3KSAC

Detailed structural insight into the dna cleavage complex of type iia topoisomerases (cleaved form)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
226
structure length
220
Chain Sequence
KLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTAKAKMADILKNEEINTMIYTIGAGVDFSIEANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALPPLYKMSKKKEEVAYAWTDGELEELRKQFGKGATLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDNVKFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA topoisomerase 4 subunit A
publication title Structural Basis of Gate-DNA Breakage and Resealing by Type II Topoisomerases
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Isomerase/dna
total genus 55
structure length 220
sequence length 226
chains with identical sequence D
ec nomenclature ec 5.99.1.-:
pdb deposition date 2009-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
C PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.670 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ksaC00
4J3NA 3RAFC 2XCOA 4G0VA 3L4JA 3RAEC 2RGRA 2XKKA 3KSAC 2XCSB 2XKJE 4KOEC 4FM9A 4G0WA 4G0UA 4Z53A 4I3HA 2XCRB 3RADC 3KSBC 3LTNC 5EIXA 4KPFC 4KPEC 3QX3A 3FOEC 2XCQA 1BGWA 4Z4QA 3K9FC 2XCTB 4Z3OA 1BJTA 3FOFC 3L4KA
chains in the Genus database with same CATH superfamily
3AUKA 1DDOA 1U2RA 3IUJA 4Z49A 3PS9A 2IHYA 1BWRA 3EB9A 3LHIA 5AVVA 1G63A 3O92A 3QA3E 3T54A 3A8TA 4B43A 2ZYSA 1RNLA 1EXMA 5A9RA 2VJMB 4RY8A 3OH8A 1KYIA 2C7OA 3EF3A 3D6VA 3TVTA 4MVJA 1OIVA 4AKEA 5KVAA 4MXDA 1O94A 4ESVA 3K6KA 4DNOA 1OU0A 2PKYX 4NCBA 4IGIA 2ZDHA 4OSOA 1EP3B 1UM8A 3S2SA 4EFLA 3NXSA 1HDGO 4MZDA 4RVFA 4TTTS 1MG5A 3OMLA 2AEMA 2ZJFA 5GGXA 1AG9A 2MSKA 3SX0A 4EY4A 1L5YA 4QREA 3LDAA 3KKQA 1VLMA 3BHNA 4FGLA 4UTZA 4EPWA 3COWA 2H11A 4GX2A 5CNMA 5A1TA 2BEUB 3MMZA 3WADA 1IVSA 4GKAA 4EWLA 4J76A 2KJQA 5ALDA 2RKOA 4I5FA 2X5NA 1SOWA 4B40A 5DMHA 4P86A 1UKCA 3VHXB 4RKWA 1RRCA 4QGSA 1URPA 1WHTA 2B6NA 2NWQA 5JASA 2FSVA 3JV7A 1J0CA 1PTJA 1QIEA 1QTNA 4QPZA 1Z8FA 2YY6A 3OM1A 4XB6B 4Y30A 3RIHA 3TQHA 5IASA 4KJXA 1P1KA 1DQRA 3QEAZ 1HSZA 3G17A 3KQVA 1PFGA 1BCSB 1GPKA 1JW9B 1DIOB 1ZCJA 1AM4D 4REOA 3U6KA 5IKXA 4HMPA 1QLWA 2J9GA 1WG8A 4CYMA 2VZLA 2C7RA 1HYHA 2VDKB 2YJ4A 4K2AA 4W1PA 3A6EA 2WSLA 3E3LA 4QTTB 1R5OA 1WCYA 4Y9TA 4IQ4A 3GQBB 4UQPA 5JNVA 5KMGA 2BGLA 4UHHA 2PDAA 3SZ3A 1GG9A 4BQPA 3PGLA 3AKEA 4BEVA 2A35A 2OWEA 1BS1A 3TRDA 1K2VN 4B47A 2M32A 1QYCA 2PS9A 4BQSA 2ZR0A 1QH1A 2QYHA 1R0CA 3NHJA 5J9FA 4LHYA 1IY0A 5GJBA 4JLWA 3NTLA 3DZBA 1NKVA 5B30A 4XRRA 4ZANA 4BNMA 3GROA 2OFXA 3SXJA 4R2LA 5B7PA 1JRLA 1S89A 5LKAA 4HI0E 1BG6A 3VGPA 1JFTA 1K9SA 4RAQA 2QD5A 1JDBB 2XAAA 2I91A 3ZCUA 4I66A 2QMQA 1BXKA 4ND2A 5HIMA 3T3PB 2FW9A 4J91A 1MJGA 5F2OA 5JWRA 3FPAA 1F60A 1QFMA 3OOEA 4R4JA 4TYPA 3WDMA 1QYIA 4K46A 3MLEA 4GMHA 1U28C 4E4YA 3QF4A 1D3AA 3HCCA 5C37A 4YRMA 2C4HA 2FUKA 2I3AA 3LOUA 3H0KA 4LCJA 1XKXA 4CHGA 3CPSA 1OLSB 2HLPA 2OV1A 5IBPA 3PCXA 3N1UA 2WJJA 5FTNA 4WN9A 4H4EA 2VLIA 3GMTA 3HGTA 1N57A 1EX9A 4FMPA 4NKRA 5AW3A 3AO0B 4R31A 1J70A 3RT9A 2PH7A 1GT91 1MQ8B 1D8AA 1FBTA 2AT1A 2QAJA 3ICPA 3HJNA 3IBFA 3M33A 3P9XA 4MW1A 3WLFA 4RD1A 4BWGA 5C5EA 5JCOC 3HVJA 1JYEA 4EVIA 3QJGA 5AKYA 2VVTA 4P84A 4NATA 1XK7A 4QYXA 1V35A 2QVZX 4DLUA 1ND5A 4CF7A 5JECA 4TWRA 1MOSA 2R751 1DJLA 1A77A 4DLAA 4RDXA 3EIFA 3HEAA 2VTDA 4DCSA 5E9QA 4Y0VA 5EJ4A 1L7OA 2F3QA 2QL9A 3BHJA 1II9A 1YVDA 2J30A 3I73A 4M36A 4TS1A 4WBXC 4YJFB 1XDSA 1M2KA 1X2EA 3ISVA 1CQIB 3P96A 4ZO4A 3VSCA 3COSA 4UC0A 3QW4B 2HQ1A 5I6DA 2QGNA 2NUBA 1VPVA 1O6FA 4CEIB 5MFZA 1H42A 3L0OA 2HD4A 2FKNA 2PHZA 4MWBA 4S0ZA 4BMXA 1JKJA 1TA0A 3AV0B 4QDJA 2ORIA 2Q50A 3A1EA 3CCBA 3HY6A 3KYIB 1QVRA 3BRWD 3N2YA 3LGXA 3CZ4A 4HG2A 5EHIA 3UMJA 3WGOA 4AXXA 1XVVA 1S2LA 2VPZA 3GVPA 1YMUA 3H17A 3KOWA 1Z0ZA 3W2TA 3KQOA 3PGMA 4KWTA 1KC1A 3HYNA 4V38A 1TIPA 1PGNA 3B7GA 3AEQB 1OHHA 1XYVA 3V1KA 3R3VA 1JTFA 5JSQA 1E63A 2FWIA 3P0EA 4M0FA 2JH3A 4IQ0A 4D8YA 4AQYB 4TTSA 2FE1A 1KY3A 3GVXA 1YUNA 1BX0A 1FS6A 3IBSA 3IBCA 4KUEA 2CLHB 4OQEA 3H4MA 4RGBA 5DTQA 5A3SA 4EJSB 1CLEA 3U56A 4G24A 3EZXA 3PA8A 2IYZA 3D7RA 3OF3A 1XYGA 4UUOA 4C3UA 1LS1A 3M70A 2GILA 5DTJA 3F1LA 3I37X 1M0TA 3JWEA 4Z7JA 4HZUB 2QTBA 2VHZA 2HJGA 5JBIA 2I0FA 3F5DA 2ZYIA 1USIA 1PS9A 4Z7QB 4GLBA 1BXZA 2W37A 2P2DA 1I33A 1ILEA 5CB6A 5I5EA 3OE5A 5CD9A 4MGKR 2JFHA 3GV0A 3PD0A 4BLRA 1NBEA 2FFQA 5DNYB 3JWPA 2PV7A 3P2EA 3GCDA 5K2MA 5BRAA 1QHIA 2B1IA 1SU8A 2W6ZA 1P1BA 2FLWA 4PPYA 1PJAA 3BMNA 3GCXA 4EG1A 2W6QA 1C9EA 2OPHA 3L7AA 2VHQA 5JFGA 1YNOA 3HB0A 1KYTA 3VR4H 2NVBA 4DLRA 1PEDA 1NXPA 2HLDA 3OZUA 2I66A 1KDOA 3HKBB 2GM3A 3HXTA 4RQBA 4KK4A 2RJ3A 1P4HA 4LOKA 5DE3A 1SXJB 4L16A 3WLLA 1N0VC 4BFUA 4BMVA 2NIPA 5HUQA 3UOAB 3DCYA 1J8DA 1FP2A 4M0UA 4MAAA 2IYEA 2NO7A 3KAJA 4HRYA 1AB5A 1TZJA 4PZPA 5FL7D 3W3ZB 1A8UA 2UV8A 1QDLB 1QZUA 5C1PA 3S1SA 1VGQA 2V1XA 1GUFA 2KBEA 1EFRA 1UBOS 4LRUA 4D3SA 1UBSB 1XD2B 4K9NA 3DXFA 2ATVA 1GN9A 2I7DA 5KKCA 5BUQA 2VZEA 2IS6A 5GONB 2A7XA 2F1RA 2M98A 4LY3A 2C4NA 2JLVA 1OREA 3KKKA 1W9MA 1CVIA 3T0IA 4RVCA 3U3RA 4F2GA 5A5VA 1N36B 1ZRMA 1XDWA 2FYTA 3U1TA 1Z0UA 3GJXC 1GY8A 3AU8A 3VDNB 3AUAA 3CKYA 1KXJA 4NBUA 3PXGA 2DVMA 