1GVNB

Crystal structure of the plasmid maintenance system epsilon/zeta: meachnism of toxin inactivation and toxin function
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
272
structure length
272
Chain Sequence
ANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELVKLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYETMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLEKELNRKVSGKEIQPTLERIEQKMVLNKHQETPEFKAIQQKLESLQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Plasmid Maintenance System Epsilon /Zeta : Functional Mechanism of Toxin Zeta and Inactivation by Epsilon 2 Zeta 2 Complex Formation
pubmed doi rcsb
molecule tags Postsegregational killing system
molecule keywords EPSILON
total genus 106
structure length 272
sequence length 272
chains with identical sequence D
ec nomenclature ec 2.7.1.176: UDP-N-acetylglucosamine kinase.
pdb deposition date 2002-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06414 Zeta_toxin Zeta toxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1gvnB00
1TF7A 1P60A 3NC1C 1KK3A 3I72A 1NP6A 1G7TA 3C15C 1XDBA 1SVOA 5LB4A 4G01B 2FDCA 2G6BA 4QFMA 4KV9A 2O8DA 4P4SA 1ANKA 2D2EA 4LJ5A 2WM9B 5BYJA 3TLXA 621PA 4LBYA 2XZLA 1LW7A 4L5BA 2HLDA 3IIKA 5L3QB 2BCGY 1DAEA 1M7GA 2ODBA 3B9PA 5A0FA 1KI8A 2QBYB 1IAQA 2E1RA 2ERXA 1XXHE 4TYQA 4O25A 5L3QA 2PZFA 4KU4A 2GCOB 3N5CA 1EFHA 4GMXA 2F1HA 3TJZA 2J59A 4TN1A 4RVCA 3S1AA 4Q9IA 1G8HA 1ELOA 1YR7A 4EFNA 2QP9X 4PSVA 2V7QA 3W9YA 4CIDA 2QQEA 2J5XA 3I4LA 5CLQA 4C9BA 1H8HA 1G291 1T4GA 3OZXA 4MYCA 1XEXA 4EAQA 4A36A 5J4KA 4ACBA 4PX9A 4RCZA 1Q1BA 1JEDA 5FPHA 3A8TA 2W2XA 1N6RA 1SHZA 2VTKA 2ERYA 5BW8A 1CR4A 1FTNA 1UKEA 5FOUA 2O5VA 3MCAA 2FWRA 2CHVA 1IY0A 1W36B 2FF7A 1KJYA 4LOAA 1ZP6A 2XXAB 3LBIA 1WRBA 4Z54A 1ZUHA 2IWHA 2BOVA 4UXJA 1OE0A 3AB3A 4HATA 4Q7KA 4A0HA 4QBFA 3A1SA 2XXAA 3PV0A 3SJBA 3PJRA 2WV9A 2J7PA 2ZJ5A 2G9NA 1ZAKA 1UAAA 1OH6A 1PZNA 1G21E 4PC3A 4DBLC 2BVNA 3RS2A 1LNZA 3R9WA 3SN6A 1EFRA 3AM1A 2WICA 4FWIB 1GILA 1E6CA 2OILA 1T5LA 1YZTA 2W6ID 4OKSA 4X8LA 1F2TA 1KMHB 1L7VC 2WWIA 3I5YA 1W46A 4LDJA 1LB1B 2VHCA 1NBME 4TT3D 4FMCB 2BBWA 1W0KD 2AXNA 5CB6A 4HAXA 4PC7A 1VYTA 2D3WA 4B6FA 1N0UA 4I1UA 2H18A 4CRWB 4DLYA 1SULA 2BKEA 1NJFA 3DOFA 3ADBA 2OCAA 1KI3A 1Z6YA 1IHUA 4QNMA 4DJTA 4W9MC 4MH0R 4R98A 2ONJA 3W34A 3IQXA 4LV8B 2N1BA 3UPUA 3VR3A 4CEIA 4TYPA 2HXSA 4JLAA 1ZC4A 1Z0DA 2ZRGA 1JB1A 3IUYA 3K09A 4M1KA 4M0LA 1XJ0A 2J0SA 3KKOA 3GFPA 1JR3E 2FA9A 5G3YA 3DZDA 4BUJA 1W36C 2WHXA 3OESA 3K0AB 1W4AA 4AD8A 1X1SA 5EP2A 4BLTA 1CJMA 3PEVA 5DI3A 4OHXA 2ANCA 3TR5A 4N1AA 1GP2A 4B74A 4DIEA 1R0WA 1MABB 1M74A 2KE5A 5IRCD 4BQSA 3EWSA 2IBMA 3K0CC 1US8A 4Y0VA 1U0LA 3KX2A 3C16C 4M21A 5FTNA 1AS0A 1SVIA 1XPOA 4IDNA 3M6AA 1XJQA 5FFMA 1B23P 1L8QA 3TUJC 1YZLA 3OIWA 1IXZA 1NKSA 1BH2A 1XU4A 3N70A 4YXWD 1E1RD 5DI3B 4TYNA 5EE5B 3HU2A 3AVPA 4I99A 3IEVA 3IBGA 4OQMA 3DOEA 1GFIA 1S9DA 2H8KA 2JIZA 4YDHB 3WY9A 3WYFA 3D31A 1H65A 3OEHA 3P32A 1G7RA 1ZINA 1X6VA 3QPUA 4C4PA 3R9XA 1NSFA 2F1IA 1N5JA 1W7AA 2G3YA 2ZITA 3SS8A 2CVFA 3TE6A 1R5OA 3REFA 1KK0A 1UBGA 1NLZA 2BMFA 2QNRA 2QP4A 2IXFA 3AF4A 4XD7A 1T0HB 1EFTA 3KJGA 4PO8A 3CBQA 2RGXA 4F4JA 3VX3A 2VHJA 1CIPA 4BFWA 1HE1C 3KKQA 2YYZA 1J7KA 5DGXA 2ZI5A 1FTSA 4F7WA 4LZZA 3FKQA 3AVXA 4HDOB 3WHKA 3HP1A 4G3XA 2WSSA 1G5PA 3LO5A 2AD1A 4Q1DA 3BH0A 2ZSBA 1S0UA 3IBYA 3VHXA 2BV3A 2QAGA 4GP6A 2GILA 4NCHA 4D81A 3P20A 2IYYA 4PC2A 3WP1B 2NZJA 3UG7A 3E1SA 1O3YA 2YWEA 1Q1QA 4IOMA 2V1UA 5EUQB 4HLCA 4QM6A 2QSYA 2YWHA 2ZI3A 2J7PD 4JT2A 2H92A 1ODFA 4Q1CA 2QT0A 1PLKA 5ANRB 2ZANA 1P2SA 4M9QA 1TF2A 2O8EA 2X1VA 4A9AA 1I4LD 3BGWA 4B33A 2GF9A 4JVSB 3QI2A 4G1UC 2B6HA 3R20A 1QZXA 2FPLA 2ZI6A 4NMMA 4M4SA 3SZRA 4A2QA 4FI3C 5EXSA 4M9SA 2W6JD 4BEJA 5FL3A 3SI7A 2F43A 3NHAA 4B76A 2IW3A 4OHYA 1RIFA 5ELXA 5K8TA 3K70C 2JGNA 2ZU6A 3NBXX 2AFIE 2DCUA 3T12A 3U7FB 3RWOA 5B30A 2IYVA 2ZETA 1SXJB 2BJWA 3H86A 4OQNA 1VG8A 3W5IA 4FMCF 1RPZA 4OL0A 4ASUD 1XMSA 3TH5A 4D2IA 1KNXA 2J9RA 1ZUIA 4A0FA 1NMYA 4GZMA 4TSFA 5BN4A 1CKEA 1XTSA 3UIEA 1E79D 2VP6A 1R5BA 2RGGA 2FZLA 3ZVMA 2C9CA 1ZIOA 4V0KA 3FMFA 4NZYA 3U7GA 4U5XA 2XJ9A 4G5SA 521PA 5FUWA 5EQTA 2FJUA 3I1FA 1E2PA 2V7QD 3QKSA 4QXAA 1XTJA 4B2PA 3CW2A 1YKSA 4AYXA 5JWHA 1DG3A 4A8JC 2OBMA 2O0JA 1OKKA 2FV8A 5TV2A 1NVXQ 1UDXA 2VEDA 2JJ1A 2XX3A 4UXIA 3LA6A 2CJWA 1P2VA 5AJXA 3B85A 1KY3A 1DG1G 4URWR 2ZE7A 3NVAA 4YONB 2QTHA 1YE8A 2QT1A 1E9FA 3BRWD 4ARZA 1ZM7A 1MRSA 4II7A 1IJEA 3IIJA 3MSXA 4MDFA 4Q1BA 5LB2A 2IXGA 2ZS9A 1QHIA 2Q3HA 1G6HA 2GRJA 2ZRLA 4DLUA 1II0A 4BLOA 3WRXC 2X77A 5KYKA 3BE4A 2BCJQ 2CLDX 3ND9A 3BBPA 4PQYA 2RH5A 2V9PA 2ZRMA 3HYTA 1I4TD 1H8EA 2MSDB 4A6XA 2XOKA 1CS4C 2BEJA 2WVJA 3GJXC 3BAFA 2I3BA 1TUEA 3U3RA 1E79A 3SHWA 4JLDA 2DWQA 2IYSA 2X19A 1Q22A 5CDFA 3D6TB 2GETA 3B7GA 1E98A 5K8UA 1W36D 2ORVA 3WNCA 4C0SA 3B78A 4DSUA 5SZHB 3C8UA 1GUAA 2B8TA 4HYYA 3FGNA 4XIGS 3ZYCA 3NXSA 3TQCA 1T91A 1CJUC 2R6FA 4WXPA 2JLYA 4A15A 5J5CA 1GWNA 3MWJA 4JVMA 1NN5A 1HV8A 2AK2A 3DKVA 4Q18A 1RYHA 5AR1A 3BD9A 4EPTA 4DLRA 1XCMA 5GJVC 4LBWA 5TVKA 4H9GA 4LX0A 4EPWA 2KBEA 5DN6D 2A5FA 1A82A 1IN5A 1UDWA 3CX8A 4R7ZA 3LBNA 3S1AB 1E2KA 2CXXA 1II8A 