3KSAC

Detailed structural insight into the dna cleavage complex of type iia topoisomerases (cleaved form)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
226
structure length
220
Chain Sequence
KLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTAKAKMADILKNEEINTMIYTIGAGVDFSIEANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALPPLYKMSKKKEEVAYAWTDGELEELRKQFGKGATLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDNVKFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Isomerase/dna
molecule keywords DNA topoisomerase 4 subunit A
publication title Structural Basis of Gate-DNA Breakage and Resealing by Type II Topoisomerases
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 55
structure length 220
sequence length 226
chains with identical sequence D
ec nomenclature ec 5.99.1.-:
pdb deposition date 2009-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
C PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.670 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ksaC00
3L4KA 4KPEC 4FM9A 3L4JA 3FOFC 4I3HA 4G0UA 1BJTA 2XCSB 3RAEC 3KSBC 3RAFC 2XKJE 3KSAC 4G0WA 2XKKA 1BGWA 4KPFC 3QX3A 3K9FC 2XCTB 3FOEC 4Z4QA 4Z53A 4KOEC 4Z3OA 2XCOA 5EIXA 2XCQA 3RADC 2RGRA 4G0VA 4J3NA 3LTNC 2XCRB
chains in the Genus database with same CATH superfamily
3AFNA 2GPNA 4PNPA 3PR3A 5DCLA 2Z98A 3I61A 2ZIAA 4QASA 3G0CA 2CLKB 4W63A 1BG6A 5K20A 4AXXA 4EVSA 3VSEA 2O06A 1X7YB 5LLDA 3OCYA 1FC0A 4LHSA 4LZJA 1GCOA 1SVOA 3A7EA 4J3FA 3PZRA 3D7RA 5BN5A 4DW8A 3CUWA 2CJXA 3QEAZ 3BILA 1A7KA 1HE8B 1L3CA 1XTVA 4LXXA 4NZMA 4Y6PA 2FW7A 4P4SB 5EWMB 2ISCA 3B9QA 2NQ8A 3PZBA 1JAXA 2YHIB 4G85A 4HC4A 4MYCA 5AXCA 1FRZA 2IW3A 4PHCA 1E3WB 4BMDA 4V24A 5A6SA 2JJ1A 1U2DA 3PGJA 1J8VA 1A04A 2WU8A 3M3PA 3PICA 5A0TA 3UJ3X 3FCYA 1QTIA 1ZIOA 1E1KA 2BDUA 2BDTA 5E1DA 4ZCQA 4ARVA 3CWZA 2G5TA 4RABA 1AZLA 2IWHA 1I1QB 3G5UA 1U1EA 2AEJA 2ZG6A 4MUEA 3TI9A 4C2UA 1AUOA 1FSFA 4ACAA 1F4LA 4ESOA 1ATIA 5EY5B 1PQWA 2WHPA 3N8KA 3F2IA 4G1BA 3RYFA 2CFOA 3ZGYA 5B7GA 4KZKA 1O9HA 1GYQA 2EKBA 4OU5A 2UUAB 3U3JA 4KWCA 2VAMA 2X77A 2XQKA 3N76A 4EHKA 5EN4A 1F2DA 4KE8A 2QTVA 3O7MA 2PUAA 2QENA 3P9NA 4F9GA 4WAUA 2DFLA 1LSJA 3BSFA 3E3OA 3PRKE 4JLWA 3SU8A 2Q5JA 2XD4A 4O2BB 4R31A 4DNFA 1IH8A 2AI1A 1E2MA 3A58B 1ECGA 3TKYA 1H1LA 3JVDA 1JLLB 3JQ8A 3DV0A 3PUIA 1TGYA 1G5QA 1VM6A 2ZVPX 4O8ZA 4S3MA 4Y18A 3SC3A 4EIWA 1YB5A 1W96A 2ZXEA 1GPBA 3FM9A 3HJHA 3PEEA 3Q3IA 4I8IA 1QU3A 4O4JF 1GQYA 2ZGVA 3Q7RA 4BFSA 3SSMA 4B5KA 5BNTA 1W30A 2JFYA 4Q1EA 5E4FA 1VSTA 2FAXA 4A91A 5MGNA 3AEQB 3OT1B 2JGDB 4RY8A 2PBZA 5ESRA 4FOPA 3B3JA 3SS8A 2AC7A 3SHOA 3E8XA 2A4KA 2FPIA 2IV3A 4DIOA 1Z7BA 1NW6A 3UJHA 3PEYA 1DBPA 4OEHA 4DZZA 4E31A 1OE0A 1XQ1A 4PNHA 1G21B 3H13A 4N0PA 2GXSA 3KU4A 3VTKA 4GRIA 4BFXA 1H2FA 5AD1A 1GQQA 3EF0A 3G0BA 3IUBA 2RHRA 1YRLA 3K0FB 3DTYA 2NIPA 1ZO8A 1E0JA 2UUPA 3H3JA 3KD2A 4WKNA 2GZMA 1PFQA 5A7GA 1S01A 2R84A 5CFRA 1JF8A 4G07A 4UEJA 2R3SA 3V7NA 2HIAA 3NANA 3QI7A 3FBTA 5TPZA 2GVNA 3HDTA 1I4WA 5IT4A 4CG2A 1F2TB 3DNMA 1NKTA 5AKGA 3AU9A 4OH7A 1ACMA 3EC2A 3AC0A 1H4QA 4CTOA 3EMKA 4P81A 2QAGC 3DDZX 4FYXA 3CUEF 2E82A 1JP7A 3H4IA 1G63A 3IOCA 1TT5B 4DNQA 3LO5A 1SAYA 2WICA 1DC4A 1ODCA 1T8RA 1RQLA 4LISA 3VJLA 4A73A 4EO4A 4NOKA 1L7DA 2J32A 2VSOA 5LFAA 5TARA 5K6AC 1Q0QA 1SKBA 4B4OA 3FJYA 3VZSA 2QN8A 4MPRA 2CLLB 3AHGA 5LIRA 3DM5A 4BN5A 2J59A 4CM5A 4W8GA 3HJAA 1BKYA 1ONOA 5JAIA 3C7AA 1KBQA 3WA6A 2OVFA 7REQB 1TMYA 1LPPA 4L8LA 1MAWA 3ICVA 3E8MA 3S27A 4RDXA 1QU2A 1E6EA 1YHNA 1QH0A 4CLOA 5A9TA 2IYRA 3AEUA 1EGMB 3Q6NA 4JVMA 2JVKA 4YPVA 2XNDD 4EHJA 2QPOA 2YRWA 1TJNA 2UZIR 4GQBA 5EQTA 4YCMA 2QRNA 2ZIXB 1TEVA 1RRFA 2HJGA 2O3UA 3N8DA 1JHRA 2YHSA 1ZOLA 1IDOA 1X7ZA 1L5KA 3WK6A 3IT2A 3DOJA 4NYJR 2OLJA 5I7FA 1SKMA 4LC0A 4G67A 1YGYA 1T8WA 3MJFA 2DP4E 2GYYA 5CX1A 3NVAA 5KO2A 2YS7A 4IOMA 1GP2A 2DUNA 1XPRA 4EL5A 3PJRA 3DR3A 3LDAA 4YIKA 1HL7A 1LVGA 3OAAA 1WDTA 3OTWA 4RVDA 4X71A 3V8PA 2YVUA 2XB2A 1EKXA 4ZQEA 3P0EA 2WAMA 1OH8A 2V4ZA 3UBTA 1EVJA 3M6XA 1DKUA 5D3MA 1HFKA 3V4ZA 4EYQA 3BWMA 2JLCA 3EUFA 3F6RA 3I37X 4UQLA 3DXFA 3MD0A 3BZWA 2B8TA 4LTDA 2B0CA 4NI5A 1ISHA 1MENA 3MS7A 3P45A 5F5LA 4EY3A 1YL5A 2JD1A 1XRQA 2IXEA 1W1IA 1PJSA 2PZKA 3E2MA 4KVFA 3UWSA 3VR4D 5K0ZA 5K8UA 3MEQA 4QVKA 2IDKA 5ARCA 2JIRA 1I1OA 1U8EA 4FWIB 2Q7OE 1TM2A 4A2QA 2ZR7A 5GJVC 3C1UA 1CU1A 4RLFA 1SCIA 1KZGB 1T24A 1A4XA 3D8SA 4X20A 3L04A 2GJ8A 2PUDA 1V8FA 1FDRA 2A9JA 2BGRA 3T52A 1Q3KA 5L3SB 3GJ8A 2JK0A 3M4YA 3SXUA 4ZI2A 1P73A 2AJCA 3CRNA 1OT3A 2V54A 4PXAA 5K0LA 3GFPA 1NVKA 2AQ8A 3M4ZA 4M1TA 1NW3A 2OM2A 2QRHA 3KHTA 3T5TA 1GYRA 4Q4AA 1U0SY 3OE7D 5INTA 3VZCA 5TY0A 4EJ0A 3WWPA 3ZWWA 3FBWA 4BFLA 2O2YA 1HPLA 3F5MA 3SYLA 4AZ3A 3U6KA 4WZBA 4X41A 3LUFA 3UKOA 4N1AA 3D6MA 1VKNA 4II2A 5DYTA 1BGXT 2FFAA 5M2QA 5B2FA 1DG1G 4HR7A 1EWYA 1LLFA 1NATA 2P67A 3L9WA 2ZK7A 1S3SA 2CJPA 4IUCS 3K6SA 1BCSB 1SUWA 2Y2UA 2LWIA 1W6RA 3BUSA 4NFLA 2ZJFA 2A94A 1UT5A 4G5GA 4H1VA 2UZ0A 4GI5A 2V5VA 1FY2A 2WKSA 1LRKA 3B7PA 3VYUB 4C3VA 4UUQA 1OCEA 2ANCA 2BOVA 3C3KA 3IAEA 1B0PA 3PF8A 1BMTA 4BNDA 3PGXA 4LF4B 1I2BA 3IAXA 1UP6A 2QPLA 5J5CA 4BNJA 4I55A 4ENTA 4C0BA 2YXDA 4M1ZA 1RFGE 3Q5EA 5K6RA 