3VKUA

Penta mutant of lactobacillus casei lactate dehydrogenase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
306
structure length
290
Chain Sequence
KDHQKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLEDALPFTSPKKIYSAEYSDAKDADLVVITAGAPILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAKMVNVDARSVHAYIMGEHGDTEFPVWSHANIGGVTIAEWVKAHPEIKEDKLVKMFEDVRNKAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
publication title Crystal structure of penta mutant of L-lactate dehydrogenase from Lactobacillus casei
rcsb
source organism Lactobacillus casei
total genus 97
structure length 290
sequence length 306
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-11-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3vkuA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 3vkuA02
3GHHA 5I9LA 5AOVA 2WSBA 4E32A 3L77A 3BMNA 4PRKA 3RAJA 3ZNPA 5KOIA 1QYCA 2YUTA 4J1NA 4RQUA 1UJMA 4JX8A 2OUIA 4B3HA 1ZSNA 4J49A 5F21A 3ONDA 1HDGO 2EEZA 4PZCA 3JQDA 3AY3A 3FNEA 2X86A 2I5PO 1EZ4A 2GR9A 2W2KA 1SBYA 3CSDA 3FD8A 4L8VA 3CZMA 4HNHA 3OJFA 1PQUA 1I2BA 2QIOA 1VRWA 2GASA 5AYVA 3WYCA 4ZRNA 3M1LA 1N1EA 1BDMA 1GY8A 3CKYA 2EKPA 4ROSA 1MB4A 2FSSA 3B1KA 3R3SA 4GLOA 4IDAA 1NX6A 1Q0HA 3G3EA 1YL6A 3AJRA 4HUJA 3VZSA 1WVGA 1I24A 2C7GA 1SEPA 5U1PA 1A5ZA 1ISHA 2VTDA 1NHWA 2X5KO 1DAOA 4P4LA 4XYGA 2EJVA 5T57A 3VDRA 3GRKA 4K6FA 2V6FA 1ULUA 3DO5A 3DL2A 4BB5A 3H9QA 3GPIA 3ZU3A 1XSEA 5EESA 5U4QA 1EFKA 1NVGA 2LDBA 3L6EA 5JY6A 1NWCA 5KKAA 3SLKA 2HK8A 3FWZA 4KTTE 3ZNNA 1PIWA 4XR4A 2X7HA 3E5RA 3FR8A 4M87A 4QQRA 2H1SA 2X22A 3AM3A 4FCCA 4S1VA 1UUFA 5DCYA 1LBEA 1N8KA 5L9AA 3GUCA 4WLEA 4OGWA 4AG3A 1K6JA 3FHLA 2VNAA 3JYLA 1Z74A 3ITDA 1QV7A 2QRKA 3GVXA 4EYEA 4PZDA 4LGVA 2BGKA 5KJFA 1D3AA 3GDGA 1PGOA 4OQZA 2NV6A 2GZ1A 1NM5A 5JMPA 2Q4BA 2G0TA 1FF9A 1NASA 1XIVA 1ONNA 3WGQA 5JAMA 4PLFA 4OO3A 3E18A 4WNIA 4D79A 1YO6A 2JFGA 1G0NA 3C7DB 3Q1LA 1DIAA 1B14A 2Y05A 1AN9A 2G1UA 4U6QA 1V6AA 1HDYA 1NQOA 3TRIA 3T7CA 5GZ3A 2C54A 4D7AA 3HN2A 1F8FA 1Y8RB 2ZJ0A 5IZCC 1XR3A 4JROA 4IDDA 4XGIA 2EW8A 1V9LA 2PH5A 3FI9A 3VTZA 4IXTA 2VHYA 3VPGA 4XIYA 4PIVA 4ZQHA 5ILGA 4BMVA 3ZDFA 5T8KA 5L4NA 1KYQA 3PQFA 4A7PA 3I4CA 2VZ8A 4RQTA 3GMDA 4LK3A 3OIGA 4DREA 4ALKA 5IN4A 1Z73A 3LF1A 2D59A 1TA4A 8LDHA 1T24A 4E33A 5CG1A 3QWHA 1RJWA 5JSFA 4AJEA 3FNGA 4H15A 3RU7A 1GFSA 2HUNA 1OAAA 1DIRA 3EGOA 4GWGA 4RF2A 4GBJA 3DMTA 1HRDA 2VRCD 2VYVD 5ITWA 3GGGA 4XDYA 1YRLA 2DUWA 3A1NA 3W4JA 3NTQA 3LQFA 4UEKA 4Q3AA 4RCVA 5JS6A 3FNHA 1Z6ZA 4YT2A 4J2HA 3KYCB 3NYWA 5CEEA 1YS4A 9LDBA 5MGBA 4QUKA 3RUIA 2Q2QA 3BTOA 4JJGA 3ADOA 4BNLA 1NPDA 1CEQA 4DC0A 5KCZA 3AK4A 4J7XA 5I7SA 3GEGA 3S1LA 1ZSVA 3GNSA 2D4AA 3SC6A 4DYDA 4UUMA 1GUZA 3LU1A 2FZWA 1U8XX 4BKOA 4RO0A 4GGPA 1UZNA 3CMMA 3W6ZA 2QYSA 4II2A 3VAZA 4BO8A 5TRTA 4MVJG 4CQMD 2O3UA 2Q1UA 4CQLB 3KYCA 1G0OA 2IXAA 1UAYA 3W8EA 2Y66A 4K26A 1H9BA 1VM6A 1B3BA 3A4VA 3D1LA 5T8KC 3KEOA 4A2CA 5L7TA 3PRJA 1I33A 4IJVA 4LMRA 1ENYA 1BDBA 1TI7A 1LDYA 2GF2A 4GVLA 4XKJA 3GLQA 3F9IA 2AW5A 5FEUA 1BG6A 3FF4A 1JDJA 1LQTA 3A9WA 3RC9A 2LDXA 3WR5A 3VHRA 1ZH8A 3KM0A 1YDEA 3TF5A 5CDGA 4WPGA 4IJWA 2O7QA 1ONPA 1ZJZA 4LSMA 3ZNOA 4ZRMA 3DMTC 5KVQA 3DMYA 3JQ7B 4CQLA 4MKXA 3AOEA 1DIGA 2BFAA 5IJZA 1MGOA 4IJKA 2VRCA 1H94A 3HDQA 4D46A 2VYVA 2ZTVA 1F0YA 4BMSA 1MXFA 1WAMA 1ADBA 2GN6A 3QSGA 4Q9NA 2BH9A 4R1TA 3H9UA 1AUPA 1GV1A 3TN7A 4UUPA 1A7AA 4CQMB 2PD4A 3OJLA 2Q45A 3WB9A 3ZW9A 1IPEA 2BGLA 1P0FA 3DC2A 3PP8A 3G1TA 2P4QA 3ROKA 3I9KA 3UCXA 2FRDA 3FBTA 1Y8QB 3G0OA 3ZH2A 2PKQP 3V5NA 3JQ7A 1JQBA 3QVXA 4ZJUA 2G5CA 2FY8A 4MVJA 1KC1A 1KY5A 4YT4A 3HZZA 4TRNA 3ZGYA 3PFWO 3ZWNA 5JC8A 3EY4A 3O03A 4Z0PA 1ML3A 4FJ0A 4CQMA 4RL6A 2IEDA 1U5AA 5JC1A 1I8TA 2B5VA 1OI7A 2A92A 3PLRA 5CDUA 1OZAA 4P4NA 5HBRA 3WTCA 5L3ZA 1ULSA 3OEYA 5CPBA 2OXIA 4G81A 3SBOA 4C4OA 1Y8QA 1AXEA 2EF1A 3Q2KA 1HE5A 2NTVA 2Y1GA 1ENOA 2Y0CA 3QLJA 1C0IA 3B1FA 4U0KA 5KVCA 1LSOA 1SCUA 3IJRA 5JXWA 5KVSA 4W6ZA 3NX4A 5COAA 1PWXA 3AOEC 3K8ZA 3BMQB 4WK6A 4URFA 2YDXA 5B12A 4NK5A 4JLWA 4BO4A 3IMFA 5GZ6A 2VN8A 1K5HA 3N7UA 4E2XA 1V3UA 1DFGA 4BV9A 1QYWA 1S7CA 2UDPA 3FTPA 4Y8VA 1EQ2A 3PHGA 1PZGA 1WZEA 1YB1A 2WD7B 4MP6A 4B4OA 1LC0A 2HCTA 1PQWA 3ASUA 4RPKA 3D0OA 4TZKA 4XJTA 5HTOA 5CEFA 1HDCA 1U4SA 3HNPA 3LT0A 3LSYA 5JW6A 2ILTA 4D3SA 3QWFA 2YW9A 4GQAA 3NT5A 1MC5A 1XEAA 3KOUA 1D1TA 1UP7A 3L9XA 5DOZA 4XRGA 3WSVA 5C5IA 1O89A 2FWMX 4CLOA 2C2YA 4LCEA 2Y1DA 3R3JA 4Z9FA 3AY6A 2Q1SA 2V65A 4JBHA 1NAHA 3PYMA 3G49A 3C3XA 2Z1MA 2X0RA 4PVCA 1XA0A 2O23A 3WQSB 2VHWA 4JIGA 2GO1A 1PR3A 1VKNA 1I3MA 4OQYA 3HSKA 4S3MA 3TL3A 2WWRA 4EJ6A 1EEHA 3DONA 4D0SA 4CMKA 3B1JA 3TWOA 1DSSG 4IQ8A 4UVGA 2HAEA 2OOSA 4YA6A 2O2SA 1R15A 3I9LA 3TL2A 3H3JA 3RC2A 4B3JA 1P1JA 1CRWG 1GTMA 1V0JA 4A0SA 4EBFA 1P31A 2AQHA 3ZV6A 3DXFA 3WGOA 2GZ3A 2NSDA 2V6MA 4Q3BA 2I76A 5JYDA 2EIHA 1UP4A 3HJAA 3PWSA 4UVIA 3F47A 1KVUA 3ST7A 4BKUA 3BTSA 4W4TA 4Q3CA 5T6BA 3H9JA 4GWKA 5L95A 4GSKA 4RPJA 5HRUA 1KOLA 1DJNA 4OXKA 3KSZO 1DOHA 2NU7A 3EVNA 1LXCA 3AM4A 4YRAA 1X1TA 2JFFA 3TSCA 4NBWA 5DBGA 5A4DA 2B36A 1LI4A 3PHIA 1B8UA 3PYLA 5BQFA 3PVZA 4CR8A 2D0IA 2Y99A 3OP4A 4NU5A 4GLLA 3KRTA 4CM8B 