3VKUA

Penta mutant of lactobacillus casei lactate dehydrogenase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
306
structure length
290
Chain Sequence
KDHQKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLEDALPFTSPKKIYSAEYSDAKDADLVVITAGAPILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAKMVNVDARSVHAYIMGEHGDTEFPVWSHANIGGVTIAEWVKAHPEIKEDKLVKMFEDVRNKAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of penta mutant of L-lactate dehydrogenase from Lactobacillus casei
rcsb
source organism Lactobacillus casei
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
total genus 97
structure length 290
sequence length 306
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-11-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3vkuA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 3vkuA02
4IQ8A 3SC6A 4GWGA 2RCYA 1LDEA 3WTBA 1XDWA 1SBYA 2XPCA 4NQZA 1EVJA 2WEKA 3L6DA 1G0OA 2Q4BA 5DULA 2CY0A 3T7EA 1J0XO 1E3SA 1ZK2A 4OHUA 4XJTA 2EIHA 3TNLA 3F5SA 4TROA 3ZHXA 3N7UA 4TVOA 5JO0A 4IDDA 4L4XA 4OSOA 4DQVA 1PIWA 2ZB4A 4PLVA 2JAHA 3NTQA 3WNQA 2NACA 2P4HX 1SO8A 3TZQA 3VPGA 4DLAA 4WCDA 2Q50A 3VKUA 1PWXA 4FIZA 3DBHA 5G0VA 2X58A 4MVJG 3JQDA 5EESA 1UP4A 1CEQA 2TMGA 2OP1A 1MB4A 4P4GA 4CLOA 1N7GA 3RASA 3UH1A 4R5HA 1HDGO 2Y1CA 1BWSA 4Z9YA 3D3WB 1HXHA 1W6UA 5AOVA 5EIOA 2LDXA 1O8CA 4NDNE 1T2AA 1UH5A 3B1FA 1DC6A 5DN9A 4IJKA 3MCVA 1U3WA 2Y68A 4OSPA 2AEMA 3WS7A 3EGOA 1VL0A 1GAEO 3MOIA 5LDGA 3H3JA 3PK0A 3NDJA 5F1KA 5DNAA 1BDMA 3WX0A 3TQHA 4D3FA 4E2YA 1AUPA 3DTTA 3NEPX 1SEVA 4UUPA 5CP8A 5G4LA 3GLQA 3R1IA 1Q0HA 3U4CA 5IDXA 3I5MA 4CM4B 1BXGA 1H6BA 1ZJZA 4DPMA 1SC6A 2CZCA 3KYCB 4YQYA 1OAAA 5MDHA 1H93A 3V1TC 1N9GB 2HK7A 1FDWA 4B4WA 3G3EA 4CLEA 2Y0EA 3GOHA 1DBVO 3CE6A 5JAMA 4BGVA 1IOLA 1P74A 3EZLA 3KYCA 4ONEA 5JDCA 4WLEA 1E6UA 5KTKA 4GMFA 2CD9A 1U4OA 3LF1A 5AXBA 3WQQA 1DHTA 3IAHA 1I24A 1HZZA 3RUDA 3CUKA 2FWMX 3DBLA 1MLDA 3PDJA 4BO4A 3U4HA 1KC1A 1LSJA 3RQSA 4TRMA 4RJTA 4AJJA 1GV0A 3V5NA 5U1PA 4CQMB 2Q1WA 4MIYA 1RM0A 1PGOA 4HP8A 4CJXA 4R1TA 3GNSA 2JFHA 4IXTA 4P4NA 3ZWXA 4XQ9A 1JAXA 1P1KA 5CDUA 4HNGA 3ANMA 4W6ZA 1ISMA 4QTZA 4K26A 5DBGA 5I9MA 3LLSA 1SOWA 1XLTA 4J7CA 4EYEA 4ND3A 5AXDA 1RJWA 4D79A 3DBRA 3HDHA 3E6AA 4XEHA 5KVVA 4OMUA 3B1JA 3ZU2A 3K9QO 3MJSA 1UAYA 5THKA 1E7QA 1BHSA 3VTZA 3K8ZA 5L4LA 3RUCA 3VZQA 1MC4A 5EN4A 5H82A 2EG9A 3F3SA 3H5NA 3U5TA 2VHZA 3L9WA 2JJYA 2G5CA 1TT5B 5G4KA 4X54A 3I6IA 5G0UA 1JKJA 3GH3A 1NNUA 2VHXA 2ZK7A 4DLLA 5A9RA 3B20A 3AUTA 3RBZA 3F5QA 2GN6A 1ZH8A 1QYVA 1UXIA 4WLOA 1E3WB 1PWZA 3OEWA 4WLVA 4YRAA 1JW9B 3NT2A 3HNPA 5B4UA 2PH3A 1R4MA 3NT4A 2NVWA 4ILKA 1J4AA 1PJBA 4XDYA 1LI4A 3TL3A 4J2HA 3Q3CA 4FN4A 4OOFA 3JQFA 2P5UA 3ITKA 4P38A 2VWPA 4Y67A 2JKVA 4ND5A 4FOSA 2VZ8A 3JQ8A 3OH8A 2FR0A 4FFRA 1ZK4A 2C2XA 3HJAA 1NXQA 2GGSA 3FWZA 4XKJA 4C4OA 1OFGA 4JBIA 4E32A 4PCVA 4YXFA 5L3ZA 4J1TA 1XHLA 2JAPA 3JQAD 1F06A 4EEZA 3X2EA 2I3GA 1YL6A 2Y93A 3DBLB 3DZHA 3GNTA 3KO8A 3UN1A 3LQFA 3GMDA 5T64A 3SJ7A 5IZ4A 2OORA 4BB5A 2NVUB 4RL6A 2Z1NA 1TB4A 3I3OA 4PZDA 3QVOA 3TOXA 4Q3DA 5G0SA 3N74A 2ZCVA 1E3WA 3I9MA 2GZ2A 1T2CA 2VQ3A 1GUYA 5I9NA 1ZMTA 1ARZA 3EZYA 4WASA 3E48A 1HDXA 4TMFA 5CPBA 3I4CA 1CWUA 1HE5A 3FTNA 5IZCA 2AQ8A 4AJEA 4BO3A 1BVUA 4YJGA 2I65A 3PWZA 3GN2A 1B2LA 3V1UA 3FNFA 3UW3A 3STHA 4ITUA 2AQIA 1KS9A 2JCYA 3UICA 3PYXA 1HYGA 1VJTA 2GR9A 5JPIA 2HAEA 3L4SO 3BMQA 4RPLA 2NV6A 2YDXA 3HHPA 4O63O 3MJ4A 5JFOA 5DF1A 4CV1A 4MO2A 1WMBA 5L53A 4BNLA 1Y1PA 3KV3O 1U3VA 2W4QA 3WYCA 3FR7A 3DZIA 3M1LA 1DIRA 5A1TA 2VYVA 3NJ8A 1JVBA 1PGNA 3JYOA 1IE3A 1LTHR 1JWAB 3HG7A 2BD0A 3V2GA 3DWFA 1PR9A 3PJGA 1PJ2A 1L1FA 4W4TA 4OKNA 3A9WA 1NPTO 4IZHA 5KIAA 2JFGA 5A03A 3FSRA 1ZEMA 2O3UA 4KWIA 4ZA2A 1OMOA 1YGYA 4OOEA 1RKXA 3PFFA 1RPNA 1RM5A 4BGIA 1WZEA 1JWBB 1FXSA 4J7UA 4J49A 4LVUA 2X0IA 5B4TA 2B69A 5T57A 3S2GA 1Z7BA 2BHLA 3OP4A 4YPOA 2O50A 1ADFA 3WIEA 2B5VA 2Q1UA 5JO9A 4CM4A 3RUIA 3WLFA 1Z75A 1Q7CA 2YFQA 3WJAA 2NQ8A 3ICPA 3OM9A 3C24A 3QVSA 1Q7BA 2DBVO 2YV1A 3HDQA 1QYXA 2CSUA 2J3IA 3K5PA 4AJ4A 3WXBA 4BQRA 3W6ZA 1GPDG 3G1TA 2E6UX 2AW5A 1Y5RA 3HZZA 4J43A 4II2A 5COQA 4TWRA 3DZBA 4PRKA 4ALNA 5EERA 3RC9A 4PG6A 1LLQA 4Q3BA 4TRRA 4Y9DA 2QRLA 1GCOA 3B70A 3KUXA 3VZSA 4ALKA 1CQJA 4HFJA 4DIBA 4JGBA 4K6CA 2PZJA 3MJTA 1BVRA 4QO8A 4Z0TA 3GAZA 2PWZA 1R12A 4W7IA 1DJQA 1ZBQA 2DPGA 5LCXA 3GVHA 4ZRMA 2HJRA 2Q1SA 1M76A 1U4SA 1A71A 3RU7A 4NFSA 4NG5A 1N7HA 2G17A 2J5QA 4I5DA 1ADBA 4BNXA 5MGBA 4G5HA 1ZK3A 3CZRA 3H9UA 1ZKMA 1O6ZA 2C54A 4YQZA 1B26A 3UFXA 4E13A 3KZVA 3ZV6A 3BHIA 4XX0A 1C3VA 3U49A 1B16A 3WICA 1IPFA 4QXMA 1T4DA 4YT5A 2X22A 2PR2A 4Y6PA 3BYZA 3LC2O 4KP7A 4CM1A 4BKRA 4TVBA 3WJ7A 3WR5A 2YFHA 1WDLA 2EW8A 4PG5A 4N5NA 3W4KA 2BMAA 4PRLA 4EJMA 3D4OA 1EZ4A 4OQZA 1LC3A 7ADHA 4J2OA 1EQUA 1C14A 2VWGA 3FNGA 4TSKA 4WJZA 3LF2A 5TC4A 1H5QA 4E3ZA 1E7RA 2PD6A 2X9GA 1ISGA 2YW9A 3JD0A 3VPFA 3TZ6A 4BKOA 2V6BA 2C5EA 2HRZA 2QG4A 1P1IA 3VH2A 4U0KA 4OGWA 3R3SA 4FR5A 1NX6A 1BSVA 3CIFA 1T2FA 1LX6A 5B37A 2Q4EA 4Q39A 4GBJA 1EFKA 1YQGA 2ZJ1A 4TQGA 4G81A 4RCVA 2AE2A 1ISJA 4UUNA 5EJ2A 3DTYA 2JD2A 4KUEA 3AUAA 4RQUA 5AVOA 3W4JA 1LRLA 3JQ7B 4KTTE 5BNTA 5EMHA 