5LWHA 5AXBA 1IM8A 1YA6A 3MAJA 5IARA 1VCMA 2ZTHA 1J0CA 2QTMA 4RK0A 4RMJA 4F46A 3E3NA 4C6TA 4DSAA 4YCSA 5AKYA 1BJKA 1Y1LA 3UB4A 1VKRA 4IJQA 2BR3A 3NHWA 4HFRA 3O21A 3VR1A 4B83A 1XQVA 1YC2A 1GAQA 1IQUA 1LCIA 1T4CA 2V7BA 4E1VA 2WK1A 5F3DA 4DSUA 5E7JA 5BXYA 2FR1A 3BMOA 1UPCA 3ODGA 5DTMA 3KKPA 1F8FA 1WXXA 2RGCA 3FKSD 4KSCA 3T4PA 3VDMA 3E15A 4DM3A 4Y2GA 4TSFA 1IMOA 2OMEA 3GAMA 4CRWB 3WRXA 3GN2A 4QJ4A 2CUNA 2I03A 4XWOA 1USVA 3C5VA 1R15A 3IIMA 4IKEA 3TW4A 2OKCA 3ZD7A 3ORRA 2VOEA 2O7VA 5EWMA 5FNVB 3Q3HA 4P4SA 2GJSA 4JYAB 3EQ8A 5E2IA 2L82A 2PV0A 4TV8B 1YAJA 1DC3A 3OTQA 8LDHA 5CFLA 2QM0A 5AHRA 821PA 3R8XA 1E3WA 1WZCA 1XDSA 2D2EA 2FSGA 3A6KA 3WNVA 4Y2PA 1BX0A 1VE5A 1A9ZA 3PLRA 4GUDA 1D2EA 3EAGA 3O8OB 2V3CC 2C5GA 1C1DB 2HRDA 2N1MA 3VNQA 1NRWA 2IIPA 1U9ZA 3GWZA 2X5KO 3VSCA 4I08A 4AWBA 1YUBA 2NO4A 4HYEA 3FOWA 4EZIA 5SYAA 2NTYC 3KT0A 4F9TA 2ZANA 4K9MA 4B6JA 4F71A 2E5FA 3LGSA 1TU3A 2OYCA 1IOWA 5KYWB 3W7AA 4F97A 3A3NA 4OHZA 1C0EA 3C15C 4POAA 4KR7A 3K1TA 3EZLA 5KYNA 3BBLA 2GLUA 1NTRA 2EYQA 2FKNA 1J2JA 2JHPA 1NVDA 3NBQA 3O3MB 5DYNA 5ILQA 1JB9A 1POXA 2P0EA 4IUYA 1EPUA 4TTVA 2MCFA 3D31A 1RMTA 4BMSA 2BHRA 1OBCA 4LXHA 5JRDS 3ZXIA 4HWKA 2X3UA 4M7RA 4Q6BA 3BQNB 2NZUG 2RK4A 4MQUA 4LG1A 4KAJA 1AUPA 4O2BA 4MVJD 2O0MA 5CPBA 4BFYA 5LZ7A 4D81A 5JQGB 1G3QA 1G5RA 1XYGA 1CR6A 2XYQA 4TMWA 1JLLA 4GZ5A 1HYGA 4C0KA 1AM4D 4B3HA 3OJEA 1TEHA 1RJWA 1M6WA 3G2NA 4TMZA 3BE5A 3HY6A 3LCMA 5DBFA 2NP6A 1W2GA 1J8DA 2WT8A 1HL3A 4O4LB 2VK4A 4DREA 2X4IA 4EB8A 4JCOA 1LPOA 3TS1A 4QA9A 4D6XA 1E0DA 2PL1A 4D42A 4KNWA 4CWAA 2QXUA 3CKKA 2XECA 3AEQA 3OT1A 2HPAA 1KL7A 3KDSE 1Q20A 2GJ9A 4MGZR 1BWPA 3JRWA 4P4NA 3OM0A 2JDID 5EIFA 4G1CA 4UUBA 3CB4A 5ALPA 3AR9A 4JVLA 4BGIA 1O94C 5A1JA 5J2UF 1IRXA 2I1QA 1UT8A 1UKYA 5BN1A 1G21A 3NOQA 3D6NB 3OY2A 3WGQA 2VJMB 2SKEA 2FZKA 3GLKA 4BP1A 4CV3A 1BZYA 1E98A 1FNSA 3K0FA 4TM7A 4B7CA 3JQEA 2DWPA 3GAFA 4II7A 3U4QA 2WJHA 2B3DA 1ELOA 1F6DA 1GPH1 2CE7A 5GM2A 4BVAA 2B98A 4FNGA 2NZJA 3QXSA 6CHYA 4WLUA 4W5WA 5SYNA 3KCNA 1F2TA 1A72A 1PJLA 2ZFUA 5DM2A 3E9YA 3OQBA 3SVZA 2B5WA 2P3OA 3WWCA 1RJ9B 5MDHA 3GLIB 1FMCA 2J3MA 1V41E 2HHCA 3OU7A 2BGUA 1UFRA 2X8WA 1TT5A 1JEYB 1X1DA 3WDSA 2J0SA 4G5FA 4QU5A 2N0SA 4BVEA 3WLLA 1Z6QA 1FB5A 3FE2A 4HO1X 4ZCPA 2AC4A 3KFXA 2Z9DA 3QUSA 3ZU4A 5KTTA 1KK2A 4GGOA 1Y5MA 3UOAB 5JHHB 3KV1A 2QTBA 4LMPA 4YR9A 3F74A 4WKOA 4YQEA 4BZWA 1AB5A 2HX1A 2VLBA 3A70A 4JGBA 1N1EA 2XUHA 3NBAA 3AFIA 4FFDA 4DUPA 4ABTA 3QPCA 2B5OA 2JHFA 2QX9A 3F98A 2AQKA 5B4VA 4BLRA 2YKGA 4GECA 3CUKA 4IEEA 7REQA 4TRRA 1ILEA 3GJZA 5L4NA 4A8HA 3LAWA 1ABBA 4G0WA 1ZMBA 4JJAA 2REBA 4EI2A 1VB3A 4HLQB 3IC5A 1JHYA 1LDMA 1U28C 1UL1X 2ECOA 4GPAA 4YT5A 5HMMA 3EGEA 3VR2A 1Y1PA 2ZIXA 2PX4A 1N75A 1TUEA 2BONA 4KVGA 3TCKA 4AUMA 1G8SA 3IVGA 1YK0A 3OT5A 2CLSA 5I9BA 3QQPA 5PNTA 5LQUA 4R16A 3PC6A 2XWQA 1CF9A 1LZKA 3ZIUA 2FRVA 1FXUA 2ZRBA 1F1JA 3L0IB 4MMXB 1B26A 2OZLB 3A06A 3C1TA 4Y1RB 1SVIA 4ZYUA 3V4LA 3X2SA 2XZDA 3VU9B 2BFDA 4X94A 3AHIA 5K8TA 1RACA 5MGBA 4M1YA 2AFRA 2Y6UA 1IUOA 2XE8A 4ASUD 5A0VA 3OOEA 3VPXA 2WM2A 1NUQA 3K2BA 4QHSA 4J0GA 1KEWA 1UJCA 1RC0A 3E1GA 1JG2A 1Y98A 5EHNA 1GTMA 1XTTA 2F9LA 4G5YA 4IIJF 1TCAA 4MX8A 3ZE6A 4B2PA 1YTUA 2Z58A 1IPEA 1BS9A 4RY9A 1AC5A 1QONA 5IXSA 2VQ6A 4GPTA 4AD8A 5LYJB 4RJKA 1KEEB 4C43A 1YB6A 3DE3X 3M6FA 3TE7A 5JZVA 3LKBA 1WOYA 3A1TA 4IILA 1XZBA 2FUCA 4DB2A 2H2AA 2HEIA 2VDOB 3BJMA 1W49A 3L4KA 1BHJA 4RE6A 4YBRA 4G23A 1RTKA 2J3HA 2YN2A 1FFXB 3JQPA 2J9GA 4HEJA 4IDHA 2YS6A 1KI4A 1C9JA 1E94E 5DGDA 5IJAA 3QTLA 2AJTA 2ZTVA 3PEWA 1ZJ4A 4OJNA 3GP8A 4KFCA 5FOSA 4ARSA 2VBCA 3BD7A 4K8OA 5TGTA 2SECE 3DBVO 4QNMA 5HIAA 3DZFA 1M0EA 5CFZA 1FYWA 5IDVA 3RTEA 2HDOA 5AVRA 2I2DA 3MJTA 4PEVA 3BKXA 1DPFA 2O6HA 4AG5A 2ZSJA 2YIVX 3HY3A 4L6CA 3ROXA 3TL3A 5JU6A 4GLBA 4K3UA 5IHXA 2DFPA 4F6RB 4LJ6A 2H4XA 2JJ1D 3PFWO 1C8LA 2OO7A 2H5JA 4FHZA 5G4LA 1CY4A 1XPJA 4PFSA 3LE8A 4MKRA 4UNSA 1CQZA 3RRNA 3DA8A 1BCSA 3EXAA 3MFQA 3CNNA 1W48A 1W88B 4UMVA 2AB0A 4M86A 4MB6A 3WHLA 4ETNA 2R1TB 3O4FA 2Y4OA 1U2DC 4O1HA 1XK6A 1AY0A 2WMOB 1JU9A 1P7ZA 3WLNA 1GUAA 1M7HA 1XZQA 2QK4A 1JNXX 2PTHA 3LPNA 5AHWA 3KD3A 4YPFA 2H5IA 1FLDA 1QGAA 3I0MA 3RYCB 1ZUNB 3EAQA 4KOEC 1MIOB 3SC4A 3TTXA 3AR6A 3NTVA 3ZY6A 1YIOA 5A3QA 4GD3Q 1US8B 2RHTA 1NSTA 4OXRA 5J5AA 1AHPA 3UJCA 4B4KA 2IOQA 2XIQA 3B3AA 4LY9A 1BVYF 1O58A 1GG9A 1OUMA 2FPSA 4OMDA 4B40A 1WP9A 1KJNA 5AKEA 4CG1A 5J23A 3FOFC 4G4JA 4LKRA 4X63A 4Z3KA 3QA3E 3P9CA 1F0KA 2BFPA 4LE1A 3CEMA 1IB6A 3FNGA 3FN4A 1TQHA 2HF7A 2DHDA 3NT5A 4B3FX 4DBLC 3CR7A 2O19A 5KVVA 3ZVNA 3R6TA 3GZ4A 1QZXA 2JLZA 3KQLA 2HTEA 2Q6KA 1JPJA 2Y1OA 4KCGA 3MMXA 2IU3A 4CQNA 1UBHS 4UBMA 4J49A 3GP5A 2RHCA 4EF5A 3MJHA 4B81A 3N75A 4MV3A 4PC7A 4LVUA 5DI9A 2Q49A 1G7SA 1XZJA 4GPD1 2YWGA 3JPYA 4K6HA 3A04A 4PGAA 1N2CB 2XB4A 4UJ3A 4NE2A 4US1R 2DBVO 3D54D 3O74A 2JRLA 2CHEA 4IM7A 2B20A 2CL6X 2YIJA 4P8RA 3O8QB 5FNVA 4IIEA 4TXNA 2PJRA 1BJTA 2WWHA 4QECA 5GJBA 4TV8A 5CXXA 4NIMA 4D9KA 3CPHA 3LECA 2ICAA 2AYXA 2IU4A 3C3AA 4EFMA 3VOBA 5L95A 4RQBA 2I9KA 1ZN7A 4CETA 5JDCA 1DDGA 2A9FA 3DS8A 4RXUA 3O8OA 2IEZA 3IQDB 3SM9A 1T2EA 2FUEA 4BVJA 3GPDG 4IIFA 3ZQ6A 1QIHA 3MYYA 1PGPA 2DFVA 2J09A 3HI6A 3Q3CA 1RFLA 