 3WLQA 1WMSA 2CMFA 3RR2A 4EJFA 1CIVA 2CV1A 1CFJA 1XZPA 2D2XA 3K5PA 3GGPA 1DB3A 3NDIA 4LZJA 4N3CA 5LQRA 5B7PA 1Q50A 2PNJA 4DC0A 2XCQA 4MRSA 2D0DA 3I04A 3HDGA 3SLRA 3TYXA 3A1NA 1CY6A 1K97A 3FVVA 4FYIA 2QN3A 1NF2A 2UZAA 2ZETA 4HGQA 4H0CA 3UB2A 1DJMA 3OZTA 1NASA 4C0QC 1YS2X 1A4XA 2VJOA 1CW2B 4ZMRA 2XKJE 3IX7A 3DDWA 3HI6A 1UDRA 1NFRA 3RRFA 1QCDA 3MGCA 1SVOA 2YV3A 4GLOA 4IWYA 4EL5A 1CRWG 1W8IA 3ITNA 1EXNA 4RKYA 4YUVA 2XIJA 2B6NA 1SCQA 2VK2A 4GM1A 4DS3A 1FY2A 3IELA 1WP4A 1UFKA 1LXCA 2DTEA 3ZK8A 3S2UA 3U60B 4MDEA 1IXYA 1BN6A 1IPHA 5IHPA 2JFOA 1T2EA 2HBZA 3QUCA 1KI3A 3HKEB 4Z4QA 5TQJA 5L7WA 3KYBA 2B37A 1PJRA 1E8DA 3LD9A 5D5QA 2X9LA 4TV8F 5A4DA 2O2ZA 2FE4A 2JIZD 1GT6A 1YRYE 3PKZA 4BJ3A 4F2PA 1QZUA 3V7NA 1T5IA 4OHZA 2WJ3A 2X8JB 1NUTA 1I4DD 1QO9A 3AV3A 3FSEA 3KUDA 4D0NA 5DBHX 1P2DA 3X1YA 1XVIA 1ZO8A 4BNFA 4DCGA 2IS4A 4AN1A 1OROA 3ETLA 5JI3E 2CVFA 2YVKA 4YAFA 1RXCA 2ORWA 4LOAA 1XC7A 4LSMA 2DWPA 3EUEA 3NYWA 2W6NA 5DP1A 1ZRSA 4BNDB 2G1UA 1WJGA 4YY3B 1Z18A 3GA7A 4YONB 4A6XA 3NYRA 2VATA 2BEJA 2DQSA 3EWAA 3KT8A 1YULA 2C54A 4WN9B 1E66A 1U31A 1YZNA 4G5YA 5BRJA 3EPJA 5ENDA 1SC9A 3PC2A 1C8BA 4FB4A 4DIKA 2GVDC 5SYAA 1D9XA 4LOIA 3TAUA 3RI3A 4ZRMA 4AZSA 4WN9A 3AEYA 2AYXA 3HA3A 1VZ2A 4HEA1 3T9CA 5AHRA 1UJ4A 3TINA 1AO0A 3L0BA 4AKSA 3HKBA 4ZFNA 4HEA6 3LBYA 4BUJA 3K9HA 1SOMA 1POWA 1Q0UA 1QIEA 3BQ9A 3WZ2A 2UYCA 5JJKA 2IP1A 3WRXC 1PFUA 1O96B 4TKZA 4ZCLA 1GY8A 1UAGA 3ELYA 1BJRE 3IUYA 5KAMA 1IEVA 4HH3C 1QFXA 2DF8A 2Q6LA 1WQ3A 3IV9A 5FORA 1B8UA 1E3TA 4X20B 1LFDB 2C4TA 1Z45A 2AUNA 4LF5B 3CXUA 3FYUB 4V2IA 4C5BA 4HAUA 3SYKA 4EBFA 3H2IA 6AT1A 3PZRA 4B3FX 2RH5A 1ULTA 4CKYA 4J8PA 1B7GO 2P3SA 3U7EB 4K3UA 1BHSA 1J09A 1UWLA 2GJSA 3ZK9A 4CR8A 3UK0A 2I71A 5IM4A 2DEUA 2O2DA 5JC8A 5HRAA 2EKPA 1W8DA 3H1TA 4I1SA 4ZHQF 1D8TA 3LUHA 2J3MA 