3KSAC

Detailed structural insight into the dna cleavage complex of type iia topoisomerases (cleaved form)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
226
structure length
220
Chain Sequence
KLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTAKAKMADILKNEEINTMIYTIGAGVDFSIEANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALPPLYKMSKKKEEVAYAWTDGELEELRKQFGKGATLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDNVKFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis of Gate-DNA Breakage and Resealing by Type II Topoisomerases
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Isomerase/dna
molecule keywords DNA topoisomerase 4 subunit A
total genus 55
structure length 220
sequence length 226
chains with identical sequence D
ec nomenclature ec 5.99.1.-:
pdb deposition date 2009-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
C PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.670 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ksaC00
2XCTB 1BGWA 3FOEC 3LTNC 2RGRA 2XCOA 3KSBC 4G0WA 3RADC 4Z53A 4KPFC 4KPEC 3K9FC 3L4KA 4FM9A 4Z4QA 4J3NA 2XKJE 3QX3A 4G0UA 2XCQA 4G0VA 2XCSB 3RAEC 3RAFC 2XCRB 3L4JA 5EIXA 4Z3OA 3KSAC 1BJTA 4KOEC 4I3HA 2XKKA 3FOFC
chains in the Genus database with same CATH superfamily
3PGJA 3PTLA 3QX7A 5A9TA 3I9LA 3EMVA 4LHXA 3D7MA 2I2FA 4IF6A 5SYAA 3VFDA 1BWQA 1K8XB 2CMKA 3BHNA 2CZQA 3NASA 2OM6A 5FTWA 3LRPA 4A8JC 3Q15C 1AB5A 4NARA 1DWQA 4ZU6X 2DT5A 1ESEA 2L69A 1Y6RA 4RFLA 4TMYA 4EB8A 4R2XA 4M3NA 5IBCA 2OVBA 3LP5A 1JIKA 2J3LA 4S0XA 2ZJ4A 4BIIA 4BO8A 4HTFB 1WMEA 1B8OA 1YR1A 4U9IS 3C1AA 3EGOA 4EH1A 2EJVA 4HWKA 2QM8A 1EUDB 4L3OA 3TTWA 2IS2A 3AR7A 2EVWX 1XMXA 2ZAMA 3M82A 3QVTA 4N8EA 3R0JA 5EZ5A 5DLPA 3TB6A 4LJ9A 1SXGA 2XRMA 4DCGA 4IHAA 1G21A 4CGYA 2XCOA 3WHKA 2VS1A 4EYGA 5L3ZA 5AW1A 4LFBB 3CC8A 4UHKA 3ZS8A 4LDPA 3LL7A 1Z7BA 2F8LA 5KQLA 1XVIA 3PNKA 3ZU6A 4LNHA 3RYIA 1D4FA 4KLAA 4L0MA 5EXDA 4G5FA 1E7YA 2X9NA 3EEFA 3VC3A 2YN0A 3WL7A 4F3YA 4WCDA 3H2YA 1DC6A 4ZPJA 2CWWA 1ODTC 2P78A 3NU1A 4DVJA 1KI8A 4TRMA 3O21A 4F5ZA 3BMNB 4Q01A 5BN3A 1YQDA 2ASVA 4ZANA 3R3SA 4ZVVA 1CUBA 5I5GA 3MERA 1AZWA 3UANA 4D8YA 2PPVA 2Y1OA 1I4WA 3DAGA 2PV0A 1XYYA 1A9SA 2A9OA 5A0TA 3A3OA 3TL2A 5CD1A 3OTOB 2IYOA 3SZLA 2ZS7A 3KR9A 3H87A 4B3XA 4B5KA 3SMQA 4KITB 5B7PA 1EE9A 1JILA 1EVJA 3BX1A 3W2TA 4HGZA 4DXHA 4XVRA 5BUCA 4J3FA 4PXAA 2V7TA 4YMIA 1BSVA 3VR3A 1P2TA 5EIBC 4YUAA 4Y2SA 1NNSA 1FYFA 2R25B 2XMBA 4ETNA 3SE7A 1KEPA 1PL7A 4HDMB 4MGYR 2C4TA 4C4YA 3LUDA 1G5HA 4KQEA 5JS6A 3LLMA 3SZMA 5EXXA 1CZKA 1FTNA 1DV1A 1KZ1A 2ZRDA 3AONB 3P2YA 4Y2RA 5DWDA 4DSUA 2Z8XA 5J4HA 2AOVA 1IUKA 4X3PA 3W6ZA 3CY6A 2FZEA 1XHEA 2Q45A 1B93A 1NZJA 4JQZA 5CAEB 2QTFA 2VRBA 4OGGA 3V9PA 5AK5A 2OESA 2VYQA 4OVKA 5GPBA 3TM5A 4YJHA 5IJ0B 3TG8A 5EPUA 2X0FA 1G1AA 3LXMA 4L95C 4XWTA 1Q0ZA 3FYHA 3TLKA 5AR1A 2HCBA 2PKRA 2IC5A 4H35A 2PX6A 1N3BA 4MWTA 5DBHX 3V7UA 4BNDB 3GLIE 3A70A 3D81A 3Q7SA 2HBZA 3OE1A 4JL5A 4Y6SA 4KUGA 5T4HA 4KDRA 4YV0A 3U37A 4DR5B 5KTRA 2EGGA 1JAIA 1U2QA 1H3FA 3B12A 2BTEA 1MF7A 2B4RO 1UKVY 1XT6A 1JU4A 2OZVA 3EBLA 1BS2A 4PW0A 5IK2A 1YC5A 4BNTA 1U0BB 1UJCA 3GGJA 4OXIA 3U1BA 2I4OA 1G8JA 4Q21A 4QTUB 3JZAA 4B75A 5T4FA 1CQIA 3Q6NA 3NZEA 4F1KA 1LBTA 3KU1A 4ILEA 1II9A 5BSEA 4G5YA 5E7MA 1MO3A 1W1UA 4EHNA 4GZ3A 5K0BA 3N8IA 2FXVA 1IK4A 4YS6A 3GUZA 1NAIA 2CCKA 1EFDN 2RGWA 2DUMA 3I39X 4QWWA 5TB5A 4JLSA 2J9FB 2MSWA 2PDAA 3UCFA 1AQ6A 1UCFA 1YR6A 3A1VA 4DUZB 2PS3A 5HE8A 3I04M 1I3KA 1N2CE 1W29A 2HXYA 5AESA 3TDKA 4YMUA 3GDGA 1I24A 2GDJA 4FEGA 2BF7A 4IYRA 2RIRA 3BM5A 4R31A 1P45A 3MHPA 3C6YA 2JIMA 2NU8A 1PJBA 1D0SA 2JIDA 1J09A 2P2DA 5EN4A 2J6IA 4GOOD 1U2GC 2X6QA 3ZE8A 2EW2A 1GEEA 1MIOB 3I0NA 3BWDD 1XTSA 2BMDA 2Y0CA 3A4NA 4HO1X 1TNDA 2VCEA 3BC1A 2G17A 4WSOA 5KAMA 2WB2A 3O9MA 4MA4A 5JJCA 4OYRA 2W58A 4R40A 4DRZA 3O3OB 3CZ9A 4DSNA 2GZDA 4MKIA 4ZIRA 3QVJA 4P3PA 2R1ZA 1N0IA 4M9XA 5B58C 2CSXA 4BGUA 4PLFA 4KE6A 2POQX 1CJKC 5LKRA 3T9CA 4QFMA 3T12A 4CCYB 1T2FA 4JQYA 4KN9S 1SUEA 5BMVA 1U2DA 2II6A 4J0KA 3FKSA 1USKA 2YWXA 1G60A 2G9VA 1M6VB 3CNOA 3ZVNA 1VSUA 3CNLA 4DV3B 4KGVA 1V39A 1EJ6A 4X44A 3E9CA 5IK2D 2ZM5A 1JDZA 2VHYA 2Q3DA 2FPIB 2BJHA 3A6JA 5L95A 3PLNA 3IUNA 3ZDYB 3EAGA 3NO4A 3HA7A 4PY2A 3EQ7A 4FTWA 5K99A 3U4GA 1Y33E 4EMTA 3A4YA 2VH5R 2Q7DA 5HIKA 1G4UR 2BGJA 1M8JA 3L7KA 4O02B 1L1FA 2HAEA 1DC3A 5ES4B 1VRVA 2A6PA 2Z2KA 3QU9A 3KKMA 2AN1A 5BORA 2XVXA 3OH8A 1AS3A 4GT1A 1E7WA 1HUQA 1KETA 3B6MA 4TTTS 4DCJA 3MWLA 2XUDA 1M1NA 3G0HA 5TMDA 4UAVA 3DPIA 4DIKA 1MB2A 2W2QA 4GZ6A 4PLTA 1M8FA 2R6HA 1T4DA 1VGRA 4PYNA 2ZQYA 3VU0A 4BO4A 5JZOA 2EEZA 1JAZA 3Q8XB 5AOAA 3VR0A 3OLVA 4V0ME 3PX7A 2RD2A 1YUNA 1V2HE 2INGX 5BQ5A 3IKJA 4TKMA 3WWCA 4DLXA 1FIUA 1Z33A 3RYTC 4NEGA 1R0WA 3SYKA 1P2BA 3CLUC 4FCCA 1YFZA 5IEJA 1ZM3A 1ZRHA 4POOA 4X6XA 1OLUA 3A9TA 1LJ8A 1PX2A 1USVA 3RM3A 1WXGA 2EQBA 3ITNA 4UE6A 3NIWA 4JEHA 2P69A 5E1MA 2K7ZA 2O7RA 3LXRA 1F7VA 1THZA 4MW0A 2QRVB 1MOQA 2ZJ7A 4WZAA 5T6BA 3M7IA 1EFLA 1IMJA 3FI0A 2L42A 3PUYA 2ZRAA 3CH6A 5JO9A 4I9UA 3I09A 2XBLA 4JB8A 3KD3A 2WTBA 3EXFB 2F3TA 1O4WA 2OG1A 1WMFA 2VQFB 1U7HA 4MVYA 4HVCA 4UARA 1C0KA 1AO3A 2HYDA 3A4LA 3LVQE 