1ZJJA 4JJ4A 1X1QA 3PUKA 4Q3DA 3SDZA 4HX2A 1QUEA 3DE4X 3S8MA 2IUYA 1JS1X 4XSGA 3PX2A 1I33A 2BEUB 1UQRA 1YZGA 3JWEA 3HCNA 1QUFA 1JDZA 4KAAA 5DX1A 5BPFA 3LCUA 4HB4A 2HU5A 3KVYA 1EINA 3PWKA 3WDKA 1E2BA 5FA8A 3K0AB 3X1DA 2Q9BA 4ALJA 4Z49A 2CLHB 3KG2A 3TE6A 3ZWMA 3AEZA 5EE5B 3TOCA 3KL4A 2R6FA 2G70A 3QMVA 1HDCA 3OLCX 2Z95A 4OSEA 1XCPA 1GV0A 1U3FA 4Q82A 4G01B 3G5LA 5EC8A 1WQ3A 5C2JB 2JD0A 2I4LA 4HTFB 4OKSA 4DDTA 3HV0A 4U7HA 2AZ4A 5CBPB 4O02B 4DWVA 2VTEA 5CBKA 4MUGA 2AS0A 2OOSA 3AG6A 3BERA 3TTVA 2FWBA 5JQGA 1M6EX 3I2FA 5AIAA 5JO9A 1E9SA 1NQWA 1R0LA 2J5XA 3CRVA 2YWJA 4R2MA 3ZU5A 1XX6A 2X0KA 4PIMA 3R3VA 4EJSA 1JYFA 1R8QA 2A9KA 3SE0A 3HKBB 5BV2P 4L7VA 1N0UA 1QHYA 4TWJA 4EK9A 3V42A 1RYNA 3OQOA 1NRIA 2QDXA 3I45A 4PS1A 3HS3A 4O4LA 9LDBA 2P8JA 4UFOA 1IL0A 2MSLA 4K6CA 1GUBA 5CIYA 2OV3A 4RMNA 1VTKA 1GN9A 1NKVA 1U8CB 1ZGBA 2RGBA 5T8KA 2ID7A 2GN1A 2Q2QA 3F4KA 1QF6A 3OZAA 2PKCA 4RTPA 1DJOA 1KQOA 3JCZA 5DW0A 4B8WA 4ENPA 2XRYA 1KVSA 1KBZA 4EG8A 3S40A 4RMGA 2VJMA 3DZGA 1B0ZA 3DOFA 4JH0A 4NR0A 3RJZA 5IMBA 2H1WA 5GTDA 4KEAA 4MRRA 1VYVA 2ATIA 5JNLA 4J3NA 3DC2A 4OQYA 4UTXA 3R0JA 1PL8A 4YDSA 4EZEA 5ILOA 1VECA 5FFFA 4KDEA 5HE8A 4AJEA 4I8DA 3N7TA 2RBEA 4HB0A 2Q7XA 3AI1A 1TK3A 3O03A 1F8YA 3ML1A 1RJ9A 5IAGA 4GRAA 3AXSA 1VG8A 4KX5A 5LJIA 3ME5A 3A6EA 3M2PA 1ZN9A 3X1WA 2J3EA 5JC8A 1J97A 1G8YA 2YVQA 3RHFA 3UM9A 1JEYA 1U31A 1RAGA 3VSBA 4UFNA 4UM5A 4MP3A 1P8JA 3F7TA 4HCJA 2ZAOA 2AUMA 1RXCA 2P9EA 3RVBA 1NXSA 3LPLA 2YIMA 4WJZA 4JVSB 1IEXA 5LUAA 3U4AA 3NGXA 4NAUA 4GM1A 1R50A 1WPQA 1OI2A 2N46A 1FYDA 4N39A 3TPCA 2AUNA 4B35A 4ECAA 1T8UA 3DFZA 4DHEA 2BGKA 3KHSA 4Q47A 4HQOA 2D5IA 4YMSA 3RBAA 5LQNA 3DL2A 4UM9B 2QV0A 5K0CA 1Z4NA 2QZ4A 4W5OA 4UAJA 2WTAA 1Q0ZA 3WWOA 4YNBA 2DR0A 4WFJA 5AJVB 5HM6A 3B89A 3E2IA 1FYXA 2WTNA 2JH9A 2WSLA 4FGJA 2OA0A 2GYVA 1XV5A 1Q0PA 4QQ8A 1GEEA 2GETA 1I32A 2R6DA 3ACDA 5AJUA 3SMQA 2R5WA 4KJXA 1T5IA 2H00A 4QO8A 4XTRA 4BO7A 3VJRA 2IS2A 1GQSA 1QOZA 4OIFA 3B48A 3EUEA 3ZLUA 1OT5A 5IT0A 5DLDA 2J7PA 2OZLA 2VEOA 3L7DA 5AHXA 1IY2A 3OLYA 4IVNA 3LTNC 2LR0A 1ULHA 2AI3A 4M21A 4PHHA 2ACWA 2A0FA 4EELA 5KUTA 5G1OA 1JQKA 1E6WA 1VJRA 3PC3A 4GL2A 3I0ZA 4Q7EA 1MRNA 2WM8A 2AYZA 5ISMA 2CGEA 3FA2A 3E9QA 3DWGA 1LDNA 1XQWA 4X66B 1RAFA 5FT9A 2HSWA 1HQCA 2JNWA 4G25A 3ICEA 1Z0JA 1AVTA 2H9AA 2R6ZA 5LYJA 2QL6A 4FDTA 5DJ5A 5TJHA 1KEEA 1XBTA 1YU9A 3D4IA 4JD5A 5JNTA 4I50B 1K0FA 2C94A 3IMGA 4FGKA 4QUIA 2F00A 3A6JA 4K28A 3KX2A 4WLOA 4O4IB 3WA7A 3EPLA 4YT2A 3K0KA 3Q3GE 2I6GA 1RHRA 2LZ0A 4GNKA 1BCRA 3DWIA 3RANA 4WEQA 1ZAYA 3AP2A 4BTEA 1X3LA 4UQPA 3MSCA 2PXXA 4NONA 4L75A 3QSGA 4BZQA 2GEJA 4PHGA 3K30A 3M1IA 5EXDA 1S96A 2A0XA 3VUFA 1KO8A 2HMTA 1W9HA 1M0WA 4AN4A 5JAPA 1PHPA 2BKLA 2H85A 1CFZA 2QSYA 2FH5B 1CP2A 3VR6H 3T1TA 1YONA 3ES9A 3PI7A 1E9CA 4EGQA 3RVLA 4DCJA 2W37A 2UU9B 1JILA 1XLTA 3HNOA 3UYKA 2QN9A 4OQPA 5FI1B 4F6RA 3ESDA 2VRCD 4EG5A 4YDQA 3BVPA 5L51A 5ALLA 1XNRB 1V37A 1NY5A 3GEHA 4NDZA 3I92A 4GKBA 1FVFA 1K6IA 3KSZO 2HPVA 4TT8A 4X92A 2DYKA 1WXWA 5CIWA 5FEMA 3C8HA 1WMBA 2EXXA 3SJUA 1ZH2A 3SFZA 5A9SB 3N2NA 3S3TA 3EIUA 5LLTA 1GPJA 2CL0X 3SZRA 1W88A 3NT2A 5ICGA 2RI0A 3G3EA 2H92A 3COYA 2A1UB 4EKIA 4MINA 1F12A 4IGIA 1VL1A 1I7PA 4PGHA 3WYGA 5IC5A 1CB0A 1D1PA 2FMIA 1HC7A 2C5BA 2J07A 3EXG1 2QUZA 3KVNA 1KJYA 1BVUA 2AFHB 3KT6A 1H3EA 2WZDA 1ZUNA 1SKYB 3PSHA 3R40A 1KYXA 1RJDA 2FSPA 2PUGA 3OJCA 4EG6A 3OFND 4C01A 3ANXA 4J7CA 1US8A 2NG1A 2C29D 2QW1A 4RE5A 1RAEA 5IBQA 1S1MA 2GILA 4UC0A 1P2BA 1MA0A 1W7AA 4B3MB 1VL0A 1CJVC 1P74A 3WL6A 3IA2A 3LFTA 2O8NA 4ZK2A 3ZTTA 5JS2A 4ODIA 2BKXA 4J0JA 1MAUA 2PLFA 3UB3A 1V9SA 2QD5A 4MYTA 4XSVA 1TTPB 3K73O 3R8FA 1QFJA 2IYFA 5KTNA 1YOVA 3ZK7A 2GAFA 4FFRA 1JDNA 2B2NA 5EINA 1U5CA 4FYMA 2O1WA 5KCZA 3N0XA 1OIXA 4U2DA 3K6KA 1FJHA 3NRJA 1G2OA 3O6VA 1CYEA 2C4VA 3H18A 4HLDA 4U2GA 1TIKA 1N2CA 3BCUA 1O8BA 3FLMA 3HVJA 2P0YA 3K9HA 5DZSA 4F86A 4EGJA 4YECA 3LI2A 3ZKAA 4BGDA 4ALMA 3DXXA 3FKQA 1UKCA 3O8QA 1FP1D 1CQPA 3O73A 5EIBD 1CVLA 3H5IA 1ODFA 2HWXA 4ZAFA 4C0HA 1T91A 3FVWA 2JFBA 4K6OA 4YQFA 3RSZA 2IQ5A 4L9SA 3ZUPA 1NVWQ 4AS3A 3S8EA 4LCBA 1VJ0A 1PZHA 1Z25A 3OOHA 3L7LA 3K1AB 1R0SA 4KVZA 3T38A 2HQSA 5KX5F 3UB2A 1XKTA 2PFGA 4Y6LA 2O50A 1Z6PA 4LJYA 1GCUA 4PX5A 5EFZA 1CR0A 2FSFA 4RK4A 2YL2A 4JASB 2K7ZA 5A04A 3FDZB 1YS7A 3V4RA 4J0FA 2YWXA 2DWQA 3NYIA 3Q1KA 4JLAA 3NUGA 4B8ZA 3K0AA 4G4GA 1HLDA 4C7MA 2VZLA 3C7TA 2Q62A 2O7SA 5K09A 2WRZA 2WAYA 1L7AA 1ONPA 4X84A 4ZANA 2GAAA 1YFZA 3C3JA 3LHSA 3FTNA 4XDZA 1U2QA 3FX2A 2FSIA 4E70A 3A1CA 1H69A 4PQRA 1TEZA 1VDZA 4HTFA 3BFPA 1Q5PA 5KNCD 4NMHA 2R86A 1DWQA 1QYDA 3R44A 4GXNA 4PHFA 5CBPA 4MUBA 3OVMA 2COKA 3LG2A 2P6UA 3VPFA 5ARBA 2NVOA 4ZJYA 2ECPA 1T5SA 2JW5A 3RREA 5IUJC 1DFGA 3LX6A 4QREA 1G98A 1PZEA 1XRRA 2CXOA 2H57A 4FFBB 1H0HA 2ZQZA 1XL1A 2O4CA 4LV5B 4V2IA 4V1CB 2AG6A 4XWWA 4TPKA 2QRKA 2TMKA 1VQ1A 3I04M 4BNWA 3SK0A 2CJFA 3ESZA 4U5XA 4F2PA 4KITB 4GQAA 3THYB 2O07A 1A4RA 1FTWA 2H1SA 4XYMA 3R3HA 5I3ZA 3LVFO 2OXRA 2IPNA 2QZZA 4J29A 4Q3LA 3N0RA 1AKVA 3H2KA 3GLTA 1MC8A 1P5RA 2O5VA 5EJ9A 2P30A 4BVKA 3G8AA 5BN3B 3JQGA 2OAQ1 3F9RA 3PDWA 2JARA 2ODBA 3PFIA 3JYQA 4H16A 3FD8A 5BVHB 5AIBA 2F48A 4G89A 7AT1A 4X8OA 4EAQA 4IAOA 3SZMA 3PIDA 