8LDHA 3P2YA 4HDRA 5K0EA 1V7ZA 3IDQA 2AXEA 5K5EA 3Q8MA 4RJLA 4F2PA 3GGJA 2FMXA 3GRFA 2V7TA 1PT9A 4HDSA 4DT1A 3M6UA 1BJTA 3N70A 3WXBA 2J3DA 1NLFA 4IS2A 4BWFB 3ETCA 2BFWA 4V0LA 2QN2A 4JJGA 4AJEA 4ZGGA 3I9JA 4S1WA 3IIJA 5JG7A 4ZAGA 2X4GA 4DMFA 4CM4B 2WF7A 3EXAA 4MVJH 3GRAA 4BZZA 2PT7A 5CXUA 1RZVA 5IN4A 1FPMA 5H3LA 4B6GA 4JVLA 2FEAA 2XE4A 5TMBA 1DCTA 1SY7A 1EFPB 2J4DA 3LK7A 4BO9A 2H5IA 3VVLA 1DUIA 3DEIA 1E6EA 3SR4A 1BJRE 1Y1SA 1OWNA 4BXOB 2JRCA 1ZHHA 2EP5A 1FNSA 1K5GA 3EIXA 1I3OA 3VU8A 3VYUB 1A8IA 3QUAA 1S3FA 5HK8A 1Z6YA 4PFKA 2AZDA 3UT5A 1GUAA 2HT6A 5KHOC 2O7SA 4FN5A 1D2CA 1MB9A 1ZGCA 2C9ZA 4TM7A 3LC0A 3H5VA 3IP5A 4PGGA 3UMGA 3NTUA 1OLXA 2CB0A 2Z9DA 4BUCA 2ZVQX 3DF7A 3OURA 4QXRA 4NZYA 4RVGA 4EQ6B 1IJBA 3CZQA 4HWTA 4N3BA 4OQPA 3VH2A 1XWWA 3BT7A 3T5GA 1RHUA 3HBFA 3DV9A 5ARBA 1F17A 1DC8A 1E59A 5CFLA 4E6EA 4NCKA 1FK8A 2O8VA 1JQKA 2I2BA 2C5HA 1QG0A 1U0EA 1ORHA 3AM4A 4ZOEA 4KFCA 2O5RA 4TQGA 3KEMA 4A0QA 4BV2A 1E60A 3C5HA 4BX9A 3T3OA 3LZDA 2NQ8A 4L8VA 1KMHB 3GRZA 5KYUA 3MT0A 2WZBA 2JGKA 3MSCA 3E9EA 4E7OA 4F4DA 4BLUA 4HCJA 5JSZA 4FHFA 5EZYF 1EX1A 5LYJB 4RACA 3K9QO 5FI0B 1YGYA 4UZSA 4WI1A 3ELBA 4GVPA 4R9VA 4HOYA 3Q8KA 1U2PA 3NJ8A 3S27A 2PZEA 2HW8A 4RD4A 3V8QA 3EIUA 1ZGGA 3DZ8A 5F77A 1XTKA 1SBHA 2B9VA 4JLDA 1RBYA 1MLDA 4DPMA 3RC8A 2FMIA 3IXQA 4IV0A 4DLXA 2HPVA 4CU5A 1RM0A 3HXPA 2JDIA 3IE2A 1LI7A 4YIHA 2ZM5A 1EFVB 4RESA 1I4DD 1L4EA 4WOJA 1KR2A 2PGOA 5KJ1A 1KEKA 3PKJA 1AXEA 4QEDA 4CI0B 3VDQA 1ECBA 2VDOB 5DDIP 4ER0A 4YJ3A 3FHOA 4HF7A 4PZZA 1QUFA 3KV3O 4B7AA 1WW2A 2C4TA 3NEAA 3RAFC 3OLVA 3CHYA 1AQIA 1QXSA 1Z63A 1YZNA 4OIMA 2B5OA 1HPLA 4GZLA 4RXUA 4ZEWA 5K3OA 3F5QA 1XZHA 4QUAA 3TCXB 2I80A 2XDWA 3TG2A 4A2WA 4KOAA 2EQBA 1NVFA 2IZ7A 2JEZA 3QKRB 3BSFA 1WO8A 3TAHA 4EVRA 5TLSA 5E2BA 3TLBA 3FOCA 3QI2A 3I5UA 4BFVA 3MF4A 4UPDA 1JB1A 4L51A 2PH1A 4MUMA 3JQQA 1BDJA 1F06A 3G2MA 4LZZA 3UXHA 5EXDA 3N8IA 4L74A 4FZVA 2FRDC 4FINA 3HCNA 1PYDA 4J4BA 1KPGA 3LW7A 3X0DA 5EWLB 1DBRA 4B76A 3EEQA 3HC7A 4I3FA 4UMEA 2HRQA 4EI9A 2WU3A 3U4QB 5CEEA 3M6VA 4EB3A 2IP1A 1NATA 5K6TA 1XG5A 1ZP6A 1AQ6A 4Y6LA 3TNFA 1EYZA 5EJFA 4AG6A 3ZWCA 4UMFA 1QAMA 4PO3X 2ZBQA 5SYAA 3ROTA 2ODNA 4PAGA 1TAHA 4KG7A 4RNCA 3CF4G 3ZTWA 2GUGA 3NUQA 4GH5A 4M1WA 4N8SA 5BMVF 4HX2A 1JU3A 4DL9A 5AKXA 2OGSA 4ZI3A 1PK7A 3IOCA 3PFHA 1PVOA 3FH0A 3ONFA 4RJIA 2OOKA 1C30A 1H1TA 3W2FA 1OVGA 5K8CA 4K8OA 3FNRA 1NKSA 4GBGA 1LBIA 3A27A 3L6BA 4KTTE 3L92A 1M2JA 4UNRA 1SD5A 2NV2B 1PLKA 1JPUA 1VE1A 3JRXA 4Q4HB 5THKA 5EQJB 2G1UA 2WRZA 4PE5B 4W6QA 2PFKA 4G9GA 5DX0A 3NHLA 2V7PA 1E92A 4BE9A 4NJOA 4MQFB 2P7IA 1QFYA 4M54A 4RELA 2Z83A 1IY8A 2JGDB 2W98A 2X8JA 4IEEA 5CA0F 4DPLA 4AYWA 4P1ZA 2QRUA 4R7ZA 3K2BA 3BEOA 4YJGB 4BLQA 4AF6A 5ALMA 1WMBA 2XD9A 4U3JA 1KXZA 5EY5B 4NLLA 4F4FA 3REQB 5IYZA 1E1RA 3NIDB 1N5JA 1Z08A 4QX6A 1I2BA 1ZWKA 2V74B 3F8TA 4P92A 1U2GA 2HH9A 4Q9JA 4CL3A 1MX1A 1V37A 3A9TA 3NM4A 3TQRA 3VX4A 2XE6A 1RHJA 4YN3A 2QPAA 3IQWA 2WTMA 1W0JA 3HV2A 5ALZA 1OTXA 5KQPA 4N7RA 1QRSA 3H19A 1GZVA 3O21A 4JL5A 1G2OA 2KS6A 4DCGA 1CUGA 1FLVA 1ZH0A 1OAOA 4MZXA 4Q3EA 5HKAA 3BB4A 4BY9E 1R00A 2APJA 4PNPA 3ORQA 3CRW1 5JSHA 4BRSA 4W6ZA 1JQLB 4RY2A 3I01M 3LCUA 1QH8B 5LDGA 5T6MA 4B6SA 1C8LA 3E18A 4UNNA 2ROQA 5DCYA 3BIFA 4X7MA 4IMPA 4AT1A 5JYEA 1II8B 3I9OA 3CONA 4LTNA 3E35A 1KFBB 1UBRS 2EEZA 3D54D 3JYLA 3LXUX 1PF7E 1EZ1A 2PLNA 2ZYUX 1V95A 4FEAA 5BP7A 4HGYA 3S28A 1K5DA 3C70A 3ITNA 4HH0A 3QZUA 1Z56C 2J3QA 3ZJYA 3ZTYA 1G5FA 4P08A 1F3OA 3NU1A 2V98A 4NCXA 1XLUA 2VJQA 3BH0A 3IXLA 1A8PA 1V1MB 4FWIB 3RFFA 4CIXA 3OQPA 5HPYB 3EEOA 4YI5A 2ZKIA 4MWZA 2QAGA 5D3KA 1JA1A 3LP6A 2R60A 4BVFA 4FNOA 2QZJA 2FPIA 3KWJA 4UU0A 1HRDA 4ZC8A 1OGJA 1NURA 2BIFA 3CWCA 3MMNA 4LDZA 3T7KA 1WXEA 4O2AA 3IAS6 3IS3A 3N39C 2WU0A 1K89A 4YRKA 1ZGBA 1G9XA 1IQ0A 2O2GA 3IKMB 1SC9A 4TVOA 1T5TA 1O08A 1PWYE 1ZONA 3FDIA 4EH1A 3QELB 3VZCA 3O8RA 1LVGA 5F1PA 1PHPA 4KZPA 1L9XA 3V8EA 3KZXA 1YQGA 3DCNA 3H9GA 5SZIA 2C07A 2GZRA 5EWJA 4GR5A 3PT9A 2PZMA 1NN3A 4F3TA 1LWNA 1Q7GA 1PZGA 2RJOA 5ABPA 2YWJA 4II3A 3H1AA 4OXIA 2FX5A 1HI9A 3I9V1 4CODB 4FM9A 2H4ZA 2VPYA 2IVZA 2RG7A 4EVQA 4PICA 5D6OA 5BQ3A 2Z2JA 4O6VA 2INGX 1AGNA 4G81A 2QN8A 1RZRD 1K4KA 2W90A 2QUZA 4Z4GA 1UZNA 1A8SA 2WSMA 3EAFA 3G2HA 4C4XA 4FQ5A 3HR7A 1ZMRA 5T6BA 1X7ZB 2ID7A 3FWHA 4QBKA 2AD1A 1EM6A 4F5WA 5KO2A 3U7FB 3JYHA 3T1VA 1QGYA 4G65A 1CRPA 1QV9A 1N6RA 2VTEA 3B9RA 1ZAKA 3PGA1 3VR5D 2HA5A 4KN6A 5FUYA 4JXZA 3ZV5A 4QG3A 4F93B 3E2MA 3WVNA 4JYAB 2ATCA 2B1RA 2QN7A 4N48A 1NXXA 2OBNA 5CT6A 3C3WA 3BFVA 3T7TA 2H1IA 4ZA2A 4PQEA 4QOFA 3RVKA 4F92B 3K6JA 2WJGA 1K7FB 4EBFA 2YFYA 2ECPA 3AXSA 5DXJA 1MOQA 3ZD7A 2VOEA 3C24A 1L5WA 3NDRA 3G8CA 4KLRA 4Q3BA 4DCNA 4LY0A 4OFZA 4OLFA 3TXXA 5K0TA 3A31A 1RS0A 1J25A 2FPGA 1A9OA 5LU8A 4RTLA 1HT2E 4W9NC 4PZUA 4QJIA 4F3KA 4ZYXA 4JUDX 1Y8AA 3AI2A 3LVRE 1GFIA 4HS4A 2COEA 1J2EA 2N0SA 3QVKA 4LX8A 5JT1A 1II0A 1KBZA 2F8TA 2VAMA 4BN4A 4IIJB 5AXCA 1DLIA 2V65A 3MTGA 3ZGXA 3BEDA 3B85A 1ZLXA 5NLLA 2IY8A 3O1HB 4A7PA 3HFSA 1WXXA 1KYXA 1S8AA 3V5NA 3QRWA 5GZ6A 2XWSA 4F4CA 1U0LA 4YRQA 1F5SA 2BBOA 1E4YA 2PYZA 4MO9A 1UL1X 1N7IA 1B6TA 1T9CA 2ZIAA 2DG2A 3A9CA 1OJLA 4HX5A 1CR6A 3RR2A 1NVVR 3VC7A 2QE7D 4EMTA 