3KSAC

Detailed structural insight into the dna cleavage complex of type iia topoisomerases (cleaved form)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
226
structure length
220
Chain Sequence
b'KLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTAKAKMADILKNEEINTMIYTIGAGVDFSIEANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALPPLYKMSKKKEEVAYAWTDGELEELRKQFGKGATLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDNVKFT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA topoisomerase 4 subunit A
publication title Structural Basis of Gate-DNA Breakage and Resealing by Type II Topoisomerases
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Isomerase/dna
total genus 55
structure length 220
sequence length 226
chains with identical sequence D
ec nomenclature ec 5.99.1.-:
pdb deposition date 2009-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
C PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.670 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ksaC00
2XCRB 4FM9A 5EIXA 3RADC 4G0WA 4Z3OA 3LTNC 4I3HA 2XKJE 4KPEC 2XCSB 3FOFC 3L4JA 4KOEC 4Z4QA 4G0VA 2XCQA 4KPFC 2XKKA 3KSBC 3KSAC 4J3NA 3K9FC 3FOEC 2XCTB 2RGRA 4G0UA 1BJTA 3L4KA 3RAEC 1BGWA 4Z53A 2XCOA 3RAFC 3QX3A
chains in the Genus database with same CATH superfamily
2WFZA 2XECA 5DLQC 2V5AA 2PYIA 2P7IA 5B64A 4F2GA 4CCSA 4HDMA 2C77A 1YC2A 5B2ZA 3CX7A 1OW3B 4FX5A 2X0FA 1EEXB 1PJRA 2HLNA 1LBTA 1UJMA 5D51S 2JGFA 1PJTA 4PCAA 4WUTA 5LB2A 3TOCA 3CZCA 3GMTA 4MO9A 4IDHA 4TLCA 5KJ1A 4IDAA 4EKYA 1YDWA 2DECA 4A4DA 3VYRB 1IOLA 2NU6B 1GPLA 3NIFB 4WY2A 3NXKA 1A7JA 4K8RB 3VHQA 5IBCA 1W34A 1JU3A 5JLAA 4WQMA 4ID3A 1X7ZB 3AHHA 2I6FA 3HSKA 5T41A 3IRUA 2AUTA 1YJ5A 4KITB 2K7FA 4HJRA 1A72A 1HOTA 1V71A 1YDFA 1G5HA 1L1EA 2X42A 4HRXA 3V4PB 4CMIA 1KE1A 1JEYB 4IXWA 4C2TA 2TMYA 4IM7A 4ZO7A 3RT7A 2XMBA 2XYQA 3CEPB 1XJ5A 5FOTA 5B37A 3RT1A 4BEJA 4DLTA 5KQMA 1GTG1 2IBMA 4DV0B 1E66A 4R8VA 3EIXA 5AVUA 4I08A 3N0WA 2H7VA 4H0NA 3DJYA 3U3RA 4XYEA 3CJQA 1U5CA 1FNMA 3PYMA 4AUEA 2VDWA 3KL2A 4AAYA 1Z2EA 4JB3A 3OTQA 4C7JA 1FL9A 3A70A 4LJSA 4TQUS 1UBCA 1W93A 4G84A 2UVQA 2BFBA 2LRHA 2Z8YA 4QRDA 4TMWA 1MDFA 2QN7A 4Z54A 2HDOA 2PPLA 1ODFA 2QTAA 2C5FA 2ZOSA 1T1IA 3VU8A 4AJHA 2FA9A 1M2KA 4RW0A 3FUUA 5JW6A 3E9EA 4R81A 2WHQA 4Y2PA 3R74A 4PX3A 3UICA 2RG1A 1W5AA 5FYQA 3H1PA 3BGWA 3MMXA 3BJZA 1A4XA 3GAFA 2JFFA 4CCWA 5KQSA 3FMPB 3QFRA 3R9XA 1CQWA 3MC1A 1IUKA 1MIOA 3GR6A 2WYIA 2G70A 3EDCA 4HG2A 1UC9A 1QQ7A 2G4LA 1SCBA 1GGMA 2X8BA 3CHYA 4GX2A 2JFNA 3LV8A 1G8FA 3SP1A 1XALA 3D2LA 3LP6A 2VSNA 3A1VA 4I1UA 1OXTA 2PRYA 2RGBA 1Y9AA 2UDPA 4IWYA 5FPTA 3V2GA 5G3ZA 3WMWA 2GO7A 2ZUDA 1R0SA 2P9ZA 1YRYE 4WBSA 1L8LA 2PIDA 3PYLA 4YO8A 5FV7A 2Q1YA 4BNLA 4DQ0A 1N3IA 4QYTA 5HF9A 1B4DA 4N03A 1AS3A 5DWDA 2AN9A 1ZD4A 1NDHA 2RHTA 3K3PA 7YASA 1C9YA 5TF4A 5IKEA 4FLFA 4J6EA 1VA4A 4N3CA 1A97A 3DS8A 4PINA 1DSSG 1EB9A 4R98A 1Z2CA 2ZIEA 1FLAA 4CF4A 4Z4FA 3FRIA 1OB2A 1E7QA 2NTVA 4FOLA 4ZQEA 3VFDA 4D9CA 2IQIA 1C9MA 3H2JA 3HWX1 2OCPA 1USKA 1LJ8A 1XVLA 4CUKA 1GM5A 3GJ5A 1FEZA 5A6SA 3P0JA 3W8EA 3HK2A 1QZXA 2O8EA 3EN0A 2PH1A 3OECA 1DQPA 1EDEA 4GPZA 2FZWA 1QHGA 1LI7A 2PBZA 3R4CA 1LK7A 3AJEA 3GVPA 1ZBQA 4J0JA 1C80A 1SG6A 4MS3B 5M29A 1JDZA 4CKEB 2WIBA 3PLNA 4ICIA 1C2TA 1KR2A 5F33A 1Q19A 2ZRMA 3S68A 4AP9A 3EXEB 3WYFA 3AF6A 4PLFA 2IH2A 2PIAA 3O7WA 1Z6QA 1UBJS 2HWWA 4XQCA 5DEOA 5AW2A 2IPAB 3GYBA 2IK8A 1C2YA 1HF3A 3QBTA 2BGNA 1U2GA 2OHHA 5DHQA 4DCPA 1PIWA 3OUZA 2J6HA 2QLBA 2IXBA 3V42A 4C89A 2HF7A 3UHPA 3PUJA 5CD9A 2IYWA 2Q3MA 1A27A 2HC9A 1KL7A 2VZ0A 1QU3A 2HPAA 4I1RA 2QW1A 4CUJA 2IH5A 1G8SA 3OLCX 4NH0A 3RKUA 2W48A 4J91A 1MJ5A 1ZK4A 2QN2A 3HN2A 2JGNA 3ACBA 3HSSA 1XQ1A 4K81B 4MRSA 3AKZA 2BGTA 5K6RA 1KFKB 3RVSA 1FUUA 2VAXA 4FT2A 1XT6A 4NZ9A 1MVOA 5GOTA 3NJ8A 4D3FA 1CB7A 2ZQYA 3DV0B 3ORFA 1TI7A 3TSAA 3E2IA 3NIWA 3RWBA 3KDPA 3FRHA 1U9CA 2I1LA 2Y71A 1V5GA 1V5FA 1XYYA 1BCRB 2GPNA 3RS5A 2BHLA 2ORWA 3SDBA 4DCTA 3GPCA 4CM6A 4UMDA 3O3MB 4DC0A 4IV0A 3ZUPA 3ADOA 2GX6A 2GVDC 2PJDA 4WFJA 2IXAA 4MRRA 3DLHA 1T26A 5JS8A 3IC5A 1H0RA 2BH9A 1GTSA 1DLIA 3KQQA 3GEIA 3OO1A 4LC1A 1LPAB 1Y4SA 4GX1A 5BT9A 3P45A 4EMTA 2KX7A 5K2MA 5B36A 1F38A 5MN6A 1BW9A 1WSAA 1O54A 1UBRS 2AYXA 2X77A 3B20A 3JARB 3KWLA 3OZUA 5DH9A 3ER9A 4MHTA 3C3JA 3CWCA 5F3WB 1JA9A 2Z5FA 4TV9F 2DOKA 2Y1DA 3BXXA 4NYJR 5AW9A 1GWNA 4E07A 1TUBB 2QW8A 2GESA 3BIXA 1NBIA 1YQDA 2Z30A 2DBRA 2Z6VA 3GJXC 2R2AA 3JQAB 1HRKA 4FYKA 3OTOB 4D26A 2H17A 5E0OA 1DJMA 4G09A 2XHEA 5JCJA 4PN7A 1TJPB 4DR2B 4EFLA 4PSUA 4S1OA 5FOQA 3EPKA 3TW8A 5JADA 5DHSA 1QLJA 1QH1A 4UHFA 3HA2A 3RHZA 1W46A 2VK2A 1DG3A 1XZ8A 3GCXA 3IP7A 4RAOA 4DANA 5J4LA 1OXUA 1BEZA 2REQB 5AVSA 4HGPA 1SOMA 1HA3A 3JVUA 1GZ6A 4XYLA 1J8VA 2H18A 1F60A 2PSFA 2WP8J 3BBLA 5EP3A 2LCQA 2XBLA 1G6OA 4DAEA 4ZIRA 1QG6A 4X45A 2GLTA 3ABOB 3T5GA 3ET5A 5JC1A 2W42A 3D4BA 2JLVA 4UCWA 3B82A 1JDPA 2I78A 4OXIA 4E09A 1N32B 1QKIA 1MO5A 1M6HA 2H2IA 3G5MA 3RBVA 1IM8A 1N5DA 3ONWA 1YKSA 2JFZA 3PDUA 3OZRA 3DKPA 4HGOA 3KOYA 4BBPA 3KQNA 2PKWA 1FRZA 2VHJA 1MXFA 1B26A 1XMJA 4AZ0A 2II6A 4TL6A 4KIFA 4MAMA 3FGOA 4DL9A 2QLFA 1EYZA 2L69A 3BK1A 1KS2A 1VYVA 1YRLA 5EPUA 