3L0CA 1AV7A 3PD0A 2ZI6A 5A3JA 2QEQA 4KU4A 2QVGA 5B4UA 4KTVE 4URFA 3SBEA 3WLAA 2V9CA 3H5NA 4E1AA 1KK3A 2D59A 5GIOE 3MCAA 4PG6A 1ISIA 3ZPXA 1I6WA 2X6TA 3WHPA 1NX9A 3PWZA 4ND3A 2ECQA 1RPAA 4MP6A 5P8WA 3D7SA 3AF1A 1MO2A 2NW6A 3DLPX 4JBGA 2R6R1 3QEOA 5ALTA 2G1PA 3Q8XB 1IEQA 3ET5A 3I01M 4JXJA 4QRDA 2XKKA 4TYQA 4WQMA 2YTZA 4YRCA 3WLRA 1ZH8A 5TRTA 3OPNA 4D44A 1DOHA 3BN3A 1C9DB 5EPEA 5KOHB 4IL5A 1QGED 1T2FA 1Z08A 3NZEA 3CF0A 1PNRA 3WLOA 4OHOA 3W1WA 2VTDA 1DEAA 3GLHB 3WFJA 3UK7A 4H6XA 1H5UA 2XJ4A 3DF7A 5FBHA 3HEMA 4ZALA 1TCVA 2H11A 5BRNA 3H1GA 4G86A 3F5QA 1IYZA 3RVPA 4DQVA 4QJIA 3FF4A 4WINA 3YASA 3AETB 1B6SA 5KNDD 4ZEWA 2ZRDA 3W2HA 4D4HA 1P17A 1ZESA 3RJMA 1FX1A 2UVDA 1P77A 5FL3A 4Q1BA 4DMRA 1YZKA 4YP5A 3PRHA 1FTQA 2BGMA 1AF7A 1G6OA 4KOAA 4NS1A 1CY2A 3NRCA 3TX2A 4DSNA 5LDDC 1AO0A 4C4XA 1BDJA 3HFRA 2VT3A 3IX7A 4HGOA 3EVNA 3VV3A 2XGJA 3G49A 3U3DA 5KC8A 3QUTA 4EYKA 1TMGE 4IOKA 2ZUDA 3V00A 3B20A 1OZ0A 4BQPA 2FHPA 3E53A 4UBKA 2ZIZA 5JWOA 3GLFE 5CB4B 4IPTA 6REQB 1QIJA 4MMYB 3R5XA 1Q1EA 2XT6A 4DZRA 1ESCA 1L4NA 3QFSA 2JGLA 4QUEA 5AXDA 3BGDA 2R0QC 5AOAA 2HZBA 3RLIA 3HUDA 3GPCA 2F1JA 2WB4A 2Q3CA 1EJ6A 1JG6A 1TRKA 1E89A 1VP3A 2CJWB 3DONA 3IELA 4G9GA 2WFMA 5LR6A 3UHAA 3HGTA 4I50A 3AP1A 1EM6A 2I1WA 4MIKA 1Y5NA 4IFBA 1NLZA 3B82A 3WR5A 4CM9A 3FPEA 2XI4A 1I2MA 4YCCA 5CLIA 4PSUA 4LOLA 2K87A 3WYEA 4MYDA 1GWNA 3VNUA 4HNTA 3V4OA 2CN1A 4ZOCA 1NW4A 1P4SA 4LNAA 4GKJB 3OA0A 1XNHA 4G1EB 1T15A 5EKSA 2Q6VA 5KSYA 1JQBA 4HZIA 5KPDA 1XPUA 1TZCA 1UBCA 3U31A 4M36A 1C2YA 2Z5LA 3ZXSA 1ZICA 3ROTA 4LEIA 3PVCA 4MI9A 1LX6A 5IMSA 3KM0A 5M5BA 3B5IA 4PFQA 1TTQB 2CXTA 3WQBA 1K98A 1G2QA 1GU0A 1KXJA 1YVDA 2JGJA 3FSJX 4U7DA 1UEXC 1IHOA 1RM4A 3VMMA 2WVAA 3V1UA 3BJZA 3D0QA 5KINB 3R76A 2CDRA 1OBHA 1NLMA 1YC5A 3ROKA 1G8MA 4BX3A 1WCWA 2IU0A 5TQ2A 1ZZEA 4FYVA 1S7GA 1WABA 5IH3A 2JBWA 2PAFA 5I9IA 3OQJA 4DV0B 3FWYA 3TRIA 5A9SA 1JAZA 5E2BA 2XADA 3KQPA 1L4MA 1ZI8A 4UE6A 4DJDC 4G24A 1GSAA 2JGKA 2C7BA 2ZUTA 1D3AA 2A1UA 8MHTA 2I66A 2GHTA 3F7MA 3GLGE 1E3TA 2OHJA 4NZ9A 1NBAA 4XEHA 5JDCC 4BC0A 2I6XA 3UGQA 5K0FA 2EOAA 4K9OA 4HXYA 2YOFA 3PGA1 4FONA 3T7JA 1KHHA 1YCFA 2AFHA 7ABPA 2BIFA 3ZLVA 1XU7A 1ZRHA 3QFHA 3W8EA 4K87A 4EQ6B 3FNEA 1ZSNA 1RYZA 2P5SA 3THWB 2Y3IA 1U81A 2GPWA 3TZHA 1CEXA 3LBAA 1LC3A 3WO0A 4ZQHA 1GG8A 3GGSA 4JBHA 3KZCA 4LWOA 1DC5A 1GG5A 1L5YA 3SIXA 5HKOA 2ARKA 4UW9A 4Y9DA 5CDGA 2NYVA 1B6TA 4C4TA 3AXTA 2WZBA 3QOYA 1BMQA 1ZH0A 3AHEA 4U6NA 3TW6A 3ZNOA 2Y0BA 1D2RA 4BB0A 2B69A 1LXCA 3IPRA 1KSJA 2HQ1A 2A1TS 3WHIA 4HAIA 1CBUA 2DQYA 2FRXA 3L1JA 4AJIA 4G26A 2VAWA 3K2EA 5JV5A 2Z04A 4KH0A 3RTBA 3DWEX 4RPKA 4IF6A 4EHNA 2QQEA 2BUCA 3R6DA 2OCXA 1CJSA 1GAJA 4N5IX 3GVXA 2VQFB 2DSNA 5J4YA 4DBLE 4QT4A 3FUCA 4PPYA 2AN4A 4MB2A 4OA5A 3RK4A 4TTPA 1QQ7A 1CK4A 4IIXA 3V8BA 2YY6A 4JUCA 3QE9Y 4HV4A 1IY0A 3QV2A 4ME6A 2Y1FA 4N6OA 1Q16A 1PJRA 4XZ3A 3AVYA 5T8KC 3VNRA 4ZREA 5DYWA 2QAJA 4X7RA 1HE3A 5EP1A 1NMQA 3NPMA 3K1AA 3BG5A 1RWMA 1I0LA 4B71A 1F0YA 3N6RA 4RNDB 1J7KA 3KLPX 4AO8A 4DCSA 3Q0TA 1Q7CA 4BYMA 4N9WA 4C0XA 2I1LA 1A8QA 1IHXA 3FDZA 3W8RA 3LVQE 5AVKA 4FFVA 4FEEA 1SUSA 4GOKA 1JDBB 5AUOB 5I7SA 3TTWA 1F2UB 1VCIA 4P5EA 1KZ4A 1QC5B 4JJGA 4QYMA 3Q9LA 1I2CA 3RRJA 4DV6B 4YGXB 1JFSA 2NZWA 4LF5B 3KVVA 4YCJA 2ZYRA 1P7YA 1PQPA 2YRFA 1XAGA 1M72A 1CUGA 3HB1A 4WKBA 2DKFA 1FTSA 2MSKA 4DQ0A 1T2NA 5CDFA 4BNFA 1AHHA 2VT6A 2YY5A 3GVPA 3VZPA 4ZO9A 3T5CA 1XMOB 1ZKMA 2OBLA 3L05A 5K7SA 3QI2A 4ZT5A 2GZRA 3D8TA 4NPHA 4FFBA 3B6KA 3WZ2A 2V6BA 4M2LA 3KQUA 1GCAA 3TD6A 2HWYA 4I2NA 1LSSA 3AY3A 4PCVA 4C1BA 5KDDA 4X61A 4DR5B 4II3A 2XF2A 2ZE8A 1MABB 1Q6ZA 1UADA 3KELA 3K9CA 1KQGA 3EQ2A 3CQ9A 2BSQA 1S2OA 3REOA 3D3WB 1HQDA 3L8GA 2C88A 4YAWA 1Y9ZA 5LBIA 2HO5A 4L51A 3CGGA 4HGPA 4RLSA 1BE6A 4B6FA 1KU6A 2DY0A 4ND1A 1EVKA 1RYYA 5JFTA 3W5IA 2O8DB 5BN3A 1Z0UA 2VSXA 5H4HA 5AVVA 5I4IA 2XZLA 1EXWA 4Z7QB 1GNLA 1NQVA 4GOMD 1UIMA 3BMQB 3HMKA 4CW7A 5JZSA 5F1PA 1G9SA 5CCXA 1DQNA 4FU0A 4R8SA 3USCS 5ADUS 3FHCB 4N9QA 1RKXA 3ILVA 4Q05A 5HF8A 1QIEA 4Z3OA 1HMPA 4L08A 1OOEA 5I48A 3EFBA 1J49A 1RMQA 1AZWA 5F9MA 3WIDA 3U0VA 1NJ2A 4KYIB 5EUBA 3RF7A 5CVVA 2F43B 5BT9A 2BLLA 4V0MA 1I3NA 4R7TA 5SYMA 4G09A 5DMHA 4DILA 4JLDA 4G1FA 1JE1A 4KODA 1YDGA 4NV0A 3X44A 4CR6A 1I0IA 1LQUA 3VNAA 1WD7A 4O25A 2ZRGA 3IMKA 1WVIA 3A1DA 3AGPA 2MYUA 2W58A 4LOHA 4UTZA 3TEJA 4BX2A 3UWOA 4R2JA 2IYYA 5ALFA 4QPJC 2PMCA 4GDMA 2GM9A 4LZOA 3HB5X 1GNPA 3GLHA 1QQ6A 4GQIA 4KBGA 1V5EA 1SHJA 2BGTA 2Z2YA 4KPUB 4PC2A 1PEDA 2YJTD 2BMWA 3G2PA 4ZYVA 2CFRA 4CL8A 1WR8A 2EHJA 1E79D 1LDBA 3AETA 1VRCA 1F38A 3U3XA 4CQJA 4TYWA 1Z5OA 1L4BA 1D8AA 1ZUHA 4B44A 3ABOB 1YRYE 1URPA 1K89A 1VXRA 1I30A 1JPNA 1OV6A 2JIOA 2QQFA 2R2AA 3HO8A 3PWSA 3QY9A 4JBXA 1JU3A 1K63A 4QDZA 4CIXA 4HQLA 1YDFA 1XLTC 3MW8A 2ZAYA 3PQ5A 2GFHA 3ETHA 1DAOA 1AQIA 4M8KA 4ZMRA 4QAJA 4IINA 3H65A 4XYGA 4YRJA 3JQAB 4UUAA 5EP2A 4V2UA 1RXYA 1GFIA 5GV7A 1T8TA 2UKDA 1UJ2A 2SICE 2ZJ1A 6REQA 2I55A 2PAAA 3VSDA 1MG5A 4Z7OB 3WYFA 4IQ8A 4U7WA 3QE4A 4JLNA 1K4KA 3C3WA 4QJ5A 4WZBE 3HFSA 3DMGA 4I4TF 4NZZA 5JD4A 1Z68A 3GZNA 2ONKA 4DN6A 1E58A 3OUTA 2WIKA 5KQSA 2P2NA 2YWEA 1CHNA 5CHYA 4XVCA 2BEVB 4O0MA 4D2IA 1XU4A 5JCZA 2QQ0A 3DC7A 4GOOD 1TMOA 5JCPA 