5FI3A 2JHFA 3ZWWA 4AJ4A 1Q1NA 3JQGB 4FJ1A 1N7HA 2BGMA 1K3TA 3I5MA 4BV8A 4D43A 4WCFA 2PK3A 2NVWA 2EGGA 3RBXA 3UKOA 3UVEA 1EUCA 4LMPA 4DC1A 1ZFNA 1PQPA 2Q49A 5G0VA 9LDTA 3FPLA 2HMUA 4E21A 5DOVA 5EERA 1EUZA 4ALNA 3BIOA 3ETGA 4HKTA 1LNQA 4CM9D 5LDHA 1E1MA 1CETA 1QP8A 3TZHA 4YQZA 1H6AA 2VZ9A 4LVCA 4F6LA 3MJTA 1U7HA 4XZ3A 4E2WA 5A04A 1VLLA 5L45A 5G0SA 2NTNA 3W6UA 3IP1A 4MVJF 4CM3A 3AI3A 3DOCA 2P5YA 1ARZA 3TDKA 2GPTA 4QTZA 2JD1A 2X9NA 4WEQA 1GUYA 1PZEA 3C8MA 1JKIA 4CUJA 1I32A 2I9PA 3TJRA 4KP7A 3BXXA 4HFJA 5F1OA 4NU6A 5BSHA 1C1DB 2XOXA 3MOIA 1M75A 3OQBA 3GH3A 4D45A 1NP3A 1WDMA 4QXMA 1A4IA 3LZ6A 1E6EA 4PG6A 1NQAO 1LSUA 4P22A 1P1HA 3JCZA 3NT4A 4WOJA 5HS6A 5EN4A 2AQIA 5I8WA 1MFPA 4FJ2A 5ILOA 5BSFA 4B4WA 4XJSA 1XU7A 2NUAA 3S2GA 1MV8A 5TLSA 5JO9A 1E3WB 1HDOA 3WSWA 1KIFA 3PWZA 1X0VA 1ISGA 3F5QA 4ZQEA 1EVIA 4O63O 4WKGA 3DHEA 2UV8A 2VHXA 3ZCXA 4QSMA 1ZMOA 1LSJA 4WCFC 3AOGA 2Q3EA 2FPPA 5DBFA 4Q3DA 3QVWA 1KBZA 1X15A 1YVEI 3GGOA 2P68A 3C85A 4FOOA 5IDXA 1C1XA 4ZQBA 5G0WA 4J4HA 1XKQA 5H83A 3EVTA 2GRAA 3DZHA 2V6BA 4W7IA 5C37A 2EKLA 1E3WA 1YL5A 4D0RA 1Q2XA 2EP7A 3I3OA 3KO8A 1ADGA 4ZD6A 2VWHA 2VRBA 1R16A 4XYEA 1B0AA 2A4KA 2BFPA 1QORA 4BNVA 3AUSA 4JGBA 1VE9A 3LT1A 4E4YA 5JLAA 4IGEA 1HTBA 1NPYA 3F5SA 4U0JA 5EQFA 4JP2A 1GQQA 1EK5A 5CAEA 3K6JA 4J4BA 2P2SA 4AVYA 4AICA 5A9SA 1SPXA 1EBUA 3JYQA 1UP6A 4NBTA 1MLDA 1M6WA 4J0EA 3GZNA 2VNSA 1Q7BA 2EP5A 4QFCA 5IDWA 3MTJA 1DHRA 1UDBA 3W8DA 4DBVO 3DBRA 5HWSA 5G4KA 1YQDA 2PKQO 2W8ZA 2YV3A 4IPTA 4PVDA 4CL8A 1G1AA 4IDCA 4CMIA 2W2LA 4LN1A 3QWIA 3HFSA 3UAGA 5C7OO 2QQ5A 3OA2A 3UN1A 7MDHA 4RVFA 3WX0A 4ND3A 1ZK0A 2QG4A 2X0IA 4PLPA 4GAEA 2B4TO 4BNZA 2DFDA 4CUKA 4XA8A 2R6JA 5FFFA 2WE8A 3PGXA 1HF3A 1LDGA 3WQQA 5DCWA 4CL3A 1GEEA 2D2IA 5IZ4A 2PGDA 3GNQA 3H4VA 4CODB 4YJGB 1GEGA 1MP0A 4NMHA 2X5JO 3WMXA 3EHEA 1NR7A 1OC4A 3F3SA 4M8SA 4EJMA 3TZCA 1K6IA 2DU8A 5CPFA 1ID1A 3JQCA 4E0BA 3BA1A 4OIMA 1IULA 1U3VA 5CHEA 2G82A 3NTOA 4R3NA 4OKNA 1RM0A 3PQEA 4DLLA 2CVQA 2CMDA 4MP8A 1MFZA 1YXMA 4XQCA 4YBZA 5IF3A 3SX2A 3BYZA 1HXHA 2UVDA 3GY0A 3JD0A 1Z82A 1ZXBA 4YJHA 4F6CA 2X9VA 4PFJA 2OBNA 5GY7A 3WQRA 2E6UX 5ENVA 1MXHA 5G0TA 1JAYA 1PJ2A 1GQ2A 2Q1WA 1TVEA 4YR9A 1DRWA 2R00A 2C0CA 1JWAB 1Z7BA 4YVFA 5FI5A 1HSZA 1SB9A 3OICA 1Q7CA 1P1RA 4UREA 4CMCA 4FW8A 4ILKA 2PZMA 3Q6IA 1YONA 3KLPX 3H5RA 4M49A 4BGIA 1SB8A 2QW8A 2X5OA 3MCVA 1LC3A 3D7LA 1X7GA 4H16A 2DM6A 1I30A 1NXQA 2GCGA 1HLPA 3LLSA 4ZVVA 2G17A 4DIOA 2OORA 1HYGA 5DZSA 3BMNB 3CE6A 3FPCA 3W4KA 3WTBA 3HADA 4MP3A 3VZRA 1F06A 3JV7A 4NK4A 2C07A 2WTBA 3VPXA 4ALLA 3Q0EA 4OSPA 4YAGA 5TT0A 3WGIA 3EZLA 4GX0A 4KDFA 4BNGA 4BKPA 3MTGA 1PGJA 3EK2A 4GX2A 1CQJA 1MA0A 2GYYA 3UOGA 3ZNQA 4K1LA 3S2IA 4EITA 4EI2A 5IFLA 3UF0A 2IODA 4CMBA 1VPDA 1P1KA 3ORFA 2SCUA 1C0LA 4IS3A 4C7JA 2DLDA 3IS3A 3H9GA 3AY7A 3E1KA 1CDOA 1B7GO 3DB2A 1ADFA 1BVUA 4RGBA 5I7FA 3WDSA 2YYYA 2FSVA 3MEQA 4E5MA 5KWEA 2W98A 3ENKA 4OXNA 2NVUA 1PSDA 1FDTA 5EJ2A 1CJCA 3RUAA 3WGYA 3HDHA 4NIMA 4R1NA 2HRBA 3PYXA 3VVCA 5TS3A 1SOWA 3D64A 3JQ9C 2VWPA 4ND1A 2R00C 3MWDB 2DAPA 5IZCA 3QVTA 1RYDA 4LRSB 2J3JA 5TIIA 2E37A 4EUEA 1ISMA 5THKA 4CMGA 3AUTA 3D4OA 3BHJA 3C1OA 3GNTA 1HDXA 2PR2A 4OYRA 1QYVA 5A3JA 4ESOA 3PHLA 2WM3A 4L4SA 3SJUA 4JP3A 3DOJA 3LC2O 1Q0LA 3GOHA 3VPSA 3JYPA 3NGXA 5DF1A 2P9EA 1IHXA 1Z7EA 1I01A 3PI7A 4ND4A 2NQTA 2GUGA 2X6TA 4WJZA 1GAEO 4JQCA 3PZRA 4E31A 4B4VA 2HQ1A 3ZW8A 2ZJ1A 1HYHA 1EK6A 1BMDA 4BB6A 4RZHA 5IG2A 4KUEA 3V8BA 3HDJA 4CLEA 3STHA 5L4SA 4R1SA 1C14A 4AJ2A 3HB4X 2FP4A 4BNHA 2VHZA 5L7YA 5JYEA 1PWZA 3GQVA 3PQDA 3IAHA 1ZUD1 4DLAA 1BW9A 4BUCA 3W1VA 1XGKA 1U8FO 4P4GA 1ZXLA 3KETA 5L40A 3RFTA 3DHYA 2VYNA 3LT2A 2NACA 5AXCA 4TVBA 4L9RA 3PIDA 3DBHA 4YT8A 5JDCC 3SVTA 5ICSA 5A1TA 2C7VA 2FHSA 3U0BA 5B4TA 4BIIA 3HHPA 3BMCA 1FDSA 5ER9A 2QYTA 2ZYAA 3CXRA 1N1GA 1GR0A 3UUWA 3F4LA 3E82A 2VOEA 2IZ1A 1X0XA 1VC2A 1QYDA 2AA3A 4UAGA 3VH4A 1U7TA 3ZZNA 4CJXA 2JJYA 2BKAA 3LT4A 4ALJA 3UCFA 5G0UA 1VSUA 2AE1A 1YJ8A 3VPHA 1VL8A 2AG8A 1B26A 3OQ1A 3RKUA 3U49A 4LCJA 2DTXA 4MPDA 2OBYA 3GN1A 3ZHBA 5DN9A 1KVRA 5JDIA 2I6TA 1BXZA 4U5QA 2FR1A 3MOGA 1E1LA 3IDSA 4KQWA 1E5LA 3UICA 4YEDA 3WNQA 3WJAA 2RAFA 4TMFA 4EGFA 4RLHA 4Y6PA 5HA5A 1PS0A 1PJSA 5G4LA 4R69A 2H6EA 4UUOA 4DRYA 1XLTA 2C82A 1U4OA 3MJCA 5FF9A 4WE3A 3EDMA 2PGJA 1C0KA 1D7OA 3E6AA 3DZBA 4BNIA 2DKNA 4WOKA 5A03A 3QE3A 2Q2WA 1E77A 2RBEA 3DWFA 1SEVA 2Y68A 1WZIA 1KERA 2WEKA 4MJLA 1Z75A 4XYBA 4I08A 3U4IA 3DQPA 3WLEA 1DRUA 4R68A 2VWGA 4FIZA 4MVJD 1VJ1A 2DT5A 4IMPA 4TKLA 3AUAA 5A5EA 3ETDA 3HQ4O 4O59O 3T4EA 3RU9A 3W4IA 4PG4A 4NG5A 3ROPA 3I83A 2X9GA 1IHYA 4TRJA 5AVOA 4KOAA 4HX5A 4DL9A 1WP4A 1A7KA 3ZV5A 4N7RA 4NJOA 4CLRA 5BT9A 4YJFB 5FWNA 2J5KA 2ZB7A 1XDWA 1HYEA 4CUZA 2O48X 5JDIC 3PJDA 3MJSA 4Z6KA 2TMGA 4BO5A 1WPQA 4NFYA 1C0PA 1DFHA 4PGFA 4D3DA 3JQ8A 1PGPA 3I4FA 2FR8A 3GVHA 3BHMA 4WLOA 4GGOA 4E2YA 1OOEA 3WGZA 4FBGA 1DBVO 1LDMA 3Q9UA 1PJ3A 3PJGA 4IINA 3V1TC 1P33A 4U6SA 3AFMA 3KYBA 3NGLA 3LDHA 5JAIA 4XYLA 4YJFA 1ISJA 3NEPX 4DPLA 5C7IO 3WLFA 1D1SA 3OH8A 3ZV3A 4RV9A 2C29D 2J5RA 3PXXA 1J6UA 4BNKA 3L6DA 3H7AA 1L7EA 4PRLA 2WE7A 3OQ6A 4INAA 3RC7A 2B5WA 3UH1A 1J4AA 1U28A 1KVSA 3WXBA 4A10A 