3SMVA 2XXBA 4UZEA 1RHMA 2A57A 2I7VA 1RAFA 3B9BA 4KN9S 2VNJA 1RZVA 3JATA 5K0TA 4ZOAA 1KMIY 2G1KA 3HFJA 5DHTA 2VNKA 1E2EA 2BKLA 2V7PA 5B7QA 3PUYA 2DJ5A 3ANLA 2Q1WA 5HCNA 3AP3A 3D3QA 3HU5A 3HFSA 3AIOA 5GONB 4HAXA 5AESA 1MT0A 2PGNA 1CLEA 1X7GA 1NJSA 3CBGA 3CPEA 3IOEA 4S0XA 1S7GA 4YPVA 4P8RA 4F04A 2GJ9A 4JQCA 3DAPA 5KYVA 2AH5A 1H4VB 3VO2A 1JT9A 2QAIA 5HIJA 1NR5A 1ATIA 4HNAA 5EIAA 1JDNA 2JJMA 2RIPA 2JJ1A 2VZLA 3QKSB 1QDEA 4ESHA 2QM8A 3L05A 4AJJA 5JNLA 1RI2A 1E4EA 4UBKA 4YEDA 4ZVQA 1E20A 3GLRA 3JQFA 3HO6A 2PWBA 2B25A 4MYUA 5DP2A 3MOSA 2G5CA 4QL3A 2ZDQA 1KBQA 1QYWA 1S3FA 1XX6A 2V6FA 2V7UA 2GDJA 3JTMA 5AT1A 4EPRA 1ZRMA 3RDPA 2JH9A 3QH4A 4OBXA 1ULAA 4JIGA 3KQLA 2NP6A 3BM5A 4TYPA 4P2GA 4O29A 4QVGA 1YK1A 4DIUA 4OYLA 4Q9HA 4FI3C 4KBYA 2XRYA 3PPWA 3U7QA 4DSNA 4ENPA 2XCQA 1G98A 3WR5A 2ZCVA 5TQ0A 1YBVA 3D6MA 3LM8A 4YN3A 5B30A 4LJ4A 4R2JA 2QJOA 3COZA 3U60B 5F2OA 3ASVA 3PI6A 4M6WA 1RJGA 5CVTA 1ND6A 2I8LA 2QZ4A 2QG6A 4BX8A 2UZ4A 4UUOA 1VKOA 1V2GA 2XGJA 1WCIA 1U99A 2A5FA 2QM7A 1O94D 1P4JA 2YJ4A 2X41A 3B5IA 2E4AA 4F3KA 1G20E 2C54A 1ZY2A 5PGMA 1G64A 4UQOA 1GTZA 3C45A 5SYAA 5LC1A 3RSQA 4RF2A 3U13A 3SIWA 4RHCA 3HI6A 2AE1A 4RA9A 1RLTA 1H1TA 4FYJA 3W5SA 5HJ5A 3FX2A 2QORA 4EJ6A 3W6UA 2IQ5A 3R09A 5G41A 1T0JB 4AJ1A 4OQLA 4YMWA 2EEPA 3HV0A 4HUQB 5B1HA 4C6RA 1DC7A 4HB0A 1JDBB 1J07A 3F4KA 4GH5A 4PG7A 3GD5A 2IYEA 1AF4A 1O9BA 4OSEA 1U5BB 2XOKD 3G1TA 2QVBA 3N28A 4ZA2A 4QQNA 1GPAA 2XY4A 4KAAA 2ZWAA 3BTUA 4LX8A 4PVCA 1SGWA 1YE5A 4PZZA 4UNNA 3RVRA 3HXPA 3STUA 4EZIA 5B58C 1COZA 2Q9UA 4B83A 4PSVA 3MWFA 2C92A 2ZTUA 3A7EA 2ZUUA 3HCPA 4XE5A 2O05A 4DCNA 4X62B 4KR6A 1YB1A 3N76A 3IVAA 4OBWA 2O0LA 3RBXA 4HUTA 3TBFA 1EE9A 4MQ4A 1R74A 2H5EA 2XNSA 2ZQZA 2DKOA 1NP7A 1ZYUA 2XB6A 3MWDA 1TTPB 2EJBA 4ND7A 1GGJA 3C1UA 4KWTA 5EIEA 1K06A 3ZZUA 3NTLA 4INAA 2GHQA 4XJXA 3X1KA 4K6MA 4XEUA 3E61A 4YBZA 5JO9A 2IBSA 1JQBA 4JSYA 1Z2DA 1VSQA 3NO4A 2ZGVA 5AWFC 5DBEX 4GE3A 3E6AA 4NZOA 2O3SA 4HB2A 3NYIA 4PM4A 3LP8A 2D0DA 5FB3A 2HAEA 1NN1A 521PA 2QNIA 1SCJA 5JQGF 1HUQA 1Y37A 3LXXA 1NKVA 3DM5A 4N5IX 4OGGA 1A5SB 2J48A 3A4IA 4FP9A 2VHQA 5TX7A 5JIBA 1YZ3A 1SXJA 5A4AA 2C3OA 1F12A 3DNFA 5IYZB 1LQUA 1UIMA 3LT5A 4JOQA 3RRZA 1ZRHA 2J31A 4UUBA 3DLTA 1JH8A 5AR1A 4D6PA 1C30B 1K8XB 4P4SB 1XDZA 4XR4A 3R5TA 3ER8A 2JVJA 1NTRA 4KQJA 3BMCB 1PJAA 2FH5B 2DKNA 2IEDA 4NFLA 1GFWA 5DOZA 1J90A 3ZGZA 2XB2A 4FOTA 2A3RA 4N7MA 3NYQA 4UJ3A 2ZR7A 2IHYA 3WWEA 3IJ5A 4CV3A 4D9EA 4H77A 2LR0A 3HJAA 3H8SA 4FMCB 1Z82A 4EB3A 3K8YA 3IJEB 1NE2A 2NQ2C 5LNK1 5AUPB 1OWPA 4CMBA 1GLNA 1YQTA 4KUHA 1DCMA 5JSZB 2UYOA 4P08A 1GYQA 1CXZA 3SR3A 2A1IA 2NTJA 1RFGE 4ZOLB 4XWKA 2ZI7A 3JSAA 5DNWA 3VR2A 3VZBA 4WJZA 1HR0B 5KNBH 2Z04A 1AV7A 4G26A 1I2DA 2VPWA 4LTMA 1NBMA 1D09A 3KR9A 4TTSA 5I7WA 4NBUA 1GQSA 2A4KA 2C2BA 3RSSA 3COYA 4D9MA 3FNRA 1G4AE 2HRQA 3EIQA 3L7OA 4GG1A 3LWNA 1GUFA 2QY9A 3D2CA 4GICA 1ISJA 2ONYA 5A4FS 3LGSA 2SCUA 3GLGA 3AOEC 3AL2A 1K6IA 2VZEA 4U2BA 3Q40A 4FNMA 3VKHA 1AF7A 3JVIA 2XE4A 2FRXA 3CIOA 3FLBA 1G1AA 3PC4A 1EFVA 1O5IA 1F6BA 4M86A 4ZN6A 2RBGA 3LPAA 5U9CA 1XTTA 4QA9A 5AKEA 2ATIA 5LWQA 1VGVA 4GBED 3I52A 4YHBA 5LA6A 5BYAA 3G5AA 2GM9A 4Q1VA 1BMTA 2EW8A 1JSXA 4DIBA 2ABWA 5F4ZA 1EG2A 2PFSA 2ZDHA 1EK6A 2WFLA 3CEJA 1F2UB 3GPIA 1RJWA 1VHWA 4Q7LA 1SZCA 2DUMA 2BW0A 2O2DA 3EXFB 4G9EA 4MW2A 1QORA 2CKMA 1CUXA 4RKYA 3PNOA 4QJIA 4Y30A 3UF0A 2IF0A 1QWSA 5L8VA 3V00A 3VO8A 2GN4A 1E1MA 1GJRA 2JGEA 2XZPA 3QVLA 2OQIA 3HDTA 4YASA 4AY3A 5KNDD 3B38A 1JIKA 1I5OA 2JH8A 3KELA 4MVWA 1N0WA 3MWLA 2EYQA 3UJ6A 5H4GA 4JBHA 3IMGA 3N3BC 4JR1A 4EFMA 4EY6A 4N8EA 3PIRA 2VR1A 1HYEA 2GZ1A 4E03A 1O6BA 3A3YA 2XEDA 4AQYB 4TQ9A 3QOFA 2X0DA 3CYFA 2D59A 3IPYA 5EZ5A 3AP2A 1IEXA 4NRDA 2BSAA 2J4DA 2GK4A 3HEAA 4H7IA 1GTMA 2NYAA 4RVOA 2IWHA 3TIXB 5HWSA 4M36A 3NTQA 1TVCA 3VBCA 1C7EA 3QFCA 5CNIA 3BE4A 2R7MA 4RF5A 3DB2A 5H80A 4CLOB 1C7RA 1SC6A 2WLSA 2HNAA 3GQVA 5FXMA 3ADBA 1DQRA 3ILSA 1LB1B 2AD1A 2FGKA 3WAKA 1XF1A 1HG0A 2IPOA 1HM5A 4P38A 4YT8A 4PTZA 4AD8A 3GEBA 1VCIA 5BW6B 1XNGA 1TRHA 5AHOA 2DQKA 4A2CA 1D2RA 4FX2A 4BRSA 1YZVA 4IZIA 5DVZA 2H9YA 1GA1A 3L6UA 2UZIR 4KUEA 3WP0A 2R1UA 3GFFA 3IB6A 4JEIA 4RPLA 2D06A 1XZAA 2FFHA 1QCDA 1T2UA 3IBGA 3O8RA 4Q3OA 3LOPA 1HPLA 4FWIB 3DZDA 4QXAA 1BU8A 2XOEA 4ZZ1A 5L3VA 4JP8A 1PWXA 1OLUA 2WTMA 1YQWA 4HZUB 2PV7A 3T7TA 5B1YA 4TKZA 5L3QA 2YWBA 3TL3A 3EYAA 3ENKA 5K0LA 5KOHB 3W0LB 1H85A 3ACDA 4ATNA 4QYWA 2DPYA 2J45A 2AOTB 3EHDA 3ZNNA 2R25B 5EHGA 5IZCC 2EEZA 1AMNA 1VE3A 1MNQA 4QAQA 3AR7A 3C5VA 3S8MA 3WGNA 2JGAA 5DN6D 4TLBA 3HS3A 1MO2A 4KC0A 4ZTZB 3T52A 1UBEA 4RMNA 1L4UA 1ZC4A 3ZBUA 3K1YA 4DQVA 3CVWA 1IG3A 3HBJA 1XPJA 4EQ6B 1NSTA 4PR0A 2P6PA 3ECSA 3PNMA 2HJSA 4DV4B 3D8TA 4P2BA 1PEDA 1DO2A 3C7TA 4BTEA 3CPJB 3OA0A 5GJWC 1TQ6A 1VKJA 3P2MA 3FOZA 2V7QD 2A1UB 4UOEA 1KQ3A 1TMYA 1R9GA 1YTLA 4KMRA 2JIBA 1A1SA 4YRQA 3BD8A 1WCV1 3O2QB 3DEJA 3C0KA 3KB8A 3NGMA 3UWKA 4GVLA 3EXIA 2A7XA 3PPYA 3F78A 2O4UX 3AF2A 3MAGA 1ZSNA 1P5RA 4MV9A 5FIUA 4G1BA 4MLZA 1NLZA 1R5BA 5C0OE 3KK0A 4URVR 1WZUA 4KXNA 4MO2A 4C4RA 1GHTA 1G7RA 2DQ4A 2I80A 3T9EA 3GJZA 4IINA 3U56A 1ZJ5A 3ZXSA 3LPLA 3VH4A 4OIFA 1ICIA 2YHUA 4O0LA 2D74A 2JBAA 1SU8A 2OLEA 1L5QA 3VX3A 1WDMA 2Q2WA 