2KW5A

Solution nmr structure of the slr1183 protein from synechocystis sp. pcc 6803, northeast structural genomics consortium target sgr145
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
202
structure length
202
Chain Sequence
MWDERFSQSEYVYGTEPNDFLVSVANQIPQGKILCLAEGEGRNACFLASLGYEVTAVDQSSVGLAKAKQLAQEKGVKITTVQSNLADFDIVADAWEGIVSIFCHLPSSLRQQLYPKVYQGLKPGGVFILEGFAPEQLQYNTGGPKDLDLLPKLETLQSELPSLNWLIANNLERNLDEGAYHQGKAALIQLLGQKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Slr1183 protein
publication title Determination of solution structures of proteins up to 40 kDa using CS-Rosetta with sparse NMR data from deuterated samples.
pubmed doi rcsb
source organism Synechocystis
total genus 39
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2kw5A00
2ZIEA 3CC8A 5FADA 1YFJA 2HWKA 1SVUA 2I7CA 3B3GA 4U7TB 1TW2A 2NP6A 3A25A 4R05A 4C4AA 3EVZA 3G8BA 3AJDA 3GNLA 1JG4A 5K05A 1R8YA 3FRHA 3B89A 3UZUA 4EQZA 3BT7A 4P7GA 4AZTA 1INLA 2PXCA 3OFJA 5U4XA 1Z3CA 1FP2A 3B3JA 3KR0A 2PWYA 3OZTA 4X60A 4E70A 2OBFA 3G5TA 4OX9Y 3ERCA 4PYLA 3UJ8A 4Y30A 4PYQA 5BW5A 3O31A 3CJRA 1F3LA 3EMDA 4C04A 3LDFA 1WZNA 5HIIA 2P3LA 2PSSA 2YQZA 3CCFA 5EKXA 1P39A 3CGGA 4PYNA 3EGIA 4K6MA 3M33A 3EPPA 4AX8A 2VDWA 1KPHA 1XXLA 1WXWA 2IFTA 4HRAA 5JUWA 4F85A 3FPEA 3KQYA 2CL5A 3CBGA 4OA5A 3ID6C 5HIKA 4PYIA 3P9KA 1N7JA 2PWPA 4XUEA 2G72A 1XDZA 5EHGA 1P1BA 2B78A 5T64A 2JH8A 3B7PA 5EMLA 5K03A 2B2CA 4RTOA 4PINA 4XCXA 3IEIA 3U81A 2YUIA 5ICCA 4YUVA 4PWYA 3A26A 2BR5A 4C03A 3M4XA 3VC1A 5HILA 1AF7A 1SUIA 2BM9A 2LD4A 3E7PA 3FYDA 3HCBA 4PYKA 2YXLA 1L1EA 2ZLBA 3TR6A 4CKEA 1FPQA 3NDJA 5D1NA 4AZVA 5H02A 2GB4A 3EVDA 1NE2A 4DKJA 5DM0A 3WSTA 4LG1A 5GP1A 4RTJA 1YFLA 3LCCA 9MHTA 3NDIA 5E9QA 2I62A 2G71A 1EJ6A 5FA5A 5FUBA 4EKIA 3HA7A 2K4MA 5DRTA 4QVGA 1JG2A 3A27A 1YZ3A 2NXEA 1RJGA 1WG8A 5DX8A 4AZSA 4A6DA 3DP7A 2ESRA 3PX2A 2YXDA 3FUXA 1IM8A 2GH1A 2P41A 3SSMA 3OCJA 4AZWA 3HNRA 3BGDA 3BUSA 3KU1A 2IPXA 3MGGA 3TRKA 5EEHA 3GWZA 4X41A 2ZULA 5CCBA 1G38A 7MHTA 3MTEA 4P58A 4R6WA 5D1HA 4RTKA 3PVCA 2BZGA 3GU3A 3TKYA 5KYGA 2FPOA 3ELYA 3E23A 4LECA 2PVCA 4P7JA 4ER0A 5ICGA 3ER9A 1JTEA 4R8RA 5EMJA 2PXAA 4OQEA 2NP7A 1N7IA 5CIYA 3GRZA 2AVNA 2ZIGA 1KYZA 5DWQA 5E2BA 4FS8A 5CD1A 1XJ5A 4XUCA 3UA4A 5FA8A 2XVMA 5FWAA 2H11A 1JG1A 2ZBPA 3G5LA 1U2ZA 2OO3A 1D2CA 3HVHA 1D2GA 2O07A 5K09A 3HCAA 3UJBA 1M6EX 1QZZA 2PKWA 3Q7EA 4FSDA 4NECA 4GEKA 3RW9A 3G2PA 2AOUB 3NVKI 1P91A 4ER6A 1UWVA 1WY7A 4EKGA 3FTEA 3EVEA 5HIMA 4PIPA 4HTFB 1ORHA 2B3TA 1XTPA 4QPNA 5DSXA 3BWMA 2ZW9A 3ME5A 3MQ2A 4PIMA 3P9NA 5EG5A 2CMGA 5FULA 1X1AA 3FUWA 3ELWA 3T7TA 2PT6A 1I9GA 2V74B 5EMKA 3KPUA 4XUDA 4ER5A 5GINE 2IBSA 3PS9A 5DX0A 3DMHA 3AWIA 3NMUF 5K0BA 2AOUA 2DULA 4M38A 4YUZA 3FYCA 3MCZA 3BXOA 5HOQA 5P8WA 2F8LA 3P9CA 5E2AA 5FQOA 1XVAA 1BOOA 4E2ZA 1F38A 2NXNA 5IKMA 5FQNA 5E1BA 3KPWA 1EQAA 3I53A 5GWXA 5BW4A 1N2XA 1VIDA 4FT2A 4CTKA 4FZVA 3HCCA 5DRYA 3BZBA 3DXYA 4V0RA 3T0IA 3T7RA 4Y2HA 3LL7A 2IDJA 1XDSA 3BKXA 4ISCA 3EVAA 4AUKA 5E9JA 3MCTA 3DTNA 4PGGA 4ER7A 3P8ZA 5CVVA 1JQEA 3PFHA 4GQBA 3RODA 1Q0TA 4U7PB 4GOLD 3HCFA 5HIJA 3SVZA 4MIKA 3M70A 3JWIA 4HGZA 3O4FA 3OE5A 2YR0A 3GIWA 2EJUA 2Z6AA 5EC8A 1L9KA 1L3CA 3NW9A 1JQ3A 1R8XA 3P9IA 4E32A 5C9ZA 2PBFA 1M6YA 5EIWA 1P1CA 4CWAA 5C0OE 1JR4A 3LKZA 2PX5A 3QOWA 4RTPA 1EJ0A 1SKMA 3KR1A 1I1NA 5EKUA 3KR2A 4OBXA 3X0DA 1Q0SA 3KHKA 5K01A 1NW3A 2CMHA 4GOOD 3LCUA 3OZSA 1M0EA 3KPYA 1KPIA 2UYCA 5EOVA 4EMSA 4KW7A 5DXAA 4RSRA 2R3SA 2XYQA 3KPJA 4R6XA 3KQQA 3SMQA 2OZVA 5T67A 4MHTA 5E8JA 2PLWA 4YUWA 1H1DA 2ERCA 3TKAA 5LQNA 2C7OA 5FCDA 3LDGA 5LQUA 1QYRA 3MHTA 3BGIA 1DCTA 2ZWVA 1RI1A 4HGYA 4UOEA 3OFKA 3DULA 5B1SA 2ZCJA 3KQMA 3M6VA 1TW3A 3DXXA 5DM4A 3DLIA 5DTRA 4RTLA 1NT2A 2CKDA 4E2WA 1G6Q1 4M7RA 4FT4A 5JR3A 3C6KA 2P35A 1ORIA 2I9KA 1QAOA 2VDUE 3GCZA 1O9GA 1SG9A 3ANXA 2YXEA 2FRXA 3FUVA 2VDVE 1EIZA 5EPEA 4YUYA 4RTQA 1ZGJA 1KPGA 1R18A 1RJDA 1TPYA 2AS0A 2ONYA 2P40A 1KR5A 2YVLA 3KKZA 3LKDA 3P97A 4G56A 3LBFA 3PB3A 2GAFA 2B25A 4GOMD 1NW6A 4GUAA 4IV8A 4PGHA 4POOA 2AN5A 1G55A 3DMGA 4GBED 1RI2A 1RI3A 1AQIA 2FCAA 3G88A 3OU6A 2OXTA 4PYOA 3B5IA 4PCLA 3C0KA 3RIEA 2I6GA 4WXHA 2QYOA 2O05A 