3SC4A 4GLOA 5A9TA 4WCFA 3ZWOA 4DIOA 2BFOA 3G79A 3SBOA 5CAEA 4J1SA 4ZJUA 1UDCA 4RPJA 5HA5A 2IEBA 3T4EA 1X0VA 5HBRA 3RKRA 3ZW9A 2FPIA 3OSUA 4XB1A 1Q7GA 4MVJI 5IXYA 3MZ0A 1GFSA 3O38A 5BSHA 3NTOA 3QSGA 1I30A 3N58A 4HFMA 2O7SA 4E5PA 5HS4A 2W98A 1U3UA 4EUHA 3D5QA 3GNQA 4J0EA 3OJOA 5A9SB 1W0CA 2X8LA 1C0PA 4PLGA 3ZV3A 4CQLA 5TT1A 4CUKA 4PLCA 2O2YA 4R51A 3C8MA 3JYNA 1K2WA 3D64A 4BGEA 4YT2A 1DJNA 3IDSA 3OBBA 4CM6A 3KSUA 5CDTA 4MINA 4WEQA 3MJEA 3ETEA 4CV3A 4KWHA 5L7WA 1SNYA 1CERA 1A27A 3IL2A 2SCUA 2RHRA 2B4RO 3FRJA 2HMWA 3S2IA 1E1LA 2CDCA 1UAGA 2ET6A 3ORFA 4ESOA 4CM8B 5A5EA 1A7KA 1FDSA 4QO7A 4PIVA 2AQHA 2R6JA 2NUAA 1QLHA 2NWQA 1B14A 5JMWA 3JV7A 3PJEA 4DA9A 2B5WA 3U4IA 5KJFA 2ZTMA 1U7TA 3ABIA 3PIIA 1PJCA 3W6UA 4YT8A 4AJPA 4BNFA 3KTDA 4L74A 1FDUA 4YYZA 4ZICA 5BNFA 3EVNA 5JC8A 1P0FA 1X0XA 3F1KA 3UCXA 3DHNA 4BO0A 3GG9A 4J9UE 1YOVA 2HMVA 3FN4A 3ZNOA 1LDYA 2VN8A 4BNUA 1DRVA 6ADHA 4IDAA 3BTOA 2BGLA 3E03A 3Q11A 4AJHA 1KERA 5FFFA 3K2BA 1DIGA 3AI3A 1D1SA 4MKZA 1X7HA 4FJ0A 3JQ8B 1G6KA 5DBFA 3D0OA 4YAJA 2HMSA 3C3XA 4I9NA 2BFPA 4J7XA 1U1IA 3RUEA 4F45A 3AI1A 1NVMB 3ASUA 2EKPA 4CLHA 1EE2A 3AM3A 1CYDA 2A94A 3K73O 2CDBA 4PZCA 3KETA 3AY3A 4GX2A 2EJWA 3PZRA 3Q1LA 4RGBA 2GN4A 3JD3A 1NASA 1PJTA 2Q49A 4AJNA 3OHSX 2D2IA 4J0FA 4ZQGA 5AQ1A 3HWRA 3U09A 3UKOA 1ZIDA 4E5MA 1DIHA 1JDJA 1U8XX 1R0SA 1TEHA 1UXJA 3LU1A 1P3DA 4Q3EA 5F5NA 3Q6IA 2DAPA 4E2WA 2X0RA 2WSBA 5FI5A 5JBIA 3CSDA 1F17A 1FDVA 3GDFA 5JAIA 2FOIA 5L40A 2DUUA 1JA9A 4UULA 3IIEA 2NVBA 3DHYA 1D8AA 1ENPA 4D45A 4WUVA 4R4JA 2EGGA 4O6VA 2AG8A 5TLSA 3QHAA 4JJGA 3CMCO 2GSDA 2ZJ0A 3JQFC 4IDFA 1F8GA 3QWFA 4KUGA 5ILGA 2FHSA 2XXJA 4CQMA 4B79A 4FBGA 3JQBA 1X7GA 5L4SA 3TFOA 3M1AA 4PLWA 4HBGA 4CQMD 1GYPA 3X2FA 2BH9A 3PVZA 2ZQZA 4E5NA 4M55A 4D7AA 2P9GA 4JX8A 3D7LA 2Y1EA 1I3LA 4UVIA 1UZLA 1I01A 4I9UA 3K30A 3F47A 2CF5A 2NTJA 1E7YA 1JVSA 1R37A 3EVTA 1ULUA 5HTOA 5KWEA 4JN6B 1T26A 4CMAA 3WGGA 1PS0A 3ON5A 1LSSA 3IC5A 4KTVE 4RORA 2ZYDA 1ZK0A 4NI5A 1PL6A 3FHLA 3E5MA 5L7TA 1EQ2A 1FF9A 1WAMA 2VYNA 4FJ2A 4MP8A 1EBUA 1VI2A 2Z5LA 3VDRA 2NVUA 2PH5A 4DC1A 2O23A 3CH6A 3GQVA 4YACA 2GZ1A 5KCZA 2EHDA 4NJMA 1HSZA 2X23A 4D0RA 4FFLA 5JDIC 1O94A 1FMCA 1KIFA 2OUIA 1YO6A 3DO5A 1MX3A 4GH5A 4DPKA 3SLGA 1EK5A 3AOEC 2BKAA 2HJSA 2D3TA 3KVOA 4R1UA 4XB2A 3K92A 2YQ4A 1DIAA 3U62A 1TVEA 2C29D 3PHGA 2DBQA 3OF2A 4J4HA 1GEEA 1TXGA 2EERA 4MKRA 5ES3A 1BXKA 3RC7A 4ID9A 1CQIA 4ZQBA 4N5MA 4XYBA 1VSVA 2VYND 4CODB 1I36A 5IG2A 2HRBA 2IZ1A 3ZW8A 2H63A 1QV7A 2VRBA 3GY0A 4PG8A 1KOLA 1NQOA 2O7QA 1EUZA 2X1HA 1IB6A 2ZYGA 5ITVA 3EYWA 1YWGO 4RLSA 3ZN2A 3HN2A 4J3FA 1H9BA 3WB9A 1QMGA 1RYDA 4XYMA 2BGMA 5U4QA 1OZAA 3KXDA 4FB5A 4QT0A 3L4BA 3DBRB 4WEOA 2HQ1A 5TF4A 2C2YA 1ENZA 1P1RA 2DT5A 2IXAA 4FFPA 3PJDA 3GF4A 3TF5A 4RDHA 3RBXA 1JTVA 2ZCUA 2PGDA 3U3XA 4RVHA 4BO7A 2E4AA 2DTDA 2I9PA 4JXKA 5TGDA 2VTDA 3VHRA 3PI7A 1U2DA 2RIRA 2EP7A 1B8PA 1BMDA 3CTMA 3LZ6A 4FC7A 5THQA 1CETA 4NR0A 1N8KA 5C5IA 4BNTA 2B37A 3SX2A 1UJMA 3P2YA 4J4BA 1KVSA 3PP8A 5H83A 1MA0A 2OZPA 1H6DA 3HB5X 4XGKA 2BELA 3O9ZA 5F1OA 1Z74A 2DBZA 3G49A 4NU5A 4IBOA 4BNKA 3UVEA 1LDBA 5GZ1A 5ILOA 4OO3A 3NUGA 1GZ4A 3P7MA 1FK8A 4PVDA 1E92A 3OETA 1PZHA 1I3NA 2WMDA 2JD1A 4LRSB 2WD7A 2NU8A 3AUSA 4IDCA 3AU9A 2JD0A 4OYRA 1V8BA 2Z1MA 4NFHA 5BSEA 2VZ9A 2GF2A 1JKFA 1A9ZA 3I9NA 2FSSA 4KUHA 1EVZA 2Y0CA 1VPDA 1QXSA 2D5CA 1I32A 2QZZA 5LC1A 3WGHA 4W99A 1ID1A 1ADCA 2I3AA 3PRJA 2VOJA 5L51A 5A9SA 3IJRA 1P31A 3F6YA 2PZKA 3Q9NA 1HZJA 1DFIA 4KQWA 3RD5A 2X86A 4MVJE 5ER9A 1DXYA 2AEJA 5LDHA 4R9SA 1DRWA 2EWMA 1KEPA 1T2DA 3AUUA 3HDYA 3JYPA 1N1GA 1M6WA 3G1UA 1HE3A 4GVLA 4RPHA 5A3VA 3OMLA 4RZIA 2XOXA 5JDCC 3L6EA 3RFTA 3BMOB 7MDHA 2I99A 2DUWA 1GY8A 4UVEA 1HTBA 3F4BA 2W2KA 2HKIA 3OIGA 5AYVA 5ENVA 3HQ4O 1UXKA 1PR3A 3PDUA 1H2BA 3EUWA 3GDGA 4MVJP 2EF1A 1N9GA 2WYUA 4BNHA 3QE3A 3VH3A 4ZHSA 4EDFA 3BAZA 4CUZA 3WGTA 3CXRA 1X15A 4GL4A 4HY3A 1YONA 2H5LA 4FOOA 4JCOA 4P22A 4OAQA 3BTSA 4B7XA 4YA6A 1Z45A 5C37A 2PZMA 1C1DB 1NQTA 4TKMA 3ZGYA 2NU6A 3HUDA 4BNGA 1SOVA 4Z9FA 4E2ZA 3ETDA 3IS3A 2ZTUA 3UGKA 4WLFA 3NYWA 4ZVVA 4BO5A 4GX5A 4JNKA 4IINA 1K6JA 3M6IA 2OL4A 2Y05A 3NGLA 4F3YA 1H2HA 2JHFA 4WPGA 3MWEB 4XRRA 5CDSA 4BNZA 1EDZA 2UAGA 4ROSA 4BV9A 2EGHA 4BO6A 3C7CB 1VJ1A 5FF9A 4Q3NA 1ULSA 5CEJA 2WYWA 3VH1A 2UYYA 5G2OA 1UP7A 2QX7A 4F6LA 3MEQA 1VKOA 4E6PA 3BXXA 5DCWA 3ZWBA 3LT1A 3DOOA 1GEGA 2GZ3A 4EZBA 2HO5A 4RF3A 1DFGA 3L9XA 4BNIA 1YS4A 1ZNQO 2TMDA 3GFBA 3NTRA 5L7YA 1HL3A 4CMCA 3NRCA 1ML3A 3ZU5A 4R5MA 1HT0A 2IDZA 4RVDA 1CF2O 2WTBA 4BO1A 2FY8A 4NH4A 1HDCA 1VLLA 3WMWA 2NTVA 1OC4A 2ZKLA 1K89A 1MXFA 2CDAA 1WWKA 4Z9XA 2RH8A 1PZEA 1WDMA 3VOSA 1PQPA 4AJOA 1DFHA 4PG7A 2YZ7A 1EEHA 3NJ4A 2C5AA 4HV4A 4BMSA 3QWHA 4A10A 2EEZA 1LQUA 1I33A 1XCBA 4LK3A 3KM0A 3ZWMA 2O48X 1X7DA 2EP5A 5J23A 2RH4A 4N54A 4EJ0A 3DXFA 4A26A 3PQFA 3JD2A 3BMCA 1C0KA 4WGGA 2WE7A 3VAZA 3ZWCA 3GUYA 5I7VA 3MOGA 1T1RA 1IZ9A 1KEUA 4YT4A 2Q1TA 3D4NA 1NBOA 3DMTA 2GN9A 3UOGA 1XA0A 1Y8RB 1YH3A 2VCYA 5JDIA 3QY9A 3W8FA 5DT9A 1YDWA 4J9VA 1Y5MA 3A14A 1SMKA 1E3LA 1HSOA 2J8ZA 3KHUA 3QWIA 4R1SA 1U9JA 2DC1A 1HLDA 4D0SA 2WDZA 2G76A 2A92A 3ZH2A 5I7FA 3I6QA 4GWKA 4NBVA 4IMRA 1QP8A 