2VN8A 3A2NA 3KUUA 4XWAA 3O1LA 3R0ZA 5CX4A 2FJUA 2J3MA 3Q7TA 4RIFA 3UFXA 2E55A 5IJWA 2BGWA 2PVSA 5EHZA 2DFVA 1H3FA 2CHVA 3QF7A 3REGA 5J4VA 5JEDA 1OBOA 1MVLA 1XD9A 2Q27A 1GPWB 3ELYA 3IQWA 3KKMA 4IQ0A 2B98A 4Q66C 3SIRA 1WMEA 3ERCA 1RHUA 1H69A 4EY4A 5J23A 1RBMA 3HPQA 4JOBA 3I42A 1GRQA 1W4CA 1Z8FA 5CLLA 2D6FA 2QG4A 1FMJA 1KBOA 3Q2OA 2K2QB 2YYZA 1AK1A 1SBYA 1UWCA 2WA1A 3OUUA 2VTEA 4OXRA 4B17A 3C8UA 1ZXXA 2CVHA 4LHYA 1SCDA 4QWWA 3LPCA 3L8FA 2ZRFA 3TFWA 2XTNA 3IXQA 4QEKA 5E3JA 2NXWA 2QQ5A 2RH5A 5JXGA 2VPXA 2XTAA 2L2QA 4TSFD 4EO9A 3IEKA 4QU8A 2YZ7A 3OJOA 1USIA 3FIUA 3HCFA 4OB8A 4YACA 4BNDB 3MS4A 1BWQA 1OZHA 4O4IF 2WFMA 2O57A 3HA3A 4M22A 3OZEA 3VAAA 2PX5A 2WMDA 3NBZC 4UPVA 4DV6B 2JGJA 1MGOA 1VC2A 1G42A 3STXA 5LR6A 2AG8A 2D2FA 5SZHB 3OCYA 2VOJA 3LBHA 4KYTA 1IIBA 1NJ8A 2GNPA 2Z1DA 3H99A 5F12A 2M6LA 2P6RA 1C7ZA 2G7ZA 2Q1TA 5C4MA 5LOVF 3MSXA 4MRPA 2QD5A 3N6VA 2DWCA 5FUXA 1N2ZA 2ERCA 4UBLA 4M89A 2EF1A 2GILA 4CG3A 4XYBA 4E5DA 2FI1A 1ZOSA 1M67A 2LD4A 1T91A 3SGLA 3ESQA 2CLDX 4F56A 1NYRA 5EFZA 1BGWA 2P3SA 1I7QB 5LZ8A 4ZCIA 5D3MB 2XYPA 2JA2A 4UE2A 1T2AA 3GEEA 5DGTA 5E9AA 4B76A 4IRUB 1VHTA 3ZX5A 2JLXA 3TIGA 2CNNA 3LY8A 2JFQA 1MOPA 4LG1A 4LY3A 3RNLA 3S2ZA 4MW6A 5CBPA 4CKXA 5GTDA 2ZANA 3OX4A 3RUCA 1FP2A 1RM0A 2WR8A 1REQB 1ECJA 3C8HA 3HO8A 3UH0A 5F5XA 3WSWA 1PRYA 1MX3A 2CJWB 2JHAA 2X15A 3FPAA 3I9V1 1CZNA 3K1ZA 2B69A 2DF8A 2ZSIA 1D2CA 1MB9A 3PT5A 1B76A 3P9KA 4Q9AA 4CM7A 3DF7A 4BU0A 1AOXA 4I2VA 1CQJA 4IMJB 4GL2A 2G77B 2AOVA 4F9FA 2XV1A 4RKEA 1IVSA 2WIGA 4G1CA 2PBLA 3KPJA 3FYUA 4LNUB 1A95A 1G5PA 4PG5A 5C31A 1T25A 3ONVA 3REQB 3AETB 3TQFA 3P71T 2C31A 3MWEA 1P9WA 2WM3A 2Y99A 2EXXA 3K05A 3MGKA 1FX1A 5ICEA 3AKDA 1SVMA 3CWZA 5DCWA 3AEKB 3W5UA 2B34A 3P2EA 2VPIA 4N39A 2V65A 1MQ8B 1O97C 3VX4A 5HQ3B 3PHHA 5KNCD 3FWNA 4M9XA 5D2CA 2VJAA 2WJPA 1C1XA 1GEGA 1B8VA 1MC4A 2Q3DA 2G9UA 2ACWA 3MIZA 3IQGX 3Q98A 4GI3A 4CXMA 2GXSA 1F9EA 4AY2A 1JPVA 2W2PA 1GYRA 3ACCA 3PB3A 1CULC 4O1MA 1PU2A 1J4AA 5EL0A 1XEWY 4U2KA 3KVYA 5E8RA 4CF6A 1Y7LA 3IHKA 3NBAA 5E9QA 2Q99A 4JELA 1EXVA 3A6HA 5DLDA 3DDNA 3IR5A 4AMVA 4J9VA 5BN3B 4D80A 2DFTA 1ACMA 3NJ4A 3MQFA 1JR3A 3EXAA 4UVEA 3GLIE 10MHA 4MW0A 1ZXLA 1V43A 2IEIA 3ECCA 4MPDA 2W58A 4M0LA 1I3CA 2IODA 3SZMA 1MABB 3VR5H 4QD3A 4EKGA 4U7JA 3RH0A 1JSRA 2LV8A 4H3KB 1D0SA 2CYAA 2PZAA 4JP3A 3TOZA 5LYJB 5E6UA 1R8XA 1XROA 4GMXA 4H18A 3OX2A 1M34B 3SQOA 3G7NA 1KVSA 4EVIA 1SCNE 2ZYHA 3ESZA 2B6HA 5JVDB 3UXMA 4R16A 1XZDA 4IOMA 4QODA 5L3SA 1FU4A 1PUXA 5L9AA 3IBTA 4XB1A 3TJRA 3K0BA 1AMUA 1H2BA 3EXG1 1ZMXA 4LRWA 1AZLA 1TF5A 4AQ7A 1T15A 4Z3DA 2CYCA 2IYNA 1E2NA 4PG6A 4Q4HA 1Z6YA 4X97A 1V3UA 2EG9A 2VZ9A 3W79A 3BXPA 1ZIOA 2GPAA 1MX1A 3ETEA 1AS0A 3DC7A 3DE2X 1YAHA 3HGQA 4OHBA 5L6LB 2BM9A 1JJ7A 5AFSA 1JIVA 4RK0A 1ZW6A 3M5WA 3P7MA 2BKXA 3K1AB 4FNGA 4JCOA 4OUDB 5MFPA 4W5QA 5HZHA 2E18A 2MIIA 3JAWA 1SBHA 2HLPA 5T67A 1T35A 6GPBA 2V5UA 4D57A 5L4SA 5FI3A 1TYZA 3EPLA 3O8LA 5CR9A 1GADO 2WD8A 1HQCA 4RPHA 1UJNA 2A35A 1WS6A 1SA0B 3GAAA 3HJGA 2ZP1A 3NOVA 5DPMA 1C1YA 2R6FA 2WOOA 4AQDA 1X77A 3OOHA 5K3AA 5JPCA 2I6QA 1L8AA 1XKXA 3HYLA 3HLTA 1AO3A 1TMKA 1ULZA 1WUIS 4QRIA 2H5LA 3UTDA 1UBMS 1W85B 5T8KC 4F4HA 1JH9A 3EQ7A 4EM6A 1G8YA 4QSHA 1PAUA 1UPAA 1CK4A 4DYHA 5JDCA 1T5LA 3R40A 4NF2A 3DL2A 4AZTA 1KIMA 2P8JA 3H87A 3MJEA 1Z7EA 1OAOC 4HN9A 3QU5A 5J63A 1CUVA 5KTPA 1XHFA 2B4AA 3FYCA 3VR4A 4A36A 2GYUA 2PA3A 1LBIA 4B9EA 3QPBA 4W1PA 3MQ2A 1D8AA 2M2IA 2ONJA 1JSLA 1H05A 2K87A 3Q1KA 5I7RA 4ZAGA 1IUNA 4RQBA 1SMKA 3OT5A 4XB6B 4AJLA 1N3YA 1FNDA 3MMZA 4GEGA 4BNKA 4QT4A 4KDFA 4QQKA 1YQEA 1IAQA 2G7MC 3I2GA 3AOEA 2YHSA 3OEHD 4EW3A 4G0ZA 2GETA 2RH8A 1L4HA 3G9TA 2CDBA 3O73A 2PGOA 5EMLA 2XCIA 4MPJA 3W9YA 4QLOA 5HGJA 1FFDA 2ZWVA 1VXRA 1HT1E 1QUEA 1JTFA 4B4UA 2O1SA 2KI5A 2DUNA 3RYCA 3EDYA 1JRLA 1MX5A 3G5LA 4B79A 4IFEA 3ZI4A 1FRNA 4HNUA 1FFBA 1DOAA 1KMNA 2YJZA 4HGQA 1L5ZA 2P69A 4XIFA 2G0NA 2RCNA 5H82A 4KLRA 4YYZA 1JQDA 4H3VA 3L07A 1ISHA 3F98A 5B2EA 5BWBA 1LY1A 1K97A 1U4NA 1TO1E 2NZXA 2Z83A 3KSZO 5AM5A 4DIDA 3C70A 4UCQA 2JFOA 3GLKA 2JA1A 1XSEA 4O4JF 1I2BA 1JKFA 1MGPA 3KXLA 4KPUA 3UMVA 1JFFB 4DPLA 1M5UA 2UXCB 3TQTA 2BTQA 3OF3A 4GRIA 5JTTA 5H59A 1CRQA 1EZZA 2G9VA 3JSXA 3L2OB 4YC7A 4MCAA 4C4PA 2GBGA 1H4TA 5F9FA 2ZBEA 3C98A 3MCAA 4U5XA 5ALPA 1E7WA 4JBIA 3W8FA 2IUYA 3H1BA 3M6WA 2AZ4A 2ZBDA 3NYWA 4LHSA 1EFKA 5TGDA 3X1ZA 3JQ7A 3KC2A 2GEJA 4F7WA 3INTA 4TWAA 3T7SA 1NBOA 1QAQA 4QG3A 2OD9A 3T1HB 1Q0UA 2GYYA 1WHTB 3RC7A 2R66A 1SCUA 4ZEWA 4DDTA 3QNWA 3G23A 4IYRA 3GFRA 1Y6QA 1QV6A 1HNNA 4NV3A 1JHPA 2H1WA 3A27A 4BHTA 5DOVA 1DU4A 1DXHA 1ISRA 3PNBA 1EM8A 1KH2A 4BN4A 3BN3A 3SC3A 2PJRA 1EEHA 5EEGA 3HJTA 1LVGA 5KSWB 1DX4A 1L5WA 1Y5NA 2WG0A 4G5SA 5F9HA 3ANNA 1AT1A 1ZDMA 4KBGA 3ZE0B 1C8VB 1OQAA 4UTRA 4G07A 1NMEA 4REQA 4JD5A 1MA3A 2WHRA 4U0KA 4YXWD 4NNOA 3CVXA 4CM3A 2XQIA 4LPSA 1O95D 1K8RA 2Y27A 5EJ7A 1AV6A 3H5OA 3OZIA 2F3PA 1G60A 3KSUA 4IKPA 4J90A 4WLOA 4B2PA 5BWCA 2GDZA 5FO1A 3K96A 3AR9A 4DV7B 1CS0B 1E1NA 4ND8A 5BURA 4I4TA 4CYMA 2OCGA 5E7IA 2DPMA 2B8EA 4RS3A 5LIPA 1M73E 1BX3A 1HKHA 2YFKA 3O9MA 2YWEA 4R1MA 5DIZA 1DRVA 4D9HA 2PXAA 3HDJA 2C5BA 5J3JA 2FMHA 2ZSEA 1Q20A 1HMYA 3ICWA 1IY8A 3OQOA 4BOYA 2A14A 