3U0VA

Crystal structure analysis of human lyplal1
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
222
structure length
222
Chain Sequence
LQRCIVSPAGRHSASLIFLHGSGDSGQGLRMWIKQVLNQDLTFQHIKIIYPTAPPRSYTPMKGGISNVWFDRFKITNDCPEHLESIDVMCQVLTDLIDEEVKSGIKKNRILIGGFSMGGCMAMHLAYRNHQDVAGVFALSSFLNKASAVYQALQKSNGVLPELFQCHGTADELVLHSWAEETNSMLKSLGVTTKFHSFPNVYHELSKTELDILKLWILTKLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Lysophospholipase-like protein 1
publication title Crystal structure of the predicted phospholipase LYPLAL1 reveals unexpected functional plasticity despite close relationship to acyl protein thioesterases
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 222
sequence length 222
ec nomenclature ec 3.1.2.-:
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3u0vA00
4C4XA 3AJAA 5A6VA 1JU4A 4FKBA 5HCUA 3FBWA 3FCYA 4G8DA 1CUUA 1THGA 2WU4A 5KWIA 4OPMA 3WK7A 2OCGA 1ACJA 1XZMA 2XMBA 1UOQA 1K63A 5CH3A 1L7QA 2OGSA 5ALSA 1E3QA 4WFJA 4M0FA 5AM0A 4FFVA 4TGLA 4AO7A 3WKEA 3LLCA 4L9AA 1O6GA 4K6KA 1XQYA 1CUEA 2Z8XA 1CUCA 3STTA 4N8EA 4BC1A 2HA5A 3C5WP 4OB8A 3AZPA 4KEAA 4B0OA 1TKRA 2H1IA 1KU0A 3QBJA 3N2ZB 4U2EA 1BE0A 4GHWA 1DWPA 1QLWA 4FTWA 3ZWQA 4BCDA 3FVTA 4QA9A 2ZYSA 1LPNA 5JADA 2B4KA 3SK0A 3STXA 2OCKA 4LXIA 2VJAA 3O4JA 4Q3OA 3WWCA 5IVIA 3G9UA 3ZV7A 4G8BA 3W05A 4IH1A 1F6WA 1CQWA 4FWBA 4XJVA 2JGIA 3E1GA 3WIBA 2EEPA 4EUSA 2WKWA 3LIPA 2HA0A 5K3DA 3RKSA 3BL8A 4QZVA 5D7BA 5LZ4A 5CH8A 2XMZA 5AKJA 1U65A 1XZFA 1EHYA 4AMYA 4HXGA 1HDEA 4Y2YA 5T4BA 3WK8A 3MUNA 4Q3KA 3FLAA 3H1BA 1XKTA 1WHTA 2H7CA 4EY4A 1G4HA 2HA6A 3B12A 4DMCA 4IH4A 1EK2A 1FFCA 3WQHA 1ISPA 3V1MA 1QJ4A 3PI6A 2H9YA 5CXXA 2P8SA 1DT3A 5EFZA 1DX6A 1U8EA 5AO9A 4WCVA 5JD5A 1QE3A 2XDWA 2ZSHA 4FMPA 3ANTA 4B9EA 1H22A 2C0QA 5AM1A 5CMLA 4AZ3A 1QTIA 3G0GA 1SC9A 3F98A 2PU5A 3NGMA 5AK4A 5DYWA 4BATA 1LZLA 3I1IA 1VXOA 5DNVA 1R88A 5C8XA 4QE3A 3FSGA 5AKHA 5ALYA 4GEGA 1BS9A 3FCXA 4B80A 2PSDA 1FFDA 3QVMA 4WDRA 4HXEB 4C4ZA 4Y2TA 2PM8A 3EBLA 5AKGA 5CT6A 1XLUA 4B82A 3FLBA 1ZIYA 3SX4A 1CUXA 2AJCA 4J0IA 4G9GA 1ORVA 2VAVA 3JYHA 4AB1A 3W04A 5JAPA 3R3YA 1CEXA 2ACKA 4Z49A 2I3DA 3QZUA 3WL7A 4E11A 1CFJA 1HBJA 2AJ8A 4TPKA 2DCMA 3PF9A 1XZLA 5AOAA 1AGYA 4GECA 1T2NA 4DNFA 3FOBA 2ZJFA 4JH0A 4BZZA 5AI6A 1XRPA 4DGQA 2WIDA 4EY8A 1GKLA 1VKHA 1CPYA 2HIHA 4UBIA 4CFSA 2WIKA 5SYNA 3C6ZA 1R50A 3CXUA 2IX9A 3GA7A 1QZ3A 4ITVA 1EXWA 3M83A 3WJ2A 4B6GA 5CW2A 3C8HA 3HSSA 1XQXA 2XQJA 2FUKA 3WWEA 4OB6A 1EB9A 2ZVDA 4BDSA 5EIEA 3I2IA 4BC0A 5AKZA 1THTA 3K6KA 1CLEA 4EY7A 4H7HA 2ZYIA 4ZI5A 5AHXA 4X6YA 1YAHA 3FAKA 4KE6A 2H7XA 4CG1A 3I6YA 1P0MA 2XE4A 1VZ3A 4MEBA 5EIAA 3H17A 2ES4A 2DHCA 5C81A 4A5SA 3HJUA 4KAFA 3HRHA 2OXEA 1Q0ZA 1ZD5A 1W75A 3PF8A 1R1DA 5AI0A 1G5FA 1UK9A 2RI6A 2YYSA 4LXHA 3O4GA 4UBJA 5ALZA 2QR5A 3W9UA 3IUMA 3MVEA 1BEEA 2OQVA 3F96A 3I28A 4P9NA 1ZD2P 4FLMA 3FWHA 3DYIA 3EIOA 3PFBA 5AP9A 4AQDA 3OOSA 2CKMA 2C5FA 2WHQA 3VJMA 2HRRA 4ZXFA 1E66A 4UBOA 3NUZA 2WIJA 4JYMA 2VTVA 3T4UA 2XUGA 4X85A 4DMHA 3TGLA 5K3FA 3S2ZA 1CQZA 1MN6A 3DCNA 3AIKA 4QWWA 1LPSA 2CBGA 1BCSA 4X94A 4FOLA 4Q34A 2HHAA 5FP0A 4U2BA 2WFLB 1JT2A 1YASA 2JGMA 4WDQA 2XUIA 1BN7A 3R0VA 4BCCA 1ZD4A 5JARA 4CCYB 4CIBA 3M81A 4H7IA 2QS9A 1FFEA 1LLFA 4UHFA 3WZMA 3WKBA 2QJRA 5DTIA 2RAUA 5JALA 5ALOA 3O9VA 4AN1A 1UKCA 2WUFA 1WB5A 1EI9A 4EHBA 4PW0A 2XLBA 4YASA 2WIFA 1JMKC 1WB4A 5T4FA 1VOTA 3I1YA 3G9XA 1XRRA 1XQWA 5EI5A 3H18A 5HQ3A 2CZQA 3STUA 5ISMA 3H0CA 3NWOA 3QH4A 4Y2UA 4RPCA 3EF3A 3VXKA 3ZLTA 4HAIA 1ZGCA 4HS9A 1JKMA 1MX1A 4KE7A 4IQ4A 1YA8A 4DMKA 2WJ4A 2RONA 4PV7A 3C6YA 5FOQA 5ALXA 1B6GA 2D5LA 1H23A 3I2JA 4FNMA 3G8YA 5CXUA 1UXOA 5ALGA 4KAJA 4J0KA 1XRMA 4IO0A 1N5RA 3I2FA 2QXUA 1X70A 4GWLA 4ROTA 3DKKA 3HYSA 3D5EA 2XQGA 4Q3LA 4HRYA 1IZ7A 1JU3A 1VE7A 4X7BA 5E4YA 1G42A 3O9MA 3WA7A 3K2IA 5A62A 2AJDA 3VISA 2WHPA 4DSZA 4QLAA 4ZV7A 1XRQA 4ZGBA 2WQZA 3N0TA 5ALEA 4X90A 4BCBA 3GZJA 4WFKA 1CR6A 5AI8A 3FYTA 1UWCA 1EINA 1EX9A 1XZCA 1WPRA 1XZIA 4INZA 5AKXA 2J3QA 3RLIA 2XMSA 5K5EA 4QWMA 1XKLA 4Y2VA 5ALMA 1QFSA 3DDUA 2JGLA 4OCZA 4UUQA 1R3DA 1Q83A 4BRZA 2EDCA 1HPLA 2CB9A 1W1IA 2X8BA 4G9EA 2LIPA 1DWOA 4DNOA 2CMFA 4RGYA 3G0IA 1ZI9A 2Z3WA 2HL6A 2WJ3A 4N8DA 3DNMA 3KWJA 2I03A 5I8PA 4FLEA 2QT9A 4ZREA 2VF2A 1A8SA 2PU7A 1MO2A 4GI1A 2GYWA 3WKCA 3HXKA 1DQYA 3C6XA 5ALNA 3RM3A 1CIJA 1LBSA 3ANSA 5FLKA 1TCCA 3Q8WA 2RHWA 3O0DA 5LZ9A 1MNQA 1RP1A 1UK7A 3WWOA 3ESCA 3AILA 4BP8A 3WK5A 5AKIA 2J4CA 3UUEA 4U2FA 4Y2RA 3O95A 1WHSA 1UT6A 1WB6A 5DTJA 1QOZA 5AI4A 4Q82A 2XB6A 3HI4A 3C5VA 5ALRA 4PF1A 3DEAA 3FNBA 3GROA 4C4YA 4K2AA 3WMRA 1UOOA 3IUQA 5ESRA 5AICA 2VAXA 3FYUB 3S8YA 1AC5A 4LKOA 1Z68A 3ED1A 3G0BA 5BOVA 1ZI8A 3HABA 1XZDA 2XUHA 1YAJA 2JGFA 2OGZA 4OU5A 3WWDA 2Q0XA 2WTNA 1BN6A 5DJ5A 1AX9A 4BDTA 3PDCA 2OPHA 4W1QA 3QPCA 2O2HA 1G66A 1EVQA 4NVRA 1EDBA 5FDFA 3ESAA 1W4LA 3RARA 1YA4A 5AKEA 4Y2PA 5FRDA 3F8SA 1MX9A 4PSCA 4MWSA 2ECFA 5D6OA 1QIGA 1HKHA 2JGEA 1UKAA 1Y7HA 2XMDA 1ZJ4A 3DL7A 1R4ZA 1XRNA 2QUBA 1JJFA 1U4NA 2I3ZA 1DX4A 4BTVA 5LZ5A 3WKDA 3WKAA 2BAGA 3VVLA 2IIVA 2VATA 4X91A 4J0CA 4I3FA 4G1FA 1GPKA 1K5PA 4W1RA 4OSEA 1NU6A 3D2BA 4FHZA 3BE8A 3BF8A 3BIXA 