1RPNA 2YQ4A 1V8BA 4FGSA 5KJCA 1Y5MA 5LC1A 3INGA 4IBOA 4YACA 4Z3DA 4ZHSA 2WJPA 1E92A 5TJ9A 1DEHA 3ZU4A 2P9CA 1VKOA 2XPCA 3RUHA 4AJNA 1MUUA 4TWRA 1IUKA 3ZWPA 1R4MB 2PWZA 3RUDA 4HY3A 3JSAA 4BKQA 1PJQA 2HK9A 1ONOA 3RASA 1KVQA 2J8ZA 1WWKA 2YV2A 3IUSA 5C3MA 1IZ0A 4GKBA 5L4LA 5JY1A 5F1PA 3D3WB 2NADA 1E7RA 3H9EO 4W99A 1ENPA 3A14A 1V35A 1I2ZA 4XIJA 5B1YA 4KZPA 3M2TA 4IXWA 3B20A 4N5NA 1W8DA 4CMHA 3ONFA 4FSHA 3ZHXA 3WOHA 2V6GA 4NFHA 2QZ9A 3ZWVA 4CLOB 4FDAA 1R4MA 3ZHZA 1UDCA 3INTA 2OP1A 1E7QA 4PLTA 1PZFA 2NU9A 4I9HA 3GG2A 3PGJA 1JU9A 1C3VA 4JNKA 1CQIA 3E9QA 3F1LA 5TF4A 1ZZEA 2ZQZA 1QV6A 3JQAD 1PL6A 3NAQA 3D3WA 3DZKA 4D42A 2FOIA 5A3VA 1I3LA 1H6CA 2AEMA 4B7XA 1DJQA 2DUUA 4JN6B 4JK3A 2HMSA 2RH8A 2HO5A 3RI3A 5JMWA 4NI5A 3RIHA 4G65A 4CLXA 3GHYA 4Y6SA 1DHTA 2ZTMA 1RWBA 1JA9A 2AHRA 2TMDA 3DZGA 4XCVA 3VPFA 5THQA 3UCEA 1A27A 4IDEA 3TZ6A 4IIUA 3O38A 3ZWXA 4DA9A 4O1MA 3V1UA 4ND5A 3BMOB 3K5PA 3TNLA 1BHSA 2NU6A 1IYZA 4PLYA 2BHLA 4KTVE 4M54A 2ZQYA 5ER6A 2XF8A 1JW9B 3TPCA 4IMRA 2BFMA 1N7GA 3L9WA 4MINA 2VUTA 1NPTO 1R37A 3E48A 3P7MA 3GZ4A 3H65A 1DB3A 4XQGA 4NBRA 2YFQA 4IIVA 4YDRA 2NQ8A 4YAKA 5AQ1A 2CDAA 4DIFA 4GL4A 3JYOA 2HMWA 1DIBA 3RKRA 3JQAB 3A28A 3K92A 2P91A 3GA0A 4FFPA 5CDYA 5JCJA 2WDZA 1E0DA 2GLXA 3HB5X 5I8ZA 3WFJA 3AI2A 1EVJA 1EBFA 3BMOA 2BFOA 3HG7A 3NDJA 2PD6A 3NDIA 3UHAA 4CMAA 1DLJA 3NDRA 4Z0TA 2IE0A 4WCFB 2GN8A 5H81A 4M89A 4AJLA 5TGDA 3T7EA 4OJNA 1QKIA 5DP1A 1PS8A 3K73O 2Z5LA 5L53A 4GX5A 4EDFA 4ZN6A 1VJ0A 1PZHA 1U2GA 4XD2A 3RFXA 5BNFA 2DTDA 4YYZA 1H0KA 2Y0EA 3JQAA 4E2ZA 5I9MA 3K2BA 1OC2A 1PJCA 3U09A 4YB8A 3B6ZA 3MJEA 3ZN2A 5COQA 4DBZA 1ZBQA 2ZTLA 4J16A 1YQGA 4C7KA 4PLHA 2BMAA 1A9YA 1LEHA 4NNJA 2RHRA 4A03A 4BGEA 4CM4A 3H5NA 4FD3A 2NLOA 1CF2O 1WXDA 3O8QA 4PLVA 5JNLA 3X2FA 5T67A 2PZKA 4TROA 4MKRA 4QT0A 5DDIP 5T64A 3PLNA 3SXPA 4XB2A 4PG5A 1AGNA 3WYEA 3VKUA 3RJ5A 1I3NA 4TRRA 1N92A 2Z95A 1WMBA 3KV3O 2Y1EA 2YY7A 3KLMX 2H5LA 1SNYA 4BOYA 5JCXA 2WYWA 1BSVA 3OSUA 5BNIA 1EVYA 2EJWA 1IB6A 1QG6A 2NWQA 2VT2A 3NUGA 2X58A 3QIVA 4EEXA 4BO3A 1SAYA 5CEJA 5EMHA 1HEUA 4N54A 1UAGA 4AJKA 1DC3A 4PLZA 4KMSA 1PL7A 1GZ3A 1H6BA 5EL0A 3SEFA 4MDHA 1U1IA 4L73A 3PJEA 4P8RA 1HZZA 1I0ZA 1E6UA 4M1QA 1HSOA 1AE1A 2OFPA 2YFHA 1HETA 4L74A 4WECA 1O5IA 1WNTA 2AEFA 1TB4A 2W2LD 3VH1A 1IY8A 4IS2A 5I9NA 3ZV4A 2DC1A 1W4ZA 1C1XB 1HWYA 1E5QA 2FPIA 5TNXA 1GPDG 3F46A 4MVJH 4E3ZA 5KNLA 1FDUA 1RM5A 1J0XO 1Z45A 4BGUA 1JWBB 4E5PA 2BELA 3ZWBA 5DT9A 2A94A 3QV1A 4PCVA 3S2EA 3PZBA 1BXGB 1PGNA 2Y1CA 2Y67A 4M55A 1E3JA 3VOSA 4B7CA 3QA9A 3TZKA 2B37A 2JKVA 1XYGA 4GMFA 4LW8A 1LRLA 1UZMA 4R54A 4DLBA 2GD1O 2CD9A 4CMEA 2EW2A 3JYNA 1PX0A 5FYDA 5A9SB 3L07A 4B7UA 1EDOA 4NH4A 2EG9A 4F46A 2AQ8A 2IYPA 3GZNB 3VDQA 4K6CA 1J5PA 5IDQA 3GAZA 2I66A 1R0KA 3DBRB 1M76A 4U8GA 5G4KB 2RH4A 3E9MA 4CMIB 1BXGA 4I8XA 4RVSA 5DULA 2Y93A 3ENNA 3FR7A 1P0CA 3GFGA 2AG5A 2OL4A 2DTEA 3EW7A 4LSWA 4BQRA 1SO8A 3H2ZA 4ZQGA 5ICMA 4ITUA 3TZQA 3BTUA 2D5CA 4QECA 1YBVA 1QLJA 2ZATA 1NVTA 1AHHA 3KTDA 3PK0A 2O3QA 4IJUA 1IPFA 3U5TA 3Q3CA 2PFGA 1LJ8A 1P1IA 3HE3A 4WEOA 1G6KA 3CIFA 5F3RA 3ANMA 1NFQA 2JL1A 2QX7A 5ENDA 2AQKA 2W4QA 4OOEA 1K89A 2PZJA 1X13A 5KTKA 1UXKA 1NFRA 1JVBA 2VOJA 1P44A 4HP8A 2J5QA 2P9GA 1HDZA 4ND2A 3VTFA 4RF3A 5CP8A 2ET6A 2YZ7A 4LVUA 1O94A 1R0LA 3GEMA 2PA3A 4MVJP 1LU9A 4OHUA 4YJHB 4Y98A 4OKIA 1EDZA 1T2AA 4WASA 1FJHA 2ZCVA 3M2PA 1LX6A 3IC5A 5EINA 2IYOA 5AXAA 1ZMTA 3QQPA 4I5DA 4JBIA 4MO2A 3VVBA 4CMEC 3WGGA 3HFGA 2VWQA 4PLWA 4XWYA 2HJSA 1R6DA 4ALIA 4ZGWA 1LLDA 3IJPA 3G1UA 4B8WA 1CYDA 4OOFA 1N9GB 5BSGA 3KYDA 4BNYA 1I36A 3F1KA 4PLGA 4RF4A 4CLDA 1WDKA 2YHIB 5BSEA 4RVDA 3WBFA 4CPDA 4TKMA 3OJEA 1YL7A 1Y5RA 1E3LA 1UDAA 1CERA 5I7EA 4OH1A 4KWIA 4CV3A 2X4GA 3QWAA 4BO7A 5HM8A 1LDBA 3PTZA 4CR7A 1U5CA 3CPSA 3PDUA 4A73A 1JVSA 1DXYA 3CEAA 5JAQA 3JQ9A 3ZHYA 1VJTA 1NWHA 1Y9AA 1UXHA 4UULA 2ZB4A 2A35A 4UVHA 2R2GA 5TC4A 1U3WA 4DXHA 1Y1PA 3CZRA 3MZ0A 4BNWA 3GAFA 1N9GA 1GQYA 1N5DA 2F1KA 2WD8A 3AM5A 5AXDA 3WIEA 1O9BA 2YHIA 4I5GA 5AXBA 2A9FA 5A02A 1GYRA 2B4QA 3I9JA 5EIOA 3HUDA 3FBGA 4RPLA 1B8PA 1LLCA 2C5AA 3DAPA 3PHHA 4YJDA 5I7VA 2VUSA 3I9NA 2HDHA 7ADHA 1UR5A 4N5MA 1QLHA 2WMDA 3GGPA 1FMCA 1KEVA 3GDOA 2EGHA 5GMOA 4BQPA 3QWBA 1DC4A 4RDIA 3U9LA 2NVUB 4P38A 1RM4A 2Q2VA 3DR3A 4J1TA 1GUFA 1H6DA 2HK7A 3GN2A 5EQDA 3PDJA 5EPOA 2DBQA 1BRMA 2B0JA 2IXBA 2BRUA 3HDYA 4DQXA 1JLLA 1TEHA 4RVGA 2ZIZA 5LCXA 4RF5A 3GUYA 3H5AA 2O3RA 2X8LA 4FFNA 3JD2A 3M6IA 5A9RA 1EVZA 2J3IA 1T2DA 4J9UE 1F14A 1XG5A 2JAHA 4J7CA 2VYND 4H7PA 2Q46A 4IZIA 4YQYA 3E03A 1JKFA 4YAEA 5DBIA 3K9QO 3GG9A 1V3VA 4R4JA 4NZ9A 1T2EA 1SMKA 4YRDA 1FDWA 1LA2A 1QMGA 5JDCA 5CG2A 4FFLA 2I99A 3TFOA 4FN4A 4HFRA 1LDNA 2UUOA 5TX7A 4GKVA 1NAIA 1ORRA 3DBLB 3BTVA 3P19A 5TJHA 1M6HA 1KC3A 1PEDA 1IE3A 1YBMA 4A27A 2DBZA 1ZEMA 4CV0A 4AJPA 1W6UA 3V2UA 3H8VA 1TLTA 5JPIA 4CM7A 2IRWA 1TXGA 1U3TA 3U62A 1M2WA 4BHTA 4W82A 1I5RA 1PS9A 4OMUA 4J91A 2JHGA 2AE2A 3INRA 4Z3KA 1BW9B 1ZW1A 4FQ8A 2V7PA 4YAIA 1KVTA 4J90A 4F3YA 3DTTA 4DVJA 4RPHA 4BMNA 3DBLA 2OMEA 3DBHB 2BF7A 4AJIA 1B15A 3C1AA 3IP3A 3WG9A 1HE4A 1QYXA 4OSOA 3BMCB 1ZK4A 3IUPA 3LVFO 4NHEA 1EE9A 4OL9A 1NHGA 4YRBA 1T25A 1F12A 4DIBA 