2ZZNA 3PLAE 1KXZA 1I4WA 5DPMA 4EVIA 1NBHA 5HZMA 5F2OA 5E1MA 5E1DA 3UJDA 3I5UA 3R3HA 5LQJA 1WS6A 3ER8A 4ER3A 5DM2A 3REOA 1G60A 4FSXA 3SX0A 1JG3A 5EQJB 5K0CA 1KIAA 3D2LA 3UJ9A 5KS2A 5DXJA 5F2KA 5K0EA 3BKWA 4QQNA 4KIFA 8MHTA 2PV0A 5K0GA 3DOUA 4HG2A 1NW8A 2QY6A 4RVHA 3HCEA 3TLJA 3FPHA 3V97A 2OKCA 3FPJA 2Z6QA 1ZKDA 1KYWA 3EVFA 3LECA 5GIOE 3GXOA 5M5BA 4FR0A 1G8AA 5IH3A 3TFWA 2PJDA 3C3PA 2IGTA 5EMMA 5EEGA 3VC2A 1XCLA 3EGEA 2ZFUA 3CJQA 4EK9A 4C05A 4IKPA 3HM2A 4B17A 3NVMB 2KW5A 1FJXA 4QDJA 3R9XB 2PX2A 2ZIFA 3K0BA 1FBNA 4WVLA 5GM1A 1Y8CA 4HH4A 5K0LA 4RX1A 4KRGA 3JWGA 3CKKA 1VP3A 4DZRA 2AOTB 1SUSA 4C08A 4PNEA 4CXMA 3HA3A 2ADMA 2G70A 2C7QA 4DA4A 4OQDA 3KPVA 3MAGA 4DCGA 3SGLA 1VE3A 2A14A 2ZSUA 2OY0A 4QTTB 5ERGB 2YX1A 5KVAA 2AOWA 5ICEA 5EIFA 2ZWAA 3KQOA 3JWHA 3FTCA 3FTFA 1EG2A 1WXXA 2PX8A 3G2QA 4HTFA 5EZQA 4E33A 2IH5A 1UIRA 3DR5A 3R24A 3DMFA 4KWCA 3PFGA 2AVDA 3LHDA 4BLVA 2O06A 5E9WA 1RJFA 3BWBA 2P1DA 2AN4A 1O54A 1IY9A 5EVJA 4YV0A 2AR0A 4M37A 4QDKA 2VP3A 2AN3A 2EJTA 1DUSA 2Q41A 2UYQA 1FP1D 1JSZA 3BGVA 3ELDA 2Y1XA 3JWJA 1HMYA 4QTUB 4Z2YA 1MHTA 1NW7A 3LGAA 4KDRA 1AQJA 3O7WA 3G2OA 5F2NA 3UJAA 4IV0A 3UA3A 3OZRA 3P2IA 3EVCA 2P3OA 3LDUA 3KQSA 5DT2A 3DLCA 3NWEA 3VYWA 4FGZA 2GLUA 2XYVA 3S68A 2EFJA 2NYUA 2IBTA 2HNKA 3C6MA 1DL5A 5HFJA 2AOVA 3G8AA 2WK1A 5LQRA 2ZZMA 2YTZA 1OR8A 1V39A 3OE4A 2OPBA 1RJEA 3EMBA 2R6ZA 4MTLA 2JHPA 1QANA 4BY9E 2WA2A 3HVKA 5LQAA 4DM3A 3BWYA 1ZGAA 4GC9A 3G89A 1X1BA 5BP7A 5G02A 2JHAA 3C3YA 5EHIA 5ICFA 2P7HA 2XVAA 3A4TA 4PYMA 2JG3A 3VSEA 2NNWB 4V0QA 1R00A 2GA9A 2H1RA 3E05A 3MERA 3DH0A 3OPNA 3FUUA 3K6RA 3DXZA 3LSTA 4CTJA 3FRIA 5LQKA 3UJCA 3E8SA 4R8SA 1R6AA 2UYHA 3M6WA 2ZZKA 1VQ1A 1YUBA 1JQDA 2IIPA 10MHA 5LSAA 5K0JA 2QE6A 3GRUA 4X61A 2BM8A 2VZ9A 2JH9A 2O0LA 4KDCA 1NV9A 3IHTA 3SSNA 1L3BA 1VP9A 4PCAA 3DUWA 2H00A 4H0NA 4P7FA 4PONA 3KR9A 4E31A 2EG5A 2CWWA 5CM2Z 5FHRA 3OU2A 4RVDA 1YF3A 2BR3A 5K0NA 2OB1A 1VL5A 1VPTA 4KVZA 4M36A 3HVJA 4DCMA 1UFKA 3ELUA 5EGSA 4YUXA 1XCJA 3I58A 5T6BA 3TM5A 5EZSA 2BH2A 2P7IA 3KQVA 4L7VA 3H2BA 4RTMA 3P71T 3NJRA 3OU7A 3PT9A 3HEMA 5KQSA 2GPYA 5MHTA 4F84A 3PTAA 2FK7A 5CUQA 2ZBRA 3A7DA 3HVIA 3MTIA 4JXJA 5DLYA 3T7SA 3UWPA 4YV2A 2OB2A 2XBMA 1X1CA 1QAMA 2WA1A 3EGVA 5DX1A 3EVGA 4GC5A 3P2EA 2FK8A 5HEKA 1KP9A 3SSOA 5CVDA 3V8VA 3LBYA 1NW5A 3CJTA 3TMAA 3ORHA 4DF3A 2G8NA 3I9FA 5DM1A 2QM3A 4C06A 5CVJA 1NBIA 4RTSA 1BHJA 5E1OA 4KIGA 5K0FA 2PT9A 4O29A 4RTRA 2B9EA 2DPMA 2XYRA 3G7UA 2PXXA 3TM4A 1YB2A 4E30A 4YMHA 2UYOA 3R0QA 3HP7A 3THRA 1O9HA 2V7EA 3FPGA 4QPPA 2FHPA 2IDKA 3CVOA 4RWZA 2AOXA 3L8DA 1PJZA 5GOZA 2QRVB 3GJYA 4E2XA 1X1DA 4PYJA 4RTNA 2UZ4A 1ZG3A 4MWZA 2IH2A 2NXJA 2C7PA 3AXSA 3IYLW 3NTVA 3KQPA 4A6EA 3HCDA 1MJFA 2EX4A 2Y1WA 1SQGA 2ONZA 2P8JA 3FPFA 1QAQA 3GDHA 3KQWA 3QV2A 2P3QA 4HC4A 1ZQ9A 3P2KA 3M6UA 5E8RA 3EEOA 2Z6UA 3AXTA 4RV9A 4FP9A 5FHQA 4OA8A 3HA5A 4ZTBA 3M6XA 2N47A 1IXKA 2IP2A 4BLUA 2ZTHA 3I64A 3AY0A 4F86A 5FTWA 4YV1A 4HSGA 2QRVA 5DTMA 1YZHA 3TPZA 5CVUA 3UJ6A 2PY6A 3A7EA 2BR4A 2C7RA 3LCVB 4X63A 1PRYA 2PX4A 2HV9A 3GRVA 1T43A 4X1OA 3SM3A 4CKCA 5LQCA 1VBFA 1JTFA 1NKVA 5BXYA 4QVKA 3UJ7A 1NV8A 4DQ0A 3EVBA 4ATNA 1G8SA 1R74A 3NWBA 3PX3A 3QOXA 2JJQA 3R6TA 4DMGA 5C1IA 4YMGA 1AV6A 3FZGA 4BP1A 1HNNA 1BKYA 4C07A 3FUTA 4GOND 2HR1A 1XDUA 2FYTA 3SXJA 3B3FA 2G1PA 4RVGA 4CKBA 3F4KA 3BWCA 2AOTA 2AZTA 5GM2A 1SQFA 3UFBA 3HTXA 1KHHA 1D2HA 4MQ4A 1RI5A 4BP3A 1L3IA 3LX6A 3GO4A 2E5WA 2ZVJA 1B42A 3LPMA 3GRYA 3THSA 5DSTA 3G2MA 5KQRA 2HTEA 5K8VA 3TOSA 5DTQA 2O57A 3TQSA 4QQKA 1ZHFA 5CCXA 5CVEA 2PGXA 4IWNA 4RYLA 4BLWA 5LR6A 1EAMA 4GF5A 2IH4A 3KQTA 1VLMA 1RI4A 5FWDA 3UBTA 1JSXA 2GS9A 2HMYB 3FTDA 4LWPA 3EEYA 4LWOA 4RVFA 2VS1A 3IV6A 4OBWA 3SR4A 2JHCA 2ZBQA 3MB5A 2NXCA 3GGDA 4P7KA 2OYRA 5GIPE 4E2YA 1BC5A 3GRRA 3Q87B 1X19A 2ORED
chains in the Genus database with same CATH superfamily