1UT6A 3ILVA 4AJ1A 1DUVG 4AMBA 1O89A 3VSDA 2ERCA 1B15A 1FRFS 1JR2A 2N42A 1U5CA 5ALOA 5LQSA 4DV7B 2CBZA 1E6MA 1KAGA 1Q3KA 4PGAA 4JGGA 2WIJA 4IO1A 4WZBA 1LF0A 3D02A 3U81A 5L95A 2IY7A 3ZE9A 1MW8X 2QQEA 2BF7A 1RTKA 4R8RA 4DIKA 4DMGA 3UGQA 3EHDA 4H59A 3PP8A 1WP4A 4MUAA 1M8PA 1OZ0A 1U0FA 4R2MA 3VJMA 2E1RA 4X94A 4F1WA 1H65A 1DOZA 2L82A 1FTNA 3EFEA 3MERA 5E7MA 1FDTA 1PYGA 1T4MA 3ON5A 3U7QB 4BO0A 5LQNA 3CJRA 3K2EA 1SKQA 1DE0A 2P5TB 1NDQA 4PHCA 4UTPA 1KJ9A 3U26A 1GKKA 4D2IA 1MUUA 2ILTA 2WLSA 1J56A 1I1NA 1Q2XA 3G0DA 4WNYA 4Q15A 5ALFA 2I9KA 1EB8A 2GETA 3OZWA 4HN2A 4V2IA 1XALA 4ZPJA 3QBVA 2KHZA 1XD8A 1G8JA 2P1RA 2QQ0A 3MTAA 3NRJA 4Z4EA 2XXAA 1SUFA 3TVYA 5FOWA 3TSAA 4N76A 1OBHA 3ANSA 3V00A 1QRDA 1OW3B 2MINA 3IILA 2LCQA 3UWOA 1ONPA 3MJFA 2BGMA 3DBLB 2P11A 2OORC 2LIPA 2VRCA 4IQFA 4MA4A 2RGUA 2CV2A 3C14C 4HEJA 3AJ9A 1JHAA 1YA6A 4LS3A 1RWKA 1J42A 1DC4A 1Q77A 2ZIVB 1FJXA 1CJUC 5HZGA 4KWIA 3S6JA 2POQX 3WR5A 2ACKA 4HWGA 1BYIA 3EJWA 2J0UB 5FL7A 1R10A 3ER6A 4MPRA 4BLSA 3GLIE 4IKEA 1I2ZA 3M6MD 3BSSA 2BMWA 2Q4OA 4P3NA 3RKUA 3B70A 1Q0PA 2V6BA 3C3DA 1QRUA 2BFNA 4MW2A 2DBVO 2XZTA 2OCGA 1POXA 1OXXK 4UM9D 5AHOA 4M87A 2QW1A 1ETHA 3PDJA 1EIWA 3NDIA 4D42A 5ITSA 1TO1E 2CVZA 3WTCA 3Q1KA 4KDFA 4JLPA 3SBEA 1OX4A 1YDMA 1OBVA 2WW8A 1KAHA 3AP2A 4FXOA 4MR7A 2J3EA 3LBHA 3UMRA 4IUCS 2GA8A 3GPCA 5ALIA 4PRYA 3ONDA 2TYSB 3O1IC 1Y8RA 2CFRA 2E37A 2ZJ2A 3DV2A 2XB4A 1R4NB 1LK7A 3KYDB 3KTOA 4WA7A 4H1WA 2VL7A 4FPXA 4R81A 2GI4A 2P9JA 4LCBA 1V41E 5JZ9A 2BCGY 2HNBA 2J9RA 4Y3UA 4YASA 1MHPA 1EZ4A 1M1YE 4HJXA 4BRWA 4CV0A 1RRVA 2A1TS 3FMOB 3VBEA 4F86A 3F90A 4MW9A 2NV6A 1M7BA 1UJ6A 2O3QA 3T94A 3GT3A 4KNYA 2ZBFA 2CHVA 4Z3OA 2NG1A 2G72A 2P3OA 4RSGA 4WE3A 1VB3A 2QX4A 4MV1A 5DM4A 5KSPA 1RP1A 2AB0A 4G01B 1KEEB 3DZGA 1P5FA 3ND6A 3GCWA 3SC6A 2A8YA 2GCNA 2ID4A 3A1VA 3L1JA 4TXLA 5TS2A 4B8ZA 1KO8A 2XZLA 4PIPA 1NRIA 3INGA 1PT5A 3JZAA 3GNTA 2ZZNA 2NMVA 3U1BA 3WA6A 4PAQA 3G2KA 4R51A 1NSFA 1BA3A 1EU1A 2D2IA 3NRBA 4KUGA 4RHEA 4UARA 3TKYA 2VNJA 4Q48A 4B4OA 4C03A 1ZH8A 3W77A 2XRYA 3RTAA 3GT4A 1EDDA 4RFLA 4TPKA 2YV5A 4PGMA 1ID1A 2E5WA 2VQFB 4E5KA 4DSZA 5AJHA 1NW7A 1P0IA 1SIUA 3R6DA 4FYIA 5FO1A 2ZBVA 5AD1A 3VNBA 2PS1A 1BA2A 1U8EA 1Y9ZA 3EXG1 4LI0A 3TTVA 1P0MA 4HQRA 4BEJA 1LSUA 3THXA 4K26A 3ISTA 3FMVA 1FA9A 2ZSKA 4OM8A 4XVQA 3W78A 2YVAA 1HE2A 1PT6A 3AIMA 1ONSA 2ZJ8A 3ETNA 2JFYA 3I6ZA 3PC8A 5CT4A 2ZB3A 3OIFA 2F67A 4QXQA 3VVMA 1EXNA 4FBLA 3ZOZA 4BVGA 3K5IA 2DHEA 4MEBA 4HSEA 2OHGA 2R6DA 4ME6A 4A1FA 3TBHA 3S8EA 3AJEA 3TRHA 3F0TA 5JZSA 4FCCA 1PFWA 3RVBA 4FMDB 1Q7CA 3P8ZA 3OCXA 2C7QA 3CCCA 4UZFA 1M54A 3H84A 1GZ5A 3LC1O 4X92A 4BFCA 4I6EA 5BYAA 1UM9A 1XHLA 2CFSA 3KQTA 5MN6A 3LXMA 3E5HA 1TMKA 3A58B 4NC9A 3D2AA 3FWPA 1LW6E 3B1YA 3RU7A 1WY7A 4U6SA 2HIHA 2NTEA 2IPXA 4IDGA 1VZ3A 1XA3A 2BLLA 3KEOA 5FI3A 2O5EA 1ODFA 3FFAA 2WV9A 4QVGA 3OWHA 3A0UA 1A1VA 3WE7A 4HNGA 5HOEA 2B82A 2O3JA 1KARA 2JCGA 2QAIA 4AI6A 4GKBA 2CXSA 2HFKA 1TQ4A 4G4SO 5AVKA 1HZZA 3AESB 5BSTA 2CHQA 1M75A 2VTVA 8ABPA 1I2DA 1GU7A 4RU1A 2P7HA 2VJAA 1SVUA 3F96A 4OM7A 4ZOLF 1XPRA 2X5XA 4M8LA 4AJOA 4MKHA 2PS0A 2HCRA 2QP4A 2AOTB 2A5DA 4M9UA 4B6RA 2O8BB 1HLGA 1QQTA 3LVBA 2VXYA 1H3NA 3PITA 2W8BB 1W47A 4GSLA 4LRXA 2I1WA 3D4PA 3KSZO 4D02A 2Z6UA 2OVFA 5CXQA 4XLZA 4B3MB 2ZRHA 1QHNA 2VPPA 4CCYA 5KYWB 5J2TF 1N6KA 4I50B 4C7OB 3MJVA 3ED5A 3OZCA 3QF7A 5B1IA 5HE8A 1CZRA 1SUDA 3VPAA 5PGMA 1C1YA 7ADHA 4HAIA 3IE0A 2PKWA 3P94A 4KQWA 4RIHA 1M6HA 3E1GA 4JXJA 3RWOA 4CBVA 3LY8A 5CCBA 3U3JA 3AUYA 5DI3B 4AECA 1VPTA 1JDUA 2P9GA 3B36A 4OQYA 3ZNNA 4I5EA 3BHIA 1RLUA 5BMOA 5FULA 4JT4A 1LX6A 2NPIA 4NENB 4LX0A 1N2GA 1RDFA 3HZZA 4ZQFA 2I22A 3BFJA 3OZAA 3U4CA 2ID8A 4JLOA 4NL4H 4EI7A 2CUTA 3L6EA 5T64A 3D3QA 1GV0A 4Z8YA 5FQOA 4CQMB 3K2IA 2VAVA 4OF4A 1UC9A 1L4LA 3WTBA 2Q9CA 5BYJA 4A8JC 4ENQA 3F47A 5HMLA 3W90A 4PNEA 5AMXA 4MX8A 2EFEB 2O54A 4KQJA 4PR3A 4RA9B 4I1RA 4YCSA 3C8ZA 1TU4A 2XMBA 1XPUA 1UMCA 2O0LA 2OC9A 4EATA 4Q05A 1CUXA 1E2KA 1E2QA 1ZOLA 3STWA 3WZLA 1L5QA 1NPYA 4N0MA 4GPD1 1L8XA 2W2KB 4JK3A 4L2IA 2VWQA 3WLEA 1KZ9A 3FN4A 2OXRA 2WLTA 3L84A 4DY4A 4QYIB 1N5RA 2X0KA 3G6WA 1YRLA 4HKTA 4Y9DA 3E2IA 3B5EA 1M6YA 1UT8A 4A27A 3PTZA 4KIFA 1GDHA 2PCLA 3Q7SA 4YMHA 4IQGA 4OGKA 1M34A 4J0EA 3LC2O 4F3YA 3IUBA 4CR8A 1H94A 1WU7A 2YX1A 4EHLA 2ZJ5A 5LJIA 3GBVA 4GUDA 2QY6A 4EVSA 3S68A 1MQ9A 3MWYW 2CJWB 2Z2IA 3WIBA 5FWNA 2Q2VA 3CZ5A 3TYXA 5INTA 3U3XA 3ZZ0A 2BJHA 4YJKA 3WC4A 3FDXA 1CVLA 2OP0A 2R6ZA 5E38A 2WTAA 1XN1A 2BUAA 4JUAA 4YHBA 1M1ZA 1N34B 2I6XA 2VSNA 1ONBA 2I67A 1V71A 2GPWA 3L05A 1J8FA 6AT1A 3SS7X 1R6TA 4GI3A 3KHUA 3QHQA 1XIVA 4UHCA 1Z68A 5HSGA 1FQKA 1V16A 2QL5A 1EBUA 3DDHA 5A4DA 3BIOA 4X97A 3N86A 1VJ1A 4KFUA 3ZHBA 3F4KA 2OD2A 3AHJA 2OXCA 1YR2A 1PNOA 2OZVA 1M2EA 2GN9A 1ACMA 4Q21A 2GN6A 3VPSA 1T35A 1ILWA 4WAUA 4I1UA 3JSAA 3D4LA 4QBTA 4BRZA 3LX4A 5ESXA 1SQFA 4BFXA 6REQB 1KBOA 5HQTA 5JJIA 3AEUA 3L0BA 4KXYA 1YAHA 4AUMA 5DGHA 4IXNA 3HL0A 4S1NA 1EUCA 2AJLI 4D6XA 3IBGA 3UJDA 3KFLA 3FHCB 4YI3A 4OYLA 4YALA 3PNBA 4I1YA 1JPNA 3M5WA 1YRQA 1IBCA 4RS4A 3MTDA 3TL3A 2R2GA 5EFOA 4KR9A 3RSHA 1FP4B 4ER5A 2EDCA 3ZS9A 1XRPA 3LBNA 2D3TA 3D3WB 1KMQA 4KXLA 5FV4A 5CIYA 3ZGOA 3IT3A 3HDQA 1NNLA 1VCHA 