3U0VA

Crystal structure analysis of human lyplal1
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
222
structure length
222
Chain Sequence
LQRCIVSPAGRHSASLIFLHGSGDSGQGLRMWIKQVLNQDLTFQHIKIIYPTAPPRSYTPMKGGISNVWFDRFKITNDCPEHLESIDVMCQVLTDLIDEEVKSGIKKNRILIGGFSMGGCMAMHLAYRNHQDVAGVFALSSFLNKASAVYQALQKSNGVLPELFQCHGTADELVLHSWAEETNSMLKSLGVTTKFHSFPNVYHELSKTELDILKLWILTKLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysophospholipase-like protein 1
publication title Crystal structure of the predicted phospholipase LYPLAL1 reveals unexpected functional plasticity despite close relationship to acyl protein thioesterases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 83
structure length 222
sequence length 222
ec nomenclature ec 3.1.2.-:
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3u0vA00
2HIHA 3FSGA 4X90A 5HF8A 2CKMA 3FVTA 5AKIA 2WHRA 2ONCA 4GWLA 4X7BA 4KE6A 3QVMA 3HXKA 4X94A 2WG1A 5AIAA 1EDBA 2JGFA 1LBSA 3LS2A 1XRQA 5J3JA 2PPLA 3V1KA 1VA4A 3B3QA 3A2NA 3ED1A 3G0IA 4U2GA 4J0JA 1KU6A 3VJKA 3BXPA 5JAHA 3WZMA 2JGIA 1QFSA 2XI4A 4ZREA 5ALLA 2WJ6A 1CVLA 5CW2A 5HQ3A 2QOEA 1QIEA 3A70A 3I2KA 2OG1A 2OCIA 2JIDA 4EUSA 4EY4A 1MNAA 1BN6A 2BAGA 3T52A 2QXTA 2BUCA 1F6WA 2PSDA 1M33A 4FLEA 4JEIA 2WUEA 3FLEA 4H0CA 1CUHA 1QJ4A 4Y2SA 3AINA 4WJLA 2WUGA 4W1RA 4BC1A 4WY8A 4EB0A 4XX1A 2HL6A 3FCXA 4D9JA 4UHCA 4BBZA 3PFBA 1TAHA 3R3YA 5AKKA 1UKAA 5LZ2A 1QZ3A 1YAJA 1NU8A 3DOHA 4DIUA 5LP1A 4C89A 4X71A 1IMJA 3SC2A 1VE7A 2J4FA 3E1GA 5ALEA 1BEZA 2I3ZA 1LGYA 3I1IA 5C8ZA 3DOIA 2J3QA 4BP9A 4M0FA 2LIPA 4BVLA 2K2QB 3G9XA 3WZLA 5HQ3B 5DYWA 1XQXA 3Q8WA 1L7AA 2IX9A 2C5GA 2PSEA 4PF1A 4OB7A 2WQZA 4X00A 1T2NA 3VISA 2XQKA 4AN1A 3QMWA 2OXEA 4OU5A 2WFMA 2ES4A 1ODTC 1Z68A 2XE4A 1G4HA 1Q0RA 5DTIA 2WSLA 4MQLA 4FWBA 1ISPA 4DGQA 3WLAA 1ZI6A 3G9ZA 3OG9A 4M0EA 1IUNA 2G5TA 3PDCA 4ZGBA 1R4ZA 4UHDA 3C87A 1THTA 3STUA 1E8DA 3VKFA 5DNVA 1XKTA 3WJ2A 4AZ3A 1FFAA 1CRLA 2HA0A 4HAIA 2Q0XA 4CCWA 5JAOA 5HF5A 1I6WA 4C4ZA 3A2MA 4AZ0A 3O4HA 4UHHA 1YB7A 3DYIA 1DQYA 5ALYA 3H0CA 3FYUC 3L1IA 3R41A 2WIKA 2ZJ6A 5AOBA 5HFAA 1MX1A 4F60A 4OU4A 1L7RA 1VKHA 1MJ5A 2XUKA 5AKLA 3HI4A 3M82A 1TKRA 1MU0A 1E8MA 4Q3LA 5FRDA 2HA4A 4QE3A 3H2HA 2W6CX 3GFFA 4PV7A 4GBGA 5AHXA 2DQYA 1XZLA 1HQDA 4X3CA 1WCYA 4BATA 1GKLA 1UZAA 5ALNA 3IUNA 4IHAA 3KWJA 4BCDA 3ZV7A 3IUJA 5C81A 1LPMA 3C5VA 1AZWA 4GECA 1ZOIA 4ROTA 3NGMA 4BVKA 4UBIA 1W76A 5EHXA 4HXEB 1ZIXA 4N8EA 3C6XA 3WL6A 3M3DA 4N5HX 1CLEA 5DYYA 4HXFB 5JZ9A 4J3JA 4DNFA 4U2CA 3HC7A 4CG3A 4A16A 4JYMA 5CTAA 1UKCA 3BF7A 3D7RA 2HM7A 5AM5A 4HZGA 4E11A 4NZZA 5ALSA 5T4FA 1ZI8A 5DJ5A 1CUSA 4KAAA 3NUZA 3AILA 1JJIA 1XZKA 2WJ3A 4QZVA 4BAUA 1XROA 3DJYA 5JD5A 4X92A 1WHSA 4UPDA 2RI6A 2BUAA 3H2JA 4GW3A 3N0TA 4GLBA 2YYSA 5ALHA 1N8SA 4MQMA 2V97A 2GBIA 4WFIA 3G0GA 1Y37A 4W63A 2OLEA 3FAKA 5CRIA 2GBFA 2YASA 2PSFA 2JGMA 3ESAA 5CT5A 1TRHA 3ICWA 3R3UA 1RWQA 1VZ3A 4Y2RA 1N5MA 2VJAA 1GKKA 2R8BA 1CUDA 4B0OA 4B7ZA 5AKGA 5CT4A 2B4KA 4UBLA 2WFLA 4BYMA 1UOOA 6YASA 5LKRA 2XMGA 1PV1A 3O4GA 4W1PA 4BCBA 5ALUA 3G0BA 3QPDA 1H22A 5K5EA 3U0VA 4P08A 4E15A 4LXGA 4YX9A 3IVMA 1EK1A 2QUAA 4N5IX 4Y2UA 3WA6A 4RGYA 1CR6A 4B82A 4WY5A 5BWBA 1UK9A 3DKKA 2DHCA 2AJCA 3OOSA 2OCGA 3JWEA 2VAVA 2VT7A 4H7KA 3I6MA 1TIBA 1LZKA 1OXMA 4MWTA 1CQWA 5ESRA 5IH7A 1HBJA 3D5EA 4A23A 1MN6A 2ZYIA 4KEAA 4C01A 1XZFA 1SC9A 3FSGD 5D6OA 4IH4A 2WILA 1UT6A 1EB8A 5AI9A 1MX5A 4H77A 2WFLB 4XWGA 2Y6VA 3STVA 4B81A 1ZI9A 3V1NA 4LXIA 1W6RA 1W4LA 2RHTA 1DU4A 2IITA 3ZWQA 2B9VA 2XMZA 1QIHA 2RHWA 4I4CA 3VVLA 2O2GA 3WA7A 5HF9A 1H2WA 3LCRA 3WYNA 2PM8A 4AB1A 4UFPA 1SOMA 4BAZA 2QR5A 4AO8A 4F5ZA 1WOMA 3HJUA 5K3AA 4O08A 3QYJA 1S8OA 4C4XA 3QH4A 2GBCA 1XRMA 1LPBB 3CN7A 5KREA 2CB9A 1DWPA 5IVDA 2PSJA 5AKZA 4OSEA 1J2EA 1JU4A 5HK8A 4OPMA 5FLKA 2FX5A 1F0PA 4U2DA 1WPXA 3VVMA 1FSSA 2ECFA 4QDTA 1Y7IA 4AMYA 5ALXA 1H2YA 2J3DA 3GA7A 5ALGA 1LPOA 4QNNA 3W05A 4TPKA 2VEOA 3LIIA 5CXUA 3CCBA 5JAUA 1C7IA 5CT9A 2XMBA 2DHEA 3CCCA 5A7FA 3WWEA 4QDOA 1CUZA 1DTEA 2WG2A 3VJMA 4I19A 4PSCA 2Z5GA 2HU5A 2DR0A 2XMRA 3O0DA 4XVCA 1ACJA 4ZRDA 4KAJA 4G8DA 1R9NA 1BRTA 2C4HA 5FP0A 3FBWA 3DCNA 5AO9A 3PICA 1ZD2P 2QT9A 1OILA 3IA2A 4HS9A 5K3BA 1OCEA 1ZD4A 1YS1X 1QIKA 1R1DA 4WDQA 1QGED 1CUYA 3B12A 2I03A 5AM2A 5JZSA 4LYDA 4UBKA 2HA7A 5E4TA 5ALVA 1JU3A 1CUIA 4Y2QA 3K6KA 3IDAA 5CBKA 4G1FA 2DQZA 5A7HA 3K9BA 3CXUA 4ETWA 1K6EA 5LZ7A 7YASA 4J0KA 1XZJA 4MYSA 2WG0A 3AZPA 2QZPA 5FDFA 1CUUA 4K6GA 4X93A 1CUGA 3F9CA 4G9GA 5EIEA 3AJAA 4Q05A 1P0MA 4AQDA 3O9VA 4MJ3A 1DX4A 5FOQA 1EX9A 4JNCA 2ZVDA 1XLWA 5HF6A 4BDSA 5K3DA 3C43A 4NVRA 5LIPA 1G42A 1AKNA 4B85A 1UOQA 3PUHA 1Y7HA 3UUFA 2HU8A 1CPYA 3TJMA 2XMSA 1B6GA 4RE5A 1GGVA 5AI5A 5DLPA 3T4UA 4FFVA 4KE7A 4BP8A 1DWQA 2JGJA 1UXOA 3DD5A 2PVSA 1BE0A 4Y2TA 4OYLA 2CEKA 2XQIA 4TGLA 4DSZA 1BS9A 4Y2XA 3C70A 3I6YA 4BZZA 1QONA 4W1QA 1FFDA 1BCSA 4ARAA 4F0JA 2JEYA 2ZYSA 3TEJA 2GZRA 3JW8A 3D3NA 3EIOA 1EI9A 3FNBA 3D59A 4Y7DA 1ODCA 2XUFA 3C6BA 5AK5A 2ORYA 1VLQA 3D2AA 2QVBA 3IIIA 1ZICA 3ZLVA 5E2IA 5JZBA 2WU3A 4C6HA 4RPCA 2XQFA 3HACA 3BE8A 2XT0A 4INZA 4J0IA 3N2ZB 2XUGA 3ZLTA 2GYVA 1DQZA 2FUKA 3UMJA 3EBLA 1JKMA 1AMNA 2PKYX 1GQSA 