1P7VA 3KB6A 4RDCA 1EB8A 1E79A 1FXSA 3RSHA 4LZZA 4REQA 4I5GA 4BUZA 3I01A 2ECKA 2OP1A 3BMXA 3OSUA 5K05A 1UBUS 3B89A 5K51A 1QTIA 5CGQB 3V8MA 1W35A 2P6PA 2C5EA 3KR0A 3OFJA 3TW8A 4L15A 1D4FA 1HUQA 2J0UA 3MUFA 4HQKA 4CMAA 2ENWA 3VYUB 2ZTMA 2OILA 2PG3A 3ASYA 2YZMA 3MOGA 1JKIA 3NEJA 1FYDA 5K6RA 4IHJB 3DNPA 4S24A 3ROMA 4BNDA 1WZNA 4L8WB 2WG2A 2YWJA 3L0BA 5IHPA 3CCFA 3ZBUA 5SZKB 5JXJA 2BEVA 1YS1X 3OPQA 1MJ5A 5IVIA 1W1UA 2H0AA 3JYOA 3PUYA 4I9UA 2F1KA 5ECWA 4C14A 4AO8A 3C4JA 5JAOA 1EDOA 2BHLA 3JZIA 1OSNA 4WCFC 2DUNA 1L4KA 3NT2A 3K9NA 2OHXA 1YT5A 3IMGA 2X5KO 3LLMA 3MOSA 4OOFA 5JT1A 4CKZA 2YNMC 3BIFA 1XNJA 5DJ5A 1PJCA 1HURA 4ZDWA 3UJ3X 1P1BA 4G2NA 1MV5A 3A1CA 1CJSA 3VU9B 3B7PA 3N5KA 3AM3A 1T25A 4BC1A 3VRHA 3DKKA 1ODKA 2Y1LA 4IQFA 3JD1A 2C03A 4ZEVA 1E2UA 1R4MB 4HF7A 5I7EA 4RS3A 4DDUA 1IOZA 1T0PA 1VRWA 1N1EA 2HRRA 4PYKA 2X40A 4ZP1A 4BGVA 4D4LA 5KWIA 1YQUA 5C32A 3D64A 5DP1A 1Y8RA 2B5VA 2HRCA 1U7DA 2C4WA 4KQFA 4KEAA 2C9YA 4H08A 2R84A 4QXPA 1JEAA 1VJ5A 3I6MA 3EQ2A 4DQLA 3IS3A 4WXRA 2DBRA 3T54A 4NEHB 5FUBA 1DEHA 1NQVA 5CB0A 1MQ8B 4NPHA 1XXHE 5DHQA 1C8KA 2MOKA 2X6TA 4LOKA 3SQLA 4MYSA 3ZI7A 1CETA 1BZYA 3OX3A 2EJWA 3PQ6A 4ILKA 4MEJA 4YO7A 2AXNA 4CL0A 2YXDA 4MR8B 1IM8A 4DVGA 5K6AC 1PK7A 1JIQA 2FW7A 2NT4A 2IPXA 3BUSA 1FYFA 1U5BB 3ENKA 5BRNA 3GLIE 1JR2A 3GWZA 5CCBA 2PRJA 1YNOA 2X8JB 3DNMA 4YR9A 4WY8A 3RT7A 621PA 5HMLA 2JZOA 1RKUA 3UAWA 3ABZA 4EUFA 1GV0A 2AXPA 1A7KA 3VJMA 1MLDA 3O0TA 3SFTA 2HEIA 1R5OA 3ZHCA 1IC6A 2VTDA 3GJRA 5CXXA 4UFNA 2C2ZA 1O6CA 1SGWA 1YE3A 2VSNA 3ETCA 2Q9UA 4U7WA 4BN4A 4UE2A 3PF8A 3B6JA 1I01A 2BONA 5CYPA 5JANA 4H2DA 1XT6A 3RBVA 3UGTA 3MT0A 1JBKA 1V9CA 8ATCA 2JJ8A 2WVJA 2X8LA 2XZPA 3PL1A 4ND3A 2AVNA 2D2IA 5ITSA 3FCYA 1TMKA 2GEDA 4JJGA 1GPLA 4JLAA 1VCNA 2DR3A 2NUPB 2TMGA 3W3AD 5KMGA 4N5IX 1WHSA 2GUWA 4UARA 4Y6QA 2DWQA 4EZBA 1N6LA 3LQFA 4C3ZA 1OBCA 4G1CA 2R8XA 5JXIA 5HJEA 1ORVA 2AOUB 5KNBA 4C4PA 1PZMA 4I19A 1JQAA 4MKGA 2XVYA 4W1RA 1KVQA 2WMNB 5F12A 2IHJA 1KGDA 1XTPA 4QPNA 3S6JA 1F8GA 5LA6A 4FIZA 3PCXA 4CF4A 2FUG6 3BMOB 4K9LA 4TQAA 4BNYA 4Q48A 2FWJA 3FCEA 2QVGA 1KSHA 1S5PA 2B8WA 3O2NA 4JKOA 1MX5A 4JUBA 2QTFA 1IY8A 4LAFA 2BFEA 4ZT6A 3AP3A 1OWPA 3AWIA 3KCNA 3OF3A 2C9ZA 3BL6A 1HQCA 1AKRA 3T3PB 1UWLA 2EFYA 2FWMX 3DQZA 1KNQA 5FO0A 3R75A 5HOQA 3A05A 1E2IA 3LAWA 3Q15C 5CW2A 2NZVG 1P5JA 3CW2A 3L1VA 3KDSE 2F1HA 3U13A 1RCTE 2RGEA 2NQTA 1AVTA 3AB8A 3HXTA 4QIHA 4G1VA 3UICA 4ALNA 1LF5A 4UQLA 5LZ9A 2OBNA 3BZBA 5BSUA 3BWDD 4X6XA 4IOMA 4TYMA 4Z9YA 3SQOA 2X6RA 3VKFA 3DFZA 5CLLA 4F96A 1Z6ZA 1GA4A 2WC1A 3NDPA 1LWNA 5HXAA 1UMCB 4MWEA 4WAUA 2J0VA 2B4QA 2ZKIA 2G63A 4P54A 4XQ9A 4WBNB 1W1WA 2UUOA 3PGXA 3EPKA 3AVWA 5KX5F 1PV1A 1MN6A 1U0LA 4H77A 3CWCA 2WT4A 4EF5A 1H9AA 3IUPA 5ED0A 2RK3A 5HVNA 4IW3B 1EM8A 2P5TB 4QBIA 1DMSA 4PVDA 4TQUS 3SG0A 4A8TA 3L7CA 3EARA 2IBMA 1O5OA 2PKEA 1VMKA 5DMXA 1P1CA 2QQFA 5EIWA 2IHBA 1FTQA 2QTVA 3NO4A 4FI3F 4CN9A 5A4IS 4NS4A 2WPNA 1VYTA 1YA8A 3E8XA 3F3MA 4IP0A 4P84A 1IEQA 3O21A 2WKSA 3O2QB 3MGAA 1AXGA 4P4LA 5D5HA 3U0VA 1IN1A 4HFNA 1FX0A 4PRZA 4M1WA 5EIOA 1E5LA 3KPYA 1KPIA 3V2HA 3HXMA 1VPWA 2R7NA 1NBAA 4MQFB 1CEEA 3R5KA 2CXSA 4OLFA 4LY0A 2WY2D 1QB8A 3HYLA 3HHEA 4GSKA 4AF6A 4DQVA 2D5AA 1TD9A 1GG8A 5HF6A 1PVDA 4IJVA 4PO1A 5F7XA 3FGZA 2G4LA 3L8FA 4J0KA 4L6AA 4UTNA 1HEUA 3ND7A 5FIUA 2O7QA 1TPZA 2QS9A 4Q9JA 1RYDA 1YKFA 4BNZA 5ILQA 4DDTA 4P0QB 4JL6A 3ZY5A 4DDKA 1E2BA 1A71A 1V11B 3BGIA 3SIXA 3GEMA 5KPJA 1G9XA 1FFCA 4KXFB 5AVWA 1LB1B 4EVRA 5JJLA 3TLMA 1E2NA 3U19A 1DOZA 1YJXA 2IWRA 1LFDB 3UY4A 2PX0A 4HZUA 1UK6A 4C88A 3FY4A 4PQYA 4IDHA 4JT8A 5BQ5A 4JOCA 4C4TA 4LF6B 4E2WA 5TMPA 1G3UA 1FFEA 1DCFA 2O2IA 4XPZA 4BQOA 3ZD8A 1JVNA 1PHPA 1UBTS 2FA9A 4LXYA 4Q39A 1Y8ZA 3WQRA 1HDYA 4W1QA 4ZRNA 3QVXA 4XYLA 4L9WA 2NXWA 1SUAA 4G0VA 1WPQA 4QHSA 3HU1A 2KI5A 5DGDA 3NTRA 2E4XA 3L6DA 3UKDA 3ZLUA 1OGJA 2UZIR 2AS0A 1X15A 2ONYA 3E6AA 5HDBB 3P97A 1L8XA 1FS5A 2AG0A 3K0CC 1YR6A 2VDMB 5SZHB 1NW6A 4X8HA 4RF2A 2GETA 3DBVO 3WMRA 4B32A 2FCAA 4J4TA 3FBWA 4D9JA 3F6YA 1CS4C 5AQEA 1DJOA 4Q4AA 3IUMA 2AT1A 5AW7A 2I71A 4DLLA 3I92A 3UMGA 3HY4A 3L8MA 3T3IA 5E1MA 5IAJA 2HMAA 3MJEA 3AHDA 1WS6A 1NNLA 2FG6C 3FYUB 3K9BA 1P5FA 2YWBA 3LCRA 3FG9A 1ZONA 4CUZA 1YR7A 1Z5PA 2N75A 2QAGB 4I50F 2NU7A 1T26A 4D0RA 4URVR 5I7SA 5AK4A 4AY6A 1P74A 4YMVA 1N2ZA 4MQ5A 1V37A 3UJ9A 5LZ4A 3CN7A 4IX9A 2FPMA 1WZ2A 1A77A 4U7GA 4M9QA 2QG4A 3F5SA 1BDJA 4RVCA 1V6SA 1DLIA 2P9BA 4RVNA 5KQGA 3C3WA 4FR5A 2VT2A 4RENA 3WDKA 1AMNA 4II7A 1K5HA 1L5GB 