5A06A 2B0JA 2BV3A 5JMWA 4LXUA 2HJ9A 4OVKA 4FMBB 2QLJA 5BVHA 4BN5A 3FB4A 4XKJA 1OHHD 1YE8A 2O5CA 3SYLA 1TZJA 1JIUA 1YIOA 2YTZA 3VBEA 2EZ4A 2ZYWX 4YB8A 2HN9A 3FPKA 4TXNA 3PLRA 1FVOA 4HXEB 3R75A 5AVKA 1RHRA 3IULA 1GLGA 2XKBA 5DASA 5HFJA 4QUEA 1UMKA 4QPJC 1PQPA 3JYLA 2Q4DA 1SNYA 1ILEA 4AWBA 1PR2A 3B6IA 2FSVC 2D62A 2W2KA 2Q62A 1E1LA 4FQ7A 1J7KA 1XAJA 4HVTA 5IDVA 4C03A 3UAWA 1OBFO 5D3KA 1V5WA 1RQPA 4EITA 3PV0A 5BW4A 3S70A 4CV1A 1TB4A 4F2WA 4ZDIA 2BMEA 2W4MA 4JJIA 4W63A 5FFNA 1JEQB 1D0IA 3HSYA 5CDYA 2PEZA 1YS7A 4HSGA 3FR8A 1V5IA 1ZS9A 2YWXA 2GVNA 3GBPA 2FWAA 4Q82A 5JWHA 3M3DA 3UMJA 2O7SA 1SCKA 3ZN2A 2Y0PA 5CLIA 1Z4OA 2Y0CA 3NV9A 1ORIA 2C1EA 4JXKA 3OAAA 4N3GA 5I9BA 4G4SP 5JD3A 2J0UA 1PEKE 3JQDA 3TUJC 2OENG 3WY9A 1KC3A 1BD3A 1CUGA 2PZMA 3DVRX 4C1BA 2PMWB 3RRFA 1FJ2A 4PFJA 3ONNA 3F73A 2JCXA 3PIDA 4HEHA 1GKUB 1DC3A 4BFWA 1RKXA 1XQXA 3K4QA 2Z56A 1MR3F 1GVNB 1ANKA 1H3NA 4PY2A 1ZCJA 1DXQA 3DR3A 3V1YA 1LTHR 3MCWA 3RRMA 2G67A 4G65A 4R9UC 3MCZA 3PT9A 3ADDA 1BD4A 1V96A 2JLQA 4C14A 3FDIA 3MCVA 4LYHA 2OPBA 3FOBA 5DI3A 2J0SA 1G5TA 2ID4A 1IQPA 1MEEA 1XEAA 1UZNA 1E8MA 1PFVA 1Z37A 4TN5A 2A9PA 5FWDA 3WK4A 3DZGA 4PC3A 1K7YA 4K3VA 3VYUB 5ES3A 2QENA 4L57A 3SSMA 4D8VA 4IDPA 4OYRA 2AHOA 2JKVA 3RK1A 5K8UA 4LWPA 4C0HA 2QMHA 4DYVA 3ZS9A 2FZLA 2DPXA 5H0IA 3WICA 1TM4E 7MDHA 2PUHA 3QPCA 3I76A 3O2SB 1CJTC 3ZY3A 2XF8A 3DJFA 5FV4A 3I1IA 4HSEA 5LJIA 3EGXB 2PL5A 5CJJA 1ZVQA 1GSHA 1KI4A 2PCLA 2OK8A 1ZD1A 3NX4A 2X0KA 4F3CA 1E2JA 2VTVA 3L7KA 5LP6C 4CEIA 3QTLA 1SUDA 4OD0A 5BXQC 3TLZA 2P91A 4R5MA 1WV0A 4C08A 1KS9A 2R87A 4BGVA 3G9UA 4W7SA 4ZI3A 5C7YA 5ICGA 5ICSA 2GRJA 4E1AA 1AKYA 2R48A 4PYNA 1VPWA 3A9CA 5EERA 4ETIA 2VYFA 3OBIA 1RACA 3U3ZA 2GLUA 3ELDA 4TTRA 5EWLA 4D9KA 4LF6B 1IPHA 2BKUA 2P2SA 3WLQA 3KFLA 2NSHA 3KB1A 4H4EA 4J2OA 5FO0A 3BE5A 3H6KA 5JOQA 2NYVA 3IHWA 4JJ6A 1U9JA 1H2EA 4R69A 3IVMA 3EZ9A 4EVSA 2IEGA 4WTOA 2EL9A 1V47A 2DE0X 2HK8A 1IZ7A 2GUWA 3EZFA 1NBEA 1ZVVA 1UMDB 2C2YA 3RYIA 1XCOA 2BMDA 3KS9A 4DE5A 1NU8A 1SK9A 2Y1XA 3R6DA 4N18A 3B2EA 1F8UA 4WZBE 4BNHA 2PS1A 2O2YA 4QYIB 1AUOA 3C6BA 3X1JA 1D4OA 2GJKA 2J3LA 1P80A 4F38A 1TU4A 3AQ4A 4YJ2A 1KAOA 3EFEA 4I4CA 4NBNA 5ALUA 4BRWA 1NMYA 2CWWA 3A4TA 3B6ZA 4PSKA 2FETA 4LDAA 3GZTB 4NS1A 3DAYA 3UJ9A 1W47A 5B57C 1VL6A 1Q1QA 1AM4D 3JQ9C 1E1KA 1V35A 2Q41A 4GOKA 4N0EA 1ZO8A 4C30A 1Q84A 3ZWCA 4Y9UA 1G2PA 4K9OA 3NHFA 2CJXA 3Q3CA 5IBRA 2JBHA 2VF2A 5CM2Z 3U6BA 4OJMX 2ONCA 5LMCA 3QE9Y 2EKBA 2GEKA 3IVXA 3DF9A 3K9LA 2YIJA 4HWTA 1J8DA 2RI6A 3AF0A 2ECOA 3FLMA 4JHLA 4UVGA 2UKDA 3U3KA 3UQYS 4JI8B 4G63A 4A8JA 1YXMA 4ENUA 1APBA 1S1MA 3LL7A 2VAWA 1T0IA 3BJEA 4MWTA 4Y3UA 1WIWA 1X42A 2YL2A 3HZRA 1G63A 1W36C 5EHXA 3A14A 2VT2A 4MGZR 4N8DA 1Y9DA 1NM5C 2HEIA 5IAAA 5IJ0A 3WBFA 1M8FA 1YHNA 2HTEA 3GHHA 4RTNA 2C03A 2J3KA 2HWXA 2N42A 5L45A 1J20A 4DZZA 4NWIA 2XDQB 1W19A 4PG4A 1PHRA 1N5MA 3BB4A 4IUDS 4P3XA 2AL7A 3ROFA 1CJKC 2FG6C 3QXXA 4YCAA 3WL7A 2FFBA 4DDUA 4YR7A 1WD5A 2PVCA 3SQLA 1S2MA 2MU1A 4GL4A 3QPDA 1QIFA 3AX6A 5DM60 3HXQA 3NH6A 1H4SA 5KVQA 3JW8A 3CH6A 4C21A 4H1WA 2XX3A 1ONPA 4OLAA 3BFJA 2FW7A 4OK3A 2HKIA 1RNLA 3P0HA 4MYHA 5EVJA 1GNLA 1E58A 4OO3A 2HSWA 1ADJA 2NZJA 3M33A 4Q1FA 4AULA 1IBSA 1XPRA 4JZKA 4NBWA 1U02A 4L78A 1WP4A 4LQ4A 5L6MB 1KZ6A 3ZBPA 1D4FA 4CM5A 1AZWA 1RSZA 2BIFA 2B6NA 4KXFB 4NR0A 4RJKA 4QGSA 1Y8ZA 5FUWA 5CG2A 4KPGA 4GXRA 1UPFA 1CUEA 1DPGA 4X84A 5LQNA 5EE5B 1P5JA 3RVLA 2YC4C 4KP7A 3JASB 5EC8A 5BMOA 1UK6A 1LLUA 4FFDA 1V1MA 4DTIA 1DIGA 2CZCA 4ENRA 4EECA 2YYAA 4TYQA 3IEPA 2VJQA 2F9LA 1QK5A 1BG6A 2BE9A 3P0RA 3U3MA 4JX9A 5T8KA 1KMQA 1KIAA 4J4HA 1EWVA 4QULA 3PQ5A 4RO0A 4B7UA 1MOQA 5A2GA 4N5LA 1MBZA 13PKA 3OIDA 1OAOA 4LC9A 3SR4A 1NUHA 3GEHA 2YCLA 1IMOA 1ISGA 1ZSVA 1VE9A 2XODA 3U49A 3LCJA 3WGZA 3GJYA 3MTEA 4HBZA 3L7YA 2H57A 5DI9A 1M1NB 4GLFA 4OHMA 1Y3DE 3WJAA 3JAKB 3HA7A 1HRDA 2VDKB 1G9XA 4CKBA 5DSTA 5E9JA 5BSVA 5HA5A 3GFPA 1HO3A 4CE6A 1ECBA 2F59A 4PAOA 1TL7C 3K72B 2OQ2A 4YBRA 4YRCA 3ZJYA 1ONNA 3BTOA 2HSEA 1LBQA 1FUKA 3HYCA 1VBNA 3ODGA 4PYOA 3V7UA 4Y6PA 1G9TA 1UQRA 5K09A 3PEEA 4D9BA 3DHWC 1BOOA 1E59A 1A9OA 3PX3A 1Z13A 4X54A 3R7WB 3A58B 3QX3A 1JNXX 1DQNA 2ADOA 2R85A 1K7CA 3SVZA 3DEIA 3HP1A 4P4GA 3T1VA 1DV1A 3RGGA 3GW8A 8OHMA 3S1SA 1H1DA 1XWWA 5EWJA 2EV9A 3MCTA 4MUXA 1N6NA 3PD1A 1KEVA 2VDQB 3OU6A 3B6JA 4B8YA 3L5OA 3O91A 2C83A 3VR6D 2QQGA 3HWWA 3PHBE 1ECLA 4LJ9A 1XTKA 3NEAA 4G23A 4PTYA 4UVDA 4FK8A 5FPSA 4FLMA 1XEWX 1D0VA 3EEQA 2JDID 2PZ8A 4N54A 1Q0PA 2X8AA 2QSJA 4YR9A 4JT8A 1HGXA 4MULA 4CMAA 2WD7B 5CM9C 4DILA 4DKXA 2OFFA 3S1LA 3GIDA 2CCJA 2O8DA 2WYHA 1AKUA 3G59A 2W2QA 1J0CA 2P9TA 2ZSKA 4FDVA 4Q1EA 2C2MA 4PZDA 2VPTA 5EKDA 3UYKA 3UWOA 1NBAA 4KFRA 1L4GA 5AHXA 2AQIA 2YNMD 4IDGA 3W77A 4AKIA 1XCPA 1EINA 2SBTA 1ZQ9A 5DTRA 4MRMA 4BKMA 4TZTA 3NANA 2OCAA 3R1IA 1CWUA 3KJEA 5F2NA 5DB4A 3PENA 3LXRA 1CJBA 5K3FB 3SHQA 2XMQA 3TGPA 4QYMA 4D81A 3EVGA 1D6SA 2W4QA 4A23A 2ZFUA 1T9CA 4R2MA 4ZOCA 3Q3VA 5ESDA 5A9SA 2HT6A 2AUNA 1E2QA 1NW4A 2JZCA 2VP2A 2VHZA 4NZYA 4U9HS 4V0SA 3S40A 4B32A 3KJFA 4GKKB 1F2TA 1HK7A 3R7AA 2KHZA 1DX6A 2BFEA 4XPZA 4NEHB 1D2HA 1UDXA 4PBRA 2W2VA 4CGZA 1ECCA 4H0CA 1XUOA 2BGIA 4YDHB 5I9SA 4PZ0A 3UTCA 2JFBA 4V24A 