2ZJ7A 1F0NA 3QPCA 2OGTA 4GHWA 4IH9A 2G4LA 4BC0A 4B84A 1CUWA 2H7YA 4H18A 3F97A 4WFJA 4BTLA 3OURA 5CMLA 5CXXA 3AIMA 4BRZA 3KOOA 1J06A 5EIHA 4MEBA 4G8CA 4L9AA 5AK3A 3L1JA 3H2GA 3L1HA 1E66A 1ZD5A 2VQ6A 2ZYRA 1WB4A 3AIKA 1XQVA 4C88A 1ZJ4A 1MNQA 1VJ5A 3FYUA 5K3EA 4MWSA 1DX6A 2XMDA 1ETHA 1UOPA 1B41A 4RE6A 4X6YA 2WKWA 5ALFA 4KACA 3IURA 5C7YA 1LZLA 4B0PA 1XZGA 3WK9A 2O2HA 4FMPA 4CG1A 4AN0A 2BKLA 3PE6A 4HXGA 1YA8A 3AUKA 4Q1VA 3C45A 1CUAA 1GPKA 3YASA 4S0XA 3FLAA 5JATA 4BE9A 3WWOA 2WHPA 1MPXA 5JALA 2ACKA 2ROQA 3I1YA 5AM0A 1DT3A 1EINA 1XZDA 4OD0A 5AICA 5ALIA 4Q3OA 4DNQA 2I3DA 3D4LA 2VA9A 4X91A 3WL8A 1R88A 3A2LA 4W1SA 4I3FA 1XLVA 2G63A 4H7HA 3EQ9A 4Y2PA 4ZI5A 5ALTA 3HSSA 3D2BA 4J03A 5FPQA 1G66A 3DYVA 3R3XA 3D2CA 1RP1A 3K2IA 5ALOA 2XMQA 2JBWA 1XLUA 4EZIA 2H7CA 5I7UA 3FYUB 1DT5A 1XFDA 1NX9A 1H23A 2X8BA 4H35A 4BDTA 5F4ZA 1LBTA 2WIFA 4PQEA 4DTCA 4P93A 1HLGA 2AXEA 2RAUA 4CIAA 1CFJA 5LKAA 1TCCA 3DL7A 3EQ8A 3M83A 3EF3A 1XQWA 2RGUA 1E5TA 3O4JA 2OQVA 5CT6A 4V2IA 5EIAA 2BGRA 1JJFA 4FKBA 2GYUA 3WWPA 3V9AA 2WHPB 2Z8ZA 3F8SA 3S2ZA 3I28A 1DINA 4WFKA 5I9IA 4MEAA 2Y6UA 1QO7A 1WHTA 2AJBA 5DNWA 3QBJA 3WKEA 2UZ0A 1QIFA 2PBLA 4QA9A 2NW6A 3PF8A 4QWWA 1UK6A 1LPPA 4DYHA 2VJDA 4U2FA 1EB9A 3I2IA 5D3KA 4Y9SA 5ALRA 2FJ0A 3H19A 1MT3A 5K3CA 5I8PA 2DCMA 3HEAA 2WUDA 4P9NA 4DMKA 5FXMA 4CI9A 3HZOA 3ILSA 5JASA 3H18A 1Q0ZA 5KWIA 1HDEA 4E14A 3HYSA 5ALWA 4JYPA 2WTMA 4PW0A 4Q3KA 2VF2A 2WJ4A 1IZ7A 1WPRA 2PUJA 3I2GA 3WKCA 1EVQA 4Y2VA 4J7AA 1CUVA 5AM4A 5A2GA 4CIBA 3GROA 2HRQA 3DDUA 3O9MA 1L7QA 4J0DA 4UFNA 3UUEA 4GXNA 1IUOA 4X97A 3D0KA 5ALZA 4G5XA 1WB6A 2OPHA 3W9UA 1MAAA 4FNMA 2WIJA 4Q34A 4K6HA 4UHEA 4ZWNA 5AJHA 4K6KA 5ALKA 2X76A 3BDIA 4GDMA 3OC0A 5JYCA 3H1AA 3WYDA 3C6ZA 4B80A 2XQGA 4GI1A 5JANA 4DMCA 4PSDA 1YB6A 5BOVA 3G9UA 4A5SA 1NU6A 4LXHA 5JD6A 1VXRA 4P92A 1CUJA 1IVYA 1QOZA 1WM1A 2JGLA 3E4DA 2XUOA 4G8BA 2EEPA 4FTWA 1FFBA 1XZBA 1F8UA 2XB6A 5CH5A 4QEKA 4WDRA 3HLKA 5AKYA 1JMKC 2OGSA 2QXUA 3V1LA 4AO6A 3NWOA 4UFOA 4KRXA 1E3QA 4BCCA 2XMCA 1THGA 4FNGA 2HRRA 2O7VA 1ODSA 2VJBA 1QTRA 4ZXFA 2HA5A 5CURA 5ALPA 4YASA 1C7JA 2H9YA 2QS9A 1K63A 4XJVA 1XRRA 4DNPA 3W9BA 1EA5A 4U2EA 4BRSA 3BJMA 4X95A 1SCKA 3M81A 4QWMA 3H1BA 5AKEA 2ZJFA 3HRHA 5A7GA 2JEZA 1U65A 1ORVA 2C58A 4H7FA 1BEEA 4OUKX 4M0MA 5ALJA 5IVKA 3S8YA 3WKAA 1R3DA 3OTQA 4PO3X 3R3ZA 4FLFA 3G02A 3C8HA 4XIIA 3V1MA 3F96A 2QTBA 3G8YA 1LPAB 5SYNA 1KEZA 3BIXA 1P0IA 3DQZA 3LIPA 3BWXA 2W22A 4QLAA 3C8DA 4B9EA 4YPVA 4QLOA 5LLSA 5H3HA 3WWDA 1AURA 5T4HA 5HFNA 3FWHA 2Y2VA 3ESBA 1PJAA 5EHZA 1UWCA 3SK0A 1GPNA 1CUCA 5JIBA 2CUTA 3MUNA 1Q83A 4J0GA 4MYDA 3E0XA 3QM1A 4EHBA 4U2BA 2XQJA 2X5XA 3FYTA 3GELA 5ALQA 1QFMA 1O6GA 1EDDA 4AX4A 3AIOA 1AQLA 4PSUA 2HA2A 4QDXA 5K3FA 4NMWA 3RKSA 2WIDA 2OGZA 5EI5A 5AKJA 1YR2A 4BZWA 5LZ8A 1EVEA 2O2IA 4UBOA 4Y2YA 5AI8A 5D3ZA 1CEXA 1UK8A 2V96A 2XUAA 4X85A 1EK2A 5JD4A 2QKYA 3F98A 3C5WP 5A71A 3KWFA 4WCVA 1VXOA 4LKOA 2WTNA 2XUDA 3MVEA 1XQYA 4BB0A 3I2HA 1TCAA 5HCUA 1XRPA 2Z8XA 1H2XA 1MO2A 3I2JA 5FPPA 3STWA 2IIVA 2WM2A 3DL4A 2HFJA 2B61A 5DYTA 4AMZA 1CUFA 5AKXA 2HDWA 1EHYA 4TVKA 1D07A 2HFKA 2DSNA 3BF8A 3CN9A 3GZJA 4OB6A 4B9AA 4FDMA 4FOLA 4BVJA 1ACLA 4KR0A 5AK6A 5CH8A 2PUHA 3IBTA 1EXWA 4N8SA 2ACEA 4EA6A 3ANSA 2FJPA 5K3FB 3OM8A 3WQHA 2AJ8A 2V98A 3VXKA 1EDEA 4MXDA 5KBYA 3I2FA 2OCKA 3X3HA 2QMQA 4RNCA 2PU7A 1ZJ5A 4KAFA 1AX9A 3BJRA 3V48A 2I78A 4UUQA 2QJRA 5A62A 1IZ8A 4L72A 2RIPA 5C8VA 1ZD3A 5HZGA 1JFRA 4FFWA 2QUBA 4FLMA 4F21A 4ITVA 2WHQA 5AOCA 5EHQA 1HL7A 4FBLA 3DS8A 4DSAA 5DNUA 5LYYA 2VSQA 1XZHA 1LLFA 4ZV7A 2XUQA 1BCRA 1CUXA 3H2KA 2XDWA 1Q84A 5ALMA 2PSHA 2PU5A 2BCEA 4BE4A 5DWDA 2OCLA 2OAEA 3PUIA 5FV4A 5IKXA 4QDUA 1ZIYA 4H7DA 3STYA 1IUPA 5FKJA 4QDZA 4H7EA 5JARA 1JJBA 3QZUA 4H7JA 2ZYHA 4HRYA 1QIGA 3AZQA 5SYMA 4FBMA 3ICVA 1XZAA 4ARBA 1E8NA 1A8UA 3ESDA 3WKBA 3G9TA 1C4XA 4ZV9A 4NS4A 1XKLA 2OAGA 3O4IA 1A7UA 3IULA 2E3JA 2XLCA 3ANTA 1GXSA 2CJPA 1G5FA 5YASA 5BV7A 4DNOA 2DHDA 2XUPA 4UHBA 3DLTA 3BL8A 4CG2A 3H17A 5AIBA 2Z3WA 4HTAA 1GT6A 1JI3A 4EY6A 3IUQA 3O95A 1QIJA 2GYWA 2CZQA 1FFCA 4H7IA 4JUIA 1A8QA 4Q82A 4EY5A 3R3WA 1YS2X 3DKRA 2C7BA 3NOXA 3ZPXA 5DTJA 5HK9A 4BAGA 1WB5A 3MGAA 2Y1KA 1J07A 3WK7A 4Z49A 1YAHA 5KWJA 3IB3A 5AM1A 4L0CA 1K5PA 1X2BA 3LLCA 1TCBA 2HA3A 1FFEA 5AH0A 1BU8A 3FLBA 2XUHA 3RM3A 2DFPA 4KRYA 1W52X 4EY8A 4B83A 2VT6A 2OQIA 5CH3A 2QM0A 1XZIA 5A6VA 1LPSA 2BJHA 3QMVA 1ZGCA 3B5EA 3DNMA 3BIWA 2WLSA 2C5FA 3GUUA 3STXA 1SCIA 3ZI7A 2ZSHA 2XUIA 3R40A 4G4IA 3WI7A 1MAHA 1GZ7A 5D7BA 3VDXA 3AZOA 2BFNA 2PX6A 2R11A 4OB8A 3F67A 4UBJA 5BWCA 5AI4A 5HKAA 3U1TA 1PFQA 2PL5A 2EDCA 5ALDA 2CBGA 2B20A 4CFSA 1CUBA 4JH0A 1XZCA 3QITA 1K4YA 5AKHA 4X6XA 3WK5A 4UBMA 3E3AA 2CMFA 4GEGA 5AK4A 1CV2A 2WUFA 3I6ZA 2HADA 1RYYA 1XRNA 1QLWA 1ORWA 1HKHA 2HU7A 4J0HA 3PI6A 3KDAA 1QIIA 4EBBA 2D0DA 5JADA 3VJLA 4KJXA 3JYHA 4G4JA 3WL5A 1BROA 5T4EA 1QO9A 3STTA 3ESCA 2C0PA 1P0PA 1USWA 3PFCA 3R0VA 1UFOA 1AGYA 4HRXA 1SFRA 4X6UA 5AM3A 5HKBA 1QE3A 1K8QA 1ZGBA 5EFZA 3RARA 3WIOA 1CUEA 4LYEA 1VZ2A 3WJ1A 3A6ZA 3Q0TA 1TQHA 1SCQA 2EDAA 2QRUA 3W2TA 3LP5A 5C8XA 1P0QA 1X2EA 4KYVA 4DLNA 4AO7A 1VA5A 4UBNA 5LZ9A 1UKBA 2Y2UA 1U8EA 1GQRA 