4WXEA 4DABA 2RK6A 4NHEA 4ENVA 4NL4H 4L3WA 3QWBA 3VQTA 4ND1A 4QODA 2QLFA 4W5OA 4YUWA 2QPOA 3RYFA 2O8VA 3KKQA 4KGZA 4ALKA 2QGFA 4AQYB 4MUXA 1U0RA 4FW8A 5ESDA 3UCXA 1B42A 2QF7A 3GPBA 1C8VB 3RTBA 1SAYA 1KAEA 2YWGA 3M4ZA 2NU8B 1QUFA 2QD5A 1F0KA 3E9RA 1Z0KA 2J46A 3ANTA 4WKOA 4WOKA 3T35A 5E3JA 1KC3A 3WYNA 4R2KA 4D0SA 3CLVA 3LX6A 3E8MA 2O2HA 5CT4A 4DR2B 4U7DA 3L7NA 1XAIA 2IEZA 3EGVA 3Q7IA 3ZWPA 4B74A 2GKGA 2XYPA 3ESYA 5JAOA 4MB2A 1T0BA 1KDPA 1ZOOA 3TS1A 3MJDA 1Q1AA 1ZR2A 2R7MA 4JU9A 3TBHA 4S05A 3M5PA 1Z6YA 4RELA 3C0KA 1DHTA 1UDBA 5H5JA 2F3RA 2ZRHA 1LSSA 3MEQA 2WE8A 3NHSA 1UF9A 5LDGA 4XX0B 1E3JA 4LHVA 4B48A 4HKTA 3P7MA 4DV2B 1GVHA 4MIYA 3FSJX 5DSTA 1T5LA 1PEDA 2NTVA 4Q37A 5GADl 2GF0A 4GKVA 2GJ4A 2VLIA 1Y89A 3U3DA 3R7NA 1JXMA 4GP9A 4MYUA 1R88A 3K2BA 4BFTA 1J9ZA 4CM9A 2XB4A 3D43A 3DVRX 2QRVA 3QEKA 2J0UA 3M1AA 3F5FA 1XZFA 3FZEA 4IIXA 4JEMA 4WZAB 4I2VA 3FTEA 3DV9A 2ACEA 1XZIA 1XZPA 3PV0A 1QP7A 3ZYZA 3EGIA 4MRMA 2IHNA 3ZWWA 1APBA 1ZW1A 2FG5A 3PUWA 3MWEB 2AZMA 2O3RA 3TW6A 3KTOA 3W5VA 1A8SA 3AM5A 3TTXA 1W36D 1UJ4A 5E9WA 4KQ2A 2D0IA 3ONWA 5T3UA 1KWGA 5FOVA 2GJ8A 4ZYUA 3O3NB 2IGTA 3T5MA 3Q8WA 4AW9A 3KPWA 1ZA1A 3L40A 3RU9A 1VIYA 4H27A 3TEFA 1RACA 4WBNF 4TYNA 1QFXA 1QF7A 1HT2E 3FJYA 3O4VA 1YR9A 4ANFA 5HCNA 2C5FA 1BEEA 7REQB 2P4QA 4V2IA 1KH3A 3OQIB 2XEDA 4ARBA 3ZCSA 5HGXA 3QVUA 5BPHA 1IXZA 1XDBA 1XG5A 4KZKA 2ACVA 1G64A 1NJ8A 5G0WA 4E2ZA 1EGAA 1NC3A 5H3LA 4ZRDA 3HCBA 4BEVA 5L3SB 1R4ZA 4DR4B 4B87A 5JISA 3WMRA 3DLAA 1YRLA 2KLBA 2XTNA 2QZJA 3M34A 4FMCF 2XUZA 3I53A 5DHRA 4AJEA 1R64A 3I0ZA 1SELA 1D5WA 2QUKA 2RG7A 1YB1A 4ENPA 5J47A 2J85A 5LDHA 3KQNA 3ZWKA 3ZWXA 4BWVA 3BE6A 1FNNA 2V3CC 1S3GA 1BX3A 2YFKA 3SZRA 3SNKA 3TTTA 2JFYA 2HXGA 2QTHA 1FYXA 4RL6A 2G88A 4UU7A 4AVYA 4AI6A 1HSZA 2VSYA 3L7AA 3VTKA 3UUGA 3OI7A 3GA0A 3RRYA 4MVJD 1BA2A 2ETXA 2Q1YA 2AC7A 1RPTA 4JJGA 4L78A 5AXBA 3GYGA 1D5CA 4DIMA 2Z56A 4QBIA 2QBYB 4G9GA 2CVOA 3G6KA 1XTKA 4MUFA 1SVWA 1L7NA 2BUAA 1E9RA 3UHPA 5K8CA 1JE1A 1J8FA 1W94A 4QNRA 1E5DA 3WGHA 1L7RA 3ZDZB 1EVEA 4PZZA 4G5GA 2J30A 4UHHA 5A4FS 1UL1X 2C59A 4JOQA 2ZPAA 4F1WA 4ON9A 4Q4AB 3PPVA 4XD2A 3IUMA 3BOSA 3PQDA 3Q1LA 3OHMA 4QDZA 4IO1A 4UJ5A 4Z99A 4DCUA 4ML3A 4K8OA 4IYJA 2GFHA 1COZA 1O6GA 4Z49A 3V5NA 2CDAA 1A7UA 3MMSA 4MEAA 3IP9A 5KTKA 3D8SA 1GV1A 1CR6A 5LP6A 4CJXA 4TVSA 3AMVA 3D1VA 2XDAA 2WJ4A 1Q22A 4BV9A 2FLVA 4HN9A 5AW2A 1SB9A 1PT5A 1JLLA 3M1IA 5LD2B 4GR9A 1D04A 3PUHA 1AZTA 1IQRA 1GPNA 3K72B 3D7NA 3W5UA 6REQB 2CNBA 3KO8A 1WF6A 5J2TF 3FNIA 1C3LA 1RHRA 4K1LA 1A82A 1NY6A 4PGGA 4B43A 4G0QA 4L7QA 3B1VA 3ZCRA 3ESXA 2VBGA 3JQPA 3AZQA 521PA 4S1WA 1Y5NA 4B3MB 3WBBA 3CO0S 4QG7A 2GERA 2F43B 3RS0A 3TSZA 1J5EB 3VR6A 3D59A 3NS7A 4N6OA 3I92A 4U0JA 2ZYTX 3SHVA 3RSOA 1QH8A 2M1ZA 1SHJA 3RRMA 3HE3A 2D8MA 1MOPA 2D00A 3N07A 3KXPA 1UK8A 2RGCA 4I4NA 4MVJA 3Q9NA 4OYYA 3UT0A 4EG5A 2R5NA 2IPLA 5GV8A 2P9YA 5IVHA 3F9RA 2JDID 3RARA 1X3SA 3ZV7A 3X1DA 3JTMA 3DYIA 4YFVA 1YJXA 1W30A 1MX3A 3AVWA 4BQIA 1JEQB 4URWR 3AY7A 1UZNA 2A0KA 3DPSA 5LIRA 3THXA 4PYQA 4PNHA 4ZOEA 3STHA 1K8QA 3K09A 3KDPA 4PZDA 1MHPA 3B85A 3IEXA 3EIOA 4FFLA 5EJEA 5EIEA 1Q1ZA 5KTSA 1EWKA 1U11A 3SX2A 2OPHA 1G3IA 2EP8A 2NU7A 1T2DA 3HV0A 3N70A 3U9SA 2ONJA 5EXEA 3E81A 4CHGA 1I01A 2XXJA 3B5IA 1YU6A 4TLAA 1CRQA 4INZA 1BD3A 4RPLA 3KTAB 2WM3A 4DNPA 4ZVRA 1NVAA 4RTKA 3EDYA 3EXG1 4WK6A 5CRIA 1YRWA 4MW9A 2NV0A 3LBHA 2WKRA 2GBCA 2YNMA 3PE4A 3R41A 4JI8B 5JJIA 1RAFA 1F1BA 1NUAA 1PP4A 1CUXA 4RVHA 2BI4A 3FBTA 3RTAA 4UFNA 3TOXA 1ZG3A 5CXQA 1YVPA 3UY4A 2OFFA 3W6PA 4RKEA 4D9IA 1VL6A 2B82A 1I36A 1T9HA 5C5CA 4M86A 2RE8A 1OGYA 2VVTA 4AY2A 3H2HA 2H8GA 4E2YA 1WCIA 3DA8A 3GRPA 1JWBB 1LBIA 4E5DA 2G77B 3A10A 2GZAA 3FDXA 3VNRA 2JFFA 5ERGB 3DR5A 3GI1A 4DNOA 2ECKA 2AQHA 4EHIA 2OGZA 2VNJA 2D06A 1Y7PA 1K0FA 3AVPA 3KCNA 3WYAA 3GJ0A 3L0BA 1EU1A 1E1RA 4EB0A 1CG6A 2PRIA 2JFQA 3R7LA 1KIMA 5FOTA 5FOSA 4FS3A 3AWIA 4PV7A 3PNLA 2H2GA 2X3YA 1DQSA 1QANA 3QNWA 4K0RA 3RVMA 3V2GA 1GCUA 1ZMXA 2VYVA 1XL1A 3VKFA 4YV1A 1BWSA 3X2SA 4G0UA 3KQKA 3LT2A 5HIMA 1O9HA 4CM6A 3V7YA 3QF4B 3I8OA 3TL6A 2IDJA 2FUCA 3EXHA 4WFIA 4LGVA 2AXNA 5AKZA 2GR9A 2HQSA 3IIKA 2B4YA 2RGUA 3OCWA 4EO4A 5INTA 3QKSB 1CVRA 1ZHHA 1U3TA 2PSSA 2V6MA 2ZSKA 3H9BA 3I73A 3K4PA 4IDGA 4N7RA 3ICEA 1X74A 2IE0A 2Y3IA 1EVZA 1LFDB 4FN4A 4WOPA 4CXMA 3IQFA 4ND8B 2TSYB 3ET4A 3GFSA 4BUJA 4OMFG 2QE7D 5M3BA 3KAQA 2IHUA 1X9IA 5IAAA 3C4VA 3ZWYA 4GG1A 1L4BA 2NV2B 3F6BX 2VF5X 1HDIA 4EGSA 2ZS8A 1RCTE 1L5NA 3L0YA 1U4SA 4WK2B 5IYZA 5K20A 1D9ZA 1G19A 1W25A 2GCPA 2ISQA 2MIIA 3KYCB 3N8KA 4ZXFA 2AL7A 1UKEA 2MYNA 3OM0A 1XV5A 4N5MA 2QP4A 4ZVLA 1OFTA 4BKQA 3SQMA 2OWEA 3ROFA 1RDFA 2VWPA 2FCAA 3OICA 4E6EA 1T0PA 5BSTA 1K5DA 3DMYA 4C04A 1VJ1A 2ZAYA 1Z5NA 5ESXA 1GCOA 3SHFA 1DO2A 4II2A 1OFUX 3KB2A 4IDEA 4R2HA 1X80A 2E89A 4P3NA 5NULA 3TI7A 3MD9A 1H5UA 1X1DA 4KBYA 3DXFA 3GFTA 4ZEXA 4A73A 5HBGA 1K1EA 4QU5A 5BOVA 4PWYA 4CLOB 3ZLTA 2I65A 2JLAA 4RSMA 5JNRA 1KHTA 3R40A 3AVYA 3OWOA 2C9DA 4JITA 3UJBA 2RAPA 4R1NA 2GBIA 3K15A 3TJMA 4DR3B 3RFXA 1XJCA 2RK4A 3Q3HA 1V1RA 2FEWB 3L6CA 4K1XA 2Y6VA 3QLUA 1OXSC 1GR1A 1QVVA 3INYA 4H60A 4MVCA 4EL5A 3PC8C 1MFZA 3AOEA 4TTVA 1FQWA 3FBWA 4XW2A 5KVAA 1ULTA 4C7MA 