4YK7A 3G2LA 3ZY4A 3ZWOA 2E21A 3O4FA 3KYDA 4B33A 1G60A 3WIBA 4H6PA 5JECA 4H7DA 2H1IA 1M73E 3JAWB 2BGTA 1KU6A 3IE2A 4JKIA 1LWOA 2YIMA 3TN7A 2WYVA 3UM9A 4BS9A 5FJJA 2HFKA 2R65A 2JLXA 4KDRA 2K5UA 2QY9A 3K53A 5TGTA 5BMOA 1FF9A 1UH5A 4M49A 2JFVA 1MW9X 3EEYA 3V1KA 1FIUA 4JU8A 1RQLA 1SU6A 4M0EA 4A91A 1X7HA 1D7OA 3KVRA 2P0YA 1R0ZA 5COQA 2ZCUA 2ZSFA 4H3HB 5DHUA 4Z9BA 1RKXA 1UT8A 1L5QA 4LYAA 5FI3A 4EY5A 4V0QA 1BU5A 3MYRA 3QNWA 1FNSA 2HL6A 4RX1A 2BZ1A 4UMDA 5DM1A 1GTG1 5DTQA 5IBQA 4A7PA 2QV0A 1KO5A 4E5SA 4XYEA 5CFMA 1MX9A 5JADA 5JRZA 4DV1B 1T8YA 1DQRA 4H4CA 1ICIA 3BWXA 3C43A 1OT3A 2B2XA 1VE3A 2XJ4A 1G66A 3CN7A 4PCUA 3DMFA 2Q2OA 3BWBA 2DM6A 3KOOA 3PGLA 5AW6A 3A6KA 4DSNA 4QGSA 5ALWA 5JXGA 2NGRA 5DMXA 1HDCA 2B8JA 2QTGA 5K0JA 1T9AA 1R0YA 3OESA 1UWCA 2A33A 4YI3A 1O95C 3DF7A 4J07A 5IDXA 1QAQA 3B1FA 2RH4A 4PZ9A 1E1RA 3VMFA 3GP5A 1GTRA 3ZJYA 1S8FA 1PFQA 3LCJA 1DIGA 3H1AA 3M6MD 4QHSA 4LXXA 4B47A 4GF5A 1PZFA 1D1PA 2H92A 5F9MA 2OAQ1 4P98A 2B9VA 3VI4B 4F3NA 1B8NA 2BE7A 4DNXA 2PIDA 2DFPA 2HKIA 3NH6A 1QQ6A 3K7EA 1V25A 1H94A 3N8DA 1PWXA 4N7RA 1VJTA 4EY6A 1AHPA 1DTEA 3EF1A 3Q7EA 2UV8A 2HSJA 5LXTA 3LFUA 4O2AA 4ZQBA 2BR5A 1KSGA 1OX4A 4WKCA 3IKTA 2I6UA 3VHXB 1GAJA 1O8BA 2QJOA 1GZHB 2WD7A 3P9CA 1YRLA 4P6VF 1KPHA 1ID1A 1ZD4A 4P1ZA 4CNBA 5KJEA 1Z17A 4UOZA 3BJRA 3UK6A 1C9NA 4IEEA 3I8XA 4YCBA 1OH5A 5K3EA 5GADl 1VE7A 1JDSA 2GXUA 2R6HA 2CB0A 4XWOA 4QPNA 2H5IA 4UUQA 4KO2S 2WOJA 2HN9A 4IVNA 3THRA 5EJ7A 2OB2A 3CJQA 2ZZKA 3G7UA 1I30A 1SK9A 2QOEA 2HQSA 2C8VA 3MILA 2AR7A 2FMXA 3AKYA 2QSUA 3R6WA 3QHPA 2QD1A 3PFFA 4HJRA 1YVUA 2H7XA 4V39A 1NJ2A 1DBSA 5A4AA 5LYJA 3FYTA 3TECE 1Y34E 2I80A 3OOJA 5DEOA 5E2IA 1J8YF 2LKCA 2XUAA 1EESA 4G65A 2JHPA 3UK1A 1X14A 1NW4A 1PZNA 2PU5A 3G2HA 3BQNB 3QP9A 1G20A 1XVLA 3FN4A 1J8DA 1EUCB 3EGWA 2IQIA 3PXDA 1Z4OA 