2MSCB 5GVSA 2WJGA 2GEUA 1A5TA 3QXHA 3LXRA 2PCJA 2PT7A 1TQ2A 1YQTA 3KXKA 3T15A 1V5WA 2EYUA 3Q8XB 1PV4A 4MRRA 3ONWA 3SC3A 2P5SA 4LJ7A 4NDZA 2OO7A 3AH8A 3QXJA 5DIFA 2HXYA 3QOFA 4IDPA 1DTSA 3BFKA 5FH9A 3QF7A 3WMEA 1AA9A 2Z4RA 2C96A 3N2EA 3FE2A 4NCKA 2EW1A 3AF1A 3LNCA 4Q01A 1G16A 2HF9A 1BIFA 4NYIR 4PAQA 2WKRA 4KBGA 1MR3F 1OV4A 2F6RA 2WIBA 3IIMA 2Z5FA 1OJLA 5FTKA 3FMOB 3KQLA 1ZIPA 1P5ZB 1W5TA 3U4QB 4QRHA 1W2GA 2CNWD 2GDJA 2WOOA 1ZJ6A 1NNEA 3SJCA 4D4KA 3AVVA 5LDDC 4XTCS 4Q19A 4TLEA 1J99A 2C5LA 3VFDA 3T1QA 1EGAA 2BMJA 4HAYA 2OZEA 2XSZA 1Q1EA 1FUUA 4JKYA 3KKMA 4D0LB 2PEYA 4ZCMA 2NZ8A 2W6JA 1R8SA 2MSEB 1FW6A 3LDAA 3U44B 2ZS7A 1RKBA 2EWVA 1GKUB 4OJKA 1W49A 1A2BA 3NC0C 3KQKA 3JVVA 1BMFD 1UBEA 4A8JB 4TMVA 2O0KA 3MRSA 3TAHA 2ZSFA 4KVAA 4WIAA 1KKMA 4P32A 2PLFA 2VHUA 4Q4AA 1UF9A 2YVUA 1Z6XA 3CF6R 4MQBA 3WP0A 4BFVA 1ZU4A 5KSZA 2W6IA 1GVNB 1W4BA 2PT5A 1PVOA 1OYYA 4JJZA 1VTKA 3L43A 3REGA 2DYKA 4NH0A 4OYHA 2BBSA 4MUBA 4CGZA 2DFTA 4HB3A 5SZKB 4HI0E 3RAPR 1CULC 3GJ4A 5C4GB 4HAUA 4GDFA 2IUUA 2D74A 4HB0A 1X86B 1KMQA 4MKGA 1J70A 4BWYA 1P4SA 2AR7A 2IUTA 2FSHA 1TX4B 2ZJZA 3C41J 2N46A 3RS4A 4RD4A 5TB5A 2RMKA 4UJ5A 5SZJA 2XNSA 3GJ7A 4MRPA 2RCNA 1JJVA 1GAJA 4ZDJA 2OESA 1QHHA 4KFRA 3GJ0A 1TEVA 2A5JA 4OQXA 1LY1A 3B8HA 1UKZA 2EU8A 2CEAA 4HLUC 4RD3A 4RZXA 3GD7A 5DHAA 4TZ6A 3WBJA 4QBHA 2WOJA 4DC9A 4RKFA 3U6KA 4JBYA 1BKDR 1J2JA 2XTZA 4HZUB 2OM2A 4ABYA 5JS7A 4XSGA 3FYHA 3L0IB 3K9LA 4M53A 4XVRA 2OBLA 3GFTA 3KFVA 3A1UA 4PHTA 2H5EA 1YR8A 1OFIA 3QENA 4DCNA 5FBRB 4CDGA 2B7BA 5JSZA 3AGPA 3QVVA 1NN0A 4LUCA 1KYIA 2KB0A 4WOPA 3RABA 5JJLA 3NG1A 2V1XA 4EDHA 1RE0A 4U02A 2IS6A 4KFTA 3ZS9A 2BMDA 5EZ5A 1SVWA 2IUSA 1E2QA 5KOYA 3K0FB 4IVPA 3FMIA 3CNNA 1T3HA 3LD9A 4K8OA 4A4DA 3GPLA 2O8BB 4B3CA 5F9FA 1R2QA 1KSJA 2PZEA 4HUTA 2NO6A 4DDUA 1FMJA 1FX0B 3GLGE 2OV2A 3SQXA 3OIVA 2QP3A 1KZGB 4J0QA 1E0KA 3THYA 3NEYA 2HUPA 2R6CA 1OSNA 4BASA 5H68A 1XRJA 3SU8A 1NLYA 1VECA 3LY5A 3X1WA 4W5WA 4AK9A 3H4MA 5HKKD 1DAGA 1US8B 2VRWA 3SOPA 3GLIE 3KFXA 4IDHA 1BS1A 3QXXA 3NKVA 1ZNWA 1KO8A 4UXHA 3LQQA 5E4FA 3BWDD 3SHFA 3CF2A 4TT3A 4UNQA 4AYWA 2QM8A 3GLHB 2WWGA 3CPHA 3I73A 1KDPA 4PR0A 3G0HA 2OCYC 1QDEA 4Q5IA 5C46F 5K8LA 4YMTA 1YR6A 4RCYA 1N25A 2QI9C 4Y0AA 4YMSA 5E7MA 2G1JA 4BFYA 1KNQA 4O2RA 2Q9CA 2YINC 3DEFA 4A92A 2H1LA 1D5CA 4V0ME 3HPRA 3ZD6A 1UJ2A 3TK1A 5FTMA 4WZBE 1SVSA 3RRNA 2WJVA 3SE0A 1A7JA 1KJWA 1N0VC 1Z28A 3IDQA 3QPVA 5CK4A 3VNUA 1KDOA 1N5KA 4US2R 3WBKA 4XTRA 3U61B 1IJFA 4NBSA 4XOIA 3BB4A 5KDOA 3THXA 1UKYA 2EYQA 3CRRA 3HR7A 2B21A 2KWIA 4PO9A 2ANBA 3HYRA 2XTNA 4B3XA 2Q6TA 3AVTA 4HLQB 1E32A 1JALA 4MKHA 4C7OB 3NIBA 2OAQ1 4EKDA 4GOJA 1J90A 2FH5B 2N42A 4JS0A 3THYB 2PBRA 4X8HA 4WAUA 2MMGA 5F98A 5EXPA 2ZTSA 5KSPA 3ZQ6A 4D0GA 1U8ZA 3H1TA 1GRQA 4OBEA 4AYTA 2HJVA 2WMOB 4MRSA 2OCPA 5FI0B 3VU9A 3K0FA 1R10A 1SXJC 2AX4A 1VCIA 2AKYA 1OHHD 3PEYA 3DPUA 2OT3B 1E9BA 3PG5A 1K5DA 3J81k 3GEIA 1GL7A 1P9RA 3R7WA 4IFBA 4MGYR 3A58B 2QA5A 2WBLC 3B1VA 1S9HA 2ECKA 2HYIC 4DT1A 3EPLA 2O8CB 4HB4A 2WWHA 1NI3A 2J87A 2TMKA 4JLOA 1VMAA 2ZRFA 5CM8B 5J4LA 3A36A 1YZUA 4TTPA 1DELA 4LHZA 4LJ4A 2Z0MA 3THXB 2FOLA 3QPWA 2J3EA 4MRVA 1XXHA 2F3TA 1SXJA 1NVWQ 3ND8A 5JRZA 2RHDA 4F92B 2GCOA 5FOWA 1E2LA 4B2LA 2H57A 1FUKA 5FBLB 3AF2A 2CDNA 2F43B 2WMNB 3RS0A 4PSKA 4JSYA 4RD2A 3CF0A 1KK1A 5TMPA 3DM5A 1FP7A 4KAXA 1G3QA 1U98A 4TMWA 4KFSA 5LD2B 1R5NA 2F3RA 4FN5A 1N2CE 4JVLA 5KUTA 2AXPA 1HH4A 3JZMA 5HE8A 4E5UA 1XD2B 3UXMA 4LBVA 2ZROA 3BERA 3GLHA 1DVRA 4P4UA 4CEHA 3B1ZA 4QC2A 5FBWB 1DAMA 1SQ5A 4ZDWA 4AI6A 5KNDA 1LV7A 2H17A 3TW8B 3ZZUA 1Q3TA 4MITA 5HTKA 2VQSA 2F7SA 5F2EA 5HCNA 3WYAA 1ZM2A 2YC4C 4URXR 2NO0A 3BFVA 5GVRA 2XAUA 2VHQA 3AKEA 1NMZA 2FSGA 2RGEA 5FL7D 5FOVA 4DUGD 2BIFA 2VA8A 2QRNA 3NBZC 5FUVA 3T35A 1M1YE 1TQDA 5KPJA 1FX0A 2FX3A 4GPTA 3DMDA 3AQ4A 4D26A 4GBMA 2ZI9A 3CUEF 3DDCA 4AKIA 2O8BA 3VQTA 4C2TA 1NMXA 1GL9B 3GFOA 4Q1EA 4XJXA 1G18A 2HYDA 1NBMA 2D62A 2XITA 1D9ZA 2A9KA 4HAZA 3KKPA 1KHTA 2YOHA 4PFSA 3K70B 2GJSA 5J4YA 2NTYC 4YMVA 2A7QA 1AZTA 3MG9A 4Q4JA 4FMBB 4IXMA 5J47A 3GLFA 1G8YA 4LBZA 2PJZA 4C0KA 1ZD9A 2IYZA 3PITA 4JSTA 4NE2A 2WSSD 4DCUA 2F9LA 4O2LA 1R8QA 1T6NA 4KLZA 4KXFB 5JMTA 5GJBA 4PC6A 2C99A 1Q44A 4P31A 4LSGA 1AIPA 3IO5A 1SKYE 3NTUA 1KAGA 2WWFA 1XB2A 4DWJA 2G0TA 3O8BA 2DR3A 2Q9AA 1OB2A 4DLWA 3KXIA 1P9WA 1YZKA 4HZUA 3AF3A 1G8GA 3VMFA 4BRWA 2FN4A 3Q72A 2Z43A 1P75A 1S4QA 1UBCA 1Z6GA 1E9EA 2EFCB 1BYIA 4PO1A 3FFAA 3TR0A 4H1UA 3NDBB 2MMCA 3VKGA 4PPFA 4QHSA 3U3KA 3VU9B 221PA 2UVQA 1XMIA 3L8YA 3T5DA 3CR7A 3W5JA 1G7SA 3EZ6A 3P27A 2GXSA 3BJIC 3Q7QA 2QAGC 3L2OB 4C0HA 2VLIA 1NIJA 3QXCA 1UADA 1UBFA 1QBKC 1VDZA 1FNNA 1Y3AA 4US0R 2CE2X 1OB5A 3KQHA 1HURA 1CU1A 3AVQA 4JBXA 4E07A 1EFCA 5FOTA 2Z4SA 5CYPA 1DPFA 4IDQA 1W0KA 2F1RA 4NYMR 1KI2A 2W0MA 1GKIA 2ZRDA 3LLMA 3QXSA 4LJ9A 1B0UA 4EFLA 1N6NA 3X1DA 1R0XA 3GEHA 1W4CA 3RC8A 3QBVA 2ZRAA 2ZJ8A 3ZIAD 4EJSB 1U90A 4TQ9A 4OHZA 1XPUA 1TADA 4ZI2A 1U8YA 3KL4A 4LHYA 1JBKA 4Z1MD 3LAWA 3FWYA 3R7WB 2I1VB 5F3WB 2VO1A 3X2SA 4BLRA 2B92A 3QKTA 2H16A 3OE7A 1R7RA 2WPDD 4DLXA 4D25A 1P62B 2J0QA 2ZE8A 1II9A 4Q7LA 4A82A 2C98A 2GXQA 2GZDA 3P1JA 1MRNA 4BFXA 1G41A 2QY9A 4G5OA 3KB1A 4Q21A 2A5DA 4MDEA 