3OJ0A 1XHLA 3DEYX 3ANNA 3WYBA 1ISIA 3U3XA 1Y6JA 1HE2A 3LC1O 4MIYA 3AWDA 1PGQA 1R0SA 4AJOA 5JFOA 4ZA2A 2UAGA 2I65A 3C7CB 1KY4A 3IOYA 1A71A 4UVDA 1GV0A 3ZI0A 2PNFA 2FR0A 4D3FA 4E5YA 2NTJA 3OIDA 4BL5A 3KBOA 2PD3A 1QR6A 3KUXA 4D44A 3P2OA 3S8MA 4J0FA 3CINA 3VH2A 1E7YA 4EEZA 5TSDA 4IY1A 1MC4A 3GDFA 1GYQA 3B70A 3RUEA 4BNTA 5G2OA 2F00A 1LQUA 1LLQA 4RZIA 2RIRA 1ZEJA 4WGGA 3JQBA 1R12A 4WNCA 1XQ1A 4Z9XA 3RBVA 1DAPA 2HSDA 4MIEA 4Z9YA 5IDYA 4K28A 2Y0DA 1SZJG 2JCXA 3PHJA 1QXSA 2Q99A 4I9UA 1GDHA 4Y9DA 4J7UA 4KDEA 3PWKA 3RUFA 4MIOA 4XX0A 4ZU3A 4G5HA 4OAQA 2P4HX 3K30A 2CNBA 4IQ0A 3FTNA 5A05A 1T1RA 4TSKA 3RBZA 2GSDA 5KIAA 1H2BA 4F45A 1K6XA 1X7HA 1P9LA 4M86A 1PL8A 1W73A 1T1SA 3K31A 3ITKA 1VI2A 1Y8RA 1LSSA 1UZLA 4GSLA 5B4VA 5F1KA 1ZVMA 1P1FA 1ZNQO 3Q9NA 5CFZA 2O50A 1WW8A 2AMFA 1O95A 1FXSA 1DFIA 1IL0A 2UUPA 3D4NA 3F6YA 1ZK3A 2PZLA 1EFLA 4CLRB 1BXKA 4CV1A 1ENZA 1HKUA 2HMVA 5JBIA 2Q4EA 3P2YA 3WIDA 2E49A 2BD0A 2PTGA 1LRKA 2YJZA 1NNUA 3FWNA 3KEQA 2IDZA 3DFUA 2QHXA 2QZZA 3JQ8B 4BNNA 1YQXA 3QW2A 4NFSA 3JQBC 1I10A 4L4RA 4EUHA 1CIVA 4AJHA 1E7MA 3KXDA 1U3UA 2EERA 2GDZA 2XXBA 3ADPA 3EAGA 3VZQA 4YT5A 2D3TA 4Q3NA 1ZK2A 4B3IA 1B8VA 4GPD1 3H2SA 5COBA 1FDVA 3MWEB 2HKIA 1GADO 1UXGA 5U9CA 2BI7A 5B37A 4IZHA 4L4XA 2DFVA 1HLDA 4HFNA 1Y9EA 2ZTUA 1H5QA 3DFZA 3OF2A 3RD5A 4DPMA 1P77A 2PKRA 1WMAA 1YWGO 1AHIA 1UH5A 1XCBA 3ZWMA 3I52A 3K2EA 4BNXA 2CVOA 5BNTA 3JD1A 4CM6A 3KVOA 3HN7A 1MX3A 2C2XA 3GVCA 4ALMA 4X54A 1E6WA 2C5EA 3HWRA 4QO8A 3VC7A 3QY9A 3ZWYA 4AL4A 4B4UA 4IM7A 4QX6A 4XGKA 3T4XA 3OJOA 2VTEA 4PZEA 2I3AA 2Y1OA 1BWSA 4J6FA 1I2CA 2DBVO 2YHUA 3GR6A 4BKRA 2QRLA 3ABIA 1ZSYA 2WYUA 1D8AA 1R4NB 1SC6A 3C1TA 4GMGA 4B8ZA 1RYEA 3SC4A 1PJTA 2GN4A 4E12A 6LDHA 1UXJA 2WYVA 3AW9A 3EUWA 4J9VA 3I6IA 4DMMA 5L51A 4K9DA 5F5NA 1RKXA 4XYMA 4ZQFA 3QVSA 1BVRA 4XGNA 5T5QA 3RUCA 4BO0A 5TQVA 1D4FA 1F8GA 3AFNA 3LYLA 4WUVA 3W8FA 1Y81A 1VL0A 3DHNA 4DQVA 2ZK7A 3Q11A 2YDYA 3WBBA 1YE3A 1PR9A 2EHDA 4BO9A 3NJ4A 3P5SA 2OGUA 3PEFA 2GZ2A 1DIHA 3G79A 3IIEA 3KHUA 3DAFA 3ICPA 4JCOA 4L0QA 1R4NA 3AI1A 3EYWA 3WFIA 2FN7A 1PU2A 3JD3A 2DQ4A 1KEUA 1GD1O 1O8CA 2E82A 3PJFA 2CF5A 4YAJA 1X1EA 3PIIA 3BHIA 3E5MA 3I9MA 1JN0A 3ICCA 4WLVA 5MDHA 1T4DA 4BNUA 1R66A 2AEJA 3I1JA 4GI2A 2VHVA 2POQX 1H2HA 3OA0A 4JXKA 3OMLA 3U4HA 3S2FA 4W9NA 5JCJD 2GN9A 3LLVA 4RVUA 3ONEA 1T26A 2B83A 3FSRA 4KQXA 2O2YA 1GCOA 4FS3A 2CSUA 1B2LA 4J1SA 1EMDA 4A5OA 1BTOA 3WMWA 3R0IA 3FNFA 1WLYA 4PG7A 1DRVA 1BGVA 4Q39A 1I3KA 2RHCA 3JD4A 4FFMA 3CTMA 3RCBA 1GZ6A 4ONEA 2VZ0A 3WJ7A 1JAXA 1CWUA 3WS7A 3RJ9A 4DYVA 2H63A 4BVAA 3S55A 2D5AA 2I67A 4I1IA 3L6OO 4MVJE 1E1KA 3VZPA 3QP9A 1WDLA 4PLCA 3X2EA 4IQGA 3TFQA 3DTYA 3JQEA 5L7WA 1EUDA 4R16A 1B3RA 4TQGA 2OP0A 3GC6A 4XB1A 4J2OA 1NBOA 1SOVA 1KETA 2JCYA 1E7WA 1O6ZA 1L7DA 3GMSA 3BMQA 2I3GA 4R9SA 5H82A 1P3DA 5A9TA 4HWKA 4KUHA 5IXSA 1GZ4A 1P74A 4MKZA 1HDRA 4NQZA 4J3FA 2HJRA 2X1HA 3WWZA 4EW6A 4W9NC 4ID9A 2JD0A 4HADA 3RC1A 1PJBA 5IN5A 2WD7A 4Y6RA 1T4BA 1NFFA 2BLLA 1H9AA 5KJ1A 1ZK1A 2EKQA 3I9OA 1X14A 2Q50A 1VSVA 3EC7A 3V2HA 1GYPA 5CDSA 1YB5A 2PH3A 2FMUA 3PPIA 3KZVA 1MG5A 2NVBA 1YDWA 1PTJA 2NNLD 2JAPA 4CM4B 1ZIDA 4DMLA 3NJ8A 3O8QB 1QSGA 3FN4A 4HBGA 2HLPA 2VT3A 2ZCUA 3OEWA 4RPGA 4CMJA 4PN3A 4E13A 1O0SA 1M66A 1YBAA 4XRRA 4FFRA 2UYYA 2VCYA 4PG8A 1OBFO 1RM3A 5ES3A 3U4CA 2D8AA 3WGHA 4HV4A 2OHXA 1HT0A 2J3KA 1T2CA 2O3SA 1A4UA 4DTIA 3GT0A 3E9NA 8ADHA 5J23A 4B79A 1KEWA 3GF4A 1X7DA 2JFHA 1U9JA 3D3EA 2IZ0A 1FK8A 4O6VA 3F4BA 1KS9A 2GERA 3QHAA 4XQ9A 1V3TA 2OZPA 2B35A 4J1QA 1A72A 3NRCA 4N5LA 3EMKA 1HL3A 4EUFA 1HE3A 3GRPA 3WGTA 1NVMB 4E5NA 3U4DA 2G76A 4R3WA 4I5FA 2Y1FA 2C59A 5KJEA 3I23A 3RROA 3CMCO 4II3A 4D41A 2W90A 4J4TA 5TT1A 4IDBA 5K0ZA 4XEHA 4BO1A 1F17A 3WNVA 3AUUA 5C7LO 4IUYA 3TOXA 2JCVA 4R5MA 1HZJA 2X0JA 4TVOA 1QRRA 2DVMA 2ZYGA 3LF2A 4R01A 1DC6A 4XR9A 2ZB8A 3WWYA 4UVEA 2YQ5A 4E6PA 5B4UA 4HFMA 3ULKA 3EZYA 4BO6A 4YXFA 3TOZA 3C24A 2NU8A 2PGLA 2EXXA 6ADHA 5DP2A 2FPGA 5JE8A 3WICA 2O7SA 5BR7A 3IQDB 3E8XA 1MG0A 3M1AA 3GVIA 2J6IA 3L0DA 4UEOA 3UFXA 4CM8A 3AU9A 5K9ZA 3JQGA 3RFVA 2JD2A 1OMOA 4CV2A 4U7WA 2D1YA 3QRWA 2E4AA 2VUUA 3UW3A 4FOSA 2HRZA 5GZ1A 2O3TA 2NM0A 3BZUA 3DZFA 4W7HA 4DWVA 1VL6A 4NBVA 1DLIA 1U2DA 3DZJA 1XWFA 5LDGA 2CUKA 2RCYA 5IXYA 1ZO8A 4MVJM 3ZU5A 1K2WA 4R1UA 1P45A 3K96A 2ZKLA 2ZYDA 2GGSA 2VQ3A 4EZBA 3FRJA 4E5KA 3A06A 3PFFA 3OBBA 3L4BA 4FPXA 4DQUA 1LLUA 5CDTA 4L76A 5KVVA 4RVHA 3OFSA 4AJJA 1E3IA 2EV9A 3CH6A 3UXYA 3ZU2A 1PJLA 3DOOA 1Y7TA 4FC6A 2AXQA 1NTOA 1TT7A 4JJFA 2J3HA 4HNGA 2QRJA 4MVJI 4TZTA 1M67A 1C1DA 3QVOA 3LC7O 4NDNE 4AJ1A 4ZICA 4RDHA 3O4RA 1L1FA 4QO7A 2EWMA 4HXYA 5JAZA 2CFCA 1IZ9A 4NJMB 4BO2A 2DPHA 5KJ6A 1Q7GA 2CDCA 1JKJA 1J49A 2FZEA 4KUGA 4O0LA 3SJ7A 4BS9A 3ROQA 2P5UA 4RORA 4LRTB 2XAAA 4A26A 4FFOA 2DBRA 1GCUA 4CM9A 3OIFA 1H93A 4BGVA 3MJ4A 4BNMA 4BNJA 1NYTA 3ON5A 2HU2A 1K0UA 3V1YA 3IL2A 4KWHA 3JQ6A 2ZB3A 4GH5A 1W0CA 4TRMA 2Q1TA 4QFDA 4UUNA 4YCAA 3KB6A 4NBUA 2OO5A 3D5TA 2IEBA 2PY6A 3KYDB 4R41A 4YPOA 2E48A 4I9NA 4GVXA 3DZIA 4J43A 4NJMA 3RQSA 1YOVB 1LRJA 2PV7A 1NQ5A 1E3SA 4IDFA 1E3EA 2CZCA 4L75A 3ANLA 4XDZA 3D5QA 4YWJA 1UXIA 2O4UX 3Q2IA 3JQFA 3NT2A 4OXYA 3VH3A 