3RAJA 1JU9A 4W7HA 3GRPA 3KOUA 4MPDA 1M66A 2H9IA 3FPCA 3LT4A 3QVXA 2CVZA 3ASVA 1BG6A 2P9EA 1BRMA 1CDOA 3FR8A 4MDHA 2J3HA 1JAYA 4DQXA 2IZZA 4HADA 1NWCA 1YVEI 4YAGA 2AA3A 2JCVA 3F1LA 3JQAA 2XAAA 1I5RA 2ZYAA 1SZJG 3IOYA 5DDIP 3DMTC 1RWBA 4GQAA 4FC6A 4J1QA 1I2ZA 1VC2A 1E3JA 3CINA 5KOIA 4WK6A 4URFA 1DIBA 4FCCA 5T5QA 4J6FA 4BB6A 5EQDA 3ONFA 4CMGA 1MFPA 1C1XA 2G1UA 5JAQA 3WBBA 3WNVA 5IN4A 2GERA 1XSEA 4RLHA 1QYWA 2D0IA 1TLTA 1GPJA 1LSOA 3QIVA 4B8WA 3SEFA 5A05A 4BMNA 4YJFA 1WLYA 4D3SA 4RO0A 1ONOA 3D4PA 1XEAA 3OIFA 4RF4A 2DTXA 1E5QA 1F0YA 3JQ7A 3R0IA 1NR7A 1I0ZA 1U8FO 3LLVA 4CL8A 1B3BA 3IQDB 4A7PA 1YE3A 3L77A 4AJ1A 2I76A 3QA9A 3ZWPA 4WECA 2YUTA 3R3JA 5C3MA 1MXHA 3H9GA 4OKIA 1KEWA 4R1NA 1XG5A 2DM6A 3VPSA 3BMCB 3MTJA 2VWHA 4JBGA 3TSCA 5C7OO 1KY4A 3AU8A 3GRKA 2FN7A 2VUUA 1E77A 3AOEA 1V3UA 3KYBA 4CUJA 3P5SA 5IDYA 3DAPA 2AG5A 3FNHA 3D1LA 2W8ZA 4L75A 2VZ0A 3QV1A 4U5QA 3WQSB 4I1IA 3UXYA 4GGOA 1NAIA 1LQTA 2NLOA 4XYEA 3WDSA 3GGPA 4DMLA 1NQ5A 4M86A 3FNEA 5GMOA 4PGFA 3SVTA 4O5OA 4IGFA 3TPCA 3GDOA 1LLUA 3TL2A 1E3EA 4YJDA 4E2XA 3JQGB 1ISFA 1ZFNA 1U3TA 2D8AA 5DCYA 4R68A 3VC7A 3GMSA 4D42A 4GLLA 4CLRA 4R54A 1HE4A 3PQDA 4NMHA 1ONPA 3A06A 5TT0A 2OBNA 2EKQA 3ZWWA 4QFDA 3NV9A 3OQBA 3DZFA 2YDYA 1MV8A 2A4KA 2AEFA 3JQEA 3WYBA 1WDKA 3K31A 1DLIA 4YVFA 5TX7A 5BNIA 3FCOA 4NPCA 3KYDB 4N18A 5KJ6A 3B1KA 3PTZA 2BF7A 4TZTA 3WYEA 4BO8A 1Y7TA 3ZHBA 2GUGA 3PFWO 1UP6A 2ZATA 4E30A 3BIOA 1YBVA 1HDRA 1XKQA 3HFGA 1DSSG 3DHEA 1M75A 5ENDA 5BT9A 3TDKA 4XCVA 2IRWA 1GR0A 5K9ZA 3QVWA 2HUNA 4IMPA 3ZCXA 3ZI0A 4DREA 5I7EA 5JW6A 5G0TA 3IP3A 1JKIA 3NKLA 2PKQP 2DFDA 5JLAA 1Z7EA 1ZVMA 3G0OA 3IP1A 4O1MA 3ZWNA 5BSGA 2CNBA 3W8EA 2IE0A 5KVCA 3M2TA 4RV9A 2E48A 4OQYA 4RF2A 3ADPA 1DPGA 1M2WA 3PGXA 3PLRA 3DOJA 4EEXA 4I9HA 1VL6A 4AFNA 4DPLA 1MG5A 2VUTA 3AW9A 5TS3A 4E31A 2X5JO 3I9KA 5EL0A 2HLPA 2J3KA 4K1LA 2C59A 4PLYA 4XQGA 4R16A 1C0IA 1I2CA 3Q2KA 4LISA 1ORRA 5B1YA 1HKUA 4YDRA 1D1TA 1A5ZA 1E1NA 3VZRA 8ADHA 2PD3A 4BMVA 3HN7A 1BGVA 1H94A 4Z0HO 1A9YA 4R9RA 2Q2VA 2ZQYA 3S2FA 3DOCA 1Y8RA 1LDGA 4XA8A 3AWDA 4U6QA 9LDTA 1PS8A 2LDBA 1J49A 2ILTA 4GX1A 2YJZA 4NBTA 1Z73A 3OEYA 1N5DA 2W2KB 4Z0PA 3RSHA 2XXBA 2Q46A 3WGOA 4I08A 4B7UA 1DC4A 4U8GA 2C0CA 5DZSA 4IJWA 6LDHA 4Z6KA 4XWYA 4LCEA 2O3QA 4XJSA 2Q99A 2RBEA 2ZB3A 4XYLA 4GKVA 2E49A 5HS6A 3LC7O 1E0DA 1L7EA 4PLPA 3FBGA 4JLWA 4B4OA 4XGNA 5JCJD 4S1VA 4C7KA 9LDBA 5CDYA 1SB8A 1SEPA 4OH1A 2OXIA 2Z95A 1P44A 1IHXA 3CKYA 4GGPA 1DB3A 4IZIA 4DRYA 2QYTA 5T8KC 1GQYA 3HADA 1H0KA 4UVDA 5TJ9A 1EK6A 1HDOA 4RZHA 3O8QA 1D3AA 1XU7A 5CFZA 3KBOA 2Q2QA 4BVAA 4G2NA 4J1NA 1HRDA 3FF4A 3JYLA 4L73A 3ZNPA 1EVYA 3V8BA 1PQUA 1K6IA 2OFPA 4IIVA 2E37A 4ZU3A 4U7WA 1VKNA 2VHVA 3GUCA 4M87A 4YEDA 1V3VA 1ZMOA 1R0LA 2V6GA 4QECA 4L4RA 1EVIA 4EW6A 4IDEA 5JYEA 1O95A 4QSMA 1YBMA 4OM8A 5A3JA 4G65A 2I67A 4LVCA 4WKGA 3ROMA 1NFRA 1U7HA 4DLBA 3B6ZA 3NGXA 1LEHA 3OJLA 4YJHB 3LC1O 4NU6A 3NDRA 2Y0DA 3CMMA 4XR9A 3GT0A 1KY5A 4BHTA 4B4UA 3C1OA 4DBVO 2V6FA 4D3DA 5JS6A 1S6YA 4TKLA 1D4FA 3ICCA 3INTA 3AFNA 4I8XA 4IJVA 2YHUA 4CL3A 2NADA 5JE8A 2B0JA 1T2EA 1VRWA 3WG9A 4D46A 2I6TA 4UVHA 1AGNA 3GGOA 3O4RA 3IMFA 3E5RA 3GHYA 4DL9A 2HMTA 3GK3A 2WD8A 3DR3A 4NJMB 1H6AA 1X14A 4WOJA 4YJHA 4CM5A 3H5RA 4BNJA 1R4MB 1ZW1A 2CVQA 2GASA 4II3A 1Y9EA 4QFCA 4GAEA 2WE8A 4L9RA 4AJIA 2IYOA 2GYYA 3GVIA 2AE1A 1TT5A 5G4KB 4P8RA 3RCBA 2C7VA 1U5CA 1UUFA 4DQUA 1J5PA 4BNMA 2BI7A 2HMUA 4YJFB 2J5RA 2B4QA 4NBWA 1KVUA 4I5EA 4NJOA 3BMOA 3GGGA 1Z6ZA 3H8VA 1P77A 3F46A 1LLCA 1CIVA 4HFRA 1ZZEA 3F4LA 2PTGA 2O4UX 1BXZA 4R41A 5A02A 3D5TA 1XQ6A 3S8MA 1W8DA 3PJFA 2WYVA 3CZMA 1A4UA 1WMAA 1ENOA 1JQBA 1L7DA 1B0AA 2PD4A 3WIDA 3KB6A 2O3RA 2P91A 3U4DA 4D41A 3NDIA 2AMFA 3C1AA 1PGJA 1GZ6A 3EY4A 3PXXA 4JQCA 2BGKA 4FS3A 5KJCA 3BHJA 3JQAB 1G0NA 3ANLA 3QQPA 5I8WA 3PZBA 4FPXA 2X5OA 1Q1NA 2POQX 4UUMA 4YAEA 1UDAA 4RQTA 4NFYA 3D3WA 1LBEA 4MVJF 1E5LA 5ADHA 5KKCA 3H9EO 2VRCA 3CPSA 4IQGA 3VDQA 3I9OA 3OJFA 3RROA 1YKFA 3DBHB 3LSYA 3FBTA 4XQEA 4ZGWA 3V2HA 2FPGA 3IKVA 3DFZA 2GLXA 4EITA 2DPHA 2Y1FA 5EINA 4NBRA 3WSVA 2QIOA 4AL4A 1Z82A 2H1SA 4FD3A 5TJHA 5K0ZA 2R2GA 1NPDA 3E8XA 2GCGA 4E21A 3IJPA 3WFIA 1DLJA 3EK2A 4M8SA 3ZU4A 3QJ5A 3H6KA 4H7PA 1T24A 1VL8A 1ZK1A 4IJUA 5F3RA 5GY7A 1X1TA 3BA1A 5TQVA 2OMEA 4RDIA 1IHYA 1GV1A 2FR8A 2Y1GA 2ZB8A 4YRDA 1DHRA 1IY8A 2NQTA 2VYVD 4S3MA 3RWBA 4Y6RA 3PYLA 1JLLA 3ONEA 3VKVA 3BMNB 1UZMA 1I2BA 1T25A 3E1KA 3DL2A 1PGQA 3JQBC 4R3WA 2PKQO 1LNQA 3H2SA 5DOVA 3AK4A 4GVXA 4XZ3A 1AXEA 4ZD6A 2AXQA 4BUCA 3PQEA 2P68A 2VT2A 4RVUA 1WXDA 1B3RA 2CF6A 1ZSYA 1VJ0A 1EFLA 1OI7A 2ZB7A 3NAQA 4HXYA 2XF8A 2FRDA 4FDAA 4JJIA 4LW8A 5TRTA 2GN8A 3OECA 5IJZA 4O0LA 4XGIA 4FQ8A 3RUHA 5KVSA 3I1JA 3L4BC 3BTUA 3HB4X 2AQKA 2YY7A 3NT5A 1YL5A 3DAGA 3ZNQA 3H5AA 4E33A 3EHEA 3VVCA 2QHXA 4F46A 5FYDA 3I9LA 3ULKA 1J6UA 3FPLA 2VHWA 2IZ0A 4BL5A 2HU2A 1FJHA 1QYDA 3PWKA 3AY6A 3S55A 4AVYA 4Q3CA 4QEDA 2Y1DA 3GA0A 2P5YA 3DMYA 1VE9A 5H81A 4DMMA 4ZN6A 5KVQA 3VTFA 3MJVA 3IKTA 3O8QB 1GZ3A 1WZIA 5JNLA 3E9QA 3UHAA 4H16A 3OA0A 3TRIA 3DBVO 1GQQA 2O2SA 3GHHA 3L6OO 1ZCJA 3CEAA 3VPHA 1GUZA 1PZFA 1T4BA 4LCJA 3VH4A 1CJCA 3ZWYA 2VHYA 3LK7A 4PLFA 4HNHA 5I9LA 2PA3A 