3WNBA 3EPKA 1E69A 1U99A 4KHZA 5JEDA 4C0LA 2XSZD 3B1YA 3K0EA 3QG1A 2ZJBA 3D8BA 4DDTA 2AHOA 3L0OA 4Z8YA 3MJRA 3W3ZB 3SYLA 1IQPA 4B32A 1NVVQ 1XWIA 2PJRA 3O8DA 3Q3JB 1O87A 4R9UC 3HU1A 4TQUS 4ARZB 1JR6A 2FE4A 4GZLA 4M1TA 3PQCA 1XD2A 1BMFA 1XCPA 4HEJA 3B2EA 1CP2A 4DSTA 2DWPA 1GM5A 2ZSAA 3HU3A 2VIIA 1BO6A 2HDNB 3W6NA 2UKDA 4Q03A 3ZD7A 2NPIA 5FPSA 4OQLA 1JAHA 3CIOA 4GOXA 3GLFE 2IS4A 3PFIA 1XJCA 5CIQA 2QE7D 2IC5A 5J4HA 4DLTA 1VPLA 3K9GA 3QG5A 1S96A 2P6RA 4N3NA 3ZZTA 3WXMA 4ZIRA 3ZS8A 1XF9A 2VPPA 4URZR 3A6PC 1KZ7B 1E2HA 3MWLA 4IOJA 4XVQA 1Q21A 4P4SB 1COWD 2IF2A 2JLQA 4JLJA 1ZM3A 4B3GA 2PX0A 4UNSA 4OHWA 2JCSA 1CTQA 3SEAA 3VHLB 1LF0A 1FMLA 2XEXA 2QU8A 3W90A 5KSOA 4V0MA 4O0MA 3RRMA 1AGRA 2O8CA 3GEEA 3DZ8A 4B3BA 1P3JA 1VHLA 2FMXA 4V03A 2FGKA 1P72A 3GP8A 2JJ2D 4NCIA 1QHYA 1IXRC 2O0HA 4NCJA 2IEYA 3OEED 4FWTA 2V55B 4AG6A 4WXRA 2ZVQX 4RZ3A 5B64A 3IILA 2WKPA 2ODWA 2O52A 2KBFA 2ZRJA 1QHSA 2PH1A 3BC1A 4TL9A 2V6IA 1OFTA 2OBNA 1GOTA 4URUR 3UMRA 4BFZA 4TQAA 4DVGA 4EJSC 5E7IA 1H8ED 2QENA 4Q9HA 5TDHA 3MUFA 4CW7A 4MKFA 5JSZB 3Q5EA 2QE7A 4B43A 3LVQE 1U9IC 3AP2A 4K46A 4PHFA 4LJYA 1DE0A 4TTQA 1JR3A 4JYBA 2OG2A 2W2VA 1P7CA 3SDZA 2I4IA 1DS6A 1OT3A 4DZZA 1KIMA 1SVMA 5EP3A 3RHFA 4QGAA 1Z22A 2R2AA 4D4JA 1GZSA 3VTKA 4BFSA 2DHRA 3BORA 3THOA 1AQYA 4JZKA 3VR4A 2RGDA 1TL7C 1ZM9A 1ZCBA 4HDQB 2R9VA 1KI6B 3T61A 2YNMA 1P9NA 3C5CA 3U3MA 4RD1A 5FBQB 2BJVA 2GCPA 2HEIA 2GZAA 3PUYA 3D7MA 2C95A 2GBLA 1M6NA 1OXXK 2JJ1D 3IPXA 1RRCA 3EIEA 2VP4A 4L16A 4EIWA 4RFSB 4LY6A 1WF3A 2QPAA 1E9SA 3I5XA 3B5JA 3FB4A 2C9OA 5HKKA 4L4UA 3GMTA 4DCVA 3EXAA 4NTZA 2Q0HA 3LV8A 1G7CA 2CLCX 3ZJYA 3QSYA 1Z63A 3A1VA 2J0UA 4B3DA 2RGNA 4JYCA 2C04A 3U3JA 2A78A 1TMKA 3AVUA 1F48A 2Q3MA 2D7CA 2ZQ5A 3QEJA 4FW9A 1N5IA 4HSEA 3QJYA 4Q4AB 1JXMA 3KB2A 1KKLA 4CT5A 1Z47A 1G9XA 3I32A 1HQYE 1S1MA 4A8JA 2RGAA 3T06B 2ZXUA 4C30A 3DO6A 5L3RA 1XBTA 3C4JA 4A0RA 5IHPA 1OXVA 2Q3FA 2A5GA 1CLUA 3P4YA 4UKDA 2C9YA 2IYRA 3SBDA 4Q4LA 1GKYA 2GZHA 4QNRA 2RHMA 4KI0A 5L3SB 1YU9A 2VP0A 5FUXA 5FTJA 2ZRKA 4N0EA 4NP6A 2IHYA 3NHBA 2XGJA 6Q21A 1MO3A 2IHBA 5B2ZA 3TSZA 3VAAA 1HE8B 3QEOA 1W5SA 3TVTA 3ZIAA 2P0EA 4B47A 3FDIA 3A1WA 3VR2A 1G4AE 2XJ4A 3K53A 1G3MA 2AWOA 2GK7A 3CWQA 1CRPA 3B1XA 1PLLA 4NYIQ 2ZRPA 4PHGA 1IXSB 4IFEA 5LPNA 4NPHA 2ZE6A 1CR0A 1DADA 3CNOA 5CITA 3ZH9B 4KODA 3VR1A 1E0SA 5H1YA 2GAAA 3SFZA 2K5UA 3U2QA 5CK5A 5AUNB 4TTRA 3TGPA 3FFBA 1XMVA 1KDRA 1EFUA 1JXOA 2Z83A 2H7VA 3O8CA 4WBSA 5JS8A 3TW4A 2R65A 5J40A 2P6NA 2WWYA 3SNHA 1CBUA 3FVQA 2I1QA 4BLPA 1YRAA 1NVVR 4OK5A 2FFBA 2CMKA 1G8PA 1XTIA 3EW9A 1FOEB 4LC1A 4NU0A 4S35A 5EP4A 3TKLA 5B57C 4A2PA 5AK0A 3EZFA 1T9HA 1EFRD 1WXQA 4U00A 1Q57A 2YWFA 2ZSEA 3A4LA 4UNNA 1KO5A 2WJYA 1E1QA 2HT6A 1TU4A 2PZGA 3GCGA 3FKSD 2OXCA 1TQ6A 1OH7A 1R0ZA 1JI0A 3CZPA 2PMKA 3KJIA 3QQ5A 1PLJA 3V9PA 4C2UA 4CEHB 1XEXB 2R6GA 3E5HA 2QAGB 3CB4A 1KDTA 4M9XA 2AFHE 4QBIA 2WWXA 5BWMA 5FR2A 1GSIA 3RS3A 2CHGA 3A4MA 3LX5A 1MO4A 3DKPA 2GXAA 1CJKC 1Q0UA 1U9IA 3P26A 3M0EA 4ITRC 1LF5A 3UWOA 3KQUA 3K0AA 1NLFA 4V02A 1IBRA 1GRNA 3CR8A 1JEEA 4L9SA 4DEXA 3ADKA 3RDPA 2VSOA 4DLVA 4Q48A 4OK3A 5UKDA 2GTPA 2JAQA 2ODNA 1KI1A 2QG6A 4Q1AA 5CM9C 3CRMA 5FR1A 3BK7A 3UATA 2YHSA 2BKUA 2FPMA 4TLBA 1Z06A 4W5JA 1YJ5A 4JL5A 1SGWA 5FL7A 4OHVA 2J0VA 2KI5A 3U60B 2WJJA 4IOLA 3ZDQA 4U7DA 2JLXA 5C18A 1OLOA 4EPRA 4Z51A 5DYGA 2FEOA 1OIVA 3IKJA 2CCGA 1OIWA 1VYVA 1Z08A 3LLUA 4URVR 1T3LA 4QJ5A 5GJWC 1KO1A 2F1JA 3ZVLA 4ZCIA 4DLZA 3L82B 2QROA 4AURA 2PCLA 1BOFA 3FHCB 2REXB 1IY2A 2ZREA 4IOKA 1RFLA 1ZD8A 2ZRBA 1RJ9A 2GAOA 3AUYA 1YR9A 2R62A 1N6OA 4OJQA 4QJ3A 2PX3A 5JI3E 1PUJA 3NH9A 4P33A 4PXAA 2C8VA 1OYWA 3ECCA 4LPKA 4NL4H 4YDSA 5DHFA 4I1SA 2QPOA 1D2MA 1P61B 2ZU0C 4DDVA 1IOZA 1LS6A 2WAXA 2ATXA 3DHWC 1N3BA 1XEWX 1KI9A 4GNKA 3IO3A 3U7EB 5IF9A 1KY2A 2RGNC 3ASZA 5GADl 1ESNA 1I2DA 4BECA 2Q21A 4ILEA 4GL2A 4MGIR 5EZ6B 4ZDIA 1E2MA 121PA 1SVKA 2NIPA 2HCBA 5IK2D 2OXRA 2WJHA 2B8WA 3FTQA 1G3UA 1T3SA 2YC2C 1ZYUA 4AKGA 5LD2C 4F93B 1NN3A 1UEIA 1E2FA 1MKYA 5H8WA 5CIWA 5L8VA 5AWFC 2OCBA 4OI1A 4DSNA 3CRQA 3X1ZA 1MO6A 4BGDA 5K8IA 1FP6A 2QTFA 3KTAA 3LVRE 4LYAA 1CR1A 1QHNA 2ZR0A 1P6XA 1VG1A 2WPDA 5CLLA 2HLDD 1TAGA 1D9XA 1G3IA 3A1TA 3CX6A 3LQRA 4FMDB 4PSAA 2P5TB 5JFGA 4UQOA 1HQCA 1GNRA 3AKCA 4GT1A 1AGPA 3EWAA 2BHRA 4QL3A 2O8EB 4DB2A 3B1WA 3ICQB 4M2LA 2A5YB 1V43A 3RLFA 1TQ4A 3VR6A 2Q9BA 3Q7PA 2HF8A 1JPJA 4JMPA 3GLGB 3CRVA 4WA7A 1XTKA 4RKEA 1T8TA 3QKRB 3ADCA 2PMDA 1A4RA 4KFUA 3OF5A 4ON9A 3MJHA 4R2HA 2JLUA 2AD5A 4L8GA 3AVYA 2ZRHA 1S1CA 1UM8A 2R6DA 4EPYA 3E2IA 4TMZA 3CLVA 5DSZA 2VP2A 2QZ4A 3TUIC 1KO4A 1M7BA 4I81A 1KK2A 4RZ2A 1VYUA 3DL0A 3K9NA 4LK2A 1W47A 1GIAA 2GA8A 3MMPA 4M1MA 1S2MA 3VR5A 4IHQA 2JASA 2EFEB 3AV0B 1E2DA 2ZRNA 2FU5C 2ZI7A 5KU1A 3CKLA 3JZAA 3IPYA 2AKAB 4C3ZA 3RVBA 5L3SA 3EZ2A 4PPNA 3BOSA 2R6AA 2F9MA 4A6PA 2YJTD 1OH8A 4QJ4A 3EASA 2QBYA 1MT0A 1MV5A 4WZAE 1OKKD 1BYUA 1VCNA 1IY1A 4EPXA 1GL6A 1Q3HA 3LFUA 1KMHA 2ZI4A 2BM0A 3A37A 3L8ZA 3OHMA 3LRPA 4IKEA 4Q7JB 4F38A 4XWOA 1M8PA 1E2IA 1Z0IA 2NO1A 1AZSC 3L0SA 4Q47A 4YC7A 1HUQA 1AKEA 5DNYB 3K70D 4EQ6A 1Z0JA 3TIFA 3RANA 2FFQA 3QKRA 4QGGA 3TAUA 2QEQA 3CPJB 1XEWY 3U7HB 4GFDA 4BE7B 4PZZA 5KTYA 2FG5A 4LYHA 