2B69A 3RSHA 3L4SO 3V2GA 2CVZA 3R1IA 4DPKA 1T2FA 5K6AA 3DAGA 5JO0A 3L4BC 4JBGA 1YJQA 3RVDA 4I5EA 4UEJA 1LTHR 1GPJA 1DO8A 4FGWA 2DPGA 4G2NA 2X0NA 1TT5B 2PLAA 4R5HA 5KKCA 3OHSX 1YGYA 3AU8A 5IAAA 1N2SA 4NPCA 1YOVA 2GNAA 4OM8A 4E30A 1LDEA 5A5FA 1S6YA 5DNAA 1ZJYA 5HS4A 2CDBA 3UGKA 3FCOA 4QEDA 5F5LA 4CM5A 4GX1A 2H9IA 4DUPA 1LUAA 2O4CA 3ASVA 3OM9A 3RWBA 1YH3A 1AXGA 1YKFA 4CLHA 3G17A 5A06A 3ETEA 4JJIA 3CUKA 3DBVO 3LK7A 3GEDA 5ADHA 3ZWCA 1DC5A 1ISFA 3GK3A 3O26A 2BI8A 1OFGA 3OETA 1ZCJA 4Z0HO 1TT5A 1YB4A 4RJTA 2CY0A 2IZZA 1DDOA 2YV1A 1B16A 3KSUA 1ZKMA 3KSDO 4R9RA 3QJ5A 1E1NA 3R6DA 4YJGA 4H3VA 3NKLA 3OECA 4NR0A 1A9ZA 4XQEA 4WLUA 1XELA 4FB5A 3VKVA 2C20A 3ZWAA 2Z1NA 2HMTA 4AFNA 3ROMA 4IDGA 4RLSA 3TQHA 1PJ4A 3NV9A 3JQFC 1EE2A 1JTVA 4EJ0A 1NQTA 3GVPA 4CR6A 5ITVA 4CM1A 1EQUA 1XU9A 1IOLA 1E7SA 5K6AC 2X23A 3O9ZA 4FR5A 1GU7A 3BAZA 4IGFA 3C7AA 2B4RO 3I6QA 1XQ6A 1KEPA 1DPGA 4LISA 3DDNA 1Q0QA 4N18A 2O3JA 4WLFA 3ZWOA 1ADCA 4O5OA 5DCUA 4Y67A 4R51A 3COSA 3IKVA 4BNFA 2CF6A 3SLGA 1GL3A 2XXJA 4YTEA 3NTRA 3N74A 4MOWA 3D4PA 1NR1A 2W2KB 3IKTA 3GFBA 3MJVA 4WCDA 4WLNA 4FC7A 3GPDG 4DGSA 3JTMA 3N58A 3H6KA 4Q3EA 3H3FA
chains in the Genus database with same CATH superfamily
1RWVA 4QPNA 1RP7A 5FLKA 2RGDA 5AOVA 1OA1A 4IV0A 1OX5A 4JYMA 3DEAA 4E32A 3GQBB 4NV0A 2JGNA 2HWUA 1QYCA 3IBYA 4RQUA 3FFTA 2GJAA 3GGSA 4JJ6A 2OUIA 3OMXA 5DIFA 3CS3A 5EPUA 2PNJA 1ZSNA 2WBLC 5G53C 3DP9A 4FP9A 2XUZA 3VX4A 3JQDA 1W59A 3KUCA 2PXXA 5FUWA 2CV1A 3RYHA 4OUKX 2X86A 2I5PO 1EZ4A 1KPGA 3FD8A 4ZOQI 2P9YA 3C39A 4QU8A 4XE5A 4GZ3A 4TWJA 4KVFA 1JG7A 1NW9B 3KR0A 5IBCA 1I2BA 1WXIA 1VRWA 2QIOA 1IY1A 5AYVA 3UXEA 4DDVA 4HTFA 4EPTA 3CKYA 1UK6A 2EKPA 5I4CA 2BUCA 2OZVA 1NP7A 5C5EA 2GVDC 3R3SA 2GKOA 4GLOA 5IC4A 3AJRA 1E1QD 4TM8A 2GBFA 3V1KA 3OQNA 1SEPA 3IDFA 1BKDR 1ISHA 2VTDA 1NHWA 3VDRA 1DAOA 1EK2A 3IDZA 2BDEA 3EG9A 5DV9A 3TLYA 1DI0A 3BKWA 4MUFA 5IS2A 1OTYA 2GBLA 4Q4HB 1ZN9A 1ZI6A 1TFRA 1VECA 2VTBA 2H7VA 4MS3B 3ZC3A 3H9QA 1KPIA 1T8PA 2FMFA 2OXFA 3D8SA 3GPIA 3ZU3A 3HUUA 2MIIA 4F4DA 4C2UA 3L6EA 5C5DA 1M6YA 1NN1A 3HRIA 4ARIA 2CL5A 1VYHA 2HK8A 4KTTE 2QKYA 1J8YF 2NUPB 1SKAA 3PUJA 4OXIA 1IZYA 3CONA 4XR4A 2X7HA 5EAIA 2H1SA 2X22A 3IUYA 4G01B 4QDUA 3AM3A 3UWDA 1PKEA 3CZQA 3L0OA 5TE9A 3GUCA 1V7QA 5DEOA 5G3ZA 4BFVA 5A62A 4AG3A 3HABA 2PZGA 7YASA 1K6JA 1QZXA 2R5FA 2VNAA 3OF3A 4XX0B 3K5IA 2IVZA 3ITDA 2WPDD 3IP6A 4PZDA 4RKRA 1DAKA 4LGVA 3ZXXA 2VL7A 5IC5A 2DQKA 1OX4B 1PGOA 3KQHA 2DWUA 2FX5A 2GZ1A 3N8IA 1AZSC 4NY1A 2AF4C 1FF9A 1NASA 1HORA 1IBCA 3Q7SA 4OO3A 1RC1A 2FAXA 1AKUA 2XNKA 3QVJA 3TQFA 1FUIA 1AN9A 1KEZA 2EDAA 5LIPA 2MT9A 2VK2A 4JITA 4EZIA 1WU8A 3T7CA 4AM8A 3HN2A 1Y8RB 1QIDA 4KWTA 5I8PA 5IZCC 2E4YA 1P9NA 2L69A 4XGIA 5LZ5A 1NI5A 1GSHA 1GSIA 2VHUA 3R0XA 5DU2A 3IP8A 1PT9A 1JA1A 2WIBA 3FI9A 3VTZA 4DQLA 1YQWA 2RHMA 4DDKA 2FDRA 4NCAA 4XIYA 3HVJA 3ZDFA 5LDDC 3D0KA 3N0VA 2O8FA 1KYQA 3PQFA 4A7PA 4DJFC 3I4CA 2XUJA 1F0NA 5FOXA 1BCSB 4DREA 4ALKA 5IN4A 1Z73A 2J4CA 4D25A 2D59A 2ISSD 3CC8A 4Q18A 2H2IA 3I73A 2CVHA 4FQ5A 1QQAA 2VFAA 5EIFA 5CG1A 5FTNA 1ML4A 4MB0A 2IF2A 4BFWA 5JJBA 3U3JA 1WD5A 4DIDA 2HF8A 4O29A 4DJAA 3LH5A 5FADA 4ARCA 4BASA 3RU7A 3KTAA 2GZRA 1ESNA 5KNCA 1N4DA 1K2VN 3SP1A 3U7RA 4HH3C 2UYQA 2Q6LA 2O2DA 3GGGA 3ESXA 1PNQA 2KPOA 3BQ9A 3W4JA 1C1YA 1UPUA 1BMFD 2V7XA 5AUQA 1KNQA 4U63A 4UEKA 1FFAA 1XZPA 2FLVA 5JS6A 1A5TA 4UU0A 3B5IA 4EW3A 1Z6ZA 1HPLA 1TIPA 3KYCB 4KXWA 5TY0A 3WK8A 3ZS8A 5K0EA 1YS4A 4GPIB 4LYYA 1NMEA 1NN0A 3Q7EA 2OE2A 1FUKA 2YZMA 3RUIA 1ODFA 1M2JA 4JJGA 2JGFA 1SCNE 3ADOA 5D3MB 1GQOA 1ZA1A 1YA6A 1VG8A 1FB5A 1CV2A 1OXSC 3EEYA 3NHMA 1A7UA 1SHKA 4PQEA 5KTPA 4E4RA 5HJ5A 5BRNA 3SC6A 1IC6A 4O2BA 3PQ7A 3IP5A 4UUMA 2C97A 2PU5A 1D6NA 3SIRA 3H8SA 4RO0A 4NV3A 4EYKA 3KLNA 4RMNA 4JASB 4B84A 2C7OA 2GAJA 1Y8AA 4GUAA 3U16A 4II2A 1KWGA 2XCOA 3GCZA 3NYIA 3BFPA 2ZZNA 2OBLA 1AZTA 3CLSC 4IFTA 4CQMD 4R8MA 3AUJB 1G5TA 2Q1UA 2YWGA 3BM5A 3WQHA 3C3AA 1XKLA 1DCMA 4NZZA 1FNMA 1NTRA 4K26A 3I32A 3LQRA 3AMVA 4RAQA 5BMVA 5JWRA 4C07A 5T8KC 1OLOA 3KKEA 3U6BA 3BWMA 4I8DA 3V34A 2V3CC 3NKVA 1N6IA 4GVLA 3GLQA 3KLBA 3KB8A 4QBTA 1AQIA 3WR5A 3HA7A 5IT0A 3R8FA 1EQAA 1RQ7A 2BCJQ 2OLKA 3U0VA 2EIXA 1YDEA 4YALA 5BW6B 3ZDXB 3P9KA 4IJWA 3RRNA 3SAJA 3SFVA 4PWZA 5CM8B 3RG8A 1XVUA 1AUXA 1ZJZA 3ZNOA 4QL3A 4TKUA 4P6VF 3P0HA 5J4YA 5LJLA 4EL5A 5B6IA 3DMYA 3HV2A 3M6VA 2Z09A 3HGQA 4MKXA 4A92A 3AOEA 3TRDA 2XYQA 2BFAA 2VH1A 3JU3A 4Y1FA 5K8VA 3PQ5A 4IJKA 3OQHA 4DA4A 4D0GA 2OZLB 2VRCA 2QL5A 4KQEA 2RHDA 1EM6A 4K9SA 4QE3A 3QSGA 2H2AA 4U2FA 3VO9A 5E7IA 3S2UA 1GV1A 3WE7A 4UUPA 4CQMB 4DANA 3B2NA 5EJMA 1IPEA 3VHLB 1PJAA 3MK31 1F2TB 1YQEA 5AQEA 2KBEA 2AOXA 2BHRA 3AJDA 3D2CA 3I9KA 4B6PA 3UCXA 3TW4A 1T4CA 1ODSA 2P6UA 3QMWA 1OXBB 5K0FA 5K0BA 3HYCA 1U5BA 3FBTA 1Y8QB 4WZZA 5AJVB 4RFSB 4FUQA 3JQ7A 4ZJUA 1WBDA 3OZSA 2IYLD 2G5CA 2ZAYA 3SKYA 1JLHA 1TX4B 3HZZA 4A8HA 3ZGYA 1I9GA 3N07A 2QD4A 2RD2A 3IH5A 5JC8A 3EY4A 3H99A 3I6MA 2I1QA 1U5AA 5JC1A 4X45A 3TJZA 4M9ZA 1BN7A 3NXSA 1E59A 1F2UB 1D2HA 2ZGVA 3AHFA 2PFSA 4E07A 3I5XA 2O8EA 2VDMB 1BROA 2OXIA 2A6PA 2IV3A 1IY2A 4AWAA 2QD1A 1JDNA 1SXIA 1L5HB 2CD7A 1Z5ZA 3F7OA 1J22A 2YWCA 5HILA 5JLJA 