1N7IA 3ZQ4A 3A0RB 3RUPA 3A1EA 5CFPA 1YCFA 3EFOA 1CNEA 4Z6KA 3ZWVA 1TTHA 1YBHA 3GCDA 3AEUB 1V11A 1CZOA 3Q6IA 1SULA 4J0FA 5AHWA 4Q7QA 1BMDA 4N76A 4D46A 3LZDA 2DETA 2CXXA 3DYBA 1XMVA 3KOUA 1EMDA 3F6EX 1R0YA 4Q7KA 4MK4A 4X90A 1J0XO 4IUBS 2CK3D 3AILA 4R5HA 1O0BA 3MVEA 1JHOA 1AXEA 1TEXA 4OI4A 3RS8A 2YXBA 1QGUA 1SU4A 1RXUA 3VZDA 3U4IA 3RIHA 3QA9A 4IQGA 3V2UA 2WSIA 4L6IA 4KPYA 4LFAB 2XOKA 4FW9A 2J87A 3GBVA 5D87A 1U6JA 2ORED 3HHEA 2BM0A 1J97A 1NRIA 1MXHA 5LZ2A 3PUWA 2HMTA 3ROMA 4ZI2A 1AXGA 3U19A 3NALA 1HE3A 2CGEA 4DV1B 4FDTA 3ZHZA 1DCKA 2JLSA 3N07A 4S05A 2QTHA 3DMTC 2VG8A 3SI7A 1PJ3A 1PWZA 2DJIA 4LJ7A 4EEKA 2JLUA 3GVXA 1C7FA 2V98A 1B7GO 2B5WA 3UGKA 5BQXA 4JUFA 2JJ2D 1D2EA 1SUFA 3D4NA 3H04A 1U3VA 3L1UA 3OPXA 4R8MA 1JQKA 2BC9A 4HDNA 4INJA 1L9KA 2PVPA 4Q7MB 1SKMA 4K6GA 4XM0A 3K9WA 4NEGA 2XRZA 2PRKA 3FFWA 3T8YA 3DMRA 3OE5A 4XVUA 1QLWA 4JC5A 2XF2A 1TFUA 2YJ5A 4LNAA 4DNQA 3A25A 4G25A 1BS2A 3N2KA 4KAJA 4RD3A 1HXHA 1WE2A 2R8RA 3CLKA 3NAZA 3T1NA 3WDSA 1L7QA 2OUIA 1PR0A 2FSVA 2FHPA 2UVPA 4TV8A 4RBNA 2D00A 5AI0A 1X9IA 1QAOA 2CNDA 4PNEA 1LPBB 1C0KA 2AGVA 3VKUA 5CFLA 2J3IA 1BH6A 2A9JA 2W2LD 4NV0A 4FMCF 3WGKA 1UAAA 1Q91A 3IQIX 3FDFA 1OX5A 2CBZA 3FROA 1CUUA 4XI9A 5CCDA 4YIHA 1EGMB 1PNTA 4MWCA 3VO1A 3IFSA 3LY9A 1WVGA 2DM6A 3PA6A 4ZOLF 5CIYA 3OQJA 1QMGA 4G4GA 4IRXA 1JQLB 1CX9B 1Z6AA 3AI2A 4JUBA 5BSGA 1P91A 2X3YA 4Q4LA 4IEFB 1E2KA 5B6JA 1VL1A 3MJHA 3ZDQA 2AG0A 1KJIA 1BTOA 3QQPA 1ZIPA 2P9HA 4B74A 2HCBA 3WDMA 1W2GA 3RROA 3U0VA 2GPTA 3BERA 4FDMA 2WWIA 1UMBB 1DGQA 4DMFA 2BKAA 4WACA 5M34A 4CTKA 2Q5HA 5B3JC 4CEJA 4FFRA 3L6BA 1A9YA 4C6TA 2HWKA 1DJPA 3KUKA 4HWPA 5G1OA 4EY3A 1T9AA 2XKKA 1N6IA 1SHUX 1V1RA 5IFLA 3B1JA 2HPVA 4EB6B 4DSZA 4LTDA 4YRJA 3LBAA 3P20A 4A26A 2WNHA 2V0NA 4BE4A 4MUJA 1D07A 2RHBA 4IXTA 1CLUA 3NAGA 4B84A 1IN4A 3K5IA 4N3NA 5K01A 1RMTA 4BKUA 5IVPA 1I6KA 2HBRA 2V45A 1HT2E 3I30X 3VISA 2ZS9A 1XI2A 3VZSA 3W4IA 4F60A 3E9QA 1DKPA 2ATXA 4PO1A 2VRCA 4DMMA 1SQSA 1OAKA 5CDFE 2PS9A 5JXJA 3AT1A 3NORA 3HR7A 3QOXA 3OJ0A 1XTIA 4EYEA 1AO0A 1UXHA 3OZDA 2BAGA 3BHMA 5BQFA 1QIKA 3REOA 1ZD2P 3RS7A 3KPUA 4G37A 4DM4A 4NPCA 3R7DA 1KJJA 3YASA 2DFPA 1V37A 3A2MA 4OBBA 1CFZA 5T64A 1JFLA 2Q5LA 4F7DA 3GZ4A 1FSPA 4HV4A 4L85A 3WGJA 3PTAA 4RFSA 4U5QA 4LYGA 4ENWA 1WY7A 4EB8A 2OQRA 2P9FA 3CURA 3QFTA 4D4LA 4RE5A 4RY8A 3QF4B 4E5PA 1WDKA 3DTVB 4AUNA 1UADA 1IXRC 1KAHA 3UIEA 4KZPA 1KPGA 3O90A 2JGKA 5AYVA 4GZ5A 1YDMA 2WMNB 1OXSC 1XR3A 2V6BA 5LP6A 2I6GA 3FYSA 4L9AA 5TPZA 2XB9A 5IC4A 5JHGB 1MRSA 2YQ4A 3NT2A 1NG1A 1RYNA 2VF7A 5I7HA 4NCIA 4AMGA 2HUPA 4UZFA 5ALTA 3C6MA 3G7UA 3H2ZA 4UDXX 2WMYA 5IG2A 1JHVA 2DAPA 1GGNA 1JN0A 3ESCA 2ZRNA 2A3NA 2MTBA 3BHIA 3DW1X 3H18A 3PDJA 4XA8A 1RPZA 1X3SA 2NXJA 3H3FA 3LWZA 4JI7B 2K7ZA 4XPIA 3CZQA 1WZ2A 4KLAA 5ALGA 1JSCA 2WZDA 1ZZGA 4DZTA 2HMSA 2OHFA 4XUCA 3DL7A 1YVDA 4JWKA 4QJ4A 2DEUA 1A9RA 1E9DA 1YACA 3D0QA 2QL9A 4L6AA 4Q93A 1X7HA 4I99A 4NFHA 3A1DA 1ZNXA 1Q3KA 2HU5A 4QNRA 5HKOA 1K98A 3BZUA 2WVJA 1OH5A 3X2SA 3VI4B 4JVMA 3PUVA 4ARZA 4EGJA 4B45A 1KARA 2GD2A 1PBNA 1E9VA 2PL3A 5K1ZA 2FQWA 4JJEA 5LMNB 1AB6A 1Y3FE 2O2HA 3CBQA 3T3EA 1U0RA 2PD6A 2XOXA 3T1TA 4GPEA 1QONA 1JWBB 4KXMA 5C46F 3WLEA 1W52X 3JQ9A 4TT3D 4UM9D 1I01A 3LPNA 3FAKA 4K9SA 4M55A 1WZEA 3RSLA 2JIZA 2NO4A 4J03A 1U0FA 3QVSA 2WHPA 4LTNA 2FU5C 2YWRA 3AEQA 3CXUA 1R6BX 3LBIA 1H1LB 2A5GA 2X4LA 4M9RA 3BMQA 1TPZA 2CDAA 2E6UX 4LV8B 4NENB 3SQNA 1M8JA 2AR0A 2NO0A 3AFHA 5BO5A 3ZD6A 5KC8A 2X86A 1Z07A 1QV7A 1ZI6A 1R4MA 4P4TA 1VL5A 2I87A 4F4DA 2ROQA 1RBQA 4RJJA 3MOIA 1ECPA 4IFBA 4LQCA 1KRXA 3EGCA 5EZ6B 3K0KA 3EK2A 3K32A 4S1PA 1KO4A 2YV4A 3DCNA 4INOA 3RIXA 3FKJA 2ZVPX 3WQRA 1I9GA 4WZBA 1KYVA 1JHDA 5ITVA 2WZCA 5B3KA 5DN6A 1WTCA 3EJWA 3IX7A 3EX7C 2QS9A 5DBOA 2BI8A 1P1CA 4N6GA 3UAGA 1DI0A 2HCJB 3C41J 4MDHA 1A8PA 4OM7A 4CQMA 3AU8A 2GTPA 3BICA 3LXMA 4P58A 5JWOA 3ZDDA 2H4WA 3TQOA 4EB0A 3GUCA 3GUZA 1WBDA 4Q1CA 4F9EA 1Z2NX 2GBCA 3JWJA 1QTNA 1RYMA 2DY0A 1FJXA 3SLGA 1GG8A 1N2HA 3EIOA 3JPWA 4HLDA 1G18A 4N7JA 2EJTA 4OMFG 2DLNA 2H16A 3F47A 4XB2A 4R71A 1DC8A 5I47A 1Y8QA 1R0LA 3VH2A 1YCDA 2YRFA 3O93A 1MEOA 3ROZA 3ML1A 1EUZA 3F6YA 2PNFA 3H2GA 2RHDA 4P3NA 4GVPA 2DHCA 3DBRA 2Q9BA 1B6GA 3UOAB 4MDFA 3NPAA 1KK2A 4DQXA 4Z4GA 2NU9B 3FVRA 1FVXA 4U4AA 2AYZA 2NP7A 4L3OA 4EDFA 3VJMA 3EUAA 1DKOA 3ZU4A 1ZGZA 1F6DA 2GS9A 1EFAA 5CP8A 4BUCA 2GN6A 2DHRA 3RLFA 4KR0A 4YWHA 3K0AA 2P78A 4MIYA 3L46A 1B8OA 2FSUA 3KQOA 5CGQB 2YJGA 1YCHA 2WOJA 5F64A 2PWYA 5G02A 3U80A 3UHOA 1Z28A 4BZPA 1XNRB 2ZREA 2I4MA 4RDCA 3TH5A 3LCCA 1KMMA 1CQZA 2CCGA 4MQFB 1W49A 4B3DA 4P0PB 1Y5IA 2IS2A 2GA9A 1A8IA 2WWYA 1GPH1 1ZM3A 2ZSAA 4XYMA 4NS4A 3B7GA 2G76A 2GN1A 1RJEA 1EGAA 1S89A 4M9CA 5AK3A 5HKAA 1SCAA 3CF2A 5CRIA 1NJ6A 4P93A 1VJ5A 1HSOA 3V8BA 3TJMA 3LHSA 3MJDA 3NHZA 5JSQA 2E4WA 1Y8CA 4QXOA 5G0UA 2NUAB 1FDUA 5AJXA 2W6PA 1N2EA 3NGXA 4ZHQA 4W82A 1ZVMA 3DMNA 2UZ1B 3AKEA 3F7OA 5JD5A 2Y2UA 4JJKA 1P61B 3BH7A 1KQNA 1BU5A 1V4BA 1B1CA 4F1KA 2VJYA 1CVRA 3R0QA 3BUSA 3MS7A 3OCWA 2O5EA 2FUG6 3ZV7A 3VNRA 4CM4B 1NW6A 2VT3A 3Q7EA 1RPTA 5CW1A 1TNDA 4R2KA 2VJMA 4I8DA 5FPPA 4JMPA 2I2FA 4WXEA 4HLNA 5FPKA 3FNEA 5L95A 3SKYA 1G5IA 3SF8A 2YWJA 3E1SA 2VH1A 3E3OA 2FVXA 2YWDA 