3ZDFA 3EDMA 4U0JA 3WLEA 1QYCA 2B83A 2DLDA 1YOVB 3L07A 4FGWA 3BMNA 3PPIA 3WSWA 3ZZNA 3A4VA 2BRUA 4DBZA 4XIJA 1EUDA 1TT7A 3GN1A 3FI9A 4LGVA 4AJ2A 1BW9B 3AM5A 3DZKA 2V65A 1NAHA 2YHIB 5IN5A 1QG6A 3KLMX 3KSDO 1RYEA 4LMRA 4KDFA 1AN9A 3GEGA 4RF5A 5F21A 2ZTLA 3DAFA 4FFNA 2X0NA 2X0JA 3MJCA 4IDBA 5CEEA 1R0KA 2C82A 4KMSA 1R4NA 1LA2A 2UV8A 4BQPA 1KYQA 2F1KA 4BS9A 1ZEJA 4OIMA 1I10A 2VT3A 4BKQA 4EI2A 3EC7A 4FFOA 1LU9A 2A9FA 1MUUA 3U9LA 2UUPA 1GTMA 3DONA 3TZHA 3TWOA 1H6CA 4E4YA 1LSUA 5JXWA 1QSGA 1YB5A 5I7SA 2DU8A 1WP4A 2DKNA 1M6HA 2OO5A 4U6SA 2GD1O 3KEOA 4FJ1A 2EW2A 4DC0A 1BTOA 2JL1A 1X13A 4PN3A 4IY1A 2EJVA 1S7CA 4PG4A 1R16A 4NNJA 3GVPA 1TA4A 3TOZA 4OL9A 2Q45A 1YRLA 5F5LA 2W2LD 1YXMA 3PYMA 1A7AA 3RC2A 2UUOA 3JQ9C 4MVJM 4AG3A 4JK3A 4YJGB 5COBA 1JN0A 3O03A 2D1YA 2NU7A 2Q3EA 4A27A 1HF3A 4L8VA 3VZPA 4CV2A 1NTOA 5EPOA 2YYYA 1LUAA 2NNLD 2CFCA 4MVJH 1XWFA 4A03A 1W4ZA 4TRJA 3ZV4A 1BW9A 5IAAA 2C07A 1ISHA 3GZ4A 1MP0A 4FGSA 4ZQHA 3VPXA 5DBIA 3ENKA 3QVTA 4HUJA 5GZ3A 3RKUA 4BKPA 4B3IA 1ONNA 2V7PA 1GU7A 4M49A 2HSDA 4B4VA 5L9AA 2YV3A 3G17A 2B36A 4YBZA 5CG2A 4GSLA 3KRTA 4E5YA 2VNSA 1NVTA 3DB2A 1LXCA 1C0LA 1XIVA 2I66A 5KKAA 2CVOA 4ALIA 1PJSA 2OOSA 4EUFA 2R00C 2OGUA 1XGKA 1NP3A 5T8KA 4YB8A 2IYPA 2P2SA 3KEQA 4H3VA 4AJKA 3WGIA 4BNNA 4HFNA 4GSKA 1ZSVA 4CMBA 4YR9A 5JY1A 4CMEC 3DDNA 3P19A 1EMDA 3H4VA 4WNCA 8LDHA 1B15A 3U0BA 1HETA 1ZSNA 4L76A 3PLNA 1R6DA 4AJLA 1RM4A 4N5LA 1PQWA 4DUPA 2J6IA 1F12A 4LRTB 1HDYA 1LRJA 3QWBA 4LSMA 4BGUA 1X1EA 3Q9UA 2O3SA 5ICMA 1R66A 2WJPA 3JSAA 4M1QA 5DOZA 1GYQA 1HWYA 1QKIA 2R00A 1NYTA 1MGOA 4CMKA 1YJQA 2YQ5A 3GZNA 4BO9A 2J5KA 4GX0A 1K3TA 3QP9A 3HE3A 1EDOA 4B7CA 1PU2A 2Q2WA 4FFMA 1EUCA 3K96A 3WWYA 4DYDA 2QZ9A 3Q2IA 5IF3A 1MFZA 4R69A 4CMIB 4CR8A 3F9IA 3LVFO 2X6TA 4UEJA 1IPEA 4MP6A 1C1DA 5B4VA 4UEOA 2PKRA 3JD4A 1DC5A 3UF0A 3JD1A 3O26A 3DEYX 4GMGA 3WBFA 3RU9A 2JHGA 1XR3A 1I3MA 4YRBA 4Z3KA 3PHHA 1O9BA 1PZGA 1R15A 3RJ9A 1SAYA 4R3NA 4BKUA 3OJ0A 5CEFA 4B3JA 4OXYA 1HE2A 4PFJA 2RAFA 3MTGA 3HSKA 4ZQEA 1Y8QA 4MVJA 4EGFA 4EUEA 3OFSA 2QRJA 2CMDA 2Y66A 3H65A 1PJ3A 1E3IA 3TN7A 1QV6A 4IS2A 4YAKA 3ZWAA 2DQ4A 2B35A 1KVQA 5JMPA 3UCFA 4MOWA 4AICA 2NSDA 3GC6A 1F8FA 4PZEA 2F00A 1P9LA 5KJ1A 1BDBA 1WPQA 4ALMA 4A2CA 5COAA 4OXNA 3WGYA 1ADGA 2X5KO 4B3HA 2V6MA 1T1SA 4MJLA 5HM8A 2QRKA 2PGJA 2PGLA 1HYHA 1YL7A 5IDWA 1ZXBA 2YV2A 4NK4A 1N1EA 4W9NA 2UVDA 3PWSA 4O59O 3AOGA 2GDZA 4CMIA 3A28A 1UXHA 5C7LO 1IYZA 1AHIA 1KETA 4WE3A 5A5FA 1O0SA 2QYSA 3PGJA 3UUWA 3ZU3A 4MIEA 5ITWA 4ND4A 1PTJA 1DAOA 4K28A 4F6CA 2G0TA 2IODA 1NFQA 2H6EA 2EV9A 3RI3A 5HWSA 3DZJA 4FW8A 3C7AA 4GI2A 1SB9A 2PV7A 3ENNA 4QX6A 3WMXA 4YAIA 1P0CA 4YTEA 5F1PA 5FWNA 2B4TO 2G82A 4CR6A 1PS9A 5KNLA 2D59A 1TI7A 1V6AA 4HKTA 2X9VA 3WOHA 1F14A 2X9NA 1PL7A 1YB4A 4CV0A 2OBYA 2PY6A 1ZJYA 2P4QA 2D4AA 2O3JA 3LT2A 4E0BA 3KYDA 1QR6A 1PL8A 1V3TA 4CM9D 3AM4A 1AE1A 1ISIA 3WQRA 2VOEA 4Q3AA 4XIYA 3LT0A 4I5FA 5C7IO 1XYGA 4MVJD 4JP2A 5JY6A 3MWDB 1GL3A 3RUFA 4B8ZA 2GNAA 2X4GA 2I5PO 5FEUA 3JYQA 4WCFC 5T6BA 5A4DA 5IXSA 3JQGA 3ZWVA 1I8TA 4CM7A 4RVGA 4UREA 1NHWA 1XU9A 1P33A 4HX5A 3UAGA 1SCUA 4RVFA 1GQ2A 2GO1A 4GPD1 2NTNA 1YQXA 4J91A 4J4TA 3OA2A 1IULA 5CPFA 1U2GA 4TRNA 3OIDA 2VTEA 3TFQA 1V35A 3WTCA 4BOYA 1PJ4A 3GEDA 4QQRA 3GVXA 1K0UA 3I4FA 1O5IA 1GCUA 2HK9A 3Q0EA 5BSFA 1UDBA 4M54A 4UAGA 1ENYA 4CLRB 5AXAA 3T4XA 5DP2A 3TJRA 3SJUA 4PLTA 4E5KA 4BIIA 2IEDA 1K5HA 1W73A 1WW8A 3DC2A 1PSDA 4ND2A 5U9CA 4CLXA 1LDNA 3W8DA 2VRCD 2FP4A 5CDGA 1A4IA 1EBFA 1N2SA 1WNTA 4P4LA 3H3FA 3ROKA 5JC1A 2Y99A 1QORA 1B8VA 4KZPA 4INAA 4XDZA 3HDJA 4Z3DA 4DTIA 1LLDA 3KLPX 3IUPA 4A0SA 1N92A 1VM6A 1WVGA 3GAFA 5JAZA 1DRUA 4XR4A 4Y8VA 3OICA 2FPPA 3ADOA 1YJ8A 1NQAO 4K6FA 1GDHA 4XD2A 3DFUA 4L0QA 4CMHA 2VWQA 1DAPA 3C1TA 1NVGA 3H9JA 4XYGA 2PK3A 3W4IA 4LSWA 3LDHA 3K6JA 4Y6SA 1OC2A 1B8UA 4CLDA 2C7GA 2OP0A 4EJ6A 2Y1OA 1XELA 3BMQB 3P2OA 1YQDA 1KVTA 4M89A 4Q9NA 5BQFA 5JCXA 1Q0LA 3VVBA 4CMJA 1Q0QA 3FTPA 3NX4A 1Y81A 2ZTVA 4WLNA 1UR5A 1P1HA 3M2PA 4UUOA 1UXGA 1ZUD1 5JYDA 2EXXA 2Y67A 4JIGA 3PHJA 5A04A 5L4NA 1OBFO 4JJFA 2BFMA 2P9CA 4C7JA 3JCZA 5ICSA 4PLZA 2C20A 1E1MA 4H15A 4ZRNA 3RFVA 5AXCA 5TIIA 4NZ9A 2DVMA 4IXWA 4IM7A 4R01A 3H7AA 4HWKA 1BXGB 1Y6JA 3PHLA 4L4SA 3GPDG 4DIFA 3ST7A 1NHGA 1YDEA 3GG2A 4QUKA 4I5GA 5EQFA 2E82A 3RJ5A 5JSFA 4ZQFA 3V2UA 3A1NA 1HEUA 4BNWA 1V0JA 3C7DB 4IIUA 1NM5A 3QRWA 1P1JA 5IZCC 1A72A 4PVCA 3H2ZA 4LMPA 4DVJA 2PNFA 3UCEA 2GRAA 3RVDA 3RC1A 5T67A 3ONDA 3ROPA 1IZ0A 3INGA 3OJEA 1O89A 2WWRA 2X7HA 3COSA 5A06A 2HDHA 4IGEA 1E7WA 4YWJA 5L45A 1E6WA 2FZEA 2WM3A 3EAGA 4LN1A 4TZKA 4BO2A 4CR7A 3I83A 3R6DA 4CLOB 2FZWA 5KJEA 3GEMA 3E9NA 3WWZA 4YCAA 3QWAA 1E1KA 1PGPA 3H9QA 1NFFA 2DBRA 3LYLA 4PLHA 3RIHA 5CG1A 1PJQA 4WLUA 4ALLA 3I9JA 4CM8A 4RPGA 1DC3A 3JQCA 3OQ1A 1Q2XA 3HFSA 1NPYA 4ND1A 4J90A 3C85A 4EBFA 1C1XB 1EE9A 5JCJA 3SXPA 1P45A 1I3KA 1RM3A 3S1LA 1G1AA 4DGSA 2HCTA 4OXKA 1LDMA 3AFMA 3GFGA 3ZV5A 5GZ6A 2CUKA 3WGZA 3FWNA 4CQLB 4GKBA 4NBUA 1NWHA 1U28A 3JQ9A 4XQCA 3ZHYA 3I52A 3T7CA 5DCUA 1GADO 1GUFA 4W82A 3W1VA 4MKXA 3BHMA 1IUKA 3GPIA 2EKLA 4CM3A 4ALJA 3I23A 3BTVA 4D43A 4A73A 1PX0A 1B7GO 3DZGA 1U5AA 4N7RA 3ETGA 4RPKA 4KQXA 