2FNAA 4QUBA 3ZBTA 4H35A 5KOJB 3PDJA 1D7OA 4XGRA 2D3TA 3DEZA 2LW7A 4ZVVA 4L15A 3PQ2A 2WA2A 2NUPB 4F6LA 2H4YA 3OWOA 3DGFC 4A9AA 4DPMA 1VBFA 1ECJA 1IRIA 1T1RA 3GBPA 3KB6A 4GDFA 3GUZA 1JG1A 2Z2JA 1SH7A 2IY9A 1KERA 4BLSA 3IE1A 5CX4A 2Y93A 4CLRB 3F1LA 4U3JB 1PR5A 3WIUA 4O4HA 2B3TA 4EY4A 1DWOA 1EP9A 4FE4A 1B42A 2WE7A 3QKSB 5FUXA 4D02A 3KQSA 2NACA 3U44B 3EZ6A 3ADDA 1QJ4A 8ABPA 4AJKA 4GZMA 5CFNA 4ZGBA 1OGIA 3KKEA 2VJAA 2XMPA 4PC6A 3NHKA 4CQLA 5BV8A 2D5LA 3RWBA 2Z6AA 3IJEB 1WSAA 2E4AA 2I87A 4MOWA 3PLNA 3VOSA 4L9RA 3KR9A 3RKRA 1ZJWA 2APJA 1BRTA 3AL3A 3N8GA 3TLGB 3WDMA 3GPLA 4YLEA 1PWYE 1O89A 5AM5A 2J9RA 3TKLA 1N3IA 3KEMA 1XEWY 3SAJA 1C81A 1WCYA 3AU8A 5DCYA 5L3ZA 3CURA 5CGZA 3DVLA 5HS6A 5J2TF 5LCXA 4YFVA 2H1CA 3QEKA 4HHEA 3VOTA 1Z39A 1RABA 3ESYA 2XCSB 4ZEOA 4WPGA 1XPOA 1N5KA 1NT2A 4NS4A 4QPNA 4LBZA 4EQ6A 2XRMA 1DL5A 1FCJA 4TTSA 3THWA 3UC5A 1XA0A 2JFVA 4Q7LA 1JZSA 2CLIB 3EIFA 4TV8F 5I7EA 2MSNA 1TL7C 4QUHA 1NY6A 2PGNA 3ZWYA 3EGXB 2QM3A 3NPAA 4GI3A 3OCCA 3ZGVA 2I2XB 4ZHSA 2KHZA 4WY2A 1GL3A 5K4GA 5KMGB 1W75A 4DB4A 3BRCA 3TOSA 3RODA 3G6KA 1GPYA 1AZTA 1IY9A 1L8AA 3LUBA 1EEXB 2H5EA 3IDZA 1Y34E 4GBED 4GUAA 2Y99A 4LA4A 4MLDA 5JAHA 3ZLJA 4RF4A 5FL7A 3WYAA 4QBKA 1N2IA 3INGA 3FKJA 1RS0A 2EIXA 5HKKD 3ZJUA 1OH7A 4G56A 3LKDA 3WX0A 5AW7A 2NU6B 1EJ0A 3H8WA 2PE5A 2D0PB 1QRRA 3H1FA 2QV7A 3T7CA 3ZE8A 5LZ9A 4J4TA 2PYZA 3D6AA 1V6AA 2V65A 3BL8A 4QVIA 5FFMA 4IS2A 2RKWA 4R6WA 3A8TA 1JTVA 4IW3B 4JWKA 4Q4LA 2Q5EA 4I6JA 3TR0A 5JANA 3GHYA 2WPDD 5CTAA 2PK3A 2Y2VA 3HV2A 1W2HA 3RVOA 3B2EA 2O20A 2MR5A 2Z9CA 3DL4A 3LQQA 3MAGA 2OAEA 1WMDA 1YE8A 4Z8XA 4E5VA 1KDRA 2XYHA 5JQGF 1O8CA 3G0IA 1ZIPA 5FOTA 2QRLA 3QKTA 4WOCA 3S5UA 4CMGA 4YUYA 3ADKA 2DQZA 3HGQA 4KLCA 3OU6A 3SSOA 1OU0A 3TXAA 3R3XA 1GZ4A 1KSGA 3KSMA 4AUKA 3NATA 4URYR 1RTTA 1BN6A 1NDHA 4YP1A 4AKSA 4CGYA 3IIJA 1L5OA 5JBIA 5CXQA 3R3WA 2RGAA 1ZEJA 3KXDA 3REFA 3AJDA 5JXGA 1C14A 1NP3A 3WLEA 4PZPA 3SQNA 3SSAA 2QYSA 1ECCA 1F2UA 1TD1A 3KAQA 5TS3A 1TO2E 4L3OA 1X70A 1GZ3A 2Z8YM 3RPEA 2JCBA 3OZTA 1QFMA 1HBJA 3HXQA 1UP7A 4KXVA 1QKIA 1UWVA 1EA7A 4FLEA 1YK1A 1G21E 3TAUA 4QZVA 4D99A 1H4SA 2WDPA 3DM9B 5J40A 1QAOA 4ANFA 4R2WA 4CF5A 2Z2ZA 1THTA 2RG7A 3FTCA 3AY7A 3M6WA 1T4MA 3MWJA 4P7JA 3Q1LA 2IK8A 3CNQS 5DXAA 3ZW8A 1NAHA 2QJTA 4J7AA 1DKNA 4QOFA 4WH0A 2OV2A 4H6WA 2R44A 4JU8A 2OG2A 3TOXA 1IXYA 4DV4B 4KR2A 1P2SA 2C9OA 5FUMA 5KJ6A 2IHYA 5KYUB 2QTZA 2LP4Y 2Q3LA 3H3XA 4TTIA 1JNYA 3UICA 3VO1A 1Q15A 2VUHB 1Z45A 2HSEA 1MABA 4WKCA 5EJEA 1XZFA 3HVIA 1G66A 2YN0A 3C5EA 4PTLA 3D3WA 3K5HA 3WIOA 4E0BA 1ZI9A 3TXXA 2E89A 4TWBA 2Q5FA 4XYLA 2QB5A 3M3DA 3WV4A 1R6DA 1FQJA 1U1IA 4JJKA 1D6JA 2AMYA 5DYYA 2AWOA 4NCNA 4CQMD 4YRKA 1UKBA 2O8DA 1NJ1A 1OA1A 1OHHA 3IVMA 3DEIA 3KLNA 1AS0A 3OESA 3E7DA 4MLZA 1YE3A 2Q29A 2ZITA 2B92A 1R6BX 5AW1A 2FWPA 2XSZA 3AJRA 3GMSA 1JSLA 4LE2A 4FFPA 3GLRA 4Y2UA 3TRFA 3CLSD 1HETA 1KIFA 3BMQA 3IEIA 1T9HA 2O7NA 2WG1A 3T61A 3ZYZA 4EKGA 1KARA 1NQ5A 4FCTA 1G291 5SY4A 3UT5B 1R6TA 5JY6A 4GM4A 1HY3A 4HNHA 1U1FA 3PR1A 1Z0AA 4HI0E 4TM8A 3THOA 3VYRB 2DU8A 2G63A 2N47A 2QE7D 3DVQX 2Z3ZA 3N2LA 3TGWA 1H2YA 5I45A 5D7BA 4BNVA 1WB9A 4EI8A 4YRDA 3NHMA 2PQ2A 3W06A 2AJ8A 4TT3D 2ZUVA 4XX0B 2GYWA 3LQ1A 3ZDQA 4EA8A 2CNWD 2W7TA 3I2KA 1TM7E 3DKRA 3VAZA 2OQ2A 3QUAA 5EE3A 2VWQA 3OCWA 4L5JA 1P2GA 3ZWQA 3LCCA 1JI3A 3OWXA 1WUHS 2YCLA 4JI5B 3NVMB 1P19A 2YNMA 3SX4A 3DPIA 4L3VA 3HCRA 1XCMA 3GFRA 4GMDA 3K71B 1F8GA 1O1YA 3LXUX 3EPKA 4YUXA 2TECE 2BFEA 2BEKA 2C5HA 1XKXA 4KPUA 4LHXA 5FBWB 3OP1A 3PEUA 1B41A 3WADA 1NBEA 1CFJA 5JSUA 1U3VA 4GXTA 3VV2A 3F90A 3GI1A 1UZUA 4K1XA 3EF3A 4XUEA 1XB2A 2AZMA 1T3ZA 2VJOA 3A7DA 2DC1A 5CJJA 4ZAGA 1VC2A 1TB4A 1WHSB 2FW8A 2KBFA 4QFBA 4M1QA 5DWVA 1QHGA 1KPIA 5CH5A 1ZY2A 4AL4A 3WK7A 4GPZA 4J07A 4JSRA 1LJLA 1MTZA 2FW6A 3GH3A 1E63A 3IURA 2J0VA 1CF2O 1ZCFA 4MSUA 1LDEA 4HQFA 2G7MC 1UMCB 1K8ZB 1V47A 1Y3CE 1XVVA 5EP4A 2XVMA 4KK3A 1H9BA 3FUUA 4X0EA 4H4EA 3ZD6A 4IVRA 1KJIA 3JQAA 4R2HA 1CUZA 3WQRA 4RFVA 2V7UA 4MULA 2QSUA 1XTPA 1DC7A 4IO1A 4FKZA 2B82A 3WB0A 1ZJ6A 4N7BA 1TKCA 3SNHA 2HJRA 3ORSA 5LXTB 4QXMA 2XQIA 1EVIA 1OIWA 2Y0EA 4GNRA 4MWSA 4Q93A 3VHLB 1CT9A 2UZ3A 3V55A 1ICIA 2OD9A 4WGFA 5BV7A 3O8RA 1N78A 5IKMA 1KRXA 1RAHA 2GJAA 2PXHA 1T13A 1ZC4A 3NONA 2D54A 2Q0QA 1DTWB 1O4VA 2H59A 1OXSC 2AE1A 2BEVA 3H2YA 3I9KA 3LCJA 4AY3A 5GZ1A 3DUFB 4LJSA 5AKZA 2RH5A 3VGPA 1AQYA 3BQMB 3LBNA 3TEFA 1T9ZA 2AHOA 4LQDA 1NIJA 1ZD2P 2HM7A 3H42B 4ILKA 3ETGA 3STYA 2WYVA 3BXHA 2P9ZA 4MAMA 4C4OA 4PGGA 2C7OA 2NUPA 3U4CA 2P77A 4Q9DA 4S0ZA 2DM6A 3ZGLA 4P7BA 1A7UA 3H0EA 1S8FA 3EVBA 4D9NA 4BJ1A 3E6AA 4DPKA 4ZHQF 1LPBB 1XWFA 2OO5C 3C3MA 3SCZA 4AJ4A 3O93A 1OGYA 4LK2A 1KA9H 1ECLA 3VTAA 2ILVA 4L95C 2JVJA 1KTVA 3LSYA 4U3JA 3FB4A 1VJDA 3R3SA 1I9CA 2WIBA 2QT9A 3UV6A 3BD9A 3QKSA 4L6AA 1NNI1 3L0ZA 3IIIA 4DQKA 9ABPA 1FQOA 3C41J 4OGLA 2E4UA 1E0AA 4ZJZA 2RHBA 4X7PA 1VMIA 3D6TB 3F2VA 4F4UA 2GZSA 1ZL0A 3AW8A 3NKLA 3RWMB 4M9CA 3ZQUA 4TUYB 5JJKA 3E70C 5LMCA 4F4HA 1X8LA 2QR5A 3R6LA 4IIVA 5BOSB 2ZBPA 4XSHA 3ZHZA 2ZXFA 1AU9A 2XEXA 1Z5UA 2I7VA 1E99A 4JI1B 1IWOA 2XCIA 2IXTA 4C5CA 2B99A 3E5MA 3IUNA 5E0OA 2GD1O 4PQEA 2H1FA 1P3DA 5E4TA 5L8VA 2IYVA 2X9VA 5LA6B 1Z0SA 5MFPA 3OEYA 