2R6CA 5EZQA 3SJCA 4CLDA 3D5EA 1V43A 1E7QA 5EINA 2VP6A 1R7RA 2VUHB 5CXSA 3LTNC 4KREA 4AY3A 4GICA 5ALGA 1XX6A 2JFWA 5K8VA 3Q10A 3QVJA 4OCZA 1NPTO 2I87A 5EFZA 1EWRA 4OI4A 3R7AA 3T4XA 3VR6A 3CVYA 1ZJWA 1U7PA 2H2HA 4UHKA 2E4AA 3P2OA 1OXBB 3TOSA 3I52A 4OP1A 1V4BA 3KYJB 1ODCA 1ODTC 3QOFA 3H04A 2FQXA 3ZD6A 5I7OA 1LK0A 2O05A 2GSWA 5TXGA 4DR1B 1MN6A 5H7XA 1T8SA 1XNQB 1M7HA 1U2EA 3H5RA 4YLYA 3DMYA 2SECE 1JHRA 4OD0A 1RZRA 3N3BC 1FW8A 2VJPA 4UFOA 1YULA 3NWOA 1GSOA 1G5TA 3OEHD 4DMHA 3GPBA 4TL9A 1VYVA 1J22A 3N0XA 3QKSA 1UBUS 5IC4A 1JEYB 3LUHA 2ZVDA 3G89A 3KZMA 3VR5A 2FR8A 3LI2A 1RYZA 4MQBA 3NJ4A 1MRZA 2FCRA 2YXDA 4FHZA 5EG5A 4B35A 1UBEA 4W7IA 1QKKA 1U4NA 2CYBA 3CWZA 3P27A 1Y37A 5DM0A 3G7UA 3DXXA 4AULA 3LRPA 2CNOA 2RHDA 1VHTA 4MKFA 1N77A 3OPQA 1IL0A 1OH7A 1H93A 1X7DA 2P65A 2LXNA 1MIOA 2HPAA 1G9TA 4KMRA 3PHIA 1KEVA 3H75A 3EH2A 3OX3A 5KPDA 4Q12A 3TUZC 5JRJA 5F4BA 5CDTA 4N0EA 1E3EA 2NUPA 4IHJF 2IYTA 3TO5A 2QRNA 1OAAA 1QC5B 2W93A 4A92A 4CI9A 3U44B 1XZEA 4LC9A 5CM9C 3BIXA 1ZMXA 3NQ41 1VGVA 5JCPA 3MRSA 4EJMA 3RGGA 4J0CA 4KXQA 5FPPA 5A4KA 2EFYA 5HYVA 2ODAA 2P75A 4Y67A 3ZBUA 4O33A 3QVGB 1G8KA 2D1RA 5GIPE 1E64A 3RYFA 1K6XA 2CD9A 1JB9A 1KI4A 5FLXA 1GGFA 4OI2A 2XIJA 3KUCA 4X6LA 4ZCLA 3BXGA 1JJAA 1NOKA 3K0AB 2R1TB 2XGOA 2QPOA 2H8GA 4K28A 4ENTA 3L4EA 1L8QA 1ZN7A 5CNIA 3PL1A 4C3ZA 3Q6MA 1XKTA 2YMLA 3BQMB 3MUNA 5E4TA 2QE7A 4WXEA 5IAOA 3K6SA 3EXHB 3LWDA 4O4HF 1YS1X 1QS0B 4A5OA 4DLSA 2BELA 5E95A 3WIVA 3HZRA 3JAWB 1BOOA 1OGYA 1QVWA 4GQAA 5BN5B 2JLBA 3K4PA 2JCBA 5J59A 3EPJA 2O8FA 1KH3A 4LSZA 1XXHE 3I32A 1RQ7A 2YN0A 4H4CA 1G3IA 2OAGA 1E7YA 2XUKA 4UNPA 1JEEA 1UBMS 4IX1A 1QG2A 3JZFA 1CS0A 1X38A 1NR5A 3QVMA 5BSVA 4QAJA 5LQDA 3B3QA 5F12A 3G5TA 1IQRA 3QXJA 8MHTA 4FYJA 5DHSA 1MMFB 4NV1A 3W5SA 5AICA 5HKOA 3ZD9A 3ZCPA 4MV6A 4RM2A 3PSHA 1YIAA 1GGMA 4ZRDA 2AD5A 1VG0B 5AHKA 3B3JA 1Q0SA 3W8DA 3OETA 3OZIA 4G23A 2SCUB 2RONA 1J7JA 2QM7A 3C1TA 4KPFC 4TZ6A 2XWJI 3TUIC 4N5NA 4ZDJA 1RE1A 2FFRA 3RUCA 3UC5A 2GZ1A 1YSCA 4ZMBA 3IAEA 1KZYC 3H9UA 4OMDA 4FLMA 4TVBA 4ECAA 1GXSA 2RGAA 2X3YA 3H05A 4Q02A 3WGTA 4KAXA 4JLJA 4HFRA 5DWDA 3DDWA 5AVYA 4MJXA 5HRUA 1BEUB 3OIGA 2CXHA 3FB1A 2DMRA 2XD4A 5EP2A 4GOXA 1P4AA 1NQWA 3DHYA 4TT8A 3S1AA 3C6BA 4RX1A 3UHAA 5BWLA 5JEEA 1RAEA 4L5IA 1JQAA 1RJFA 2YC4C 3AR2A 2F3RA 1KSFX 2E4XA 2O0MA 2VZ0A 1RSZA 1XXLA 2HWUA 4LVCA 3T95A 4B4DA 1FYVA 4F2WA 2IU6A 3QIVA 4KHPB 3ZLJA 4X5OA 3Q72A 2B2XA 5FNVB 5KC9A 1OC4A 3NHRA 5BN3A 4QUDA 1FQWA 2PIDA 4BV9A 3G13A 5AUNB 4NFYA 2ZR7A 5IK2A 3U4MA 1Z38A 3ZE0B 6PFKA 4C7XA 3HR8A 1RT9A 1SBZA 1WB5A 1KMIY 4GNKA 1UBJS 1TL7C 1TRKA 3HPRA 2J5BA 4P35A 1TJPB 5ELLA 4DTIA 2VF8A 3ZBQA 2F90A 3ZWXA 1RPAA 4I7EA 3GZTB 3V9PA 2R00C 3MJRA 1MJ5A 1D5CA 1LBEA 1VDZA 1XZLA 1ZESA 4NMLA 1AGPA 3ONVA 3ZH9B 1WR8A 3TJRA 1DIBA 5AVTA 3ESDA 5EKTA 2NO6A 2W00A 1NVAA 3UAOA 1FFXA 1JFSA 1WDMA 3GRUA 4I2VA 1JP7A 1JU9A 4Q4JA 3SOPA 5AKZA 2F1JA 3HSYA 1PVVA 4YUXA 4INPA 4MR8B 3IKJA 4AMUA 2WAXA 4DNQA 2GNAA 2IHUA 4PG7A 1T5HX 3A9RA 3BILA 1X3SA 4BJ6A 5TPWA 1VL0A 1GZHB 2AG6A 2UDPA 3DKPA 1DJOA 1H66A 1DV2A 3FPBA 4PWYA 4ZQHA 2IH4A 4XJSA 4QULA 1YDEA 4UTOA 4XJXA 2NSYA 1QB7A 4GWGA 2JGEA 3FUUA 3K0CA 4OH7A 4BU1A 4D4HA 5JVDF 1QBKC 4NCIA 3C5WP 3CMMA 4QJBA 2OQ2A 3IQFA 1I4WA 2GEBA 1I9CA 5SZJA 4E4RA 2AEFA 4ALJA 1NBMA 3CX6A 1X9IA 2LPMA 3EAQA 3FBTA 2J07A 2QX9A 1YRBA 3KD3A 4NHEA 4PC1A 5DYIA 1W76A 3V1LA 4ZYWA 4FYVA 1YTUA 1T36A 5L3SA 3ZDQA 3RM3A 3OM8A 3T7AA 3REOA 2UYHA 4AMVA 2EBWA 3WNBA 2YWBA 3W2HA 3C4QA 3PQ3A 2V45A 3BFKA 3A3OA 2XT0A 1E61A 3PC4A 1VMIA 4B44A 4M55A 2JGLA 1VQ1A 5CDYA 2C2MA 2V7GA 1XMJA 4ECEA 4X7PA 1Z4OA 1CQJA 1L7QA 2JKVA 2J6IA 1XA4A 4DIBA 2P69A 1Z16A 3UUWA 5TF0A 4MCHA 1Q1EA 3JQEA 2OV6A 3PR1A 1Z22A 4PQYA 4UBNA 4ZOLB 3G5AA 4YP7A 1Z6AA 3DM9B 3R74A 1ZNQO 4RY0A 3T7SA 1L2TA 3I6QA 3CR8A 5K4AA 3IURA 1KZHA 1VMKA 2ZSDA 4IZIA 4M86A 3OLXA 4PNZA 5JDIC 5KNBD 3A1TA 3TL6A 4DWOA 5CURA 1GTMA 1YE8A 3TBKA 2IZ1A 4V1CB 4A3SA 1RVV1 1H2BA 1JECA 2HMTA 2HM7A 3CRQA 3MMSA 3VV3A 5C5CA 2AWOA 2ZUEA 4QOIA 1Q0RA 5F78A 4ZVTA 3TQTA 3UPUA 3MHTA 4ZQCB 1TKAA 3FJ1A 4B0OA 3UVEA 4ZYTA 4RDIA 2WU8A 2GAIA 4B9EA 2DWUA 4C7VA 3UJ8A 3AF1A 3CCFA 4H3KB 3GIWA 2X8AA 1SUIA 2FWAA 1MH9A 2Y0BA 1ZBQA 2HWXA 4JN6B 3UCXA 3RHSA 4MUFA 4O4JF 3H1EA 4DCTA 2IUFA 1H5UA 2EKPA 3KB8A 3ZLBA 1F2VA 2AG1A 4DUGD 1RYYA 1TOAA 5I9BA 4DEXA 4MDEA 3VR6H 3WWDA 2RGDA 2V3WA 1R9NA 5LC1A 1GT6A 2OCXA 3RIMA 2ZYGA 1DZIA 3TTSA 1YL5A 5JYCA 2CHGA 5CIWA 2XBUA 1U1GA 2X76A 1QTIA 3GFRA 4W8OA 4CMGA 1DHTA 1M10A 4MS4A 4RE6A 3NHZA 2CCKA 2RIRA 4AP9A 3TQSA 4IH4A 1ZOSA 3SIWA 2OLJA 5CB4B 3UB3A 1J5XA 5AVSA 2IL1A 3R6GA 4ZI5A 1KBQA 1UP6A 2XPCA 1YVRA 3V42A 2QBYA 3I8SA 1OXVA 1SOAA 4PLZA 1FDUA 1NXWA 2X7HA 2AI2A 2XCOA 4RZ2A 1QDUA 3RC3A 3MOIA 3VTZA 3LUKA 2X5JO 1ORDA 2C2XA 4XWKA 4DXDA 4E0BA 3RIYA 3R7WA 4Y9RA 3SC2A 4G4JA 5BWMA 3FVRA 1U2TA 1CC1S 4C04A 3V7WA 4Z53A 3DOFA 4JVNA 1C3OA 2GEDA 2ZBGA 1B4DA 2RD2A 1UPTA 3IUMA 1LDBA 1YZVA 2W4MA 5L9AA 1TW3A 5CVJA 4BKQA 3IALA 5KYGA 5LZ4A 4C4TA 5LD2C 1QE0A 1Q84A 1N25A 3AYZB 2VLBA 3EA0A 3PDWA 2I3DA 1UEIA 3CNHA 1RAIA 2ZIUB 5JY6A 2UXDB 3IT1A 4HJRA 1LJLA 4XCVA 4BVJA 1RKUA 1YD7A 3JATB 2CMHA 3QE2A 2GYWA 4KYUA 2UZAA 5IBCA 5JEDA 1T0BA 4TVSA 