5AOAA 3KSRA 3P2MA 3WK6A 1A88A 3QMMA 1YA4A 2C0QA 1QIMA 1W1IA 3TRDA 2GZSA 4BTVA 5AP9A 5IVHA 1N5RA 2JGKA 1E89A 4HVTA 4C4YA 1JMYA 4LIPD 3BDVA 3WKDA 4CCYA 2WFZA 3HABA 1MTZA 1XZMA 2WU4A 2V9ZA 1YASA 1GPLA 3KXPA 2XUJA 4OYYA 3SX4A 1VOTA 4DMFA 4K5QA 4OCZA 1A8SA 4FHZA 3RK4A 2O7RA 2YH2A 1HPLA 5AI0A 5JAPA 3G7NA 1YCDA 5ISMA 1XRLA 5IVIA 3WK4A 4E46A 1LNSA 2QJWA 2VATA 3ZLUA 1U2EA 2AJDA 1J1IA 2GBGA 3G0DA 3EQ7A 2XLBA 2AJLI 2HA6A 3IUMA 3C6YA 4DM7A 2Z3ZA 4KE8A 4N8DA 1EH5A 4EY7A 3WWCA 3SWWA 4G9EA 2J4CA 4LHEA 1MX9A 5E4JA 1LPNA 4W9RA 4IH1A 2H1IA 4IO0A 4UHFA 3DEAA 2D5LA 1TK3A 2WIGA 1X70A 3R3VA 3FCYA 1DWOA 2BGNA 2G5PA 3MUOA 4IQ4A 3WL7A 2BUBA 4L3WA 3PF9A 1N1MA 1UK7A 5AI6A 2H7XA 1JT2A 4Y2JA 4CCYB 1AC5A 2ZSIA 3H04A 4J0CA 1T4MA 3FOBA 4DMHA 3H2IA 1YSCA 2RONA 4B6GA 3OPMA 3KD2A 5T4BA 4K2AA 1W75A 2VAXA 3QPAA 1FJ2A 2HHAA 1CQZA 1H2ZA 2P8SA 5LZ4A 1KU0A 3FVRA 1QTIA 2YXPX 2VJCA 3WK8A 5E4YA 3WIBA 3RLIA 2JGEA 4AXBA 1R50A 5EHNA 3TGLA 1XZEA 1R9MA 2VTVA 2JF0A 3W04A 5LZ5A 1QIDA 4C87A 3GBSA 1BN7A 1CIJA 3W06A 1O6FA 3AFIA 4PNZA 1AUOA 1U4NA 1VE6A 4KE9A 4G4GA 5EGNA 5CT8A 5FUMA 3WMRA 3G0CA 4YK7A
chains in the Genus database with same CATH superfamily
4DJAA 1X7WA 2H1LA 2OY0A 4Z9YA 1P61B 4Q39A 2KB0A 1UH5A 2SKCA 4MUMA 5J2UA 2YXNA 3HXPA 1J22A 4A6XA 4WV3A 1YTUA 4X90A 2OE2A 5DTRA 3LXXA 3FVTA 2DQ4A 4FIDA 1FRQA 2ONCA 4GWLA 3RRYA 3UJAA 3WTBA 4KE6A 1PGPA 4EJ6A 1AQNA 4HAZA 3NXSA 1HO3A 1SQ6A 2MIIA 3I05A 4IVPA 5AIAA 3B1JA 3R5TA 3SJAA 4D8XA 2JHFA 1XCJA 4TV8B 3UOWA 2CDAA 1QGYA 5CHEA 4A92A 1NJ8A 3NAMA 3PIDA 3LX8A 1Z06A 3BH6A 4ECEA 2CZGA 1PX0A 3U4GA 3LS2A 4BVGA 4EUNA 4ZCQA 4GPTA 1GA4A 1E1LA 1XRQA 2NZYA 5HRAA 2VDJA 4YAUA 2IL1A 4B4VA 3ICCA 3E3MA 3BK2A 3F7OA 3I76A 4JIGA 5ILQA 4K2HA 5IZ4A 4AUNA 1QANA 4BIMA 4CV1A 1QLHA 2NTNA 2PPLA 3MT0A 5LA6A 3ED1A 2ZOSA 3G0IA 2GRAA 1XTBA 2M1XA 5BV1A 1KU6A 1X7YA 1U2DA 4JJZA 2W42A 2CVZA 4C7XA 4N41A 3WZMA 3TFOA 2RC5A 5LQAA 2YC4C 3ILVA 2HMVA 2FEOA 2IK8A 2PUWA 2DGDA 3W4KA 4A0RA 3EE6A 5FI1B 1E2BA 3FZQA 3UMVA 2C7GA 4CT4B 4ZV4A 2X1LA 4R2JA 1L5SA 2ODBA 2VDWA 4PFKA 4ZAVA 3QWHA 1CVLA 4BN4A 5K4AA 1TVEA 4XPIB 3T3PB 3UG7A 5H4HA 3LX4A 4OH7A 4OMUA 2QGNA 3K09A 1VL5A 1L7PA 1FX0B 3S40A 3TZLA 1Q1NA 1K7FB 4TRRA 2C61A 3GN1A 3R5SA 1R37A 1LNZA 3A70A 5AUQA 2CZCA 3AR6A 1RLUA 3NP9A 2JIDA 2I1QA 3IGFA 4RIFA 4QOFA 1NDUA 2C83A 2GAAA 3ICPA 5CD9A 4ID3A 1DC4A 1YCFA 1NP3A 1P1FA 1OZGA 2BHLA 3PFGA 3T7AA 4IMIB 5A5VA 2WAOA 4MHTA 3AOEC 5A1JA 1I6LA 1NI3A 2NO1A 4Z9AA 4BLPA 3E9EA 3GAZA 1BHQ1 1KVSA 4JSRA 4FZVA 5FLYA 1JI0A 5JJIA 3OD1A 1TJ3A 3EAQA 5K8TA 3LP6A 3V55A 1E2IA 1F6WA 3D4OA 2G77B 1CF9A 1KI4A 4HOYA 1ZEMA 2ADMA 1Z0UA 2NT3A 4UHKA 1X3SA 2C3PA 2NACA 1PZMA 2PYIA 3M9WA 3CMMA 4G0YA 2NU6A 3A9RA 4HVAA 4PC6A 4O2AF 3FLEA 1CUHA 1DBIA 2Y1EA 4WNAA 2JPDA 2SBTA 4C5BA 3W6PA 1HDCA 2ZIAA 1JG6A 1QVVA 1EAYA 1AKYA 5ES3A 5BSRA 1II9A 1M2VB 4LY0A 3J81A 5EXPA 2B4QA 2A67A 3MFYA 1RWKA 3IAEA 4MVJP 3WLNA 2X3YA 4TS9A 2R79A 4G8JA 2WSSA 1M34A 2ISCA 3K70B 5CVUA 4Z4QA 1O95A 3ZBTA 1SIUA 4JBIA 3TVDA 5JXWA 3HB5X 3JYNA 1X1TA 3UYLA 5FV7A 5K20A 3UPUA 2XKAA 2FMUA 5TMDA 2HAEA 4BBZA 3PFBA 1ZFNA 4RXUA 1JDBC 2Q3LA 1WP4A 3JQ8B 4BJ5A 4WI1A 4BWYA 4TYWA 4D4IA 4PC2A 4OHYA 5AKKA 1NI5A 1G291 2PUAA 2JD2A 4M22A 4XA8A 3E9MA 4EUFA 2EF0A 4IMRA 5M34A 2I6GA 1BEUB 4LBVA 4C89A 1F14A 4PC7A 5TT0A 2FG5A 1FA9A 1S2GA 2I34A 4OM7A 1RS0A 4IIFA 5EKDA 2Q4BA 1BXKA 1DRKA 3UGTA 1VE7A 1C1YA 4FDVA 4PG4A 5ALEA 1V37A 4LJ5A 1T5HX 3M6UA 4R6XA 3RUHA 5B7GA 1TW2A 2YTZA 1LGYA 3A6LA 1NDHA 3I1IA 1KEUA 1TU0A 4AX8A 1FK8A 4B7XA 5C8ZA 1CR4A 3DOIA 1GOTA 4BP9A 2GH1A 3K31A 4I55A 1XB2A 4XUDA 5J4KA 4HNAB 2OC4A 5FOSA 2ZM5A 2JCVA 4R3NA 1USKA 2C9CA 2K2QB 2YN2A 5A1TA 5HM6A 1NXPA 3WZLA 2HR1A 4C4SA 3TSWA 1QBGA 4N18A 2VK4A 3BEOA 4P7JA 1HEUA 2VF7A 3CZ5A 1LD3A 2EJBA 4M8LA 1GEEA 4PF1A 3NKVA 4TV9B 2ONJA 4IGKA 3AYZB 3MT9A 3RVBA 3UAYA 4B4WA 1Q17A 5KJEA 1G17A 3M6IA 4DR7B 4ZZ0A 3OZSA 4I2NA 4ZYTA 4NBTA 3MRXA 1I0IA 3UMGA 2D8AA 2XRYA 1XF9A 4M9RA 2ORVA 3OFKA 1Z0KA 1ML3A 3O92A 3QMWA 3EXFA 3GGPA 2XHEA 2KJQA 2XWBF 2ID9A 3KVOA 2PKRA 4M8SA 2B8TA 4BQOA 3SHTA 2IOFA 2AS0A 3AEZA 3VPHA 2QJFA 2C88A 3TL6A 3TGPA 3P9KA 4ZOBA 3BJEA 1KVQA 3RANA 1ODTC 2XE4A 3AF4A 1G4HA 2EX1A 2YXBA 4WCFA 2QZJA 4R83A 3EVTA 1GPMA 3V42A 1RLTA 1JXAA 2GZ2A 4Q02A 3LY7A 1GEGA 2RH9B 1G20E 3R7AA 5A4KA 2CVOA 1OHHD 2QN9A 2X4DA 4LDQA 4AY4A 3AF6A 2C3UA 3WLAA 1K0FA 4AMUA 3SPXA 2QLFA 4NCNA 1WEKA 1XU9A 4OV6B 1VE1A 1GM5A 3G9ZA 3H0KA 4A0GA 1ML4A 1U90A 1OU4A 1ILEA 4QBIA 5IYZA 4O2RA 4RSRA 1NY6A 2D8MA 5L4SA 1C9MA 1C8VB 2R6DA 4TMYA 4WLVA 1JTFA 3ZH9B 2VIIA 3DVSX 4E5PA 1QWOA 1T6XA 4L0DA 3ZBQA 4EKYA 5M04A 1T9HA 2M2IA 2P3OA 3IOBA 3BILA 3EXAA 5BNFA 2JGDB 4UE2A 3ML1A 3JASB 2G5TA 2H1FA 4IEFB 4N54A 4CMCA 3FHTA 4ZGBA 4EIWA 2IHNA 5H59A 4V0KA 1SNYA 3MINA 3EW9A 3C87A 3SIXA 1VLVA 1HRKA 1BMQA 3STUA 4V1CB 1V11A 1GA1A 1V71A 2B5WA 3ZXIA 5I6DA 2B35A 3QY0A 4J4BA 2JG3A 3V8QA 3EDOA 3FR7A 2RGAA 2NXEA 4ZJYA 4CYMA 4KQWA 1C81A 3ZHXA 4CM5A 3A6DA 1VRWA 2POQX 3BRWD 4OQPA 1Z08A 3O8OA 4NJEA 2RD2A 1YR6A 2PWBA 4ZZ3A 2NYUA 4RZXA 4G5QA 4Q9IA 3RS0A 4BIIA 3KHUA 2A9RA 3Q6MA 1T0HB 1O6CA 4CCWA 4BV9A 2MSWA 1NLFA 5CVCA 1UPXA 3L6DA 2BHTA 2OKGA 2J85A 