4MP3A 5ER6A 5K6AC 2FMUA 4CMEA 1AHHA 1KVRA 3IUSA 2PZLA 1E7MA 1OOEA 1Y9AA 1DOHA 1GD1O 3OQ6A 1R4NB 4WCFB 2QQ5A 4CM9A 4DYVA 4KOAA 2AHRA 3E18A 2NM0A 5TSDA 4DXHA 3TZCA 3ZHZA 1HLPA 1NR1A 1Y8QB 3EMKA 4RVSA 4D44A 2FR1A 2YHIA 3RFXA 4BNYA 3ANNA 1ZXLA 5IFLA 2W90A 1QRRA 4WNIA 1E6EA 3S2EA 1E7SA 4Y98A 4JP3A 3INRA 5K6AA 3PHIA 4JBHA 3RUAA 2BLLA 5CHEA 4UEKA 1MC5A 3GVCA 5IDQA 3ZNNA 2DTEA 3E82A 1K6XA 1H9AA 1ZO8A 2JCXA 4JROA 3SLKA 3PEFA 4NK5A 1P1FA 3GZNB 4CPDA 2IXBA 2BI8A 3JTMA 1KC3A 2FSVA 2VUSA 3EW7A 3L0DA 4OJNA 2HK8A 1YB1A 4IS3A 2JFFA 2DFVA 1IL0A 3QW2A 4A5OA 1VSUA 1AXGA 4UVGA 2A35A 5I8ZA 2O3TA 4KDEA 1CRWG 4IPTA 3WFJA 3DQPA 1LRKA 1D7OA 2WD7B 3QLJA 1LC0A 1LJ8A 1PEDA 4IDGA 2UDPA 2O4CA 1XQ1A 2ZIZA 5TNXA 3ROQA 4IQ0A 3WGQA 2OHXA 3V1YA 4MIOA 4J16A 3AJRA 1FDTA 4WOKA 3K2EA 5BR7A 4XRGA 1V9LA 3JQ6A 4NHEA 1UZNA 2W2LA 2J3JA 2D5AA 4BNVA 4IUYA 4E12A 3TZKA 1DEHA 1DO8A 1HDZA 2BFAA 2RHCA 3E9MA 1KEVA 3GR6A 5L95A 5B12A 1SPXA 4BV8A 5DP1A 3BZUA 3AI2A 4NIMA 3ITDA 3D3EA 1PJLA 1DDOA 1KBZA 1M67A 1QLJA 2NU9A 2VNAA 4DWVA 2GPTA 1GYRA 3KSZO 5FI3A 1YBAA 3FD8A 5G0WA 2PLAA 3RBVA 2QW8A 4FSHA 5HRUA 4K9DA 4W9NC 1HYEA 3AY7A 3PIDA 2PFGA 1MG0A
chains in the Genus database with same CATH superfamily
2P69A 1DUIA 1M5UA 1P2TA 3HKCA 4MLDA 3V8MA 2QE7D 3BWMA 3DXZA 2RCYA 1I7PA 3K1TA 4D8YA 4KDCA 4ISBA 2TECE 3LI2A 4MZDA 1EVJA 1RJEA 4UNPA 5AICA 5BW4A 4R98A 1TIKA 1OYVA 2Q4BA 4JBWA 4QWWA 2CY0A 5DULA 2HYDA 1ABFA 2JBWA 5H8WA 3NWJA 1SQ0A 1U1FA 5GIOE 3ZEAA 4RHUA 2XQJA 3LGSA 1RWWA 2AR7A 2PT5A 4JIMA 3I09A 3N53A 3QBEA 1GPLA 2C5GA 4Y0VA 4DQVA 1E4VA 5JECA 1NLMA 1WPGA 2MSWA 2ZB4A 1XD9A 1N6RA 1PNOA 3BH0A 1R3DA 3WNQA 1H3NA 1EWRA 2NSYA 1RMQA 4L5IA 3TZQA 2GHQA 3TLMA 2Q50A 3OJCA 4GPAA 4WNYA 3DOHA 5CM2Z 2X58A 3IAEA 4BV2A 5EESA 1UP4A 5K8JB 4FK8A 4JHLA 2TMGA 4P58A 2V7VA 3DKKA 2CLMB 2OV3A 5MN5A 2VH2A 4JLJA 4MUAA 4AN0A 4UAUA 16PKA 2EFGA 3M0EA 4FSXA 1VKZA 1ILWA 2NN3C 1X1BA 2RC5A 4G23A 1R6VA 1T2AA 1UH5A 1GL9B 2ZVDA 4IJKA 1IIBA 5EMMA 3DVAA 4K81B 4Q47A 4TT3D 3GUHA 4ZO7A 3D3NA 3UK1A 3F6EX 2V7QA 1MAWA 3WS7A 5A62A 1N3IA 2BPOA 2OYRA 4ZZ3A 3VC1A 3MOIA 3BCSA 4MAMA 1Y4ZA 1CS4C 1JR4A 1QG4A 1W9HA 2JDID 3EZGA 1Y3DE 3GW8A 3PC2A 4NOJA 2QTRA 3EULA 2HHHB 1QONA 1QCZA 1CSEE 2FWPA 2R751 2QQGA 3Q1KA 4H7IA 3QUQA 2LBPA 1SKBA 3NEPX 3I0NA 1CR6A 1NF3A 1Z2PX 2D7CA 4P54A 1Q0HA 1ZRHA 3H4TA 2A9QA 2GETA 1FFXA 4CM4B 1MQ9A 4E1AA 4UTPA 3IFSA 4HS4A 1SXJC 4R0VA 3SXUA 4EG0A 1Z8HA 5AVRA 3EIEA 2WIBA 1H93A 2FPSA 3V1TC 2Q5CA 4TTQA 3ZIAA 4BCBA 1NQXA 5HYVA 4CLEA 3VC3A 1DBVO 3CE6A 2O2JA 5JAMA 1JTFA 3T5PA 5K0BA 3NANA 1P74A 1QIGA 3MXTA 3EZLA 4MQEB 2XKAA 4JLBA 1YRQA 3W2EA 4BU1A 1FXUA 1HURA 4BRWA 1U9YA 1F2VA 1GPWB 4G89A 3JAMA 1OZ0A 5KTKA 4G8DA 4YY3B 2YRFA 3MPOA 4OX9B 4O4JF 2CNLA 4DANA 5AXBA 5D6OA 3DDSA 3IAHA 3C3JA 2HI0A 5EXEA 3CPEA 3FXAA 4C7OB 3DBLA 1MLDA 3PDJA 3GUVA 5FBHA 1C7RA 5JXJA 2HU8A 1CVRA 2NO5A 3U5ZB 4D26A 1DRJA 4OVKA 1VSQA 2J9YB 3GB9A 1EX1A 4TRMA 5A7FA 1Z4OA 3IULA 4LKRA 5EP3A 2Q1WA 2W71A 2BRUC 4MIYA 1RM0A 3V8VA 4CQMB 5K8LA 4R1TA 4M46A 4HGZA 3GNSA 3EG9B 1Z2AA 3AQIA 2F3UA 2LIPA 1JAXA 5BWBA 5BQ3A 4EPRA 5KNDD 1RE0A 3ANMA 4HNGA 5DBGA 1Y1QA 4K26A 1VGRA 3Q8WA 5LP6B 4N3CA 1J9ZA 3GARA 4QJ4A 1RAGA 4HUTA 2BCEA 5K03A 3HDHA 3TGWA 1UBLS 2F1IA 3U31A 4XEHA 5C0OE 1Y6RA 4NENB 1A5SB 1T3LA 1W5FA 3D43A 5GOTA 3ZU2A 1CW2B 1UAYA 3A6LA 3MJSA 5FT9A 5THKA 3X0DA 4C0JA 5IVPA 3QXJA 3HI6A 5L4LA 3TW6A 3VU3A 3VZQA 4ZGBA 2EG9A 4KSBA 2C3UA 3OE7D 5BVHA 5FPKA 2O8DB 1P39A 2H11A 1GFZA 2JJYA 3FUVA 1IUPA 2IY8A 2ZJ8A 4X54A 5AJHA 4UXJA 2FEWB 2LCQA 2YWHA 2IEGA 2VHXA 3CE9A 1KFKB 3B20A 1UPUA 5EQTA 5YASA 3TCXB 4DSUA 1ZH8A 3LT5A 4LOIA 3I5XA 1E0AA 3F2VA 1UXIA 3EAFA 1XZBA 3MJHA 1XN4A 4WLVA 4DJJA 2IBSA 1JW9B 3NT2A 5C4IA 3IUEA 2ZTHA 1FFEA 2WLTA 2NVWA 3G9QA 4MUMA 1A9SA 4JJ4A 3LPLA 3U19A 1PJBA 1GT6A 1Q1BA 1W19A 3DVSX 1JI0A 4XDYA 4IVQA 4FN4A 4RW0A 2P2CA 2P5UA 3ITKA 3KZNA 2SBTA 2ZJFA 2JKVA 4I4IA 2JZNA 3JATA 4NABA 4Y67A 4YWHA 3UZUA 4FE4A 1ZK4A 4PXSA 1NXQA 4Q1DA 2GGSA 2XB8A 2XCIA 4LRWA 1U6JA 1OFGA 3PG5A 4JBIA 1A8QA 4ENRA 4QGAA 4QLAA 4J0DA 1J00A 4PZ9A 2PRIA 5AUNB 1TZ2A 5AHWA 3JQAD 4XIFA 1F06A 1KO8A 3UTDA 4EEZA 1AXRA 2F7SA 1AQLA 4R8LA 3MOSA 3KR1A 4G9EA 1YL6A 1PO7A 2QIPA 1KBOA 1W5EA 3LS2A 3DZHA 5BNWA 1YBHA 2RBGA 4B8YA 3LQFA 4AX4A 4CG2A 4P36A 1AZLA 1HZZC 1OV4A 2OORA 4ZO4A 5CT5A 2NVUB 4RL6A 3SJ7A 4WIAA 2P9ZA 4BB5A 4M38A 3U7QA 4BQEA 2XTAA 1GP2A 1FSFA 1WD5A 4MV7A 4UFOA 2FWJA 2GZ2A 1V2GA 5I9NA 2XTNA 1TKRA 4KAAA 5AD1A 3HLTA 3PCRB 4MPRA 3R24A 3ELUA 4KQCA 2VP4A 1JKJB 3E48A 5EWMB 2Q9UA 4YV1A 3ZOKA 3K09A 1XMQB 1CUZA 2OSBA 4HGQA 4L95C 4TMFA 3UA4A 1HE5A 5BPHA 5BVHB 2AQ8A 4BO3A 4W5WA 3VGPA 1AS2A 2I65A 3ZE8A 2UVPA 1ILEA 1H5NA 1GKLA 5ANRB 3ICEA 2LIVA 1KAMA 1ULBA 5A0VA 3N6VA 2H2IA 1HI9A 3UW3A 4EARA 4JSTA 2R87A 4ITUA 5CLFA 4K6KA 3JALB 3ZHCA 3OO0A 2WG1A 2DUMA 2FG6C 3UICA 4NULA 5AH0A 5K2MA 3TD9A 2XX3A 1A7UA 1VJTA 3D8BA 1C81A 3BGWA 3UT5B 3P0RA 1E99A 5AR1A 3LP6A 1WXFA 4RPLA 4I0WB 1PNVA 4YIHA 2AOXA 2YDXA 2D2VA 3HHPA 3H97A 4WMLA 1JV2B 3GPLA 4O63O 3UV3A 5TVGA 1SBQA 1S2GA 4FHCA 3AEUB 3PITA 1B73A 4XWTA 5K8VA 1OH8A 3WWOA 4U7HA 2YINC 1S3SA 3BQMB 3RIMA 2V5UA 2W4QA 3RQIA 5BWCA 1FJ2A 