3HMKA 2LV8A 2ZIEA 2I29A 2XV1A 3MWJA 1E9DA 4N5HX 1JTVA 2IZZA 2QUJA 3VU9B 4MIKA 5JNRA 4KXXA 5DN6A 5JH7B 3DKKA 3LKZA 4TWZA 4X7BA 3RVJA 1AVTA 2E2WA 2J0VA 4IWXA 1EBFA 5K05A 3KV1A 4QUKA 3K8YA 1PJ8A 1AGRA 2VPQA 1GAXA 3MFQA 2VDJA 2J3KA 2X2EA 3CH5A 3CR7A 3NYIA 4FC7A 4KNVA 4LDNA 3BJIC 2VF7A 4KKXB 3SE0A 2BY4A 4MITA 4OXNA 4G2TA 5JNSA 2JVJA 2JD2A 1ZOPA 2P9EA 4GPZA 5C34B 2OBLA 1HDZA 4GM1A 4JB0A 4Z99A 5DVZA 2ST1A 2AZMA 1ZI8A 4JLMA 1IULA 5ER9A 3WKBA 2FQ1A 1FF9A 2NYVA 3LDGA 3PC2A 4BO6A 1GUBA 1UMBA 1OLOA 2KLHA 4GKVA 2GLUA 5D2CA 4BAGA 1I7DA 1Z2DA 1Z36A 1ZVKA 4TROA 4WDRA 3X1YA 1SK8A 1T9GR 3PRJA 4HQOA 3E7DA 4G1VA 4J0KA 1NP7A 5JSFA 2XNDD 3CUUA 5CDHA 4DYVA 3ZWWA 5K2OA 2RIPA 1ZICA 5KX5F 3W2IA 4V3BA 2D5LA 5H3CA 2I2DA 3MC1A 4ZCSA 3DBIA 1TYCA 2C5FA 1FX0B 3TFWA 2R47A 2PZLA 1E9RA 2DUNA 2JZCA 4IDBA 3A4LA 3L7BA 5LIRA 1CTQA 1J2YA 1W581 3L7LA 1DS6A 3ZHXA 3FMFA 2ORED 3WHPA 3YASA 4BB6A 4LWOA 1XZJA 3WDLA 1LTHR 3OLYA 1JSLA 3LUDA 4DMMA 2W6PA 3Q40A 3LO5A 1WRBA 3TXAA 1DFIA 2L18A 3GLFB 4ZO7A 7GPBA 2H1LA 4EY3A 2OO3A 4LN1A 1Y7PA 2B7BA 3PVZA 4ZAYA 2B25A 5B3KA 3NBMA 2UU9B 5BNFA 3MJEA 5IAKA 4GDMA 1EGQA 4I9NA 1SHZA 4IL5A 4UVHA 4PXYA 1KP2A 1RQPA 4BTVA 1U7WA 1YQEA 1BDBA 2A0FA 2QMOA 2E4ZA 1V8PA 4F7WA 1ZJJA 3QMWA 1NSYA 2G7MC 4F4JA 1NVDA 2QYOA 1JQEA 1P2GA 2GFQA 2A0XA 4XYBA 1XTZA 3GFSA 1YJAA 5U4XA 2NZXA 3NC1C 2P4EA 1GA1A 2BGTA 5CUQA 1USGA 3BFPA 1Q22A 3O8LA 4X63A 4DDUA 3PVCA 3WMEA 4D8XA 1U0RA 3TOXA 3IP8A 4NFLA 1EK1A 2UYQA 5F3WB 3BD6A 1M6VB 1IVYA 5DGDA 2DHCA 3QSYA 1ULHA 3F3KA 1M1XB 2IUEA 3I6IA 4NYIR 3IMCA 1QWOA 4G0QA 4PAMA 1NJ2A 3F2IA 5EIWA 3FPFA 3JRNA 4ARIA 5IU6A 5EHQA 4FBMA 1YIDA 2FX3A 1AE1A 4ZALA 1RTTA 1U11A 3JQBC 1PWXA 3FYHA 4YCAA 3H4TA 5ALVA 1NVXQ 1MO4A 2BGUA 2J3IA 1YNSA 1YOBA 1IG0A 2R5WA 2VJLA 3D4BA 4B3DA 3CUKA 4LJ7A 2IC5A 1QAOA 2G70A 4JX9A 3UH0A 1CDDA 5FPTA 2JBAB 1RWXA 4I4TF 4LDPA 3ZWPA 5K99A 2QR3A 4Z5XA 2BWJA 4P32A 4RIFA 2QN1A 4NMMA 3OEHA 4JU8A 4MTCA 2VJMA 3A9SA 4D9HA 2VSQA 1ZNZA 1J5PA 1AU9A 5HRCA 3NYQA 4LZPA 4KLZA 1KIFA 3HB7A 2JJ8A 1OPRA 2H4XA 1XF9A 3R7DA 1QP0A 1DIGA 4BDSA 3GK3A 1SCNE 1NYTA 3FYTA 4DJ5X 1FRVA 3OJXA 2QOEA 3G2LA 3GJ7A 4RF5A 3GPIA 4Y8VA 4Z1MA 5TT1A 5MFPA 4ZO8A 1W0KA 3EDQA 3CE6A 2DB3A 1OU4A 1UK8A 2Q2NA 3DLHA 3ZGNA 1FNMA 2DPMA 3BRCA 3F6PA 1KQPA 3EZNA 2BEUA 4Q16A 1SUAA 2O8CB 1R9GA 5AVJA 1Y1PA 2IPNA 1XAGA 1DQZA 1EKXA 5CVEA 3MJCA 4TTIA 4B3IA 1T34A 3VHXA 4R1QA 1L7MA 1U7TA 2MSEB 3LQRA 3NEPX 2ZUDA 3VXKA 2H08A 1JG6A 5IX8A 5JIBA 2HA2A 2QVLA 3WKEA 2DUUA 2VPIA 4G25A 4JT8A 5FI5A 1YBVA 3OT4A 5ICEA 4LCEA 1E77A 1GNVA 3IAXA 4YROA 2GZ3A 1MVNA 3I2KA 1BCSA 1KORA 1U3TA 5AI5A 2Y6UA 1P0QA 4HUQB 2OR3A 4BV8A 1SVOA 1GUYA 4IINA 1R6AA 3ZWYA 4DYDA 2WILA 2D06A 2O3SA 2C59A 1X9HA 3RT7A 2X9GA 4WUVA 4CV1A 3CUTA 2GZMA 2VNHA 2DFNA 3B82A 3WDKA 5C5DA 4CW7A 4R2HA 4K05A 4ARSA 2GBPA 1U8XX 2ORYA 4ATNA 2QP9X 3CIOA 5AJVB 1F4LA 1WPQA 4RZXA 3JWJA 1DKLA 2PUHA 3CX3A 3H97A 4KVFA 1QIJA 4R3WA 1FFYA 1C7EA 3B3GA 4U7TB 4NNOA 5JQGF 3L0IB 1KOJA 2XEDA 3HY3A 1NV9A 1DKUA 3K1AB 5FUWA 1MO2A 4ZI2A 3NC4A 2C5LA 1KPHA 2PRSA 1HETA 1G20A 1R88A 5CK5A 5AI9A 4FW9A 1NWCA 5F2EA 2F8LA 1ZGHA 2BCEA 1GG5A 2F3TA 2IEDA 2WE7A 1QYWA 2YDXA 3P4XA 4Q3AA 4RPJA 2E5FA 4FONA 3SF8B 4KYVA 3HCRA 5BRNA 2Q5QA 2XUIA 4WZAB 1TO2E 3ZHRA 4I1PA 3K3PA 5CVDA 1E3WB 1NR7A 2GO7A 1L1RA 4UNIA 4EX6A 4CKCB 1RC8A 1HYEA 3X1ZA 4ZOAA 1EP1B 1DC5A 4I1VA 3KP1A 2JZNA 3QPCA 3A4NA 5T41A 3INNA 3JAKB 3TFOA 5DJ5A 3WQBA 3BN3A 1NT4A 3IJRA 4C6SA 1NNI1 2QUAA 5FWYB 5G0TA 1OLSA 4CF5A 1IOVA 1GRRA 2IRWA 2G4CA 1PWEA 3BXXA 4JLBA 5HIJA 3J7TA 5DBFA 3HKEB 4DA4A 2IBSA 3V32A 2GXAA 2CXOA 5BW6B 3AF2A 3PGVA 3AK4A 4NPAA 3JTMA 3IMFA 1WQ3A 2FCAA 2HHHB 4LF5B 3M49A 2A0UA 3W5VA 3LDHA 3B3FA 4Y2GA 5JVDB 1P7CA 3C74A 3R23A 2RJNA 3CNBA 3RC2A 4AS3A 2WSBA 1PJBA 2G9RA 2ONCA 3JASA 1UOQA 1UAGA 2IYUA 2QV0A 4FI3C 4MPJA 4HV4A 1U8UA 2JJ2D 4B79A 3LSTA 1TJ5A 1ZMTA 1XZMA 4PG6A 2F55A 5LFAA 2YH2A 3PQ7A 3WK5A 3IAS1 3NANA 4FDLA 4YJFA 4E1AA 3LIIA 4ZYUA 1CQIA 2I6TA 4BMDA 5HILA 2B35A 1KDZA 1O0BA 1N2ZA 1MHTA 4ZO6A 3SVZA 1MT0A 4JYZA 3VOAA 1ZLYA 3K0SA 5K0CA 1GTJ1 4MVJF 1NW9B 3EDMA 3PUJA 4OUDA 2DPHA 2GPYA 1FUUA 3M6FA 1B16A 1JJIA 4RDHA 3PNOA 4GT1A 2C77A 4U6QA 3REGA 4JB8A 5AM0A 1COZA 3OZ7A 1T43A 2ZUBA 1QGUB 2QNBA 3M81A 3LHKA 5E6RA 1HL7A 2IV3A 3UMCA 3KR9A 3AEQA 1GVNB 1FFAA 3OJFA 2GJKA 1SKMA 1Q7BA 3FUXA 1W36D 1QNFA 2QT1A 3IV9A 4Q24A 3UK0A 4RF4A 3RDPA 3EQ6A 1UBKS 3IEKA 4H77A 4LZAA 4JXKA 4TKLA 2ZQ5A 3R09A 4MV4A 3PHHA 1HZJA 1MBZA 4EJSA 1JBQA 1FTWA 4ZV4A 4NULA 1VSUA 2B6HA 5G0UA 3ER8A 1Q74A 1JFLA 4XDZA 3RD5A 5BVGB 4A8TA 2CMKA 2VDUE 4BPBA 3BH6A 4HZUA 2E87A 4HXGA 1G2QA 2B1GA 2JFBA 3E48A 5EC8A 2W11A 5A6VA 5EJEA 5I51A 4TV9B 1T0PA 3REFA 4GC9A 3WWOA 4JR1A 4PFQA 3OLWA 2ZI3A 2K87A 2O3RA 2G0NA 4FEEA 1MQSA 5C7LO 1NE7A 4BOYA 3JQGB 2JA1A 3UV3A 2QD1A 4URWR 1WCV1 3PF8A 3OCYA 2OZPA 4B6FA 1VSTA 2YNMC 4G5HA 4Z51A 1V2GA 2XB8A 2WDPA 4IY1A 1QIDA 4WXPA 1JIJA 3QY9A 1C7FA 1CKEA 2H6EA 3EDOA 4NEHB 3DHWC 3KQLA 2ZM6B 3MWGA 2B8TA 2QSUA 1OYYA 1ADCA 1BMDA 4LYAA 1NGSA 1O5OA 4ZKEA 1ACLA 1DCFA 5FA5A 4OTZA 1ODJA 4G1FA 4AJKA 4NZZA 2HF9A 4M9SA 4BVHA 4RETA 2QR2A 1E7SA 4LJRA 3TE6A 2R79A 3D31A 3HKBA 3T3MB 1JEOA 2A0WA 1DBIA 2VHVA 3CZRA 