2OK8A 4J9UE 3UGQA 3UKOA 3WFZA 2JD0A 2TMKA 5LQUA 1X1SA 2CNOA 4RD2A 3QE0A 2GM5A 4N03A 5HIKA 2IZ7A 1GVNB 3QP9A 5HMMA 2PZFA 4AZ0A 3CLUD 4UHHA 4DDKA 3ZY4A 4OXXA 4E51A 3DYIA 1W35A 1AKRA 1W6UA 3ET5A 4TLEA 3KVYA 4ME6A 3H0EA 5BUZA 2ZXEA 1S96A 3A8TA 5JMPA 1CHDA 1MX1A 1F12A 1S9DA 3NEYA 4F60A 4RLHA 9GPBA 4OU4A 1L7RA 2F00A 2V8OA 3LK7A 3BDAA 3MWEB 4RWEA 1E1NA 3V8EA 5JYEA 2I6UA 4E5UA 3B7GA 5BSEA 3ZDBA 3D43A 3TI7A 2J59A 3ZWDA 3CKMA 1JN0A 3EVDA 1LTKA 5LOVF 3GA0A 4DW8A 3LLSA 2B4AA 2JFNA 1TKRA 1PSWA 4C0WA 5DWQA 3ADCA 3PGMA 1GGMA 5IWAB 3G3EA 4K9QA 1I2ZA 2QJTA 2DFLA 5H70A 3O73A 4AJ4A 1E8MA 4QEDA 4ALNA 4JZYA 1R5NA 1BJRE 1SUPA 2W6CX 1PFGA 3GFFA 1YR1A 3TOXA 1KK2A 2DPLA 1I14A 1PUXA 2OBNA 2QZ4A 3VU1A 1Q1BA 3GQBB 1LQUA 3LO8A 4M1OA 1XZLA 2EBUA 4OQYA 4G1MB 3ZVNA 3ZY3A 2IT1A 1EFCA 2FX3A 2A4KA 3S2UA 1GKLA 1HT2E 1UZAA 2EOAA 4BATA 4R1MA 3EPLA 2A94A 4YIHA 1HDIA 1UC4B 4PYMA 4UUBA 2BFPA 3PLAE 2J0UA 1N2GA 4FE3A 1QYWA 1TQ4A 2G4CA 4IFIA 4K9SA 4KIUA 4RMIA 2VJLA 3C5VA 2P0EA 4RVSA 4JCOA 1GNTA 4EWLA 4KR3A 1FUIA 5CX1A 2E4AA 1SBTA 5JECA 4GP7A 2V54A 3F5MA 1QE5A 1AT1A 2RHCA 4IJVA 1M1YE 1ZOIA 3F0TA 3ZWWA 4R98A 1YRYE 3DTVD 3NGMA 4H0FA 2PTGA 3LTEA 3B8HA 4RFSB 3I9KA 5BWLA 3SC6A 1PZXA 1W76A 2PX2A 1ZIXA 1ACMA 3QXHA 2OC9A 1SXHA 3C6XA 3FIJA 4G86A 4KO3S 4WBXC 1A27A 5G1NA 3RS5A 5T7BA 1RI2A 2HLDA 4C9BA 3HP4A 3JQ9C 1M7GA 5EZQA 4HX5A 5JZ9A 2ZCJA 5LWQA 1EXDA 4J3JA 4LYHA 1TYEB 1ZN7A 2COEA 3C3MA 4DNFA 4PHFA 1NSYA 2NU9B 4OG2A 4Q12A 1Z7WA 2WYIA 4U7WA 4QJBA 1IPHA 1KI6A 3LO5A 4EM6A 3O3CA 4JL5A 2PBZA 1IEXA 3H1EA 2ZJAA 1UJCA 2OZLB 3BF7A 3P9ZA 2MOKA 3HFGA 4KMMA 2BBOA 3DB2A 3JSAA 4EX7A 5B1DA 3RYCB 3V32A 5HHTA 3VJRA 1BRMA 2GMWA 2JASA 3KYDA 4DLZA 4NZOA 5FBLB 1RQNA 1L1FA 3VU0A 3ASUA 4FYXA 4XQCA 5F51A 1JR2A 4MQFA 2UAGA 3DGEC 3X2EA 4DR1B 3H9GA 2YWGA 1UC8A 1HLPA 4LRSB 1JJIA 4M9XA 3TOSA 3U13A 3TF5A 2X0RA 4L85A 4BP3A 3MERA 4PVCA 1Q3KA 1EWKA 2C3MA 1BH2A 4DLYA 3L7YA 3S2GA 3D31A 3EWAA 4OFBA 3GFPA 4U6SA 3GLSA 4Z1MA 2Z1DA 3PYMA 3BQNB 2NO9A 4LS3A 1OGJA 4IIJF 3CB4A 2FUNB 2RI0A 4E4TA 2Y68A 3NC1C 3H2JA 4PCUA 3OHPA 2QRNA 1FL9A 3N0TA 4GW3A 3I8SA 3KT8A 4NH4A 4WOPA 5D1HA 1I94B 1R6BX 1SEVA 5ALHA 4DYVA 1NLMA 2I22A 4IXDA 2PT6A 2IEZA 2W0SA 1Y37A 4JY7A 4G1CA 4PQYA 2ZR8A 4JP5A 2Y9MB 4GS5A 1COWD 2M9MA 3FAKA 3KB2A 1M7BA 1GGEA 2XCOA 3PENA 3IUBA 4I7EA 2VNIA 3B6ZA 5P8WA 3EODA 4F5WA 5AVQA 3IQWA 3OZUA 4ZVVA 3LYLA 5TQ0A 3IBFA 4N39A 3M1LA 2YZNA 2BGTA 1ST3A 4INJA 3UUWA 5FTNA 3R3UA 1KE2A 4KO4S 3TW0A 1WDLA 2R4UA 2VL7A 1I0ZA 2YJZA 3WDSA 3LC2O 3DXFA 5DYNA 4KXNA 5BW8A 3M4YA 1PR1A 4Y6PA 1A8PA 1ONSA 1VZ3A 3ZJ4A 4RIHA 2EBWA 1K92A 1W87A 3CGWA 3W77A 1MB0A 1EJ2A 1ZCAA 2GJ4A 1CUDA 3QENA 1I32A 3L0BA 4B7ZA 1AO0A 3KXIA 1PQWA 4GVLA 2XTMA 3KUXA 3LKVA 1GQOA 4KPUA 4BBAA 4C3VA 1GHTA 2XMGA 2Z5LA 2Q8NA 3PGVA 3V7YA 4GUAA 4MI3A 3A6PC 2RCYA 4DEVA 4KQMA 2P0AA 2ZTSA 1YJQA 4U0KA 3RS8A 4FR0A 1Q12A 3ZGLA 2C5SA 3G0BA 2J31A 3PNBA 4UEOA 5JYBA 1H22A 5JCJA 4BQFA 4Q21A 1RCFA 3K5IA 1Y3BE 2WVHA 3E9DA 2Q99A 4CM8B 3ZWYA 1SZJG 4H31A 1VFNA 3EVZA 2PA3A 3BIJA 3VU8A 5IC4A 3FFXA 3HWWA 3HY6A 3NHRA 1L9KA 1QPBA 2QUAA 3LYUA 4JVSB 3WNBA 1ABBA 2XKKA 1G8JA 4N5IX 2EP7A 2Z0MA 4Y2UA 2QW0X 3EOAI 5G3ZA 3RJ5A 3WA6A 5A5GA 2HW8A 4EUKA 5T3UA 4B76A 3ZQKA 3IFSA 5J4LA 5GZ6A 3C3XA 4FOPA 4C4OA 1EZZA 2C3OA 3IRUA 4ZPJA 2EJTA 4OBXA 4NMLA 4WY5A 2ZUTA 3V4ZA 5BOSA 2AE2A 2IHZA 5BWBA 4LYJA 2XCRB 4DR2B 4QEZA 3PU6A 2VP3A 3DKKA 2Y0DA 2Q3MA 1FDWA 1HOTA 3B3GA 3OOSA 2GZDA 1OLSB 1UBSB 2CXTA 3K4HA 2MWMA 3MBIA 5U4QA 1CVRA 2HSEA 5JFTA 3W3ZB 2ISSD 4CL2A 4L8GA 4MDHA 4KREA 1RAEA 1YDWA 1U1CA 1NQOA 3OEEA 3WC4A 5BR4A 1H1DA 3ZZMA 1NNSA 3CZMA 3GN2A 3KZMA 1KPHA 3RS9A 3R2JA 5EE1A 1CD5A 1S2NA 4CKEA 1PZEA 2ZPAA 3U7GA 2AZDA 2DUJA 3I6MA 3QXSA 1TU3A 2PVPA 2WOJA 1M0TA 1V7PC 2BIFA 3WRXA 4DA4A 2PZEA 1P17A 1VSVA 3ANNA 2H1SA 3OJEA 4YJ3A 3VZSA 4ID9A 1HNZB 2YZGA 1DTSA 4V1CI 1HBJA 1SKYE 3GFGA 1NTOA 4A23A 4WUVA 1N4DA 5IH7A 2C29D 1R9GA 3FM9A 1MN6A 3HG7A 5C5CA 3BE4A 2Q0SA 3QGMA 2E87A 3A4YA 3LHSA 1MQ8B 1DBSA 4PAQA 4CIDA 4F7DA 2A2ZA 5KSZA 1IVSA 3S1AB 4WVFA 4EA8A 3AT1A 1GSHA 4II3A 5EERA 3J7AC 4L9WA 1ORHA 3TE7A 5KOYA 2QAJA 3CV3A 2IZZA 4F12A 3LFUA 1L4NA 4GPZA 1U8ZA 1E9FA 1E0SA 3HCAA 3C16C 3PL5A 5F7ZA 1CDDA 5GOZA 1PW7A 4PY2A 2GXSA 1SKBA 1OA0A 3R0IA 1ZOPA 3CPEA 1N6OA 2Y99A 4YRJA 1UXHA 3NC4A 3TUJC 3H05A 2FPWA 1TLLA 2PUBA 2WFLB 1DDOA 1DKMA 2Y6VA 3AK4A 3T5TA 1KMQA 4PHHA 3BTSA 1ZQ1A 2UV8A 5JMTA 1YQGA 1ZI9A 1IXKA 4R2MA 3SEAA 3VU9B 4YLEA 4DCPA 3GZNB 3DAHA 2PZAA 2RHTA 1GG5A 1JYSA 2C77A 2IITA 3ZWQA 4Y98A 1QIHA 1P9LA 4ZYZA 1A2OA 3VVLA 1SZPA 2AKEA 3BL6A 3VNVA 5FA6A 4CMEC 2QX9A 2I6XA 4IJMA 4NV1A 4K8RB 1S2LA 1G2IA 4Y3UA 4DWOA 1IHDA 4JJAA 5HF9A 4W9NA 2ZAIA 1NASA 1IN4A 2PM8A 2VHEA 3PKJA 4UFPA 2QB5A 2A0XA 5JS7A 2UKDA 5B2ZA 4RETA 1XCBA 1DIBA 1TM5E 1DKLA 2EP8A 2RGBA 1XQ6A 2WWIA 1ZQ9A 4MQEA 4YMSA 5AW6A 5K3AA 4Q66C 3EZNA 3HJRA 1SCUA 3KOUA 4O08A 1ISJA 5K6AC 2NUPB 2QIPA 1PU2A 1QUFA 2BFFA 1JLHA 2ZSFA 3NTUA 3CN7A 3PIRA 1V5WA 2P30A 1XDZA 1DWPA 2YZ2A 3KJQA 3PQ2A 2GCOA 1B8VA 1FYEA 2XOKA 4UDXX 5AKZA 5CK4A 3ZS9A 1MV5A 2AOWA 3IOEA 4HNQA 1W19A 1WU8A 5IDVA 4BFTA 3UWSA 4K81B 2P9HA 4B40A 1Z4MA 5DFAA 4ZYUA 5T64A 