1DQPA 1PDOA 5EGNA 2Q27A 1I0IA 2VSXA 3LBNA 2ZPTX 1JR3D 4QSHA 1KERA 2C4UA 3A3KA 4G1MB 4YECA 1BIFA 3O2SB 1XZ8A 2EFGA 4PRYA 1I1QB 2H5JA 4QICA 3JS5A 3ETGA 2ZTLA 1HFEL 1AKNA 4WGFA 2IU0A 1U0RA 2ZR7A 2ZXEA 4C08A 3HU2A 3KT0A 4O5AA 1YV9A 2WFZA 2CHGA 1F3OA 2PGOA 1U3TA 1ZA1A 3A1TA 5KKAA 2IXBA 2O7RA 2FEAA 3M89A 3UHPA 1JQBA 4NE2A 5IJ0B 2CYBA 5ICEA 5DN9A 3BC1A 1ZSNA 3JWHA 1CZNA 1OMOA 2Z43A 3QE4A 1RTKA 2ZSAA 4YCJA 3KU4A 4E4RA 4QTXA 2DFPA 3WIDA 2K7FA 3CVVA 3PYXA 1E63A 2YYZA 5F1YA 2OV1A 4IF4A 1Z37A 3ZU6A 5EVJA 2HMVA 3EUEA 1Q1GA 1VA4A 2IUTA 1W6UA 3ETLA 3T3OA 1FBTA 3OJLA 4RD0A 3M3HA 3OOSA 1WP4A 3P0EA 4JHXA 2R7KA 4DBZA 3LGAA 1K8YB 1F1BA 5EZ6B 2V6GA 4IV0A 3EMKA 1NVTA 2FB9A 4RTOA 4DCJA 4A15A 3W3ZB 1C3OB 2GYWA 4INJA 3GAZA 4GR9A 1KETA 1QYVA 3I6IA 1ZAKA 2CMFA 3E5MA 4LJ9A 1DP4A 2VATA 4AYTA 2PLAA 3G9UA 4C6HA 3SNKA 5BQXA 1IZ0A 5K8CA 4JI8B 2NQ8A 4S35A 1Y63A 3BH6A 4PSAA 5K99A 3PC8A 5EJIA 1AXRA 3BXXA 2I55A 3BWYA 3LLVA 2Q21A 1PNOA 5D3KA 2JHAA 5F9MA 1QO0A 2N0SA 1P7CA 1XCOA 5CP8A 2HB6A 1TOAA 1VMIA 4WZAE 1UBGA 3RK0A 1K7YA 5G1NA 2VAMA 3VZDA 3FRIA 5LQKA 3QIAA 1UK8A 4NH4A 1XN4A 2EF1A 4A91A 5KOHA 1YR9A 2OESA 1NVAA 1P61B 1DTEA 2VHWA 4H1WA 5KC8A 5LQMA 4IDGA 4N9QA 3ENNA 4RORA 5CU7A 5HCIA 4L1KA 4X7BA 1EX6A 5D7BA 3OFNA 1KJJA 4PQFA 2NO1A 2HOQA 1VP9A 4P7FA 3TCXB 2JI6A 1ZD5A 3B5EA 3P0IA 3WJAA 5F3RA 4AG3A 3HEAA 5HJ2A 2CWWA 3H5VA 2MJLA 4WDQA 4BMZA 4ME6A 4TZ6A 4LYHA 3HVJA 5ALEA 2DXIA 3B6KA 3ELUA 4O2BF 4MDYA 4AY4A 3UT6A 1KO4A 2B1GA 3HR8A 1QHEA 4Q4HB 5CCDA 3NTQA 3KQVA 3WRXC 4GL4A 4KLNA 3LJKA 5KZMB 1HL3A 2QVCA 4J3NA 3ZS9A 2VHYA 1DG9A 2X7HA 1HYBA 3N9IA 5J2TB 3EPJA 3I2KA 1KBZA 1W4BA 3Q72A 2BTQA 3BJIC 3QVJA 4OF4A 5DNCA 2JIZA 3GVXA 1JIVA 3H2SA 4PLTA 4WE3A 1NY5A 3DHVA 3IMCA 5DX1A 4DE5A 2OKGA 2ZQ5A 2HA7A 1QZUA 1KRXA 3KEQA 2XCOA 3T12A 4AL4A 3PHIA 1N2EA 3E1KA 2QI9C 4Z4HA 3BCSA 4ENPA 2O8FA 4E5VA 4FMCB 4UTOA 1Q91A 2X42A 2ODWA 1G5QA 3QJ5A 4LBZA 3LQYA 4HQ0A 1GYPA 4OB6A 4Q7JB 3WGYA 1AE1A 3U4DA 2XYRA 3G0OA 1YQTA 3PBKA 3Q7PA 3IRVA 2XUDA 1UT8A 3OCYA 2DPLA 4N39A 4CW7A 4YUAA 1RAIA 1YD7A 1ZMRA 4R41A 5CTJA 4FDMA 5TGTA 5C3UA 3ZGNA 3DJFA 4ICIA 4QGHA 2NXJA 1NF2A 1J5XA 2F3UA 2JFNA 2UZAA 2C3MA 1IEXA 1J2TA 4LKOA 3NAQA 3BIJA 1ZQ1A 4UUOA 2QW0X 3S8YA 3M6UA 2LPMA 2W2XA 3GR6A 3ADCA 2MYTA 2Y9MB 5TIIA 2BGJA 3KQNA 4OKSA 4E1BA 5IM4F 1NRWA 1Y0BA 2ZSKA 3TSYA 2JC3A 4GI7A 3HWWA 5EZYB 1WMDA 1DG3A 3UWOA 5JRZA 1EZ4A 2HK9A 4Y2TA 5KDDA 5EUCA 3TPZA 4LJRA 2PCJA 3RO7A 2MTBA 1WEKA 4Y9RA 1PZHA 3AESB 1ICIA 4CGZA 2AJLI 4ZREA 3C6YA 5NLLA 1O2DA 3K5PA 3UAOA 1JFLA 3RS3A 3ZCQA 4WK6A 1C9MA 1GRQA 1G8SA 1UMDA 3NWBA 5CBPB 2G80A 4YT5A 3FH0A 5IT4A 2ZJBA 4JT2A 1XXHB 1OU4A 1K92A 2O1EA 3OSZA 1QRUA 2C84A 4QASA 1GR1A 1CUVA 5JAIA 2GAAA 4TS9A 1XD9A 3VO8A 1FB5A 1ARZA 4JSRA 1Y4UA 5ALXA 5EE9A 2P4HX 5A9RA 3O4RA 1M7BA 1A9RA 2FF7A 2HWXA 2O23A 4WBXC 4BP3A 3GLIB 1NVDA 1RWQA 5IZCC 1Q14A 4UHKA 3EAQA 3VVBA 5IAOA 3H3JA 4X1YB 5GV8A 1PN3A 4NAUA 2AMYA 1GNLA 1ISJA 1U7TA 1CS0A 3OPYI 2ZYRA 1WV1A 4AP5A 4UDYX 5BV7A 3QBDA 3MS7A 2R8YA 1EAMA 3N28A 3HM9A 1D2MA 2YJNA 4PXYA 1SQ0A 2DHQA 4H7DA 4NYIR 1T2AA 4J0GA 4QELA 2BIFA 1SU7A 1G5HA 1G8PA 1Q3TA 4QYMA 1GTRA 1U65A 5T4BA 1CY7A 4J29A 4E4YA 4W9NC 2VBIA 4YMIA 2J08A 4C78A 1PWZA 4RH1A 1C3VA 4G5HA 2JJ2A 4YQYA 4RELA 2PWBA 3OVMA 2LWIA 3FGNA 2IXTA 3FPSA 4XJSA 4HVCA 2YBEA 2DBZA 4FBGA 2HWYA 5AICA 5KNLA 2QN1A 4Z7NB 3VH2A 2HWKA 2GFIA 2XT9A 5B2EA 1QYWA 2VUHB 3IE2A 3EMVA 1QWSA 4AJJA 1JHYA 3V1NA 1JG4A 3HZZA 4K40A 4A0SA 2Z8YM 1A4XA 1BU5A 4QHTA 4DBLC 1NRIA 3TS1A 5ELLA 5ANRB 1L0BA 3OZGA 2I1VB 2AB0A 5JVDA 3UJ8A 1FYXA 3UQZA 4F56A 3IIJA 4BVFA 5DYIA 5E6SA 5J5VA 1I3NA 3VYTB 2YMQA 3VHXA 3L9XA 1GPYA 1XD2B 1E3IA 2VQ3A 4ZI7F 1QFSA 3FWNA 4HSEA 1Y48E 4QTYA 1QRRA 5B7NA 1C7FA 4H17A 3ILHA 4PR0A 4US1R 4Z0HO 4WOKA 2AA3A 1MJGM 3EZNA 3MT9A 1L5NA 2BGGA 1N2SA 2C2OA 3O8LA 2FE4A 3LQRA 5DYWA 4X66B 1L9XA 3ZKWA 2FPSA 5GY7A 4DA9A 4QTZA 1QMGA 1EVLA 1WCXA 5BOSB 4OK3A 4DHWA 5A4KA 4RZHA 5I9MA 4OUDB 5I6DA 2HK7A 2CZCA 2GBPA 2PVSA 4RJLA 2X9VA 5CFOA 5KNCA 2ICAA 1TGYA 4PINA 1FNCA 4TSRA 4A2PA 1CUIA 5C4MA 2NIPA 3BB4A 1MO2A 4O4LB 3ZCRA 2A7XA 2OORA 2BR5A 3A26A 3PQDA 2H52A 5DLEA 3H5NA 3MIZA 3D6VA 2PUEA 2X0RA 