2JEYA 4KE8A 3CN9A 5ALIA 1S8OA 1YB7A 4DNPA 4EY6A 3BDIA 3WIOA 1EH5A 3VKFA 4BYMA 5AM3A 5JZSA 4X00A 2IITA 4X97A 3HACA 4AXBA 1H2ZA 4QDZA 2YH2A 3P2MA 5CRIA 1EB8A 4C6HA 4U2CA 2G5PA 3E0XA 5KBYA 3WL6A 1SOMA 5IVHA 2Y2UA 2QKYA 4UBKA 1JJBA 3R41A 3AZOA 4X93A 1MAAA 4YPVA 1MT3A 4OD0A 4FLFA 3ZLVA 4UFOA 1WM1A 1KU6A 5D3KA 5I9IA 1TCBA 1Y7IA 3WJ1A 1U2EA 4BAGA 3HLKA 5FPQA 4OYYA 3AFIA 1L7RA 2ZSIA 1A8UA 1CUVA 4RE5A 4H35A 4P08A 5AKYA 2HU8A 4JNCA 3SWWA 1DWQA 1CUWA 5EHQA 5A7GA 1QFMA 2WFMA 5JAHA 3E3AA 3DD5A 1XROA 5HF6A 2O7RA 2J4FA 2ACEA 1LPAB 1TIBA 3D59A 4G8CA 4HTAA 5DNUA 5C8ZA 4C88A 1GKKA 3RK4A 2QUAA 4MEAA 1M33A 3IDAA 5A7FA 4QLOA 5LKRA 2RIPA 4ZWNA 2DFPA 5FV4A 3QMWA 5LIPA 2BKLA 2EDAA 2JF0A 4UHBA 3LP5A 1GQRA 1XZHA 1C4XA 3D2CA 3R3WA 1IUOA 5K3FB 4BE9A 2QOEA 2XUDA 1J1IA 5CT5A 5DLPA 2GYVA 4ETWA 2WLSA 1QIDA 4QDOA 2OQIA 2BFNA 5EHZA 4M0MA 5IH7A 4F60A 1CUZA 1CUGA 3KDAA 4L3WA 4DIUA 5HF8A 1PV1A 5LZ2A 4Y2JA 1C7IA 4LYDA 3T52A 4M0EA 4B81A 4RNCA 1IZ8A 2WFZA 3QMMA 3PUHA 2WILA 4B83A 1L7AA 1LZKA 4U2GA 4IH9A 2Z8ZA 1MJ5A 3DYVA 1SCIA 3EQ9A 4H0CA 1SFRA 3Q0TA 5IVDA 4PQEA 5C8VA 1CUDA 4LYEA 1XZAA 5LZ8A 3QPAA 2WU3A 3G7NA 5ALPA 3KSRA 4E46A 5FUMA 1JJIA 4MXDA 2HA4A 3BF7A 1F0PA 5HQ3B 1HL7A 1BRTA 2XUAA 2OG1A 1H2YA 4WY5A 4BE4A 1MTZA 2QTBA 1LNSA 1JI3A 2ROQA 5JAOA 3ZI7A 4S0XA 1T4MA 4EZIA 3H04A 2C4HA 5HK9A 1I6WA 2ZYHA 3D3NA 2I78A 3ICWA 4NZZA 2Y2VA 2E3JA 5BWCA 5H3HA 2XUOA 3YASA 1QIJA 3KWFA 2HU7A 4B84A 4BVKA 4CCWA 4QNNA 3OTQA 4BRSA 1TRHA 3LS2A 3PE6A 3I2KA 3O4IA 3WYNA 4QDXA 1ETHA 4FBLA 1W6RA 3WLAA 4OUKX 3CCBA 4J0HA 4GBGA 2WHPB 3O4HA 2AJBA 2OAGA 1P0PA 3A70A 5CURA 3QYJA 5AIBA 1NX9A 1K6EA 2O2GA 4MYDA 4O08A 1MX5A 4QDUA 3BJMA 4C87A 2OCIA 3H2JA 1E8DA 2ORYA 1SCQA 2R8BA 4K6HA 3V1KA 4A23A 1IUPA 3BXPA 3AINA 1JMYA 1QIIA 2XLCA 1KEZA 3B3QA 1VZ2A 4B0PA 4GDMA 2JBWA 1K4YA 3C87A 2XUPA 4DLNA 3V1NA 3STYA 1X2BA 5AM2A 1ODCA 5CBKA 4GW3A 4X95A 5DNWA 4BTLA 4D9JA 4Y2QA 1MNAA 1CUBA 3C70A 3NOXA 4WY8A 3WK4A 5ALDA 1BROA 5AM5A 1N8SA 3L1HA 4X3CA 3I6ZA 2XUQA 1EA5A 1R9MA 4XX1A 2FJ0A 2PKYX 1UK8A 2PVSA 3IUJA 2WFLA 4UFNA 1MAHA 1XQVA 5BV7A 2PSEA 4J0JA 2XMCA 4KRYA 5AKKA 4CG2A 4DMFA 3G9ZA 5ALUA 4PSDA 4B7ZA 5LZ7A 3GBSA 4EA6A 3CCCA 2DQZA 3HZOA 4H7EA 1TQHA 2AXEA 1DTEA 2W6CX 5JIBA 1ORWA 2XQKA 1GPNA 5JYCA 2OAEA 2PSHA 2PX6A 2WM2A 3ICVA 2OLEA 1GZ7A 4L72A 4FFWA 4K5QA 3L1IA 3I6MA 1F8UA 4I19A 1SCKA 5HK8A 2XQFA 4J0GA 1YS1X 4J0DA 2Z3ZA 2GBGA 1P0QA 3WZLA 1LPBB 4W1PA 1RWQA 5I7UA 3IURA 1QONA 4QDTA 4H7DA 4FBMA 1W76A 1TAHA 5CT9A 2QZPA 2GBIA 4CIAA 1GT6A 3KOOA 3ESBA 4PSUA 2OGTA 4UHDA 2V96A 3STWA 1ZICA 1XFDA 4Y9SA 4XWGA 4Y7DA 3EQ8A 4AN0A 4YX9A 1Q84A 2V98A 3IB3A 5FPPA 4UFPA 3IBTA 1ODSA 2B20A 2B9VA 1UFOA 2W22A 5BWBA 4WJLA 3GFFA 1LPPA 3IULA 3H19A 2VT7A 5A7HA 5ALVA 5AK6A 4BZWA 4G5XA 3TRDA 2BJHA 2BUAA 3IA2A 1H2XA 4KR0A 4G4IA 1BU8A 1NU8A 3OPMA 5T4HA 1R9NA 5AH0A 5SYMA 2HU5A 3TJMA 4ARAA 3DJYA 2VA9A 3GUUA 4DTCA 3I2GA 5ALTA 5E4JA 3U0VA 5EHNA 1P0IA 3H2GA 2VT6A 1XLVA 5JD4A 1OILA 2BGRA 1AQLA 2K2QB 4UBLA 2X76A 6YASA 1B41A 4OYLA 4H18A 4HVTA 1J07A 3VJLA 2Y6UA 5AI5A 4E15A 1JFRA 2QMQA 3WWPA 3ILSA 3M82A 1YSCA 2HA7A 4N5HX 4EBBA 3AIMA 4UHCA 4N8SA 4DYHA 2FX5A 2V9ZA 2XUJA 3D0KA 4ZRDA 2O7VA 2WUDA 4Y2SA 4XVCA 3G0CA 2DR0A 3R40A 4W63A 1AMNA 2GBFA 2XQIA 2WUEA 5ALLA 5CTAA 3JW8A 3BDVA 1EDDA 5ALQA 1CUFA 5AJHA 4G4GA 2R11A 5LKAA 5C7YA 5HFNA 2ONCA 7YASA 3K9BA 4LIPD 3QM1A 5KREA 3DS8A 1GPLA 3EQ7A 1WOMA 4AMZA 5IVKA 4X6UA 2GZRA 3PFCA 1OCEA 2QRUA 5D3ZA 4HXFB 3WI7A 3H1AA 3DL4A 2HFJA 4CG3A 3WL5A 1WCYA 4DM7A 2RGUA 3C6BA 2D0DA 5FKJA 3WL8A 1FFBA 1YS2X 3IIIA 3A6ZA 2VQ6A 2BUBA 5AK5A 5ALKA 3IUNA 4F0JA 3V1LA 3V48A 1CV2A 5JZ9A 3B5EA 1D07A 4X92A 2NW6A 3DOIA 3R3UA 1IMJA 4Y2XA 3WYDA 4B9AA 1CUAA 2H7YA 3FYUA 1ODTC 3G9TA 1BCRA 3FVRA 4BVLA 5EIHA 1A8QA 1AKNA 1FFAA 4J3JA 3CN7A 2J3DA 1MPXA 4I4CA 2Y1KA 3X3HA 3OM8A 2YXPX 1H2WA 2DHDA 5HKBA 3A2NA 3D2AA 1GQSA 4C01A 2XUFA 1UK6A 3VVMA 2VJBA 2WTMA 3MUOA 1QIMA 1IVYA 3G0DA 4U2DA 3FYUC 1VE6A 2HM7A 3C45A 4OB7A 4BAUA 5CT8A 1UZAA 1YB6A 1XRLA 2CUTA 2RHTA 2C7BA 3IVMA 5AKLA 5J3JA 5HF9A 2HFKA 4MYSA 3D7RA 2WIGA 5KWJA 1UKBA 4W1SA 3JWEA 5AOCA 4PO3X 1E8MA 2G63A 4MQMA 3AUKA 2BUCA 1Q0RA 5K3BA 2HDWA 5DYTA 4ZV9A 1J2EA 3D4LA 4KE9A 3DKRA 1A88A 4MJ3A 3BWXA 3KXPA 4IHAA 3C8DA 2G5TA 4UHHA 4UBNA 2C0PA 1QO7A 5K3AA 2GBCA 2PSJA 1TK3A 1VXRA 4LXGA 3F67A 4P93A 3UMJA 2BCEA 2ZJ7A 1N5MA 3R3ZA 1QIKA 3KD2A 4KJXA 5K3CA 1VA5A 4LHEA 1YR2A 2WHRA 1X2EA 2JGJA 1ZGBA 4TVKA 2C58A 5E4TA 1J06A 5DWDA 4Q1VA 5JASA 2OCLA 4V2IA 3AIOA 1XZGA 5ALFA 4MWTA 1ZI6A 4DSAA 3QITA 1E89A 3OURA 4QEKA 2XUKA 4BBZA 5IKXA 3QPDA 5A2GA 3L1JA 5HKAA 3A2MA 3W2TA 3ESDA 3U1TA 1QIHA 1Y37A 3V9AA 2Z5GA 3LIIA 2G4LA 3PICA 1VJ5A 4A16A 2XMQA 5HZGA 4RE6A 1CVLA 5ALJA 1E8NA 2XMGA 2WUGA 4OU4A 2WJ6A 3M3DA 5JAUA 4EB0A 1ZJ5A 2ZJ6A 1QO9A 1DQZA 2GYUA 4YK7A 4HRXA 5AK3A 4DNQA 1YCDA 1PJAA 5EHXA 2GZSA 2QXTA 2XT0A 2QM0A 3PUIA 1QIEA 4G4JA 5T4EA 2VEOA 2VJCA 4P92A 2HA2A 1BEZA 1C7JA 4AO6A 1GXSA 1EVEA 2JGKA 2BGNA 2PL5A 4Q05A 1AUOA 4H7KA 4FNGA 3F97A 4F5ZA 3ZLUA 1FSSA 4JYPA 4XIIA 4BB0A 1LGYA 5E2IA 2WG2A 4KRXA 3UUFA 3WK9A 4JUIA 2QJWA 3H2HA 2HA3A 4J7AA 1CUSA 1UOPA 1QIFA 3SC2A 2C5GA 1AURA 3ZPXA 2PUHA 1ZD3A 