2EF1A 1YE8A 1HE5A 2OVFA 3Q2KA 2C2WA 2OD7A 3O3MB 4FMCB 1XA4A 3S68A 3Q88A 2Y1GA 4FYPA 2RBGA 4YMLA 1ZYUA 5LVAA 4AS1A 1ZJ4A 1FJ2A 3D6VA 4I1VA 1KSFX 1LSOA 1SCUA 1CK4A 3PUYA 3FUCA 3IJRA 2IKSA 1RWXA 4G67A 5CCDA 3SQMA 3NX4A 1RLMA 2JIZA 1IEQA 2ZBQA 1YZHA 2ZSBA 1PWXA 4RV4A 521PA 2V03A 3RK0A 4B6JA 1XTUA 3IV9A 4WK6A 4Z53A 1MA3A 4ZCIA 3OWXA 4EL0A 3NCTA 4P9NA 2CXPA 4BO4A 4BQSA 2HPVA 3CBQA 5KYWB 4TYPA 3OLCX 5FPYA 1L5KA 1Y1RA 4M98A 4FFDA 1IWPB 3G59A 5KQRA 3M49A 4Y8VA 4ES6A 3PHGA 5GINE 3VDMA 2X3YA 1YB1A 1T9GS 1TZKA 3V1LA 5IX8A 2WY2D 4MP6A 3CJTA 4DDMA 3KWMA 1T5HX 4ZRDA 4N47A 4M1YA 4FYHA 4TZKA 2LE0A 3ZHUA 1NUHA 4XJTA 3U81A 1CZUA 3F98A 3N86A 1HDCA 1XK6A 5CEFA 2L2QA 3V55A 1O96A 3LT0A 5JW6A 1Y1SA 2ILTA 2NYVA 2IPNA 4G4SP 5JQWA 2ZE5A 4NXMB 2MSLA 1CZOA 5JT1A 5K99A 2QBYB 1MC5A 4LXHA 4ND8A 2R7NA 3K4PA 1XRSB 1C8KA 2FWMX 5EYPB 3UT5A 2RI1A 3SK0A 3AHJA 3VR1A 2OUKA 2BGUA 2Y1DA 4R1MA 5AW7A 2OY0A 2P7IA 2Q5OA 4M9UA 4DIEA 4F7WA 1URPA 2V5UA 3HSSA 4O1IA 4PYJA 2XDWA 2J0SA 3ML1A 2Y4OA 4JBHA 4MWZA 4LEIA 4ZCQA 4UXJA 4EENA 1EJ6A 2VHWA 4WHMA 1RKVA 3BQMB 4Z4QA 3VJRA 1XN1A 2QTGA 1VKNA 1I3MA 4S3MA 2QD2A 4Q24A 3IA2A 1Y3IA 2WWRA 3D0RA 4OJMX 4J0JA 3P0FA 2P2NA 3BMXA 3I05A 3TWOA 4D9HA 3S3TA 4V0MA 3V8EA 2F4VB 3COWA 2HAEA 1C1HA 2VBFA 5JPDA 2OOSA 2JZOA 2F1OA 4YA6A 5HCNA 2O2SA 1R15A 1ZLXA 1C8LA 3I9LA 3H3JA 3RC2A 4B3JA 4PRYA 4KB5A 1CRWG 3G7UA 1W85A 2GHIA 4UD2A 3ADBA 3GLHE 2GKSA 3G9TA 4EBFA 4ENRA 4XB6B 3WMGA 2XUHA 4EJ2A 1DBIA 3WGOA 2NSDA 4Q3BA 1AG9A 3VR6H 3HJAA 2ERCA 3PWSA 3OFND 1VXRA 4RUKA 1CEEA 3T34A 1H66A 3E8SA 1CBUA 1E2BA 1DNPA 4P7BA 1R5BA 4W4TA 2NYAA 1WSDA 4Q3CA 1ILEA 3VR3D 4GWKA 4JVLA 1USUA 4GSKA 3O84A 5L95A 1XZDA 5HRUA 2BFBB 5K8CA 3ORHA 2Z2JA 4RACA 4OXKA 4DLWA 1XAHA 1DOHA 2FX2A 3DJFA 3EVNA 2VH2A 1XXHA 3BJIC 4GQBA 4LY0A 5C34B 5SYAA 3W7BA 1F1JA 4ZOCA 3IE2A 1DEKA 1TQ2A 2XECA 2XNDD 3M1YA 3D3KA 4HUQB 4NBWA 5ECDA 4D3ZA 4HB3A 2BT4A 5DBGA 2TYSB 1AS2A 1ZL0A 5BQFA 1WHSA 2C03A 2LVBA 4NU5A 1BE1A 5AVTA 3E0QA 1EWTA 2JHPA 2QX9A 1XU4A 2WTMA 4CM8B 2O57A 3JQGB 4FJ1A 3ZE2B 1LI7A 1N7HA 2AS0A 1E60A 2H1IA 2VJNA 4W8OA 3FWKA 5EFZA 2Q7DA 4DAOA 2O54A 3LLMA 3FW1A 2CXRA 2XNCA 5FAXA 3N0XA 1KZHA 3UKOA 1KYYA 2I4LA 4YYEA 4LPSA 2W6JA 2XCRB 1R9JA 1PQPA 4I99A 3PEWA 1GGFA 2YVAA 3FPLA 1U1DA 2Z3WA 5DOVA 4LI3X 1EUZA 1ADYA 4ALNA 3BIOA 3UMYA 4X65B 2F43A 4X64B 2R6R1 4JLAA 1E1MA 1T4GA 1TM2A 2R6FA 1TQ4A 2JI6A 1QP8A 3OOSA 2W7TA 4NYJQ 2VZ9A 1Y48E 2RG1A 4QC2A 4F6LA 4F8YA 3TSWA 5LQJA 4RMJA 1MO3A 2MJLA 1VLLA 3K0CC 2EZUA 5J2TF 5T4HA 1AXRA 1TJNA 4DFDA 3W6UA 4DSTA 4GLFA 1OT3A 3IP1A 4CM3A 3DOCA 2P5YA 2AKYA 3QVMA 2ES4A 2GPTA 4QTZA 2JD1A 3C45A 4F7DA 1PZEA 4GNKA 4EVRA 2PV0A 3ZY5A 3DZCA 1BX3A 1JKIA 2YOFA 5EKSA 3THSA 3WMEA 1V8DA 1L7MA 4KP7A 5TMBA 2ZM5A 5GVSA 2O6HA 4MW5A 1M1YE 2PX4A 3PCXA 2WMNB 5F2EA 5ETJA 5JSQA 3PD1A 4QXMA 2IL1A 4GI3A 5F73A 5KDOA 3LZ6A 1G4HA 4TL6A 4ZAVA 2G9NA 4RK1A 1NQAO 1QK4A 2XB9A 1IEVA 5AW9A 1EP3B 1NL3A 4P22A 3COVA 1K9VF 2Z3ZA 3CCFA 4HDSB 5CTJA 3K7EA 4FJ2A 1JEYA 1PR6A 3D4LA 1PDOA 2ZAGA 3LUFA 4MCJA 1XU7A 5I9TA 4QM6A 4Q15A 1MV8A 1N3YA 2I34A 2P3QA 1V4BA 2WUVA 3K8QA 1KIFA 3PWZA 5HMLA 2QN2A 5H8WA 4JJ7A 4Q7MB 3T0IA 4QGHA 2BM8A 4AUKA 1Q57A 5IC6A 1TVKA 1Z0AA 2XUIA 4GXRA 3E1SA 4P3OA 3R6GA 2B94A 5JZVA 4D2IA 3ZCXA 1T1EA 5FH9A 5KYTA 4JV5B 4UAUA 3I8SA 1J21A 1VLMA 3DVSX 3KNZA 4HLCA 4JT8A 4W63A 2CUZA 4WN9B 1U2QA 3AP3A 4H0CA 4Q3DA 1E89A 1JIXA 3R9XB 2XGOA 2H1HA 3F6SA 3OPYA 1CUBA 3GGOA 4FX5A 3C85A 3REQB 3UMFA 1MN6A 1C7RA 4H4DA 3CZAA 1ICIA 2YTZA 4J4HA 1PNOA 3QYAA 5G0WA 1BDIA 1UAAA 2JBHA 1H85A 2PJZA 2W43A 1G3QA 3O90A 2H0RA 4MWSA 3BORA 1M1XB 1YL5A 3TLCA 3T95A 4RHYA 1Y4DE 4ZD6A 1ADGA 3G2NA 1H4VB 3WRXC 1TF2A 2O07A 1EP2B 1R16A 2OAQ1 1QORA 2HJGA 3AIIA 1T8YA 2QUBA 3LT1A 4ZCPA 5JVDF 1E2LA 4MI1A 2C3PA 1ZGHA 3AJ9A 4CCYB 4NLLA 3IEUA 4OIFA 1NPYA 2BFWA 3G2QA 3PQ8A 4EYEA 1FYVA 2DLNA 1M73E 1JAZA 5JJCA 4J4BA 1D1QA 1XD9A 1YIAA 3FNQA 3HCEA 4RM2A 1NUSA 4B5KA 1FFBA 1UP6A 4P32A 2BL4A 2ZYHA 3T1NA 3H11B 3FPFA 1J1IA 5IDWA 3MTJA 5K3EA 4TX1A 2YV3A 3S2ZA 1M0TA 2VP3A 4HVTA 1FDIA 4LC1A 4QU0A 4BX0A 3MIZA 5LLDA 4ZC1A 3NP7A 2P6NA 4DA0A 1QKKA 3QWIA 4XD7A 4I81A 3HFSA 3GWZA 3CF4G 5ITZA 4XDHA 4B0PA 1T10A 1Y5IA 1LW7A 4FDVA 4OI1A 4RVFA 4O33A 3UN1A 5B1EA 2Q2OA 2GMWA 1PT6A 1J0BA 1U7UA 2WFAA 2B4TO 1O6GA 4PLPA 1DQNA 1SBNE 2YWEA 1ZM4A 2O52A 3AB7A 1CQPA 1QMPA 3CF6R 4FT2A 1W87A 5BPFA 5DASA 5FFFA 5KYUB 3Q8KA 2GD2A 3PGXA 2ZBFA 2ZT6A 2RCNA 3U61B 3D7MA 1GEEA 1RPAA 2D2IA 5IZ4A 2PGDA 2WZQA 4YJGB 5FB3A 3OEED 1LPAB 2X5JO 1NR7A 1OC4A 3I42A 3LPMA 3AKEA 2Q0XA 4M8SA 1RT9A 1XTIA 2FUG6 3OU6A 4M1OA 4EJMA 4UE3S 3QBEA 2YZ2A 4BTEA 3QXCA 4MROA 5CHEA 4EARA 1YZNA 3N2KB 1M2EA 1B4DA 3NTOA 5CYFA 1XNQB 1B73A 3MUEA 3P9NA 3PQEA 4KLNA 4UU8A 1S2LA 4AD8A 4DLLA 1DWQA 3F8WA 1JEQA 4MP8A 2CNOA 1RVV1 1UBKS 3QPUA 4RQBA 5GM1A 5IF3A 8ATCA 4MUKA 3SX2A 1WUYA 3ZV7A 3GY0A 2UVDA 4LG1A 2DQYA 2IDMA 3DYIA 1YNSA 4KXLA 2IX3A 1WHTA 1WPGA 1ZXBA 3DTVD 1R8JA 5CLIA 1UM9B 1VCIA 4HAIA 3VSEA 1E4OA 2X9VA 1XDGA 4F6CA 1DAGA 4HEHA 2E6UX 5A5VA 2EQAA 3QTBA 1SULA 4QJBA 5G0TA 1RI3A 1PJ2A 3N2GB 2VDVE 3GJ6A 5G3YA 4YRLA 4OU4A 5CVVA 4K87A 4YVFA 5FI5A 2JDID 1P5ZB 4HLQB 1HSZA 