3Q98A 2AA3A 3V8NA 4H27A 3W5SA 4RAQA 2AN5A 5K7SA 4OFZA 4OSEA 5F33A 4FCVA 1JU4A 5HK8A 4BGUA 4JVNA 2BEKA 5I7VA 2IHTA 4UM5A 5FWDA 4M38A 2Z98A 1JFLA 1FNMA 3KO8A 4OI4A 1F0PA 4Q6BA 1Q1EA 3PXCX 1WPXA 4IOKA 4XUCA 2NAPA 2VQ3A 2ZJZA 2N75A 3ZVLA 2CXHA 2N9UA 1SU7A 2AK3A 2Y1FA 4QOEA 5IAEA 3ZDXB 4YO8A 1Z62A 2PRZA 2EHJA 4QYMA 1GT91 4MUYA 3MXOA 1BMFD 2ZIGA 3EDQA 3ICEA 3GA7A 5ALGA 1UMCA 1D3AA 1MVLA 3EN0A 5K0SA 2ZRFA 4QICA 1Z0AA 1GGHA 3W05A 2X58A 4HNSA 2VEOA 5CXUA 4DQUA 4L4XA 2AH5A 2ZRIA 4IJ6A 2ILVA 2XMBA 4W5NA 2A57A 3PHHA 3VKWA 1ST2A 1SXJE 1UM9B 2E4YA 2TMDA 3TL3A 3UK0A 3EXG2 4XGKA 1K8ZB 4CL8A 3COWA 1FFXB 2QMEA 4QDOA 4ABTA 1ADCA 2Q21A 2QRJA 4A2CA 3OZIA 1KP3A 4CDNA 1Z74A 2L2QA 2LP4Y 3BK1A 4YUVA 1Y3IA 3T34A 1O58A 3VJMA 4UPVA 2OFFA 1D1QA 3PYXA 4LDNA 3U3KA 1T3ZA 1BXZA 3ZHUA 3A3OA 2Z5GA 2X5NA 3NHPA 4DBZA 1IXSB 2LKDA 2QRKA 2DR0A 3KSMA 3HCEA 4HN9A 1NW9B 2O4CA 3RUDA 1HFEL 5EKUA 1T10A 2P6NA 4KAJA 1NC3A 1R9NA 4G8DA 4Q3NA 4BJ3A 2RAFA 2IP2A 3FBWA 3DCNA 4LTMA 1XT6A 3KQNA 1Y5RA 1PJCA 3DOFA 1EM6A 4Y1FA 5BXQC 2JAQA 2JA1A 3D7MA 1NUSA 1ZD2P 5JNUA 3CW9A 4HS9A 4JLNA 2Q6IA 1U1EA 3DVQX 3MTGA 4XM2A 4AWXA 3ND7A 3T1OA 3KR1A 2WYUA 2Z3VA 4MDYA 4X1YA 4EJ2A 5BVHB 1DUVG 2C2KA 2XYRA 1RAFA 1UDRA 1FLNA 4I0WB 3WGIA 1R1DA 1WY5A 1LBEA 1ZK3A 3KPWA 2D2VA 2GWRA 4PSAA 1CUYA 2B83A 4ZYYA 3D3WA 4PIMA 1E3JA 3BMOB 3RHTA 4ZI7F 1SUDA 3RR2A 3PFNA 3U3DA 1POXA 2OL4A 3B12A 4IQ8A 4X0EA 2ACVA 2I03A 3Q12A 4B48A 5AM2A 1GGJA 3ZYZA 1M8JA 4PXSA 3KEOA 3JQRA 3CO5A 4LYDA 2H1OA 1ATZA 1U7XA 1R4NB 3KS9A 1Q0HA 2CFSA 4V0LA 4DHWA 2ZJ4A 4FMDB 5JXIA 2CB0A 2VNHA 3X1XA 3L7KA 3BULA 2QM8A 1QRDA 4Y2QA 1USUA 3K6KA 3RTEA 2YMPA 3UAXA 3FIUA 5CBKA 5JO9A 4G1FA 2DQZA 5DX8A 1U4OA 3CXUA 3R3SA 3SQMA 1K6EA 2R8PA 4R3WA 4KPFC 5LZ7A 5JJCA 2CF6A 4JEUA 3NTQA 4LY6A 1D4OA 1RKBA 4G1BA 1Z07A 3WTCA 4ATNA 5IJAA 4C0AC 3GGSA 4JA2A 4YT8A 3DLCA 4O4JA 2XB2A 4ZDJA 1QB8A 3KHKA 2WG0A 1DG1G 2IZ0A 1ZGHA 1EGAA 1TJNA 3U9TA 3O4FA 3RBVA 2HV8A 3U44B 5DK4A 2YWFA 2V1XA 2FSSA 3GJQA 4F3NA 1M5TA 3ECCA 3EK2A 4DLWA 4OX9B 1CUUA 3GT0A 4KR9A 2I2CA 4RHCA 1YIDA 3PFHA 4RW0A 2ZS7A 5FIUA 2P2CA 4X93A 3V46A 5KSYA 1CUGA 3DFKA 2QUJA 5DSXA 2X23A 3OEYA 1KY2A 3G89A 3FPFA 4Q05A 1YB4A 1FJXA 4CR8A 1P0MA 5JO0A 1EBBA 1XTZA 4KIJA 3EVNA 5BXYA 4C2UA 3EEQA 2IDJA 2VCYA 5FNZA 1I7SB 4A1FA 1DX4A 4LHXA 5IDXA 2GX6A 4MRMA 4PLGA 3KXDA 2EJVA 3FHJA 4JNCA 5H9VA 2I2XB 2B1GA 1UJ4A 1Q3TA 4LV5B 1SUWA 4XYBA 2IQIA 5HF6A 3D6AA 2VWQA 1TADA 2BTOA 4ZGGA 1VMKA 2DPYA 1FP1D 3LUJA 4IFEA 1AKNA 1UOQA 3MILA 4J2HA 1UFRA 2XQVA 2Y4NA 1P7VA 4XXHA 2H4ZA 5DSTA 5IK2D 4MGYR 3MCUA 5LYJB 2XMSA 3LKBA 3GA5A 4JWKA 2QX4A 5AJTA 3U4MA 4KITB 1EFKA 1DV1A 5DLPA 4FFVA 5JSQA 2HSJA 2A1IA 5ERGB 2E48A 3USES 4O33A 4QUHA 4IDAA 4LZPA 1E0DA 1UWKA 4ROSA 4B09A 2A7QA 2P4UA 3RFXA 3O2NA 1BE0A 2WMYA 3F6CA 2GK7A 2AOXA 1UBHS 3M5PA 4IIEA 4KFRA 4OYLA 3V2GA 1A04A 3D6NB 1KDPA 2XQIA 5T41A 4D44A 4YT4A 4RK0A 4FSDA 1UJNA 4LRTB 1F7UA 1N1GA 4JV5B 3H5NA 1QONA 3GAAA 4W1QA 3U81A 4BZZA 2M98A 2FPLA 3MSCA 2HT1A 2JEYA 4OHWA 4R2LA 3JW8A 4F1KA 2BL4A 2YCBA 5BN3B 3BB4A 2H5JA 5FLXA 1QTQA 1FRVA 2IUTA 2IYRA 5DLQC 4Q4DA 2AG6A 2NGRA 3FNBA 2JHPA 3D59A 5COBA 4TWIA 1NY5A 9LDTA 3AHCA 4ZT3A 1LJLA 3PXXA 4UEKA 1XTJA 5AK5A 5ADVA 4U7DA 3SZRA 2ORYA 3KLMX 1O9BA 3D2AA 3PIIA 4NBVA 1ISIA 4OLJA 3ZX5A 4E5SA 2II6A 4CN8A 4PN3A 2YCLA 3NRJA 4ND6A 2VT2A 3NV7A 4HB3A 1WZIA 4L28A 1VKOA 3HJBA 4MAMA 3RFFA 1PW5A 3AVPA 3OTHA 1CNMA 3AF3A 1DIRA 2P2NA 5JY1A 1E96A 4LXUA 5JZBA 3MZ0A 1COZA 3URKA 1CJBA 4O63O 3WIVA 1IM8A 4RPCA 2QXYA 3L40A 2JFBA 5FBZA 3GDFA 3TTVA 3DBRA 1ECGA 2VPPA 2ZSKA 2QUIA 1PJ4A 2XT0A 5KJFA 4XRGA 3BMQB 1ZC4A 3FJOA 4M99A 3VVCA 1KDVA 4G36A 3KKLA 4PTLA 4ZFNA 3WNZA 1NV8A 5CNKA 5C5IA 1U31A 3OA2A 3SIRA 2IV3A 1P0FA 4R8RA 3HBLA 4O4HB 5G53C 3TRFA 1QJCA 2A7XA 5FYDA 5LB2A 3B82A 4D6YA 2UUCB 1RXCA 1DQZA 3QKSA 4H2DA 1RKQA 4AWAA 3ZNNA 2VYCA 1T15A 4PPNA 1DZ3A 3GL9A 1YRHA 4NKRA 4E1AA 2JGAA 1ZLXA 3AB3A 4DAOA 2AF3C 4R1QA 3PHBE 5DHFA 1I2DA 2R8ZA 3D6FA 5EHGA 1L0BA 2FZGA 3RG2A 2OGTA 3OLWA 1Q14A 3P9RA 4IH9A 5F76A 6NULA 2FWRA 1AGPA 3IIEA 1R4AA 1S8FA 2B69A 2RHDA 4MS3B 4B84A 1LTQA 1CUWA 2H7YA 5F12A 5A9TA 2REQA 2JS7A 1NJ6A 1X13A 3F97A 5HCIA 4E88A 3S44A 1UPBA 2CMKA 5GINE 4UDNA 5C1PA 1RYBA 2QTAA 3OE5A 2JLQA 3B60A 1JZSA 1JTEA 1P91A 4GVXA 2O3RA 2WWYA 3H9EO 4LBWA 1MPTA 5IBQA 2I99A 3UAOA 1U9JA 1W34A 4D02A 4U9IS 4JP2A 5F1YA 3V4FA 3FTEA 1RI4A 1NVTA 2DY1A 1BCSB 3U48A 1HYHA 1MC4A 3DDZX 3L1HA 3PNQA 4BB5A 1RADA 2XTAA 1JXMA 1ZD5A 1S3SA 2I1LA 2IYOA 2VQ6A 3ELYA 3GRPA 3JQDA 1IZYA 3KKNA 3SQDA 1UMKA 2HJGA 3JAWB 4A1OA 1DJQA 4L1KA 4WACA 2HMAA 1BDHA 3CMCO 1U5AA 1GTJ1 1WKVA 2H2FA 2O50A 4C88A 3C3DA 1SQSA 3LZCA 3TL2A 4DA9A 1GNVA 2VJKA 1VJ5A 3THSA 4I50F 3REGA 3N2GB 3Q7QA 5CIYA 4WKNA 1WCIA 2CMGA 3FGOA 3SMVA 3K9LA 1IWPB 2OV1A 3NKFA 5ARCA 5BPHA 1DO0A 2GR9A 2TRSB 4JXZA 1S9HA 1TTQB 4P98A 4CIXA 4RX1A 1WXFA 1WZUA 1B41A 2PD6A 2Q8QA 3UXMA 2A59A 5ARDA 2IZ5A 2QENA 1GCIA 2H85A 1C3VA 2B99A 3H2ZA 1IY0A 4FFSA 4B0PA 5J2TF 1YXMA 3UUGA 2NTVA 3QLTA 4RVNA 1YQUA 1E94E 4D56A 1KHTA 1G8YA 4WXHA 3HSKA 4CETA 4K26A 3B38A 3WADA 5C9ZA 3A32A 2C9OA 2F1JA 2P62A 3AY7A 3Q5EA 3VRHA 2WV9A 1YZUA 1NWHA 4X1KB 2VPYA 