1T1RA 3KKOA 2GEUA 1DBWA 2PEZA 1A50B 2FA9A 2YBEA 4ZP1A 3V1TC 1A9OA 3O4RA 2H3HA 4I66A 4CTJA 3IQDB 4WKCA 1P1CA 5D1HA 1II0A 1VKNA 3EWIA 4QUJA 1ZC3A 2Q0QA 4IMIB 1BG6A 1V5IA 1YZQA 4Z1OA 1NFRA 4PLCA 3JVVA 4R1SA 2JCVA 2V74B 1TO1E 1FBNA 1E9SA 4FHDA 4JBWA 4BTEA 1STOA 1YAJA 1ULAA 2BMEA 3B3AA 3WDMA 3MJ4A 3G89A 3TQOA 3WRXA 5IT0A 2ZCUA 3SKYA 2C31A 5REQB 3RVPA 4FILA 1G9TA 4JL6A 2PH5A 2WDZA 1EUQA 1Z4JA 3EUEA 4XX0A 1N2ZA 1SXJE 3I5MA 1MEEA 1XPOA 3KQQA 2JCXA 4YB8A 3CVYA 4EA6A 2H17A 2A9PA 1OJ7A 1Y42X 2QN8A 4F3CA 1XMSA 2CBXA 1G6HA 1RXUA 3B38A 3DFZA 4JSYA 2B6NA 4ZJPA 2R4QA 1G21E 1LA2A 3MCUA 3USZA 2GAIA 2HQ1A 4BNWA 3IPYA 2PANA 3NM5A 3R9XA 1JHDA 4LYEA 4F84A 4ZCRA 3UHAA 2UZIR 3T06B 1OGIA 1TE2A 3O3MB 4KDEA 3MGBA 3IVRA 2FAXA 3C7KA 1LDMA 3MJRA 2HHLA 3L46A 3OZUA 4KHZA 3D3JA 4GM4A 1XQXA 5KWEA 3HB9A 3H99A 3NEAA 4NAUA 1GA4A 4CKEA 3BQ9A 3NHMA 1ODFA 1T0JB 2QTZA 2N9UA 1QLWA 1NBAA 1UPXA 1IE3A 1KJ9A 2BUBA 2OO5C 3KPVA 3QY0A 3R1IA 4GYKA 4WINA 4XYGA 4AKGA 4UBOA 1LZKA 2BGUA 4D9EA 1Z0IA 2K4MA 1IULA 2FRDC 2OHVA 3LRXA 4QUBA 1G9XA 5JANA 3IL2A 1JJIA 3GEMA 1B8PA 3DM9B 1XCLA 2GX6A 3A4MA 3FCAA 1L4UA 4LZJA 4JI7B 3VKWA 4EECA 1E1KA 3ZWVA 1NA5A 4M1OA 2F67A 1U9ZA 3CRQA 4C7OB 4Q1VA 4NFYA 1K7YA 2QL7A 3H5NA 3OJ0A 4JX8A 4NXMB 3PC6A 3LOUA 1SC9A 3HLTA 5LQAA 4WMLA 2OXIA 5D6OA 2I6SA 3QZUA 4Z4GA 1Y8QB 2YX1A 1M2FA 2R6DA 3DW3X 4LRUA 5FD8A 4IFEA 5JYEA 3FTFA 3GJ7A 4C20A 3EXEA 1NFQA 5LUBA 5B57C 2BSXA 1Y6ZA 3VYSB 5IN4A 3S5JA 4KXQA 2BR3A 4HGPA 1D7AA 4P3OA 4C0HA 4RD2A 1U2EA 5U4QA 4UZFA 4C6TA 2DT8A 4XD7A 1S1MA 3HVUA 4L73A 4AJ4A 4F21A 2VDNB 1OA1A 3MF4A 1V0JA 3PXAA 2DUNA 5AH0A 4R05A 4X1IA 2JAHA 4BVKA 5HMLA 4U7GA 5D3ZA 4J1NA 5C1IA 2J09A 3GLHB 3KR1A 5GJWC 3SWWA 1BMFA 1PKEA 1NBME 3LHDA 3ST7A 3TNFA 3PR1A 1HA3A 2ZB8A 5COQA 5HF5A 4XSVA 2WUGA 1JYEA 3VHXB 5LQUA 3H05A 4NBNA 2V7GA 4MTLA 1Q17A 1FMCA 1IWBB 1SXJC 1L4FA 3FI9A 1L8XA 4JBYA 4JJ6A 4MWEA 1H23A 2R44A 1QAQA 1UIMA 3DDSA 1TRHA 3ZKAA 1AK2A 3K7EA 1U2GA 3ZJ5A 4Q05A 4R2WA 1DZIA 1U94A 4XVQA 5DTRA 1ABEA 4S0ZA 1K3FA 4DA9A 2H6EA 1USIA 1BE0A 1S3IA 2Q8QA 3U4QB 5M7EA 2CXXA 4KW7A 1QMGA 4ZTUB 4JBNA 5TJHA 3WK8A 3GCXA 5FB3A 5KUTA 1XWFA 1Z38A 1QF6A 5AI4A 1P9RA 1MRZA 3UOGA 4GBED 1BFKA 4B2LA 4HEHA 3RREA 2AJCA 4YMLA 1QHGA 1CETA 2FF7A 2ZAOA 2UV8A 1QYRA 4FYHA 2DJ5A 3EGDA 3FSEA 3HGMA 4PXYA 1E3SA 4WXYB 1F14A 1PGQA 2X6RA 2H9AA 2P9QA 2B1IA 1EYZA 3ELWA 4GVPA 4JJZA 3W0LB 2VT2A 1HDOA 4MJ7A 3O2NA 1JZQA 1UDXA 1QYCA 3KHTA 1ENYA 1TT7A 1QP4A 1NW7A 3C3MA 2CCJA 5C8XA 4EUFA 2G0NA 2Y66A 4K9MA 3OURA 2OCIA 1T29A 2AF3C 1YKSA 4N9QA 4G24A 2B5VA 1T4CA 2J4CA 1BE6A 2V7VA 4DLUA 3K94A 1ATZA 4PONA 1RKXA 4ZT7A 5FJIA 4ZJZA 3I5YA 3N0RA 3TBKA 3W5BA 3AM4A 1JLSA 5I7VA 1PLLA 2FUG1 2H92A 2W48A 3IIIA 5JI3E 2X8JB 5JMOA 1SC3A 5YASA 4TLEA 3KQOA 3N0TA 3H13A 1MH1A 3E35A 4AKTA 2DM6A 4RTQA 2CL5A 1BFDA 2REBA 2QRHA 5I48A 1E3TA 2IYLD 4MUNA 1ZC4A 4EA7A 3C7TA 4R0MA 4JYBA 2ZU0C 1RQ7A 4W8GA 4QLAA 3AHDA 1MB4A 3IP5A 1WUHS 5LMNB 4KKVA 2VP9A 1QK4A 3JV7A 3EQ9A 4CM3A 3GFPA 3EVEA 2H0QA 1D07A 5B12A 4BV8A 2JVJA 5AVYA 1QCDA 1ZM2A 3RAPR 3G5MA 1X2BA 3GD5A 3RI3A 2I2CA 2DWOA 1P60A 1NGSA 1UM8A 1UBEA 1MOSA 1SCNE 2REQB 3C3CA 4Y0VA 5F23A 3V1KA 2PZBA 5FEUA 4ENTA 5TQ2A 1P2VA 4C01A 5FJJA 3WLNA 1ZITA 1Z06A 5KYVA 3OKCA 5KWSA 2IYUA 4U6NA 1X7WA 1YOVB 3T3DA 1YA6A 2CT8A 1PLJA 4LNUA 3TF5A 2I1VB 1DHRA 2J3HA 2V9ZA 2EG5A 4K9LA 1WCWA 5TT1A 5EOVA 4A2PA 4Q9HA 5AVXA 1P0FA 2UZ4A 1L8LA 1Q12A 2VTVA 3CT6A 3U3XA 4MHOA 2OZLB 2NUPA 2RK3A 5J23A 3FVTA 4V0RA 1IZ8A 5WRFA 1U1GA 4TYYA 4F4IA 5B2FA 3IQXA 3USCS 1VG1A 4RD3A 1CR4A 3CKMA 3OJEA 3AY6A 1G291 5F3DA 5T41A 3RABA 3BGOS 4KR2A 3EG9A 3GZTB 4FP9A 1EFHA 1JUDA 1OREA 3EJWA 3VPXA 4A9AA 4BNZA 1YZ3A 2FWPA 2P9BA 3KZXA 3Q0IA 2NX2A 4RJ2A 5FORA 4WY2A 3GLHE 3GLRA 3JYNA 5BVHB 1Q7TA 3CBQA 4RSGA 1DRKA 3ONEA 3N7UA 3FOAA 1W2WB 5GJVC 5E3HA 4PNPA 5AW4A 3D6MA 4B3BA 2VPYA 1ESNA 1BQ4A 4NIMA 4CKBB 3L1UA 2I67A 2YR0A 3DAOA 3QRWA 3KU4A 4MXDA 4YAGA 4FDMA 3PYMA 1VPWA 2NPFA 3K0SA 3RSCA 1I1OA 1FNDA 1TEHA 1O5IA 1TGVA 2Y9MB 3IPCA 1TQ4A 2PXCA 4O5AA 4C2AA 2G36A 5C5DA 2Q5HA 4I9NA 3BSYA 4TWBA 4TXLA 4O29A 3NH6A 1B3BA 1Y9ZA 3BE5A 3HJBA 2VXBA 3LS2A 5AVQA 4K2HA 2HMAA 1ODIA 1ZD3A 3PICA 1B76A 4LRXA 4ZU1X 4LYJA 2TS1A 1UP6A 2YVKA 1EX9A 2DJIA 3GDHA 3GJRA 3WSVA 4A8TA 2FEPA 1JW9B 3CUTA 4IV0A 1SHLA 3I32A 2GBLA 2O2DA 4RD4A 1TM2A 2EKBA 4JFAA 2XJ4A 4D9FA 3DJFA 4DIUA 4MDHA 3QELA 3RIMA 3HKBB 4YC7A 2OXRA 5FWXA 1NR1A 4B84A 1BVHA 1XVAA 1O94D 1VL2A 2CBZA 2FUKA 1FB5A 2HJRA 4LDAA 1I3LA 4LYHA 4M83A 3DZHA 3RU7A 1PHPA 1QYXA 1TUIA 4XWWA 1JBEA 2J3KA 2CHFA 3QVWA 3A1SA 1MEOA 4GKBA 3IJPA 4HFRA 2FNAA 5JDCC 4WKPA 1EWYA 4DNQA 4E09A 1UJMA 4QXOA 3T1NA 2GM4A 4TUYF 1XZGA 5FA6A 1AMNA 4IAOA 4YP7A 3M5CA 3K35A 4ZOBA 3C6MA 4UMFA 3KKEA 3IPRA 4FU0A 1NZFA 4HN2A 4QPCA 1TW2A 5EZSA 2QQ0A 3VGPA 2GPAA 3MCWA 4AZSA 1SHZA 1KQFA 1E61A 4PLVA 5KJFA 2ZJOA 4WNCA 4QQKA 4FHZA 2PGJA 5EJ7A 1GT6A 2GUWA 3UMRA 2WT8A 1S4QA 2KBFA 1A0OA 3SYNA 4D5EA 3SLGA 5HIAA 1IUNA 1KI4A 3THWA 4BGEA 3ZDEA 1JH9A 1M6WA 2XQVA 1Q0PA 1U9IA 1FRZA 2XGSA 3MMPA 4OFBA 4PPFA 4DLKA 3GLGB 3FNQA 3A6EA 2YWHA 1O9GA 1B74A 3ENQA 2NUPB 3WX0A 1IHOA 2UUPA 1XRLA 2Z09A 3H6HA 4CN8A 1HM5A 1M66A 2NXJA 3OCXA 4HAYA 4AS2A 1OH5A 