1V16B 3V4VB 1MX9A 4X3PA 3VDXA 4WXEA 4Y3UA 3P9RA 2VDQB 2QN6A 1MXHA 4Y9UA 3H11B 3KAPA 5ECGC 1EQ2A 3DHWC 5CDFE 3EZ6A 1FXWF 5GZ6A 2GAOA 3I5YA 1GZ5A 4KACA 4ZGBA 3FHOA 1E98A 5DRTA 5L9AA 1SKUA 1WSWA 1IK6A 1S2GA 3ISJA 3KZCA 4JCOA 4BEWA 3HDTA 3CSSA 1H2FA 2VXCA 3R4VA 4G25A 4GS5A 4E08A 1KDTA 4G84A 5ERYA 4DV0B 1FP4A 4LYGA 2FMHA 1V48A 3ZHSA 3H5AA 3GPCA 1ZITA 3GJ7A 1R50A 3NAZA 3NHUA 3RC3A 4Y2XA 4FC7A 1YAJA 5JCPA 1G64A 3VDQA 4EHBA 3EAFA 3G3EA 1X87A 1VL0A 1QOPB 1ZH8A 3ZWKA 2CLLB 2QX7A 4LTMA 1CVIA 2WD9A 1WMSA 4YRKA 1HDZA 1JR3E 1ZY2A 2GO7A 4MQBA 2IP4A 1J2EA 4OP2A 1I6KA 1LK0A 2DR0A 2VSFA 3DVAA 4RY9A 3D3WA 4CR6A 3FJ1A 3I6YA 4K26A 4BXOA 2NZXA 4TT8A 5LJIA 3JVUA 4RGQA 4P33A 4FS8A 2EP5A 1X7WA 3EAGA 4RO0A 2GPTA 4WJZA 4J1SA 4N0MA 1V3VA 3HN2A 1T9GR 2OE2A 3DM9B 4HLUC 5CXSA 2FCRA 4JP1A 4C3UA 3PUJA 3I4LA 1E79D 3BFJA 3JZFA 4XVQA 3RU7A 5BYJA 1H85A 1SVWA 1G7TA 5G1PA 2BN4A 5JU6A 1BE0A 2WYIA 4PX5A 3VR5H 2ARKA 4P9NA 2AW3A 5I5EA 3ORQA 3STXA 2WFAA 2QAIA 4WIAA 1MT3A 4PGAA 3SOPA 2YV3A 2OTCA 2D2XA 4TLLB 4CHTA 3ZDDA 1EESA 3KSDO 3EUAA 1BE8A 3SN6A 1ADJA 5DZSA 4TPKA 1HTTA 1O6BA 5A0TA 3PEVA 5EP2A 4FSHA 3HLTA 5IYZF 1G2IA 2J45A 1XYVA 2DYKA 2NYAA 4QRIA 5L8VA 1MAVA 1MC8A 1BRMA 1M66A 1N5JA 3QLTA 1JDPA 5LQDA 1P80A 4FD3A 1ZK3A 5K4HA 4MTCA 4N4AA 5A62A 1I30A 4XYEA 4HEHA 1FTWA 1PGQA 2O2CA 1CXZA 5DBIA 3WP1B 2L42A 4V38A 1HG0A 2DCMA 4Y0AA 4L76A 5BR4A 3K09C 4YNBA 5FUMA 2PZJA 2IX3A 2BV3A 4A26A 3INYA 1X0VA 2WHQA 3IUEA 3OZCA 2IPLA 1VM6A 4C4RA 4RIFA 2JA1A 2MSWA 3DTNA 2HFJA 3L7JA 4PGGA 2RHDA 1NN5A 7ABPA 1H69A 5FWNA 2ATCA 2UUBB 1OZHA 2AJTA 4LF8B 4G8BA 4KH1A 1BGVA 1NVEA 1QIGA 1CZOA 1DC5A 1WTCA 2QU8A 4QREA 1P2UA 3R23A 2VWGA 3GRPA 3OE5A 3QKIA 4TRNA 4CNBA 4D9BA 1GG2A 4QATA 2BEJA 4PR3A 2YUTA 1TEHA 4CM4B 1T1SA 5K3FA 1AV7A 3H7AA 3NYIA 3VYRB 2F9MA 1FUUA 1RYBA 3ITEA 4MW0A 1ZESA 2HDWA 2O2ZA 3AYZB 2PX5A 2YC2C 2ZS8A 3C7KA 1ZW6A 3CRW1 4BVEA 2ZRMA 3CLSC 4ARUA 4C4YA 4YCCA 4RQTA 4OGLA 4RUKA 5DI9A 2Q2QA 2AR9A 3DHYA 4JJ4A 4V02A 4YCAA 1ONNA 1E7YA 1XLWA 2C95A 3C98A 2R3SA 3KPJA 1T6YA 4N01A 2IYQA 2WJJA 1EVKA 1WVIA 3WLIA 4BPRA 3UXEA 1RDFA 2FFQA 1MMFB 3W1EA 1SG0A 1W4LA 1APBA 2FN3A 4WFKA 4XSVA 1TF2A 4IH4A 1SC9A 2YJ3A 2IUEA 2K87A 1CVLA 1PUJA 4JBLA 1Z35A 1NJSA 3R1IA 2W2LA 5LQUA 2B7LA 3L07A 3RH0A 1X2BA 2OGZA 4HGYA 4YV7A 1IM5A 1MEEA 1XWIA 5IJXA 5C8XA 2REBA 3M6VA 3ZW8A 4GSLA 4LJYA 1H94A 5DBGA 4YPVA 3P5BA 2RB4A 2IHTA 1Z0DA 4P92A 4CF3A 3WR5A 2I9KA 4I7EA 1WMEA 3HJCA 8ABPA 2EBUA 4BWVA 4L5AA 3OWXA 4QFBA 4IZIA 4LEIA 3VH1A 2EGGA 4NCJA 5EPEA 5AVKA 1EGMB 1KPGA 4F86A 4IKOA 5JEDA 5KNBD 2J3JA 3DCJA 4G56A 3IT2A 1JX6A 1E1YA 3H16A 3OEEA 5EXSA 4D45A 7AT1A 3U9LA 4N82A 1J0XO 5HK9A 4ENVA 3EY4A 4EBBA 1BX3A 3M5PA 4NTZA 3IHKA 4UMVA 2IITA 4D9KA 4JI2B 2WM8A 3Q2IA 1XNGA 3HJHA 4I1SA 4WZAB 2CV0A 1TXGA 3LRPA 3IIMA 1WHTA 2AH5A 1II0A 3CA8A 3T95A 3UPDA 3F6EX 2QYOA 4ZOLA 2DWUA 3GFOA 2XQKA 4MUEA 3IMFA 5IU6A 1F2DA 2EFHB 2GR9A 3FVWA 4IIYA 4XW2A 1U8FO 2NVUB 4PLGA 3Q5GA 2I4IA 2YWGA 3AETB 3D0RA 2AIRA 1DRVA 3GV0A 5KSZA 3GC6A 3SXUA 1KIAA 3D2LA 3IT0A 3T9BA 3CINA 3I61A 3UWMA 5AKZA 2PDAA 1KP3A 2C0QA 4O4JF 2CUTA 1NKSA 3JQ7A 2WIBA 2Q3CA 2ZK7A 4Q3EA 3IJEB 5BN4B 1Y1QA 4UVHA 3TLJA 5LL6P 1VKHA 5DNWA 1TTHA 1G6KA 1R5JA 1DEOA 4I14A 5SY9A 1SWWA 3MMXA 3COSA 2DFVA 3AR2A 3ZGOA 2IK8A 4PN3A 3PNLA 3PYLA 1KJZA 4AY2A 5BXQC 1YACA 2OMKA 4FM9A 3STWA 2I8CA 1B6SA 1D6MA 3BE4A 3L93A 3R9XB 2GAIA 1KO1A 3SE0A 1CR1A 4BNXA 3JTEA 4PO9A 1CG6A 1EBFA 3QPWA 3F2VA 1VMDA 3W2TA 4AI6A 3V8QA 3BD6A 1QLWA 1RVV1 4X8LA 5BUQA 2A9KA 2BZ1A 3TZBA 2X58A 3SF0A 1Z5OA 5TT0A 3C8ZA 2XMPA 4IINA 4PPGA 2YVUA 1QGUA 3S55A 4ZANA 3D0KA 4RJTA 3ZK7A 3FTFA 2HWWA 4BKPA 2GZ1A 1DCMA 1O5IA 3AEZA 4Q3OA 5JZMA 2AJ8A 1V1JA 4LA4A 3TNLA 4BAGA 3PC6A 2N1MA 2PYZA 1E6MA 1DAIA 4YJ2F 1GY8A 4ZYZA 4C20A 4Z53A 1NGSA 3ESYA 3EGOA 3IV9A 3NBZC 3WNVA 2FW9A 1ECBA 1UCFA 5ULLA 1Q20A 3MJCA 4IJUA 1NX9A 1BXRB 2W7TA 3ZVNA 4FQ7A 3LDUA 3QVUA 1RPJA 1RWVA 3TB4A 4FGZA 1Z16A 4K9RA 4F4CA 1OI4A 1QQ5A 4M9RA 4OFXA 1VYVA 4B75A 3SBOA 4JODA 4Y7DA 3N2KB 4R2MA 4OFBA 1PYGA 5ALVA 5EERA 3WNBA 5CX1B 2AOVA 2IYVA 5LQRA 3C3BA 2O9JA 1EUDB 2YTZA 3USES 1MBZA 3FDXA 3I2GA 3V42A 3ZZMA 2AI2A 1ZC3A 1Q0LA 2H9YA 3KYDA 