3RB8A 1G8AA 3OICA 1Q7CA 1P1RA 2R79A 2Q8QA 1JPUA 3UUGA 2DYKA 3SJBA 4ILKA 4RV5A 1LCIA 1CD5A 1YONA 3H5RA 1MMFB 4P53A 4UC0A 1YAJA 1SB8A 1VJGA 2OFFA 4DJJA 5JOQA 1LF0A 3QU9A 1NUAA 5K8IA 1X7GA 4G36A 4C6TA 4HAOA 1I30A 2PS3A 4QXOA 1VE6A 2GCGA 1YJXA 3NOVA 4LQDA 2REBA 1KXZA 3HN6A 2C1XA 1YC5A 2FWNA 3BGDA 5JI3E 2OAEA 2Q9AA 2WNIA 3GUZA 2DEUA 2BR5A 1F06A 3JV7A 1DZIA 1J7KA 2C07A 2WTBA 4L02A 5EWLA 1X8XA 3P2MA 4YAGA 2DCMA 1CRPA 5KQMA 1NC1A 4GX0A 3BE8A 3O4IA 2EZ4A 4KDFA 1QO9A 1BH6A 5AVRA 3EK2A 2GYYA 3DTVB 1E4VA 1K92A 1L7RA 3TNJA 1M3SA 2RGXA 1ZH2A 2A5YB 2ZCJA 3JZAA 3U13A 4CMBA 1XMJA 2WT4A 5IEBA 3LPAA 2SCUA 1C0LA 1MNQA 2G5GX 2HSGA 1STOA 4JOBA 2GPYA 4C7JA 3E2MA 2HIMA 4FQ7A 3ROGA 2HD4A 4FLMA 1R8QA 4BPRA 1JQDA 1WCIB 1B7GO 3PNYA 4IRMA 1SUWA 2RGEA 1Y3DE 3MMNA 3PXBA 1P80A 3ZG6A 1KGSA 3ADKA 4B6GA 1RYBA 2YYYA 4ZT3A 2WLSA 4AO8A 1RRKA 2NAFA 2DKOA 4E5MA 4QPPA 2AD1A 4E1BA 5EJ2A 1TUIA 1ZD1A 5ERXA 4NIMA 5K3FB 2AZTA 3D2BA 2HRBA 1TRKA 2PSEA 2ZRBA 3VVCA 4RS4A 2PMKA 3G0BA 4PV7A 4DN6A 1SOWA 4TS3A 3CN9A 2F59A 3WNZA 2DAPA 1D9ZA 2AZXA 3BH0A 5JPCA 2OSBA 4YGYA 5DM2A 1Y7IA 4LRSB 4QRHA 3QEMB 5FUXA 4LYAA 2E37A 4KREA 3KXLA 1ISMA 1KAHA 4CMGA 3GLIA 2ZJ7A 3IBSA 2QP9X 3FWPA 2PJDA 3DL4A 3WGJA 2ZSJA 1KQPA 3VKGA 2FUEA 1M2KA 1ZHFA 1AB6A 1HDXA 1YDGA 2CHQA 4YP6A 1LS6A 3MCTA 1DWUA 2XNHA 3F7NA 3I5YA 2V96A 1ISPA 4L4SA 5CUQA 3K09C 4M1KA 4JYAB 1VIVA 2OORC 2FKNA 1AQUA 3T6KA 1N2CE 1RJFA 4N03A 2M6SA 5FFNA 2PRZA 4BQEA 3HVUA 3C41J 3VPSA 1AKRA 3JYPA 5BVGA 4ZZIA 1Z7EA 1I01A 5G41A 3HY4A 1LPMA 4TT3D 5LP6F 3B3AA 4YCLA 1GAEO 4DMHA 3IDAA 3IV6A 4E31A 4B4VA 3EISA 4KO2S 3WBKA 2IDJA 1TA9A 2ZJ1A 4K5QA 3ZW8A 1HYHA 1KI7A 4I8IA 4K6MA 2NMVA 1E62A 2IKQA 4PO9A 4RZHA 3JZMA 4EHNA 5IG2A 4HCJA 1QB7A 1U31A 1VHJA 2PXHA 3BWDD 3UJ8A 1J00A 1JIJA 2H08A 5LR6A 2IS4A 4UM9B 1TKCA 1EB9A 2JJ8A 4KYUA 1T9BA 3VR6D 4I3GA 7REQB 1JT2A 2OWDA 4C5AA 2B4YA 2X19A 2I6XA 4W1QA 1P91A 5FL7D 1P4AA 3AJEA 3R2JA 2VP4A 4UTOA 2PE5A 1PBNA 1ZUD1 3GH1A 2Q3JA 5JADA 3Q5EA 4B6QA 4Q9JA 1JV2B 3ZJVA 3P9IA 1Z83A 5EJ7A 2PUDA 1AV7A 5AXCA 5K0GA 3JAWB 3O8OA 2EZTA 3OHPA 4H18A 4RADA 4C76A 3SVTA 1WETA 3M33A 5D5QA 3T8YA 4WZBE 3QUAA 1U7DA 5K4AA 3WLKX 1GR0A 3TQRA 3UUWA 3E82A 2VOEA 5KTMA 1S1CA 3JZDA 1KSGA 4MVXA 1QDLB 2AA3A 4KSCA 4H7EA 4UAGA 1XK7A 4YO7A 3VH4A 4CJXA 2YY5A 2OWEA 2V3WA 3QMMA 4RFLA 3UCFA 1JKXA 3ZLUA 1QM5A 2ZI5A 2CV2A 4KWCA 1SZDA 3BA6A 3NM5A 3Q3JB 1A9SA 1FTGA 3C43A 4S1PA 4FS8A 1WW3A 3RKUA 2I9KA 3PNKA 1QE0A 1JJIA 2ATIA 4LCJA 4G5XA 5BWCA 2C95A 2EL7A 2OBYA 3TDNA 4S2UA 4X85A 3PC7A 1KI9A 1EM8B 3HWX1 4L22A 1VCMA 2I6TA 1RZ3A 2FVYA 3ND8A 2CXSA 1L9XA 2FR1A 1PUXA 2C3YA 4PS0A 5ARCA 4L0MA 3MWLA 5TR9A 4U3JA 1WMFA 4C4SA 1E5LA 1G38A 1SVSA 3S99A 2RAFA 4TMFA 4CDMA 1QGZA 1XOIA 1RBQA 3RYIB 4EG8A 3Q3IA 2HU7A 1TUEA 3DT8A 3PNMA 2X9QA 3Q6MA 1C9MA 5FF9A 2VP9A 1SD1A 2OXCA 3EDMA 4DCMA 2PGJA 1C0KA 1KOGA 1O97D 4BP3A 2DKNA 1T0PA 4ZMSA 3D31A 5A03A 1EB8A 4G0XA 1TK9A 2BFFB 2Q2WA 1T2NA 1PHRA 1H2AS 2DMRA 4P2GA 1NV9A 1D5WA 3DWFA 1SEVA 1UZAA 1U0SY 1WZIA 3M6WA 1R0WA 3MTIA 2VK1A 3NS7A 3N87A 4XYBA 4PQGA 5IK2D 1IBMB 2P69A 3U4IA 5CYPA 4FFBA 3OZXA 2VDLB 4RVNA 2QVLA 2UUBB 3KPYA 3J7TA 1YZGA 4C06A 2HNBA 2YL2A 4FEEA 3AVPA 1OLXA 5BOVA 1YI0A 3RSZA 3CPJB 3ETDA 4K0RA 4BAUA 4EZEA 2BSXA 3LQ2A 3TTXA 3T4EA 1E66A 4ZQIA 3K8OE 4ZOLB 2E4UA 3RKSA 2A57A 3QX7A 2ZOSA 2JBWA 1OFTA 4G0PA 1BCRB 4V3CA 4ZI7F 1QH8A 5TB5A 2R8PA 3K9LA 4NOKA 1UKYA 1DV2A 1PW7A 1J1ZA 2QN6A 2B34A 3HO1A 1K8YB 2WW8A 3E3OA 3I8OA 3IEKA 1WP4A 2FMXA 3FKSD 3L40A 4GHWA 2Y1XA 4N8EA 5CIYA 5WRFA 2PTHA 1K7FB 2ZT8A 3ZV5A 3CLRC 4CLRA 3LP8A 2WG0A 1V11B 2J5KA 3CCCA 3DT6A 3QELB 4KC0A 2ZB7A 4ENQA 2XGJA 1XDWA 3UWSA 1HYEA 4M2LA 2BR4A 5K3AA 3WHLA 4L4YA 3CUTA 4TM7A 3MCWA 4MUGA 5EQJB 1T36A 3S29A 3ZXYA 4M7PA 2X8JB 5C0OE 2HRQA 4BO5A 4Z6KA 1YCHA 1MRZA 3GPLA 2GWRA 1D2AA 1C0PA 1EU1A 1WBBA 3ANXA 4QREA 4X90A 4CN8A 2CT8A 2IHNA 2FR8A 3GVHA 3BHMA 4UTRA 3I01A 4E2YA 1XLTC 4DNQA 2E5WA 4Z4EA 2IXGA 3WZMA 3K35A 2WLTA 1DBVO 1IJFA 3Q9UA 1PJ3A 1OFVA 3PJGA 1BWQA 3V6MA 4U6SA 3ZHQA 2D7CA 4E15A 1OZGA 1UMCA 3NGLA 4JMLA 3LDHA 5JAIA 1QGOA 2A9KA 1P9WA 2GF0A 2QJOA 3JATA 4GLJA 1UBMS 2Z9CA 2IHUA 3CPEA 3MWEA 1ACMA 4RMIA 1BDJA 4C0XA 4P0QB 5ALKA 3WLFA 4IQ4A 4EI7A 4RV9A 2RGYA 4DXDA 1CF4A 2V1XA 4HNAA 3F49S 5KI6A 3H7AA 2CLFB 5GVRA 3TLGA 3KD3A 2EZ8A 1G64A 3NHSA 5ALPA 2QRGA 1QHYA 4A10A 5ELXA 3INYA 1RPNA 1KQNA 5C1IA 4E94A 3OMWA 1GWNA 2IZ6A 1UK8A 3BE6A 1PHPA 2WFMA 4R7ZA 3H1PA 1EI9A 1TU3A 1YI8A 4WOBA 5LC1A 1JR4A 4CXMA 1PJ8A 3QY0A 2HGSA 4IBOA 5KTTA 4YHHB 1JU4A 4E5SA 5B4UA 4ARBA 1RC8A 1QX3A 3O4JA 1L8AA 4QASA 3N7AA 1SPBS 1VKOA 4TWRA 5ARBA 1LF5A 4B31A 1N1MA 2A0WA 3AXTA 3IA7A 2C0PA 5KMGA 1R4MB 1H3NA 4OBXA 1PTKA 1XZGA 2NW6A 3SYLA 4EW2A 1L5MA 1PJQA 2P90A 2PCLA 2ZJ2A 4L4UA 2V7QD 4M22A 2ZVDA 1WWKA 3C98A 2ZXUA 3V42A 4B85A 5KHOC 3QF4B 1I3OA 5L4LA 1XRNA 1V7CA 4P86A 1RRVA 4UUBA 4DLXA 5JY1A 1RMQA 3NXKA 2NADA 1E7RA 3H9EO 3QVLA 3FYUA 4GLBA 1P81A 1WF3A 1T5DX 3KTOA 4KZPA 4HOYA 4JHLA 3FJ1A 4OHYA 1W8DA 2G83A 4CMHA 3KYIB 4C2BA 1D1PA 3LXXA 4FSHA 4Z7NB 3PF8A 2V6GA 3I1IA 3EMVA 2QZ9A 4JGIA 4NFHA 4CCAA 2AJTA 3L1JA 5K6TA 3OPNA 1YZTA 2CCGA 4QJIA 4YV2A 3SS9X 4ZEMA 3GEEA 4JL5A 