1W52X 1CUJA 3DQZA 4AO8A 2CEKA 2JEZA 1DINA 1WPXA 4KAAA 2JIDA 2O2IA 4KACA 3TEJA 4X71A 4X6XA 3AZQA 1ACLA 3W9BA 1LBTA 1F0NA 3BJRA 3I2HA 2CJPA 2X5XA 4F21A 1E5TA 4WFIA 1MU0A 4H7FA 5LLSA 5JATA 5HFAA 5CT4A 4H7JA 2QVBA 1XZEA 3HEAA 4GLBA 2ZYRA 3C43A 4N5IX 2V97A 2HRQA 3MGAA 4HZGA 4UBMA 2Y6VA 1IUNA 4BAZA 1XZJA 5DYYA 3GELA 1CUYA 1CUIA 4JEIA 4K6GA 2PPLA 2B61A 1A7UA 2WSLA 3VDXA 2HADA 1AZWA 1HLGA 4E14A 2YASA 4NMWA 3VJKA 3W06A 5A71A 1USWA 1LPOA 3G02A 4FDMA 1EDEA 4CCYA 2WG0A 1XLWA 3WK6A 4ARBA 1TCAA 4H77A 2DHEA 3OC0A 3FLEA 5HF5A 3HC7A 2XI4A 3F9CA 4B85A 1FJ2A 5ALHA 4UPDA 5YASA 2PUJA 5AIAA 2FJPA 4PNZA 1QTRA 1RYYA 4BVJA 4UHEA 4NS4A 1O6FA 4GXNA 2PBLA 3A2LA 3DLTA 5AM4A 1EK1A 4EY5A 2PSFA 3DOHA 3WA6A 4L0CA 4MQLA 4W9RA 4KYVA 5F4ZA 2DSNA 1VA4A 3E4DA 1PFQA 1K8QA 4CI9A 3FSGD 2VSQA 3R3XA 1CRLA 4AZ0A 5LP1A 3LCRA 5FXMA 1CUHA 1XZBA 4J03A 5AI9A 1ZOIA 3OG9A 5ALWA 3H2KA 3R3VA 2VJDA 2DQYA 1N1MA 5JD6A 5K3EA 1HQDA 1DT5A 1ZIXA 3H2IA 5AOBA 4AX4A 5EGNA 1QGED 1DU4A 4BP9A 5LYYA 3QMVA 3STVA 5JZBA 2AJLI 4C89A 1VLQA 2XMRA 1GGVA 3BIWA 1LPMA 5CH5A 1XZKA 2UZ0A 1OXMA 5JANA 2WG1A
chains in the Genus database with same CATH superfamily
1LDEA 3NP7A 4MIOA 5GOTA 4C4XA 3GMSA 3OFKA 4HNRA 3TIGA 3FN4A 5F2EA 1K5GA 1TVKA 2CBZA 1FIUA 2M1XA 1OXUA 4A36A 4EHFA 2VWHA 2DYKA 3IBSA 5TEWA 3UIEA 2WHXA 4C21A 3DHYA 2XWPA 4LZPA 3ASZA 4FKBA 3R6WA 3R0JA 3N5CA 5F2KA 4MH0R 3LQRA 1RYHA 1Z6AA 3FMGA 4G8DA 1JUDA 4N18A 5JDCC 3SZLA 3TSWA 4BNMA 2FUG1 1GGNA 1WUIS 1X19A 2PX3A 3DA8A 2HU2A 4JBWA 3TIFA 1O96A 1QJCA 2AX3A 1D2NA 2P40A 4G5FA 1JG6A 4HBGA 1BDJA 3F0TA 3WK7A 4IWNA 3SFVA 1WDMA 3GP5A 3LT0A 1SN7A 5EP1A 1NPTO 1YS4A 2PN1A 3GRYA 3O2NA 1TZMA 3ETHA 3PHCA 4Q9NA 2QMUA 2F1RA 3UXEA 2BRUC 3U31A 1EUQA 4DT1B 4PAQA 1SCAA 1XVLA 4QYXA 4HSEA 2JLVA 4G0YA 1CETA 1A7KA 5C7OO 1VE3A 3QVTA 4U8HA 1OBHA 2J0UB 3ZI0A 1VPVA 4NMXB 2EZ9A 4GE3A 4D0LB 3SC6A 5ED0A 3HKBB 4FFVA 5I4BA 3NHJA 3KV3O 4OLFA 3TOXA 2EATA 4UTNA 5FPYA 1H1LB 1W85B 5B12A 3EGXA 5TLSA 4HDSB 5A4KA 2IK8A 2QRNA 2IYXA 5HFJA 2QN1A 2N47A 2FQQA 2ZBDA 4MO2A 4ARZA 3A1FA 3A3PA 4M87A 1P5HA 4PLPA 4N8EA 5E7IA 2DY1A 1LD3A 1Y63A 1QG2A 1Z4OA 3IE0A 1QWOA 4MMXB 1T3SA 2DAPA 4GVLA 3QYFA 4QPCA 3TTTA 4B0OA 3TCXB 1FUIA 1FXUA 2A67A 3GQBA 4XQ0A 5EE1A 3IUEA 1QVRA 2MMCA 5FTLA 4JI0B 1M10A 2G0NA 3RU3A 1GPMA 3GDOA 4NWIA 1FS5A 3WADA 3MTEA 2I2DA 4XX0B 1A5AB 2UVQA 1NTOA 3NHZA 1KEVA 2DKFA 3NC4A 2QL5A 3SZ3A 3EOAI 2PZEA 2WJIA 1EFCA 3DBLA 2RIRA 2VXBA 1ZH2A 1R8QA 2GCIA 5ERYA 3ND7A 3JSAA 5IJWA 4EPTA 3KB8A 2HMTA 1LPNA 2QQ0A 4IEEA 4OHFA 4S35A 4YMIA 2WF8A 1F38A 3K9QO 5IVPA 4ECAA 3GEIA 3SK0A 1IQUA 1Q0UA 4RKWA 2EBFX 4FUQA 2ISQA 1RD4A 3F7NA 3STXA 3WB0A 1DC4A 2HJHA 4Q7KA 4W5RA 2F17A 4LDJA 5JI2E 1BTOA 3INRA 3MTJA 2CYAA 5EMJA 2YZKA 3JQQA 1RCFA 5K0FA 1RT9A 3KKEA 1Y8AA 1ZW1A 2W6JD 1PQWA 4Z7JA 3RSCA 3CKLA 4KPFC 3T5DA 1BGXT 4R40A 4D45A 4FWBA 3KKPA 4FR5A 3EE6A 2AFIB 4IFEA 1GPH1 2G9QA 2HIGA 3WSWA 3KHKA 5IJ0B 2ZK7A 3E1GA 3TWOA 1AKQA 3TE7A 3WGYA 4XR9A 2W43A 5BV8A 4X6LA 2XVMA 3RNLA 5FUQA 1QP7A 4TT8A 3SXJA 3PHGA 4MULA 3VM6A 1VMEA 2NNLD 2V7GA 3BRWD 4CMKA 1F5NA 5AFSA 3NMUF 2AB0A 2HA0A 1UAYA 1H9CA 1L7EA 3C5HA 4LEIA 4V24A 3OIGA 2CB0A 3MJTA 5EXDA 1M7HA 4K6MA 4RZIA 3ICPA 5FL7A 5CH8A 4PYMA 5B1HA 1IK6A 4L73A 4G56A 3PFWO 4NF2A 1Q6YA 3NWBA 3V42A 1X1TA 5DN6A 1W5TA 2XF8A 2HN9A 4IHJA 4UUBA 3EAQA 3OT1A 5AR1A 2BGMA 3B60A 1DFHA 2QL7A 3ONVA 4E0BA 1UP4A 4LOJA 1VYHA 2B3TA 1EHYA 1UAAA 3MYYA 2G1UA 3FVVA 1HDEA 4WESA 2B1JA 4PZLA 4HEJA 4P7KA 4PC7A 5E2AA 4Y2YA 4P4TA 4ZRNA 1NZFA 4HNHA 2IHKA 3SXUA 2VHTA 5IYZF 3PCXA 4B4OA 1WJGA 2A1UA 3I9LA 4BJHB 3H1BA 5DT9A 3ROTA 3TQTA 2MINA 2WU8A 3Q8LA 4MV0A 3ZJTA 2QIOA 2PKQO 1ISMA 2GK6A 2QPLA 1A1VA 3IO5A 1WHTA 1X80A 2CLHB 1J5PA 1LLCA 1NBME 2H57A 2VLIA 1C50A 1SGWA 3O8BA 5J2TF 1G4HA 4YT2A 2QE7A 1CQJB 2HA6A 2HCRA 3KKMA 3B12A 1DPGA 1UMDA 3QXJA 4HDKB 3KPJA 1EK2A 3ETGA 1Z2AA 2Q1YA 3DD1A 3E7FA 1XWWA 4UM5A 5KOJB 4XSGA 2P7HA 5JEEA 1NRJB 3L7BA 2CFOA 3QLVC 4AP9A 4KLCA 4L5CA 1GAQA 4DDMA 2BF4A 3CR8A 3U1VA 2H9YA 5CFLA 1FLDA 1OV4A 1C9NA 4QJIA 3FB4A 2FN9A 1I3OA 2CHFA 3C3DA 3KEMA 2H4YA 2JJ2A 4OYRA 1PJQA 1KMNA 1B8OA 2QTAA 3FF1A 3R77A 5TQ2A 1KOFA 5FWDA 3ZHQA 2W00A 4CODB 5LOVF 3A14A 3TCNA 3NKLA 3P0IA 1JDSA 1M34A 1DX9A 1YOVB 3NDIA 1KOGA 2MSCB 4BGDA 1PJ8A 3ZWCA 3MAGA 2V65A 3T41A 2F8MA 1QS0B 3ZCRA 5H5JA 2J9ZB 1Z0IA 4X61A 5LU8A 4C4RA 3H5RA 3JQ7A 3ANTA 1KNQA 1N4DA 4KW7A 4NE9A 4DLTA 4DG5A 5IJZA 4PVCA 1HR0B 1QTIA 1P1BA 3T7AA 4L28A 3U0BA 5EZSA 3TW6A 1NNUA 3GLIB 5EMLA 2NN3C 1F2UA 1ISJA 1CB0A 1RDFA 1LC0A 2ZUBA 3F98A 1KRXA 1WSBA 4LXUA 1JAYA 4BATA 3UZUA 5SZJA 3AM4A 4KHZA 2X0NA 1UFQA 4IXMA 5B37A 3ACBA 2WEKA 1SZJG 3LQ1A 3NHKA 3FFWA 3CH6A 4LOHA 1TM5E 2R79A 3JVIA 4PICA 3FSGA 3HN7A 4RF5A 1N0UA 2XDQB 3QKUA 5ALYA 1BS9A 2J4DA 3AKDA 5BT8A 2HSDA 2Y76A 1FFDA 2O57A 2YVQA 4O1HA 4NNJA 4XZ3A 4YTEA 3VOSA 2LE0A 2PJDA 3FGOA 1G2OA 1H1TA 2ZJ1A 3ECCA 3OF5A 3W5VA 4HTFB 3WHLA 4HDMB 3ZXUB 5CT6A 2CVZA 3DBRB 4O4IB 4B82A 2PV7A 5AVOA 1L7OA 3PRJA 4GP6A 1CE8A 2G7ZA 3UJAA 2AJCA 4EHIA 4KWTA 4QATA 2BF7A 3KOYA 1TC2A 4LECA 1E1DA 3H13A 2BFEB 2VQ3A 2VAVA 4KPUB 3RDPA 4AB1A 1WXIA 1Y1TA 4LYYA 3A6FA 2BTOA 4MDHA 3W04A 3E9QA 