1VLZA 1WXXA 4H7DA 4I1IA 3QPVA 3PX3A 4DE5A 5ADWA 2QN1A 3AGQA 2BFBA 3CLTC 1F2DA 3CUYA 1YQQA 3GWZA 1RADA 3ULKA 4NBSA 4F71A 1CQZA 1JKMA 3IT1A 3UT6A 5JZMA 4DMFA 5KHOC 4XYEA 2C2MA 2PYIA 2YHSA 3DOIA 1Z25A 1Y1LA 1CW2B 1NXTA 2C5HA 4LXYA 4P0QB 4C3ZA 4HOYA 1ZK2A 3BXFA 4XIFA 3VSDA 2ATXA 5DNCA 2UYCA 2AFIA 1WX1A 1JDTA 5JQWA 1VMIA 4RQBA 1T1JA 2H7XA 2NSJA 4YDRA 3VBEA 1L5HB 1N4DA 1WD7A 1G20B 1WEKA 2O57A 3PRJA 4X1OA 3D2AA 3P0FA 4EG3A 1LI4A 1VOTA 4YJDA 2OXFA 5DH9A 1IY8A 1FRVA 1YI1A 2X0JA 3W4JA 1NVMB 1Q0QA 1YL5A 2K2QB 3R3HA 3S2SA 4R1QA 3LHFA 5AQ1A 3G2OA 1EWQA 4AKIA 2HMUA 4I19A 3BGIA 1FP4B 1E5QA 3QW2A 1VG8A 4JUAA 2JA2A 4UZSA 4RHUA 3KOOA 1MPTA 1R4NA 4UFPA 1QO0D 1YASA 1DTWB 3EPLA 3WNZA 1MH9A 4DWVA 2XCRB 2I22A 5JCOA 1TVCA 4D8TA 1U04A 5KDOA 3N2IA 4TROA 4EBBA 1KVQA 2YYAA 2XNJA 4EQ6B 3WKCA 1IBRA 2CMFA 2Q3BA 2PH1A 2KI5A 2QUJA 3QE9Y 4RIEA 4FSHA 1TYAE 2YJTD 1KS2A 2C97A 2ZYUX 2PCLA 3HR4A 1PR2A 1PK7A 3Q7TA 5FO0A 3DO6A 2DFLA 1H1TA 3RKUA 3VVCA 1DP4A 4LF5B 5TSDA 1E69A 4C14A 1L5GB 2CCGA 1XNHA 1XCJA 2IPXA 3T4PA 2GVZC 1AKTA 1Z5PA 4XVUA 4ARIA 4A23A 4XYLA 1X7YA 3R3XA 2C07A 1QG2A 1YS9A 3GVXA 4NBTA 4EG0A 1QIIA 1SNYA 2NP6A 3UXYA 2XODA 3T5BA 3KOXA 4M88A 1FLAA 3DNFA 5E3IA 5DM70 1O9BA 5A0FA 4OO3A 4RQAA 4WXMA 3CIFA 5CA1F 3UOWA 2I4MA 2UYQA 3TO5A 4YRQA 3BMOA 2XDYA 4Z0PA 3FUCA 3PKJA 2XMSA 3O91A 4QYSA 4BCDA 4C7BA 2GSDA 1TLTA 2RHOA 4Q7LA 2XB6A 4DIEA 4KREA 5JV5A 1YS6A 2W00A 2FXIA 2ZK7A 3AHIA 3LCVB 3OQJA 5F2KA 3H0KA 2ZANA 3ZR4B 2IP4A 1KDOA 5CYOA 5AHKA 4KXUA 5BR4A 4MRPA 5IM4F 2FOLA 2AE2A 2NTEA 3FAKA 2CJPA 3ZD7A 2QTTA 2I7DA 1Z8HA 2AKAB 4TL9A 3UM9A 3V42A 2ZYWX 3OOWA 4IXWA 4IG4A 1XVUA 3N2LA 2V03A 4J8PA 1T3SA 5KCZA 1G6KA 3EEIA 3HJAA 4G8BA 6ABPA 1DELA 4EX6A 1RHQA 1G18A 1OFGA 3M81A 1A72A 1FJHA 3HYLA 1U0FA 1I30A 2OAEA 3ANXA 4EHDA 1Y0BA 2FZ4A 3GARA 3VU1A 5KQSA 2J07A 2BKEA 1EVQA 3EZ2A 3RIXA 3S1SA 1TVMA 3K4HA 1G4HA 5DM2A 4FINA 5K6AC 1Z22A 2Z8ZA 2VHCA 4F91B 3AUJB 4XE5A 3NHRA 1CR1A 4M37A 2F4NA 2PZJA 2JH9A 1E5VA 1GFSA 3PS9A 3GMSA 4TV8F 1AGXA 4W7SA 4Y6PA 1JFTA 2JGLA 3KWFA 3H16A 5CX1A 3C8ZA 1Z35A 4P84A 1LUAA 5TX7A 3TLEA 3V4SA 5C1OA 5HS4A 4GMHA 2RCNA 2HIAA 2AXPA 2VXYA 2QJRA 3L6BA 3PVCA 5DTEA 2HU7A 4NOLA 2E6UX 2AQKA 2SECE 1U0HC 2JEOA 3HJTA 5ENDA 4EJSA 2BEVB 5EHIA 2ZJYA 4OQPA 1CCWA 1OIWA 5LPNA 5C7YA 3GLGE 1M83A 5DNEA 2XQKA 3VUEA 2B25A 3JVDA 1IXKA 3SJUA 2FQQA 4EY4A 3C1TA 4YQYA 5DGHA 3G1WA 3S28A 1JDNA 2ZI4A 3FDZB 5KS2A 1LCIA 1EVYA 1LB1B 5CIQA 1I9CA 2CNWD 3NTQA 4DBZA 4NJEA 3VAAA 4ENUA 4QYIB 2ZFUA 4H6WA 4PHGA 1GPYA 4ZAZA 5C4IA 4NV3A 4U7FA 4AG3A 1HL3A 1NW8A 1QHIA 4Q15A 5C3UA 1RLJA 3KD2A 4WK0B 1A1SA 1D3AA 3FVVA 3RADC 1MDFA 1GSOA 2QZZA 1ONOA 2JGDA 2VYCA 1TL7C 3OX1A 4KE9A 4MCAA 1UC8A 3LJKA 5D2CA 1GNPA 1L5VA 1TQ8A 1Z0FA 2B94A 3BMCA 5DF1A 1R8XA 3LP6A 3PNQA 1K7FB 1U3WA 3GBPA 3IUQA 2DX7A 1NQWA 4OHCA 1NIPA 1AH2A 1EDBA 1SKUA 3V2IA 4DSTA 4B44A 2P1DA 3JVEA 4OTZA 4G5HA 5FHRA 4KQ9A 2UVQA 4A0QA 3S7ZA 1UFQA 2Q46A 1XZJA 3PQ3A 4TTPA 4FGJA 1EK0A 3AFHA 4HRAA 3EIFA 4YO8A 5E2IA 4OF4A 3LHKA 3QVGA 3TZHA 2XWPA 3VO8A 1ZJYA 4BLPA 3VC7A 2ZR0A 2QRNA 4CTOA 4KQKA 1P9WA 4YRSA 4D82A 2W93A 3H4TA 4S1NA 5K09A 2P9FA 2EKQA 3L1VA 4KPYA 2P3SA 4YRJA 1UXIA 2W7TA 1XAJA 1A2QA 2IU4A 2KBEA 1IDOA 1F8FA 4XAQA 2AD5A 2XTZA 5TMEA 4QTTB 4BZZA 1CV2A 1DEHA 1FFAA 2HRDA 2LD4A 1I3CA 1SBCA 3D7RA 3GLTA 4GZLA 3ZU2A 4LKOA 3QKWA 4TUYA 2D0DA 4U7PB 3LDFA 1C0IA 5DW0A 3GDOA 5LU8A 1W0CA 3GOHA 3VNSA 4A7PA 5K0LA 5EJ2A 1OBCA 1YIDA 3OIFA 3CRW1 2QTWB 5DYNA 4TTJA 3BULA 5KNBD 3URMA 1ZIYA 1P80A 4MWGA 3EZLA 5BYBA 1GAWA 1VPTA 4WV3A 4RMGA 1Z6AA 1DFGA 1K6XA 3LWDA 4QGBA 4HG2A 5F2OA 2I6TA 5JYCA 1OXKB 4Q3OA 3EZXA 3CNQS 4N6GA 4CN9A 3ZGLA 1KAOA 4RY0A 5FTKA 4L4RA 3JVUA 3RVNA 2AZ4A 5K45A 2DQZA 3UN1A 1ONPA 1PSZA 1XZ8A 721PA 1ZN8A 4IKEA 3ZXIA 1UAAA 3EGDB 4B3TB 4B9EA 5KOHA 3AKEA 3MSXA 1GNSA 2Q1XA 2MSCB 2ZZMA 4FSDA 1VKOA 1L4MA 2GNPA 3BIXA 1JRLA 3H4MA 3KSAC 1CBUA 1HDXA 4P3XA 1KJ8A 1NMQA 1AKWA 2BZSA 2FW6A 3FCEA 3HYSA 3VR6H 2EW1A 2ZCVA 4C21A 1DJOA 1VBNA 1WO8A 4NYJQ 2Q50A 3M8KA 2CLEB 3LCCA 4ZICA 4CM9D 2YV5A 4LPSA 1EAYA 1Z83A 4Q9JA 5ER9A 1DX6A 2VP3A 1HZJA 4ENWA 3A9WA 4LQCA 1NX9A 4YN3A 2P41A 1I33A 1XN1A 2JLQA 5BSMA 2UYOA 2O8DB 4QDTA 2I3GA 3QFCA 2JCGA 4L8FA 1SZCA 2J0QA 3VTAA 2FPPB 5A3SA 3AFNA 3I4CA 1TKBA 3RG8A 3RRBA 4AJLA 5JZBA 4NNJA 4O08A 3N8DA 1D1TA 1OIXA 1JLLB 3K1TA 2O2CA 4N54A 4X85A 5H68A 2V59A 1XLTA 3FFBA 2W9XA 1IRXA 3QYAA 1GUDA 3DMTA 3CT4A 3DFUA 3FUUA 1NXQA 4GHWA 4ZCSA 2ACWA 3NT5A 1NMXA 3ZPXA 1KMMA 1N9GA 2DHDA 1U28A 2Q3MA 3HHEA 3OIVA 3WIVA 4D57A 5CLGA 1E1LA 1A96A 1WDKA 2VJPA 4CCSA 2XYQA 3CRMA 3ORQA 2F17A 3HB1A 1HYBA 4RE5A 1E9FA 5KVSA 4V1CB 5ITZA 1YR7A 2OFPA 2XE6A 4L7VA 4ZZ2A 4AMGA 3S8EA 4FWTA 4ZZ3A 3O8OA 2PGOA 3CPSA 4PX2A 4NENB 3RVBA 2JJ1A 1MTOA 1RQLA 3AG5A 4PC1A 1EVKA 1YJ5A 2Y4OA 3AU9A 3CLUD 1KRWA 1D4OA 3ETJA 3LW8A 4EVRA 4DYDA 3A6DA 2JJMA 1IJKA 4Q4HB 1Y3IA 3NHJA 4C0JA 2XXAA 4PANA 1C3EA 1X0VA 5CT6A 5ALIA 4GP6A 1N2IA 4JCOA 4RU1A 5JG7A 4B8WA 4FX2A 1TADA 2IYRA 4A1FA 1HL7A 1L4KA 3EVCA 5E6UB 1WV1A 3DHNA 4FLMA 4YRTA 3W5CA 3FSGD 2BJWA 2YASA 3PQCA 2AXQA 3BYZA 4JP2A 5AWFC 1EG2A 4NWIA 2RGRA 1DQRA 1MXFA 1IJBA 3HN7A 4HDSB 5L6MB 4M7WA 2Q6OA 3B7GA 2AOUA 4ALIA 1F6DA 1JYSA 