1ZVKA 4FYMA 5TMDA 1T0PA 3NJ8A 2ZETA 5JXHA 1V7PC 2I71A 3OC0A 4QYSA 4ABYA 1KP2A 4GRDA 3AI7A 1Y63A 1G291 1IE3A 1UBCA 4MMXB 3HG7A 3SS8A 1UL1X 1Z5VA 5CVUA 5BRNA 2Z6UA 5HZHA 3ZVLA 2XI4A 2W83A 1OE0A 1WZCA 2XMCA 3CNEA 1P2GA 5CRIA 1Y8ZA 4MJ7A 1F48A 4JODA 5EXTA 1RC1A 1ZIYA 3CZQA 3IEIA 1X7WB 1BIFA 4D9IA 4KXWA 4BMOB 4MTLA 5J2TF 3P8ZA 5KIAA 3AKZA 1IVSA 3ONNA 2Q2NA 2IZ6A 2O3UA 2QYHA 1SC3A 3EC2A 3TX2A 5J40A 4YCSA 5HRAA 1NV8A 3RAEC 3QVJA 4ARCA 3Q7IA 1J0BA 4BGIA 1WZEA 1J8VA 1JWBB 1R0XA 4LVUA 1RKQA 3SDSA 4P98A 3KYIB 4ETNA 3LHKA 4LNHA 3OG9A 4UBNA 1NRWA 2JARA 3CY6A 5EHGA 3YASA 4H60A 1E9BA 4ACAA 2J0QA 4D2IA 1J21A 2O50A 4MPJA 3SVZA 4OHKA 1G20B 3WIEA 4HL6A 4JLUA 2Q1UA 4ZKEA 4CM4A 3WLFA 1B1CA 2NQ8A 3OM9A 3QPDA 4PIMA 2P6NA 3QVSA 1K06A 1ZX1A 1JEYB 3GLHA 4DCGA 4BWGA 2VQSA 2QMUA 4EY6A 2CSUA 4KDRA 3QMVA 3TW8A 1WA5A 3MCWA 2PGNA 1EP9A 4HDNB 1VL1A 3G1TA 2OZEA 1NBAA 1VHJA 3HZZA 3NC4A 4KN8A 1F1JA 2ZANA 3KR9A 5COQA 1QGUA 4R0NA 3QELB 1RZ3A 1E2EA 2FSVC 4NV0A 1INLA 3S2YA 4DV2B 2OG1A 2W6CX 4PG6A 1XZPA 1EGQA 4Q3BA 3D0KA 5EHQA 3T3OA 4Y9DA 4X85A 3B70A 3KUXA 4ALKA 4EHKA 1ZA1A 1RBYA 3D81A 1TGYA 4ZVSA 2OO5C 3MJTA 5EE9A 3LKZA 4R6XA 4Z0TA 3UXEA 5HKBA 2VXBA 2PWZA 1XMJA 3CX8A 4BVHA 1DJQA 2DPGA 3L2OB 2WYHA 4KFUA 5EVJA 5LCXA 3TR5A 1II9A 1CHNA 3GVHA 2GEBA 4UOEA 3EGXB 1QH8B 3LOUA 4BP8A 4A1OA 5IULC 2OMKA 4TM7A 2R6FA 5C52B 3SHOA 4BGDA 4LJYA 1NONA 2FU5C 3H2YA 1ZL0A 2F43B 1G21A 1ADBA 2WF8A 3HN6A 1ZK3A 1FSGA 1XWWA 3CUSA 3CZRA 3E7XA 2PHZA 1H0RA 2PLFA 2Y6VA 2XRYA 3NOVA 4PICA 5AOAA 3UFXA 3M6XA 3W7BA 4E13A 5ULLA 3BHIA 3M7IA 1C3VA 4XX0A 1B16A 4QXMA 4XWAA 3ZK9A 4KQFA 4X0EA 1T4DA 1QOZA 1SHZA 3IQZA 2HV8A 3I01M 1VDZA 4MAAA 2PR2A 2FMFA 5A7HA 1ULTA 3IE1A 2OZLA 3GDWA 4FLEA 3WB1A 4ND8B 1JL3A 3U3DA 1PT6A 3DE3X 1J8YF 4CYMA 2YWGA 3GGDA 5KX5F 3UNXA 1N9ZA 3ES9A 3FLMA 2YNMA 4G4SO 3W4KA 1JEJA 2HFJA 3EDOA 4F2GA 2CNDA 4YO8A 3OOYA 2XMRA 7GPBA 4Z1MA 4IH9A 1KO5A 1KJYA 2QTWB 2WIJA 4J2OA 4Q1CA 1U0EA 2Y3IA 2IDMA 4AZTA 5M29A 2Y4OA 4UKDA 1Y4DE 3LF2A 2C3OA 4KL8S 1E3MA 3LRXA 2QS9A 2X9GA 1MTZA 2NU6B 3VPFA 3ZXUB 4Q3OA 3TZ6A 4OHZA 1P5HA 3MB8A 4MKHA 2HRZA 2QG4A 3OU7A 4CE6A 3VH2A 1UBGA 2AC7A 3IMKA 1H2ZA 4HB4A 2WUVA 3R3SA 3UUGA 4DJEC 3FOAA 4BC0A 4MUJA 2XKKA 1T2NA 1TM5E 4LQCA 4F3TA 1LX6A 1MX1A 1Y4UA 2W7TA 1XMXA 1UWKA 5B37A 4LDNA 4A2PA 3I4LA 1EFKA 1I6KA 3PU6A 3E8SA 3R09A 3BICA 3KOMA 4G81A 5DN6D 3CW2A 2AE2A 2G1JA 3KJNA 4MRSA 4EFDA 4QPZA 4ENVA 3R9KA 2BLNA 1J2JA 2A0KA 2JD2A 3L7OA 4KUEA 3W4JA 4YMHA 4L72A 5K3FB 2JBHA 1GSHA 4YRCA 3ZXXA 1CJUC 3W5VA 4WCFA 3QU7A 4DIOA 1NBMD 4TQAA 1EUYA 4JA0A 2BISA 2E4XA 1C3EA 2VEDA 4RPJA 5HA5A 4ZJUA 5FBWB 1IBKB 3VJRA 2Q6LA 1L4NA 2FPIA 4UTZA 3SF8A 1UJ4A 2ZCJA 4B3TB 1NF9A 1DADA 3AHCA 3VNUA 2ODQA 3EQZA 2VLIA 1EFHA 5DTMA 1O87A 4OLFA 1N5RA 4ER3A 1D04A 2O5CA 1PP4A 3NTOA 3OFND 1OH5A 4HFMA 3A9UA 1KMNA 3FAKA 5IAEA 2REQA 3RYHA 3X1DA 1TMKA 2JLBA 4JKYA 3OJOA 3UB2A 3AB3A 1LVHA 3PFIA 2VO1A 5MF6A 4QGBA 1C0PA 5JZVA 4KJXA 3EFHA 4QDZA 4CQLA 5TT1A 3UTCA 1A82A 2OM6A 3ZCUA 5KSPA 1KMQA 1AQ6A 3C8MA 3KR2A 4R51A 2V5AA 1YQUA 3IDSA 1IZYA 3OBBA 1E2UA 2HMAA 3KJGA 3UJPA 4TLDA 1D2EA 3ETEA 3WLIA 4KWHA 1NVEA 1SNYA 1CERA 1A27A 3G0IA 2SCUA 4KGZA 1NW7A 1CZKA 4UCFA 5EP4A 2HMWA 2P1ZA 4N49A 1XRJA 2C88A 3I53A 2HJGA 3VX3A 3PB3A 4D0GA 1E1LA 4G2TA 5C1BA 3LG2A 2GSWA 4CM8B 1EX7A 5A5EA 1FDSA 1YD7A 4OHXA 4M1OA 3ZUGA 3AIMA 1GZUA 5HVNA 1T10A 3RG2A 2PGAA 3GLUA 4CU2A 1WMDA 1B0PA 4MXDA 4W8HA 2NO7A 4L2IA 4NV1A 3JY6A 2ZRIA 2J31A 4C43A 1PVOA 1O6GA 2P3OA 2B5WA 2RDMA 3L05A 5BSTA 4YV7A 3ABIA 3CEJA 1E1QA 3RTAA 3W6UA 1EM6A 2GA9A 1DWOA 4WCVA 4BNFA 4L74A 1FDUA 4YYZA 4ZICA 5KPJA 2XSZD 1K63A 3Q3IA 2ZWIA 1NF2A 3R44A 4UHKA 2DFTA 5BNFA 4ARVA 2P2YA 1T5OA 3U6KA 2V9CA 3EUAA 1HO3A 5EJIA 4CDGA 3F6RA 4BASA 1YOVA 2HMVA 1YQTA 3FN4A 4HDSB 1SOUA 2CWWA 3FPJA 3SF0A 4IDAA 6ADHA 3LK6A 3CKKA 1V4VA 3OPYB 2QVGA 1E1QD 4BMCA 2BGWA 1W96A 4BB9A 4G5GA 2JG3A 2WFLB 4Q34A 4EUKA 1TFUA 4A15A 3G0DA 1SHLA 4IEIA 1PT9A 5EEGA 1X7HA 3GRVA 1SGWA 1NDHA 2HMSA 3RUEA 5KO2A 4F45A 3AINA 3AI1A 1NVMB 3FWPA 1E18A 2EKPA 4CLHA 4A8TA 3UAXA 2J6BA 3TKAA 2A5FA 2PWBA 4Z3OA 4YRRA 5AUPB 1ZH2A 3AY3A 4GX2A 1M73E 3Q1LA 2GDJA 1XVAA 1KJJA 4UHFA 1N5LA 1PJTA 4C4RA 4EQZA 5SV2A 3OHSX 2D2IA 3WRYC 4ZQGA 1OPRA 1GILA 4XUDA 4F60A 1N6HA 3ETCA 1KMHA 1WXHA 1REQB 4YRTA 5LB2A 1Z6YA 4ZI7A 1N57A 1VBNA 1R0SA 1UXJA 1XCGB 5CU7A 3LU1A 1RQLA 4K46A 5DISB 4Q3EA 5F5NA 1KFJB 1GAQA 4BUZA 1JIJA 4DMCA 2X0RA 1CY0A 2G28A 3BMXA 2Q27A 4CN8A 3K6SB 2DPXA 1OA0A 5JBIA 1KA9H 2I2AA 3PHBE 2G63A 4MARA 3PUHA 5JAIA 3AVUA 1PAUA 5F3DA 3IIEA 1JKXA 2NVBA 2AUMA 2JPDA 3L6BA 4V39A 3DHYA 3OU2A 3D2AA 2EFCB 4M7WA 2QG6A 1M1ZA 4WNAA 2CLKB 4JUCA 1G8YA 1OBOA 1THMA 1BGXT 2XITA 1SWVA 3P9NA 4ZT4A 1O57A 2E55A 3LPAA 2ZJ0A 1VYHA 2P77A 1NN1A 3EXIB 2NP6A 5I7HA 3JQBA 3TFOA 1D2HA 3M1AA 2HGZA 4F9TA 1BMFD 1UC5B 4HBGA 5TPZD 4KVFA 3V97A 3QOFA 4MPTA 2QV0A 4DV0B 3K7EA 3ZCTA 2J9FB 2ODTX 1LS1A 3AF6A 4M55A 4RIIA 2Y92A 4X24A 4JX8A 4C88A 2BYTA 1D0SA 3AR7A 2WUGA 2OQVA 3PNVA 5AKJA 2DCMA 1NL3A 1RYZA 3DMDA 3UEOA 2HV9A 4E4TA 4R2JA 4UTRA 2W6NA 2X4LA 2VHCA 3EMBA 4I9UA 1NUTA 4WDRA 2P4UA 2NTJA 4V38A 5HF5A 2H31A 4X6XA 4ETIA 3E9YA 2XGGA 1BS9A 