5JAPA 1GNVA 4YRKA 2GFHA 1ZA2A 3IVRA 2PYDA 5BUCA 3LGAA 3ROFA 2I2BA 5GM1A 4CI0B 2JHAA 3L0YA 2HEIA 3SC3A 4EVQA 2FP3A 3FDJA 1QZZA 2RGAA 2WYUA 4KXFB 3GARA 1CFJA 1HBJA 2DQKA 2XE6A 4GRDA 4YH1A 3O82A 4P4NA 3UKJA 4DF3A 1OBCA 2OCDA 5D3MB 2OG2A 5AOAA 2JFWA 3QUCA 3L6RA 2WV9A 2ZDGA 4GECA 2HXYA 1O97D 4ZAFA 1T2NA 3KZCA 1QV6A 2JHCA 4RX1A 1J2TA 1P4JA 2XVYA 3IODA 5BSWA 1L4HA 1V3UA 4DNFA 3REQB 1DNPA 1C1HA 2IYEA 3GLSA 1TTQB 1JJAA 4KR7A 4PIPA 4JH0A 1Z15A 3AERA 2Q07A 1W36B 4RKEA 4OTZA 4DGQA 1N34B 2QX7A 2WIDA 3O94A 1URPA 1JR2A 1CPYA 1WPGA 2LDBA 2REQB 2DKOA 3LZDA 4PGGA 3IYLW 1FRZA 3OJXA 2W8BA 2VT3A 5A4FS 1IM5A 2BOVA 1TF2A 2JLQA 1OFHA 1KJ8A 4D44A 3CWQA 3LQ2A 4B3TB 4BQFA 5FLXA 3GA7A 1ENPA 1QZ3A 3P0RA 4I55F 1EXWA 4N0QA 1EU1A 2BBSA 2VQEB 3VU9A 3QXHA 5JPDA 3HSSA 1PD1A 2CFSA 3S40A 2MT9A 4MUJA 4M89A 4OB6A 5EQFA 1K0FA 1OVGA 3E7XA 4MRSA 1PZEA 1RM4A 1ML4A 2ATCA 2Q1SA 1RRMA 3D6VA 4LJLA 4WKGA 5AKZA 3R7WA 4AYWA 4BC0A 4CNQA 4ZJUA 1THTA 621PA 1WDWB 4M1OA 4EIWA 5EHIA 4OOFA 1MQAA 3RG8A 2XRYA 3W5UA 4EELA 3HGMA 1Z9BA 2BC9A 1PDOA 3P9CA 5BSVA 1PFVA 2DJIA 3T9CA 4CV1A 1SKUA 5L6LB 4MGZR 1O03A 1TJPB 1K66A 3HDQA 1YAHA 5J2UB 4Z1MD 3FAKA 1OQAA 3GRUA 3O8OB 5ER6A 5FT9A 3T3DA 2IZ5A 1HKUA 1X7GA 2QNRA 2XOXA 4H1UA 4HSGA 2WNHA 4XR4A 4OAQA 5KKNB 4WA8A 3FTPA 4E1BA 4ZQBA 4MEBA 4HQLA 4I9UA 1V5WA 3NQ41 4DCNA 3M1LA 1V9SA 1VJ1A 3I4LA 3Q2OA 4UNNA 3H17A 3DQQA 1DAFA 4TXJA 1PCXA 2SICE 1G3IA 2I54A 5JSKA 3IEMA 3F5MA 4PYQA 4ZI7B 4HPJB 3A58B 5LDHA 1ZJZA 1U9JA 1R27A 1YZHA 5DLQC 5IAEA 4PCUA 1E1LA 2V4ZA 3V7YA 5C81A 1YK0A 1VB3A 3SC2B 3E23A 4A5SA 2POCA 3FUWA 4BX0A 2QGFA 1QQBA 3TD6A 2OXEA 5EJ6A 4ND8B 2AG1A 1BKYA 2GPBA 1DCKA 4JV5B 4AS3A 3NIDB 2DWQA 2HXGA 5IXSA 3BCHA 1Z06A 3PF8A 3GW8A 3HZRA 4Q1DA 1FXWF 1ESMA 5DM60 3KOXA 4QO8A 4RIGA 4DVJA 2W6JA 5JY1A 3ZJUA 5DW0A 3SZMA 4OQPA 1VHDA 1TA0A 5TQ0B 4CQMD 4UBJA 4NG4A 5FYQA 4IKEA 4F7WA 4OM7A 1YZVA 1V96A 3VA7A 2E48A 3IOMA 3JQEA 5FJIA 1YC5A 1BEEA 3CSSA 2I7DA 3EXG2 3F96A 1FU8A 5LDDC 1UEIA 4BNFA 3FWHA 3MT9A 4EB6A 1P6QA 1CS0A 3GRCA 2ZIVB 4PS0A 4PGHA 1PG0A 2R60A 5JJ5A 4DA9A 1RJWA 4PFSA 1YIOA 3BRWA 3PNVA 3VJMA 3I04M 4XW2A 4QUAA 2OR3A 5GJVC 4ZXFA 4K6CA 2RHRA 4Q15A 2YN4A 1J8MF 1UBEA 4UBOA 3K8YA 3ZVNA 2HK9A 1C9JA 1BJRE 3BGVA 5BUQA 5C3MA 4F85A 4JYMA 1TQ8A 2IYNA 4ZVLA 2VTVA 2HNAA 1DQNA 1I2AA 2XUGA 3DDCA 3HXPA 4L8FA 4I8DA 1U6JA 3F1KA 4TV8F 1T1JA 2HF7A 1Z4JA 3GNLA 3AW9A 4DREA 4LY6A 1EFKA 2I1VB 1SO8A 4BQSA 3ZKWB 4NBSA 1XTQA 2F3TA 5D84A 2WD7B 4TZ0A 3MTIA 1K7FB 3AF4A 3B2NA 3PJFA 2BHLA 4X3OA 1NBWB 1Y80A 1S7GA 1NY5A 2IEDA 3AIKA 1GTJ1 1RC1A 3CFYA 1P81A 5EJIA 3S55A 3ZZ1A 1V35A 1NLYA 2VJMB 1ECFA 4QJ4A 1TEVA 2XB9A 1XU7A 4CCSA 2D2FA 1XTRA 1NSYA 1X1CA 2WFLB 4N6GA 2B92A 4BLOA 1C4KA 3O1IC 3L4BA 2J3EA 1A04A 2PPVA 2ZCVA 1XU9A 4O4LF 4EKDA 1PR4A 1ADGA 2XUIA 1LI5A 2PQMA 1QOQB 4JMLA 3ZZ0A 1W8DA 1ZD4A 2BI7A 1YV9A 4QYWA 2GWHA 2VWPA 4CCYB 1RC8A 3L6UA 3HJAA 3RWBA 3AUAA 1DBPA 4GOJA 1LRJA 4UHFA 1SCUB 3AF0A 3WZMA 2ATEA 2WJAA 1AS2A 5ECYA 3H2YA 4ZT2A 2G1PA 2MSNA 2O1EA 3KLOA 4Q4DA 4CETA 1CBUA 2X77A 3O3MB 5FPSA 1Q7RA 5FEUA 5GQSA 2JC3A 3C3BA 4K6OA 4HAVA 1Z4MA 4RJKA 5CLHA 1D4AA 1P39A 3PR2B 3UMRA 5JALA 4BNXA 4D26A 4FP9A 4Q4HB 4YCMA 4BNNA 2BFMA 1KO4A 4QFCA 2CJXA 2GBLC 1KAQA 3O9VA 1HLFA 1XMSA 3U49A 4AC9A 4I6EA 4HAXA 4BV8A 4DXHA 3THXB 3KQMA 2O8BA 2HC9A 1EBUA 3BILA 4YASA 4A27A 3CXRA 4B2IA 3QVLA 4BO0A 2I3AA 3FJYA 5EVJA 4DCPA 5KYWA 1M72A 1AMOA 4NBUA 3BMCB 4LNUB 5K9ZA 4GBMA 5G0TA 2PGJA 1KI3A 2QY6A 3ETDA 3RW9A 2ADFA 1ZVKA 2PGIA 1NFQA 1JGTA 3PUWA 5CFOA 2JAUA 4DJJA 3ZV5A 2IOQA 2M32A 2ZT8A 1JHYA 4ZCQA 3F8TA 2Y05A 5T3YA 5ILGA 3BULA 3IJRA 3RYIA 3PDJA 1EGAA 2C8VA 1AA9A 1UQTA 3DC7A 3O3OB 2RK3A 2YUIA 4LG1A 4W6QA 3F5QA 3JYPA 4R68A 3T8YA 3LGXA 4D4MA 5HQ3A 1EUCB 4YJ3A 3H0CA 3STUA 2FN8A 1Y9DA 3HKDA 3MWGA 1LSJA 1YS9A 3D8BA 3NWOA 3NLLA 2J09A 4Y2UA 4OQQA 3ZBUA 3Q10A 2G1JA 3S5JA 3T0GA 1BD4A 4RPCA 3EF3A 3OOWA 4HDQB 2C31A 4KQ2A 4PCAA 4DG9A 1YQ9A 1HNXB 1PJSA 1L1FA 2V5UA 2DBZA 2FPRA 5HRCA 2QP9X 4HS9A 5BW6B 1MX1A 2FCRA 2GD6A 4KE7A 2PS9A 3R0XA 1MHTA 4DMKA 5F33A 2C9MA 3DM5A 4QOFA 2WJ4A 2RONA 3L07A 4PV7A 3UO8B 1JXMA 3C6YA 3DF7A 5ALXA 4BNYA 4LF6B 3NBUA 1L3IA 3B6EA 1KDRA 4BFVA 2V9CA 1FLAA 4CKCB 3Q98A 1E3EA 3NRCA 2P27A 2I4LA 2VHQA 4FMCB 2PZMA 2G70A 3NBMA 5CXUA 2SCUB 1G17A 3HYCA 1LBHA 4FGWA 1DC3A 5TNXA 3RRFA 3UAXA 1AMUA 3X2EA 1NP7A 1HDIA 2QTVA 3LCMA 2VKQA 4OHBA 4GWLA 4L15A 1Q14A 1KTIA 4PLFA 4MUHA 2PDAA 4YP1A 2OOSA 3M4XA 1QV9A 3N8KA 4YJFA 3HYSA 1F4LA 2QVXX 4L8LA 4BJ6A 1E3JA 3BD8A 3T9FA 1DIOB 4Y6SA 1XX6A 3DAYA 3EG9A 4X7BA 2VH5R 2V0NA 3X1KA 3WA7A 3A9CA 1UQUA 2G4VA 4D6PA 4NPCA 2PUBA 4NZPA 1MDBA 2JHFA 3BWYA 3ZK7A 4PLGA 4XRGA 5TIIA 4YP0A 4AF6A 4ZV7A 2JA2A 6REQA 1JQ5A 2VJQA 4I4TA 1JEQB 4PYNA 5EGSA 4CCAA 3N0TA 5ALEA 1NLMA 3TW0A 4G97A 1I0LA 3MCAA 3CZ4A 5B2EA 3AHIA 4XCXA 2C04A 2AZDA 4QUDA 3HYLA 2FDRA 3JARB 4X90A 3NVKI 1JKJB 1J2JA 4HN2A 4WFKA 2NSLA 3KBBA 2A59A 3K53A 3P32A 3WL3A 4BBPA 2JAWA 3CB4A 3EXEB 3H42B 2GH1A 3U7EB 1GG5A 3UJ3X 1B16A 4Z3OA 1E18A 4FUTA 4KQHA 2F3PA 4INZA 1TFRA 1VMKA 2VCHA 1P2GA 5AKXA 521PA 4CV3A 1Y9EA 5CEFA 1SKMA 4QWMA 1MRSA 1F1BA 4X62B 5K8TA 3SM9A 3G8BA 2Q4EA 2VR1A 3IPYA 4FOOA 