5K3SA 2GLXA 2R6ZA 3A4VA 4EB0A 4RV5A 1IPEA 5L3QB 2POQX 3RYIA 3JALA 2WJYA 1D2NA 2AC4A 1Q44A 3E3LA 5FOSA 2Q9CA 4D0GA 2PUFA 1EBBA 4OLAA 4LTDA 2BHRA 5AVXA 4MRRA 2XUZA 5HOEA 1DFGA 2GILA 4IYRA 4UNQA 2H1RA 3NI2A 3MERA 1N4DA 1R10A 2GMWA 2LBPA 3BB1A 3OPNA 3CH6A 3FNRA 4MLDA 4QUJA 4KHPB 4NOJA 5BRAA 1E6EA 4Q37A 3ROFA 2A5GA 5B36A 1QG0A 1UXGA 3NHRA 1SR8A 2G5PA 2X3YA 3DUFA 1LU9A 2CXOA 2EJBA 5LDGA 2G08A 4ZQEA 2JH9A 2O0LA 1QBGA 1SK9A 1BSVA 3SVLA 4A16A 3R76A 1P2SA 3OA0A 3TW4A 1HYGA 3TE7A 1MZPA 3OKPA 1A5ZA 4GVXA 3ZR4B 5JNUA 3E84A 2V45A 5A9SB 5ADUS 2FN4A 3DTVD 1JEOA 2Y1KA 2PTHA 2Y0PA 4X9XA 4DUZB 3L0OA 2HNBA 1I7PA 2ISQA 3H2BA 3ICPA 1QLJA 1GTJ1 3CXRA 2H4FA 3FF1A 3QW4B 4MRVA 4Y2PA 3KSAC 5DTEA 4C0HA 2ZBGA 3A7DA 4B6GA 3ZHQA 3HKBA 2QTCA 3SZGA 1OLSA 1BDMA 2WA1A 1ULHA 5JYDA 2WWYA 4ZDKA 4ZVNA 3V8VA 1EFDN 3EXFA 1JMKC 3CJTA 2HSJA 1C9KA 1DT5A 2ZWMA 3ON5A 3GZTB 5AVRA 4V0OA 4NX2A 4C06A 1ECLA 3A28A 4FEYA 2Q3LA 1IHXA 1ZCZA 4LDQA 4GW3A 4H3KB 3K9GA 5JS8A 1FLAA 3COYA 2Z9DA 1UKEA 1A4IA 1XDWA 1OX4B 3B85A 2V4UA 4YQZA 3CCCA 4KITB 3LBAA 4HTAA 2UZ4A 3IQGX 1YL5A 4IQGA 5C8DA 3NS7A 3MF4A 1ZHHA 1QKJA 1KEEA 2AKYA 2VCEA 1FP6A 1NVVQ 1U28A 1YQDA 2PS0A 3KQPA 3V8RA 2RG7A 1KMNA 2I6TA 4YQFA 1K75A 3BB3A 4G0MA 3TVDA 1OIVA 5EJEA 2QJRA 1L7NA 3KLPX 5AKJA 2DR2A 1T36A 2E4ZA 2ZTHA 3EXHB 3QE2A 2EBHX 2HRQA 1J90A 1NZJA 4P98A 2WWFA 1J0AA 3IP6A 1P5HA 1XF1A 3NYWA 4X8MA 5CVUA 4AJKA 4F12A 1QP0A 1V1RB 2F3PA 3VC3A 1ECGA 3TZEA 1FFXB 2PX4A 1CKEA 5TJ9A 1EHCA 1EXDA 5GJBA 2D0DA 3HYRA 2Z04A 4JVMA 3SM3A 2BCGY 5LQCA 4B3RB 1P0QA 2D1RA 1FP7A 4FCVA 5G3YA 3LK7A 2GVNA 4FC6A 3WX0A 2JEOA 2GEKA 1XLTC 1QK3A 4FHEA 2OFXA 3PX3A 2C7BA 2WW8A 2O20A 1M1ZA 1E61A 1V1MB 3ACDA 1YRWA 4IQ8A 4E51A 1QO0D 4MI1A 2J8ZA 4B0PA 4RS4A 3C7CB 5JATA 1BFDA 2WKRA 2XVZA 1WXGA 2AFIA 3NFYA 1P3DA 1U6IA 4M9CA 4PSUA 2AOTA 2AZTA 5F3DA 3T9CA 3HTXA 4NJMA 2FFBA 3BK7A 2AN1A 2GZMA 4G8CA 2CXQA 3HB1A 1JZSA 1HGXA 4NYMQ 4EF6A 5C4IA 2PYIA 1X1TA 1SVKA 3DS8A 2AMFA 3ZWWA 4XD7A 1ZUHA 4GP9A 3F3YA 3N2IA 2WKWA 4HNVA 1D09A 1EXWA 2WR8A 1NXWA 5HS4A 1ZHFA 2KWIA 4EPWA 3OFND 1GDTA 1M7HA 5D84A 2XT0A 5JDCA 3MTAA 3FMPB 1M7GA 3L8YA 4EB3A 1O03A 3UV6A 4M7PA 1Z06A 4PPNA 4IIGA 5KAMA 4DIKA 4KZKA 2C1ZA 1F51E 2JIOA 2VPWA 5AHRA 1E58A 3EULA 3C74A 1S01A 3WLNA 1WCYA 4D9GA 3RS5A 4J0HA 3BZWA 3IIIA 4MQMA 2I87A 3W7AA 3SZOA 1J7JA 1OH7A 3L8EA 3E4CA 1NT4A 1VG1A 5DXFA 1B0ZA 4BVJA 2WE7A 4CM1A 2FW6A 3RTAA 5JALA 3FRHA 3SLGA 2RGBA 2WABA 3GVHA 3GHHA 3IPYA 3R0JA 1LV7A 4OGWA 4OMDA 3VDMA 4F2GA 1ZIYA 1U80A 4Y1FA 1QQTA 5JG7A 4RQUA 2P2CA 5EP3A 4RD3A 1PP4A 5FBKA 4GL2A 3KDPA 2CFCA 3B1WA 4TTJA 1YIOA 3T5CA 5E6UA 2XNKA 1WDTA 2Q8QA 3L49A 3U7HB 3AF4A 1P39A 4UUNA 3MTDA 5EKXA 5BWMA 5I8PA 3UV3A 2J59A 3TQCA 4DR2B 2Q4BA 1UJCA 4YC7A 3LL4A 1LS6A 2ZYVX 2P6UA 1GL6A 3FPEA 1TRHA 1PYOA 4CKEB 4ECEA 5AOAA 1VI6A 3QBTA 2FXVA 4FU0A 1JFFA 4PYIA 1REQB 1SEPA 4XUEA 2PH5A 5SYMA 2GNPA 2Z1NA 3JSAA 1IFXA 2B78A 2GPAA 4JVSB 4ND6A 5EMLA 5M3BA 3TSWA 2HLNA 3IQIX 4BGEA 4HAIA 2I78A 4ZHQB 3ZCTA 1F14A 1GCAA 2JFYA 2R00C 4PF1A 1JHUA 1SIBE 5I5GA 5IZ4A 1M0SA 2LD4A 4HNTA 1WDMA 1FPQA 2FPUA 4RLHA 1EP9A 2WJ6A 4QULA 2UUPA 1V6CA 1WCIA 1D07A 3G23A 1RACA 4LG1A 1XZCA 3FYTA 3A11A 3GEDA 1JECA 2QLTA 5BYKA 2VJKA 3EIXA 5KEIA 1DIAA 1T4MA 4YAJA 4MKHA 1E1NA 1LY1A 1SCKA 1Z4PX 2QJFA 2NXEA 2C9OA 1WG8A 4DC9A 3IPRA 5KNDH 2WB2A 4POAA 3AR7A 3IX7A 5EHQA 1JJBA 2CUZA 1T8UA 3QKSB 2Z3ZA 1PUXA 2J7PD 3NKFA 3K0HA 5JAUA 4Y8VA 2ZULA 5DV9A 4KI0A 1JQLB 5JLAA 121PA 1FVHA 4D3DA 2VPPA 2JK1A 1YO6A 1M8FA 4AO6A 2R8EA 1JHPA 5DKFA 3HLKA 1QQBA 1SHUX 2CJXA 1FDRA 3H4IA 4HAVA 4PLYA 1FS4A 5CURA 4AG6A 4QLBA 3ER9A 2QLJA 2NNLD 4BV2A 1VRVA 2B7CA 1MJHA 2XB8A 1YBHA 2I1LA 3B6MA 2DHCA 4OHCA 4A10A 3RUEA 2AFVA 4XJVA 5EWMA 3V1UA 5E2BA 2QLFA 4OHBA 5CCEA 4KHZA 1GV1A 3CUSA 4HXYA 1PDVA 4BCBA 1UAAA 3TL6A 1V8OA 2JFGA 1F2TA 5I7OA 1GGHA 3P2YA 2W6IA 4EUEA 5EUQB 3LBIA 4LHXA 1D6JA 1F2UA 2YRFA 3FDZA 4ND8B 4U39A 3T94A 3I2JA 1KZ9A 5DI3A 3RE1A 4G37A 4BJ3A 3NVKI 3D8SA 1JWBB 1WY7A 2R6R1 2IYZA 1GUAA 3OOEA 1C1YA 2ZTVA 4GECA 2MR5A 3HKDB 5JBQA 3I1FA 2GDZA 1HC7A 4XWAA 1R9MA 4WKCA 3VV3A 4YRAA 4UHCA 2Q0QA 4J0EA 3K8YA 4FFBB 4XB1A 3VFDA 4L5CA 4TL7A 4R0NA 3X1YA 