4Q4HA 3T5GA 3CONA 2IS2A 2IS1A 4EFMA 4N0DA 4DUGA 3VX4A 1G3RA 4GI7A 4P0TA 5DO9A 1LTQA 1XD9A 3TSWA 3PUZA 3SQWA 3KJEA 3SJAA 1ZCAA 2P2LA 1XTRA 3OIYA 3MWKA 4Q9JA 1WBBA 4ZDKA 3U6BA 2QRZA 5EE3A 4KYIB 2ZUDA 3DM9B 1ZNZA 4IEIA 4DLSA 5EE9A 3HWSA 1DAFA 1U0HC 1W48A 1ZC3A 1W1WA 5FOSA 3FHTA 3KUCA 2BWJA 4Q4JB 4ZO4A 3CZQA 8OHMA 2IYTA 4TLCA 2JIZD 3F8TA 1W4RA 4CEJB 5HR5A 1I4DD 1HEIA 3TBKA 1Z07A 1LVGA 4OI4A 1MO5A 2GXUA 1PUIA 1Z2CA 2KJQA 5E3HA 4LGMA 4YMUA 2QMOA 2CK3A 1EG7A 3GJ8A 2VP5A 4BFUA 3HDTA 1QF9A 1ZU5A 3HR8A 1G64A 2IF0A 1Z83A 821PA 3PENA 2IL1A 2OLJA 5AJZA 4FIDA 2DB3A 4FCWA 1DOAA 3AF0A 4X8OA 1CR2A 2V6JA 4OI0A 4S2EA 2IXEA 5CJ2A 4HB2A 1XCGB 3B82A 2XZOA 5AUOB 1SKQA 3QUSA 5LBIA 3UWKA 2ONKA 3PCRB 2FPKA 4QHTA 2V3CC 1X3SA 2C77A 4LJ8A 4M1WA 1RJ9B 4NYJR 4M22A 4R71A 4KLNA 2W0SA 4GSYA 2QORA 1QG2A 3TNFA 4JL8A 3BS4A 3QIAA 4HUQB 4DXAA 1XPRA 1D8TA 1VG9B 3T1OA 1W0JD 2KSQA 4NCNA 2GJ8A 1Q20A 4RSGA 5AUPB 2OUKA 1N0WA 4M8NE 4AG5A 3EZ7A 3OFND 4GOKA 1NY5A 2LKCA 1HA3A 4POAA 2ZR9A 3PIRA 4TLDA 3TVDA 1E3MA 2GWHA 1MABA 3LH5A 1M2OB 4JLMA 1GTVA 3LX8A 3BB1A 4RY2A 1JJ7A 2HV8A 2OE2A 5EE0A 4C0JA 2OEPA 3IGFA 4LYJA 3PUXA 4MGZR 5CDFE 4GRAA 4V0OA 2X2EA 1GNPA 5CYOA 1R0YA 1G5RA 2GBLC 3EAQA 3THWA 5BN3A 3IQWA 2ORWA 4Q9KA 3QNUA 2J46A 4ZPXA 1WQ1R 1I2MA 4MA4A 2GVDC 1TTTA 2WSMA 4TMTA 2IYLD 2L0XA 4G5GA 3MWYW 4ZCLA 1H8HD 2QMUA 1E9DA 1ZVQA 3D3QA 2ZYTX 4L15A 5DI9A 3UANA 1COWA 3BXZA 1IONA 3L0PA 1XFAA 5JRJA 3FMPB 3KUDA 5IK2A 4HLUA 1RRPA 3EC2A 1E96A 4DHEA 4B71A 2ZAOA 4D4MA 5FPYA 1RYFA 4LV5B 1E2JA 3M4YA 2JLWA 3Q9LA 5JHHB 2J1LA 4RFVA 5IDVA 2VF8A 3U3OA 5GJCA 4MGKR 4PAMA 4F91B 1T8UA 3QE0A 4IVQA 1C9KA 2YOGA 2R44A 1WE2A 1IN4A 4QGHA 3F0TA 1N6LA 2BMEA 4IJMA 4KSBA 5HZHA 2ZS8A 1OHHA 1GG2A 4B3FX 3OIUA 1KGDA 1YRBA 3CO5A 2D2FA 1N6IA 3H0KA 1N6KA 2ZJOA 4E03A 1G20E 2SHKA 2NO9A 5G41A 2XB4A 1JPNA 3QF4B 1RC8A 1K5GA 1ZD1A 2A30A 3WMGA 4B48A 4KO8A 3EIQA 4C0BA 2G0NA 1F3OA 1FQJA 1LS1A 2DFNA 5EE1A 1JECA 5KDLA 1E2GA 3AUXA 3T1VA 2XZPA 1AJEA 4D6PA 2JA1A 4UJ3A 1VIAA 1NG1A 2C78A 4FCVA 4EUNA 1F6BA 3GLHE 1SXJD 2QMHA 3A4NA 1XNJA 1E1QD 2BC9A 4UNRA 1CF4A 2NGRA 1NIPA 2NPFA 3CWZA 4ACAA 4TZ0A 4MYHA 1JQJC 1G8FA 3SFVA 2W58A 3ZVNA 4B73A 2CCJA 2DY1A 1GITA 3EARA 2WTUA 3OE7D 4C0QC 4DSOA 4BEBA 1S3SA 4OK6A 4TL6A 2GJAA 2BM1A 3MFYA 1JAIA 4CVNA 4MUAA 2GHIA 2JJ2A 1E9RA 3RSLA 1J8MF 4O3MA 1W2HA 1KO7A 1YVDA 2C2HA 4DEYA 4BLSA 2OFOA 2YOFA 1VKJA 1JNYA 4B2IA 2WJIA 4Q02A 4A0GA 4F4IA 3V00A 3MLEA 1E0JA 2O8FB 1E94E 4FMDF 1Q12A 3UKDA 4AWXA 1VG0B 5B58C 2O8DB 1YZQA 1KSGA 2VSFA 2V8OA 5FBVB 1SZPA 1M7HA 1AM4D 4W5HA 2W00A 2AK3A 2ZAMA 5DLQC 4JT4A 1QG4A 1Q1ZA 3I8XA 1OPXA 5A4JA 5HZKA 2ZPTX 2RGCA 5J4VA 4DB4A 5JI2E 4IXNA 5FPTA 5KHOC 5EXTA 1IM2A 2IA5A 3NBYC 1HTWA 4GMDA 1J8YF 2ZSDA 4A2WA 3C7KA 3AP1A 2ZEJA 4I4LA 4PZYA 4I1VA 1U0JA 1SXJE 3K09C 1ZM4A 2CK3D 4HLDA 1OFUX 1T5IA 3AGQA 4DRZA 3EPJA 4TYWA 1XZQA 1Z0FA 4NHOA 4BZXA 3CM0A 1AKYA 5KNCA 1N6HA 1QHXA 2E87A 4E22A 1P2UA 1AS2A 1HY3A 4KBFA 2QN6A 4ZKDA 3GJ6A 3IEUA 5AJVB 3EPHA 4JLKA 4XWKA 3MAAC 4DDWA 1ETUA 3U44A 1FQKA 2ATVA 4KSCA 3ADDA 3CH4B 1Z6AA 3QVUA 3BFXA 1RW4A 2FNAA 2ZRCA 1XD8A 3I61A 1P73A 4IDOA 2JJ8A 1NVUQ 2P6UA 1E9CA 1UFQA 4HAVA 421PA 2GF0A 4LRWA 1XTQA 3I62A 1W0JA 3SBEA 1G17A 1G19A 5D3MA 3JVUA 3RSOA 4JL6A 1EXMA 5KSYA 3UK6A 2DFKB 3X1YA 5JWOA 1E0AA 4BZQA 4F4CA 3C14C 2GK6A 5FOXA 3WNDA 1NL3A 4PHHA 2OFWA 2YKGA 2LCFA 1UEJA 2HJGA 2CL0X 1WMSA 2JLZA 2CBZA 3K8YA 2JEOA 1DAKA 4PZLA 3KJHA 4C0AC 3NH6A 4BZPA 5TY0A 2EVWX 1FZQA 4PAOA 2UZIR 2P67A 1C4OA 3RRYA 3FHOA 2GKSA 3NDPA 1TPZA 2XNDA 1DO0A 3MGCA 3EX7C 4G0NA 2HCJB 2ORIA 4TL8A 1Z0KA 4YMWA 3BIFA 3TSOA 1G4UR 1X1RA 5JJIA 1Y63A 2W83A 2D7DA 5FI1B 4M1YA 2QTVB 4TL7A 4LHXA 3X1XA 2J45A 3RNLA 5P21A 3UG6A 2QGZA 4LHVA 1GNQA 4PPGA 4TYYA 2V4ZA 3AVOA 2IYXA 1ZMXA 4LPSA 3W8RA 2REOA 3F3YA 4XVUA 1RRFA 4RD0A 3R9IA 2D4HA 3R8CA 3BH7A 4G5RA 2JLSA 3IHWA 4W7SA 1NKTA 2ZJYA 4B34A 1N5LA 2FEMA 2GNOA 4TMXA 4BLQA 3CPEA 1EX7A 3G82C 5JLJA 5H70A 1FFHA 2EWWA 3Q85A 5DISB 2GJ9A 4DT1B 2F55A 1RVDA 2ZVPX 1U81A 4LJ6A 1E2NA 2OLKA 4PQFA 5DE3A 1M34E 1X8LA 4RFSA 2QMEA 4FCTA 4ESHA 4JVNA 5JWRA 2G88A 1X8JA 1TF5A 1AK2A 4URYR 1KSHA 4MKIA 1NSTA 2P65A 4ERNA 4AC9A 1U94A 2VP9A 4PANA 1D2NA 2A3RA 1NBMD 4I1OA 1QVRA 2FSFA 1KJZA 2QAJA 1ZNYA 5JCZA 5TXGA 3GLFB 1QHHB 2R8RA 4JLNA 3AP3A 2QSZA 4NKRA 2GCNA 1OH5A 1Z0AA 2ZYWX 2ZIAA 2BDTA 4CT4B 3PVSA 4D82A 4TMKA 3QF4A 3BH6A 1KI4A 1NF3A 3CX7A 1ZNXA 2FFHA 3V4FA 3ZVRA 4AY2A 1JR3D 3B60A 5EJEA 3PUWA 2RKOA 4BRUA 3WHLA 2EQBA 2DWOA 1MOZA 2PLRA 1KSFX 2ZM5A 3F5FA 2GESA 3FPAA 3HJNA 2J0UB 3HPQA 4E09A 3SR0A 1VCOA 1SHKA 1TUIA 2NO7A 1SVLA 5DH9A 1A2KC 4CYMA 2EFGA 3K0CA 3W6PA 1A1VA 1XMJA 5A5GA 2VHTA 3QKUA 5JECA 1NN1A 5JZVA 3M1IA 3QKSB 2AL7A 1RZ3A 1YZGA 2BEKA 1N6PA 1L2TA 5D3MB 2X8AA 4LI0A 1AS3A 2REBA 5FTLA 2IT1A 3PXGA 3RWMB 4G5QA 4JJKA 4QKQA 4UNPA 4DKXA 1OW3B 1OXUA 2ZE5A 4KVGA 3U5ZB 2DFLA 4KCGA 4Q7MB 2FSIA 1R6BX 2WKQA 3THWB 1UKVY 4KITB 5KPDA 2NMVA 3WMFA 3T34A 5M04A 5C1BA 1L4YA 2LKDA 2EFDB 2EFHB 4WVFA 3TRFA 3I92A 4WW0A 1G1MA 3LW7A 3GQBA 1FPMA 2JDIA 3RS5A 1IN8A 1XEFA 2CHQA 2CLSA 3NBFA 3CH5A 2ASEA 2XOKD 1JQLB 1GRRA 2IYUA 5AJWA 5G40A 3ZQJA 3SYNA 1E4YA 1CJTC 1G5TA 2IK8A 5C4MA 1WA5A 5E7JA 