1RZVA 4G5GA 4YRTA 4EQZA 4CM1A 4AMUA 3SQLA 4DBLC 3QPVA 4RS4A 3U44A 3BL5A 2JI4A 3JYOA 4A8TA 4FOTA 1O0BA 4HGOA 1R3DA 2FUEA 2I2XB 1PGQA 3TNLA 3IILA 3K0EA 3N58A 2FFBA 5CNJA 2I2AA 2G77B 2Y9PB 3A4TA 3WBBA 4CKWB 3C3CA 3H2ZA 2FGKA 3M6UA 1B1CA 5C31A 1HLDA 1XEWY 4DDUA 5CG1A 3PVSA 4JP5A 3WMFA 1FSGA 2RGXA 3A4NA 2XEXA 1LXCA 4DQLA 3U6KA 1KI8A 3H11B 3JQBC 1ONNA 2N0SA 4BRZA 4FD3A 1T8WA 4E21A 5A9SB 1H5UA 3OZDA 5TRTA 1WUKS 3DPSA 1HPLA 3GVXA 3RC7A 3U9SA 1W1IA 2CHEA 4XDHA 1WSWA 3F3YA 4PHTA 3C97A 3RKRA 2E0IA 4YMVA 1DCMA 3WGIA 4MUXA 2FSSA 2CMFA 2BEVA 4GUAA 4UEOA 1OJ7A 4J9VA 3MT0A 1GNSA 2O8NA 1IOLA 2ZZNA 1CIPA 2YVKA 2VZ0A 1LW7A 4KVZA 1O54A 2XGJA 3K31A 2WDPA 2WJ3A 3G8CA 1VGQA 2VCYA 3OO0A 4QU0A 3UXMA 5HXAA 1DRWA 2WOJA 1TZKA 1X7XB 1TM2A 3GPBA 3OJEA 4KGXA 1GPUA 1DKUA 4NABA 3KWJA 2F9MA 5JNTA 3U56A 4EI2A 4QXPA 5AJXA 5FUWA 5JH7B 4P54A 3KG2A 2FP4A 2JFQA 1R6AA 1TX4B 1MB4A 5ELXA 2CNWD 2PU7A 3PCTA 3G0HA 3U40A 1WR8A 2H2FA 3MMPA 5T5QA 1Y34E 3EW9A 4DB2A 4KR6A 3VYRB 2FZCA 1Z2OX 1WABA 4ZDWA 1CWUA 3F7MA 2GYWA 2ZRCA 4F3TA 4CMCA 3SLKA 1GTRA 1W9HA 3QI7A 4EI7A 1YUBA 3GRPA 1IBKB 2EZUA 1XYVA 3FMVA 1IHPA 1MV8A 1RVDA 2BJVA 3TAUA 1LBSA 3WYBA 3CLSD 4FS8A 4XUDA 3ANSA 3Q8WA 2NVOA 2J9GA 1GWNA 2VK8A 2IPOA 2QDXA 3MJHA 2AZTA 4L8YA 1TUIA 4OJYA 3S1AA 3OX4A 5LQSA 5F64A 1Y5LA 2VUIB 1E0SA 2VRNA 3BK7A 4RHUA 1RP1A 1UBMS 1Z5GA 2GO1A 3GJYA 3WWOA 1WWKA 5CM9C 5FO1A 2CUZA 3G2MA 1BDHA 1E1RD 3DOCA 3OZVA 4R2JA 3TS1A 3DGEC 1PFYA 5JNSA 3K0KA 4JLAA 4E5KA 1RJDA 3GH3A 3UGKA 2QSUA 2YJ4A 1BMDA 3PS9A 4U2FA 4Y2RA 2IQ5A 1CJMA 4IDGA 5F7ZA 1E7YA 1KO8A 2NU8B 1TO2E 4EBFA 3MCUA 3S44A 1LX6A 4AL4A 5JMTA 1CFZA 1Q0QA 2O54A 4H1VA 4NQZA 1FMJA 3GIWA 221PA 4TSFA 1S2LA 4E4RA 3ZD6A 3G7SA 5BV1A 5DKFA 1X94A 2Z2KA 3I64A 4X7PA 3UHOA 4BNGA 1XRSB 3EXHC 2JW5A 2IPNA 5ALRA 3WLTA 1TAQA 5CGZA 4PF1A 3DEAA 1PK9A 1P9OA 3KM0A 3A8TA 3VC7A 1J9EA 1H3EA 4JT4A 4K2AA 1KH1A 3S2SA 5CA1F 3ZDXB 2P2DA 4QUIA 5AICA 2XV1A 4QQ8A 3UJ9A 3FYUB 2QUZA 2Q8PA 3HCBA 4HFJA 2Z2IA 1AC5A 4O2AA 5BSFA 3GD5A 4LKOA 4E7OA 4RXUA 2Q21A 1U6IA 1WUYA 3ED1A 4FYXA 1CQPA 1KMHB 3K9GA 3LT1A 3N59A 3G0BA 3QEMB 2OBXA 4YJGB 1G5PA 2QX4A 1XZDA 2ASEA 5EINA 5ICGA 2WJJA 5TF0A 3WNBA 1S3SA 5U4QA 3ZD9A 5DLDA 3A11A 4EVRA 1FNCA 2YW2A 1GNPA 5K0LA 3JWGA 5AW6A 2FWMX 5JMOA 4I6GA 3SHQA 4XASA 5FA6A 1LSUA 2NAFA 2Q0XA 2Q1TA 2QB5A 3B9QA 3IEPA 1V7QA 2OP0A 4KQ1A 1ZAKA 4MDYA 1VGRA 3VKWA 3MBOA 3KIPA 2J59A 1FP4B 2KSQA 2VCEA 3OCWA 3UWKA 1RAEA 2O2HA 4DCMA 3HCPA 3FUVA 4W8GA 1G66A 2W4QA 2VTBA 3EIHA 1H2FA 3M6IA 4Q16A 3GUZA 5JLJA 1EDBA 3KFXA 3CLHA 1BNCA 1EZ4A 5FDFA 1NQWA 1JR3E 3ELUA 4UTZA 3ESAA 4ISBA 4MUYA 4V3CA 1N2CA 3K4HA 4K1XA 3SIXA 2CCJA 2E4AA 4JQOA 2F3RA 1YA4A 1VKRA 4MVYA 3KXLA 3K1YA 3KUXA 5FORA 3WE7A 3N7UA 3N2EA 2FA9A 1OGIA 1PVVA 1P4HA 4WCFA 3N8GA 2O50A 2J67A 4HI0E 1I7DA 2E18A 1B0AA 3F8SA 1ML3A 1FFHA 2D2IA 3AL3A 1FNSA 3SVZA 4DA4A 4MWSA 5CEJA 3Q4GA 2YIDA 1SK8A 4RDHA 1TD1A 4CKBB 4N0DA 2PY6A 5K2OA 5LIRA 3ADBA 2C7PA 4HXYA 2JGEA 3WMXA 2CNLA 5ARCA 1L7NA 2R1VA 2CCKA 4PQRA 3GT0A 1DKRA 4ZOEA 3I9MA 4ZVOA 2XMDA 1ZJ4A 3LSYA 4OVKA 2PUEA 1OV6A 3QNUA 3RUAA 2D54A 2HLPA 2OT3B 4PLZA 2C8KA 4UZSA 4XCVA 5IJ0A 3ZCSA 4DR2B 4KU4A 1T6NA 2QF7A 4XFKA 2J3IA 4LVOA 2GRUA 2IJGX 4DIDA 5LZ5A 3JAMA 3R5JA 1VSUA 2PEYA 2ZQ5A 3DVAA 4II3A 3VVLA 2WWFA 1KDYA 3VDNB 1UBCA 2F48A 4MI1A 3NW9A 2C3UA 2ZJ0A 3DE4X 2NYUA 2DT5A 2P9FA 2QX9A 4G1FA 1Z8DA 2TECE 3K9FC 4NC9A 1GPKA 5I9TA 3RRXA 4RA9A 3DEFA 4HFRA 3TGWA 1L5OA 1RMQA 5A3SA 3ZNQA 5HKOA 3WSVA 4UAVA 4HK4A 4FFLA 4URUR 3LSTA 1G3UA 1B15A 4JFRA 1UEJA 1ZMXA 1ISHA 1FFSA 2XYPA 3IO3A 4B7AA 1FU4A 3RYHB 3UICA 3WLQA 2Q9AA 1PVDA 1QK5A 3PQDA 1VMDA 1WVGA 1J2UA 1Z39A 4ALIA 2JEYA 4RS3A 3CN9A 1M3SA 2GEKA 4JBNA 5B30A 1QR2A 4M6WA 1M6VB 3ZE9A 5HP4A 2JFBA 4ACBA 1ZUHA 2WZQA 1GQ2A 4K88A 1G2PA 4OHOA 3ZX4A 4ND4A 2KS6A 2DM6A 1WS6A 3MJEA 4Q18A 4BO9A 3B6MA 2QN2A 3JS5A 1EH5A 1K06A 4JUAA 4TV9B 4CTOA 4I1PA 3AKEA 2EYUA 4L4XA 4X00A 3PHBE 4LMRA 2IITA 2OWDA 4WY2A 2UUAB 2JLZA 2WPDD 4PE5B 3SF0A 3EZ7A 1FVXA 3HACA 4X97A 3WGKA 1DUIA 1DO2A 3FVWA 3V8PA 1E3WA 2CLFB 1WZNA 4RMGA 4WACA 3FF4A 3HB7A 3ENZA 4RTKA 1EB8A 1VG8A 3HCFA 3SPXA 4C6HA 1JEOA 4Q19A 4WHMA 5BN3B 3UANA 5BURA 2ZM6B 1BKSB 3OPQA 5KBYA 4PZYA 4O4HB 5E6SA 2XIJA 1ND6A 1G0NA 1D2RA 5FWYB 2Q3LA 3DNFA 4RCYA 2WE7A 3RCBA 1MG0A 3DF9A 3NJ8A 1PKEA 3EHEA 3VVBA 2ATIA 2EF1A 1O95C 2ON6A 3HKEA 5KPDA 5LP6A 1DXOA 2GKOA 1LI7A 3C3JA 3EUWA 3IMEA 1KJIA 4URWR 3AZOA 4BB9A 4GBJA 3PQ2A 3PQ6A 1NVGA 3I1JA 3Q88A 5IMBA 1T2DA 2ZYAA 4ZVSA 4D9IA 4BO4A 2O7SA 3NC0C 4ZHQF 4XB6B 1B2RA 2C2OA 1E79D 1IPHA 4O2BA 1GL7A 1MT3A 2W0MA 3NDRA 4HS4A 4MWEA 4X9XA 5FPTA 5KJCA 2BE7A 2GYYA 2QWXA 3LPDA 1F8GA 1WM1A 2AN3A 2HMAA 2YC4C 5D3KA 1VIDA 2B1RA 2XCQA 3DPUA 2IEGA 4MGYR 5CDGA 1XTZA 1J8FA 1Y7IA 1HRKA 2Z04A 4RHFA 3TK1A 3TXXA 6Q21A 3HLKA 1EJ6A 4DCJA 1EVZA 1X74A 4G0XA 2QD3A 3C7KA 4XH9B 3CYFA 3ECAA 4UXJA 2YWEA 4K2HA 3BHIA 5CP8A 5CM8B 4OYYA 5C8YA 1GZVA 4YXFA 4EYQA 3QJGA 1EXDA 4DDWA 1GEEA 1A8UA 1JEDA 3A25A 3RF6A 3CEPB 3ZZUA 2GNOA 5CITA 5C5CA 1V9LA 1VSBA 2EWVA 3DUFA 4FMDB 1XL1A 2FPGA 4QG7A 1PL7A 3RAFC 1PI3A 1A72A 1KJWA 1YZUA 2G6TA 1W59A 4JLNA 4F2GA 4TMZA 4HX5A 1DWQA 5DLYA 1YVEI 