3M0EA 2D1RA 3TRKA 3FNHA 1N6RA 4LPKA 2I6FA 3UH0A 4V0OA 4ZVRA 3BRSA 4QG7A 4CZ2A 2A4MA 5AW2A 3K5IA 5E6SB 4MWDA 2GZ2A 2ZSHA 1I7SB 4HL6A 4DLTA 5ALSA 4KFRA 5JYBA 3AI2A 3EGXA 3D8HA 1M2OB 2AOVA 3O1JC 2Y76A 1AQUA 2FW1A 4J2TA 2PNJA 1KI6B 4N5HX 1RQPA 3WXBA 2CNLA 5KMGA 3OX4A 2EQAA 2Q3MA 3GJ7A 3KOMA 5A3SA 2FYTA 2PX2A 4Z0TA 2Q3JA 1UPUA 1C1YA 2CVQA 1J0EA 4WT7A 1IWPB 2PQ0A 3I9V6 1K2WA 3MWYW 4FGLA 4IVQA 2BAGA 4MRNA 2VOJA 3I04A 4Y1FA 2J48A 2ZI5A 3FSEA 4GFDA 1D1QA 1WMAA 5AI4A 1FX0B 5FD8A 1NE7A 4BVFA 2NU6A 3UKJA 2C92A 2XLCA 1Z82A 3HZZA 4QQFA 1SKUA 3Q98A 1EM8B 1PV2A 3PQ8A 4O08A 4F12A 4MO9A 3GT4A 3L40A 4KQXA 2YXNA 3USES 1EFKA 4RK1A 2JFWA 1TT7A 3GLUA 3CEPB 3JQ7B 1TC1A 1VE9A 1Z33A 2ZTMA 3K94A 1P3Y1 1KFCB 2L19A 2PZFA 3B53X 4IDBA 1MVOA 1DO2A 3A2LA 4YP9A 2JFFA 3CCCA 5K0GA 3WNCA 1DTEA 3WOHA 1DI0A 1MU0A 3VC7A 2E6KA 1QCZA 2JAOA 2RHOA 2VF7A 1ENYA 3L02A 1ONBA 2ZYIA 4HTAA 4DLKA 2N1BA 5BYBA 4P22A 3GROA 1XZIA 2QROA 4KQMA 3KEFA 2OK7A 3FNIA 3S68A 4FC7A 1P9NA 1DUSA 2FE1A 2X1MA 3I5MA 3KLOA 3PGMA 4MCAA 4MYUA 2AZTA 2CJYA 5BNZA 1Q0TA 5JCOA 3V2GA 1T2VA 1HDOA 4OGKA 3ZHBA 3HXKA 2P2YA 3U9TA 4OB7A 3W77A 1U04A 1CRLA 1J70A 2OL4A 2CL5A 2O8VA 3WGKA 5L3VA 1CJUC 1U2GC 3O38A 3GJYA 1PZNA 4BX9A 1NBIA 3NO4A 4TWIA 4LFCB 1PJAA 3EPRA 3I01A 3JAWB 1VE1A 4E6EA 3CUSA 1L9KA 2NVBA 2ZM5A 1ITZA 4MWBA 4D96A 1YHZA 1AUVA 3BA1A 1DAIA 1C7JA 4DLYA 1AOXA 4M49A 4OQLA 1NR1A 1M7GA 5C34B 5TQVA 1RE1A 2G9QA 2D74A 3I9V1 4L8GA 2ET6A 3OEWA 3ZWKA 3F96A 1DU4A 1QLWA 2HNBA 1A27A 2JIPA 4LC1A 1KE2A 3EVEA 4BN4A 5ICSA 1ZXLA 3ANMA 5KYUA 1WEHA 3BL6A 1V0JA 3IBCA 4HLCA 3RVKA 3T1VA 3WRYC 2WLTA 1DELA 1Q12A 2Y1XA 3W9SA 4LJ7A 3GLIE 2UYCA 3E3AA 1XYVA 1RIIA 3KQHA 1VHLA 4EFDA 5EGSA 3OCVA 3FTPA 3DLBA 4MB0A 5ELMA 1T10A 2KE5A 2WKPA 2Y0CA 2W8ZA 1XZKA 2CXUA 2F3UA 4PO3X 1HQKA 1UMDB 4WMLA 4MQ5A 1I3LA 2F2TA 3O82A 5AJWA 2X5XA 5TX7A 4GIBA 3WBKA 3U09A 1UK7A 4R8KA 2IV2X 4EJMA 2ERXA 3K96A 1A0OA 4EHHA 5HQTA 3LDGA 1NJ8A 4WXEA 1WUYA 5CK5A 1D4AA 2QI9F 2VP2A 1F4VA 3OIFA 1R6AA 2DXIA 4Z4GA 4HLUA 5F1OA 2OBMA 2PRZA 1XN1A 3ITKA 3UHOA 2D2IA 2PUHA 4GYJA 3UT5A 2KBEA 4Y0VA 5KDLA 4CT5A 4EMUA 4F2HA 2MU1A 2EQBA 3UW1A 4J1NA 3ZV4A 3LHKA 4PINA 2DHQA 2JEZA 1LK7A 3A4VA 3P71T 4TMKA 1LTQA 2WZCA 2B2CA 1N3YA 2ZRMA 3AHCA 2C00A 1SA0B 2PZLA 2VR1A 3IP9A 1FEZA 4FN5A 4XX0A 1EB9A 3EW9A 3WK9A 2Q41A 2A86A 3GK3A 4WK6A 3B1ZA 3KEQA 3P97A 1M2VA 3CBGA 1KEUA 5EUCA 3MWKA 4QGSA 4KQKA 1TVCA 1NX6A 2WD9A 5JQWA 2BVNA 2HH9A 4BNIA 2ZVDA 2VSFA 2AXQA 3O2NA 5EAIA 1SBHA 1C7RA 2H51A 1WXGA 2PTGA 3MWDB 2J9FA 2A33A 1Y7IA 2G72A 1RAIA 2Z5GA 3H16A 4OQDA 5F51A 5TSDA 1YJ5A 1DJPA 1FDWA 2YZNA 3GLQA 3K09C 3QLJA 2BGNA 1TUBB 1ADFA 1KDTA 1TADA 2VDNB 1U7PA 2X2FA 1SJ9A 5E2AA 3L93A 4WCFB 4NARA 1WHSA 4BYGA 3EPJA 4G81A 1A4IA 2NT4A 3FXAA 3QZUA 3WLJA 2QQGA 1X8JA 1QSGA 2HU2A 1W52X 2ENUA 2VWPA 1GLVA 4NV3A 2NNWB 4XKJA 2R8EA 4O4IF 4XI9A 4AJJA 4DIBA 5A4MS 4CXMA 2G06A 2I8LA 5EJGA 4LTMA 1UMCA 2FMKA 4CIAA 3DL0A 4XAQA 1PUIA 4G41A 2EDCA 1S2MA 4OMFG 5U1PA 3UJAA 1Q7BA 3KHKA 5IRCD 2HF8A 4EY7A 1H0SA 1OILA 3AR8A 2WY2D 3ZBQA 4IXMA 1UBOS 2VYVD 1GSIA 4AIRA 4XLLA 2QF7A 4BV8A 2FPUA 1P1BA 5LXTA 4HKTA 2ZSDA 3TUJC 3UV7A 1G5TA 3GX1A 3GYGA 4ACBA 2C4HA 3VPSA 4LI0A 1E59A 1QNLA 3DJYA 1E4OA 1JBQA 2PGLA 4IIHA 3L8MA 2VH5R 4AQ7A 1WW2A 3BEDA 3UHJA 1QDLB 3AIKA 4R1OA 3EDQA 3GUVA 4AS1A 3I4FA 1X15A 1DTWA 1YVEI 3UF0A 4NE7A 3TJMA 1ZNWA 3DUFA 1HTBA 1ZG3A 1S9DA 3D4BA 1M7BA 1T1SA 1RHMA 1GGKA 2RH4A 5D6OA 1NWHA 3CNHA 2BY4A 5DOZA 2XVZA 4GLJA 3RNLA 1U5AA 4R9NA 2J31A 4HADA 2QXTA 4XJSA 2FN3A 4QNRA 1FVXA 1VGVA 4K81B 1KNXA 4PO1A 4KMMA 3ZHYA 5IM4A 2WWRA 4P2GA 4DBZA 1N34B 2YYZA 4QXPA 4B4WA 2ZVQX 4LOIA 4M53A 3RS2A 1U8ZA 2CV1A 3JD2A 1CZOA 1R3DA 3L7IA 2LXNA 3RSOA 3NB0A 1UBMS 2R7KA 3X0DA 3PNVA 4GVPA 4AJNA 5IT5A 5K8LA 4B4VA 1IULA 3B7WA 4LWPA 3JQDA 2PD6A 2VDPB 3MAAC 4TS4A 3WIVA 5LSAA 1WNFA 4GX5A 5DN6D 1DT3A 1J21A 4JEMA 4OHMA 4BQNA 1C5KA 3ONDA 1EGVB 3FPAA 5IK2A 3GEEA 4MEBA 2HUPA 2WJ6A 3NEYA 3RIYA 2X3FA 4A0QA 5MN4A 3W5AA 3KZNA 3CLTD 1YFKA 1AGYA 1PN3A 4NG5A 5CNMA 4OG2A 1HE2A 2WSMA 5P21A 1Q22A 4TUYA 5E4JA 3LZCA 3WP0A 4ONEA 3U61B 5HKLA 4KX3A 3PNKA 5CA1F 4G5XA 3MGCA 4IVPA 5B1SA 4L5BA 4WY5A 5AW9A 2CSUA 3Q2KA 5BOSA 2XBMA 1Y6RA 1RXSA 1C29B 3RDPA 2ZPUA 2R2GA 5IEJA 3CLTC 2WV9A 2WHRA 1PCXA 4ZI7B 1N2CE 5LA6A 3GY0A 3ZHXA 1XZPA 2C04A 3BJRA 1N57A 1T34A 4RA6B 4AP9A 5K45A 4Q3KA 4PNEA 1BGVA 2NZ8A 2O2CA 1UOOA 4GOLD 4ZICA 1GLNA 2FQ1A 3MT8A 4FWBA 3URMA 3WXMA 1ORRA 1E6KA 2ERCA 3I2GA 2EF1A 5E6SA 4G0UA 2AOUB 2VATA 5JSQA 1M2OA 3OPVA 5G40A 2QTCA 2UAGA 3UWKA 3DH0A 1DFHA 1EQAA 3LPAA 4IGEA 1TECE 4F4IA 3CKYA 3HNRA 3QG5A 4HGQA 1OTHA 4EMSA 5AUQA 5B5SA 4CTNA 4GR9A 5EE1A 2M6SA 3ST7A 4DCNA 5HF6A 1FDIA 3ZOKA 1R1DA 2IP1A 2GEBA 2D06A 3LYUA 3IMCA 4OAPA 3KQYA 3KR1A 1W8DA 3I3OA 3U44A 3E9EA 2IZOA 1QZTA 1SC6A 3CA8A 3IXQA 3K53A 2NM0A 1GYPA 4KO4S 1FX0A 4MKHA 4ZHQB 3GOQA 5FQOA 5I9LA 2EFHB 5I7WA 2H48A 4NZOA 1RYEA 4L07A 3CEHA 2JLXA 2CC2A 1UBUS 1WETA 1RYFA 4FM9A 4EDHA 1MOQA 2KM1A 2X7XA 4C7KA 5IYZB 4JJEA 1E2GA 4GEGA 3JQ7A 3D0KA 3UMJA 2F55A 1ACJA 2YICA 4D80A 4MTCA 1WULS 2QR3A 4FCCA 5FYDA 2TMDA 5A9RA 4I81A 4AJHA 3OQ6A 4JI2B 4ZQFA 5DCWA 3EZFA 1R4NB 3QXCA 1H85A 1E5TA 1SXJD 4MEJA 3TOVA 