3LXXA 4PPQA 5AUQA 2GJKA 2DPXA 3UMFA 5FUYA 4AKEA 4KYUA 4A1FA 1X8KA 2NG1A 4RZUA 1D6JA 4LC0A 1U2RA 2FZ4A 3IHLA 3RRZA 2UZ3A 3MD0A 2IYQA 4AIIA 4QBGB 1VHTA 4D0NA 2OSBA 1IN6A 4V0LA 2WWWA 1ONBA 3FKSA 1F60A 4IEEA 2JLRA 2GVZC 4Q9LA 3EIHA 3R8FA 4IW3B 1W44A 3BB3A 5EP1A 2C03A 2ZYUX 4QM7A 1TNDA 1EESA 2JLVA 4QG7A 1Z5ZA 2Y8EA 2GEVA 5JEEA 4ZKEA 1LFDB 2D06A 3NEJA 4BPBA 4AKHA 2JATA 3VKWA 5G53C 4FINA 3OAAA 4B6EA 2DBYA 2QQ0A 3OEHD 4JIMA 4RD6A 3EA0A 3ICEA 3AKYA 5E95A 5G3ZA 3O47A 4JLPA 5HE9A 3KZ1E 3B6EA 2A2ZA 4Z1MA 1ZW6A 2AN9A 1KI7A 4M1OA 4ZIRB 3KQNA 1E2EA 4B35A 5HPYB 1K6MA 1SKYB 5CJPA 2IWRA 2J7KA 3LWNA 2QPTA 1S3GA 2LWIA 4LWZA 2G77B 2VBCA 3TUZC 5JJKA 4L9WA 1QVAA 4TSFD 1Z29A 2ZRIA 5TARA 4Q66C 1K8RA 3LBHA 5KDDA 4ZI3A 4XSHA 2QM7A 1UPTA 2WIAA 4P3YA 4D80A 2QGNA 4ASUA 3ZZ0A 4QGFA 4IVRA 4US1R 4PQRA 4BFTA 4HZIA 4XWAA 3I8SA 4IRUB 3B13B 1TEXA 2RB4A 5KO2A 3ETLA 1DBSA 1TU3A 1T0JB 1OXSC 2ZYVX 3RC3A 2HT1A 1WP9A 4DCTA 4D4LA 1F5NA 2VF7A 3KDSE 3GJ5A 2B7CA 4CF7A 3GLIB 2CL7X 3ZLJA 4OQFA 1WCV1 3RS7A 1NG9A 4EQ6B 2XNDD 2FFAA 1CJVC 3KKNA 4EPVA 4Q00A 2IEZA 1PJRA 5C2JB 2G1KA 4HUQA 2VYFA 2FGJA 4PC1A 1R4AA 1S8FA 2CNWA 3AVWA 4B44A 1EWRA 4LCBA 3CRW1 3N2IA 1F2UB 3TMKA 1CRQA 4QHYA 4ESVA 1D2EA 2OHFA 2PEZA 4MRNA 4MYUA 1P2TA 1ZUNB 4NYJQ 3TQFA 3W8NA 3WYGA 1DAHA 5FPKA 5HCIA 2J41A 4OI2A 1L4UA 2GEDA 4MYTA 3K0SA 5D3QA 2RGBA 2P3SA 3SYKA 1FL9A 4JLBA 3I3SR 721PA 2ZR7A 4P4TA 2NOAA 4EJSA 1Z8FA 3QBTA 3DMNA 2G83A 1ZBDA 4DCSA 1U8AA 4LYFA 1HT1E 2YV5A 4R2IA 5L3VA 3Q5DA 1WDTA 2VH5R 1VIYA 2PL3A 4NONA 1G6OA 1DARA 1KOFA 4M9ZA 3ASYA 4K81B 4TLAA 4JKIA 4H1VA 1KAOA 1E1RA 4XH9B 3QY0A 3H84A 2AWNA 4FXPA 1OXTA 1Z2AA 2OAP1 2X2FA 5IT5A 1Z3IX 3GLGA 2WZQA 3DVLA 1OIXA 1YZNA 2YWGA 5JBQA 1E9AA 1F2UA 1E4VA 4JLVA 1QHGA 4HDCA 4HAWA 1HYQA 2Z6VA 5DYIA 4B75A 5KNBA 1WB9A 2XB2A 2O8FA 2YZ2A 3NWJA 3RYTC 4M1SA 3UMSA 1II8B 5JHGB 4KJZA 4WZ6A 1EWQA 3EC1A 4C7OA 1E99A 5AJYA 3CNLA 3C5HA 5BYKA 5JCPA 3OAAD 4CZ2A 1XX6A 1Z6TA 3GLIA 2E9SA 4TWZA 3FOZA 4CEIB 2IX3A 2ZJ2A 2ZUCA 1YHNA 3PR1A 1XP8A 2BBOA 4Q4HB 1NJGA 3KTAB 3K1JA 1KI6A 2ODEA 2QL6A 3T1TA 3AEZA 2QUZA 3VNVA 1OFHA 1HT2E 2IYWA 5CB8A 4PTLA 3EZ9A 3H2YA 3W3AA 4V0NA 5F9HA 5SZIA 1DO2A 3KXLA 2VSXA 3PEUA 2JDID 2CVHA 4X8MA 3VKHA 1EX6A 2CL6X 4YLGA 3WRYC 2CE7A 5BQ5A 4YQFA 1F2TB 5DN6A 1VCMA 5BN5A 1NRJB 2W2TA 1ZRHA 3EG5A 2BBTA 2ZJAA 4FD2A 3OEEA 4XD7D 3O8RA 4LHWA 1NY6A 3EA5A 1GDDA 4ZV4A 3K9HA 4CEJA 4DIDA 1QRAA 3AKDA 1XZPA 5EXXA 4Q1FA 1XXHB 2WAYA 4GP7A 2XTMA 4NYMQ 1WBDA 4Z8XA 1DAIA 2VL7A 3B9QA 2OFXA 3PUVA 1RRGA 3W6OA 3PEWA 4YXWA 4LV6A 2RAPA 3ZGXA 1IN7A 3GJ3A 4RJLA 2V54A 5EUMA 3U4QA 3LW8A 1CEEA 1CXZA 1KTVA 1MH1A 3V4RA 1DEKA 1ESMA 2CCKA 1AQUA 1C1YA 3OFNA 2NQ2C 1EK0A 2CJWB 5BXQC 3SJZA 4QOSA 3E70C 1OF1A 2ZUBA 1FNMA 4LJAA 3P4XA 3G5UA 4JBWA 1AN0A
chains in the Genus database with same CATH superfamily
1TF7A 4KQIA 4BYGA 1RMTA 1KK3A 1NP6A 2EDAA 1GT91 2WJPA 4YV7A 1EB9A 5LB4A 4HTFA 3MT0A 2TMYA 4BBAA 5BQOA 5FWAA 2POCA 2DT5A 1ANKA 2YBDA 2FW7A 3C39A 3GRVA 4LBYA 4LYGA 2XZLA 5A4FS 5U4QA 2FOIA 1M7GA 1A8UA 5BSWA 1RBZA 1KI8A 3RUAA 3M82A 5HJ5A 1XXHE 3IDOA 3INGA 2OHIA 4TYQA 2NTEA 4O25A 1N7GA 4KU4A 1NM5A 2GCOB 5DNDA 4HKTA 3KWMA 4F72A 4JQYA 4YAOA 4R8SA 3G0DA 4S04A 2CXRA 3UK1A 1T4CA 3WRVA 2JGDB 4XDZA 4QUBA 3FRHA 1UPAA 2CFCA 3KUXA 4PSVA 2XV1A 4J4HA 4NBRA 4RFLA 1C9DB 3KZNA 1RYDA 4YO8A 2RH4A 1T1GA 3W9YA 1SIUA 2YHUA 1BE8A 3ERCA 3E03A 4FLMA 1SC3A 4RPKA 1HM5A 2GRAA 1X9IA 1TU0A 3OURA 3BZWA 3UK2A 4WFIA 4ZQBA 5ILGA 1N75A 1YQXA 1PFQA 4XRGA 1OYOA 2QN3A 3EXHC 1E7SA 1ZMTA 3QTTA 3EEFA 2PBLA 4M55A 5B1YA 5IJ0B 3AY0A 4R9SA 1CR4A 4GG1A 3HNOA 1XN1A 1V5GA 2X2OA 5EAIA 2FWRA 1IY0A 4NPAA 3E4DA 3WJ2A 3GWGA 2FF7A 4B6SA 4LOAA 1QCZA 2RE8A 3TX2A 5COBA 5EJ7A 2XXAB 3FPKA 4RK5A 1Q0RA 1KQ3A 2AG6A 2BOVA 4WV3A 5T3YA 5BYAA 4Q7KA 2Z98A 4EBBA 3T3DA 2I2BA 4KE8A 2R4TA 2ZT6A 4Y2JA 2NYVA 3KVVA 5J5AA 5U1PA 4DBLE 1TVMA 1L5HB 4ZOAA 3PJRA 1T43A 4FX2A 5U9CA 1G9SA 1UAAA 5KOIA 2PSSA 4OHUA 4P0QB 2EZ4A 1OH6A 1YGYA 1AHHA 5B4UA 3RS2A 4RJIA 1KP2A 2DKNA 2O3TA 4XFKA 3AM1A 4NI5A 1RXWA 4G86A 4UVGA 3JATA 2HQRA 2WUVA 2HL6A 2YN2A 1NJ5A 2WWIA 4V0RA 3WLRA 3ZXIA 5L45A 5JPIA 5KVCA 2VHCA 1NBME 4FMCB 3WLAA 1DBIA 1W0KD 2AXNA 3AWIA 5DYTA 1VYTA 5K4HA 1A97A 1QGYA 4LTMA 1EFVB 2WWRA 2Q0QA 3QYPA 5D84A 4QVKA 1U7TA 1DXYA 4WBNA 3HBAA 2VNAA 3LT0A 1TLFA 4HFJA 4QEDA 1KVQA 4W9MC 3W34A 4LV8B 2N1BA 4TWBA 3VHQA 3UPUA 4TYPA 5TPZD 2P6PA 2HXSA 1SN7A 4G1EB 1ZC4A 1Z0DA 2ZRGA 1JB1A 3IUYA 4EW6A 2GAJA 1MB3A 3PJEA 1JDVA 4JK3A 4G8JA 4G1CA 1TT7A 2WHXA 2X6TA 3ABRB 4UMDA 4L4YA 3HB0A 4WBXC 2DBQA 3PGLA 4YRNA 1Z2PX 3DZHA 2G5GX 5G2OA 4IH4A 2Z5VA 3L46A 1FC0A 1JLRA 2JI6A 5DI3A 1QYCA 1V26A 1LSSA 1NYTA 2Q07A 1ND6A 4ZVVA 3TR5A 4N1AA 3QMPA 1PFKA 3RVRA 4BJ5A 5ICGA 5CVVA 4C29A 3RTBA 2XCOA 4GVLA 4DIEA 1MABB 1TYAE 2KE5A 5IRCD 2J6IA 3C4VA 3K0CC 5JCJA 1RAFA 1GV1A 3P9SA 4OG2A 5IM5A 1Q7TA 3PHJA 2MSNA 4GP9A 3JYQA 4G1MB 4EW2A 1RHQA 1XJQA 4XARA 1SXPA 4JUCA 1X9HA 2AB0A 2VF4X 1S3FA 1MJNA 2VDPB 3HCNA 2X23A 3BM5A 3OIWA 3TUJC 3VR6H 4EF6A 2NLOA 1M76A 4KDEA 4FR0A 4KNWA 1QB8A 1ISJA 4HRAA 2PV7A 5JNLA 5LKRA 4O2BA 3D31A 1H65A 3F47A 3OEHA 1TVCA 1ZEJA 1G21B 1QMGA 1X6VA 3GGPA 3O4RA 4KDFA 5JAIA 3NOVA 3QXGA 2ZITA 