2PBLA 3K9CA 2RFLA 4OSOA 4PNZA 4AG5A 3GPLA 2JZCA 2R87A 2VOEA 2NSYA 3LQFA 4PLWA 2NUAB 4IDAA 2BP7A 1PR4A 3UMGA 3SDSA 3PKIA 5KYGA 3IUSA 3VJMA 4U00A 1UMCB 3W34A 3U4MA 5ALMA 1FMLA 1A27A 1NPTO 2CBGA 2R60A 3ETCA 3VYTB 1SWWA 3BWVA 2AZXA 2FZKA 4MWDA 4EYKA 4KXYA 4FE3A 5HCUA 4UOQA 3EGXB 4E1BA 4R9UC 1RQRA 1B14A 5CM2Z 2C4NA 4ZFNA 4JR1A 2NV6A 3WI7A 5I8PA 1OTHA 1FEZA 1Z17A 1J8YF 2H1CA 2VWGA 3H1FA 4GPZA 2UVPB 3DTTA 1XL0A 3X1JA 2G83A 3MVEA 4XDZA 1SVIA 3IVMA 5KKAA 3OBBA 1GL9B 2ZT8A 4BEJA 3AEQA 3SHTA 1R9GA 1RPNA 2BHTA 3GFGA 4LEIA 3U62A 3VI4B 1WMBA 2C95A 5T8KA 3CE9A 3AG6A 4BBAA 3LA6A 1E99A 3AV3A 1IN7A 3HDVA 2CNKA 4HB2A 3CF4G 1CB0A 1L8QA 1MEJA 3OT5A 5ALUA 4D0RA 4HMPA 4M4SA 2QI9F 1LVUA 3DTNA 2GN0A 1UAYA 3GJSA 2H2HA 5IUNC 3KETA 3DOJA 5T57A 1VA4A 3OC6A 4XIGS 5B1IA 4EY3A 5BQPA 3ANMA 1OSNA 3BIOA 3T7SA 5IDQA 4KQMA 1MB0A 2WU4A 3SX0A 3OX3A 1LDYA 1KDYA 3UAGA 4F04A 1FLDA 2EFDB 1BGWA 1Q6ZA 2P65A 2XUFA 5DU2A 5G1OA 5TGZA 2X1HA 4G25A 2P2LA 2QX9A 1EVLA 2F90A 3O3CA 4ZCLA 4MKRA 2VUUA 1JB1A 3TQSA 1UXOA 3LT5A 3UJ8A 4H08A 1KXJA 1F2UB 4N1AA 4UXHA 5CNIA 1FS4A 3F71A 2C77A 3IIMA 4MQEB 1XOIA 4Q0MA 5CX1B 3RF7A 4RY9A 3LDAA 1M8GA 2Z2XA 4P7FA 3GEGA 1V1RB 4ZT4A 2CF6A 2VJOA 2XD4A 3SOZA 2GPBA 3VDMA 3VR1A 4R9VA 3LMKA 1XF1A 2GCGA 1MD9A 2I78A 2EFJA 4QVIA 1M75A 2NIPA 4GIBA 2JCBA 2XPCA 1ZY2A 3D7SA 2AS0A 4AUNA 1HKHA 1USGA 3PEUA 3W2IA 3EW9A 2AKEA 3IKMB 3LPLA 1RLTA 3BB4A 1U65A 1U99A 3JYLA 3K0CC 3NBYC 2OBYA 2XBUA 1ZVJA 3A6LA 1ZJ6A 4KAXA 5AHWA 1GG2A 5L3VA 2O05A 1E7RA 4I5IA 4E33A 2VTEA 4ICIA 3F49S 4G0ZA 5CK5A 2VUIB 2XIJA 4HWTA 1YDWA 4Y18A 1U0GA 5SYMA 4BGDA 1S89A 3EXIB 4MV8A 4NYIQ 7YASA 1R37A 2AWNA 3NAMA 3UJNA 1HLPA 1K4KA 1ZL0A 2GNOA 3C16C 2O5VA 2FQYA 1RPAA 4JP3A 3FJ1A 3U17A 5A4DA 2JLUA 1U0OC 5JU6A 1TQ2A 1AU9A 2ZBFA 1TIKA 3B9BA 3MSCA 4TRRA 1SQSA 3ZG6A 5DN6D 1YK0A 1CY8A 4M6WA 1IOWA 2VYFA 3VU8A 1TI7A 5TQVA 1UADA 2UDPA 3IMEA 1MBZA 5ICMA 2PZ8A 1R0LA 1WSBA 1YOVA 4RPHA 3GY0A 2FPLA 4XQEA 2AGVA 5U1PA 3VH1A 1K89A 2A0UA 3WMWA 3KYDB 1YQEA 1A9YA 2WEKA 3M9WA 5DO9A 1SUDA 4EUSA 4QICA 4P53A 4FM9A 2ZJ2A 2XMZA 2HV8A 3CPHA 4BKMA 5K8TA 3O1IC 1PRYA 4QYMA 4WH0A 5CR9A 3H83A 4CEHA 3BHJA 1L7OA 1K6IA 1K8RA 1IHPA 3EG9B 1C30B 4IQ4A 3VO2A 1W4AA 3L8MA 3UHOA 3OY7A 4X92A 1V8PA 4FJ2A 3VR5A 1KA9H 2FFBA 3JQBA 4JX9A 4YRLA 1ICEA 5DWVA 3DB2A 4MQBA 4UNNA 5C37A 2G25A 1I2DA 1KSGA 3URKA 2QN9A 3QKTA 1RZRA 1QLHA 3JQGB 2X9VA 4AJNA 3RIYA 4F12A 4DV7B 4PZ0A 1A7JA 1WCYA 2XMCA 3PUIA 4L5JA 5EXPA 3SKXA 4V0NA 4D3SA 1U6KA 2D7CA 5EWLB 3QEAZ 4JMLA 2XUKA 1P0MA 2CLHB 4IR7A 5JCZA 3RSZA 1LSOA 3M5DA 4BOYA 3TIXB 3OZGA 2Y1CA 4OX9B 1KEZA 2IZZA 5DX1A 4LHSA 5J59A 5AM3A 1B6SA 4PLGA 3GAAA 5JUWA 1NVWQ 3BILA 1KNQA 3NBQA 1FUYB 4IIJA 4MA0A 1TTQB 2CXSA 2CSUA 4X8LA 3TGPA 1J1IA 1P4HA 3ILVA 2PFKA 5HRCA 2PLNA 1VL0A 4PAQA 3CURA 2Q1UA 3HQ4O 2VCYA 4MJXA 3U61B 1UQRA 3V46A 3X44A 1YAHA 3P97A 2MYPA 4M2LA 4X94A 3UMCA 2O20A 2W2OA 2X8LA 3C5HA 3NUQA 1HNXB 4QEZA 2VT7A 3SJ7A 5IFKA 4U7WA 1AKRA 4YI3A 2VIIA 4HMOA 3LI2A 3TD9A 1M10A 1B2LA 3QYPA 1KKLA 1RBZA 4OHVA 3ZBPA 4DUGD 1W0JA 3QE2A 4WA7A 3AEUA 4JBIA 2QP3A 5H81A 4MW6A 5SV2A 3IEUA 2OQIA 4JENA 3JAMA 1TZBA 5FQNA 1R0YA 2EIXA 3NNNA 4LYAA 2B21A 3RTEA 2DVMA 1DTSA 3E22A 3QX3A 1SIWA 4LGMA 4YJGA 2UYHA 3VYUB 1UBCA 4DLZA 4LRTB 1AKQA 3A1FA 3KOZA 2H08A 4JLPA 5KJEA 2D6FA 2YTZA 1G6OA 4TT8A 1W35A 4X61A 4NMLA 1YS1X 3NNDA 4CG1A 2GAFA 1SZPA 4DTIA 1OTXA 2X6TA 3GAMA 3S81A 4KAFA 2PGXA 3B7WA 2A5FA 1AE1A 1YWGO 3U7QB 3JALA 1CUVA 4L07A 2WU8A 4UKDA 3G5LA 2ZWAA 3DEYX 2CEKA 4RA6B 3QXSA 1L6IA 1ZUNA 3ZQ4A 5AD1A 1U9IC 3HYTA 2BZGA 2P4HX 1X7XA 2X2FA 4Q3LA 5E0KB 4MDEA 1OTYA 3DOEA 3M2TA 3OIWA 1DOAA 2Z2IA 4EI2A 2XUPA 1LDNA 4NESA 2PUHA 3TR6A 3U49A 4BVEA 1X1TA 1SCJA 1BAPA 3ZIUA 5JZVA 1QRTA 4HSEA 3KQHA 4YRNA 5LL6P 1QH8B 3IBCA 5AKKA 1S2DA 3N2YA 4IUBS 2OK8A 4RD6A 2JGRA 2XCLA 2QRPA 4HDKA 2BBTA 1C1XA 2DLCX 1KH1A 1U5BA 3GUHA 4JA0A 1TM1E 4X3OA 3UKJA 3AFMA 4IMJB 2HSDA 1GA6A 3DT9A 2IYFA 5DLDA 4TLBA 5JDCA 1CUJA 3MLBA 3QBDA 4NCXA 2NZJA 4UBMA 4Z3DA 5JY6A 1HFJA 4JI2B 1JU9A 5CT8A 3MCAA 1IATA 2C96A 4XVHA 3IH5A 3ID6C 4F3KA 2XQJA 4QX6A 5LJLA 4FKZA 4IIYA 3QIAA 4DLVA 1QM5A 1Z4MA 5CYPA 1SG6A 5IBRA 3OTHA 4LDQA 2Y68A 3G7NA 4U2DA 3BRWD 1RRPA 2XIQA 1G1MA 3DAPA 3K05A 4N0DA 2A88A 2O8NA 2IJGX 3LE8A 1Z6PA 1CFJA 3ZDFA 1Y80A 1NDUA 2WA1A 3IQEA 1ECFA 2DQSA 3RLIA 1ZNWA 4REOA 3R6TA 5IJAA 4D81A 4CV3A 3I2YX 3UMBA 1LPSA 1A4UA 4CL0A 3PJGA 1K75A 2HQRA 2E0IA 1YULA 2OGSA 3DMDA 1AUPA 5AO9A 1WBDA 3ETHA 3W05A 2EOAA 4ZK6A 3ZNNA 5KOYA 2WIFA 5JPDA 3SVTA 1T1GA 2B78A 3OQVA 1H6AA 3LU1A 4XRRA 5FCDA 1AX9A 3EVDA 2M98A 2AJBA 4HUJA 4ESVA 1XP8A 4AL4A 2C8VA 4RLHA 4ES6A 1MC8A 2HA5A 2JCSA 2VZLA 1JPUA 2FEOA 2YL2A 3IBTA 4UDNA 1NURA 1KI3A 2W4IA 2QIOA 3AP1A 1IYZA 1RJEA 2ZBRA 3GLGA 3DBRB 4W99A 3DQZA 5CD9A 2HEGA 2MWMA 5AM5A 5I9MA 2REOA 4HWGA 5ILGA 1V11A 4WESA 4P31A 5LVAA 5HKLA 3ABQB 4DDTA 3F4BA 5FPYA 2JLWA 2REXB 1U9YA 3Q5GA 3ZGYA 2E18A 3TVTA 1H0HA 1GPUA 4XOIA 4DR6B 2QRKA 2VRCD 1G8KA 1JSLA 1EFKA 4YP1A 1XTIA 3G0CA 4JLJA 2FEMA 4EI8A 1PJ2A 1YFJA 1ID8A 3FNFA 5E4TA 1IOZA 3PFGA 1F60A 1WUTA 1NDQA 2H06A 3OQOA 2V54A 4HXYA 4IBOA 1BROA 2C4MA 1T5DX 1JT9A 2G09A 3G82C 3GYBA 3GPCA 3D64A 1IBCA 3AUAA 3O5AA 4GR5A 