2HRBA 2B3DA 3PWSA 4LJYA 1A9OA 1SO8A 3C45A 3HRKA 1SB8A 4P4SB 1GPKA 1Y82A 3DNFA 3NDIA 1MV8A 4S0XA 4UUAA 1ORTA 4JXKA 3NFRA 1FLAA 4URWR 2A1UA 3F6EX 1XZPA 1JNXX 4AAYA 3E70C 3SHOA 3FUCA 1RNLA 3PQCA 4EB6B 1GILA 1VG1A 4LK2A 1Z33A 4MVJG 2CXXA 4I66A 4J16C 4QL3A 1BX1A 2Q6VA 2VP9A 4C0BA 5KINB 2P1DA 1X1RA 2ESRA 4MTLA 4AKGA 1WVMA 1GUFA 2W2LD 4UNIA 4DA7A 2Y3IA 1I8TA 3P4YA 1VHLA 1H4TA 3CWZA 1CY0A 5LQSA 2CK3D 4C29A 4CIVA 1Z2CA 2JAWA 4QXMA 5TQ2B 2PJZA 2VA9A 4LF4B 1K5HA 3PC4A 3U3RA 3SYRA 5DHRA 2E82A 3I5YA 2QY9A 3HB9A 1XLVA 2ERXA 4R1NA 2D3TA 4Y2PA 3S8EA 2PXHA 2DPMA 1WUTA 4M87A 3LE8A 4WESB 4O3FA 4F72A 7REQB 1XD2B 2D7JA 2R5WA 3F5DA 4EENA 4J03A 5FPQA 1QZTA 2J6BA 1NYQA 1BW9B 1N9KA 2H5LA 1M2WA 3C4QA 4ZQEA 3R3XA 4F8JA 4JQCA 1QX4A 3K2IA 4I1IA 4ND8A 1C7ZA 3BREA 4YV7A 1ZGAA 2QA5A 2ZITA 4HWOA 4KLAA 5KJ1A 1WL8A 4PANA 1WVIA 2MMGA 4C6TA 4WZBA 4RNDB 4WLFA 4AM8A 3T9DA 3JALA 4IY1A 4ERNA 3OBBA 3FYUB 1ZM9A 4KX5A 4OHXA 2PRKA 5ESXA 1DT5A 2BOVA 1PNTA 2QAGC 3MTEA 2Q07A 1UC9A 3IOCA 4GPEA 1Z4KA 3ET4A 4CDMA 3PRHA 4ZD6A 5LQRA 2CE2X 4PLCA 4BDTA 4R6WA 5F4ZA 1ZIDA 4FS8A 2ZRPA 1A97A 1GGFA 3VMFA 4WNIA 3IT2A 1W5FA 2EZ9A 2RAUA 3PK0A 5C31A 2I4OA 1FXSA 5FUBA 4DILA 1B0PA 1NW7A 1QH1B 4PAGA 1Y89A 3MAGA 1TCCA 2PZMA 5DBOA 3T0GA 3M83A 2WE7A 2EX0A 3EF3A 4YCBA 3U5TA 2H06A 1FSPA 2VHQA 1YQXA 2HK6A 2PTHA 1DHRA 1NUUA 1GPJA 3IDQA 1DKPA 4FU0A 3I01M 4OXKA 1AQUA 1S5PA 4OX9Y 4RTJA 2JGRA 2HT6A 1YZQA 2VJNA 4RZIA 1JBKA 1PWHA 2LCIA 3KAQA 1VJRA 2BGRA 4M9SA 1MC8A 3HXTA 1JJFA 3JD3A 4BTEA 4C0HA 3WWPA 1BQ4A 1GZ3A 1D1TA 3FGPA 4IX1A 4OGFA 1E59A 4IOLA 1MA3A 4CMGA 3LBYA 2GTIA 1NT4A 3AY3A 2A5JA 3I28A 3RAJA 3ZWAA 2QMUA 4YRKA 4LYGA 5JPCA 3WAJA 1MFPA 3AWIA 4QSMA 3ODGA 3NMUF 3FTPA 2AZXA 3DGFC 3WGYA 4J6EA 1Y4ZA 2P65A 4DR6B 3QUCA 3C6KA 3T3EA 3SZ3A 4DPMA 3A7EA 5MDHA 4HGPA 3A6KA 3SYLA 4PFQA 3IUSA 1AGNA 4PNEA 2EFYA 2PGIA 1MQAA 2YW2A 3ASYA 1TMOA 4KB5A 4CMKA 3KUDA 3DLAA 1IOVA 2IHJA 2GN0A 3WLQA 5CEFA 4LMRA 1QGOA 2CVPA 1GL7A 4Y9DA 1X0XA 3GRUA 4BNGA 3A05A 4YRAA 3F5SA 4D9HA 1ATIA 4C76A 2XYHA 1QHFA 3VHXA 3BJIC 1H05A 1XVAA 2A9QA 2B0CA 4QOSA 4S3MA 2FEXA 3WZ2A 3HEAA 4R9UC 1R12A 2EIXA 3AHFA 2QTCA 4WZAA 4DMKA 1JIIA 1R0LA 1TZCA 1ZMXA 4EELA 4GF5A 4UOEA 3ILSA 4LGMA 4UE3S 1DL5A 4CF5A 2VHJA 5LUBA 3SQLA 3OPVA 5KI6A 4YT2A 1IU9A 2D54A 1ZOSA 2JZNA 2V1UA 4ENQA 3Q15C 4E14A 3ND5A 3HYSA 4RA9A 2HMWA 4JYPA 5EGSA 1Y5IA 3O7WA 1R74A 3B9BA 1QVWA 2VNSA 2WTMA 3LNTA 4PW0A 3KJXA 4Q3KA 5ES4B 3ZV4A 2PV7A 2PUJA 2R6JA 3WKCA 1XN1A 1YQEA 2BELA 2Y67A 2OYSA 4CM7A 2CJWB 2C84A 3WWZA 3CUKA 3VKGA 4UUOA 4BFVA 2IV2X 2R00A 2XA1A 4EHFA 5A2GA 4CIBA 3GROA 3Q2KA 1Z47A 4YUYA 3K4PA 5EMKA 4LWQA 3ROFA 5CFOA 1TEHA 2OHXA 3O9MA 4M0PA 2DUMA 4BFWA 2C03A 5BSGA 6REQB 5KVSA 1G8SA 1L3CA 2GVNA 4DA6A 2QLJA 1YACA 3H3JA 1IUOA 3N0WA 3ZCPA 1HRDA 3GLQA 4I6JA 4LDAA 3Q8XB 5CLLA 3HDQA 3RVSA 1N5IA 2SECE 1N36B 2EJWA 4KGVA 2R3SA 2BR4A 2O07A 3LT5A 5FBRB 1M2EA 1TUGA 4NDNE 2WMDA 3VR6A 3LHFA 4LWOA 3W9UA 1MAAA 4G07A 4S1PA 2GI4A 1T9BA 1E5DA 2ZSEA 1DJOA 3PQ3A 4LYYA 4TN1A 1J00A 4JI6B 5JRJA 1MXHA 4AROA 1B8OA 3MMXA 2A1TS 1G63A 2VBIA 3VDQA 4ZWNA 5ALKA 2LE0A 3PDIB 4DSUA 1T9ZA 2IOQA 4GDMA 2NZWA 1U3TA 3ABQB 4PHGA 4S1WA 5I7RA 1KEWA 3OC0A 5DM2A 2DTXA 2JLYA 5FTJA 4I9HA 5JYCA 5CCDA 3W8RA 2WA2A 3KOYA 4JIMA 4WQMA 1WHTB 2XQGA 1SIWA 1H0RA 4HPJB 5ELLA 3ZOZA 4COKA 1HNXB 3MW8A 4GI1A 4PBTA 3TR6A 5LN1A 5F2OA 5LD2C 5HDQA 1ZD1A 4B3SB 5CVJA 4DMCA 2DBQA 4IPTA 3IUPA 4GI3A 5CP8A 3L0CA 3F8WA 4CUKA 3TMYA 4A5SA 4N3BA 4BLVA 4B17A 2AGVA 4F3TA 3KYJB 5KOIA 3HUTA 4HGQA 2JZOA 4F46A 3AERA 3A25A 3K73O 4TKLA 1CUJA 2ZATA 3C3PA 5EE9A 4LX0A 1PQUA 1QOZA 1UP7A 2Z9BA 2A3RA 1WM1A 3PC8C 1KR5A 1VLZA 1Z6PA 4D4KA 4YQFA 4GI2A 2WSYB 2J32A 2H3HA 4FTWA 4A8HA 1ICIA 4ESEA 3MS4A 1A50B 1F8UA 2GA9A 3B1VA 4X7MA 5CH5A 1WX1A 1M6VB 5AKYA 3R0XA 4GZMA 2OGSA 2X0IA 4KXWA 3NB0A 3TSZA 1QUEA 4R0MA 3LAWA 2ZTLA 2VRNA 1J8YF 2IKSA 3WBFA 2PKQO 4JR2A 4L76A 3V34A 2FLKA 3V1LA 1EG2A 4DCUA 1M0SA 3DZFA 3E22B 3X2SA 1VLLA 1RYNA 1BX3A 2K6GA 4IGIA 4R9NA 3RC1A 4LI3X 1E3QA 2WPDA 3V5NA 3LT2A 3IV7A 2W8BA 3KM0A 3QBVA 4ZQIA 3AV3A 1OFTA 2XMCA 4J75A 1PR4A 4U8GA 3PI7A 1K3TA 1G59A 5F9HA 1A5SB 4O5AA 1ZVJA 3ZCVA 5DW3A 2FI1A 1ODSA 1E2DA 1UMDB 3C7CB 3VO9A 2UYOA 1OWNA 5CURA 5KYWB 5ALPA 3QEMB 1PI3A 4LE2A 1XRRA 1SKAA 1CS4C 4U2EA 2X9QA 1IXZA 1GDDA 1NKSA 1WMSA 3HPRA 4KWEA 4ND3A 1DCMA 3AVUA 2FPKA 1OZAA 3W3AA 1E32A 4AKSA 2ZYWX 3WO0A 1QKKA 1SCKA 2CY0A 3TTUA 2A9VA 3UMCA 2CJYA 1JEDA 3H1BA 1U7WA 3EC7A 3FCSB 1H93A 2ZJFA 1C7FA 1Z2DA 2VUHB 4GXQA 4W8HA 5DT9A 4HNTA 2JEZA 4M21A 3HMKA 2AOTB 2AW3A 3VR2A 2AMJA 1JDJA 1N78A 3FHLA 1DIOB 1KYIA 4Z86A 1OX4A 1HORA 5TX7A 1ZCZA 1U28A 1EIWA 4ZO6A 1YMVA 1P33A 3ND9A 1KERA 4KP7A 4XPZA 4PHTA 2PZJA 3IPXA 4FFLA 3HM9A 1QK5A 1WPGA 4M0MA 4HFNA 4FDUA 1NLUA 1PFUA 1RBQA 4MVJA 5DB4A 2QTGA 5ALJA 3HLTA 3ZU6A 1EVKA 1X15A 5IVKA 3HVRA 3IKJA 4XD2A 1EQUA 2VRCA 2J8ZA 1IJEA 3OTQA 1LXCA 3UKJA 5EAIA 1DPFA 3U6BA 4EKDA 2TMYA 1VPEA 4GRDA 4PO3X 5H1YA 4Q4CA 1NAHA 2X0JA 3GV0A 3MELA 1PTJC 2FKAA 2BTEA 1T35A 4NATA 5JJLA 1II8A 3EQ2A 3K9CA 2ZUCA 3IHWA 3RSFA 4Q93A 3C8HA 3HA7A 3WMXA 4DCTA 1TZ2A 3F96A 3G8YA 4HWGA 5E3JA 1EK0A 3B2EA 5SYNA 1V0JA 4FC7A 4KC0A 