2JAUA 2BR4A 3HSYA 1RPZA 5KWEA 1ZMRA 2EJBA 4QTUB 3RU2A 1DBSA 3P26A 1PS0A 2G4VA 5FTKA 1XN1A 3PXAA 2CLOB 2GN2A 1CB7A 2RK6A 3IC5A 5FPSA 2F8SA 3E7PA 3KUDA 4E7OA 1NVXQ 5EIXA 3COVA 3K1AB 2ECQA 2NG1A 3I34X 4ZODA 2GXAA 1EQ2A 1FF9A 3A6DA 4URZR 1FBTA 1B41A 1RXUA 4HSGA 5ED4A 1EBUA 1VI2A 1LBIA 3H11A 4KLRA 4CG3A 4V0LA 2NVUA 2VDJA 1MPXA 1FBNA 1G5QA 3LPDA 2XHZA 2A86A 4DC1A 3ADCA 4YACA 3TE6A 1D2AA 2ACEA 4G4SP 4NJMA 4HSEA 2QUBA 5DNDA 4FFLA 4G5SA 1O94A 4TS4A 5AIBA 2IL1A 1YO6A 1Z07A 1MX3A 5KEIA 1YMUA 4HAOA 3FPBA 1EK5A 5FJIA 1L5KA 3VU8A 2WWGA 4HEA1 2R8ZA 4K6GA 4QEZA 4RY2A 4M0UA 4JL8A 1TVEA 1EGAA 2ZIXB 2C29D 2D00A 2PWPA 4XFJA 4XLTA 5HF9A 4PNPA 4IRMA 3KFVA 1ESMA 2GKSA 4NVRA 4Z4QA 1YZNA 2GCIA 4D6YA 1O0BA 3HJUA 4HAWA 3IT0A 1BXKA 4NAUA 4ID9A 1P0PA 4J94A 4N5MA 3OCWA 1Z5PA 1I0IA 1A50B 1G18A 3VUEA 5CLGA 5TVKA 1CIJA 1QV7A 1RHKA 5CYFA 1U0NA 3KDPA 1RMYA 2OXFA 2C5LA 4OQEA 4UJ3A 2HU5A 2XT9A 2YWBA 2V54A 4EJ2A 4LHXA 4CWAA 1NBME 1JUDA 5EJ7A 4Q03A 3OT1B 3RC3A 2ZYGA 1TUBA 5HBGA 2XQFA 3RH0A 3RV4A 3ZDZB 1L7OA 3ISTA 3ZIDA 3ZN2A 1ZGHA 3D8UA 3C48A 4J3FA 3IDOA 4GC5A 1AKNA 3J7AC 5U4QA 3KXDA 4QT0A 4WEOA 4L51A 5TF4A 1Q74A 2ECKA 4Q7QA 5DHQA 3TF5A 3TGLA 3RBXA 3D6JA 2W6JD 5TARA 7YASA 3L8ZA 5JWRA 4HEQA 2ZCUA 2CV2A 1NU8A 1SXHA 3CLUC 1T13A 2E4AA 1JIQA 2CB9A 1A96A 2C4TA 2DTDA 3FDIA 2WAXA 2IOYA 4N01A 5TGDA 3VHRA 2H57A 1CBUA 3ICQB 1TEVA 2VF7A 5FPPA 3FGZA 4YRLA 1B8PA 1E61A 5CFQA 3CFYA 1DAHA 1BMDA 1KH3A 3L1KA 1R0BA 1VG9B 2X9QA 4GKAA 4DMKA 4EZEA 4ZYUA 2GVZC 4M0DA 4PTLA 2XD4A 1C4OA 1SELA 2O57A 5SY9A 3O1HB 1MQSA 3RAPR 1PBTA 4BNTA 1DINA 4IUBS 5DNYB 4MDYA 1KVSA 4ZJPA 4QYXA 5H83A 3HB5X 4JYBA 1C7IA 3G49A 5IT0A 1OVMA 2D74A 3FVQA 2VF8A 3C3MA 5FP0A 3FMOB 4C21A 1NOKA 3K0SA 1UOPA 2GEDA 3LBNA 4EY3A 1O6BA 4HNVA 1Y33E 3AB8A 4BN0A 1FK8A 4PVDA 2PXCA 3T3MB 4XVHA 1JHDA 3DPSA 2YY6A 1FZQA 1W9MA 2JD1A 4LRSB 2PUFA 1KAEA 2WD7A 3ER6A 1IY1A 3AUSA 4KNYA 2QTZA 3T52A 1AJEA 1PEKE 4XJVA 4FFWA 4F7DA 1V8BA 1JR2A 2VZ9A 5KYNA 2IP4A 2GF2A 4LVNA 3KIPA 3TL6A 5BN3A 1A9ZA 2RHDA 4NYJQ 1U9IC 4GG1A 1ZBDA 3D6UA 4EHBA 2YTZA 3TK1A 1ZN7A 3EXEA 4YRZA 5A2GA 1N6KA 4G41A 3EPKA 1KI4A 2XVMA 4PYIA 1ID1A 1ADCA 2I3AA 4RA6B 1OI4A 4W99A 1SCJA 2VOJA 4QFBA 3L1IA 1SKYB 1W1UA 4G09A 4AT1A 1OXSC 3IJRA 3N2IA 5A9SA 2HHLA 1U0JA 4MGIR 2G3YA 3EVEA 4LE2A 4PC6A 3T7TA 3KLOA 5ER9A 1XKLA 4YAOA 5KQLA 4C7OA 1KEPA 2FSHA 3AUUA 3O8OA 3JYPA 1KY3A 1HE3A 1KI1A 2QX9A 4I4TF 5LMCA 2R11A 3OMLA 1NNI1 3R77A 2XOXA 4JYCA 4RKWA 1CUAA 4ICIA 5IKEA 2GD0A 2G7MC 3EOZA 4XTRA 3HKDB 2ONJA 1E3QA 3IHKA 2I99A 3AR9A 4G97A 1O54A 1HTBA 3W90A 4RTRA 3VXKA 1VLMA 2GXSA 3HQ4O 3HBMA 1PR3A 4LQDA 2VPYA 1J25A 1P4SA 1KEEB 2FQQA 2VSFA 4H2DA 2BM8A 2X1MA 4GBED 3DHVA 3CUUA 3HKEA 3URMA 4RVNA 2EF1A 4BNHA 1ECBA 1ZNZA 4US1R 4ZHSA 3KQYA 5CCXA 3JASB 3O8LA 2D62A 3WGTA 4CUZA 5FLYA 1GGFA 4MRMA 2Z2IA 1CXZA 1M74A 1X15A 4GL4A 4XVRA 5FWAA 3A9SA 5JSZB 3PHCA 2JLVA 1F5NA 1S2MA 2MYPA 1C2YA 1VCHA 2RGDA 2RMKA 3DHWC 2NYAA 3IOMA 2WAYA 3Q9LA 3OEHD 4FOOA 5EWLA 4JCOA 1ESNA 3F74A 4DKXA 1YOBA 4OAQA 3BTSA 1U2TA 5DLEA 2AFRA 4YA6A 5AM5A 1Z45A 3RARA 4S1WA 1NQTA 3P5BA 3U16A 3ZGYA 4E3WA 2NU6A 2QRNA 4MCJA 1RJ9B 4E2ZA 4Z9FA 4X60A 2M32A 4LDPA 2GJSA 1J7KA 2PX2A 2ZIUB 2XLBA 2ZTUA 3IS3A 4HH1A 2IITA 4D0LB 1XTBA 4BO5A 2JIMA 4GX5A 4YP7A 3DCNA 4DQKA 3BBPA 3QGMA 1E79D 2Y05A 2H59A 4MB2A 2G6TA 2XQVA 2JHFA 2HF2A 4WPGA 4XRRA 4ZAGA 1UFQA 1EDZA 1VLZA 1RS0A 4EYGA 2NMVA 4FNGA 3C7CB 3NLLA 4MYTA 3PBKA 1TKCA 4PNZA 1LPSA 2BFFB 3UIEA 1U1CA 5CEJA 2WYWA 3LBFA 3UMJA 1MT0A 1KDVA 4OFWA 3RT7A 3T5BA 3VH1A 3W1WA 1UP7A 2HWXA 4F6LA 3MEQA 3LP8A 3AVXA 5DCWA 1EHCA 1NT2A 3LT1A 1ODCA 1H65A 3DOOA 2JLRA 2O0LA 3AVPA 3TVYA 4EYQA 4G1BA 3NM6B 3VO2A 3VPBA 1XNJA 5BV2P 4HWPA 3GFBA 3NTRA 4MITA 4R7TA 1HL3A 2PUTA 4BFLA 4CMCA 2Z0MA 3NRCA 3JZMA 1TQ6A 1QQTA 1W94A 2P5SA 3AXSA 3WL6A 4I55A 1HT0A 2PJDA 1U80A 3HUFA 4R5MA 4R7GA 4F96A 1A1VA 1CF2O 2WTBA 4JOQA 1MGPA 2OKGA 3FTCA 1HDCA 2PSEA 3QQ5A 1XRNA 2NTVA 3WMWA 5C18A 4FZRA 4P0TA 3DZCA 2C00A 4AIRA 2CDAA 5ARBA 5HNKA 2QN9A 3EWIA 2YJ3A 1RZUA 2RH8A 4UXIA 1YS1X 2ODWA 4REOA 1WDMA 5E1DA 1PKXA 2QL7A 2FZKA 4PZAA 2UXBB 1PQPA 4XOIA 1L0BA 1PT5A 1YVPA 1DFHA 2ZJ2A 3NHYA 4LI3X 5BYBA 5EI5A 1WOMA 2PN1A 2YZ7A 2ZE6A 1WHSB 4EJSA 1Q7TA 3DBIA 1EEHA 2OV2A 4G07A 3NJ4A 2UZ1A 1DZ3A 4MR9B 4NBNA 4QOGA 5ALWA 3RLFA 4HV4A 4F4UA 1ZVVA 2IUFA 4A10A 3VOTA 3VO8A 1XCBA 4LK3A 1DJOA 4W1RA 3U3OA 5AK5A 3ZWMA 3FYUB 2O48X 2EL7A 3H0KA 4BPBA 1CVIA 5J23A 4EJ0A 1E79A 4AZ3A 2IZ7A 3RRZA 4DV7B 3WNCA 1G9SA 3LDAA 5FOTA 2ZZNA 1Z0FA 3SEAA 3TI7A 2XYGA 1U63A 2FKAA 2WE7A 2ZUWA 2R5NA 4IILA 3BCHA 2RB5A 4JJKA 1SQGA 5TXGA 2Q1TA 4MQ4A 4UQPA 1P9RA 2Z5VA 2QD2A 1C1YA 3C14C 4KBGA 3ITNA 1K8QA 3F67A 3DMTA 2INGX 3K0AA 3NUQA 1F5SA 3AT1A 3GJ4A 1Y8RB 2H51A 1N5KA 3GT3A 1YDWA 2GILA 1VXOA 3A14A 1J97A 3RSLA 3QWIA 3KHUA 1U9JA 2VNJA 3Q3HA 2Q3MA 3SQWA 4GDFA 4HNTA 3R5TA 4YMUA 2VP3A 3OY2A 1FDOA 2LNDA 2WF5A 4UHBA 3A0RB 3LHDA 1L7XA 3OOSA 1JU9A 3CO0S 3GRPA 3DCYA 3NDPA 1E9AA 4KK4A 4MPDA 1KRWA 1M66A 1T9DA 3A7DA 3ASVA 5DI9A 2R1TA 2YXDA 2A0WA 3GFTA 3B7WA 4B3XA 5AJYA 3QE2A 1QIKA 2JGIA 4FHZA 3HRKA 5AKHA 2F59A 1NWCA 1V9SA 1YVEI 2PBLA 2JCVA 4KYTA 1OROA 2JAXA 1T6NA 3IIKA 