2B6HA 3QKRA 5LQNA 4ZXPA 4AJPA 1JDUA 2WRZA 1U6IA 3OD5A 4XR9A 2VBCA 4LNUB 2AV6A 1K6EA 2XQIA 4BS9A 4WKBA 2V97A 5EPEA 2H1VA 3E9MA 2C8KA 3HP7A 3OZRA 4JKIA 5EINA 4BFZA 1LVGA 2QYHA 4MYCA 3FXAA 3H7IA 4PWZA 4U39A 4UVDA 5FKJA 3GRYA 3GZ4A 5B2EA 1G5PA 4KMOA 4W1SA 2EDCA 3LC2O 3QUAA 4DBVO 1UBGA 2PMKA 4BYGA 2JHGA 2P6PA 1PCXA 3REGA 4QBKA 2CVQA 2IYQA 2VYND 1H3EA 1P7PA 3OOEA 4Z5XA 3SJZA 3IESA 2YFQA 1C8BA 1THGA 1AG9A 3PDIA 3GC6A 3STWA 1MUUA 1PFUA 4EKIA 1WKVA 3PGKA 1ZD1A 1HT0A 4ZV7A 3PJFA 3E61A 2PLFA 3DULA 2FV8A 4NBWA 3TLGA 4UPEA 4OP1A 5ULLA 3QE0A 4KR9A 2NYUA 2HA3A 4QOGA 3RD5A 4EA9A 4P86A 4WJZA 4G5SA 5G53C 1BE1A 2HO4A 3DF7A 3L02A 3MBOA 5G40A 3WR5A 1Y1SA 4OHOA 4J3NA 3C4JA 5EVCA 3TSYA 4ZN6A 1W5TA 3OEYA 1JI3A 1UP4A 2Q5OA 4LFAB 5H9VA 3ZEAA 4TKUA 2WHPB 5JMPA 3ZIDA 2V7UA 3R77A 2GF2A 2QQGA 2KPOA 4ED9A 1ETHA 3CXRA 2XDWA 5BRAA 4RE6A 5F4ZA 1ZGAA 3ZHRA 1T8YA 2PU7A 3HB5X 4XJVA 2HCJB 4YLGA 5D86A 1IPFA 2NO0A 3AEKB 3UXEA 2JFOA 3OZDA 3QJYA 2HDNB 4BE4A 3T99A 1ZRNA 1YKGA 2C04A 5KVQA 3TRFA 1IB6A 1E3DA 4OXKA 4QDOA 5JCPA 5LWHA 3OSUA 4FZVA 3LZDA 3GZJA 3T7EA 1NMZA 5F4BA 5L3RA 4X95A 1A4RA 4XFJA 1XNRB 4M60A 4I6JA 5JJLA 1XTBA 1RZRD 2D5IA 2HSWA 3ZWNA 1PZHA 2P3QA 2A0XA 4HH1A 4JT4A 2IEIA 4KYIB 4DQVA 4BKOA 3KXDA 3G8YA 3T3EA 2J5RA 2QAJA 4P08A 1DVRA 4G1UC 3TNDA 4KIGA 1VPDA 2WJ3A 3AO0B 1XMJA 5AKLA 4ZQIA 4NPAA 5DMHA 4Z9YA 4ZVOA 4YXWA 3V1YA 4TVOA 3UB3A 4BLTA 4ZQGA 5EI5A 4MYDA 4U2BA 3G0BA 4WGFA 5CGZA 2PUGA 3UAWA 2CJWA 1YB6A 5DEIA 1PU2A 4B40A 5L4LA 1KF0A 1ZLYA 4MARA 1H2BA 1ZZEA 3MGKA 3CUWA 3WYBA 2JBHA 3S6JA 2AJLI 4BNFA 5HJ7A 5LWQA 2L82A 1EKXA 5BWLA 3M3PA 4UVGA 3O4FA 3THSA 3G8AA 1TVKA 2FSIA 4ISCA 1B8VA 2XCSB 1KJYA 4OXNA 1PJ8A 3LX5A 3UB4A 3VR5D 4BO7A 1X1BA 3CZ5A 1C9EA 1QAOA 2YHIB 1U4NA 4E46A 2PT6A 2PUVA 1BH2A 2XUAA 1OBFO 4LMBA 2AEEA 3OUZA 4DDWA 1EEXB 5K1ZA 4WXPA 3TCXB 2Q5FA 1MJNA 2WD9A 5AKIA 3S0JA 5J2TA 1FFCA 5LJIA 2NZVG 3NHAA 3K8ZA 4RTOA 2BELA 3GAFA 3VHQA 2O06A 1RU3A 4UW9A 1J5PA 2CE2X 2JI7A 2W6OA 3EH2A 1KOJA 1E6UA 2OV8A 5BWMA 4YEDA 2O6LA 5A1TA 4AZWA 1W85B 2HQOA 5DB4A 3HEAA 1DCKA 3P9PA 4RV4A 3O8OB 5A5EA 1ISMA 3F0TA 2FN9A 4JI3B 5D3MB 5JH7A 3B70A 1GYRA 3QLTA 3RC3A 3TYXA 1PWZA 4DLBA 1QQBA 4CCYA 4JD5A 2C88A 4LMAA 1XNQB 2BFWA 3CF6R 3YASA 1NC1A 1L7BA 3VR4H 4DIDA 3GLFE 2Y71A 3T3MB 2FN8A 4QNNA 2Q7XA 3QH4A 3I6BA 2YWCA 2BY4A 2FR0A 4J2OA 4U3JB 3PA6A 4UBKA 5IT5A 5K5EA 4KHPB 4IUDS 4D74A 1JE0A 2R11A 1V16A 3MBIA 5DBIA 4DY4A 5A5GA 2UZ3A 2OO5A 3EZ9A 2DPGA 2WWYA 1S02A 2V58A 3I01M 2WTUA 1IM8A 3G9QA 1TAHA 2X76A 2E4ZA 1ENZA 2ORED 3AUXA 5A6SA 2CN1A 2R5FA 5JYDA 3V97A 5FYQA 4UU0A 1F9EA 3FNBA 1T5SA 1CRLA 3AU8A 3IB6A 4UNIA 1ECCA 2LZ0A 5BSWA 3PLAE 1TTPB 2GWRA 2RH4A 4LJKA 4ESOA 2JKYA 3FOWA 2FPXA 1N1GA 2AFHB 4LYGA 3SQNA 4XXHA 1FCJA 4L1KA 5EEHA 3TSAA 3C3KA 3S55A 1IQ0A 2VJAA 2JKZA 1E5XA 2OC9A 4KX5A 4FFPA 3UG7A 4C6RA 2O2JA 3UYLA 1N25A 1E1RD 4D3FA 1L5OA 4EPRA 5AJXA 4CMBA 5FQOA 2YXBA 1NJFA 1K9VF 2O0HA 2FN4A 3OEED 3QKRB 4HNAB 2WYIA 3PFIA 4OJKA 3S7TA 3TI9A 1IM2A 1I1HA 3DXYA 3FPFA 2ID9A 4DCPA 3I05A 3MJEA 1T2VA 5DI3B 4JLOA 1VYTA 4YRCA 5F7XA 2WFZA 4TXHA 4JYCA 3ZH2A 2LCIA 3H1EA 1SIOA 4D6YA 3GVHA 2YMMA 3OVMA 2QRZA 1YE5A 4EMUA 4C0KA 2WVJA 2Z8YM 2H2IA 1CR0A 2Q41A 3BCHA 1JN0A 3FG9A 3IELA 1MJHA 1K3UB 2DY1A 4FPXA 1JQ3A 4Z0NA 1JR4A 3A0RB 5IVIA 3RLFA 5IZ4A 3UH0A 1C29B 1V11B 4PC6A 4YDQA 1H8HA 3EK2A 2Q0HA 1QYIA 3ND8A 4MTCA 1MT0A 2B4KA 1RYDA 3N0VA 1P9NA 3PGVA 4G26A 5CFNA 1OXVA 1RLOA 4O4IA 1DUSA 2XUIA 3AOEC 3LPMA 4UBLA 2PSJA 1E5LA 1RMQA 1G7TA 5IJ0A 4YUVA 5T4BA 1XWWA 2DPHA 3AEZA 5B3JC 4KXFB 1EBBA 1FNCA 5ICGA 2ROQA 3NFYA 4MVJM 4CLXA 5LXTB 5KZMB 4CCAA 1AS2A 2PK3A 1JHVA 3BRWA 1TD9A 5F73A 2P2SA 3HCDA 3KM0A 2UYGA 3N59A 4LZPA 5D3QA 1SCIA 2DKOA 4AIRA 5K8IA 1MABA 3FCXA 2CHQA 3IGFA 4HZUB 4I81A 3DC2A 5B6IA 3KPUA 3IYLW 3ENKA 5BRNA 3FOEC 1F5NA 3E3MA 1K2VN 1ZCBA 1XVLA 3WWDA 2PUFA 1MV8A 5K8UA 4CMKA 2G9UA 4NCIA 3ER8A 4JT9A 3EN0A 5ALWA 5IJZA 4Q16A 1Z0DA 1DIRA 3NIFB 3P9CA 4IKOA 4LBWA 3HHPA 4K6GA 1XD2A 3NM6B 4INOA 3CM0A 2WAOA 1EQUA 2FP3A 2PWAA 2W2LD 2XNSA 2ZTVA 3B1YA 3GLKA 3P2JA 1OROA 1E9VA 2ODAA 4IQ0A 1KO5A 1YJQA 4RL4A 3EZGA 2O23A 5EIOA 1TB4A 4HQ6A 5H3CA 4AJJA 3IBSA 1QTRA 1TQHA 4KXMA 4YNBA 4DKXA 1FFXA 3O7WA 2YIJA 1GGJA 2GZ3A 2MSKA 1UIRA 1WR8A 4KBFA 1SO8A 4MUKA 4QG3A 2G1PA 1WLYA 1C8KA 3T3PB 3RWBA 2ZTHA 1MAWA 1XA3A 3WKAA 2ORVA 4IJQA 5G4KA 3AV0B 5IH7A 4JOSA 5HHTA 4UMEA 2PAFA 2OB2A 1UJNA 3A2KA 3BD9A 1YBAA 4YJ3B 3C3PA 4IDNA 3INTA 3DO5A 3NGXA 3SBDA 8MHTA 1UZLA 1YBVA 1O3YA 3E27A 5DKFA 5HM8A 3A58B 2IH2A 2NQTA 3Q3IA 2A94A 4MPRA 4RF3A 4EM6A 1KH2A 4TM8A 4G5QA 1K3TA 4BN4A 1DAIA 2BHLA 2NZ2A 2P3LA 2QWXA 2I6XA 1H66A 3R3UA 2NT3A 4WD3A 4W9NA 3RT9A 3V55A 2PMCA 2NVOA 2ZREA 3HBMA 4KN8A 3ROPA 5JSKA 3T5GA 1EXVA 4Y3UA 1NM5C 1FTWA 1QDLB 2CXPA 5F5NA 3IJRA 1Y4ZA 4GMFA 4MW2A 5TRTA 1U9CA 3AKYA 1LSJA 3B52X 5EAIA 3X1YA 3L0PA 3D0KA 1D2MA 2JFUA 1BDHA 2C98A 1A7AA 1KTVA 2DFNA 3H5AA 2X0NA 3LVFO 3RH0A 3E9NA 1FDIA 3ONFA 5U4XA 1PDOA 4CG0A 3NETA 1NIJA 4BO1A 4LJRA 4NZPA 4YAWA 4MV3A 4BUZA 4B3SB 4AY6A 1X70A 1XD9A 2R6R1 2DMRA 1AV7A 1MKYA 1GQ2A 1P7VA 2BUCA 2C4WA 4GQBA 4PSVA 4AM8A 2BE7A 4UREA 5IABA 3RFTA 3MT7A 4DAOA 4Z6KA 5AW6A 1GRQA 2C5AA 3AL2A 1OWMA 1KMNA 