3U60B 1DTSA 4DZZA 4L02A 4AIRA 1LVUA 2CNWA 4D79A 1ESCA 5JJCA 3IUPA 4IKPA 3DTYA 5KNDD 4YMHA 3RFFA 1QFMA 3ZWXA 5JAHA 4J91A 1ZM7A 3WRXA 1EFLA 3DD5A 3ELYA 1I01A 4A2CA 4KXYA 5BSUA 4BNKA 1G291 3GYBA 1MD9A 1LPAB 4MWBA 2BW0A 4LBZA 4G8CA 1QFXA 5TJHA 3L40A 3SS7X 5H7XA 5C8ZA 1JN0A 4BZXA 3U16A 1OMOA 3C16C 3QU5A 4ZODA 3ROXA 3GUYA 1SRQA 4KFSA 4BLUA 1ZCBA 3B52X 4Q24A 3PTAA 4H3VA 2H4ZA 4A6PA 3OQBA 2QUAA 1P7ZA 3L43A 1RNLA 4UE2A 2LGJA 2G88A 1IYZA 4YCDA 4D0SA 4YAEA 1G8AA 1YR6A 4D4KA 1WTAA 4WK0B 1GTMA 1HE8B 2XW6A 1QF6A 3M4ZA 4XE5A 1E1RA 5EP3A 5TGDA 1Z4KA 3HA2A 4YP9A 1AVTA 2C9ZA 1RW4A 3W90A 4KIJA 1VECA 4IDAA 4F9GA 4C22A 3ILVA 4KR2A 3NGXA 2JF0A 4UHBA 3T61A 3ABRB 1P74A 1MTOA 1XZPA 2ZANA 3KYCB 2LZ0A 1Z0ZA 4YY3B 3HLYA 1RIIA 2H59A 1JDVA 4I5EA 4JJEA 2ZZKA 2HLHA 4PPYA 1D6NA 5BWOA 1JQKA 5DNDA 1DEOA 3I83A 3CV3A 3QBEA 5A4MS 3VQTA 4G0VA 1YDEA 5AWFC 1ZBQA 5CT5A 4QO7A 4MI9A 1JMVA 3NKVA 3WHIA 1BCSB 1J24A 3IQHX 4WN9B 2YNMC 2C9OA 1X7DA 5JW6A 5ITSA 2O48X 3RGWS 3U5ZB 1EPUA 3KL4A 1X8KA 4BWYA 4E22A 4NYMQ 2FFHA 4BQQA 2Q3CA 3OLXA 4F60A 1CUZA 3STHA 2X5NA 5KNBD 5HVNA 3BMOA 4CIYA 4FX5A 1SVKA 3OKPA 4K9SA 5LZ2A 2K6GA 2CF5A 4LYDA 4YMGA 4ZEOA 1XAJA 5FWNA 1M2OB 4MAFA 3DZHA 5T3UA 3Q7RA 1Z7EA 1HYQA 1V16B 3SP1A 4NARA 4DM3A 5C5EA 1AKUA 4CMBA 2Z5LA 2ZVQX 4NK4A 3OLZA 5BOSA 1MF7A 3DBVO 4DLLA 1K6JA 3PXAA 2OD7A 3PUHA 4ZARA 1LZKA 3EOBI 3WS7A 1N5LA 3JATB 3NASA 1R00A 4HLUA 4W4TA 1Z5WA 1MJ5A 2GR9A 2ID8A 2V5AA 3PP8A 3C7TA 4ZQHA 3DYVA 3NNNA 5FAKA 4B2YA 4C6SA 1A2KC 4KOEC 3ET5A 4ZZ1A 1OWMA 1OZGA 2P9QA 1RE1A 1SFRA 4DEXA 5BMVB 1DDOA 1KDPA 2VG8A 3AL2A 2UYGA 3QBTA 4Q1FA 2YXDA 2ILTA 4FNAA 5FI5A 3UJCA 4CFYA 1KHHA 4O0LA 3D4BA 4J8PA 4MHSA 4PQEA 5C8VA 1NW7A 1QR6A 2M9MA 3OZWA 1XZAA 5LZ8A 3OO1A 1JLLB 4YRGA 2Z6UA 3BM5A 1MQ8B 1U0LA 2I62A 4OL0A 1ZH0A 3E7DA 4K9PA 5IKEA 5KYXA 3I9OA 3TEFA 2ZJ8A 1I14A 2IP1A 4EL0A 2ODBA 1BRTA 1JAZA 3CM0A 1H2HA 1C8VB 3RFVA 3L46A 3FPAA 3A9WA 4WV3A 5JYEA 1P9WA 2P75A 2IQIA 1E2NA 3VDRA 3V6MA 4Y1EA 3RS0A 5K0BA 1NL3A 1CDOA 2C5SA 1ZM4A 3G1TA 4BE4A 1MTZA 2CJYA 2QTBA 4MPJA 3MPUA 3IQDB 1RVV1 4QJ3A 1SXJD 3U19A 1JHDA 1Z2NX 3K2QA 2MSKA 4IFTA 2ROQA 5JAOA 3A0UA 5FEMA 2GFIA 2SNIE 1T4MA 4WSOA 3DFMA 1EK5A 3HJTA 1GUBA 2PX8A 1U2SA 3DLCA 3H04A 5HK9A 3DFFA 1I6WA 4D97A 5KQRA 2I4NA 5FUYA 1GUDA 2ZYWX 3VH1A 4AK9A 1GEGA 9MHTA 3IP3A 1OWPA 4TLBA 4MIKA 3RSFA 4IXTA 3FSJX 4IG4A 1X8LA 3FNHA 4J1NA 5H3HA 2VXOA 1CYEA 1QGUA 1RKUA 1WKVA 4WW0A 4ZZ2A 4FI3C 3WAGA 2BTQA 3KCQA 2QX8A 3M89A 1JDZA 1NBAA 3KEOA 3H0EA 4HEHA 1RXSA 2HK6A 4QNNA 4DIMA 1C8LA 1UBFA 4DXDA 9LDTA 4RY2A 1IOWA 3IHKA 4MVJD 4FYJA 5THKA 3WYNA 3IP9A 4U39A 2EQ5A 3ZE1B 3RSOA 1ETHA 3M70A 1P1RA 1ZYUA 4FBLA 3W3AD 1W5AA 1W6RA 1SCJA 2YBDA 1D2AA 3TLZA 4N48A 3C7DB 1I7LA 3B3FA 4G0QA 4QECA 4CKYA 4C7BA 3E9NA 1G0OA 3PDUA 4JLWA 3CCBA 3CW9A 4ZT7A 3QV1A 2RKWA 1ZMBA 4GOND 4N9WA 4TUYA 1XMQB 4NBKA 3E61A 2OD9A 4OI0A 4EJFA 2GX6A 4P58A 3RI3A 1SH7A 4OHCA 5DF1A 2QG9A 5C18A 2AJBA 1N0WA 1NSTA 1SU6A 2OFOA 2WJPA 3ILHA 1PT8A 3QFHA 4FWTA 1ZZGA 3G49A 1SXGA 4TKMA 4BFYA 4JP8A 1ISFA 3VR1A 2N9UA 4G5SA 2AFHB 1P4RA 5IXJA 5CVVA 2ZE8A 3DC2A 3RU7A 1QTQA 5IN5A 3ROKA 5LPNA 1FDVA 2YFQA 1ULAA 4KOAA 1A9RA 1VTKA 2GPYA 3JR7A 5F76A 3FKJA 3W1EA 1B3BA 2FW7A 2XD9A 1I36A 2JBAB 4ZXPA 3WGZA 4QDUA 4BECA 1Q0SA 5BVHB 3OZCA 4MW6A 1SA0B 3TZKA 1C9YA 1OI3A 3INNA 5LDGA 5F1PA 4I66A 4RVFA 1L2TA 2RJNA 3UQZA 1R5NA 2WF5A 1SCQA 3AESA 4FEGA 1E79A 1YIDA 2H63A 4MVJG 3IPXA 3B3AA 1PZNA 3BXPA 4YPFA 1NYTA 1JMYA 2I76A 1AQJA 2FEPA 2BELA 5AXDA 5T57A 4GX5A 2W6MA 4J3FA 3ZKAA 4NAVA 3V8QA 2D4AA 4LY0A 2CZGA 3L6EA 1VZ2A 1D1PA 3T0IA 1U99A 4EGAA 4TL7A 3W5HA 4GM1A 3V1YA 4F11A 5EJ8A 4S04A 1M74A 1T36A 1ZH4A 2XUPA 3BIJA 5EZYB 1AV7A 5TVGA 4PNEA 5T41A 3OOHA 2QRVB 4R1UA 2AG8A 3OQJA 1X2BA 3STYA 1ODCA 4OG2A 2FZVA 1U0FA 2QRZA 1XXHA 2EGGA 3A6DA 1SUSA 3TUJC 4BTLA 2DWCA 4BB5A 5IF3A 4D9JA 5BN5A 2AI3A 2HX1A 2P9ZA 1H0RA 1XWFA 1MNAA 1GPAA 4NFSA 1CUBA 2YDYA 3C70A 3LA6A 4O1IA 3WNVA 3OQNA 1MOSA 1ABEA 3M3PA 3EEYA 1WD5A 2VYQA 2B5OA 2NTNA 2WSMA 3BIFA 3AR4A 3GVPA 4G01B 5CR9A 3RVJA 2G0TA 2NV0A 5B6PA 4R41A 4OP1A 5KJEA 3FTCA 4REMA 5KNDA 4DCVA 1NC3A 1OSNA 1EA5A 2XUQA 3MXOA 3WGJA 5LMCA 1R9MA 4XX1A 4EGFA 2PX5A 2PKYX 1UK8A 2YUTA 4E51A 2PVSA 1EAMA 3NFYA 3W1VA 3NTRA 2WC1A 4LRXA 5HILA 1EWQA 1BHQ1 3CUUA 4YNBA 5EA2A 3T9EA 1PG2A 2IH5A 2R84A 2BEUB 3CVJA 4V1CB 1RFGE 1PS9A 4R1MA 3RHSA 3EPPA 5JSYA 5BV7A 2IUFA 3OM1A 4J0JA 2R8YA 4JEMA 1KE2A 3EZGA 5AKKA 5KHLB 1E2IA 1LBQA 5DHPA 1TVKB 2WBLC 2XT9A 4CG2A 2JPDA 4L1KA 1V6CA 1E1NA 2RGNA 4NZ9A 2A14A 1KPHA 5JXIA 2JATA 3PGKA 5BSGA 4BVHA 3ZY6A 4IIBA 1ZOOA 3PNSA 4WKPA 4Z53A 3DR3A 3L7OA 3K5IA 4LISA 5FOTA 2AXEA 1O96B 1XP8A 3C6KA 1ORWA 3R7AA 2ZRFA 3ORRA 4G26A 3OPVA 4IV8A 3OPNA 3FTNA 1ZUIA 1IEQA 4FWIB 2A0YA 1JJVA 3TLGA 2WB2A 1GPNA 2E4ZA 2ZE5A 5ANRB 2DFLA 2A78A 1F4PA 3EIFA 1RACA 3OSUA 4R2LA 1BWSA 3TRFA 4M0PA 4X1IA 4EFNA 4RK1A 4NX2A 1GZ7A 1I3MA 3LBNA 3OY2A 4GMKA 2B9EA 2YCLA 4K5QA 5CW1A 1IL0A 1NR1A 1N5JA 1T15A 2W8ZA 3L1IA 5GONA 4DILA 1PDVA 2HK8A 3Q7SA 4BQIA 1GAEO 1H4VB 4RYDA 3KBOA 5D85A 3RTAA 4YCCA 2X5KO 1RHKA 2PKRA 5A5FA 1VBKA 5G0WA 4MUAA 5HK8A 1FUKA 1N3IA 3P9YA 4J0GA 1YS1X 5A0FA 3TPZA 