3OE7D 4GYYA 2WJ4A 5EHIA 5T6BA 5B58C 3D7RA 1Z5OA 5LBUA 1G4AE 2DZDA 2ZJBA 2VPIA 4Q9JA 3DXFA 4JOBA 4TWZA 4U7FA 3TVYA 3SM9A 3CZPA 5B6PA 1LBQA 4CM1A 3H1FA 3TBFA 2EC5A 2IUEA 4Q1CA 5HOQA 8ABPA 1B43A 4MVJM 1N34B 2OCPA 1U4SA 4RKWA 3QBTA 3R7WA 2COEA 4BFTA 3CNOA 3HHEA 3L7YA 3O95A 4RJJA 1RZRA 2H2FA 3IPCA 3FPHA 4O1HA 3H11B 1NN0A 4XR9A 5FV4A 4QNMA 2NXEA 3E9MA 2GB4A 4G5FA 3JQBC 1JEJA 3II6X 1KDZA 1NI4B 1J2TA 3OPNA 1E0JA 3DEAA 1WQ1R 2GHTA 2O0KA 2B4RO 1G5HA 2OZLB 3JALB 3LC2O 2QVCA 2IEDA 3DZHA 1TGVA 5DI9A 2RJOA 1QBGA 2FGJA 3LDGA 3PVCA 4O4IA 4ZTBA 4Z4FA 2BCGY 1PL0A 4MR9B 3I4CA 3L7KA 2FPOA 1M10A 1SULA 3HBNA 3DE5X 3OLYA 3TIIA 2I3GA 1EE9A 5EKXA 2NYUA 3ANTA 4RANA 5H1YA 4B6EA 1ZS9A 1UBFA 1UXJA 1RPAA 3FETA 3PYMA 1E4EA 1ABBA 3FNQA 3OJ0A 4WRRA 1EPUA 1I3NA 3QPWA 5CLLA 1GTJ1 1N9ZA 1GD1O 4D82A 2H1OA 1IZYA 5AHOA 1TXGA 3PDCA 1H2HA 3QQPA 1SXJA 1S3SA 3DBLB 3LNCA 4NI5A 5JCXA 4A36A 1TZJA 2E89A 1UJNA 1TZCA 5EKUA 4L5AA 2D2IA 2FZ4A 1A2OA 4DQKA 1MIHA 2GAAA 1E2EA 1PEYA 3AFGA 5IWCA 2OFFA 2OGSA 3Q9UA 4JQCA 1CRQA 1YJ8A 3TRDA 3I45A 2HA6A 3MHTA 4PCLA 2WJWA 2A5FA 5BY2A 2ZWAA 4O59O 3V2IA 4CIAA 4R9RA 1I3LA 1M7HA 3K5IA 5BV8A 4I4TA 4ZVMA 4MIYA 4EHKA 4MWTA 4DLNA 4DL9A 1ADYA 1KI8A 4LC0A 4CWAA 3IAM1 2ZUFA 3GUUA 3OZCA 4ZVSA 4RTJA 2H2GA 3DDCA 1NM5C 3DS8A 5J1TB 3VO1A 4OHPA 3A1VA 2GGSA 2R1UA 1V3UA 2RI1A 4GUDA 4OYYA 4QU0A 5BMVB 1G21A 1GDDA 4HFMA 1NE7A 4G3XA 4YJ2F 4IDOA 5GP1A 4CCWA 1FSFA 1RRFA 5CB4F 3CBGA 3FPGA 2ZVJA 3PUHA 2KWIA 4KWHA 3RD5A 3I09A 4RACA 1KP3A 2WYHA 3H17A 3N2NA 3ZDRA 3VAYA 3QY9A 3WE7A 4FS8A 4G84A 5B7NA 2J0UB 3P2EA 3KR2A 4YP7A 4NU0A 3DD1A 3FNRA 4LWOA 1DWPA 3IVRA 4L08A 5E6SB 3WFIA 3R8XA 4F5WA 2PWYA 2UVDA 4YUWA 3UYLA 4B7ZA 1NVFA 2FB9A 2UVPB 1Y7LA 2HU8A 4YAUA 4ZARA 3M4NA 3AEKA 2OXIA 1G8FA 1M6YA 4HXYA 4QOIA 4URZR 1O8CA 4NBNA 3DT9A 2D54A 2GDJA