1NOJA 2VEOA 3DONA 4WOBA 3TRKA 2XLBA 2DQYA 2RGNA 2DFKB 2PY6A 3M33A 2YDXA 1H2XA 5IC5A 5GJCA 5DTJA 4JVNA 4TVKA 2PTGA 3ND5A 1UWVA 1W5SA 4OAOA 1CX9B 1C4XA 4QFCA 3U1VA 3LWZA 2R68A 2Y2UA 1S3FA 3GO4A 4I2NA 4JNKA 3TW0A 4IIDA 4WLNA 2ASEA 5JXJA 3SQXA 1OZAA 5EMHA 1DAFA 2EWWA 2ZSHA 2X15A 3PNYA 5FL7A 1MNQA 2ADOA 2YIDA 3O8QB 4ALLA 3EA0A 2W2KB 1Z63A 1AXGA 1Y1PA 2ENUA 3AI3A 1N2SA 4CT0A 4CF4A 1EUZA 3QU2A 4F2PA 3PB3A 3KVOA 2ZG6A 4O25A 3GP3A 2XADA 5CA0F 3TJZA 3DQQA 3SYTA 4Q39A 4O59O 4NE9A 1XC7A 1D1PA 2F8MA 1COWD 1OQAA 2FB9A 2O3JA 2XI4A 3DKRA 1CS0B 4GOND 1E1YA 4IW3B 4LCEA 5ESWA 1Z73A 4QRDA 1RKUA 3PHIA 3U4HA 1M5RA 5ABPA 1Q14A 3ELBA 1BKSB 3D8NA 1RYZA 3QFRA 3QLVA 5JSYA 4JQCA 5GWXA 3S3TA 4TT3A 1MG0A 5CNMA 4JFRA 3DGEC 2QX6A 1CNEA 3INRA 3GNTA 4NFHA 5FL7D 2OQRA 1TCUA 3PF9A 3A2LA 4KIFA 3SS8A 1BXRB 4JP5A 1CEEA 2IH4A 2IPAB 1HLFA 3PFFA 2VAWA 5DJ5A 3K1YA 1TZMA 5AM4A 1KU6A 1E6LA 4LISA 5AXAA 1CYEA 3WFJA 4CI0B 3BCSA 2ZYRA 2NO5A 3ADPA 1DWUA 1EUCA 1GUYA 3DOFA 4M9CA 4MRNA 4WUVA 1NW9B 4C6SA 1M1XB 3F98A 4FNMA 1WZCA 2FW0A 4ZAYA 5HRAA 1IZ9A 3KVYA 2B34A 1RI3A 2ZSDA 3E18A 2DU8A 1SOWA 3ZDXB 1RXSA 2JB9A 2QSZA 4L6CA 4UTVA 6REQA 1KFKB 1G5IA 2DPYA 2PUEA 2FK8A 5EJFA 1PTKA 2P4SA 1Y8QA 1Q0UA 3BREA 4N65A 4PYLA 2VSQA 2ODPA 1V5FA 3K70C 1QYWA 3D1LA 3CCCA 4JBHA 1M0TA 3WG9A 3HG7A 4EF5A 4N0MA 3PT9A 3MCTA 1PJ4A 4LFCB 4KGXA 4WAUA 4Y30A 3V8MA 4RIFA 1G5FA 2E1RA 4MV6A 4B82A 3EIWA 4OEHA 4AMYA 4N76A 4B35A 2XZTA 5FPKA 2WYOA 3VRHA 4UXIA 1TKCA 1GAQA 3RC2A 3SN6A 3CUKA 3F9CA 5CG1A 3GEDA 1Z4NA 4ID9A 3I34X 4Y6RA 2P79A 3Q7EA 4QL3A 3W04A 3FUTA 3OPMA 1ADGA 5TXGA 1RJDA 3CONA 1EFAA 3DE3X 3KT6A 1REQA 2DQ4A 3M6WA 3V8PA 1QQ6A 1Y1RA 5B3AA 2QTNA 3O92A 5BN4A 1MAAA 4L8GA 1CQXA 1G2IA 1N9ZA 3MGCA 3R44A 4M9ZA 4ZD6A 3VH2A 4FQ8A 4W6QA 2ZSFA 5DX8A 1I4LD 1Z4QA 2LPMA 4ZO6A 1NF2A 1DXYA 5HBRA 2ES4A 5DXAA 1LTHR 4TLLB 2BFPA 1QX3A 2EZUA 5A62A 1MLDA 3FKSD 1X0XA 4J0IA 3VYVA 2BKVA 3OLWA 3VM6A 1PJLA 3S29A 1O8CA 4DQDA 1RAAA 3BMQA 5C8ZA 1TLFA 1ZD5A 3ZBTA 5L3SA 1NVUQ 3QOFA 3KEMA 5KBYA 1E1NA 4X41A 1FYEA 2IHJA 3T3HA 1WL8A 2G5PA 1JFVA 3WB0A 4OY3A 3IEPA 3WFIA 2V6IA 4M0LA 1YQTA 3OX2A 2C5LA 3WOVA 4AD8A 1FNMA 3SCZA 4N5IX 2AE1A 2O4CA 4V0MA 4EJ6A 3A0UA 3JQFC 2B20A 1L1EA 1RRVA 2QN3A 3F5SA 4FBLA 2PNJA 3TX2A 4DUGA 6YASA 5K9ZA 5DLEA 2VP6A 4PAWA 5IXSA 1PR1A 1P8JA 8ADHA 5CM8B 3BD7A 3BMQB 3RW9A 5BWBA 3KUXA 1ONBA 1HBJA 1WSAA 3EB9A 4NQRA 5CFZA 2CJXA 3VPCA 2VNAA 4IDCA 1V37A 5A3JA 3LZ6A 1DO8A 4B85A 2GYUA 3KHKA 4MS3B 3MWEA 4DXDA 3NFRA 1N1EA 3DEKA 3D0RA 4FOLA 5CA1A 3J80A 3LT4A 5AVJA 5IC4A 1Y6GA 1I1NA 3BJEA 3S1LA 4QPJC 4E4RA 2J59A 4OQQA 3FGPA 3OM1A 1GTJ1 1L7MA 1FFSA 1UINA 4RNCA 4YRAA 1DX9A 3TLYA 1QIDA 1XE3A 1CFZA 3FPEA 2QS9A 4G0OA 2V7WA 4QFBA 3PHHA 4MVJE 2X2PA 3GX1A 3F4KA 2JIBA 5LBTA 3CR8A 3ZHTA 5B5SA 5C7LO 4BTLA 1OPXA 2V1XA 4EZIA 3U7IA 1IPHA 1D03A 4LMPA 4PE5B 5IKXA 4IGEA 1B6TA 3LFTA 1JHZA 1QPGA 5D6NA 4BVAA 4JV5B 3VNUA 4U1RA 2EFYA 1W0KA 1DKOA 4MB6A 2WYUA 3PNOA 2YFYA 2PL5A 3HEBA 2NT4A 3ZD9A 4NV0A 3MILA 5AJZA 1N7GA 2P0EA 4RZSA 4CVNA 2LBPA 2VNHA 3MWJA 3Q41A 2WABA 2IA5A 3B2NA 2COEA 5IULC 3OWHA 5FTLA 1OB2A 1RRFA 2XR1A 4E3ZA 3WJ1A 2Q99A 1CZUA 4RA9B 1TEZA 3UAXA 2OFWA 4PYRA 3MGGA 2Q6TA 2YS7A 1RWOA 3OX4A 3FPGA 5GGYA 1UBFA 4ZTBA 5L9AA 1NBHA 2PL1A 3VYRB 2IOFA 3PIDA 4M8KA 4EG6A 2NNWB 5LCXA 4JLMA 1RFGE 2YYSA 4G01B 5I9TA 1TECE 3DPUA 1CNMA 4GX5A 4Q82A 1KK1A 5T7BA 1QQ7A 4L0QA 3O7MA 5JH7F 5K3EA 2BMFA 4QPDA 2WJZB 4LIPD 4NS4A 1O94A 3PC7A 4GWGA 1FDTA 2QW1A 1M54A 3B20A 1GV0A 2X4DA 2G4LA 1QU3A 2Q5EA 3ZY5A 2WE7A 2GZ1A 4GH5A 1Y1TA 1J99A 4XRGA 2YMQA 1NBIA 4HAXA 1VBKA 1G2PA 3OU6A 4RDIA 4E21A 5T67A 2XSZA 4C08A 1R0KA 2YWJA 4G85A 4FB4A 1EFVA 3H75A 4N9WA 1T36B 4XGQA 2XB9A 4FBGA 3G0DA 3ZHBA 4A0FA 2C2OA 4IIBA 1EWVA 3PUVA 1UOOA 1UJ5A 3H9JA 4AZ3A 1ISJA 1PG5A 1IN8A 4D3ZA 1CT9A 3Q1KA 3NVMB 4RTNA 3HRIA 3OUUA 4DLWA 1A04A 1QFSA 1R6BX 4Q4DA 4IXNA 4XIIA 2PMBA 2W2PA 3FKQA 4CODB 1R12A 3R5TA 4UQOA 3WGVA 5TGDA 4DG5A 1ZD4A 2V0NA 3KP1A 1YS7A 2G5GX 3MAAC 1CUUA 3MWKA 1KDZA 5I8ZA 4ECEA 1DKUA 2C78A 2OCXA 5F35A 4ZI7F 5JROA 4PCAA 3ORYA 2WZCA 1FLVA 1WXEA 2NU6A 1ABFA 5LQMA 3FMGA 4D2IA 2G07A 3DUFB 2ZDGA 4RSRA 1L5HA 5FA8A 1IEWA 3WHPA 5A2GA 3MMXA 3ZE6A 4HLUC 5EHNA 4TKLA 3MTDA 2XA1A 1H2RS 2E6KA 3B9RA 4IX9A 3T38A 3T5TA 1ZQ1A 4G5XA 3IVGA 3V8EA 3S2IA 4LV8B 4RV5A 4U0KA 5FH9A 2Q5IA 1N0WA 4FSXA 2AD1A 3VKUA 1HX7A 3RRNA 1I4EB 1WOYA 5IAKA 5IC6A 2YNMD 1P6XA 4ZALA 5F2NA 1COWA 5DNVA 1A88A 4LRSB 2UUBB 1A95A 1XTTA 2ZRQA 1J2JA 3PCXA 4QHYA 4YRRA 1H0RA 3SR3A 4QZVA 3ZH9B 4MA5A 3LPAA 3KT3A 4CG2A 1OKKD 5FI3A 1Y5RA 1KEVA 4CQLA 3UKDA 1GPJA 2I7TA 1JKFA 3BSSA 4Q1BA 1GL6A 5BV0A 3DH0A 3AKZA 2KS6A 4KE8A 3F3MA 2FPGB 3F6CA 4TS3A 3FWNA 4YRIA 3PLRA 3FPLA 2NM0A 3OPXA 4QXAA 5EXTA 3NNSA 1JA0A 2QTLA 5FFFA 2IUYA 4W9NC 2Q5LA 1UR5A 4NMWA 4E5UA 1WB6A 2EL7A 4IXDA 3ZY6A 4LCJA 1IWOA 4RAQA 5JXWA 4HDRB 1R6XA 1GL3A 1T91A 1NQ5A 2YVUA 4ZO8A 4OCZA 1P18A 2QA5A 5GTDA 1Q20A 1J8MF 4KACA 4V38A 4JJ4A 4AKEA 2XV1A 3HC7A 1D8AA 2XUQA 1VIVA 4TWIA 4B9AA 4WACA 1LRJA 4F9EA 4URVR 1QG4A 5JASA 1I7DA 1M2VA 2FPMA 3CLRC 4R1TA 1BXZA 1FJ2A 3M5WA 1OVMA 1NJ2A 1Y5IA 5T8KC 1E7MA 3AIMA 4KFTA 1WZIA 5EMKA 4QGSA 5GVSA 2Y76A 5GZ3A 3LUCA 5D84A 1PN3A 4IEEA 