2V7EA 3A6JA 3C4VA 3EEBA 2XD4A 4FCWA 4J0DA 5GTDA 1VJGA 2GBGA 2HMVA 3E9YA 3IERA 2CJWB 5F3RA 3PEYA 1P2VA 5KNBA 1RM5A 3H9JA 3LQQA 3GQBB 4QRDA 3UOWA 1BE8A 4ZQEA 5CU7A 1OX6A 1HSOA 5HMLA 1RPZA 2HUNA 5H68A 2DH6A 2VIIA 4FBMA 1W7AA 3EGVA 1W76A 1VJTA 1TAHA 1GSAA 5CT9A 4C04A 3NT5A 4KTVE 3HB1A 1V4VA 3LRPA 4TM7A 3H75A 4V03A 1JXOA 3G13A 5MN5A 3H5WA 1S2OA 3HKCA 1QUEA 3TQRA 3W6UA 4ZVKA 2ONJA 3ZHYA 4JUFA 4MW0A 4PSUA 2V7XA 4P3XA 4PBRA 1R5OA 4UHDA 1CQXA 4M1ZA 5J59A 1R74A 5BNWA 2V96A 5TT1A 3SFTA 1QYWA 5IDYA 4DA7A 4Z9BA 2Y0BA 2CVPA 1XFDA 2O2XA 2VVTA 1K8ZB 2AMFA 2IOFK 3U7QB 1A2BA 4Y7DA 2MHCA 4AN0A 1BHO1 2FLVA 2CV2A 5DX1A 1KO1A 2R47A 2HJSA 3LUPA 4C7KA 3BN3A 2VF8A 5EJ9A 4E5YA 1Y0BA 2C4WA 3PZRA 2A88A 4MMYB 4RJ2A 2VRWA 3NOVA 5EUQB 3P4YA 3LVBA 4U7HA 3Q8KA 3IULA 1M2KA 4U0KA 2GZ1A 4IVQA 3Q9NA 5DK6A 4D56A 3GFBA 4YRCA 5E4FA 5A7HA 1L5WA 4G5XA 5KU7A 3QEBZ 1Y42X 5TV2A 4HNQA 2BJHA 2BUAA 1GTG1 1LWNA 2IXFA 1PEAA 3ZDAA 4NDZA 4PTZA 1SNYA 1SXJA 4KR0A 3SJ7A 2V7VA 4G4IA 1SURA 1TJNA 2Q1XA 2VK4A 3KQHA 1RMYA 3EF0A 4IHJB 2IZ0A 3OT1B 5KNLA 2AYZA 1T2FA 3ITEA 3JWIA 4Z51A 2ZDHA 4B3XA 4RD4A 1FPQA 3N8IA 3QE4A 1E9VA 3GGPA 4MSUA 4WESB 3O3NB 2AX4A 3E9ZA 3EZFA 1KP2A 5P21A 4BNWA 3KUCA 1EHIA 3CUVA 3MHPA 3OEHD 4NI5A 3IB6A 4DTCA 3I2GA 5ER9A 2BZ1A 5ALTA 5C80A 2A1UB 3QFCA 3GMDA 2PK3A 2MINB 4L5IA 1YWGO 2O2SA 1P0IA 2RHOA 1T35A 1WHTB 2Z1DA 1X80B 4G0ZA 4HH3C 4MUEA 4MVJA 1U31A 2XZOA 1IQPA 3UGJA 1TQ2A 3EVEA 2BVNA 1A5SB 4V0LA 3SR4A 1HE5A 4URZR 3ZWWA 1W9MA 2JLUA 1QU3A 3KVYA 4O8ZA 3EZ2A 3OTHA 2VOJA 1GZ3A 3W3AA 3DPIA 1A4UA 1SEPA 1S5PA 4IRUB 4MAAA 5DM1A 5AUQA 3GP3A 4L6CA 3LOQA 1XDSA 1UC5B 3GJXC 4WGGA 1AQLA 4U7PB 5C1IA 5FULA 3RS8A 5BORA 2BKAA 1Y1RA 1J0AA 1NNLA 1XQ1A 1J07A 4TMVA 3RC3A 1E99A 3BE6A 3CTMA 3GN2A 4YP7A 3VJLA 1R0CA 3WWPA 2L2QA 4JI2B 2OL4A 3F5FA 4EYEA 1G98A 4Q37A 3NDPA 4M54A 4OUDA 1M34B 2HHLA 4RFVA 3MWFA 4YHBA 2D5IA 3Q3JB 1F7VA 4NE2A 4DYHA 1E4VA 1Z13A 1O94D 2QXYA 2V9ZA 2VHUA 2Q4RA 1DP4A 3GN1A 2IUUA 3AKZA 2WA2A 1DQPA 1KZYC 3D0KA 2HSEA 2P30A 4RYLA 4ZRDA 1TYBE 4ZCMA 1AN0A 2G9UA 4NBVA 3M9WA 3JQ7B 2GM4A 1YVPA 1LLUA 2HJGA 3TKYA 1DPFA 4YDRA 3NAMA 1UXJA 1PQYA 3H9EO 2JLXA 2C9CA 2M6SA 3MZ0A 2QTGA 4RSGA 2GBFA 4RPIA 5ALLA 4RDXA 2JNWA 2ST1A 3JQFC 1V3TA 2QRHA 3H5NA 3LC2O 3ITKA 1L8XA 2PMEA 5CIWA 4PGFA 4ZVPA 3BDVA 4B3BA 3WWZA 4OGFA 3PFIA 1CUFA 1LDYA 2BIFA 5AJHA 5H4GA 5LKAA 1S9HA 1F8FA 3O8LA 5F3WB 2H4JA 3CZQA 3PX3A 2PZ8A 3OBBA 4XFJA 2ONCA 7YASA 4LIPD 2BD0A 5FNZA 5IC4A 5KREA 2UVPB 2JZNA 1NVFA 3NANA 4EZBA 1W44A 1OWLA 2ZKIA 1L4KA 3ILYA 1R3UA 5CCXA 2H6EA 1POXA 4US1R 2CC2A 2JL1A 2FX2A 4JR1A 3BFVA 3RVLA 4YV7A 1HK7A 1Z0DA 4RFLA 1BRMA 4DVGA 5IVKA 1WAMA 3R5HA 1PJRA 5B57C 5DGDA 1NI5A 4J2OA 2P2LA 1PZMA 5FTJA 4JC0A 2A7XA 3M6WA 2PT9A 1GL6A 4KJZA 1CE8B 1BGVA 2QTHA 4B7UA 1SBTA 4HXFB 3WNZA 2GMWA 2YV1A 1DUSA 4LI3X 1P33A 4KHPB 1FF9A 2FW8A 4ECEA 3KYBA 3ZGVA 1WCYA 1ZX1A 2BMVA 3GJRA 4FGKA 2RI1A 4C0LA 4YQFA 1Q7EA 2Z6VA 1VRVA 2D0DA 1WETA 3P4XA 2IDJA 4MLPA 5ITZB 4YJ2F 1YS2X 2IU3A 3WO0A 3QYAA 2QA5A 3IEUA 3ZDZB 2HYIC 2B2CA 1M2GA 3IIIA 1EP2B 1Z6GA 3MMNA 4UXHA 1JHAA 4JBXA 3L8MA 3ZU5A 4ERXA 1C1XA 1GTZA 2YV2A 3FOEC 4Q1CA 1CV2A 2DQSA 2JD0A 2BJWA 1YJBA 2WI8A 3B5EA 4KNYA 4G2NA 3HE3A 4UMFA 1KY3A 5B1SA 1EUYA 3AERB 3KDSE 4MKFA 1O9BA 3H1TA 3UHAA 1DC6A 2GM9A 3O8CA 1DIAA 3DZGA 3MTDA 1I5OA 3MERA 4I99A 4DRXA 4KVFA 1G3QA 1T91A 1VHTA 2ZCUA 3HNRA 3QY0A 3OTWA 1GCOA 1M1UA 3AG5A 3WYDA 1D2HA 1MC4A 1CUAA 1B14A 2W8BB 5IEJA 3RJTA 1ODTC 4HB0A 2E2WA 1HF3A 5IANA 1KSHA 1JVNA 1QHGA 4JEHA 3UTCA 2F43B 2F64A 4BVLA 3X1DA 1RYNA 5JSQA 3FCAA 2NZVG 4CT4B 4KN5A 1A8QA 2F1HA 4RVOA 1FFAA 1U2ZA 2HREA 2NPOA 2QU8A 1XV5A 5BWMA 4IDFA 1OREA 3VPSA 5JQWA 5EESA 1GQQA 1V48A 1O0SA 3JCZA 3A3OA 3PDWA 1YJAA 4WX2B 1K97A 1A9XA 1U94A 2HY7A 3I3OA 3ZHCA 1S4QA 1TF7A 3PIDA 2FEMA 1GUAA 4FHCA 2PGDA 1LDBA 2L17A 1LDMA 3V7FA 2BEJA 5FBVB 3AR6A 4I1IA 3SICE 4MRAA 3EUAA 3NZEA 1H2WA 4NP6A 1C1YA 3WLSA 4F5YA 1OROA 5K7SA 3ZD8A 2C4VA 2D4HA 4DN6A 2OBLA 3M1YA 4O33A 3PNOA 1YR9A 4MUBA 4CLHA 1GQSA 2CD7A 2HWXA 1QG0A 1X7WB 3MWKA 4J75A 2XUFA 1FP2A 3ULKA 4EOGA 4F6LA 3K6JA 3NC1C 2R8XA 3CF2A 3R7LA 2XBLA 4QDKA 5KYVA 2VJBA 3HXMA 1CEQA 1LLDA 3GEBA 2C20A 1P7WA 3MUOA 1QIMA 2WM3A 3MN1A 2CW5A 1NP6A 2C29D 3AHCA 3HQ4O 4JBYA 2BKXA 2O8CA 2OO3A 1MA3A 3EZ6A 5DOZA 4ZHSA 3FYUC 4OXQA 4WUVA 1NVEA 4DOMA 1LRKA 3M2PA 1S1CA 2FK8A 1LLQA 3QVUA 4BE7B 4ZI3A 5LYJF 2VTDA 4L9RA 2ORWA 1MHPA 5HIJA 5ADUS 1DEXA 4PZUA 1IWBB 3K0AB 5BXQC 1T0JB 4D9HA 1SXIA 4HMQA 1OW3B 3L0IB 4NHEA 4RESA 3D31A 4WNYA 4HDOB 3ZYCA 4BAUA 4BHTA 4CM3A 5K4HA 2OCXA 2W2XA 5IBCA 2HCTA 4EA9A 2BL4A 3TX2A 5JCOC 1RQ2A 2CUTA 2ZB3A 1PNQA 1GRVA 3AFNA 3NT4A 4MINA 3RH0A 3W77A 4PLTA 4M7OA 2C7BA 5BNFA 2BTEA 1PGJA 3GLGE 1ZS9A 5EJ2A 3RFUA 4ME6A 1FRFS 1OWOA 2HHJA 1UBKS 1ULHA 3GEPA 3IP8A 1Y1QA 3ON5A 1J7KA 1KJYA 1M0SA 4OXIA 2J32A 2BFFA 4MYSA 4C76A 1E1MA 5ICSA 1JZTA 2HQBA 2UAGA 1RRVA 1W5EA 4NPAA 4URYR 2NXNA 9ABPA 3NIWA 4W1SA 3H4IA 4JA0A 1ODLA 5AW9A 1N6NA 3OC6A 5AOCA 3WV5A 4EB6B 1A9OA 1ZUWA 4I14A 4LDZA 2VFAA 2RBEA 4Z4EA 1CS0B 2EG5A 1E8MA 2Z95A 4OQLA 1MDFA 3EEFA 3ROMA 2QHXA 3ZCQA 4NCIA 2EVWX 4D4HA 3P9QA 4JCCA 2BUCA 2J5BA 4YRZA 1O1YA 1D4OA 