1YZGA 1JBEA 1ZR2A 4M6WB 1J21A 2IBSA 1UM9A 1F4PA 2V9PA 3DMHA 3FCXA 2FWRA 4JK3A 4LHSA 4Y1GA 2A78A 4NABA 1SZDA 4JUDX 4N49A 1CRQA 3V2IA 2YBDA 1ZRHA 5A4MS 1KJYA 4RADA 4BNNA 3WI7A 1TB4A 1L7VC 1KY4A 3L6BA 3TKLA 2YIMA 4EW6A 4G0XA 4FT2A 4INAA 4TTRA 3PPXA 5C1PA 1T5TA 1IE3A 2EDCA 3PK0A 4G65A 2PD3A 5KNCD 4H0CA 3QELB 4FWBA 4LRXA 3KTAA 5FR2A 3R8XA 4TWRA 5LXTB 4ISCA 5D51S 4BWGA 4CIDA 3HMQA 1KJ9A 1GTL1 3H0CA 4WFIA 2SCUB 3T6KA 4FNGA 1P5RA 3KT6A 5COAA 4K2AA 5SZJA 1UZUA 1AUVA 3PDIA 4XSHA 3RODA 4RA9A 4KXWA 3VZRA 1RFGE 2WLTA 2GESA 1E2EA 3O4FA 4WUVA 5KHAA 2XDQA 4HVAA 3IT1A 4IZHA 3A6FA 1XTZA 4D46A 3A9VA 5JROA 3CZCA 1ZIDA 3NP7A 1U0TA 1TUIA 1Q6ZA 1PNQA 4EB6B 2WU4A 5AW6A 3IERA 1JR4A 3OCCA 1G9SA 1KFBB 3OY7A 3MMPA 2FZEA 1G41A 5F21A 4UNNA 1QP4A 1K5GA 4JT9A 2BRUC 2CMHA 3ZWQA 2Q45A 1M0EA 1K4YA 3KDAA 3SZ3A 3O3CA 2VHZA 2C4TA 4HQLA 3UT5B 1GGVA 1RWBA 1NLFA 2JAQA 5CA0F 3AH8A 5GJCA 5E95A 1N36B 4E2FA 1OLXA 5IKOA 3OURA 4FFWA 4X0EA 2GBCA 3CPJB 4Y9DA 1ETHA 2J3MA 1AO3A 4MIEA 1HDOA 2FSVC 3ES9A 2CNLA 3EF1A 4P34A 5DN6A 2HBQA 4C6RA 2FZCA 2ID7A 3V7YA 5LQNA 3P4YA 1S3GA 3D6AA 2I2WA 3R7BA 3F6PA 3BTSA 1CJMA 4IH1A 2QU7A 2PRKA 4E5YA 4JJEA 4KQJA 1UK9A 4L8YA 1KKLA 1P7YA 2VRCA 2C54A 5TY0A 1QR6A 1QS0B 2HPVA 2Z2KA 3KQMA 4M98A 4M1QA 3DXXA 5A3VA 2DHEA 3EASA 3S5UA 2F9LA 3JAWB 3OOYA 2CKDA 5HJ7A 5D00A 1F8UA 3W78A 4XARA 1WZCA 4U2CA 4G86A 1GTVA 4A3SA 5CH8A 4C0WA 4WLFA 3KC2A 3B2EA 5AP9A 2YWRA 1HE1C 3R3XA 2WT8A 3DA8A 4MUBA 1PK9A 1SQSA 2YXEA 2RHMA 2O8CB 4LY3A 1R0SA 3IIEA 3G0GA 4NSNA 1U7UA 4W5QA 2ZUUA 1O0SA 3LKDA 1M2VA 13PKA 4QEZA 1S3FA 1I3LA 4GLOA 4GG1A 5EL0A 5MF6A 1W29A 2ENUA 3RUIA 4BX2A 5B7QA 3CUUA 5MDHA 2J46A 1IEWA 2AYYA 2B35A 2D62A 4CM8B 3L0CA 1H0RA 3OQBA 4GKKB 2GJ9A 3GA7A 1C9NA 3IXQA 1NFQA 2WIFA 3RIEA 4BZQA 5CR9A 3PLAE 2ZZNA 2XGJA 2RI1A 3KTFA 1N0WA 3I12A 3WIVA 1AKVA 1C4XA 3UJDA 2X3UA 3A2LA 4IILA 4O2RA 1PIWA 1Z36A 3ER8A 1U3GA 2RARA 1CEYA 2A0WA 3C1UA 3HI6A 4KQXA 2CHFA 4UC0A 1O8BA 5D3MB 7MDHA 5JJIA 2Q5CA 2YQ5A 1YGYA 3CWQA 3RJTA 4A5OA 5KS2A 5DXJA 1P2DA 3FDIA 2CN1A 1A8SA 2R86A 3PUVA 5CDYA 3CW8X 3WOHA 4Z1MA 4EO9A 3KHSA 3UW3A 4JS0A 1O94C 1RADA 1FSSA 3IBSA 2OK7A 3MSXA 1KTVA 5FWYA 2R97A 1JT2A 1XUOA 1OGIA 5CFNA 3GROA 6ABPA 3VOSA 3GXOA 2RMKA 2XX3A 3EDCA 3GB9A 4NK4A 5IH3A 1Z82A 3L7AA 1E1LA 3QKUA 4EK9A 2Y0CA 1CUBA 4GKAA 5EPOA 4OB7A 3BFVA 4QDJA 4XWTA 1FJXA 2FEOA 2XQJA 1G18A 4XOIA 3MWJA 4CIBA 3S2YA 4XTRA 1XKTA 1AY0A 3GFTA 1H2AS 2DMRA 3JWGA 4FFLA 3SC4A 2WUDA 3UMVA 1EUZA 2GARA 4ZWNA 4PNEA 4CLOB 2IVFA 4AQDA 3QKRB 1PX2A 4G36A 1HYQA 2JAWA 3MVEA 3BMNB 4IDFA 6PFKA 2C2XA 1JXAA 2A58A 5DGCA 1Z39A 3PEEA 2QUHA 1IY2A 4HDKB 2GRJA 4TQ9A 5CJJA 1J8FA 4CCSA 4DV5B 1J97A 2GBLA 3KKOA 2WJZB 3JARA 5J5CA 1RRGA 2HADA 1R16A 2YHIB 1BD4A 1KKUA 3AI2A 5KTYA 4UNIA 3K1YA 3MWEB 3WSVA 3NB0A 1IY9A 1O95A 3C5WP 3K8OE 3OBIA 4KGVA 4RM2A 4X1KB 3D59A 1GL9B 1PSDA 1YDMA 4LBVA 4Q01A 5K7SA 2Q3DA 3BQ9A 1O1YA 3GFBA 3IA7A 3MWKA 3OT5A 3D6NB 2AN3A 1JXOA 2Q41A 3AZOA 1ZKMA 2C04A 3PD0A 5FFMA 3CX6A 2W2LD 2XQIA 3M6MD 4R01A 4HYYA 4MHOA 1MVLA 3O7WA 5A3QA 4C4ZA 1EGAA 5J47A 4RYDA 1ECCA 3KQSA 3AV0B 5E7MA 2IV2X 4ZZ2A 2W37A 4REQB 4B3SB 2GLUA 4HZGA 3GA5A 3SQXA 4AJHA 2EFJA 3AF0A 3UXHA 1ZNWA 2HNKA 3C6MA 4U2EA 1W47A 3PD7A 4YAWA 4C0JA 1PNRA 3GJQA 4TMVA 3ROQA 2D0PB 2J0UB 3BTUA 4AJEA 3K1AA 3UIEA 1YJAA 3BFKA 3E7WA 2ZTSA 3NHYA 4FFNA 3U7IA 3I0NA 2Z3VA 3TBHA 4AJ2A 4BTLA 1TEZA 1PTJA 2V59A 2VF5X 2NW6A 4IH9A 3E58A 1DKOA 3G6KA 1SJ9A 4NENB 5J1TB 4BLRA 4BNDB 3BL5A 3VNRA 5E3HA 4C7OB 4RIEA 3OEED 5IT5A 2RGWA 4L72A 2G17A 3S5JA 5ITWA 3A36A 5JQGA 3ZWYA 3HDYA 2YMPA 3COVA 3A4TA 3CNOA 4F3KA 2EKPA 3VSEA 3WZMA 2DGDA 1LNQA 4BBAA 1BWRA 1U4NA 2XT6A 3F7OA 5JEEA 4G41A 4DWOA 1FFSA 1JNXX 4TLMB 3UJCA 4DDVA 5KHLB 3R9IA 2NQ2C 5KYXB 1EK2A 1YUBA 1PTKA 3BCHA 3FAZA 5JI3E 3KJEA 2GHIA 3N39C 4F3CA 3KBBA 4TMKA 1Z8NA 2H00A 4YTEA 2R7MA 1AN9A 1Z08A 1N0HA 3AUJB 3BE6A 4OUKX 3RRBA 4FKZA 2IEDA 1RQ7A 2LIVA 4X3CA 4KQHA 1TNDA 5CT6A 3TIFA 1OB5A 3L4SO 4DCMA 2O1SA 2GA8A 3B70A 4XVHA 2FMXA 2RBKA 2YFQA 3NBMA 1T4GA 2P7IA 3H5IA 1N77A 3NFRA 3CLKA 2ERYA 3GJ6A 4HD8A 1T29A 1V3QE 3JQQA 5KQSA 5TQ2B 4EKEA 3KOUA 1ZD3A 1FNSA 5HFNA 2OWEA 3EJ6A 5A4AA 2AWNA 3L79A 2WSYB 