2QTZA 2I9PA 3OPVA 2VP6A 3ZWPA 1MFPA 5A6SB 4DUGD 3USCS 3NVKI 3OQ6A 2O8EB 1V48A 2WNIA 5ESRA 2OA0A 2H2GA 3IUNA 4IQ4A 4AJKA 1FJGB 2QJRA 3H11A 2HHCA 2PMDA 1YB4A 3KYDA 4M7OA 4I81A 1C9KA 4RLFA 2Q5CA 4XX0A 4RVDA 5JO0A 1C9NA 4N9WA 1IL0A 1T5DX 1VKHA 3H8JA 5CD1A 3NTOA 1U6IA 3E23A 1M8GA 2NIPA 5I5EA 1Z5OA 3IDQA 5JAMA 1K8ZB 1ORTA 1CUAA 2MYPA 4UUQA 3DD1A 1QX3A 3HB1A 3UMSA 1N8SA 3M1IA 1L4BA 1LS1A 2WRZA 4D8XA 1M1ZA 2YWFA 4GMDA 1GNSA 3ZKWB 4YRBA 3I1JA 1NI4B 3BH0A 4FW8A 3NC1C 4DRYA 1QO7A 2ADMA 1UKZA 2CF6A 1U2ZA 2A1TR 4D4GA 3MB5A 6PFKA 4PZAA 4AZ3A 4TTAA 2GCIA 1O6ZA 2QGNA 3AB8A 5AVWA 3DHNA 2BFPA 4Y2VA 5A3SA 1ADGA 4Z4CA 1GQFA 5AW3A 4QPNA 4QSMA 5FI0B 1RIFA 5EJAA 1DDOA 5JMPA 1AZSC 1CW2B 3T99A 3V1KA 1NV9A 4OOFA 4DRXA 3R0XA 2IBTA 4HAIA 5B5SA 3A1SA 1NV8A 4L16A 2Y68A 3NHYA 1NRWA 1FSGA 1W1IA 3LFTA 1IQ0A 1J9EA 3KJZA 1CDOA 3QUAA 3N2EA 3MHTA 1XMPA 1IC6A 1UP4A 3Q6MA 1SD1A 2IGBA 3QXGA 4I6EA 4O5AA 4PZCA 2N47A 4OJKA 4B80A 1T6BY 1Z83A 3RC3A 5TR9A 3PFFA 4HX5A 2ZJ7A 4Z53A 3I45A 2BCJQ 5KNCA 1FPMA 3DLPX 3TX6A 4ZKDA 1I33A 4IIEA 3OM1A 3I34X 3G02A 3GGJA 2BR4A 3T5DA 3Q4GA 2ZAYA 2O54A 4Q3NA 4XGRA 2MCFA 2WJ4A 4ZQHA 5LYJF 1M2VB 4ZTBA 4ND4A 4HH1A 4N49A 3MYRA 2HA0A 3MSCA 3OQ1A 3LMKA 4BCBA 4D96A 3KOWA 5IUJC 3QXJA 5TS3A 1QK4A 2AD5A 2J09A 3WRWA 3ER6A 5JVDF 2AC4A 5BOVA 4MVYA 2J7PA 5IC6A 4IBOA 3U7HB 5JANA 1SXQA 2FR0A 3W4KA 1RE1A 3KAKA 2OAGA 3HCDA 2FFQA 2ZS7A 5FR2A 1VKRA 4E46A 4US2R 4RF3A 4CL0A 1SQ5A 4H0FA 1S7CA 5CIWA 1LPSA 2H1SA 3EWAA 2ISCA 4J8PA 5K6TA 2RHRA 3ND7A 4CLEA 3QPUA 4GMKA 1T0UA 5ECGC 5EMJA 1US8B 1B6TA 5IKPA 1LPMA 2WNSA 3X44A 3A32A 3FJ1A 5CT6A 5AW1A 4RTJA 1DBQA 3O0TA 4QU0A 2VP0A 1KI7A 4R9NA 4KQGA 2WUGA 3L6OO 4WXYB 2XYVA 4F92B 5FLKA 5K2OA 4M9SA 4HDKB 5BNFA 3FPFA 1KZGB 3OJLA 4FEGA 5H83A 1EVEA 4O2AA 1YVRA 2RH9B 1QHIA 3PDIB 2C7OA 3QIVA 3SBXA 2JLBA 1WXQA 1Z39A 4UBMA 1E3LA 3TJZA 2B4QA 4OLJA 1MG0A 3MGGA 4NLLA 3DAHA 4EYGA 2HK9A 4L0CA 5ALMA 4OMCA 3R4VA 4KWIA 5FNVB 4KGVA 1PW5A 2H5JA 4N5DA 3IT3A 4DLSA 3DLCA 3LQYA 4JL6A 4K46A 3DVAB 1E9SA 1OIVA 3PEFA 3QMMA 1MEJA 2EF0A 4PPQA 5G1PA 5IMBA 5AKKA 1K27A 4RSMA 5I7FA 1VJ0A 4WZZA 1XE3A 3W6PA 3NNNA 1VL8A 2MYNA 1CT9A 3VDNB 1KPHA 3WHKA 1CY1A 3QVOA 2ADFA 2ZRDA 2I71A 3NHSA 2Z9CA 1DPFA 3FPSA 3D3NA 1P4GA 3W2HA 5LD2C 3KRTA 1C50A 5FWAA 1KU0A 1MKYA 3B13B 3LDAA 4JLPA 2G80A 2CLKB 4FJ1A 5EIBC 1GUYA 4CDRA 1G41A 5B3JA 5A3QA 3CB4A 3DC2A 1SUCA 2AJDA 3PNVA 4LXTA 1NWCA 3BULA 3KETA 1PUJA 1R4NB 1I4OA 1OXVA 1JMVA 3A06A 4IPTA 4KI7A 3TL2A 3VGJA 2HDNB 3OU7A 1BXRA 1JKXA 2ANCA 2B1RA 4MUKA 4GP6A 2OE2A 4RULA 1L5HA 5D7BA 3L0PA 3RSCA 2ETXA 3FFXA 3TRJA 1LDBA 3DVLA 4GSLA 1NPTO 1Y42X 5D3ZA 2VHYA 3BWEA 4MUMA 4AB1A 3S81A 2YWCA 3ZCRA 3U7EB 3AERA 4CDMA 5MFZA 2IYTA 2GSWA 3DAFA 1W0JD 4KXXA 5JZSA 2ACVA 3RSGA 2C7QA 4B7AA 5E2AA 1X1QA 1I6MA 3P9ZA 1WPXA 2YN2A 2RAUA 3DMDA 3KU1A 2QSYA 5KHOC 1RZRD 5DGDA 4PYLA 5CXUA 3E1GA 1ONSA 3I92A 1X14A 3DVSX 4OHWA 4R8SA 2WQZA 5AVRA 2EX4A 3C3MA 3PRYA 1FFHA 2F8MA 3HN6A 4UU7A 1UZAA 2VA9A 3WLOA 1E3DA 2A9FA 1ENOA 2X23A 5C51B 1GUDA 3DTYA 2P3OA 2AI1A 1SEVA 4JLKA 3GJ8A 1N25A 2P4QA 5LB4A 3VMMA 4R05A 3SM9A 1RPNA 1ZM9A 2ZSUA 4TKMA 1OI3A 2WM8A 4MYTA 3TNJA 4P22A 4XSHA 4KXLA 4DJAA 2HFKA 2E2WA 1E2DA 1OLXA 2CVZA 2QZJA 2VNIA 2PXHA 3FUWA 4JYZA 3SEAA 2JAQA 1YKFA 4FNOA 1CQXA 2JHPA 3CF0A 2ZBUA 2X0IA 2QD4A 3A4LA 3I2HA 4BQQA 5CDFA 4BFLA 1N2SA 4EGAA 5ED4A 2OFWA 4BMOB 4GU5A 3SIPA 2OVBA 4OQMA 4E6EA 3BFVA 3RRYA 1CQPA 4GZ6A 1N4DA 2R7NA 1MOSA 1L7XA 1RW4A 2OHGA 3HCAA 3K73O 2G72A 3H4TA 5EHQA 1XCMA 5T4HA 4HLUA 4ARVA 4ZRNA 2O8FA 2HHJA 2O0HA 4FI3F 1JG1A 2LE0A 3L0YA 1KYWA 1B16A 1YC5A 5E7JA 1YQXA 4NJOA 2NV0A 1XDDA 5CA0A 3RIGA 3T6KA 3JQPA 2O2JA 2ZWOA 2PQ0A 1IFXA 3GN2A 5H68A 3S1AB 4B4DA 3E9RA 1TVMA 2FN7A 2QWXA 5IP5A 5C1PA 4L08A 4RTQA 1AGXA 3VSBA 3SOPA 2EGGA 3ET4A 4WLEA 3OQIA 4G36A 4MICA 3DE5X 4K6OA 4U2GA 2HJVA 3QM1A 1JMKC 1NWHA 5T6MA 4QFDA 4M38A 3ORYA 4W99A 4F84A 3ZE2B 4BS9A 3O5AA 3HKCA 1OYVA 2GD1O 4JXZA 3EAFA 3LNCA 1Z8NA 1XFDA 2H29A 5B6IA 2F1HA 2KYRA 5FX2A 2ZDGA 3GT7A 1B15A 3GN1A 3M1LA 2XHZA 4YROA 4IIUA 1KDZA 4AY5A 4DY6A 1XTQA 4FN5A 8GPBA 1JZTA 1KU6A 1NF3A 1X94A 2ZATA 3EAQA 4LOHA 4YJ3B 4YXWA 1P2GA 4JEUA 3ZV6A 4E11A 5JECA 1HZJA 3NB0A 1HE5A 2IYOA 2BMWA 1UC8A 1IH8A 5KX5A 1KZYC 2JIDA 1OKKD 3HYNA 4KFSA 2PX8A 1O5TA 2FX3A 3DOIA 3JYOA 3G1WA 4FBLA 4PLPA 3RJ9A 4CEHA 3VU9A 1JR2A 3SS9X 5GJBA 3RG8A 5IM4F 3A6DA 4JKYA 4U2DA 1ZN2A 1OSNA 1F0YA 4IP0A 2YXDA 2Z1NA 3ZWXA 3HN7A 1ESDA 3OZSA 2EATA 1ZITA 4JLAA 4OQDA 1CP3A 3E53A 5CA1F 5KWSA 3F8SA 4WFKA 1CRLA 4K9QA 4D2IA 3DTTA 1QZ3A 3ZLJA 4NCAA 1HX7A 4RF4A 2SKCA 2B3DA 1P1KA 3OWXA 4BO2A 1QYVA 3LY7A 2OZKA 1ODIA 2BGMA 2RKOA 4R40A 3LWDA 2Q46A 5JJLA 2Z2ZA 2FHSA 3PUKA 1O4WA 1Y6FA 4RMHA 1OY1A 1IBKB 4IX1A 5A05A 5JNWA 3TPFA 1KDTA 4EEZA 4LFCB 5COAA 3I83A 1MA0A 3CPSA 1PG5A 5P8WA 1TF2A 3DEAA 2NT3A 5I9MA 5A0VA 2Q1SA 1FXSA 4LE1A 2YVQA 3F6CA 4PXAA 2YFHA 4XGNA 4ETNA 5K6AC 3PFNA 3QTTA 4MJLA 1MJNA 1U0TA 3EZGA 2V7BA 1JKJA 1KYXA 3C7AA 3P4YA 3B3QA 4H6WA 4HZIA 6Q21A 1GKIA 3NWJA 2YZNA 5B1DA 1UJ5A 5C80A 2G5GX 4LJ6A 2AMFA 1UINA 4X6UA 1GZVA 4DNFA 3RRNA 3FUCA 1XPUA 3E0QA 1EFRA 1UPXA 4NTZA 4X8HA 3KUDA 1J8MF 1E7YA 2YMMA 3PKZA 1P7CA 3LCUA 4RCVA 3TTWA 4V0ME 2JGDB 