5BYKA 2NXNA 1YULA 3UK6A 4QHTA 4BJ6A 4P53A 1QFZA 3HWWA 4R7GA 2C5AA 5EZYB 2VN8A 3RK1A 5HX7A 1KFBB 4H7PA 3COZA 4FKMA 3HVRA 2KYRA 2WNHA 3L79A 2ZSUA 3LY9A 4JX9A 3LLSA 5DNYB 1UUFA 3S2SA 4GP6A 2JAPA 3ESXA 2XMDA 1QF7A 2MINB 2QM8A 1LRJA 2VDKB 3L6BA 4ZVMA 3UMVA 2QD4A 4Q1FA 1QV7A 3EIWA 5KI6A 4EX6A 2VNJA 1E2EA 5IJ9B 1TX4B 5D85A 4OHXA 1V5GA 1WJGA 1JZTA 1N9KA 4DYDA 4AXBA 4N18A 3K70D 1A97A 2C2OA 1Y9AA 2PRIA 3B78A 3DMRA 3HCFA 4EOGA 1IIRA 2AEEA 1YDEA 4O0LA 2WOJA 2QVZX 5DTEA 3DPUA 2HK7A 5KVSA 1AXGA 2KPOA 5JECA 2OFPA 1SFRA 2JKZA 4QYIB 4MGYR 4I1SA 3I1YA 3TFOA 2JAWA 4F72A 5AVTA 1ARZA 1VJ5A 3KHUA 3UC9A 4F2DA 1JHOA 1PVVA 1ZK2A 3K70C 4REOA 2YNMC 2EFEB 1NXTA 3D2LA 4ZZ2A 4YHHB 4YAUA 4NU5A 3A1SA 4BNZA 2RHDA 4L50A 4MUHA 4P34A 3FRHA 4F5WA 5AMXA 5LUBA 1FXWF 1U65A 4HJXA 2C03A 2I4TA 4ND5A 5EQDA 1HDEA 5EGNA 1JTFA 3FHTA 4PXYA 3O0DA 4A7PA 3RSHA 2O2XA 3KK0A 3MLBA 4KDCA 5LOVA 1X9IA 1GZSA 1NHWA 4PVCA 4BPRA 5IVHA 4HS4A 3IPAA 3ABZA 1B8VA 1ZK3A 1JEDA 3BSWA 4REMA 1DAHA 3TIGA 3KWJA 4FT4A 1DAFA 1DEHA 4Q3BA 4E88A 3HFJA 3QFCA 3OZ7A 1XDZA 3I8SA 4Y8VA 2OESA 1AKMA 4D98A 1YE5A 1MTOA 3CO0S 4BE4A 5IXJA 5CDYA 1VRWA 5EHZA 4R2LA 5KNDH 3R7LA 4JL8A 4MWZA 4YROA 3AJEA 5HFNA 5DP2A 3CH4B 3PPWA 3Q12A 2I78A 3QX9A 4P83A 5D3ZA 3RVRA 3U40A 3VU3A 2X58A 1VZ3A 3ZV5A 1QK3A 1SOVA 2EGHA 3SX2A 4RTSA 4HK4A 3VUEA 1SA0A 4A4DA 1PWHA 1JG4A 2I54A 4NH4A 5F12A 2ZAIA 3TTSA 2WJWA 2ZUSA 3OSUA 5K0BA 4JYBA 3ZE1B 4HDSB 4Z9XA 2X8BA 2VZEA 5E6RB 2XVXA 5LMZA 1GT6A 1X7HA 2VP6A 3AP3A 1BC5A 3ASZA 1DOZA 4X64B 3R6WA 5CB4A 3P0JA 4MH0R 4OHYA 3PRJA 4KFUA 4XB2A 5CGQB 4D0NA 2B8WA 2HLDA 5JZ9A 5IPFA 5DYIA 3LWBA 2WWYA 1BMFA 3D02A 5G0TA 3T5PA 2JCVA 2B61A 1TUBA 2K2QB 4BMVA 1HLGA 4YWJA 1SQ0A 3EDOA 1TW3A 1M1XB 4WCFA 7MHTA 3EA0A 4PTZA 4YK7A 2YHAA 1NE2A 5JO0A 2MYTA 4IG4A 3R23A 1TF7A 4WDRA 4G36A 1KKMA 1ZU5A 3ZV6A 2GVDC 2DMRA 4BATA 2DZDA 1UXKA 1WO8A 4QO7A 3TJZA 3CNOA 1NW8A 3T0FA 4Y6OA 3W5JA 3IA7A 4RHTA 2GMWA 4PFKA 3VC2A 2QBYA 1OI3A 3PGLA 4D46A 2QD1A 3W2FA 2FPWA 1DS6A 3DZCA 2WP0A 2UZ1A 3QVUA 4M0PA 2H0QA 4MV7A 4NCJA 2P40A 3O2SB 4UCWA 2RJOA 3U0BA 2PUBA 5KWJA 3A25A 1WA5A 1PQYA 2FEWB 4PCLA 3HCOA 1FRNA 2JJ8A 1RZVA 3OCZA 4KWIA 4B4UA 4IHJB 4RKYA 1UBSB 5K2MA 3HU5A 4FSDA 1A1VA 4AZVA 5CP8A 3PPXA 4JXZA 4LK3A 4RMHA 1O7JA 4Y9SA 3UENA 1WWKA 2OLKA 4X6YA 4DCVA 3OG9A 4JB0A 4GM0A 2DJIA 2DBRA 3IXMA 1AN9A 3OM8A 1PYGA 3EGDB 1XRMA 5LKAA 2HWKA 4V38A 2ZWMA 4A5SA 1FNBA 2KLBA 1WX1A 3F5SA 5EIAA 1SOMA 4ZYLA 3AI3A 1OZFA 4DAEA 3OUUA 2JAHA 5LP1A 1VPTA 4P58A 1DMSA 4I9NA 5HZMA 1NMXA 1OWPA 3CY6A 1JVBA 1JKJB 3D1VA 2AFHE 3BFXA 3LHDA 3PX3A 4JR0A 4L0CA 1MO6A 4PG8A 1SKYE 3MWFA 2CY0A 3RVSA 2D7JA 2Z2KA 1XWWA 3A27A 3QU5A 4PSDA 4XD7D 1V95A 1P4AA 2ZKIA 4XM2A 3R7DA 2VO1A 3OZCA 4CLHA 2C97A 2KSQA 1AKRA 1RLUA 3DUWA 4LCEA 3W9UA 2HL6A 3AUFA 3I30X 5LU9A 2IW1A 5JNSA 1H2WA 4KQ9A 4CIYA 3NDBB 2IHBA 4PQGA 4QFDA 3H5OA 2ZB8A 5J58A 1YZFA 4I9UA 3UO8B 2MOKA 2P9JA 2FMXA 3ZCRA 4V02A 2XA1A 4JQYA 4MVJG 1U1GA 4H0FA 1Q7GA 1ZAKA 3WJ2A 3LDUA 5DO9A 3AVWA 3VH1A 3HZRA 1J1IA 1JIKA 1V8OA 2B1JA 2FUG6 3X1ZA 5CD9A 2FGKA 4LDAA 4Q5IA 4R41A 1LBSA 1LW7A 2R1VA 3W05A 4CMIA 1NN3A 4LZLA 3VKFA 4YJ3B 4BO3A 1KZYC 3DMYA 1CW2B 2DJ5A 4G5SA 4PZUA 4AMVA 2AV6A 2CXNA 2WQZA 2ORVA 1KRHA 1RQ7A 1WB5A 2PZ8A 3R9IA 2Z8YA 2IODA 2FR8A 1ONSA 3K3PA 3QV1A 1TAQA 3WFIA 5JCOC 1JT2A 4HATA 1K5HA 1FYFA 1SCAA 2GNPA 2A8YA 2XMZA 4KXYA 4Y1GA 5E1BA 1PEYA 3B13B 1PFKA 2ZIUB 2HGSA 3DO5A 1W5TA 2AOUA 3ECCA 4M8LA 3MTIA 4Q18A 3MILA 4Q6WA 2XEDA 5E8JA 2PSDA 3PJGA 1IBKB 1LF0A 1IVNA 1VL6A 3SBOA 5JLJA 5T64A 2C9CA 5KKAA 2FPGB 2JIZD 2DT5A 4KQEA 3GCGA 2HWUA 3O0TA 2H08A 4EKDA 1QNFA 1N6OA 2F9MA 1H5QA 3KKOA 1OZGA 3WV5A 2VJCA 2R8PA 1YQQA 4E1BA 1FFSA 2EKQA 3ET4A 4OHBA 4BGEA 4BMNA 1NUPA 1TMKA 4EJSC 4KMSA 4R81A 2B25A 2IXGA 2PBFA 4ZVNA 2I76A 3LPMA 2WYIA 4RD3A 1FFHA 1QYCA 3HUUA 3QUQA 4ZHQA 4GC9A 1NVXQ 2IKQA 2VNIA 2V5AA 1MR3F 5FJJA 2VPZA 1H8ED 4UUMA 3PFFA 3MM4A 3ZE9A 3OQMA 1WZUA 3DLCA 4LSGA 5B37A 4GWGA 2JJ2D 2PBRA 3HCAA 1LNZA 4FZ5A 2OFWA 4X24A 3V8RA 1D4FA 3NORA 3ZZ1A 4YRRA 1X0XA 3E7FA 4LUCA 4BIMA 1RWNA 1QQBA 1BU5A 3RNOA 4JXKA 2IEGA 1MGPA 2FUG1 3NDPA 2HT6A 1DVRA 1D2NA 1E60A 1WXHA 1XVTA 2IOFK 4E11A 5KNBD 5D6NA 5I9TA 2WR8A 3HJRA 1ZIDA 4GG1A 5ILGA 1R4NA 1F4PA 2FWAA 1UK8A 2R11A 4MWCA 1XNQB 2HXYA 5TVKA 4YV2A 3BL5A 4XM0A 5DNEA 5FBQB 4YQYA 5EZYA 2C59A 3RI3A 4LY6A 4BY9E 1YRBA 4HQKA 2YMQA 1CR1A 1M2FA 2G82A 4OJMX 1ENPA 3CF6R 1TIBA 2AJDA 2B9EA 5IAEA 1THZA 3HCCA 2XTZA 1JKIA 1GPUA 3JALB 3FZYA 1JLSA 3MYRA 2OYSA 4XWAA 5TDHA 1NBMD 4HLUC 4A0FA 2MINA 2WEKA 2X5OA 3HVKA 2Z57A 3JWPA 4YC7A 4EHAA 1T6NA 4ABYA 3JRNA 3EWNA 3L8FA 1IUKA 2PT6A 4I7EA 1ZXBA 1P1JA 1Z8HA 2J3LA 3G2QA 3AV0B 4P3NA 5IJ9A 3LT0A 3JZFA 4Z4FA 5HUHA 3IYLW 4BZPA 1G7RA 1DZ3A 3LK7A 4BP9A 1P61B 2F4NA 2OHVA 1OXBB 4L0MA 1FU7A 4RBNA 4EGCB 4QL3A 1BVRA 1J2YA 4QYWA 2ILTA 4GMGA 2CXPA 1L4EA 4DMUB 1LPNA 2DG2A 2P4QA 3THSA 4U9IS 2JJYA 5BWMA 2JI6A 4NBUA 3ZJ5A 2Q9CA 4X93A 1I4DD 4J1SA 1JLHA 4EKNB 3MTAA 4BBAA 1Y8RB 3MLAA 3R9XB 5KOIA 3BK7A 5GZ6A 3RADC 4B2LA 5FXMA 3S70A 4INOA 3UA4A 3ZYCA 3VX3A 4RGBA 3SR4A 1BD4A 4ER5A 2C20A 3AHFA 1HNWB 1SUEA 2FPRA 2HMWA 2X0DA 1Q1NA 4V0ME 4M9XA 3VH2A 4UBJA 4HSGA 2C2XA 4PYLA 1TPZA 1ZSVA 3PHIA 