4M98A 5DHAA 1SXJA 1MZPA 3AEYA 2ATEA 2RB5A 1N8KA 2ZRAA 4CQJA 1H2AS 2BUBA 2J5KA 1GYQA 3NGXA 3GP3A 2GSDA 2HMVA 2PSEA 4MUGA 4Y0NA 4M46A 1YS9A 1ZEJA 2ZIZA 3SZRA 4XVCA 2JGAA 1DAEA 1F9AA 1T8TA 1XD2A 4BLOA 1XL0A 3SNKA 1UBNA 1MAWA 3VNAA 3WNQA 1IXZA 1K7EB 5AVOA 4LFCB 2LDBA 3WGVA 2FZLA 4QPDA 4MGIR 4D41A 3ADCA 1NLMA 4IJVA 2EKBA 1IQPA 4KAAA 3W06A 1A2BA 3IR6A 4G85A 4XOUA 4YRBA 3HRHA 4TTQA 3DFKA 5AXDA 3A14A 1DKQA 2HEIA 1BFUA 3G59A 3QW2A 1RCTE 3F5FA 3QX8A 3U80A 3FFTA 5CFOA 3CX7A 3PX2A 3DL4A 1XKQA 3KPYA 1D1PA 4ZT4A 2HSWA 2K2WA 3RI3A 4YTEA 3AL2A 4CKWB 3IHKA 1E1NA 4HQFA 4AO7A 5IAGA 4B48A 4XX0B 1KYYA 3SZLA 2Z2XA 2FFAA 1F8GA 3EOBI 4X66B 1UINA 1E2IA 4ROTA 1QK3A 1M76A 1B1CA 3C7AA 3E53A 3IAM6 3R0QA 1XMIA 2BUCA 3U7RA 2VT2A 5L40A 3DVQX 4WASA 3MINB 5KCMA 3UJNA 1TU0A 4J0DA 3N2EA 3MRXA 1LB1B 1TXGA 2DWQA 2PGNA 3F9RA 2JRLA 4FFDA 4RGYA 5DGTA 5E3JA 3MIZA 3RJMA 3TLGB 3EGCA 4BECA 2C8VA 1ULTA 2F7SA 4KQGA 2C3PA 5HMMA 1D6SA 5IKPA 2B2NA 1ISSA 1C14A 1AKUA 2C4KA 3GO4A 4GXNA 3VR2A 1A7AA 4UBKA 4Q3NA 2OYSA 4QKQA 1PEKE 3DSRA 2YS7A 1EFPA 1H2ZA 3N59A 4UMVA 1YKFA 5AKGA 3ZU4A 4EYGA 4EY7A 4F9TA 3NDBB 3HO1A 1DCMA 2HX1A 1RPZA 1VKNA 3H5LA 4BXOA 3WBJA 4P6VF 1W5AA 2HF2A 3E82A 4CFZA 3GEGA 2AN5A 5D3ZA 2O8EB 4PO9A 1U1IA 3WB9A 5KKNB 2Z2ZA 3AOGA 3R9IA 3VDRA 3SFZA 4PS0A 3A6ZA 3TZCA 5KTOA 4DV4B 4ZCRA 4KO4S 1U8TA 2GJ9A 2MR5A 3KL4A 4EQ6A 4N8DA 1VLLA 1ZOOA 1JEAA 3KCNA 2W6NA 3M6LA 4E2XA 1PJTA 2H29A 3BKXA 3UMFA 2F9LA 3ETHA 4CTOA 2V0CA 4CM6A 3OPYB 3OVMA 2BHLA 2RHRA 4MUEA 1A50B 1JQDA 5CCEA 1G41A 2R8BA 1U90A 3DEHA 3T8YA 1MEJA 2R7MA 4RZQA 4GZ5A 2FXVA 2BJWA 2FPSA 1Z4KA 4O5AA 2IOFA 3THOA 3NVDA 5CXXA 2CNDA 3FI9A 3OFND 4YRGA 4XGRA 1VP3A 4IKPA 3UV6A 1KMHA 2B4RO 2WNSA 5T3UA 1MZVA 3ZJUA 3QP9A 1T2NA 2HSEA 4HVTA 3NAZA 4Q1BA 5LYJA 5DZSA 4BNLA 5LM3A 2CZQA 2WFMA 3DBRB 2W4IA 1CPYA 2GJ8A 2CLKB 5FOVA 1DKPA 3OECA 4YMVA 5JCXA 2H0AA 2I6QA 5LKRA 1ZH6A 5TB5A 3PQ6A 1A9TA 3FPSA 3P0JA 3TNYA 1A7JA 2C4VA 3HABA 1ECGA 5EKSA 2IEAA 3PLNA 4ND7A 2J0EA 1Z5PA 5IVHA 4ZEXA 2ZWPA 1SFRA 2SICE 2E4YA 4TSFA 4ZQBA 4F97A 1BHJA 5FPYA 1EFVA 3SU8A 4BNIA 4EI8A 4G0VA 1EWQA 2C58A 2AIRA 4QJ4A 3AFIA 3R8CA 3TX6A 4UEJA 3OQ1A 5FBVB 5CNJA 4ALLA 4WX2B 4UUNA 3UT6A 3QV1A 3C6QA 4ARAA 3NG1A 1T4GA 4UXIA 2HEGA 3D7KA 4MQEB 5ERYA 1NYRA 4M9QA 1EB9A 1D4OA 3ADDA 5DYWA 4JASB 3SXPA 3H1GA 3ZGLA 4D4IA 1SKAA 2H16A 4IDFA 2W6JD 2DETA 2JLSA 5B6PA 3QKRA 5IABA 3TIIA 4HN9A 3HR4A 4AYXA 3LT5A 1TYEB 2YJ5A 2PGIA 3NJRA 1X15A 1XZAA 3NYRA 4FP9A 3QLEA 2FZ5A 4HY3A 3KAKA 4KE9A 4Q9IA 2JLYA 1ZM7A 1NG9A 1SXPA 2OT3B 1T1GA 1NC3A 4S2EA 2XYRA 3DEFA 3PGJA 3UJCA 2BHTA 5C32A 1P9WA 1RPNA 5L45A 2XX3A 5JAQA 3BCRA 2ZUVA 5EWLA 1YO6A 2XVMA 3MW8A 4BNKA 2WUVA 5IW8A 2CSUA 4FT4A 5HM8A 4LQDA 3O7WA 4WK2B 4B2IA 4IXMA 1WCXA 3CZMA 3PHBE 3K96A 4BMPB 4LISA 2X9QA 1CZLA 3BDAA 5KTNA 3V7YA 3L0CA 1KK2A 1X8LA 1LLCA 2OCAA 4Q39A 2ZE5A 2MDTA 2XUFA 2AQHA 4JROA 4HAVA 4QA9A 1G64A 2XMSA 3LL4A 1D03A 5EQTA 4J49A 6YASA 2HSJA 3EARA 2Q8NA 1XCGB 1JFFB 2XCIA 2ZAGA 3AY0A 3OOYA 3S0JA 4Y2VA 4H7HA 4P82A 4Q4HA 4Y2YA 3Q3GE 4OHZA 4YV1A 1K6IA 4B74A 1J6UA 1E20A 3MWDB 1ZA1A 3ZBPA 1XRSB 4ZAWA 1XTTA 1FXSA 2FPOA 9LDTA 1Y7TA 4LJ6A 4MQFA 3ZWQA 1NFQA 3AERB 4FSDA 2B7CA 1OYVA 3MD9A 1ZD8A 2WE8A 4W5TA 2CV1A 1HY3A 1N6LA 2X86A 1TYBE 2JGDA 2Z5VA 5LQUA 3JCZA 1XMVA 1QSGA 3MXOA 4AM8A 4R0MA 2R7LA 3O3CA 1NN5A 4XQ0A 4YJGA 3ZWNA 4EIWA 2YHAA 2PS3A 2IPOA 2JD0A 3KOZA 5ERGB 2I3GA 1V26A 4RWZA 2GDJA 3CVXA 1K3FA 2ZIXB 4F8YA 5LDHA 4ZCQA 2FSFA 1LBHA 5AUOB 1KRWA 1JDSA 3CIFA 4BQQA 2IEBA 4XDYA 1QHEA 2GCPA 3QPAA 1YQWA 3D6JA 1W2GA 2Q1SA 2G1PA 4GDFA 3IR5A 3OTWA 4IBOA 4N54A 1MOZA 3SHQA 3MGBA 1G4HA 3OIVA 8GPBA 4CT4B 5LDDC 4R05A 4HP8A 3OZFA 4G5YA 4HEHA 2H0QA 3G8AA 1VI2A 4R7GA 3ZJVA 2JFZA 3GA7A 4N8EA 3WK9A 1PJQA 3IDFA 2HQSA 1XYYA 4LOIA 1U9ZA 4OK6A 3E84A 3U3ZA 1XZ8A 4MRSA 4BYGA 4MQMA 1FDWA 2CL6X 1GQQA 4KMSA 5KSWB 2CSXA 2J67A 1II8A 2CXTA 3Q0IA 3EXFA 1WUKS 1N92A 2CK3D 4GS5A 2CXXA 4J8PA 5DT9A 5DYGA 3SOZA 4GPIB 4CMKA 2D00A 2IFTA 1WE2A 2XSZA 3DKIA 3HBJA 3ITKA 1T6XA 2MTBA 1YXMA 3E70C 5EKXA 3ONWA 5JAHA 1TQDA 1CIJA 1Z5NA 4R8SA 5EE1A 2PUCA 4PQGA 2DR2A 3DMPA 1P80A 2O3UA 4KQ2A 1J8MF 1Z37A 2R8YA 1VA4A 2ZSBA 1L3BA 2CLSA 1V1MA 1HOXA 2V97A 4YJ3F 2PRYA 5BO5A 2FWBA 4EW3A 3EFHA 4GX1A 5KTYA 4LYEA 3RVLA 2XQFA 4Q1FA 1N8SA 1NVUQ 1JF8A 1NUHA 4FE7A 3ZWOA 5JATA 4QD3A 2Z09A 5K8JB 1XROA 5HRAA 3IKVA 2VRWA 4XQGA 4LHEA 1QO7A 3MXTA 2Z04A 2VZ9A 4OSPA 1VE6A 4UOZA 1KE1A 1EUYA 2OFOA 4B6JA 1V8BA 2B4TO 3QU7A 4EB8A 4UTXA 3A6LA 1H22A 2P5UA 3LKBA 4ZODA 4MA0A 1CBUA 4MRMB 1P5RA 5ELMA 3GFOA 2H1WA 1XQYA 2Q3HA 2GN4A 3QELA 3BGSA 5IDQA 2RBEA 3I6MA 4MOWA 1E3DA 1HLDA 5ICFA 2J48A 5JD3A 4R69A 1JVBA 2PWAA 2JLCA 1E96A 2Y0CA 4ARCA 3VH3A 3KB6A 3WWPA 1RPTA 3I2GA 5ULLA 1GZ4A 3A1FA 3AFMA 3EZFA 3TQIA 5IFKA 3LUBA 1BTOA 5IJAA 4HLCA 3THRA 1SBIA 2CLIB 4BX0A 2GWHA 1KI2A 1ZA2A 2ODBA 4E13A 1E89A 3IPYA 5SY4A 4ESHA 2Q1TA 1X7ZA 4DQDA 1QH9A 2O5VA 1T26A 1I6KA 2ODWA 5A0TA 3BE6A 5ALHA 4MEAA 5E9WA 4E08A 1S7GA 1X1BA 5HQ3B 4HGNA 1WHTB 4UUQA 3VYRB 3S5UA 1XJQA 2F3SA 2JJ2A 1ZIDA 3G85A 1Y89A 5IDXA 4M9RA 3MILA 5COQA 4AO6A 3OD5A 4E2FA 4H1HA 1NW3A 1ZL0A 2BZ0A 2VXBA 4U00A 2YMPA 3L40A 4IRXA 1R2QA 2CHUA 3QBTA 1KEUA 2VQSA 4UCQA 