3M6LA 2PAFA 2VDRB 2WU8A 5IJXA 3H19A 3V8EA 1PX0A 3GDFA 1GG5A 3WRXA 3AFIA 3FCXA 2OCBA 4FVTA 3LRPA 2J46A 2ILTA 2AG6A 2Z5VA 1C1DA 2PO5A 4QHYA 4PBSA 3DOEA 4H1UA 3RVPA 3EBLA 5FBHA 1QVWA 3BRWD 3NNSA 1OLOA 3EOAI 2HYIC 1NR7A 2WD9A 1V95A 4WA7A 3OKAA 1KGDA 4OKIA 1GZ5A 4QELA 2WJVA 2PXCA 5CEFA 1OZFA 3QG1A 4XUEA 4H6XA 3OCUA 4J7UA 5FWYB 4G0OA 2F48A 4Q4AB 3NTUA 3KD2A 4RV5A 4OHXA 3NKFA 4NE7A 5JBIA 3FGPA 3PXEA 4YA6A 3I5XA 1KYYA 3FTPA 3D4LA 4BB5A 4BDSA 5ITWA 3HDQA 4M49A 4P3OA 4ZCPA 3CWQA 1I4TD 3IQHX 3IUJA 1ZD8A 2E48A 2RK6A 2WB4A 3PRKE 2BL4A 4LY6A 5FHRA 5I9NA 1E2UA 5KQRA 1F51E 1EXDA 4EATA 2WUWE 1YJCA 2DCUA 2Y66A 2XGGA 1GNQA 1OYOA 4HWRA 2X6TA 3KE8A 5E9WA 5C1IA 1LEHA 3PGKA 1ADBA 1P75A 4KHPB 2ZRCA 4FIZA 1X0VA 1I24A 2PRSA 2BUBA 3KZCA 3WA6A 4XSVA 1H22A 1KJNA 2I6XA 3FTEA 1UXKA 4GEKA 2HF9A 5K0SA 3ZGXA 2YDXA 1FP4B 3U81A 1VBMA 4MW1A 4D9JA 3HDYA 4QVIA 1IN5A 1PTKA 1Z75A 4CM9D 4DQLA 3BH6A 4JXXA 2YBDA 1GN9A 3RI3A 5FT9A 3GD7A 3UZUA 4ZCRA 3HRIA 4PC6A 1DFIA 3RLIA 1QIJA 1XF9A 3ZIAD 2B5VA 4ZJUA 3SZGA 1Q1BA 5DW3A 1AKEA 4BMPB 4F1JA 2D13A 2WE8A 5TPWA 2WF8A 3LC1O 4EMUA 2W5UA 1BFUA 4O4LB 3BWMA 4RVUA 4MEBA 3X0DA 2QX4A 3GO4A 2VF5X 2MMCA 3UA3A 3EFHA 1BC5A 1E9AA 4ZQCB 2ZRLA 2Z2XA 4CI9A 3JQ8B 4F4UA 3EISA 3BSSA 1E18A 3V8QA 3MM4A 3ZK8A 1DRJA 1L6IA 3R76A 1C3LA 3P9SA 4MB6A 2D0IA 2M98A 5EOVA 4LZPA 2Q5JA 4NJEA 1I7PA 1O2DA 4UNPA 3GFGA 1JBEA 4KAFA 4L95C 1T4CA 2YY7A 5C18A 1KY3A 5IXYA 1ZP6A 5DBGA 3DULA 3PWSA 1KEKA 4UOQA 1E3IA 2AFHE 3TRHA 4CU2A 3OQPA 1MNAA 1L5FA 1LBEA 1QXSA 2PR2A 4X1IB 4B6SA 1GTJ1 4DS3A 5EPOA 3DWGA 2I54A 4BL5A 1XDUA 4X1YA 1IYZA 3F71A 4BFXA 4M1QA 1CUBA 3UJPA 1LQTA 1Z25A 1YNOA 4CNBA 3PQ4A 4LZJA 5E1BA 1SAYA 2JI4A 4UDNA 1KEWA 2Q6KA 5GVRA 4XX1A 1GV1A 2R6AA 1EBBA 1HFJA 2P62A 1WXFA 1QR2A 4E7OA 4NMLA 3LP5A 2ZT8A 3GLSA 4WLUA 2I2WA 3VTZA 3ASZA 2H2HA 4R0NA 4XQEA 4CVNA 5E2IA 3DQZA 1NLUA 2UUCB 4RHYA 3EXG2 2HA5A 2GZ3A 2O2SA 3OCVA 1A9ZA 5A7FA 3RS2A 1N2XA 2X58A 1Z6TA 2I2XB 3VDRA 3ZHBA 4D8TA 2BPOA 1WPQA 3N5CA 3D6HA 1L4LA 2JLCA 5LDGA 3UFBA 5IASA 1XEXA 2GN9A 2YW2A 4TUYA 1DAFA 3ZLVA 4C07A 3H5AA 3SQMA 4DB2A 3F3YA 2BEUA 3QXSA 4K3UA 3FN4A 4X71A 3CUUA 5KYWA 3KSAC 2PLWA 5KTSA 4AVYA 3NBYC 5E7MA 3FPBA 3FI9A 1VZ3A 3K53A 2TMDA 3KLNA 3MPUA 4TKVB 3V7FA 3E18A 3TG2A 1T34A 3WJ2A 2GEDA 4YAWA 4ZAXA 1QK3A 2FPPA 1DQYA 2QTCA 3S2UA 3IKMB 4BPBA 2C8VA 2GF2A 3LDUA 1I4EB 4PCLA 3IDSA 1HNWB 4MVJF 2ZJAA 1ZG3A 4X1KA 3CINA 4CT5A 4BYMA 3PVZA 5FBZA 2PFKA 1B42A 4OREX 5IBPA 3V6MA 5KQGA 1MDBA 2WJIA 4DUZB 4G8DA 1LUAA 3FM9A 2RI0A 1AKQA 4CT4B 1NXVA 3D1VA 3EMBA 2E5WA 2D2EA 2ZTLA 3EC2A 4DT1A 1Q0LA 2GM4A 1VB3A 3R7FA 2Z2IA 3WFIA 3KQSA 4NYIR 5CX1B 2ZIAA 5J5AA 1UJ6A 4WBNF 3L1KA 4MMXB 2BMJA 4MROA 3BWYA 1UFKA 3GGSA 4J1SA 3LLSA 3W2GA 1E6LA 3A3KA 4ZYXA 3G13A 2VXCA 3A2LA 5TE9A 3OTHA 1QB8A 1YQGA 3HP7A 4IH1A 2GD0A 4C0KA 2BGKA 2CVOA 1J56A 2DRIA 2FZEA 2PD4A 3E27A 3IKTA 2QJWA 4GPD1 4C7OB 4EO4A 3PJRA 5IVKA 1DVRA 2DHQA 2XQFA 3O84A 3RC9A 3K70B 4KXYA 3MJTA 3U4MA 5AW4A 4I1PA 1ESMA 2OCKA 1RC8A 1ODTC 2FMTA 4CKWA 3OOEA 4DPMA 4J0GA 4BMSA 2EBHX 5EWMA 1U7WA 1YBFA 3WB1A 4O3MA 3U4GA 1NPYA 4MV3A 4J7XA 2P77A 1MAAA 2LXNA 4MKZA 3TWOA 4LDRA 3U37A 1CCWA 3RUHA 4TMFA 5J4YA 1Q6YA 4MRNA 1NOIA 1T5SA 3KWJA 4Q19A 4E3WA 4LJLA 4Z7NB 4DA8A 4P32A 1YCGA 2GQ0A 1FY2A 3TL6A 4I7EA 4DG5A 2JI7A 4CFSA 5JEEA 2R8EA 1G17A 1E5LA 1P2SA 2AX4A 2CMDA 3QIAA 4K03A 5ERXA 3IAS6 3U1VA 3WLAA 2QAJA 3GRAA 3QU2A 2JFYA 4H08A 4I3FA 4WZAE 3BA1A 4RIHA 4R6XA 5DISB 2V5VA 1IDN1 1Z4QA 2A2ZA 5KOIA 2CKDA 3C3YA 1XQ6A 5DNEA 3QLJA 5DXAA 2HRRA 3UK6A 1F7UA 5FRDA 1R9MA 2WW8A 4LI3X 5JNVA 3WKBA 3HYTA 5IAGA 1WKBA 4AX8A 3G5TA 3NV7A 3MJ4A 2BFMA 1GFZA 5I7VA 3FYUB 2C96A 9ATCA 1QE5A 2CVPA 4H6VA 4BQRA 3EUWA 3SY8A 1H0SA 3DXFA 3HXTA 1X7XA 2IIQA 4UATA 1IJBA 2C8JA 3ZC3A 1N5RA 3ZZTA 4RCYA 1IY1A 3GF4A 4R1QA 1IN1A 3GLHE 3VH1A 4OHOA 5THKA 3Q5EA 4PPNA 3WWCA 5T7BA 4LPKA 3EOBI 4WFQA 2YRWA 5CVEA 5LCXA 1U0SY 2D8AA 5FOXA 1OV4A 1GKLA 1Y3BE 4HQ6A 4CKYA 3D4OA 3CNHA 3ZV5A 5BV7A 3U62A 1C3EA 3IP8A 3A9TA 3C6ZA 4FR5A 4LDPA 5CLHA 1V45E 2VUHB 1KSHA 1WXXA 3TO5A 3KSBC 4NDZA 4D9NA 3FLEA 2QAGC 2I8CA 1P29A 3K0HA 3KPWA 3IBSA 3UMBA 2EHDA 4UHKA 5B58T 1ZGHA 2O9JA 4DMHA 2I1VB 2FMXA 2YNMA 5AKGA 1E4VA 1W0CA 4R3NA 1I14A 1YZNA 4F91B 1P31A 3DFMA 2GHIA 3U7IA 3TTTA 2L82A 2E4ZA 4X64B 4A0GA 2C1XA 4R51A 1PS8A 3IA7A 1NI3A 4J0KA 5F77A 3DOCA 1FFCA 2NNWB 1BDJA 1QM5A 3SJ7A 3WWOA 3O83A 1G3IA 2J9XB 3K0FB 1FFEA 3PFIA 3LLVA 4F4FA 3OZBA 3RAJA 4LSZA 3N2YA 3LZ6A 2XE7A 3IERA 1VSVA 4QU5A 5KDOA 1YO6A 2O8BB 2IJGX 5KSPA 3AUYA 1G20B 1U4OA 2W6OA 3KEFA 3FMOB 4MWBA 3TM5A 1GR1A 3V1LA 1NOKA 1LWNA 1QIDA 1Y81A 2XYHA 3LUFA 4NU6A 1BRMA 3DBHA 2GUGA 4V0OA 1W6UA 4FFMA 2WAYA 2FZVA 1T6ZA 2F8TA 3HPRA 3TKAA 1QG0A 3QVWA 3BCRA 1LSSA 4Q4HB 4BVBA 2C4UA 4B6JA 2FK7A 5C5CA 2YVKA 1R37A 3VPFA 1O08A 1POWA 4JT2A 2PZLA 4B85A 2OZLB 2C5GA 2ATEA 3EVEA 1GKYA 4OK5A 4AJOA 5B7NA 5ALLA 2CE7A 1EWTA 1TIKA 2I4IA 3TTVA 3VGPA 4B6GA 4BQSA 5C8XA 3E81A 1RD4A 3ZVLA 1AUVA 2ZUCA 2PCJA 4XJSA 3R5FA 5JS1A 4IIBA 4BEBA 2B4KA 4F4JA 3SFTA 4KR3A 1RXYA 2QVYX 2ZIZA 5REQB 5EJ6A 2HCTA 1U9YA 1VLZA 2Q8QA 4EHKA 2MSEB 1ZH2A 2FJPA 2GTHA 4KKXB 5EQJB 3RS4A 3LKVA 1ZCAA 3FWZA 5KMGA 4C0AC 3KAPA 3ZTYA 2XVMA 