2PXXA 4JYZA 4FZ3A 2EV9A 4AYWA 1Y4UA 3WL6A 5KYTA 1QE3A 4RLFA 3P19A 4B6QA 3BXGA 4YRGA 1GQOA 1GLGA 2J1LA 3EEQA 4R6XA 4B34A 4UEQA 5K0TA 1DQZA 1R0SA 2QT1A 3QELB 4FDVA 2OC4A 1K7EB 1ZMOA 1QOZA 2P62A 1CE8B 4B76A 2YQ5A 3TRIA 1Y3DE 1Z4PX 3UMFA 1LJUA 1X7HA 2N0SA 2OFOA 4PG5A 2WJ6A 1EGMB 1PIWA 1U1DA 4HAZA 4PSAA 1QX4A 2Y1WA 4UDOA 4X1YB 4G37A 4H0NA 2OMKA 4UULA 1WKCA 3O4GA 4ZT2A 5G4KB 4LF9B 4R8LA 4B3HA 5A5DA 3IO5A 4M1SA 4XCQA 2KW5A 1NBOA 1MABB 4HC4A 5DYGA 4CKWA 3CLKA 3IE0A 3GNLA 2VJKA 4MICA 5FWYB 3SIRA 1ZNXA 3BD8A 1XTPA 2WIGA 2PWYA 1UT8A 4X90A 3K73O 1O6FA 5HF8A 4GR4A 3GL9A 3IBGA 3C1OA 3ZK9A 5BW6B 3VR5H 4B4WA 4TN5A 1JP7A 2YZNA 1JNYA 1LX6A 2PQ6A 3OKPA 4RMHA 4EFLA 5JVDA 2F64A 2HA2A 3GN2A 3MJSA 1P72A 3KALA 4PICA 4YMSA 4ZVSA 3SNHA 1JHRA 3AUTA 5CMLA 4D8VA 2HRCA 4I1YA 4LXGA 2A14A 1L7DA 4D41A 4MAAA 4BLWA 1NNUA 3W9SA 4RBNA 4GKAA 5JS2A 5L7YA 3ABZA 1LWNA 1ORRA 2PWPA 1Y8CA 4L74A 5CX4A 2P75A 4LGYA 1QPZA 1KZ4A 3T34A 4P32A 1J56A 1XMIA 1YB5A 1XPJA 4P22A 1H9BA 1E9AA 5AVTA 1YDHA 2M32A 1GPKA 3E3NA 1ADBA 1QIFA 2BBOA 4H6VA 1LPBB 2X0EA 5CB0A 5LXTA 3EC2A 2GJ9A 1P0CA 2H1HA 4LXIA 2CDRA 4IDDA 5C4MA 3IHTA 2ETVA 3NDIA 3A3NA 4HEA1 2N75A 3WQQA 1GG8A 4IDHA 3ZN2A 4C3VA 2XYVA 2H1SA 5IF9A 1TTHA 2QP9X 4CEJB 2WC1A 1WCV1 1MJ5A 3BICA 4TSRA 5EJ9A 2Z95A 2DFDA 2IITA 1HI9A 1YHYA 4JJIA 4O4IB 4TWRA 1RRCA 3GHYA 4O2BA 4RPJA 2Q2NA 1KPIA 2JJQA 3LY5A 5FI5A 3D4BA 1Z6QA 4HDKB 1YOBA 1YZTA 5HMMA 3WQSB 1KGSA 3SC6A 5E1OA 4PTYA 5KNLA 3PR2B 4XLTA 3HCAA 4WLUA 9LDBA 2YFHA 4Y2JA 5FOUA 5BW4A 3FZGA 2BTOA 2AMYA 5JNWA 4XR4A 5KOJB 1ZBDA 1DNPA 3NBUA 1H6CA 2BL4A 4IWNA 1DIBA 1W5FA 3AF2A 3O1JC 1RBQA 2ZSAA 1SR8A 3ISJA 3OA2A 1SIUA 4RWZA 2QZ9A 3EE6A 3JVIA 4QEKA 1Z6TA 1F4VA 1L5RA 1KY3A 1NUTA 5DGCA 2Q3LA 3F78A 2FN7A 3VHLB 4ETIA 2QX8A 3P9XA 3WB9A 4ABTA 3F46A 1YMQA 2W43A 3HA2A 1XA0A 2XYGA 4UQLA 3OE7A 4WZZA 1FFDA 5JE8A 5CUQA 1MB3A 4B7XA 1HYEA 4B5LA 2B4QA 5FAKA 3WA6A 3CSSA 2C3MA 3A37A 3C7AA 1TA0A 1VCNA 2HGSA 3FRIA 3L8YA 2JBAB 3EDRA 3L6OO 3MT9A 5EC8A 4I9FA 1RI1A 2B8TA 4IX1A 4DA0A 5THKA 1XA4A 3LBFA 3T4EA 2E3JA 1UBOS 3RASA 2IBSA 1T5BA 3ZVKA 4BV3A 3AR3A 2X23A 4O5OA 4AG6A 3ZTYA 4YVFA 1R8YA 3C2QA 4AN0A 2QI9C 1T8PA 2B3DA 3AF3A 1A77A 3KLBA 4IDQA 3AJEA 4FFMA 3LYHA 2Z08A 1TKAA 1W87A 4KX3A 5KYUB 1KK3A 2V98A 3ZGZA 1DAMA 3GCGA 221PA 2IWRA 4Z4FA 1XU9A 1KOGA 1OI3A 3IPAA 2YMLA 3OM8A 5EHQA 2QYOA 3W2FA 2ZCJA 1Q1BA 4HV4A 3OLZA 1Z0JA 3CEPB 1EZ1A 4WLFA 4XFDA 3ANYB 3F73A 1NKSA 2HSGA 1QRUA 1JDSA 4YK7A 2KSQA 2DF8A 3IQWA 4AQ7A 2YWRA 3PNSA 5FULA 1NXOA 2BGLA 2ZR8A 4RYLA 3CTMA 3KHSA 4D5GA 5K2OA 4KQFA 3DTVA 3K9HA 4A0RA 1P4JA 4V0LA 1ZO8A 2A5DA 3H42B 3IQHX 1JHYA 4H1TA 5CLFA 4NMXB 3SD7A 1C5KA 3GDWA 4V1CI 1RS0A 1QJ4A 3BVPA 2HL6A 3NPAA 3SXUB 4OMUA 2AFRA 1X94A 1JFLA 2V55B 1OLUB 3E1GA 5H59A 5TARA 1GU1A 2JGNA 4TZ6A 1HURA 2ZRCA 1JU3A 1S9HA 2SICE 3QWIA 5TJ9A 3HGTA 4OBWA 8ATCA 2JD2A 5TF4A 3IDSA 2AI1A 2R1VA 1Z47A 3EXHC 4KO4S 4KJZA 4L4XA 3RSQA 4M1QA 4R51A 4AC9A 2P6MA 1JLMA 2JATA 2HA6A 4XWKA 2I3AA 2OGWA 4OL9A 5C81A 2DTXA 3AJAA 3DCYA 2OYCA 1OIVA 3MTBA 2A9KA 1M1YE 3MC1A 4MVJI 3WKBA 1MJFA 5DM60 4CETA 1P7CA 3DXZA 1EDEA 1P5FA 5A4KA 5K3FA 5LMCA 3IPXA 1PYGA 1N3YA 1Z37A 5BNWA 3H6GA 1SPXA 4DJEC 1JNXX 1RYBA 2JJ2D 3HCNA 3VR3D 3UIEA 3N1UA 4RFSB 2PZEA 1M6YA 4LHEA 4YHBA 1CXZA 5IT4A 1LK7A 1L9XA 1V6CA 2HMWA 1WCIB 4L8LA 2RAVA 1R0BA 5IF3A 3A1TA 3A6GA 4W5QA 1C9JA 3ROTA 3S4YA 4EKYA 1Z5WA 5FUWA 3FGZA 3W2GA 3PPIA 1L5WA 3OE5A 4XM1A 7ABPA 3QNMA 1TYZA 4Y6QA 5FYDA 3WTCA 4RK4A 4XIYA 1R8QA 3A7DA 2BFEB 1HEIA 4YJ2F 4DMRA 4PAMA 5EA2A 1BTOA 3ZWAA 2E4XA 3ZXYA 5JXHA 1JKIA 1VDZA 2WVHA 1N77A 3R0IA 5IH3A 3QGMA 3AFOA 4I9HA 1ILEA 1D6NA 3UCEA 1RM4A 1ADCA 3QPCA 4YIHA 5IJXA 1EIZA 2PR2A 3IUJA 3W9BA 5J1SB 1OAKA 1U4OA 1IK6A 3PEFA 1T9AA 5EHGA 4DIOA 3MINA 1N36B 2PUTA 4G5OA 4E15A 2ZU6A 1LX7A 2GXQA 3L8ZA 5IKMA 4QIHA 4A2WA 5SY4A 2H9YA 3PI7A 5KYKA 3BRQA 3CZCA 4BNNA 1GO2A 3PHBE 1RQ2A 1V2GA 1YS4A 2QIPA 3HKDA 1Y6QA 3CCFA 3IAEA 3KPYA 4G4GA 3EFOA 3ZI0A 3WLTA 3DDOA 3I01A 1DARA 1Z6XA 2IELA 4GI1A 4ZT3A 2QTBA 1UOQA 3OP4A 2SKDA 3MHTA 2MJLA 3TR0A 3D2BA 4DLSA 1OH6A 4KOEC 5TQJA 4XQCA 4PYJA 2AG5A 1GNRA 2R7LA 3O2QB 4AZ0B 4ZRNA 4KPUB 4EAAA 4F86A 2AVDA 2CXUA 1VJ0A 2HNBA 2PZGA 2NXCA 2WUDA 4UTXA 1E1CB 3RS9A 1M2VB 1RHMA 2VUSA 5AOVA 4RVUA 3S70A 3V7FA 2C9ZA 5CCEA 2QL5A 4P2BA 1CY4A 3F3KA 4TOIA 3EFBA 5AUNB 5F5LA 4CW7A 2EFGA 4CMEC 3ILXA 1TCVA 3H19A 4M9QA 4EHAA 3VXKA 2PGAA 4Q6BA 3ED1A 3IAHA 3ZWMA 1ORIA 4Z51A 1SRQA 4PFKA 4QXMA 4R71A 5A6SB 3G13A 2E82A 5HRUA 2ZRNA 1DQYA 1V43A 5HF9A 4QYXA 2G5CA 4FYIA 1IEVA 2G1UA 1DC4A 4GVLA 1ESMA 1V16B 4BMZA 2WTXA 2QRQA 3IJ5A 3JQRA 2JAOA 1RQGA 1MW9X 1XZKA 3DHWC 4D44A 1HDGO 2ET6A 3DOUA 1N5LA 2CL7X 3N8HA 4HPWA 4LY6A 4AP6A 3U19A 1GT91 1SA0A 2ZJZA 2H29A 3B1KA 4QXPA 2XT0A 5G4LA 4HBZA 4BHTA 2X7JA 3AUYA 3P45A 4GGPA 3FKJA 4UPVA 3A27A 3JU3A 2B4AA 4MLZA 5BN4B 4XWGA 3TN7A 3V4FA 1CZOA 1W96A 5JLAA 1VHTA 3FVWA 3KLOA 4LXXA 4QBFA 5EIBD 1C1DA 1KP9A 4PYIA 3ET5A 4LSZA 2OFXA 5EIFA 2W98A 1FJXA 3NWJA 2SKEA 1JDJA 2JI8A 4FX5A 3IEKA 2RHWA 4JN6B 4HAUA 4OAQA 2VPXA 3V6LA 3AJ8A 4BWFB 4DC0A 4HR7A 5BMOA 5AVWA 1QFZA 4RTPA 2ZBUA 3UAOA 2I4RA 4JVLA 1C7FA 5CVUA 3T6KA 5L51A 4ADSG 4JC8A 1R8SA 4GLFA 3GV0A