2EZ4A 2I4LA 4BLPA 2OG2A 2OG1A 3DTVD 3MS7A 4FFBB 3STXA 2QX8A 4Y98A 1PNRA 2VFAA 4MVJE 3SLRA 2FJUA 5DX8A 3TOVA 1O6BA 1GTRA 1SVWA 3NM6B 2G04A 1XJ0A 4Y6GB 1D2AA 1IHXA 5ARDA 4NI5A 5IYZF 1KEZA 2FVYA 4QBIA 1XJ5A 2HRRA 1JIUA 1XEFA 3LT1A 5EXXA 1O96B 1O0CA 2JGRA 2XZPA 1WXQA 1UDAA 4IIJA 3M3HA 4V0OA 1JTEA 3PYLA 2JASA 2QM3A 1VLHA 3S44A 3KWMA 3KR0A 3NORA 2PTGA 3V46A 2DX7A 3EDCA 3KZNA 4CKYA 3WB2A 1XTBA 2C95A 1NE2A 1BE0A 1ECLA 2Q5IA 3U7HB 1QV7A 1VLJA 2VYVA 1XVTA 5CYGA 1N3YA 2Q6VA 5T7BA 3ZDAA 1YDWA 3UMBA 4EJ6A 1JDJA 1NNUA 4AJHA 1YB2A 2FN4A 4PY2A 3AKCA 3WAGA 3HN6A 2EOAA 1TM7E 1GZUA 2GTPA 3ZN2A 5D84A 2P3QA 2Q3JA 4QQFA 1G8PA 3IUEA 1FIUA 3DMHA 4Q4DA 3ESZA 1ZPDA 1SCJA 4F0JA 4WLVA 3JQ7B 2CHEA 4YLEA 1E66A 1WKBA 1LRJA 2AUTA 2HCJB 2QU7A 3I2HA 2HOQA 2HWKA 1TEHA 2VBIA 4EHKA 4X41A 4B7UA 4WN9B 4LV8B 3U7QA 4ALMA 4U0JA 5ENVA 5E3IA 1YMVA 3CMCO 1VZ2A 5IJZA 1PTJC 1T0IA 2V8BA 1TQ8A 2FZVA 1FE8A 1WXGA 1DIRA 1ISMA 2ADFA 3IO5A 1KZ1A 4TWIA 4KIUA 4Q7KA 1E2EA 1DB3A 3C8UA 3NNDA 2CLEB 1JN0A 1FLDA 2QQ5A 1IE3A 2CBGA 1HNXB 4I55B 4FE4A 4X8HA 3RSQA 3A6KA 2EX0A 4LYJA 4HXYA 2ODEA 2YHUA 4ZIRB 4ZRNA 1QJ4A 1QU2A 3D0KA 2AZ4A 3LPDA 4F11A 4L5YA 4DB2A 4O2AF 1PT8A 4TLDA 2V9PA 2N1MA 3OQVA 5I8PA 3V4OA 3OCJA 3CLTD 5BWBA 3FHJA 4NZNA 5IZCA 5F2NA 3TLKA 4MCIA 3AZOA 1JPJA 4RGQA 4FYYA 2J0UA 1ZMOA 3L3BA 4KPEC 1AJEA 2PZAA 1JZQA 3ZX4A 3I2YX 2E0IA 3G0IA 1GCAA 3DNPA 3EYAA 3NGLA 2NZ8A 4HXFB 1C0IA 1V96A 4KXWA 3VO2A 3C41J 4L4YA 4US2R 1SXHA 1PDOA 1I6LA 3W0LB 2G5PA 1LBQA 1R6BX 4DLZA 1L1QA 2FN3A 3KQHA 2G09A 2Y2VA 5EJMA 3A04A 3BF8A 2VHUA 2DHDA 2BT4A 4WADA 2ACEA 1SPXA 1WPGA 2A5LA 4P3KA 2YTZA 4W5RA 1YHZA 3HKCB 4EG5A 1G7TA 1APBA 1Y3DE 4ZHQB 1AC5A 2J7KA 3JARB 4TQ9A 4X20B 3KYDA 4P3XA 1CIVA 2X4IA 3SE7A 5F35A 1ISIA 2KPOA 1NQ5A 1FXUA 3UB4A 4OQQA 1W94A 2I7TA 3CNQS 4HDOB 5SYNA 3RHZA 4PU0A 3GAMA 2W42A 1VL8A 1PVDA 1WEKA 1EIZA 2ENUA 3EVFA 4I9GA 1ESEA 4LXXA 2XYHA 4LYDA 4XGQA 4YACA 2IBMA 3WFZA 4YAEA 4DR2B 1WKVA 3UGTA 4C14A 5L53A 1K88A 1RD4A 5BRJA 4N6NA 1R8XA 1KI1A 3IOYA 3PIIA 3SHWA 5A3QA 3LUPA 3PEWA 2VWGA 1NOIA 1DHRA 4IHQA 1VBFA 4G5OA 2IZ6A 1KEEA 2BSAA 4LMAA 4H7FA 2RGBA 4GLFA 5A9SB 3DFIA 4YMUA 1LPNA 1CY6A 4HH3C 1YKGA 1GFSA 4KH1A 4XR9A 4C4YA 1U94A 5KNCA 3M1YA 5B3LA 5CX4A 1Z0AA 2PANA 4KGXA 2ZUCA 2IEZA 1JSXA 1P3DA 2Y3IA 3FKSA 3NM5A 4IH9A 5LMNB 5J40A 3L8DA 4ICIA 1PBNA 2PRKA 5DOZA 4B80A 2GRAA 1KDYA 1FVHA 1NMSA 5JHGB 2VDPB 1JIIA 4K1XA 3WRXA 4YO8A 1KQOA 4BLWA 4CJXA 4GD3Q 5AW0A 1P1IA 4NK4A 4I81A 1W9HA 3AUXA 2ZGVA 3EGEA 2II6A 3GXOA 1NAIA 3T3DA 4C9BA 1FFEA 9LDBA 3OOWA 4JB3A 3KKZA 1NL3A 1EG7A 3ZQJA 2AKAB 4FT2A 5JMOA 4HEQA 1E8MA 4DSUA 1UKBA 1WB4A 3II6X 1VPWA 3H2BA 4CUKA 3FYUC 1QHHB 2XNKA 4F5YA 4J4HA 1KI8A 3C45A 3LA6A 1G8FA 3QOYA 4XB1A 2D0PB 2JKZA 3QENA 4I14A 5FUBA 4CMEA 2FWMX 3IVXA 1CETA 1KH1A 1U0HC 1UIMA 1C4XA 1GOTA 4JI3B 1LNZA 2I9PA 1NOJA 1IEXA 2XOXA 1SU4A 2WHEA 3NXKA 1THZA 1P5JA 1DBQA 1XDZA 2VWPA 5CHYA 3CVVA 2RCYA 5BPHA 1IWBB 2BONA 3ICOA 3UXEA 3ZCRA 3FPHA 5KSOA 5CLQA 1LSOA 2WHXA 3QTLA 2RH8A 1X1CA 4HDRB 3A11A 3JY6A 4AS2A 4HWOA 1NRXA 4RJTA 1OFUX 2PE5A 1TM5E 1KOGA 4OHYA 1UEJA 2V7QA 3HLKA 3U7GA 1CHDA 2FLVA 5EEHA 4C6HA 3W5HA 3D2BA 1KY5A 5GINE 2B30A 4IICA 5EP1A 1T0UA 4X3OA 4HAXA 3KNZA 1Y1QA 3F1KA 1HR0B 3KBOA 3HHPA 4IG9A 4Q7EA 1H2YA 2DGDA 1ORTA 2P67A 1YS2X 4MUNA 5IP5A 3NMUF 3GJ4A 2A2ZA 4XCXA 5MGBA 3DVSX 1WULS 5A06A 1LPPA 1OV6A 3V1UA 5IJ0B 4GXRA 2F1KA 3A10A 1QE3A 2FLKA 1CJBA 4Q1AA 1B41A 3RC1A 4C0SA 2FW7A 2BF4A 2DFKB 2AOTA 2XDAA 3FFWA 1QTQA 2O8BA 1BD4A 4UE2A 3OE4A 2FPKA 1DPGA 1M66A 1XLVA 2W8BA 1R6DA 2I4MA 4E4TA 3B6EA 4M0MA 2A94A 3CR3C 5KYWA 3L1HA 2JIRA 3AIKA 1JIQA 4I50A 4UAUA 1XDUA 3UXYA 1DRUA 2AFIB 2C5EA 1N6IA 1YZFA 1R8QA 2VYCA 4N7JA 2AMJA 1FMTA 5COAA 3RIXA 1CQWA 3KXKA 4Y6OA 1VJGA 2CVFA 3RFCA 2ZUFA 4BNDB 4NNPA 1RI1A 4YEDA 2JFXA 3H6HA 3L1UA 5EWMB 1BU8A 2W2QA 1BMFD 4TKMA 3V33A 4MPTA 2I62A 1YR3A 2WJHA 1YE5A 3SPXA 5I4BA 4X61A 5I3CA 2AFHB 1L4HA 4PPNA 3ULKA 1XTQA 5ALWA 3GLTA 5ICCA 2XMQA 5TY0A 4NENA 2BCJQ 3T61A 1FYXA 4DG9A 1NI5A 2VCYA 2FUNB 2XKJE 4CQMA 3JQCA 2XB2A 2A5FA 3SHTA 2P41A 5FBRB 4FKZA 3WBKA 4TXHA 5EE9A 3KOMA 3WHIA 5C18A 2BDEA 1EDBA 5KYUB 1C0KA 3FZEA 2CWWA 4Z4QA 1P33A 1TNDA 2VZ8A 4P81A 3BXPA 1O95D 4YECA 1SXIA 1ZX1A 1XPJA 1IY1A 5GOZA 1N0WA 1HDCA 3E3OA 1T8YA 2DR0A 4X45A 5DIFA 1H0HA 2ODQA 1RAHA 2W2KA 3MCUA 1ISRA 1P2UA 1IFXA 2NLOA 2PT9A 5FUMA 2FUG6 4FYMA 4QO7A 4BQOA 1ABEA 4EHIA 1WXHA 4L0CA 1GZ3A 5DGXA 2PD4A 3ENKA 2JLAA 4MV7A 3QY0A 4FUQA 3U62A 5EUBA 3U61B 1PKEA 3AETB 3UAXA 3D5QA 3DOCA 2WQ7A 2XMGA 1PU2A 1X7XB 2GCGA 2VNIA 1HNNA 4JQOA 2PMEA 4YJ3B 3CZCA 5JADA 2NGRA 4M37A 4DCPA 2QNIA 4QHSA 5JS8A 2EKZA 2C5BA 1FTYA 2CJWA 2QVGA 1P29A 2SNIE 3B38A 2J9FB 1FU8A 3QPUA 5FQNA 3HV0A 2H2DA 3DBHB 4MW6A 4M60A 2YKGA 4A0GA 4QJ3A 4ESEA 4YCLA 4U2KA 2O7NA 3EC2A 1BEEA 2HBYA 4S24A 2EX4A 3H2ZA 1M1NB 2DULA 2FX2A 2ODPA 4IFTA 2HRZA 4BAUA 1D6NA 1GU1A 5LUAA 1Y9JA 4FGKA 4GP6A 4U1RA 2J6HA 3FTEA 2CLCX 3M8KA 4HD8A 1UFQA 4KWEA 2AJBA 5CH3A 2IVFA 3RROA 4K0KB 2Z08A 1AA9A 1TZKA 1WHSB 2FK7A 5E2IA 4TSRA 3QVWA 3KE9A 4JGBA 3SZGA 1UCFA 5ALUA 4UCFA 1LCIA 1AO3A 5IVIA 1HMPA 3GRPA 3P4YA 3GLGA 1VG1A 1CU1A 2HRBA 1F4PA 4LYHA 1B8OA 3VVCA 2H2FA 2X22A 3C3AA 