4Y1RA 4IWYA 1O97C 5FV4A 3TAUA 2CMGA 5F2NA 4HN9A 3ZI4A 5JZBA 1OTXA 5B1SA 4OUDB 2B1IA 2YICA 3AR4A 3JAKA 2HRCA 5TF4A 1SQFA 1G20A 2ZQZA 2OLJA 3ESBA 5D5HA 2JRLA 1PL6A 3VHXB 1OROA 5LFAA 3WKAA 5FEMA 3H6GA 1ZRSA 2ERYA 2JJQA 1R8YA 4XJXA 4JK3A 2WNHA 1GZ5A 2D8MA 2HMSA 1FP7A 2XT0A 2G5PA 2RH8A 2HO5A 1IY9A 2PWAA 3N3AC 4NI5A 4Q4JA 5DRTA 5JMWA 1GL7A 1TCBA 3KDPA 1BE0A 5JVDA 1KJ8A 3DDCA 2PZ8A 1NDQA 2ZPAA 3UHOA 1M7BA 1DHTA 3JALA 3ZIDA 4RZXA 2HSZA 2V7GA 3T38A 2HWKA 5EUQB 4Q00A 1TMOA 1O08A 1N4AA 1QO0A 3VOTA 5JASA 3GRZA 1KK2A 4IDEA 4CKWB 1KP3A 3HL4A 4DA9A 2V8BA 3ZWXA 4F3NA 4BCDA 1SVWA 1ZJJA 3BMOB 3TNLA 4O2AF 3RNLA 3K05A 4MDFA 1P2FA 2NU6A 4PLYA 4M88A 1LJUA 3FCCA 4YI3A 1WPRA 4Q12A 1Y5NA 5ER6A 3WDLA 4NCBA 3IQIX 4UHBA 4DCJA 5BW5A 2LW7A 1INLA 1VHQA 1FX0B 2H2FA 3E2PA 3P7MA 5DSZA 5ALXA 3D1VA 4MUAA 4NG4A 4EY8A 2NQ8A 1UBOS 2A3RA 5CLFA 5CB6A 2QLBA 3LGSA 3T41A 4FI3C 5EKXA 4DIFA 5AHRA 1KSHA 1CUAA 5CA1B 4BX8A 4OLHA 4JI5B 3A28A 3K92A 3PX7A 4FMBB 3SF0A 5E7MA 3GA0A 3FCEA 4H1VA 5CDYA 1AUVA 2FWIA 2HZ7A 3BAFA 3C70A 3N2LA 4JOSA 3RFUA 3AKZA 3HG7A 3OY7A 1Z28A 2CLCX 3NAZA 3TSYA 1DLJA 3NDRA 4IGKA 3SC2B 2AMYA 3ESAA 1BFDA 2IE0A 4WCFB 2GN8A 3AVUA 1SA0A 4M89A 2ARKA 4RHUA 3T7EA 1PVDA 4RTSA 1UJCA 1KORA 3D81A 4OJNA 1XYVA 4M9XA 4JI8B 5TMDA 2FZVA 3H75A 3O7WA 2C04A 1YMQA 3H17A 4LXQA 4REQB 3G9ZA 5L53A 3GW8A 2A1UA 3I0ZA 4WBNB 4C7XA 3BRCA 2B20A 1Q1BA 1QYIA 3AUFA 3STUA 3CNBA 4NYMQ 1ECCA 4O8ZA 3DAOA 4RD6A 3ZXIA 4AMUA 2IPLA 4YYZA 2AOVA 4E14A 4E2ZA 2I6GA 4I4TB 4U7HA 4MGEA 4XFJA 3ZIAA 2HA3A 4S1TA 1JF8A 3U09A 1COWA 1A7JA 2CNWA 2ZIXB 3LNTA 1HEYA 1KQ3A 3FUWA 3LKZA 4QOHA 4UQPA 5COQA 2CYBA 4NENA 1ZGAA 4DCCA 3WNCA 1CJBA 1MH9A 1MABA 4J16A 1DJLA 2FNAA 2BMAA 1A9YA 3FWHA 2E85A 2WSLA 3RHFA 3H0EA 2BMJA 2NO6A 3OLZA 4KVGA 3NALA 4JLSA 4ICIA 2B8TA 4FD3A 4L57A 1CF2O 1GZVA 2FJ0A 3O8QA 3PA6A 4PLVA 4V0QA 5JNLA 2HFKA 3C5EA 4TROA 1WO8A 3VKHA 2VBCA 1NGSA 1OBHA 1QAQA 2W5UA 2ZJZA 1EJ2A 2R0QC 1RVDA 3QEBZ 2MYPA 3R9WA 4MB2A 5FR1A 2FEXA 3CRQA 3DCJA 1VPEA 3G8AA 3RJ5A 1I3NA 1VPTA 1N92A 3SSAA 3VKUA 3TRJA 4IVQA 1LVUA 3KV3O 3DZ8A 3KLMX 2A9VA 1JJFA 1WJGA 2BE9A 3KHTA 4KXUA 4PQFA 2OC4A 4CKEA 2EJWA 2PPVA 2VLIA 3NBYC 5ALTA 1R2QA 3NUGA 4QTXA 1DTWA 4DLNA 4EEXA 1JXMA 4X1KA 1SAYA 5CEJA 2RK6A 1W96A 1V2GA 4RSMA 3U37A 3S1SA 4N82A 1DC3A 1V9CA 2RAUA 5FWXA 2WB2A 3VNVA 2M1ZA 5CTAA 2UZ0A 1U3GA 2OM2A 2H00A 4Z4CA 3DLTA 4C43A 2XUDA 1I0ZA 3MT0A 1P1BA 2QJTA 5B1YA 1VFNA 1HSOA 1F0PA 1VG1A 3EQ8A 4WECA 1OY1A 1Y34E 2W4MA 3OKFA 4WADA 4FGUA 1WNTA 1RQ2A 4WT7A 2ACWA 3VH1A 3OD1A 1W5BA 2H4WA 3L1IA 5BT8A 1L9KA 4AQ7A 4E51A 5I51A 2BGTA 2QLJA 2VSQA 3V00A 1U2GC 1YS2X 4S2EA 1TO6A 5TNXA 4LF5B 3F46A 4MVJH 4YRFA 3T9DA 1FDUA 4LV6A 3AEKA 4I0WB 3ZZUA 4YC7A 5KNLA 3DL7A 3RFFA 2BELA 3ZWBA 4AWBA 3SX4A 3I2YX 2A94A 2V6IA 2BUBA 2YZNA 3AEZA 3QV1A 5KDDA 3OZGA 4IHJF 1JUDA 3F67A 4EVSA 4YCNA 4G1FA 4YCJA 1I7LA 1UPTA 1XLWA 2GXSA 2JS7A 1W49A 1E3JA 2PX5A 3BG5A 4M55A 3T7JA 3VOSA 1XAGA 4F85A 3EPLA 2OO3A 3TZKA 1JFSA 1C8VB 2C83A 4TMWA 1SUFA 1XYGA 3PNPA 4GMFA 4WMLA 3T5DA 4R54A 4DLBA 2ZUBA 3HJFA 1X7YA 2DWPA 2JFZA 4GI7A 2GD1O 3E7DA 2YMQA 4UHFA 3DFKA 2ZDHA 4GG1A 2ZU6A 5DFAA 4PANA 1KIAA 1PX0A 5FYDA 2X2PA 3O8BA 5A9SB 3L07A 3F74A 4WXPA 1Z36A 2FQ1A 1Z25A 3N53A 4NH4A 5CB4A 3EEOA 3MXOA 4C7OB 5B64A 4KIWA 3EULA 3GZNB 3KELA 4EF6A 3THXB 1OH5A 1J5PA 4JUDX 5IDQA 3DBRB 4U8GA 1O77A 4NBLA 3TE6A 2RH4A 1W75A 4MUYA 5CGQB 4YMTA 4NTZA 1FP1D 4I8XA 1NBWB 2OEPA 5JSZB 4GT1A 3PJRA 1Z0JA 1IMJA 1H5NA 2J41A 3GFTA 3GFGA 4LSWA 2IU0A 3H2ZA 4C30A 4YIKA 1KDPA 2D5CA 3HR8A 4IUCS 1RLUA 3G8DA 5KX5F 1OLUB 1P2TA 5EP3A 1WU7A 2A1TS 1GTG1 2XHZA 1HDEA 3H8WA 3FOEC 5JD3A 3VR0A 4Y2GA 3Q3CA 2PFGA 3GEHA 1IHPA 4YMVA 1XI2A 5F3RA 3CIFA 2IELA 3G5TA 1NFQA 2PH7A 1Q0RA 2XTJA 2V7UA 1OYYA 3I30X 4A3SA 4Z1OA 5ENDA 2AQKA 2CFSA 4HR7A 5BYBA 3J7AC 4BWVA 3PTAA 1YFLA 4BFCA 3O9VA 2XBLA 1GKKA 4MMZB 3NEJA 4NCXA 5ICFA 5KTKA 2P2LA 4U7TB 5ALJA 5AWFC 1ZY2A 2QRUA 2W8BA 1P44A 1R18A 2DFTA 3TG8A 3ORYA 2WAXA 3MW8A 4LJ9A 4RE5A 1U7OA 3N0TA 3VTFA 1SKMA 1OBOA 5DVZA 4DHWA 2FMKA 4JB2A 5DNWA 1PVOA 2CZGA 4YJHB 5C1BA 2QPTA 4Y98A 3H2YA 3CF0A 2M6LA 1T2AA 4V0SA 4WH0A 2ZCVA 3A9VA 3IT2A 3M2PA 4C4RA 3FLAA 3AB8A 5EINA 3E3NA 3EWAA 5DT2A 2ZS9A 3ZH9B 4H08A 3WA6A 4I5DA 2DSTA 3VVBA 4AUMA 1B6RA 2PUCA 4IZ6A 1O03A 4KO4S 4CMEC 1Y42X 2OESA 3IJPA 4ZGWA 1RRFA 4BLOA 1W25A 2QLFA 4BFLA 3FPAA 4OOFA 2ZXEA 3GJ7A 1CFJA 1I36A 2GM4A 3FHCB 4Y2VA 3AIMA 2ZRJA 4MQEB 4RF4A 5HIKA 2YHIB 3S70A 4CPDA 1ZUWA 5F51A 3VC2A 3WBFA 3SJAA 2B1RA 4W5RA 2PWBA 4IL5A 4DMCA 5HKOA 5LYJF 5B30A 5BV8A 5IKOA 2IPOA 2XGGA 3GEPA 4X3CA 4KQJA 5AW4A 3QWAA 5FOTA 4W8HA 2ERXA 2XT6A 3ZJ5A 2G1JA 3PDUA 4A73A 1E5TA 3T3EA 1FNBA 4ZI5A 5JAQA 3ZHYA 3AEXA 3HU2A 1TW3A 1Y9AA 1UXHA 3CRMA 3TNDA 4DUZB 2A33A 4UVHA 4MKGA 3LMKA 3IP9A 4A16A 2P5TB 4FYMA 1IATA 4IJ5A 3W7AA 4DXHA 3PNQA 5JJ5A 3CZRA 2Z4TA 4JQOA 3K9BA 4PHCA 4RD2A 3SXUB 1JI0A 2F1KA 2D2VA 4YDQA 2BEVB 2GB4A 4HWOA 1O9BA 1M2FA 1U2RA 5AXBA 4BATA 2ADMA 2OAGA 1Q12A 2ASEA 2B3DA 5I5EA 5DWVA 4NS1A 3ACDA 2B4QA 3G2KA 2UUCB 3B1WA 4C29A 2G9ZA 1K8RA 3JWHA 2QE7A 2KSQA 3FBGA 4Q37A 3DAPA 2C5AA 4XGRA 3ZVNA 1F2VA 2VYCA 2XADA 4YJDA 3B3QA 3FCSB 4GF5A 1DXHA