1KEZA 4QULA 4CG0A 1LEHA 1QYRA 3P26A 5IULC 4YRGA 3LQ1A 2AB0A 2LRHA 2WD7B 2UXDB 2XSZD 3AO0B 1W8DA 2W22A 1G7CA 4HC4A 5DI9A 3NW9A 1BYIA 1RYHA 2NVWA 4P6VF 4CKYA 2VJQA 5E6UA 5LLSA 3MHPA 3ROZA 1Z6GA 2DBRA 4E5DA 1WDMA 4EHJA 1U1IA 5H3HA 3ZJUA 1FXUA 2PRIA 3PGA1 3E7PA 4RHFA 1NKVA 4GOND 4AZSA 5CDTA 3L6UA 1L5NA 4B3TB 2FQXA 2G0AA 3ZZTA 1HDGO 2PX8A 5T4HA 3TKAA 4JLAA 1AHNA 4YJHB 5FQNA 3RF6A 3X1WA 4N5NA 4BV3A 2I54A 1AUQA 1O0SA 3WLPA 4FYMA 5HSGA 2QVZX 1PJAA 3ETLA 5JD3A 3FRHA 4CLRA 5L40A 5EHZA 3QV2A 4M8NE 1Q0TA 4PYRA 1XMXA 2GLTA 5LQMA 2CMHA 5EMJA 2E1RA 2HRDA 2REOA 3E8MA 1FRZA 4P1ZA 2NM0A 3T3IA 5JIBA 4F2HA 1TAQA 3MUNA 4EPTA 3LC0A 4RM2A 2NV2B 4J43A 5BT9A 1QOQB 2OUIA 2AN9A 4TTIA 2V7BA 4CQMB 2DR2A 1XRSB 3THYA 5EIXA 2Q9BA 2XQJA 3WMFA 4PZ9A 3LSYA 3HR7A 3GELA 4DSOA 3M6WA 4HS4A 4P4GA 1T5IA 5ALQA 1E7QA 5ARBA 5BWMA 2OLKA 4KN9S 2VZEA 4NPHA 1EDDA 2JH3A 4AX4A 2GB4A 2O06A 4G56A 3L93A 5FBHA 5FWXB 2R4QA 2HZ7A 3RIEA 3TTYA 5IANA 1MBZA 5K3FA 3G2JA 4IUDS 2PQ2A 1AK1A 4KPGA 3RJMA 1RWOA 3TQHA 4BYGA 4HMOA 1YVRA 821PA 5IEJA 1ZRMA 2FQ1A 4JB0A 2JJ2A 1KEEA 2XCSB 1IBRA 3GFBA 4BZWA 4DMMA 4DCOA 3HKEB 4JUCA 1EVEA 4PBRA 4RZQA 4F4IA 2YNMD 4F8YA 3A37A 2QYSA 2HJSA 2VAPA 1CEXA 3CRZA 4MWDA 5AI8A 5EA2A 4DDTA 4JWTA 3UFBA 5AW0A 2P67A 4NBNA 3FNRA 3L06A 1Y6FA 1EK2A 2OFWA 4HDKA 2AMLA 5E6RB 2X7XA 3FPEA 2NUAA 3KL2A 4F2GA 3ADKA 2IU0A 3QX3A 3BCRA 3LU1A 1X42A 1LF0A 2L82A 3C5WP 4KPYA 3PHGA 1EUQA 5K0GA 1U98A 3UT5B 1UMBB 2KBEA 3KWFA 3JY6A 4DA0A 1XEXB 2R25B 4G5FA 2E9SA 4UUPA 3OQMA 3DMTC 1V1RB 4F7WA 3S1SA 2IC5A 3EGDA 1RI3A 1X9IA 3CM0A 1SRQA 3ESQA 3TB4A 2WP8J 4C3OB 5EZYB 3OLYA 2I8CA 3TSCA 2JHAA 3SVZA 4IV5A 1QHEA 2ZRGA 5FPPA 1R0KA 1ZRSA 3ZE0B 2IIVA 1OF1A 4L4ZA 1FYDA 1QNFA 1F4VA 2YJNA 2B5VA 2YVQA 4DS3A 5LDGA 1D5CA 1EX1A 2XAUA 1IHOA 3CF4A 3NTVA 1RRMA 3OEWA 2B61A 2J45A 1BDJA 3FETA 5LPNA 4AMZA 4GOJA 4EG0A 3PR3A 2AI3A 2OXRA 2W58A 4XGNA 4YRCA 3EVCA 3VH4A 1U99A 3JVVA 4FKMA 5DK6A 3A1CA 5EWLA 3E9QA 4IEEA 4M53A 4RL4A 3U40A 3VKHA 2EGGA 1R4MA 2IHVA 3ONNA 4XVUA 4FYJA 4FYIA 3BWYA 1ULZA 1X7XB 4A3SA 5LP6A 2DSNA 3T99A 4OB6A 4Y6OA 4JI4B 4NRDA 1J1ZA 3D3QA 5ECDA 4FOLA 4BVJA 1FZQA 1GUBA 1QM5A 1ACLA 2VTDA 4KR0A 2VTKA 3UJDA 5AVRA 9LDBA 4TLBA 1FE8A 3OUTA 4MI1A 2AFVA 3VNRA 1ZU4A 1E2MA 1TVKB 1YZFA 5CH8A 4EK9A 3Q8MA 3I09A 1A1SA 2IF0A 4IDBA 3ZU3A 1N6LA 2BHNA 4EMSA 4NE7A 2ACEA 3KR9A 3IKTA 1YFLA 3FHCB 1QLJA 4GOKA 1V95A 4A0HA 3KKPA 2GAIA 3TN7A 4KQFA 3GT7A 4I6GA 2VSNA 4RENA 2ZZNA 3FMOB 1YRBA 3PKZA 4Y1RB 3K0KA 3Q41A 2NZXA 3OY2A 5CBPB 4LQLA 3RAEC 1YK1A 2PUVA 4KXYA 4B3MB 4I1PA 3IS3A 4K6OA 1TTHA 3O2JA 3QTBA 1U0RA 1TT7A 1EFPA 5EIBD 3X3HA 2ZWPA 3AEKB 3R5HA 5JQGF 1MG0A 2JL1A 4NX2A 2X40A 4EEKA 4TQGA 2GVDC 2GN1A 1SBQA 2VNKA 4G4SO 4P7KA 3IPLA 4L78A 1M1NB 3RS4A 6GPBA 4P8RA 2X77A 1OXSC 1OREA 1NIPA 1G16A 1XVVA 1YZYA 2SKEA 4PO1A 4OQEA 3B2NA 3AU9A 7ABPA 2QJRA 4KXUA 1GSOA 2NVUA 2RIPA 3AVVA 1OV6A 4ZJPA 1VRVA 1X1BA 3MJTA 3FMIA 4TRJA 2ZJYA 3CR7A 4U7GA 1I7LA 3N8GA 4JUBA 3KEQA 2I87A 4NENA 2MSDB 1KOJA 4FLMA 1E2PA 4MKXA 3DCJA 5F9FA 1ONNA 2WHQA 1GLVA 3M2PA 4OKIA 4Q19A 1H5UA 4BNNA 5IXYA 2HO5A 2PZBA 3R0JA 1MF7A 2ZI7A 3AEQA 3FWKA 4FK8A 2FWPA 2BFDB 5D00A 4QXPA 3K35A 4MRAA 1BYUA 2VJPA 3SOZA 2I7VA 1BDBA 4F3RA 1B15A 3A0RB 5KNLA 2CMDA 4LDJA 3N8DA 4ARCA 2EQAA 3D02A 1FX1A 4HUTA 2VQSA 4ZV7A 4BEBA 1C0EA 5TQJA 1BCRA 2X0NA 2MYPA 3KWMA 2NU7A 4NCIA 5ALMA 4R9RA 4YLGA 2Q9CA 4DJFC 1SUSA 1H2EA 2GF2A 2C4UA 3CSSA 4A8JA 1BVYF 1LQ2A 2XDAA 5LMCA 2O2XA 2ZYVX 1OBVA 3MGCA 4XTRA 3RYIB 1DGQA 4LTDA 4U7FA 1QVZA 3AEUB 3RUCA 3UMFA 3MS7A 1QRTA 2F43A 3KPVA 2EF1A 4H6PA 3PQEA 4CF6A 1MOZA 1XXLA 3DW3X 2IXTA 1AK9A 2PEZA 5GP1A 4OSPA 2JIBA 3GB9A 4XVQA 4MRVA 3CUUA 2XRMA 3DT8A 3I9NA 4C4AA 2FLVA 3N7AA 1L3BA 2J9FB 4I9NA 3SN6A 1XTKA 2Q9AA 3RC8A 1Y7TA 4ER3A 5K2OA 3U6KA 1MXFA 3E23A 1GG9A 4OAQA 3AZQA 4WOKA 3Q1KA 3TRIA 1Z4JA 4CEHA 3IVXA 2ZAOA 1YQTA 2ZE8A 2XDYA 3GFOA 2ANBA 1UAAA 1E8NA 1LFDB 2OPBA 3CIOA 5ITSA 3TYXA 1E1CA 2EW8A 2ZR9A 2DM6A 2G09A 3AJRA 2WUVA 3WKBA 2YMLA 3EY9A 4P2BA 4H4DA 4HVCA 3WDLA 1BXGB 2ATXA 2IYSA 3WRYA 3K8YA 4C3ZA 2F8MA 2YQ4A 4G0XA 3M89A 4NS4A 1M1XB 4JOSA 1M9NA 1NM5A 3DXZA 4OHUA 1CZNA 1VGVA 4R2HA 1YVDA 3ZWBA 2FDRA 1NZJA 2DCUA 2DWOA 2YJ4A 3IULA 3N6VA 1U1DA 2XKBA 3DBIA 1OZFA 1Y6ZA 2E3JA 5C7LO 4HFJA 4KWIA 5DBEX 3JYLA 5KWSA 4DEXA 1YQWA 1JZTA 2WIAA 3O8LA 3OO1A 1R5BA 3OLXA 2IA5A 2VDQB 3ZI4A 2CJPA 4DMGA 5JSZB 1PT9A 2V9PA 3OH8A 5YASA 4TTRA 2WDZA 4WOJA 5EWJB 2DHDA 1DLIA 1UOEA 1W93A 2XXAA 2XUPA 4UCXA 4YRIA 3DLTA 2QQ0A 1U3UA 2HHCA 4HAWA 2DEUA 5DF1A 3VYWA 2EBFX 5JPDA 4RFLA 2VO1A 1JI3A 4EY6A 3IUQA 3QVGB 5F1KA 3E27A 4FX5A 3UGKA 4ERXA 1N3LA 2ZKIA 3WBBA 4RYLA 1WBBA 3QBEA 4I5IA 1JIXA 3QWIA 4PR3A 3AG6A 1QIJA 4DLBA 3G2KA 5CA0A 2W6IA 3IBSA 3U7RA 1VG9B 1CX9B 2LXNA 3HUEA 1LVHA 4B4DA 4EY5A 1D2NA 4ZVRA 1YE8A 1N9GB 3CZRA 2D5BA 2VPQA 5AESA 4D26A 2XZPA 1NMQA 2C7BA 3DKRA 3NOXA 1EUYA 5DTJA 5HK9A 4I1UA 1WW2A 5K0NA 3PEUA 4XDGA 2HZBA 4K46A 4DPKA 5J43A 1J0CA 1A72A 4DVGA 3IAFA 5H5JA 1IZZA 3NHKA 3WK7A 4PQRA 1WXXA 1A96A 3INRA 1VYHA 1KHHA 1YONA 2Q4DA 3H11A 1YAHA 1TJPB 3EXHB 5KWJA 4CJXA 4WTOA 1GNLA 4PLWA 1XA3A 3NBUA 3IHTA 3X1MA 1P1BA 7ADHA 5I4KA 1X8XA 4GQIA 