4D43A 2PGAA 2F00A 3AQIA 3AZPA 2DSNA 2PGJA 3OKAA 1COWD 4CHTA 3D0OA 1Y3IA 3F7NA 1XCOA 3UATA 2IYFA 4YRDA 5CRIA 2HHAA 4C1BA 2I4IA 1FP4A 3EUWA 4LGYA 4MARA 3D3WA 3AHDA 3EN0A 4L9RA 1SR8A 1F8UA 5G1NA 2JVKA 1RIIA 4BUZA 3T4UA 1GIAA 1GZ7A 3HA2A 3ROPA 1GFWA 1GJRA 2NAFA 3P2IA 3B6MA 2GQ0A 2ZDQA 1PV2A 4MLDA 5K45A 2GN8A 3DKRA 2WZCA 2VDQB 3J80A 3PTLA 1HFKA 5F7XA 4N0PA 5IHPA 3B51X 3Q3VA 5C9ZA 3RRBA 3GJ3A 1N7JA 1S2MA 3WP0A 3WIUA 5IDWA 2X8JB 4JDPA 4L9WA 1E0SA 4G8JA 2LDXA 1R0WA 3I9KA 3I39X 3CINA 2BKVA 5HDBB 1EFTA 1GL3A 4I0WB 5BSWA 4YB8A 3FHTA 2RDMA 1Q6ZA 2AC4A 3H5TA 2PMCA 3D8UA 1UOPA 2Z5FA 3AHGA 3IMEA 4GVXA 4WNAB 1FRZA 4JX8A 1DWOA 2ZWAA 4WEOA 3WZMA 3ZVRA 1NVVQ 4LJAA 4XSVA 3GUUA 3H3JA 3O4RA 2DM6A 4PX5A 3VSEA 2PPVA 3ITDA 2X9LA 2ZVJA 4JWTA 2Q4DA 1Z5VA 4JU9A 3W34A 4B73A 1DAOA 1FFWA 3GR6A 1M73E 1JEYA 3LT4A 2N1BA 3FCSB 3FCCA 3PC6A 5IMBA 2NYRA 3UJPA 3TRFA 1NHGA 3ZCXA 5KNCH 3NBZC 4WGGA 3O7MA 4BFWA 2FGJA 2Z9BA 3D6MA 1G59A 3KDSE 1L5FA 2Q5CA 1QLJA 3M0EA 4AJ2A 2FDXA 4P4UA 5KOHB 1YVEI 5M2QA 3WL3A 4I3HA 4POAA 3MTEA 1H8ED 3TZLA 3O8DA 4H7DA 5CNKA 5FHRA 4QWMA 2WUDA 4PSKA 2EQAA 5KU1A 1QC5A 1QIFA 2QT9A 3LCCA 1SVLA 4QUHA 2JHAA 3U44A 1BHQ1 3R24A 3T5TA 3IVRA 3PLRA 2VSYA 4HAWA 5GOTA 5LXTA 2GS9A 2PMWB 4KIJA 1NAHA 4RFSA 1ZD9A 4NCAA 5LMCA 2C5AA 4HC4A 4DSNA 4GMGA 1UUFA 3QVGA 3AZQA 2Z6VA 3CRNA 3M89A 1N7HA 1G5IA 2OP1A 2O50A 5C4MA 1CUUA 1S4MA 1D9ZA 2R1TA 4QT4A 5EL0A 1XEAA 4GWKA 2WB2A 2FEKA 2G07A 2A5GA 2O59A 4UE3S 5DSXA 1OWPA 1BH2A 1Q7EA 1DI0A 3EXHA 3WLNA 4IX9A 1QS0A 1VBKA 4WZ6A 1KZ4A 5SZHB 3WNDA 2DFTA 5BN5A 4O3MA 3U4IA 3D5TA 2QK4A 2FH5B 1KS9A 3AXTA 2ZSJA 2BKUA 2NU7B 2YBDA 3QXSA 3QSGA 4DTCA 1K4MA 1Q1AA 3SJUA 4BX3A 1ZJ4A 4CDGA 1CR4A 1W5TA 3D3EA 1A71A 4L6IA 4EZEA 4EZBA 3EPKA 3TLCA 3ZWKA 3PNSA 2P6OA 1W96A 1LKZA 4FFLA 5GV7A 3AL0C 5TF4A 3V4ZA 3GN1A 3CX8A 2BHNA 4TMTA 4B85A 1RKQA 3GDGA 1CFJA 3FBGA 4O29A 1SKYB 1RYBA 1JJVA 3T5MA 3K7EA 2HRDA 2SCUA 1ZJZA 3VU1A 3HU3A 1B2LA 1J1ZA 3T9FA 4PS1A 1NVBA 3WO0A 1M8GA 2YZ7A 1NJ1A 1PJ4A 3KZVA 4J0FA 5FBLB 5A4JA 2ECKA 4LF4B 1KQFA 3SS8A 3QLVC 4R83A 2O8NA 3ZS8A 1RACA 1QG4A 4DE5A 1LDEA 4J43A 4HWSA 3QGMA 1E5VA 3IB3A 2P2NA 5A4IS 3LPNA 4ZQIA 2IYNA 2V6FA 3WMFA 3R8FA 3I01A 4IOLA 1DL5A 4FX2A 3ESRA 2FWJA 1Z88A 3CUSA 5C8YB 1XCBA 2OB1A 5PNTA 2M6RA 3DDOA 1TM1E 4V0SA 1W19A 3V4SA 5FNVA 4ZJZA 2BFDA 3ZHQA 4I08A 4P2BA 3PQ2A 1C8KA 1WUJS 2BR3A 1I1HA 1Y81A 4JYBA 1FP1D 2GARA 3T7IA 4KR3A 1PUJA 3A25A 1V5GA 2QTCA 1CUWA 4MVWA 3RODA 4DAEA 5IMSA 2B69A 3L0DA 5HK9A 2ZJZA 5LLDA 4P0PB 3K1TA 1KYVA 2CMFA 1Y5IA 4C7KA 1OI3A 3VYTB 3JQFC 2QGFA 1Z7GA 2WSYB 2PWPA 4ZZ2A 3ZOKA 4B4WA 2QJRA 1QJCA 4NR0A 1JV2B 4W7HA 3GELA 4ERNA 1NRJB 5F9MA 2BZSA 5E1BA 1HA3A 2CWDA 1DFGA 4WL0A 4YR7A 4MR8A 5C35A 2GOYA 2CNKA 3KU1A 5JAMA 2ZJ1A 1RQ2A 4LRYA 5U4QA 3BJZA 3ZYCA 4EI2A 1VSQA 4J75A 3F73A 2G8LA 5B1HA 3FLEA 1AURA 3GF4A 2OV8A 4LQ4A 2H85A 3S99A 2C20A 1W73A 1AK1A 2QTHA 1NBIA 2ZBEA 3EMVA 3GC6A 3WSTA 2OMEA 2W6IA 2XXJA 3N7UA 4TLBA 1ESCA 1DELA 1D6MA 2R6GA 3AL3A 5EMKA 2O2DA 4BYMA 1AKWA 1R50A 1W34A 5TPZD 4YV2A 6LDHA 1XRNA 1E5DA 3L01A 2JL1A 3OEED 5BYBA 1ZM2A 1A2QA 5DBGA 4TRNA 2VHCA 4FXPA 5HS6A 2F3UA 3ZU6A 3PB3A 3TQQA 4GZ3A 1LBTA 2GN0A 4A8HA 3QX3A 2DKFA 2XXAB 1N1GA 4M8NE 5B58T 1UF9A 4C87A 3QKIA 5TMPA 1D7OA 1XP8A 2AK3A 2JI9A 4MUIA 1PDVA 5EMMA 2ZE7A 3OIWA 4FU0A 4CMHA 1QGAA 3ETGA 1IJKA 3JD3A 3LK6A 2LKCA 3AFOA 2AOWA 3DCIA 4L4ZA 3OI7A 3K6RA 1ZCZA 1CCWA 4O1HA 1B8PA 5E9AA 1Z7EA 2BDUA 3R3ZA 4TN1A 4JOBA 5AIBA 2D5AA 5EXTA 5CVVA 1XSEA 2OHVA 1W87A 1I24A 2PKEA 4WZBE 3VU3A 3OHPA 4LY9A 4P80A 3ZIDA 2OFFA 4WY2A 1Z39A 5AKEA 1EHYA 4RHUA 4MV0A 1FW6A 1GPNA 4CFYA 3TTYA 1KMCA 4JVSB 1NUUA 2H48A 4GXQA 3ELYA 4MW7A 5AH0A 1ZI9A 1OX4B 4W99A 4ZMSA 1FNBA 3SR3A 3PNQA 3PE6A 4BU0A 1U81A 5IDVA 4V1CA 1DAGA 2HC9A 1JWBB 1KTVA 4UHDA 1LDYA 3G82C 1SUCA 4ZYZA 2JLUA 4M1YA 1Y8RB 1OXUA 3KBBA 4KSYA 5DLDA 4L8FA 1S8NA 4KI0A 4I9FA 1R16A 5ERXA 3U3DA 5JFTA 4EG4A 4J0HA 5TQ2B 3IQDB 4K40A 2QJWA 1M2OB 3A37A 3IOBA 3ZIUA 3U60B 3RSLA 2IXTA 4CF6A 3DAHA 4CF3A 3T5CA 2X0IA 1KY2A 2WICA 4DDHA 5JS2A 3HRKA 3DOJA 4XIYA 1IEVA 5HJ2A 2PKCA 1EK6A 3K9BA 4KGDA 2CVOA 2Q6LA 1B14A 1MXFA 1WA5A 1B8UA 1O87A 3WL8A 4JZKA 2D5CA 2KB0A 4KHZA 2Y27A 1ESZA 1M3SA 2WIAA 5WRFA 2C9CA 1NFRA 3HFRA 4REQB 3C16C 1ORRA 2YY5A 2WHRA 4Y1GA 1QIIA 1O0SA 2XITA 4J4TA 3DHNA 1TMGE 1RXEA 2R86A 2WUWE 2CB9A 4L8WB 5CB4A 5IT5A 3RJZA 3KUKA 1AOXA 1BKSB 4NEQA 1A82A 1AD2A 3C7CB 1R37A 2YUIA 1T9ZA 4MWCA 4OVKA 1ECFA 3R5TA 3GRYA 3LCMA 1PD0A 2Z30A 3DZHA 3JQPA 4RJKA 2Q5OA 2I4RA 2ZYWX 3FOAA 2VHWA 2M1ZA 5FLYA 3I83A 4BCDA 1EX6A 1HG1A 3Q87B 5K3AA 1C3LA 4DLLA 1H4QA 1HV8A 4TMYA 5DKFA 3VC1A 3WK4A 2FQYA 1K6JA 2AJCA 2R87A 2HIGA 4M7WA 3VPDA 1XP5A 5FORA 4X64B 3HCEA 1NMYA 1CG6A 4QZVA 1U3CA 2Z98A 3VH1A 2GCIA 5G3YA 1ZI6A 2DFVA 2R9VA 2AYZA 3N0TA 3GLVA 2IYAA 3TD6A 5HP4A 1EI9A 3BHMA 2CJPA 2ZCVA 4D74A 1DKOA 3HU2A 3JATA 3OJLA 2CDAA 1I5OA 1N2BA 1TFUA 3MBKA 5FPSA 5AW9A 1LVUA 3IQXA 4EMUA 1E2BA 5DHTA 4KXFB 4OB6A 3M4NA 5K3BA 5KVVA 5JH7A 1CJCA 2J5QA 4PGHA 2VG8A 1SHKA 1SQ6A 4YQFA 2GMWA 3NT2A 2EQ5A 5KVSA 1W36C 2IP4A 4RKRA 1KDTA 1ZUWA 2L0XA 2R68A 2VJOA 5D5PA 4MYUA 3NWPA 3Q3EA 1TPZA 5CB8A 4B5KA 2WVAA 4GBJA 2Q1XA 4AZVA 2X41A 3MJDA 1XQ6A