2ZSJA 4OGGA 2OMKA 4ZC8A 5IHXA 4PRYA 3L8CA 5DYTA 1J0EA 1J2EA 1TNDA 2LWIA 2Q3DA 4K40A 3VKUA 5JMWA 3T5CA 4ND3A 2ZBFA 1T0UA 1XAIA 4DHWA 5CDSA 3ZY5A 2IV3A 3B1KA 2JFVA 3B1JA 3KQVA 3KXPA 3PI7A 4LSWA 4FB5A 4OKSA 5IBQA 2BBTA 1XNJA 3CH4B 4G1UC 3K1AA 4P3OA 7ABPA 5DI3A 4CXMA 1QYCA 3KTAA 5AVTA 4UBNA 2WJHA 2V3CC 1ZD8A 3LXUX 4RV9A 2CXNA 4IRMA 4RH3A 3X43A 4AY3A 2C0PA 3OEHA 4I1OA 3EPJA 2IBTA 1G63A 4CF5A 1AF4A 3RHZA 4B6FA 3KQPA 1ZONA 3I8OA 5IDXA 3KTFA 2CL6X 3F67A 2POQX 3HWX1 4P93A 1TFUA 2ZJ7A 2DERA 1UXHA 2FZ5A 1SUBA 5IJ9A 2VQFB 3EIEA 4IQ8A 2R62A 1V1JA 1QIKA 2AQHA 2PGLA 1I9CA 2IGTA 3LW7A 1B0UA 4HRVA 2OOKA 3CNBA 4V0SA 5CX4A 4CQLB 1Q44A 2FKNA 2UDPA 1UC9A 1R6VA 1VA5A 4LHEA 1HZJA 3LKDA 3SQNA 1YR2A 2WHRA 2Q3MA 2UUCB 1FRQA 1C80A 1R4NA 3A6LA 3GLIE 3CW2A 1M83A 4D9MA 3I45A 1I32A 3ZQJA 1B23P 4TVKA 4YECA 2HJ9A 3K20A 4M0CA 1X1EA 1FBTA 1D6SA 1KVUA 3BS4A 3LWNA 2ZUUA 5I7WA 1KTVA 2Z5FA 2YFYA 4X54A 1I2CA 1KAHA 1J06A 1KGDA 3GJ6A 1WEHA 5J4VA 4Z9FA 1BYIA 4C1BA 1QB8A 3PL1A 3AIOA 1QYIA 4YRDA 4XWWA 2R6HA 3QWFA 2NIPA 5LUBA 4L5JA 1PSWA 1O94A 4PSKA 5DGIA 4DSAA 1E89A 5JBIA 4QUHA 4I1RA 2L82A 1POWA 1GG8A 2EOAA 2ZTHA 2PHZA 5IKXA 1P9RA 4FFNA 3LX6A 2AR7A 2FAXA 2ZRNA 5BW5A 2XRZA 1Q57A 4OKIA 4LE2A 5KYWB 3G23A 1U28A 3VVCA 1A2OA 1UPFA 3VDQA 4FDAA 2I91A 1M6WA 1WW3A 3FYSA 4A6DA 4CM7A 3T7IA 3MC1A 2PX4A 3H65A 4X41A 3GLHA 2DUWA 3R24A 1KPGA 5AMXA 3HCDA 4CMJA 5IXYA 3A1NA 4E31A 4GRAA 2O8FA 2IZZA 1J8QA 4XSVA 3JASA 3RYIB 1R0YA 4N4AA 4XVUA 3K2BA 3I12A 1ILEA 2DUUA 4GM4A 4ZQFA 5KSYA 1JSCA 1QP8A 2GKSA 4Y7CA 1F48A 4YJ3B 5JECA 5E0OA 3HKDB 1NR7A 2YYZA 3A1WA 4UM8B 4UVEA 2I4MA 3QTBA 2XMQA 3NORA 2HWKA 8MHTA 4XIGS 2HT6A 5ALJA 4HG2A 3JZFA 1ONOA 2XMGA 1P4SA 3MS7A 4OU4A 3AY3A 1RYEA 3RT7A 5F5LA 4QU8A 3P5BA 4F3NA 1Q3KA 1T8YA 2WSSD 2ZW9A 4FBGA 4DV0B 3IMKA 2ZJ6A 4RJJA 1SCNE 1Y9AA 4LY3A 4EHDA 4ALKA 1ZESA 2Q8NA 2GYUA 2X0JA 4RV5A 1U8YA 4RSMA 4PINA 5BQ5A 4DNQA 5JLAA 2CE7A 5L4SA 3AWDA 1IH8A 1GVNB 1JECA 4B6SA 4F12A 2GZSA 5EC8A 3TRIA 3B2EA 3KHTA 3PUIA 1C9KA 1WNFA 2GBLA 1QIEA 3EA4A 2IXDA 4DWVA 4G4JA 3AB8A 4JJKA 3TW8B 2VYVD 5T4EA 4CTMA 1RI4A 2BR3A 2FZLA 1LVGA 1E2QA 3LDHA 3ZDCA 2UYOA 1GKYA 3ICOA 3ORSA 2ZB7A 2HA2A 4XYEA 5DM2A 4KBGA 3WG9A 4BMYA 2O4UX 4IIDA 4F3KA 2GXQA 4JT8A 2EW8A 3JQDA 2BGNA 2PL5A 4C1NA 4LBWA 3JQCA 3MNFA 2FDXA 3GLUA 4YJFB 5FIUA 1G20B 3MYRA 1O6BA 4MA5A 2DQ4A 4IJMA 5TB5A 1VSTA 5AJUA 5C4MA 2O8DA 1H9BA 1OHHD 3W79A 1H9AA 3EG9B 1H2EA 1O89A 5I4KA 5IT9A 1VP9A 1LGYA 4LCEA 4FCVA 4O4JF 4BB0A 2WG2A 3TH5A 2AJTA 2TMYA 4GI5A 3R6GA 3HU1A 4KRXA 3WK9A 1ZM9A 4EECA 3P94A 4TZKA 3B78A 5L3ZA 1RLUA 1GA6A 1VG9B 2HA3A 3H2HA 3G17A 3IHTA 2CV0A 1P2UA 5CYGA 1CUSA 1E5LA 2PQ6A 4Q9HA 1YFZA 2XX3A 2V45A 4I4TB 3TYXA 5HJ5A 3T1NA 1Y4UA 3ZCXA 2P0YA 2HSZA 5DSZA 3ZPXA 4ALJA 5DNCA 3T1VA 4H3KB 2NX2A 1W52X 2WZCA 4PSAA 4REOA 3UMYA 4G1BA 1FS6A 1I4DD 3IBFA 5BNZA 1CEYA 2JEZA 1WPXA 3OT5A 3MCTA 4M8SA 4C08A 3L4KA 3BE5A 3OUZA 4UOZA 3QKRA 1V6AA 3P19A 1ID8A 4U63A 3ZD7A 4EG7A 4BLRA 4YYZA 7MHTA 4QL3A 3RJ5A 1IWPB 3AHDA 1NBIA 3L79A 3TOZA 3PL5A 4JU8A 3WIEA 3OFSA 1KY2A 1KZ1A 2VJPA 3W9BA 4C7MA 1LBTA 3KSDO 3VV3A 4EGCB 1EFHA 2EWWA 1E1YA 1PJ4A 1A3CA 2HRZA 1ANKA 3M1IA 3N3BC 4R6WA 5B7PA 3U44B 4L07A 4MWGA 5G1PA 3EVAA 1UC4B 3C5CA 3H7IA 2YMLA 3AOGA 3OPYA 5A3JA 4JL5A 2GSDA 4JEUA 2X5XA 5D2CA 2OXIA 1XZNA 1E92A 1E5TA 3A6HA 4DJEC 2GDJA 1ZN9A 4W8OA 2Z4SA 3SKVA 3OZUA 2ZE7A 3A3KA 4ZKEA 4OYHA 5JNUA 1RE0A 3QLTA 5A0VA 3T06B 5E95A 3KE8A 4HBZA 4O4IF 3WGVA 4RIHA 3AFMA 3EDQA 5TDHA 4BKUA 2IH2A 3HEAA 4MR8A 2XNCA 4MB0A 5JSUA 1EQUA 1Q92A 2V97A 4Z2YA 4ZAVA 2HRQA 4C20A 1IOVA 1HG0A 2EEZA 2FEKA 2OO5A 3OWXA 4KC0A 5HG0A 1RXVA 2OAQ1 4A2PA 5CTJA 1Z5ZA 4CUKA 2BEVB 1CUIA 1C0KA 4RK4A 6LDHA 4WGFA 1GSOA 1I51A 2EHDA 3UWSA 4XVHA 3G82C 3LTEA 1NBMD 4FI3F 3B8EA 5JR3A 2EKBA 1VMIA 5HBGA 1REQA 2VYND 2WSLA 3G85A 4LJ5A 2DMRA 4ZT4A 3DMTA 1AZWA 1GYPA 2A9OA 2R68A 3W8FA 4CQMB 3TPFA 1B3RA 3H1FA 2YASA 3UC9A 1MZVA 3IAEA 1TT5B 2FP4B 3F4BA 3FFTA 4QVKA 4WZBA 1MENA 3VJKA 2BE9A 2CN1A 3FYCA 4H1WA 1ZSYA 2Z98A 4GQIA 3UUGA 2CSXA 3I9NA 4ZCLA 2DPHA 1P19A 3B36A 2CGEA 3WK6A 1ECJA 2WYHA 2AUNA 1TCAA 4DYDA 3PDIA 1THZA 4EAAA 4EMUA 2O5EA 1O8BA 4B40A 2N1BA 3FLEA 3OVMA 2C2BA 1OAKA 2JKVA 3HC7A 5B3JA 3EEIA 3F9CA 5C34B 3L92A 3U4CA 1QH1A 1XVIA 3ZNNA 4EG5A 5ALHA 5J2TB 1E9RA 1FTQA 5CAEA 1RRCA 3KELA 4M7RA 1ULUA 4YC7A 1NF3A 3NCHA 4YWHA 2QPAA 4LK2A 5A1TA 2PUJA 4F06A 1MJFA 2FJPA 2ZI4A 3S68A 4B79A 1U0BB 1M9NA 5EJ5A 3GX1A 2CSUA 3DFIA 2J6IA 1QAQA 4B7XA 1HMYA 3O84A 4EUHA 1KR5A 3DCIA 3EY9A 3R6DA 1E77A 1QB7A 1G4AE 4G8JA 1S2NA 1RWMA 2FSGA 1NXTA 4S1OA 3A2LA 2GUGA 5MFPA 1RBYA 4FILA 1QKIA 1FDWA 4JP3A 1N2HA 1E9AA 1EK1A 5AM4A 5E9JA 4D0GA 2IOHA 4WBNF 3NHYA 1HY3A 1KJNA 3WA6A 5J2UF 2NO9A 1J1UA 4W9RA 2JFYA 2TRSB 5BR7A 1RAGA 1Y3DE 3K8OE 4L0QA 3USCS 2Q45A 3ONEA 3IDZA 5GVSA 5HZKA 5AXCA 1PS8A 2WAMA 3QX9A 3E4DA 1EFDN 1C0IA 1H3FA 3H6HA 1K8QA 4XJXA 4KYIB 3V7WA 4ZTZB 3UAVA 1TI7A 1DDIA 4HNTA 3NBAA 4DQXA 5L4NA 2QPTA 5FI3A 4RLSA 4JELA 5DMXA 3S0JA 1ZRHA 1U0GA 3BCRA 3WLKX 4CI9A 4J9UE 4PWYA 3SZGA 4AJNA 1P72A 2PZJA 5TMBA 4BGEA 1VL6A 2VSQA 4ZI7F 1JG3A 3LCRA 2FRDA 5CIYA 1XLTA 5AI9A 1T9AA 2KM1A 1D04A 4M88A 3E84A