1ONSA 2GWRA 2R3SA 4AO7A 2CVFA 2LPMA 3REFA 4Y2RA 2EZTA 4BNDA 1SR8A 5ULLA 1EXVA 3GJQA 2ASVA 1NLZA 1WXGA 1M8GA 2CWWA 1QFJA 1N8TA 2CKMA 2HY7A 2QP4A 3AF4A 1T0HB 1T26A 2GHQA 3LRXA 1JMVA 4LY9A 1EFTA 3KJGA 1M1ZA 4C7KA 3CBQA 3K30A 3TI9A 4DM3A 1H2ZA 1SCBA 3PD1A 2IU0A 1Q50A 3VYWA 1T2UA 3ZGZA 3EJ6A 4F4JA 1ZN7A 4Y9SA 1CIPA 1V7PC 1YMUA 1AUOA 5KQMA 3KKQA 3MC1A 1ZGHA 4FFRA 4G5FA 3O0TA 1GCAA 2W6ZA 3IAS1 2ZI5A 3KQWA 4KXWA 5AHKA 1FTSA 3NHUA 3O75A 4FGUA 4E6EA 5B1EA 3AVXA 3HP1A 2HF2A 1OQAA 4H4DA 1PS9A 2QDKA 1G5PA 4CIDA 1YR3A 3LO5A 2AD1A 4Q1DA 4XJVA 4UTPA 3PNMA 4YJDA 3BH0A 3FCEA 2ZSBA 1BEEA 1JG7A 1S0UA 3H99A 2Q3CA 3IBYA 3VHXA 1MAHA 1B3BA 1WBJB 4AZSA 2GILA 4F1WA 4PC2A 2NZJA 4D97A 3E1SA 4LXGA 5DZSA 2DEUA 3RAGA 3F4BA 2HPHA 2C9ZA 3DTYA 2A6PA 2QSYA 2YWHA 2J7PD 2ZI3A 5FYQA 3C3DA 1PLKA 2ZANA 1XMOB 5F33A 1Z8NA 3WGOA 4DM4A 2VEOA 5EZYB 4N48A 3U4DA 3QHQA 2GF9A 4G1UC 2XCLA 4DNQA 1U2GC 2B6HA 3R20A 1CQIA 1LRKA 1HWYA 2FPLA 2ZI6A 1QZTA 3OY7A 4MLZA 4NS1A 4NMMA 5HDBB 3O83A 1ADGA 2QRUA 4H6VA 3LUJA 1EFKA 2EATA 1W96A 1CDEA 5EXSA 3ZDRA 2W6JD 3NGMA 4L07A 1Z18A 5G4LA 4YCBA 3VTZA 5HDQA 3T9EA 3M3HA 1IQ0A 1J2EA 2CMGA 1QBGA 3X0DA 3G59A 2OOKA 5K8TA 3NBXX 3P96A 4OQYA 4RMIA 4M9RA 4BQPA 2V7BA 3H86A 3X2FA 3LQ4A 4FMCF 4G24A 1A0OA 3T3HA 4BV9A 4JXKA 4OL0A 5DLDA 4ASUD 3TH5A 4XIYA 4B3JA 5IZ4A 1AH2A 4COKA 2HH9A 4D2IA 4R83A 5KOJA 1V16A 2XT6A 4DMUB 3GC6A 2QUKA 1NMYA 4TUYB 3T3OA 1NXXA 4LZJA 4CBVA 4OA8A 5JE8A 4NMWA 4TKMA 3B6ZA 4JC0A 3WYNA 5T8KA 2IHNA 4MMZB 2CWDA 3CVYA 1K7EB 3BFJA 1MJFA 4Z4FA 2HI0A 1E5DA 3D2AA 3K1ZA 2NVOA 1YDMA 4REQB 1Y1RA 2XIJA 2C9CA 3ZVMA 2XBLA 3FMFA 3WIVA 4OMUA 3FKJA 4NJEB 2I4LA 3O1HB 4BMNA 1RZRA 4CUZA 1JMYA 5AJTA 5CNIA 4PIVA 1FBNA 3I1FA 3JWIA 4EFKA 4EDFA 1S2LA 5JQGF 2CFOA 2IITA 3QKSA 1P74A 4ZI7A 1RPNA 1B16A 3W78A 2ZJFA 2IDMA 3GUYA 1KYXA 1R37A 1SNYA 2VT7A 4HPWA 3T54A 1ZGJA 4AYXA 3DV0B 4KXNA 4X63A 2EEZA 3P9KA 4A8JC 1A9XB 2O0JA 3HKDA 3SX2A 3H2HA 4HFNA 1S6YA 2JJ1A 2RJOA 4L95C 3V8RA 5GONA 3B85A 1ZA1A 2BFBB 1IHDA 1B6GA 2O07A 3A2MA 2A59A 4GOLD 3GXOA 1Z2EA 3FOZA 3H6GA 2XEDA 4FQ7A 4ZQHA 3MSXA 1JJBA 1I3NA 3T9FA 4DIFA 2H2FA 4Q1BA 3E0QA 5LB2A 4JUDX 3S81A 4E5NA 1E3QA 2QRVB 2AEJA 3ANSA 3AR5A 1XRNA 2HWUA 2CNKA 3EGDB 2CLDX 2WIFA 3IP1A 3D3NA 2NV0A 2R8PA 4HH4A 1ZS9A 2OHGA 2X9NA 1N4AA 3WGYA 4JI7B 3CN9A 2BEJA 1IHYA 4BE4A 3GJXC 1XHLA 4J9UE 1MQAA 3U3RA 3E7FA 4YRAA 1BG6A 4JLDA 2QKYA 1LDYA 2ORYA 3C45A 1WQ3A 3DMTA 3BDVA 3UJAA 2Z2YA 4E33A 2FHSA 3D6TB 3OEYA 2V98A 1KORA 4EGAA 5D3ZA 3CNQS 3RV4A 1XV5A 5JR3A 1NW4A 3UJ8A 3JQPA 4DSUA 4JB3A 3A9TA 1L5YA 3ZWCA 4XIGS 1LXCA 1UK9A 3O1JC 5H9WA 3J80A 1QIEA 3K9QO 3G2NA 1MC1A 2FMUA 4WACA 1ATIA 3ZNPA 4MQ4A 4DRYA 4A15A 2JLAA 3MWJA 2JGEA 3IOMA 1NN5A 1RP1A 1CEXA 4HNSA 4QT4A 2AK2A 3RODA 1U31A 1XZNA 5HQ3B 2AI1A 4RHYA 5AI0A 1Q83A 2HKIA 4ZODA 4A8PA 5JCXA 1LH0A 2JKVA 5JNWA 3UBTA 4BMVA 3T4XA 1SD5A 3W5BA 1VDMA 5T57A 3L77A 2FQQA 4PX5A 2OVBA 1A82A 1IN5A 1UDWA 3JAKB 4EHBA 1QP8A 5A7GA 3JAWA 3MQ4A 3SWWA 3UHPA 2B4TO 4BTVA 4I55B 4RULA 2HWWA 2GEUA 5F77A 1K63A 1OAOC 3ZY4A 4KRYA 3V7YA 4C76A 5GTDA 1ML3A 1QPBA 4L3VA 3OJXA 3E9QA 1QG0A 2FR8A 4MRRA 5CH3A 1Q19A 4YUAA 6ABPA 1ZD3A 5DBFA 3O2NA 4JQZA 2UVPB 2VHVA 4YRPA 4FHGA 3ODPA 2PLNA 3AH8A 4MUJA 3DVAB 2J4DA 2HXYA 3DUWA 3BFKA 1WMFA 5CVJA 1SQ0A 1G8MA 5HFAA 4XB6B 3DT9A 1ATZA 3QF7A 3RV3A 3WMEA 3N2EA 1ULUA 5CA1A 4GYKA 1MJ5A 2ODAA 4CLDA 4J0EA 2XRYA 4PGGA 1KZHA 1DFHA 3LP5A 4P7JA 2EV9A 1NJ8A 3E48A 1BIFA 4H6WA 4PAQA 2F6RA 4DCOA 1XA3A 2WIBA 3WL5A 4ED9A 2NXNA 3FMOB 4TUYF 4EB8A 1AKWA 4XCXA 8GPBA 1P5ZB 1W5TA 3DEKA 4N3AA 4BAGA 3U4QB 1W2GA 2AVNA 3TRJA 4FSXA 2ZB4A 3O0DA 4Y30A 4CN9A 1Y33E 1ZJ6A 2WOOA 4ES6A 1NNEA 4XEHA 4OAPA 2V3VA 4FYHA 2K87A 4OB8A 4TLEA 4MR9A 5BUCA 3H5NA 3NHRA 2G5PA 3VFDA 4GLJA 3VPBA 4MO2A 4Q3NA 3IEXA 4HAYA 1JSLA 2OZEA 2X0NA 2XSZA 2HFJA 5KYTA 2IDZA 1UBHS 5B7PA 3OO1A 1R74A 4D0LB 2A0WA 3SC2B 2W6JA 3I9V6 3SEFA 4ZCMA 4RH3A 3D4BA 1SUPA 9LDTA 3GGGA 4A91A 2NUPB 3RSHA 3PB3A 3GN2A 2DP4E 1VJDA 1DCTA 3SHQA 2PAAA 1U8CB 3WWCA 2FXIA 3QQPA 4S0ZA 4A7PA 3WGLA 3A4YA 2C42A 2EWVA 3ROTA 1VP9A 2PT6A 5BMVF 3KQKA 2DUUA 2QR5A 1BGVA 3AUTA 3RROA 3UAVA 2JIRA 3GAMA 1C30B 1T13A 2PL9A 4MJLA 2V7PA 2VAMA 3WA7A 2BHLA 1QZZA 2ONYA 3HXPA 2RI1A 2RJ3A 4P32A 3O73A 3QVWA 3RUHA 3GBPA 1FU8A 3PQ6A 4A0QA 4BFVA 1UPFA 5KSZA 3BULA 1QE0A 1JTEA 2PT5A 3KWJA 3HKBA 1CZLA 1TKRA 1CY2A 2X4LA 3JD3A 3L6BA 5CLGA 3E6AA 1V8DA 4YWJA 5JCOA 2DYKA 5ICCA 4KH1A 4OYHA 4UW9A 4B6GA 2XUGA 3IQGX 2A4MA 2DFTA 2NT4A 2O1SA 4HB3A 1ZOPA 1M2WA 1CULC 4HI0E 4PF1A 3RAPR 4Y6GB 3TM4A 1WVIA 4HB0A 4ZHSA 4UFOA 1M54A 2X8LA 4BGUA 1SQGA 2VYVA 1DDOA 3Q2OA 4XWYA 1GLGA 4R1SA 2HU5A 1JT2A 3L9XA 3P5SA 3PQDA 1QH8B 4G23A 4GR5A 3NX4A 4KLRA 2MWMA 4XFDA 5J2TF 2W6CX 4CCYB 1M34B 5HW0A 2QX8A 3GJ7A 3MXOA 4F5DA 1KTIA 5DXAA 3VJRA 3PR3A 3L0ZA 4PTYA 3T9BA 5LIPA 1CUEA 4F56A 2JPDA 1H3FA 2ZIFA 4PLWA 1JPUA 3DFKA 4OQXA 1LY1A 3BEOA 3B8HA 5K51A 3WIDA 5K3DA 4WCFA 4HLUC 2ZT5A 4ND8A 3PNLA 1X1QA 1N3LA 1B0ZA 2VK1A 3AEYA 3GD7A 3N8IA 2WOJA 1ZMBA 1DMRA 3U4CA 4KR9A 1CY7A 1DIOB 3AL3A 4AF8A 5JCJD 4DXHA 4OHFA 4XSGA 3KOWA 5JDIC 4ZQEA 3L0IB 5I4KA 2FLVA 2XKBA 4D9BA 1IXKA 2P7IA 1LJUA 4IUYA 4XVRA 4EI2A 2VWPA 3OQNA 3ZBTA 1YQGA 3QELA 