3QK7A 4PM4A 1I5RA 2ZYAA 3CPHA 5DDIP 5C8XA 3DMTC 3AUJB 3CKMA 5IJ0A 3KCQA 2AT1A 1PX2A 4GQAA 3FF1A 4OUDB 1RKVA 4RFLA 1I2ZA 3WJ2A 1AH2A 4PONA 1YR8A 3G9UA 4PXAA 3I2FA 4FCCA 1RE1A 5T5QA 1SUPA 4IYJA 5EQDA 4H18A 1CIPA 1WUIS 5EIAA 4DEYA 1MFPA 1J2RA 2G1UA 4L22A 3SYTA 4YJ3A 2XODA 2GERA 4X91A 3T1OA 1SXGA 2D0IA 4C5CA 3WRWA 2GCNA 3QIVA 4GXNA 4O2AB 3TRKA 3FDJA 1WLYA 2XKJE 5HM6A 2YJTD 1LCIA 4KQJA 1RAEA 2OGSA 2C2KA 3ESAA 2ZE7A 2DTXA 3NAMA 4KWCA 4P33A 4RF4A 1W5BA 5FTJA 5K8UA 1I0ZA 1U8FO 4CL8A 4KR3A 1B3BA 4HZUA 4FGZA 4Q3KA 3D02A 2IS4A 5DIZA 3FCCA 1S89A 3PUVA 4KO8A 2PT6A 1UJBA 3PDWA 1M1NB 4M1EA 4AJ1A 4Y2QA 4WECA 5C35A 2F2TA 1MXHA 3SC2A 1NVDA 2FF7A 4OKIA 1KEWA 1QJ4A 4NAVA 4B44A 4IW3B 4WZAE 4DAOA 3N0TA 4YROA 1XG5A 2DM6A 5FNZA 4JBGA 2VWHA 3TSCA 1O94C 4E22A 1K8ZB 3K70D 2BJHA 2H4YA 2QUKA 2QWXA 2BUAA 1HTTA 3SYRA 1YA6A 3PUZA 3E3LA 4HHEA 3W2TA 1E77A 2DQKA 2E4YA 1RHMA 3KYBA 3NMUF 3HCNA 1DDIA 2I2WA 3P0FA 3DAPA 5UKDA 4CIXA 5KNDA 1NXVA 1XOIA 2GBFA 1KHTA 3QV1A 4BWVA 4CKBA 4U5QA 5A6SA 2VJQA 4IUCS 4Z53A 1KZ6A 5CFMA 4ABTA 1ODFA 4IDNA 4DCNA 1DCMA 1LQTA 4G4JA 4JOBA 4OREX 3GGPA 3I01A 4CIDA 3EW9A 3DQQA 2A9OA 5GMOA 2VA8A 4F8EA 1L4EA 3H8WA 4P34A 4O5OA 4IGFA 3TPCA 3GDOA 1LLUA 4LJSA 721PA 3AETA 1E3EA 4YJDA 1U0GA 3I9V1 2D8AA 2HBRA 2YX1A 3HJGA 2KYRA 4L08A 2ZYVX 2XF2A 4D42A 4I55B 4CLRA 1IY0A 2BCGY 2Z8YM 3DDUA 2GPYA 4BYGA 2EKQA 3ZWWA 3DZFA 3TTSA 1Z5OA 2H3HA 2WNSA 4TMTA 4Q82A 2A4KA 3JQEA 2NUAB 3WYBA 1XXHE 4B35A 4YVFA 4FMDF 5TX7A 4I6EA 4EH1A 1K97A 3E9EA 3SFVA 4DV3B 3BB4A 3EGVA 1NJFA 1Y3AA 2R65A 1Q0PA 1Y7TA 3M9WA 4M9ZA 3PFWO 2HQRA 3GRRA 2ZATA 1NW5A 4A2WA 1AQYA 5D87A 1MA3A 2BFFA 1TQHA 1W87A 2MSDB 5HDBB 1DSSG 1MQAA 5ENDA 1RT9A 2B1QA 2PX6A 4L8FA 3OEEA 1KE1A 4QDUA 1XP5A 5K9ZA 4Y2JA 3SK0A 5I7EA 4YCDA 3ZY5A 3QYPA 5G0TA 1GIAA 2M6SA 1R5NA 1USIA 5DSZA 4CCYA 3G0OA 3E2PA 4X7MA 4RK0A 4AMYA 1EK0A 2DPYA 4O1MA 2CNBA 3G23A 3W8EA 4RLQA 1TGVA 2WJIA 1P2DA 3REQA 4BX2A 3K94A 3ZYZA 3CLSC 2V7QD 1WP9A 5DB4A 1RYNA 1YT5A 5FPHA 1NMZA 4EEXA 3ADPA 3PGXA 3UC9A 4IZOA 3N2YA 3T5GA 2EZ8A 4EELA 1GO2A 3DDHA 3H5VA 5BN3B 1ZGBA 3AW9A 3HU2A 1P62B 2X5JO 4URWR 1DKMA 1EG2A 2IC5A 1KR2A 4K1LA 1QH1B 4D6PA 4RTPA 4R16A 1PD1A 4HJXA 1ORRA 1GAXA 1HKUA 2HOQA 4YI3A 3PTLA 1A5ZA 1JTEA 2GZDA 3SY8A 1M9NA 3D3JA 4BMVA 4HNRA 4BZWA 4KI7A 2VHEA 1H5UA 1A9YA 4J7AA 1UPFA 1P80A 4Y0NA 2NYRA 3D7NA 1M6EX 4E5UA 5KWSA 3K70B 4P4SB 1J90A 3LMKA 3O8DA 4MA5A 2GAOA 4XA8A 2FP4B 2OXCA 3AWDA 3ZGNA 2DHEA 1J49A 5H7XA 2YJZA 5BV7A 1Z73A 3MK31 2PUDA 4ESEA 9MHTA 3RSHA 4C3UA 2V7GA 1ZY2A 3K05A 2YJ6A 4U8GA 3M3DA 5I4IA 1TIPA 4RAQA 4NCHA 3T95A 4O1HA 3DE2X 4IJWA 1IU9A 5CNMA 1IJBA 1D2CA 3OZVA 1E9RA 4KRXA 4LCEA 5AKEA 3N07A 1TM1E 4RMGA 1KK2A 2WJVA 3FJ1A 3UK7A 3D59A 4LMBA 3L1UA 4BDSA 4PCUA 1RWVA 4GKVA 4GO1A 1Q95A 4BBPA 1FNNA 1M1UA 3PNLA 2HJ9A 1K98A 2VJMB 3B60A 2VIIA 3ETNA 4IWNA 4JP1A 5LQUA 3F5DA 3ABRB 3I2IA 4XGNA 5JCJD 2QDKA 4C7KA 9LDBA 3H4IA 3HWWA 4ZAZA 1I9CA 2WYOA 2DETA 3DNPA 3K2IA 3QBJA 3GL9A 2PUAA 1U2RA 5FOVA 4PPQA 1U28C 1N6PA 1G21E 1IHXA 3NC0C 3K2QA 1DB3A 4GGPA 4RHTA 3ESCA 2NXNA 1GQYA 3I5YA 3NBKA 3HADA 4M7PA 3C7KA 1H0KA 4UVDA 4ER6A 2HA4A 2GHRA 4X5OA 3KOYA 4D9KA 3AESA 3IQGX 4MYCA 2XMSA 1NA5A 3VYTB 4DWOA 2PX8A 3KBOA 3L0YA 2CKDA 1UODA 4WOCA 4G2NA 4EHNA 1T9KA 4J1NA 2E89A 1AKUA 1GXSB 3RW9A 3OSZA 5BMVF 4R1PA 4ZVMA 3WFJA 5E4YA 4Q02A 1ECGA 1EJ2A 4ZU3A 1AK9A 3R20A 5CK4A 3ROEA 1NSYA 1PWYE 3GUCA 4TYWA 1V3VA 2D5BA 2V6GA 2WV7A 1Q0ZA 3DV0A 5E3JA 4D96A 3OPNA 1A4RA 2ZEJA 5JYEA 4MROA 1VA5A 4Q05A 4QSMA 4UATA 2ID9A 5DCLA 1JE0A 2Q6VA 4PO1A 3L6CA 4BLSA 3LVBA 3L8HA 4WBSA 3QU2A 9ATCA 3HVRA 1G3UA 1P5JA 3KQKA 1MB2A 2I67A 4LVCA 4PZPA 4EX7A 1CTQA 5K6TA 1KQ3A 1LEHA 4R83A 4YJHB 4ZK6A 3IPYA 3NDRA 2Y0DA 4NU6A 2AZDA 3CMMA 3OESA 1KY5A 4WDQA 2VVTA 4YLEA 1LB1B 2JJ1D 2JC3A 2Z3WA 2ZS7A 2V6FA 5F7ZA 3UAVA 3RRBA 4D3DA 4ZGGA 1UWLA 3ICCA 1QK3A 2VS1A 2E18A 3DH0A 3DLCA 2H7XA 2H5JA 2YHUA 4FW9A 4IDHA 3S99A 5JE8A 1QVVA 4S1OA 2B0JA 2Q0XA 2GM5A 5LYJF 3HRHA 1L7MA 2I0FA 2I6TA 3UJ8A 3IOEA 3PCXA 4RH0A 4V0ME 5DYNA 1AGNA 4GPEA 3GGOA 3IBFA 3W3AA 3RJTA 5B64A 5CYPA 1A97A 4NJMB 1H6AA 3P2IA 5BRAA 4TL8A 5BSWA 2O8FB 2C9YA 3CF4A 4WOJA 4CM5A 2GFHA 3IKLA 4O2AF 4EHHA 4OATA 2G07A 1Y9EA 4WX2B 1XZQA 4O4JA 4QFCA 4B71A 3K1YA 3NXSA 4D9CA 4L9RA 5JNTA 4DWWA 3I30X 2IYOA 4OHRA 2AYYA 2X8AA 2GCOA 1YMQA 1MO2A 3NEJA 3B5EA 1KYIA 4MKGA 5DEIA 2JLXA 1X7YB 4P8RA 1QIJA 2XSZA 1ACMA 3E5NA 4G0XA 3ZJ5A 3GO4A 1SCBA 3G2OA 3FVRA 4JLPA 4LWQA 4MGKR 1EFRA 2R6DA 4ATNA 1Z4LA 1XC7A 2J5RA 3TR0A 2ORED 4I5EA 4K2HA 3DDWA 1F6WA 4NJOA 4YMVA 1JLHA 1NYQA 3BMOA 3GGGA 4CKZA 4GEGA 3Q3GE 2WFAA 4RNCA 3F46A 3VZCA 4LEIA 2P6OA 4LY3A 4FONA 4IGAA 1JG2A 3NH6A 4B7ZA 2JI9A 4EI7A 3O4GA 5CA0A 4ZHQF 1IN5A 1B42A 2ZJ3A 2WSSD 2YICA 1NJ5A 4ZV7A 3WDLA 3S8MA 1W8DA 3PJFA 3ETHA 1N8NA 1L7DA 1B0AA 2O3RA 2P91A 1V41E 1N0HA 3U4DA 3NDIA 4DJTA 5BOVA 1T35A 1SC9A 2JLQA 4K1XA 2ON6A 3B5JA 4RCZA 1DC7A 1XQWA 3KEGA 1QHNA 3OTIA 3AF1A 2X0EA 4TXLA 2NUTA 3SZGA 5I8WA 1MOSA 2OKCA 4JT2A 1Q15A 2ERCA 1QFSA 1WSBA 2POQX 3NIBA 1GGJA 3P0JA 5BR4A 4RQTA 2CJWB 1AKYA 1TAGA 3N6RA 1LBEA 2CL6X 5ADHA 1W5TA 4JU9A 2ZYRA 2GPBA 4IQGA 1TLFA 3I9OA 3PQ4A 1DO2A 1SVLA 1J99A