1E0KA 2EYUA 4DSTA 4L27A 1YWGO 1K6MA 1OIXA 2RHJA 2WWTA 3DFIA 3VU0A 3WI7A 4B73A 5B4VA 5KWIA 3QLTA 1P8JA 2PUGA 3DLAA 2BE7A 4PRLA 1YFJA 1YSCA 4ER6A 4GOND 4YMUA 4N5NA 2C4TA 2IIVA 3QUCA 5AKJA 3NETA 3Q7RA 4L50A 3ZBQA 2FRVA 3VC3A 1MJFA 2Q8NA 3B1YA 1JHZA 4TLLB 4EK9A 4EP1A 4MA5A 5TMBA 3HG7A 4Q0MA 5ENVA 1RWWA 1QKKA 2FRDC 5MN4A 1A3CA 4LHXA 4BMDA 4NAUA 2MSCB 5ALYA 2HA7A 3DMPA 4DHEA 5C7LO 3S7TA 3F6SA 4YX9A 4IWXA 2W00A 2DERA 1B3RA 2GK3A 3F6PA 4JI1B 2H85A 1UKEA 3WGLA 1T5TA 2CV1A 3ZVMA 2AN4A 2OOSA 5K6AA 1YASA 3AVXA 3LC7O 1J6UA 1C9DB 1FNCA 2F1OA 3QE0A 3IMFA 5JQWA 4LRQA 5CVJA 3PD0A 2EP7A 3Q3IA 1BO6A 2H08A 5DTEA 2ZB4A 1Z0JA 4YECA 4CCYA 3DUFB 1N2CE 5CT4A 4TRJA 3I01A 4K9DA 1FTNA 1NNSA 1VIVA 2C5HA 2IYXA 3JQAD 4O8ZA 1L4YA 4NCXA 1M74A 1E4YA 2QROA 2J0EA 3WWDA 4A03A 3BTVA 4V1CI 4G9GA 4JC0A 4EARA 5GINE 4O2LA 5HS6A 1XQ9A 3HGMA 2MHCA 1XB2A 2NV6A 3MJFA 4D0RA 4QE3A 1CIVA 2I99A 3EVFA 1YRHA 4ZAZA 2XWBF 2F43A 1Q74A 4GKAA 3UUGA 3ZGOA 3SD7A 3L6CA 3O2NA 3D8BA 5ELXA 4US1R 3TAUA 6REQB 1EXNA 2P11A 2BHNA 2G28A 1HDZA 4YQEA 5AOBA 5E95A 1R5OA 4C0SA 1XZGA 1ZC3A 4L4SA 5AI9A 3ZVKA 4H7FA 3GT0A 3JVEA 5MN5A 3L77A 2J9FA 3GJ6A 5AM2A 1AQUA 4P53A 3U2QA 3S99A 1Y7TA 5AKLA 1MIHA 5DJ5A 1EXWA 1OE0A 3H5RA 1EFPB 2E87A 3V48A 1G3RA 4H35A 4Q47A 3P97A 5E6SB 3TZKA 4B71A 2FW0A 1Z5GA 1KSGA 1QPGA 1H66A 3D2BA 3IHTA 4HNSA 4MR7A 3RFCA 3Q3EA 4OOEA 1ZSYA 1J2EA 2QG9A 5FYDA 1JB9A 4WL0A 2WSMA 1FMLA 3AL0C 3IXMA 1VYUA 1RADA 2MSDB 3V4RA 5TLSA 2AV6A 1JYSA 4KR9A 2ENWA 3OP1A 3ZD9A 4B6QA 5TEVA 1ZI9A 4UTOA 5JYEA 2E5LB 2WJWA 4ZVOA 3GGCA 4V0MA 3AC0A 2R11A 1BROA 1FRFS 1OVGA 3MMPA 4Y2UA 4O33A 4ZZIA 3WYGA 5FEUA 1GA4A 3V4VB 2CFIA 4FYMA 1C7IA 1RRGA 3LQ1A 4RYDA 3WFZA 1H2XA 3IPAA 3PEWA 2J67A 1ZNYA 1HDIA 3H2BA 2J7KA 2C97A 2FUCA 2SKDA 3NC4A 4RWEA 4NJMA 1ESNA 1NW5A 1ZJZA 1DTSA 3AU9A 1OD6A 1EI9A 2BFOA 4A5OA 3FCYA 2XMRA 2TSYB 2HCRA 4TM7A 1LDMA 1HI9A 5G4LA 3GGOA 1SY7A 3QBEA 2LTAA 3DYIA 1FF9A 1K7XB 4Q5IA 3T5MA 4REQB 3T12A 3ZU6A 4XQ0A 3E3NA 5DLYA 1EFLA 4CWAA 1U0EA 1JGTA 1NUQA 4NDNE 3ZG6A 4KVAA 4R1UA 1QC5B 1M6VA 5G4KB 3V8MA 4XD7D 5JNSA 2ZI5A 4KX5A 1FMTA 3F46A 2J33A 2G88A 1DKLA 3I72A 3JZMA 1IHYA 4PPGA 4D45A 3T7RA 4DIKA 2OV1A 3IKLA 1JEAA 3ZXXA 4MCJA 1T9GS 3ZQKA 2WUVA 3UJAA 1NPDA 2QIOA 4MX8A 1QF9A 3EODA 1JLSA 3AUSA 3M89A 4I4IA 5DFAA 5EJ2A 3CRRA 3DZFA 4F6CA 3W5DA 1PFUA 3A9SA 4DXHA 3LA6A 1Z16A 3UW1A 4H3HB 4GGOA 5IT9A 2EU8A 2ISSD 1HMPA 2VO1A 4IYJA 2C88A 2MR5A 1XZLA 2XZTA 1XZJA 4L0MA 1TVKA 4QHTA 5ALZA 1V6CA 1J39A 1PYGA 1VCNA 3M1AA 1KTVA 1EK5A 3PE6A 4HATA 4HQLA 1NFQA 2A5JA 5ALOA 5KYUB 1LV7A 3O38A 3I0MA 4JFAA 4KIJA 4AFNA 2XW6A 2Z1MA 3BCSA 1JHAA 3ICCA 2EX1A 1X7YB 2P5TB 2OAEA 3BFXA 3OY2A 5A6VA 4BV3A 4HADA 3EVBA 1XXHB 3RUDA 2PRIA 4L15A 4Q3KA 3U5ZB 2PT6A 3I4FA 1Y3CE 1XLVA 4UULA 1IULA 1T5OA 2YWGA 3TD9A 3RSOA 1UC5B 2G8NA 3KEMA 2HDWA 3JD1A 3KYBA 4G0WA 5H16A 1DRWA 1D7AA 1LPOA 4H1HA 4MP6A 1JW9B 2PQMA 3RK4A 2HJWA 4MZXA 4CGYA 2QX8A 2EVWX 2OHJA 2VAVA 5T4BA 2FVYA 4REOA 3VNUA 5IUNC 4Y2SA 4MLDA 3KDAA 2GYWA 2EKZA 1NHWA 1RVDA 1BXGA 3DP7A 3FWHA 3JZFA 3NHUA 5F21A 3TLAA 4QATA 1TE2A 1RQGA 2C0QA 3BEDA 3OZTA 4RK7A 1X1AA 4Q9KA 3LPDA 2YR0A 3RF7A 1KVQA 1KAMA 3G82C 2DUWA 3A1FA 3UB4A 2ZM5A 3LUBA 4TX1A 5GQSA 9GPBA 3RPEA 1VHDA 1JBKA 1X6VA 2AFHA 1V8DA 4JC8A 4MMZB 4WK6A 4ASUD 2QE6A 5L51A 5LDDC 4RAQA 4UFNA 4CPDA 4DR4B 4FGLA 2FSSA 1Z4PX 4EVRA 1A4IA 4B87A 2CHFA 1EVLA 4F86A 5DTIA 1R8QA 3QWFA 3IIJA 1WSBA 4LXIA 1TVEA 4UHDA 4ZYWA 1JI3A 4BCCA 1G21A 2ZB3A 4ADSG 1RI5A 3PR2B 3R3VA 1SOWA 3O47A 4FFPA 1C8BA 3DPUA 4LI0A 2OSVA 3LA8A 4IXDA 4AW9A 2X0EA 2GRUA 1HOXA 4QUGA 1W9MA 1LJLA 1PZMA 1QRDA 1UUFA 1OH7A 1CNFA 3S4YA 5I4BA 2WM2A 1U8YA 1ZOPA 5JYCA 2X5NA 4QDOA 2P2DA 2CZQA 2OECA 3BMOB 4RV4A 4O0MA 5EJ4A 2PLAA 3OJCA 2CBGA 2NVUA 3ND6A 4GBGA 4IHAA 1EU1A 2FPLA 4MR8A 5DN9A 3FVWA 4E51A 1W8IA 2FOIA 3ZYCA 5D86A 2HZBA 3FTDA 1T9ZA 2PUTA 4WA8A 3WVNA 3M3PA 4RNDB 3PA8A 1MO6A 2C4WA 2O2EA 3HP4A 3F2IA 5ALQA 1D04A 1D1SA 1JR4A 3KHTA 4TLDA 4TS4A 3V1MA 1X8LA 2FKAA 3EH2A 4RVHA 3PYXA 5SYMA 3QKIA 3S2GA 5KSYA 3U39A 1SJ9A 1FB5A 2FPIB 3P8ZA 5JCJD 1DQSA 1A0OA 1QS0B 1PNQA 1PSZA 5E3HA 4FFOA 1AD2A 1NVEA 2IZ7A 1OLSA 1RHJA 3MMSA 5FPYA 1X1CA 5BP7A 3W3AH 1CD5A 4Q3DA 1B8PA 1G4HA 1THZA 4L9RA 1Z7WA 3PL1A 1QO0A 3RKRA 3Q8MA 1M6EX 3O2JA 4JODA 3ICVA 2JARA 5KYYA 2WBLC 4H7HA 5B55A 4ZT7A 4X7MA 4H7DA 3NT4A 1EHYA 1I1QB 4HF7A 4I5EA 1MH1A 4XUGB 2R6DA 4GF5A 5DX1A 1LRKA 5AK6A 4DREA 1L1QA 6YASA 3TW6A 2A9QA 4MV4A 3WYCA 3DV2A 3H9UA 2RARA 3CLRD 4UC0A 4AP5A 1KMHB 2QZ9A 5EKUA 4QBIA 2MINA 4TLEA 1HFWA 3PNQA 3I64A 3MCUA 4JJ4A 4B6FA 5LBIA 5F7JA 3U3DA 4DABA 3W5BA 2RKWA 3LC2O 3NG1A 4NARA 4ZAWA 4XIYA 4LK3A 1N1DA 1BX1A 5F51A 4KQMA 3U3XA 4XYGA 1DJOA 1CYEA 1YQ9A 3RYIB 3L6RA 1W59A 2OKGA 4QUIA 4DHWA 2XNDA 1ODKA 4PNPA 4FCVA 4NP6A 3NVDA 4P1ZA 4PAGA 4X8OA 5AJTA 3K9FC 1J1IA 2O7QA 3BXFA 2PUBA 5LKAA 1LC3A 1E1DA 1UDBA 1UR5A 4RENA 1V25A 3R7LA 1RLMA 4BJ5A 1EFCA 3BOSA 4GSKA 3URMA 3AG5A 1HLGA 3FSEA 3PEVA 4PNHA 4CRWB 1CDEA 4AMZA 3QW2A 2JJ1D 1D9ZA 3QHQA 1LRLA 1GGKA 3R5XA 3LVFO 4OB7A 1TCBA 1W4AA 4KN6A 4J94A 4WZAA 4DR3B 1TAHA 5B3AA 3SX0A 1L7MA 3DZKA 2OM2A 3G89A 2QZSA 5A2QA 4M83A 3A0UA 4IXNA 3A9RA 1H9BA 3RU2A 4LZWA 3A3OA 2YVUA 4NH4A 4JT9A