2HMWA 2R11A 1RI1A 4RWZA 4QGSA 5HYVA 4TN5A 2XUJA 3NM6B 5IVKA 2CUTA 1LI7A 4LUCA 2FY8A 1L7PA 4W8GA 3NG1A 4KE7A 4YRZA 3R7LA 1W34A 4KHPB 3G1TA 4U02A 4ZVLA 2WF6A 1JAZA 1JIXA 3BXHA 3SHOA 4L51A 4L1KA 1XWFA 5KOYA 3R9XB 1MPTA 2Q2OA 1G21A 4LRYA 5AHWA 2O7SA 1GA1A 2ADFA 3A0UA 2QMZA 3WKDA 2HA4A 5IBCA 2GM3A 2ZUUA 4TS1A 4B3CA 3NATA 1X80A 2OY0A 3WOHA 1KSJA 2R8EA 3HGTA 4BNXA 4DDUA 1FX0B 3OIVA 5KS2A 1PU2A 3EG9A 3T0GA 2WW8A 4YJFA 1LSJA 4N9WA 4A03A 4UREA 4W5QA 1NC3A 1XRJA 3X1WA 3R7AA 1VECA 3DUFA 3M1AA 1Y8RB 4W5WA 4ZVOA 1ZN9A 1RIIA 3QXXA 2VBFA 4PLVA 2AG0A 3GNQA 3NKVA 4Y6LA 3WLEA 5KBYA 4UXHA 3IALA 1K6XA 4NNJA 4ER3A 5KHAA 1MAUA 3KZMA 4M37A 4UNQA 4EA8A 4BECA 1JSZA 3I73A 4I9UA 2BEWB 3DXXA 4I4IA 3IR7A 1YR6A 3PD7A 4NENB 4RCYA 1JG2A 1XKQA 4BNWA 3K4QA 2PSJA 3CVJA 4TS9A 1KNQA 1BMTA 2WG1A 2B99A 2OM6A 3KJNA 3OG9A 1EJBA 3Q87B 2Q9CA 3DEFA 1Y3BE 3M49A 4O2RA 4OXNA 4KOEC 5I3ZA 4Y2XA 1FMTA 1P0IA 4H7IA 4V0ME 2PGAA 3X1JA 1NUQA 5A4MS 5BSVA 4FHFA 1A7JA 1KJWA 1N0VC 1UBLS 1XUOA 4IV5A 1Z0ZA 3IDQA 4X7RA 5TQ0A 3CISA 1DKUA 4F5YA 1D2HA 5KQGA 1Q0TA 4QPZA 1N5KA 2H7CA 4QPNA 2YTZA 4XTRA 1E3DA 1ZGCA 4Q12A 2JGDA 4WBNF 3BB4A 4RVGA 1UKYA 2VHXA 1RP7A 4ZYUA 2RIRA 2ANBA 2V4UA 1V5EA 2XTNA 1UK6A 2IYEA 4B3XA 2Q6TA 3L49A 4HNQA 2Q3BA 2PGJA 5A3RA 2NVBA 1Y8RA 4HLQB 5TT0A 3G0IA 1AMNA 3AO0B 3QVXA 3RRBA 5BR7A 2XB8A 1XLTA 3ILHA 3K15A 2OAQ1 4C7OB 4GOJA 1EIWA 4EQZA 5GOZA 3RC2A 1OBOA 2FW0A 5K8JB 5KVSA 4QOEA 1QPZA 5DX0A 2ZTSA 3ZQ6A 4BY9E 3UOWA 5IH3A 1N57A 4HR7A 1GRQA 2GD0A 2ZOSA 4OBEA 5HKLA 4AYTA 2WMYA 1PHRA 2JAHA 2QLNA 4R68A 1GA6A 1R10A 1Z4PX 3SVTA 1BKSB 3I6IA 1BH6A 2AKYA 3PEYA 2FWNA 1S2OA 4ZREA 3DPUA 4V1CB 2GTIA 1E9BA 4NICA 3NAMA 4BJ6A 3GEIA 1WKBA 1N2EA 4I4TA 1P9RA 1YB1A 5FWYB 3FYCA 3QVSA 1KH3A 4WCVA 1ECCA 3RWBA 1AK9A 2QA5A 3INYA 1N8SA 1NLMA 2CXQA 3KCQA 3OMXA 1BE0A 2RGUA 3E23A 4PLHA 5H02A 2HYIC 2BMWA 2XQVA 3EPLA 1AZLA 4BJHB 2WWHA 2CVZA 2ZB7A 4K6CA 2J87A 3IAEA 4QXQA 1G55A 3USZA 2PU5A 1YJBA 1ZXLA 3L0BA 1GG9A 5CM8B 4L4RA 1UBUS 2EJUA 2HR1A 2X6QA 4LHZA 4X24A 1YR2A 3THXB 3UJCA 1SC9A 1WX1A 3QPWA 4KXXA 3B9BA 3BHMA 4LQ4A 2FUKA 9GPBA 2XUPA 4Y9UA 1LCIA 3I37X 1QIGA 5EOVA 1ZUD1 1SUSA 2F48A 1RQGA 3LDHA 5TX7A 5FOWA 1CUYA 3PQ3A 1WTAA 2JZCA 3UCEA 2CV0A 1QV7A 1FUKA 1VPWA 1UQRA 3WJ1A 1G20A 2IQIA 2F43B 4GBGA 1VBKA 4PSKA 2J67A 4JSYA 5CPBA 3L7LA 3KEFA 1T5DX 3CF0A 1KK1A 3KR0A 3PHCA 4GPBA 5TMPA 1U0BB 5C32A 1U98A 2XCTB 1R5NA 2X9QA 3LYUA 1N2CE 3R3ZA 4E21A 2FWBA 1R12A 3R9KA 1HK7A 4EO7A 2AXPA 3JZMA 3KEQA 1KAMA 1SCJA 2C7BA 4WNAB 1XD2B 4ZI5A 2N0SA 3FN4A 1E59A 3KKEA 5CT9A 5JZOA 1RFGE 4CEHA 1PQWA 2Q3JA 3WLTA 5C8ZA 4YK7A 4A3SA 1HE2A 1QE5A 1GL3A 3PWSA 1Q7BA 2H17A 2I66A 2F7SA 1ZM2A 4IJKA 1E1LA 1ETHA 2W8BB 3SNKA 2PL1A 3BFVA 3K9WA 1EUDA 2XAUA 2OSVA 1NMZA 2XMZA 4ZHQF 3R7DA 3AHEA 2BIFA 2VA8A 3W6UA 4FFVA 3BJRA 1M2NA 3NBZC 3WKBA 4RLFA 4B7CA 1TQDA 2G9RA 4HRXA 5BWOA 5KPJA 4FKZA 3BMQB 2FX3A 4GPTA 2V7VA 3RTDA 1A7KA 3CUEF 3DXZA 3EC7A 1AGNA 3LUDA 4TVOA 2O8BA 4AKIA 2IODA 2VBGA 2OENG 3KWLA 1KJ8A 2PGDA 2LW7A 4UHHA 5CT5A 4C2TA 4PGHA 4HNAB 4NCXA 4Y2TA 2JGAA 4XJXA 3B6MA 3GUHA 4V0SA 2D62A 2XITA 4HAZA 1EAMA 2B8JA 1HE3A 1TW2A 3KKPA 3SY8A 3L4SO 2NTYC 3QFRA 1RJFA 3D3EA 1J8DA 2J6HA 1AZTA 3IV9A 3MG9A 7REQB 2QRQA 3GLFA 2XLCA 5ENVA 4HBGA 3ROGA 4B84A 4C0KA 2NTVA 4DM7A 1RPJA 4RK6A 3V1UA 1Z7WA 2EX0A 4IRXA 3DAOA 4KXFB 4Y2YA 4CM4A 3JQQA 3GHHA 3QVJA 1WY5A 2NZYA 1XLWA 4P31A 1R8XA 5IAKA 2G0TA 4ZEMA 2HQSA 3VU0A 1H42A 4ZZ3A 4I8DA 4UHFA 1TPYA 1YZKA 5GOTA 1G8GA 4AZVA 5JMOA 2IIBA 1QRDA 2HREA 2Z43A 1P75A 1UBCA 3FIJA 4NNOA 5DLPA 5IYZF 4YY3B 1E9EA 5TEWA 1JE1A 1O9BA 1WTCA 2FPRA 1ZY2A 2WU4A 1D04A 4E13A 3VKGA 2ZUTA 4QHSA 5A5VA 3U3KA 4LOJA 221PA 2UVQA 1K98A 1XMIA 2NUBA 1V6AA 1QH1B 4XLLA 5FNVF 3G9UA 1Z7GA 1MC4A 1MTZA 2GXSA 1O97C 2E4WA 4MWGA 3LYLA 3RYFA 3LCRA 2QAGC 1J00A 3DTVB 1VMKA 3LZCA 2X8BA 1J23A 3QHPA 1NIJA 4KQ6A 3ETEA 4RVFA 2REQB 3GDOA 4YP5A 1U2EA 1IMOA 4Q1VA 3STTA 4IICA 1Y3AA 2ARKA 2B1GA 1L7AA 2A8YA 4M86A 3TFQA 1EJ0A 3ISTA 4L8YA 3VH2A 3D6HA 3KQHA 4EKYA 4KR2A 3UXHA 2HO5A 3PNQA 4O33A 4E07A 1EFCA 2QLMA 2Z4SA 2Z8YM 1DPFA 2A9VA 2F1RA 1TJ4A 2TRSB 4CLHA 2V59A 4IEFB 4X1KA 3LHFA 4EGSA 4HAIA 1N1DA 1PRYA 1WUJS 4FFSA 5IC6A 4UZEA 2IOQA 1OR8A 1N8KA 1U6KA 4K2HA 4UC0A 4YQZA 5B3KA 3W8FA 1DEXA 4NCAA 4L2IB 3DEIA 1AQIA 2NACA 3NFRA 4C7BA 1HYGA 1ZLXA 3BZUA 2ZJ8A 4FEAA 5G0UA 4EG1A 1V1RA 1GEEA 1U90A 2BFPA 4TQ9A 1EDDA 1XPUA 1VL8A 2XA9A 3TVYA 3VGPA 3KL4A 3VZPA 4Z1MD 3DE5X 3FWYA 3G2QA 1IY8A 2I1VB 1SA0B 3I9KA 3VR6D 4O4LA 4BLRA 1VBNA 2B92A 2WJ3A 5BO5A 4XR9A 4EELA 1IAVA 1CRZA 2WPDD 1RLUA 4HEHA 4DLXA 1N7IA 4BO1A 2DE0X 4A82A 1PEKE 3P1JA 1BEZA 4LNAA 5AJUA 4YRGA 4MCIA 5JZ9A 2NZXA 3VOSA 3VYVA 4BO6A 4CODB 4G5OA 2C20A 3KB1A 3AT1A 1X15A 1EE1A 2A5DA 1GUDA 3E9YA 4ZOCA 3UV7A 3VR5H 3ZEIA 4L27A 3JRNA 4MDEA 3IKMB 1O6FA 3VOTA 1U3CA 4FJ2A 3HC7A 1E64A 3E81A 4C0LA 2PVSA 3FSJX 3EHEA 4CQJA 2Q50A 3IHKA 1Z9BA 3D8BA 2EDCA 4CKWA 4G4IA 4PYNA 4B32A 3T9CA 4YMGA 3U5TA 1S89A 1XWIA 1JHYA 3SC6A 5ER6A 2WZCA 7MHTA 3Q3JB 4FOOA 1OX6A 4R9UC 3HU1A 3ABOB 4TQUS 1JR6A 2YVLA 5EJ2A 3ZE9A 1NQOA 2E55A 4BV2A 4X3OA 1C9YA 2IP4A 3C8HA 4F86A 2YQ4A 2I55A 1RR6A 2Z2XA 2BFWA 3B2EA 1CETA 3ESYA 4HEJA 5F78A 1DO8A 3A0RB 