1R6UA 4MIYA 1QP0A 3A14A 1OXKB 2O3JA 3AKYA 4RQBA 2FSVC 3L43A 3MLAA 1HK7A 3O31A 2BWJA 2FEMA 2WWGA 4V2UA 3GUCA 4EL5A 4QFBA 3OQVA 4POAA 3JQ6A 5CAEA 1NBEA 1G2OA 1FFEA 2VG8A 1G20B 4BFYA 4DIMA 3KQLA 4EEZA 2QN2A 3I37X 3K92A 2A35A 3LKDA 4WXPA 1QO0D 3CSUA 2PJUA 2B5OA 3ZDYB 4KRYA 3ZQJA 5I48A 1AV6A 1E2QA 2I9PA 4JJIA 4AKTA 2UXBB 3F7MA 4WZZA 3PNPA 4HDAA 4IL5A 3UC9A 3TLXA 1OWPA 5KIAA 3WSWA 1A2QA 1TMKA 1UJ2A 2R8OA 2ZI5A 2JKYA 2OQIA 4YR7A 5CH3A 1PJ8A 3N87A 4JJ6A 1Z0ZA 3M6XA 4DPLA 4L02A 5BR7A 3GPLA 4GDFA 1BFDA 2WJVA 3DDSA 4YMLA 3R7SA 4AUKA 4FFRA 2O59A 1RM0A 1P7WA 3PEFA 2HCRA 3ST7A 1VKJA 2IYFA 1JGTA 2NQ2C 3WMGA 4KQKA 2M6RA 3IVAA 4L8VA 1IN7A 4MWZA 1JUDA 4RCVA 1GXSB 3UO8B 3T1HB 1LVGA 1M5RA 2FR8C 4AL4A 4MMYB 4KODA 5C7IO 3ODPA 4RLSA 1JEYB 4MR7B 4OOFA 2O8FB 4DABA 4U5XA 2Y1GA 1O08A 2LUOA 2ENWA 2YJGA 2C2XA 2WLSA 3BIWA 2XMPA 2ADFA 3GUUA 1XCMA 3QLJA 1T6ZA 1FMFA 4LOIA 3U7HB 2DFNA 1B42A 2P5YA 1BTOA 1U5BB 4OP2A 4G4IA 1FPQA 3TPZA 5D5PA 1ND6A 1GV1A 1ENPA 2ENUA 4NU6A 5DULA 3W2IA 4FFBA 4AULA 3DOEA 1E6LA 1WXWA 4PX9A 2E2WA 3GLHA 4WZBE 1TMGE 3A6HA 2H4HA 5EHIA 1Z5WA 2BW0A 2KQUA 3A11A 3N2IA 3NNNA 4GAEA 4R8MA 5IZCA 1PR5A 2R11A 2JCYA 2HQ1A 4UVGA 5A0TA 2OFXA 2OM6A 3F67A 2DQSA 4LCEA 1IY8A 1E0KA 2HPZA 5HKAA 5EPOA 1BS2A 1PFQA 1XU4A 1T1RA 4IHJA 4JLBA 3SEQA 3BHJA 3RBXA 2W93A 4DNXA 5LD2B 4DAEA 4B3RB 5CYFA 1E79A 2QM3A 1G3IA 2Q3EA 3OO0A 3I42A 4GEKA 5ALDA 3JZFA 1D7OA 4KU4A 3UN1A 1T2CA 3WNDA 2FXIA 2JKVA 2ZSUA 3KKMA 4TTJA 5EC8A 2C42A 4JJ7A 4TSFA 4GO1A 4JH0A 3IQFA 5HKLA 2E7ZA 3ESXA 1XZCA 2Q5LA 1GZHB 3KTFA 4QVKA 4ZRNA 4CQMD 5AKHA 4X6XA 2RGXA 5TB5A 5K1ZA 4GLJA 4G2NA 5AW9A 3AI7A 1G7RA 5CG1A 2GEJA 3D3KA 2IZ1A 2P4SA 5KX5B 1C14A 3ENKA 1OAOC 4US0R 1PFYA 5LFAA 1CKEA 1T43A 3F6RA 3HVKA 2X9NA 2OFOA 3DQPA 3I6ZA 3MAJA 3OE4A 2PEYA 2GO7A 2VF4X 2YV4A 1JWLA 1PJ2A 1SHUX 1VSUA 1N0VC 1CK4A 2HADA 3H4VA 5E0KB 3DDCA 1XRNA 3BN3A 1ZO8A 3ISJA 1ORWA 1LDGA 2AXPA 1JVBA 1HKHA 3C5HA 1XNQB 4C03A 2HU7A 1SCNE 2P9CA 4F8EA 4NI5A 3C3BA 3CVXA 1H66A 1KF0A 3N07A 1I36A 3O21A 2FZKA 2JK1A 1Q92A 4EBBA 2GPAA 3BWMA 3ON5A 4GIBA 4MAAA 3O3OB 4P32A 1K7EB 3HBAA 4ZQGA 5J1SB 1XLTC 4XR9A 5ANRB 4CLDA 5A4DA 1GCGA 2Q7XA 4YO7A 2WB2A 3EEIA 1PQPA 4PG7A 2HHHB 1NT2A 1SVWA 3J81k 3HADA 3O47A 4FNAA 2QN1A 2G9RA 1KFJB 2IZOA 1U3GA 1B2RA 1NBME 1NVBA 4UTNA 2BKVA 1M1YB 3O8BA 2QN7A 1FUUA 5T4EA 1QO9A 2O1EA 3MOIA 4G63A 4J9VA 4Q03A 3STTA 3ZKWA 1QHGA 2RHRA 3FFTA 1B4DA 4PYNA 4KKXB 3BC1A 4NBRA 1G21A 2XEXA 5JH7B 4YEDA 2R7AA 1Y0BA 3OAAA 5GWXA 1SFRA 1QVRA 2GERA 1LA2A 4RSHA 2IHYA 4WZAE 1XMVA 5HILA 4UTXA 1PVVA 3ZU4A 4M1KA 4BWVA 3RUIA 1QE3A 3PFWO 1ZGBA 4ZHQF 1DOZA 4EKEA 4WMLA 3IR7A 3ICOA 4B79A 3KJHA 5FPKA 2YY7A 2Q2OA 3RARA 1ORIA 4U00A 2J7PD 1Z45A 3V2UA 3ER8A 2C07A 3EG9B 4MNTA 1R6DA 2RGYA 1NHGA 3AU8A 1NBIA 3NPMA 4DMLA 5EJ5A 3I64A 3T0IA 1IEQA 1XXHA 2Y1CA 4F91B 5KYNA 3HKBA 3GJZA 1E69A 3WJ1A 5B4UA 1Y1KE 2CWWA 1E18A 5DRYA 2O5VA 2OBLA 4GSKA 4AF8A 4TMVA 1HZZC 3SXPA 3GJYA 2AZ4A 4I5DA 3LP5A 1BA2A 3EXEB 1OLUA 2R62A 4HTFB 1DKNA 1P0QA 3ZHYA 4L8LA 1CRWG 2WVGA 3H5RA 4FR5A 3M4NA 5J47A 1RRKA 4REQB 3WP0A 2NSYA 3FUXA 4PQGA 3RC7A 3UYKA 3DZKA 3JQ7B 1XC7A 4UBNA 2A14A 3C2QA 4G81A 2OHGA 1N2SA 1PGJA 2BFEA 1AS2A 1LDMA 3K0SA 3GRKA 3W8FA 4NEGA 2ZU0C 1W5SA 1GQRA 2DBZA 4N0PA 4ZOLB 3KB8A 3T7JA 3TE6A 3S81A 2FE4A 2BEUB 3JVDA 2QN6A 3ENZA 3R7WA 4O59O 3VSEA 4BASA 1CLUA 5U1PA 3K1ZA 3BIFA 5BMVF 3LQ2A 1IYZA 1A88A 4MUFA 1CP2A 3LA8A 3GRAA 4IZHA 1FSZA 4Z99A 4BFSA 3GUYA 3L82B 5JY6A 3DUFB 3KCQA 1YWGO 3OZEA 2QR3A 2C4MA 1E4VA 2WU0A 1Z7BA 2C0QA 4MUJA 3D1LA 2ZT7A 3TRDA 1NUAA 4BTVA 5AP9A 5JXGA 4MR8B 2JGKA 2FTKE 2G82A 3EOZA 4HVTA 5SY4A 4ARSA 3VOAA 3ZWVA 3L7CA 2YIJA 2JJ8A 3GT3A 3W78A 2DHRA 5DZSA 5K0FA 1SOAA 3P52A 5K6AA 3HABA 4UM8B 2Z6VA 2GM4A 121PA 2D2IA 2GT1A 1JALA 2H3EA 3VX4A 4F96A 1M2KA 2IBSA 1G6KA 1U81A 3L7LA 1TQ2A 3TGWA 1LSJA 3NIBA 4AG6A 2WU1A 5CGZA 3HYRA 1M2HA 1SIOA 2JHCA 5LXTA 4TYMA 4OCZA 2OORC 3JAKB 4WADA 4YJ2B 4OJKA 3L8GA 5F77A 1XYYA 3ACCA 3B6JA 2C9BA 1SHJA 5G3YA 3T1TA 1WD7A 5KPJA 3RK4A 2O7RA 2JJ1D 5P21A 1U6IA 4MPPA 1BE6A 1HPLA 4R51A 5G0TA 2NWQA 1XJCA 3JCZA 4FOTA 5B1EA 2AOUB 3L3BA 4TMXA 1YCDA 2DR3A 1CZOA 4J90A 1YBVA 5JSYA 4QPCA 4TLDA 4D9MA 2YQ5A 5F2NA 1FFXA 1SHLA 5DTEA 3ESYA 3WK4A 4EB3A 4L6AA 1PZHA 4LF8B 3RJZA 4QU9A 1LNSA 3GOHA 4B3JA 4DCMA 1RPTA 1WB9A 1IWBB 1GTRA 2YIDA 4JI2B 1KZ1A 2ZIXA 3KSAC 2WDPA 3OFVA 2GHIA 4BU0A 4FGLA 1O89A 1F17A 3L5OA 4FW8A 4JZKA 4P36A 4QT0A 3ZLUA 4EW2A 4ODIA 3GLIA 2O4UX 4LVOA 1JEEA 3V6MA 1Z8NA 2AJDA 3ETNA 2GBGA 3U56A 5JJ5A 4ZAWA 1VCMA 621PA 5DM0A 2DZDA 1ZH6A 4HWTA 2Z04A 3IUMA 3C6YA 4PC1A 2Z3ZA 4HDQB 4KE8A 4N8DA 1HY3A 3LH5A 1SCBA 4KR7A 1E6MA 4JR0A 5KVCA 3I9V6 2JIMA 4C7MA 1YBMA 4AKIA 1JLLA 1XD9A 2HF2A 2Z57A 3H8JA 4G9EA 4RJJA 3FMVA 2ZXFA 3RT7A 5FEUA 3KTDA 3A6EA 5B2FA 1MX9A 3TR5A 3K9QO 1WQ3A 2ZREA 1DTWB 3QY9A 4HD8A 1NVMB 4CN9A 1NA5A 2IPMA 1G3MA 1T5DX 4JYCA 2PXXA 2XHZA 4HJXA 2H5EA 4HCJA 3KX2A 3BSFA 1QH0A 1UPTA 1X70A 4PSKA 3K1AB 2QPAA 1RYDA 3AONB 3TLZA 2G5PA 5J4HA 2CL0X 2QMHA 3UGJA 3JWPA 1Z5ZA 1QG2A 2X7HA 4GZLA 4MVJE 4HYQA 5IAJA 3WL7A 3M9LA 3P71T 1ZK1A 2P35A 4FP9A 5TGTA 3C39A 5EJIA 3VR5D 1J20A 4NZMA 2R65A 1KP9A 2RIRA 4GR9A