1NQOA 4M54A 4K9LA 3GEGA 2WG2A 2G9NA 4C1NA 1P44A 3STTA 1RCFA 3STWA 1J8YF 3VO8A 3NP7A 2FQQA 4LWZA 1EVZA 1HE4A 3OEHD 5CHEA 5FOVA 3URKA 4R1PA 3GLHE 4TRNA 1J0XO 3FPKA 3PVSA 1JE0A 4CHGA 2Z1MA 4G5OA 4ITUA 4CHTA 1KYYA 2H7XA 5CDSA 4QPPA 2FCAA 3IOEA 2DECA 2Y0DA 5CD1A 4LJLA 2QUJA 5FPPA 4OQFA 3EQZA 3ZUGA 1VG9B 1BQEA 4EVRA 2FN4A 4KW7A 2DETA 3R74A 3MWEB 2C58A 1OTYA 2O3QA 4MRAA 3UQZA 2ODTX 3FLAA 3ASVA 1E9VA 2V3WA 4WN9B 5CLGA 1YFLA 1YDWA 1YRWA 1KHTA 2P9FA 2X1LA 3KT8A 3CVXA 1M1UA 4HDSA 1YCHA 1PUXA 3IQEA 5BWOA 5E6RA 2MMGA 4ON9A 1DQZA 1T8YA 2WIGA 5IJ0B 1JIQA 2HWWA 2GD6A 4IH1A 2IYXA 2ODAA 3K2QA 3Q0IA 5ITZA 3BMXA 2HLPA 1SULA 3A32A 3H17A 1KZ1A 1M3SA 3KTFA 4MV4A 4DC1A 2PEZA 3DEHA 3ZDRA 3HBMA 4JHXA 1Y7PA 1QRUA 1TJ3A 2NAPA 2TSYB 3GC6A 2WVGA 2Y68A 1FFBA 3CNEA 3GNTA 2VRWA 3K9BA 3PSAA 4EW2A 5JMWA 4RYLA 4W5NA 3X1YA 1JMKC 2C8LA 4K46A 2HHJA 3CJQA 2CYAA 4H18A 3VBEA 3UATA 4ALIA 1EWQA 1ODJA 4EY5A 2W6MA 5A1TA 1BFDA 3RH0A 4F96A 1FZTA 5CYFA 4DJAA 3F71A 1V25A 3PDIB 5JJLA 4BNMA 1BHSA 5TT1A 1OLUB 3PKIA 3UJNA 3BBPA 3IOMA 3R8CA 3GA7A 3IUSA 4HNUA 4BU0A 1JI0A 2FEPA 2VF2A 1B00A 2CCJA 4G8JA 1V3TA 1H0RA 1VA5A 2CCGA 4E13A 1J6UA 2CKMA 3CPSA 4IHJA 4DM4A 4X6LA 5LQKA 3ODPA 4GLLA 3OMXA 1Z8FA 3DEJA 3CZCA 5IKOA 2OGZA 3IHWA 4N01A 2PHZA 3V3TA 2GEUA 3NAZA 1KMIY 1L4GA 4KFSA 3UOWA 4H7JA 1OXUA 2X6RA 5DBHX 5LB2A 2I71A 2RK3A 2FN8A 5HBRA 3EGDA 4NU6A 2PS0A 3JR7A 1GZ5A 2ZS9A 5CMLA 3DTNA 4NOJA 4MS4B 3W34A 1PD0A 4DRZA 4DRXB 1W0KD 3J7TA 3G59A 2I4RA 5AI0A 2VJKA 1W0JD 3TLCA 3WWZA 1JKJA 4ESHA 5H83A 5B36A 4LRWA 3DBOB 4M22A 2IHNA 2GB4A 5ES3A 1VA4A 3JVEA 3DCNA 4TKVB 4W82A 5F4BA 2P90A 1L5MA 1DTSA 5JG7A 1ORIA 1JA9A 3HA3A 2QJRA 3BIJA 3WGLA 4E09A 4RZ2A 5DK4A 2AKYA 5HSGA 1WAMA 3WKCA 4Q9NA 5HGJA 4OXYA 1GA4A 3MPUA 2VIIA 1B43A 3FPBA 5HQ3B 2YV3A 8ADHA 1XZMA 2VJBA 1L7XA 5AM0A 3VR5H 3E03A 1KY3A 1NMEA 3L6UA 1VDMA 1WY5A 1K27A 4FFSA 3RU9A 5LP6F 3T3OA 2AG8A 4X1KB 4V3BA 2ESRA 3MOSA 3U3MA 3ND9A 2J7KA 3WMGA 1F9AA 3GB9A 3TNLA 3D7NA 1ABFA 1PDWA 1IWBB 1I4LD 3SC6A 2IH2A 2CVFA 1YHYA 1NLYA 2CHUA 3WBFA 2FHSA 4R05A 5BSFA 1AF4A 5G3ZA 4INAA 4YJ3A 4YQZA 2Y77A 2F1RA 4KQGA 1FVHA 1I7LA 1DHTA 3AM3A 3LXMA 1D9XA 1RNLA 1Z0ZA 3RU3A 1NNEA 3PHGA 1EDBA 4MVJM 1GDDA 2FZ5A 4GRDA 5FTWA 4OGFA 4WOBA 4AX8A 5IFLA 1ZGCA 4XW2A 3ZEAA 3TX6A 1AXRA 2QHXA 4GR5A 4ZZIA 1GRNA 2DTDA 5EWJB 2C5EA 1DADA 2LIPA 4IX1A 4ZDIA 1Z18A 4XR4A 4Q16A 4S05A 2J6BA 2YWCA 4EZBA 1GSOA 1RQXA 2EGUA 2FPGA 2OCGA 3T9BA 3W90A 4ZDKA 1ZDMA 3ZDZB 2Q3HA 3RC7A 3TIFA 4GS5A 1BFKA 3ED1A 4PLGA 3NWBA 1B0AA 4E5KA 4BQSA 1Z6GA 3KWMA 3MGGA 3EG9B 7GPBA 721PA 1JLKA 1Y9DA 1X7DA 2DH6A 3DZKA 4X8LA 2P2ZA 4EITA 3GNQA 2OHFA 3W5SA 3V1YA 3PXEA 5DHRA 1GDTA 2V1UA 1KOLA 1B14A 1XMPA 4NYMQ 3FB1A 4YBZA 3MT9A 4J0EA 2VDLB 3ZNQA 2FK7A 5KWVA 4QHYA 3FCXA 2OILA 4UOZA 3FI0A 4BWGA 5JI3E 1RP7A 3I4LA 4ZZ1A 2C4MA 1OLSB 4QULA 3NFRA 3VH4A 3NYRA 1QE0A 2P79A 5TQJA 5IHPA 5EZSA 1DIAA 1TA9A 2WIDA 1CSEE 3GJSA 3RBXA 4BO0A 5HMLA 2X41A 2C0CA 1XZEA 3EDCA 2CFSA 4L28A 4Z0NA 1VYTA 3RFVA 3V1KA 3BF8A 1FFCA 3N39C 3M4JA 5F3RA 5JVDF 4GT1A 3QMMA 3TKAA 2FG6C 1IZYA 2IHUA 1P39A 3WSVA 3JR3A 4UU0A 1KC3A 1Y1SA 3P9YA 3IH5A 4LFBB 3H1TA 1SU6A 1XWIA 4B32A 5HKBA 1GPAA 2Q6LA 2WIJA 4KQCA 3UY4A 4CCWA 4DNPA 3UMGA 2DQ4A 1T5DX 2EATA 2JBHA 1YVRA 1F5NA 4YH1A 2W2VA 4D56A 3AIOA 2BZGA 1A8HA 3D8BA 4L0QA 3A4MA 2A0KA 1E9RA 2M2IA 1QBGA 4KXMA 3PLAE 2WKRA 2C2GA 1LUAA 5AKIA 1EUZA 5FCDA 4GPEA 2VAVA 3C2QA 3H1BA 2NVUB 2VQ3A 4WX2B 3VOAA 2A0YA 4P7FA 1BMFD 5EEHA 2XKAA 2ZYAA 5FWYB 4BUCA 1P80A 3FYCA 2II6A 4EEXA 1J9GA 4XQEA 4BO6A 1NT4A 1OU4A 1UKZA 1X74A 1UH5A 2PVSA 2YZ7A 1KE1A 1SWWA 2GAJA 3RG2A 3ZCVA 3W6ZA 1Y8RA 3T41A 4YAKA 3R9XA 1IEVA 3BXGA 3INNA 3Q7IA 1ZCZA 4Q9JA 5C4GB 3RK0A 1Z0KA 1J0BA 4DVGA 2EW2A 4PHTA 3Q9SA 1SUAA 3UEOA 3GRFA 4L0DA 2R8XA 1CS0A 3DTVB 3NHAA 5TGZA 4BNKA 1Y6JA 2AH5A 3FWPA 3KZVA 4EF4A 2C7RA 4JB8A 1P5ZB 3I8OA 3LIIA 4FS3A 3U7JA 4B6RA 5I8WA 1AXEA 1I80A 4QGAA 3FVVA 4WCFC 2DPXA 5AK4A 3VR6A 1BA2A 1E5XA 2BGJA 4GGMX 3PNPA 4LMRA 1QAMA 3CE9A 4JAVC 3DW3X 2RH9B 1P7WA 3M6MD 4RAOA 5D5PA 4F38A 4PE5B 2C0QA 3KAPA 5F2KA 1PFVA 2ONJA 2QN6A 4I99A 1HKHA 5LQMA 1Y8QB 3WISA 1JHVA 4G9BA 3HN7A 1XMSA 4JIMA 5KSZA 1W76A 5E3JA 3M81A 3DE5X 1LLCA 1PJ2A 3R7WB 1B8PA 1E3LA 4CDNA 3KYIB 2AL7A 2MT9A 1LDYA 2QPTA 3ZCSA 4CUJA 5JBNA 3I5UA 2BFFB 1Q0SA 1WZIA 4D8WA 2VVTA 1I10A 1JHQA 4AKHA 1FDVA 3AF4A 3H05A 4NC9A 4ZOLF 3H0KA 1U0JA 2JZNA 4KE9A 4UM8B 4YS6A 1PS9A 3QG1A 4L6IA 3B6EA 3VPAA 2GRUA 1E7YA 1UXOA 3L0BA 5CDUA 1P62B 1NUUA 3CLVA 3BGWA 3DAYA 1GVNB 3RTAA 2AF4C 3FCOA 3H1PA 4P4TA 1ECBA 1I3OA 1A96A 1NVFA 1C1HA 1R0XA 3CRZA 4MUIA 4RM3A 3UAVA 3REGA 1RPJA 2GCNA 3KJQA 3Q5DA 1L7OA 5LXTF 2WB2A 4N3GA 4QRHA 2PX0A 3DE7X 3JS5A 1WKBA 5IAOA 4YHBA 1O2DA 1D2MA 3CH5A 4QU0A 4CR7A 2CBXA 4EW1A 3GEBA 2FX2A 1T1IA 2QJFA 1S2LA 4L7QA 3UBMA 1MQ9A 1ZMRA 2VPWA 4IMRA 5B57C 3L07A 4TL9A 4EPRA 3RROA 2ORYA 4D9FA 4RD1A 4CM3A 2O2IA 3OJ0A 1CF4A 2NU9B 3C48A 4GSKA 1RWKA 1VB5A 2XUPA 3F3MA 5FOWA 1K5GA 3KKMA 3OTIA 1KIMA 1OLUA 1MGOA 3KOOA 2RSLA 3LWDA 2VP3A 4KUHA 3F8WA 4KPYA 2I4IA 2EKZA 2J33A 3CC8A 3CMMA 4GU5A 4QIHA 5FQNA 4ZZ0A 1S0UA 1T6XA 2R4TA 5DIZA 3TMAA 4R9RA 3EXHA 4M8SA 4BUJA 5IUNC 5GINE 1W6UA 3E2PA 3FPCA 4NF2A 1PGJA