4XDHA 3AEQB 2PTHA 2IOHA 5CH5A 3RC7A 3VZRA 5FF9A 5FPSA 4ZCQA 4KIGA 1PG5A 1JU3A 2BFFB 3DV0A 4GOXA 3AHFA 4OP1A 5DCYA 4M1ZA 1XJCA 1RRKA 2EKQA 2XQFA 4DLTA 5J4HA 1Y6RA 2QLLA 4FONA 1UMDB 1NVAA 4RQUA 1V1JA 3IL2A 2NPOA 3K9GA 2P6RA 3R77A 2G28A 3FTDA 3JQAB 4BBZA 4ZIRA 3DMGA 1XF9A 3A3OA 3P9RA 1LKZA 3FF4A 1IN1A 2LRHA 1H6AA 3KD3A 4C5AA 3PKJA 4IOJA 3FOEC 4UTXA 1THMA 1H2WA 1TCUA 2ADMA 1Q21A 1COWD 2IF2A 3R6LA 4JLJA 1XQWA 2VSQA 1L5QA 4Z3KA 4C2AA 3TECE 4B3GA 4G0QA 4TMYA 2AOTA 4OHWA 5B53A 5HP4A 2JCSA 1K66A 1CTQA 4H0FA 4XR4A 1XNRB 2OBYA 1LF0A 5JD3A 1VC2A 2XEXA 2Y6UA 3PGJA 1FU7A 4V0MA 4XQEA 1XQ9A 4YT5A 1FPQA 4AULA 3ITNA 1AGRA 1ICEA 3LGSA 4O4JB 6NULA 3DZ8A 4CPDA 2OD9A 1P3JA 3LY9A 1VHLA 3DBHA 4OPMA 4D44A 2FGKA 5CFLA 1P72A 1XZFA 1LBQA 2JJ2D 2ZFUA 1QHYA 1XTTA 4A26A 1LPSA 3GNSA 1FVXA 1M34A 1UM9A 3IUJA 2CEKA 1VIDA 3BMXA 4YYEA 2P1ZA 4FVTA 4AX4A 1P9OA 1QH8A 4WXRA 3GDGA 1U1DA 2PG3A 1ECPA 5AXCA 1YE3A 2WKPA 4L8WB 3E8MA 1V11B 2AJDA 2O52A 5CXUA 2XKJE 4JR2A 3OPYB 5IAOA 5M29A 2PH1A 3BC1A 4P7KA 3VDQA 1GOTA 1UZAA 4BKUA 4DVGA 3ZI0A 4WCFC 2Y0DA 4M9CA 2BFFA 1XA4A 1H8ED 4Q9HA 2W43A 4LVUA 2D1QA 4IDDA 4P34A 1OU4A 3UUEA 2WHRA 4J4TA 3MUFA 4E4TA 1K2WA 3PPIA 5DX1A 4OJTA 3OSUA 2H7XA 4MKFA 2QE7A 2QTMA 3W7AA 2MINA 3K8ZA 2AYZA 4PHFA 1Y4UA 4LJYA 1DE0A 3W5SA 4HDMB 4JYBA 2OZLA 4LY3A 2Q49A 1FNDA 3J7AC 2Y1DA 1PV1A 2W2VA 5DPMA 4H1WA 1OLSB 4Z7JA 3ISVA 3JVEA 1QLHA 5EP3A 4M7OA 1USIA 1XZHA 1Z22A 3INNA 2FEKA 4XIFA 4E2WA 1BOOA 1PYDA 4D4JA 1MIHA 1VPTA 3FDZB 3DZFA 1YRQA 1AQYA 2C97A 2QV0A 5AK5A 3A9UA 4F1JA 1BW9B 1PR1A 4F7DA 1XJWA 3K72B 4JB2A 3COWA 4FHZA 5DYYA 4TPKA 4UE2A 4LRQA 3UJNA 1D07A 1ZRSA 2C1ZA 2B2XA 2I54A 4CQMD 4F12A 2HLPA 1P9NA 3WI7A 2ATEA 1WB5A 2CJXA 2P4EA 3LLVA 3C5CA 4JGIA 3ZBPA 2GR9A 3VNSA 5FBQB 1IEVA 1E7WA 2BJVA 2GCPA 3HCPA 4R16A 4MPRA 4UDOA 1IB6A 1OGIA 3PUYA 2Y1FA 3MRVA 5AW3A 1OXXK 4ENSA 4MAFA 4ZYXA 5BMVB 2C2XA 3JQBC 2ZBRA 5JYBA 4BC0A 4HYTA 2HIMA 4EIWA 2GAIA 4LY6A 1EM8B 1WF3A 3TCKA 1PL7A 4P93A 3EXAA 4G0YA 5EKUA 4D0SA 3D64A 3GCXA 2Q0HA 3LV8A 3RSFA 3ZJYA 1JFSA 4NOMA 1FXSA 5B6JA 1XCJA 2GSDA 1Z63A 1XZKA 1VB3A 2E6UX 2ZJ0A 3ILVA 1FRVA 3EVDA 3U3JA 1CZHA 1FZTA 3IT0A 4EGQA 1VJRA 3GZJA 1NUPA 3FY4A 2B4AA 1GCOA 3X3HA 3FPBA 2YJZA 1A8SA 3R8XA 2ZQ5A 3AY7A 1FLNA 1Y34E 1ZBQA 3NYQA 3QEJA 4WGFA 5GGXA 5H3LA 1JXMA 3VSAA 2PY6A 4KR6A 2BL4A 1G9XA 1TCAA 1K89A 4A8HA 2BKLA 3A10A 1S1MA 3T06B 1PSZA 4RORA 1MNQA 2ZXUA 4RZHA 2W6NA 4INJA 5GY7A 5M34A 3U7QA 1TM3E 3AI1A 3RUPA 5A0TA 1A76A 2Q6KA 5IHPA 1SCUB 2MSLA 4CKEA 1P4AA 1U3FA 1CB7A 2OYSA 3FF1A 1O6CA 5JSHA 1RRMA 1IHOA 3HYNA 4H77A 2H4ZA 2IYRA 1QWOA 1W8IA 4J76A 2RHMA 5GM2A 3K96A 2EHDA 3FH0A 4LDRA 5BRJA 5L3SB 2D1RA 2P77A 3F6YA 3FD8A 4EATA 2UXBB 3ZXSA 4N0EA 3BWCA 2XGJA 1T2AA 4YECA 1I3CA 4ZC1A 3IPCA 5AM1A 4CDRA 1X7WB 4FE7A 5B2ZA 5CBKA 3QEOA 1AMUA 3L4KA 4IIBA 2F8MA 2V5UA 1EP2B 4B47A 3HXTA 3LX4A 1MXFA 2O7NA 3LK7A 5AHOA 4QPPA 3K53A 4I19A 3HY4A 2J6CA 1E5QA 2AWOA 3A3NA 3CWQA 3WGQA 1ZH6A 4AZWA 4UOEA 4ADSG 5C35A 3B1XA 1XDDA 1X1TA 3RGGA 3PLAE 2VJMA 4RMNA 3CJQA 1U8UA 4PHGA 2DPMA 1SVUA 4S1OA 3QEMA 5BN4B 1M33A 1G5HA 1VJ5A 5CITA 1DADA 3CNOA 1JHOA 4CM4B 2A9QA 4Z7QB 3UWDA 5HRAA 4QVGA 1E3SA 3VR5D 1NZJA 1T6ZA 2ISCA 3D4PA 3TKAA 1JIUA 2K5UA 2LTAA 1C5KA 2IVFA 2J09A 1BX1A 3MJSA 4PCLA 1W29A 4KBYA 2QR2A 1JDJA 1B8UA 1PWHA 1EFUA 1R3UA 3DH0A 4F71A 2Z83A 5CD9A 1IHPA 1EGQA 5AKJA 1YI1A 3D3KA 2P6NA 1KARA 3HO6A 3PDUA 3CUWA 2JHCA 2QTTA 2VT3A 3U4IA 1SIOA 1BRTA 3ZNNA 3Q88A 1A9YA 3FTFA 3DLIA 3JWEA 1JA9A 3F5QA 2YFYA 3PQ7A 4D3DA 4L02A 3E9MA 4RAQA 1L5OA 4S35A 1V8FA 4UARA 5EP4A 1M1NA 1EQAA 1VKRA 2NO5A 1BCRB 1DX4A 3UMGA 4KFCA 1FFXA 4CR6A 3C1TA 3OJ0A 1NR7A 1FUIA 2SCUA 5IARA 1W85B 1Q57A 2R1VB 3IBSA 1KO5A 2OQRA 5EI5A 2R8XA 5GPBA 2YWXA 3AINA 3HJCA 3L01A 3O8QB 3E8XA 2WVAA 3S2IA 4CEHB 3F67A 1SB9A 1SHJA 1DQZA 3CB4A 2MYNA 5B1DA 4GR9A 5JYCA 1XALA 2NSHA 2YHAA 3UPDA 5BWMA 5FR2A 3N0RA 2CHGA 4F4FA 1BJTA 1C3XA 1ZGZA 2Q2NA 1PJ3A 3LX5A 3OPNA 4CMAA 5LWQA 3AFOA 5L6LB 3P26A 4B82A 4XPZA 2R6ZA 5JOQA 2VUHB 2R751 3H2IA 4JAVC 4ZGBA 5F4BA 1QSGA 2FSVC 4L75A 3ADKA 2BSAA 4JHLA 4JQOA 1ZGAA 4Q48A 5UKDA 2GTPA 4X9XA 4R54A 3HH8A 3TTXA 3O74A 1ISFA 1FYVA 5LQKA 4EHNA 3V1TC 2A1UB 2FPMA 4RMGA 1R6XA 4M3NA 1OZGA 4W5JA 2VOJA 6CHYA 3K35A 5AM4A 2KI5A 2W90A 1A5ZA 2H85A 2XDQA 3G7NA 1ZH4A 5LQSA 3ETDA 2AC2A 4RLQA 5CBPB 4K6KA 5CFQA 2XTJA 3SVLA 2XMQA 2W22A 2CN1A 3IKJA 3KU1A 4JXJA 4Q3AA 5JW6A 4G0WA 3AMVA 4G8CA 4URVR 4IHKA 1J0EA 4FBMA 4DLLA 2HSGA 4AICA 5M3BA 2QAIA 1OX4A 1KO1A 3PE6A 4GW3A 1JS1X 5HIAA 3OQMA 2G72A 3L82B 3TM5A 4NBTA 3ZE6A 3V4VB 1P2FA 3AEKA 3K0BA 2REXB 2ZREA 3GT4A 4EVQA 3EGVA 5B1IA 3E61A 2ZRBA 4YBRA 3C6ZA 2P9YA 1BS9A 1K27A 3AUYA 3W2IA 4IG9A 1YR9A 2ZTVA 3LNTA 4MV1A 4OJQA 2OFFA 4KV7A 4NARA 4PS1A 2QQFA 3NH9A 2FZKA 4HSGA 3ECCA 3U7RA 4BFCA 1T35A 2PE5A 1KRXA 2AZ4A 2IYNA 4BIMA 1IOZA 1LS6A 2ATXA 1H94A 3USES 3L79A 2FPSA 2GCEA 2EGHA 2HPVA 5IF9A 2KLHA 2UU9B 1UANA 5I9TA 3WL3A 4PVDA 2JGFA 3PWTA 1GNTA 3FLBA 3D3WA 1QQ5A 2NV2B 2O8VA 5KKAA 2I7TA 3V1LA 3ZHRA 4GL2A 2VHYA 2OZKA 2TMDA 4GKBA 4OY3A 4QYXA 3VPFA 3I53A 3WMXA 2OXRA 2IUFA 5H3CA 3TOXA 2W93A 5C1IA 1TXGA 1EM6A 3H4VA 2QG9A 1J20A 1KJ9A 4XVCA 4C78A 1K7XB 3M70A 3ZX4A 4AKGA