2CLFB 4FGJA 1I3CA 5B6PA 1X39A 4QKQA 5TR9A 4QBFA 3ZN2A 3NBQA 1NQWA 2GNOA 3KXPA 4FW8A 1MX1A 1NBIA 4RTSA 2W4IA 4LTNA 1CRZA 4RTRA 3WA7A 4AICA 1KYXA 2X2EA 2PE5A 1U8CB 1L5OA 1XZHA 1Z3IX 3UBMA 5DBOA 3FPGA 1E6KA 2AD1A 3RREA 3NTOA 3P9SA 2BSAA 4OJYA 2BP7A 4PPQA 5DH9A 3O83A 2OHHA 3LD9A 4E2XA 9LDTA 2I33A 1GPH1 1YBFA 1YZUA 2CHUA 1BJRE 3GMDA 3K4HA 4KLAA 4MI6A 2AJBA 2FR8C 3KQWA 2X2PA 3TW6A 5EC8A 3O3OB 3ZIUA 4CMBA 2IH2A 3Q98A 2OSVA 5IBQA 2Z6UA 3STYA 3AXTA 3K9HA 4K9OA 1K8ZB 1IHUA 3HXPA 5IJWA 5PNTA 1IXKA 1JHDA 1EU1A 2RHHA 3BILA 3LC7O 3EEQA 3VKWA 5AVUA 1M8JA 2CJYA 4G81A 2X0EA 4EG6A 4C4XA 2Y1EA 4PLPA 4YT2A 2DT8A 2PGLA 1FYVA 1ZN2A 1ZVMA 1UOQA 2JJ1A 1GFZA 2HHLA 5D85A 1DB3A 4MV5A 1PRYA 3AUYA 3UGJA 1OFVA 3L7DA 2V4ZA 3OQ1A 4OXYA 3DZDA 5LA6B 3SZLA 1GZ6A 1U0BB 4DQ0A 3PVZA 3K31A 3FBTA 1ZCAA 4ATNA 4PLFA 4N3CA 5H16A 5JV5A 3USZA 3TFOA 1OBFO 1WMFA 4DMGA 4JI7B 5JSHA 1XCMA 1SZPA 2X5OA 2BFEB 2CHQA 2PZ8A 5EHNA 5HP4A 2VNJA 3TGLA 1J0CA 2IIBA 1N34B 4RSMA 5F35A 2Q28A 3IOEA 2G1PA 3VTZA 1NMXA 2JGRA 5AK0A 4I08A 4QPZA 1F2VA 3VYVA 3K70D 1JG7A 1SVOA 3GZ4A 2ZG6A 4OGGA 3FPLA 1ZSVA 3E4DA 4KO2S 3M1LA 5DSTA 1JSCA 2JLQA 4M21A 2WI8A 4ZO6A 4HGPA 1G16A 1K2WA 2VYCA 3MELA 3EBLA 4BEBA 1VCIA 2H92A 3X43A 1VLQA 1CFJA 2IQIA 3H13A 3HJNA 1QMPA 2WG1A 4UUBA 4EA9A 4NDNE 1WB9A 4Z9FA 5B30A 4KBYA 2IS6A 4GMDA 3KXIA 1UR5A 1E8NA 1A72A 4G8JA 1MEOA 3QVLA 3U6KA 4LVNA 3TTXA 4OHZA 4C5AA 3D0OA 4UTVA 2PX6A 3VNQA 5EJMA 3M6AA 1KEVA 5DYNA 1J09A 1T24A 1DFIA 3O8NA 5JDIA 5LP6A 2B1QA 4OBEA 4BVHA 5JS2A 2DUUA 5J1SB 3F6BX 3I39X 4UAUA 1G1MA 1ILWA 4H27A 5EJ6A 1P9LA 4TKVA 4P4NA 3ZXIA 3JTMA 2GKGA 3T4UA 3T7JA 4A5SA 1RVDA 1XSEA 2CWDA 3GJ3A 4P7GA 1WNFA 1KWKA 4LY6A 3OE1A 4P5EA 5ALDA 3UAGA 1T1GA 3K53A 1B8VA 2OBFA 3URKA 1J5EB 4QOHA 3NNSA 4P5DA 3T34A 3BM5A 1HDRA 1EK0A 2EZTA 4C04A 1FSFA 1U8EA 3N86A 3HYSA 4J7AA 2K2QB 1N0IA 2R44A 2BTOA 5HQ3B 1K06A 5BSGA 2Y0EA 5DEOA 3EGIA 4DC1A 2ZRDA 3A31A 4CM6A 3RKSA 1RXIA 2NMVA 1DC4A 1BO6A 1C3JA 1DAMA 1WXWA 3I2FA 4LOHA 3L4KA 1Y3FE 3HSSA 4NYMR 4FI3C 4LQ4A 3G68A 1GPNA 4X84A 3SBXA 3WTCA 3TLXA 2SNIE 1WQ3A 1NM5A 2DWPA 2M32A 3HJAA 4R5HA 1IQUA 2R5WA 3OQIB 3IL2A 1GEGA 1XDZA 5EHGA 4IGKA 3NVAA 4R1NA 5EXXA 3FNIA 3M49A 3ROEA 2B2CA 2BFCA 1JB9A 3JVVA 3IEIA 5JJ5A 3G2LA 3TSZA 3LC0A 4WSOA 4LNUA 4MV1A 4IV5A 2BFWA 2APJA 4I1IA 4CMEC 2DJIA 4BV3A 4ZVOA 3LIPA 1QRAA 2J07A 3H9UA 2PIAA 1E5TA 1X7ZA 4R9SA 4X20B 3SHOA 1CUJA 1XZBA 5AM2A 4MB2A 4GR4A 1GRCA 4Q4AB 2I62A 4EKIA 2ID9A 1XMOB 2W93A 1KVRA 2V6IA 3AR5A 3FVVA 3PJEA 5YASA 4QVGA 2OQIA 3RNOA 1OOEA 1DX6A 1B23P 4ID3A 2VT3A 1DVRA 4OAOA 4FFVA 4V0ME 3DP7A 1C50A 2AF3C 3PSHA 1A8UA 4DLUA 4O0LA 3ZY6A 2NU7B 1F0PA 3PE6A 1N9ZA 3B9QA 2NZ8A 3MGGA 4HI0E 4JLMA 3RK1A 4KQ9A 3WKAA 4CM7A 4LYFA 4P31A 4GGMX 4CF7A 5AOCA 2QUAA 3LHIA 5HRAA 2HA4A 2B34A 1Z4JA 1J1IA 1CY4A 3JRWA 2Q3MA 4CT4B 1XRPA 2WNIA 3DTVB 3B7WA 2FPOA 1M76A 4KXUA 1U2QA 4ZJZA 2LP4Y 6LDHA 2UXBB 4OO3A 3LFUA 1WXEA 5ILOA 1K4MA 2O48X 2VPZA 2XADA 4MRMB 3A3OA 1AQLA 2QPLA 1BHSA 3IILA 4GYWA 2XE6A 5CT8A 4UULA 1D9XA 1X7YA 4OXQA 4AVYA 5LMUB 2WYHA 1WLYA 5EVCA 1I24A 4PTLA 4KQIA 3CVWA 1GCIA 2P78A 1XFAA 1RM4A 5FA8A 3TFQA 4E14A 1NL3A 1HORA 3EXHC 3WC4A 3ABSB 2DERA 3AF6A 2FP4A 2CFIA 2H2FA 2IUSA 2XCIA 4H1UA 1M6EX 1R12A 3W8NA 1TJ3A 3YASA 3RW9A 4WLEA 4RCYA 3TPCA 1P91A 2R4QA 3MCAA 2BMAA 1RMQA 3TQQA 3TWOA 1U98A 3EVEA 3IALA 2JGNA 3WQQA 4EKGA 4ESEA 5B4UA 1FUYB 3EIUA 2R6GA 1D1QA 1SELA 2QRHA 2XNDA 4NATA 4EJSA 5DYGA 4PLWA 4GXTA 4PC7A 5FWXA 4JLKA 1OV4A 1T0UA 1GN8A 2NUBA 3QWIA 3D7RA 2CXHA 1TT5B 2KLHA 3RV4A 1N2GA 2W2PA 1U63A 4BIMA 1MH9A 4FUTA 2QTTA 4BO4A 2C61A 3PS9A 1UWKA 3SJUA 2FSGA 4ARZB 3P45A 5FYQA 3TOVA 3NZEA 4EPXA 4YUZA 1H6AA 2G9QA 2JVJA 5P8WA 2F8LA 5AQ1A 1S02A 3D7SA 3I0MA 3LA8A 3ZHBA 1WXHA 2XGOA 2CLDX 1E5QA 3I53A 3ISVA 3Q6IA 4FHGA 4BNTA 5LU8A 1HM5A 3KUCA 1YS7A 2IRWA 4OSEA 2PH7A 4TSKA 1Z2OX 1X3LA 3AFOA 3NWOA 3D4IA 3L0SA 3VU8A 4Q9AA 1H65A 4UBIA 2XKKA 4LHZA 5H59A 1YR2A 1CY0A 3EFOA 3PE3A 1FDVA 3DWGA 1FVFA 3GVIA 3IULA 3PIDA 3WO0A 3DDHA 1UAYA 4IIFA 2OZEA 1PR6A 2DHDA 4P08A 3T8YA 2Q62A 4HGZA 4JB2A 2V4MA 4BX8A 5EJGA 3I2HA 3GIWA 2EJUA 3PQ8A 1TF7A 1FDTA 2HHJA 1VHDA 1W5AA 4UW9A 3U17A 1C9DB 3TSCA 1UJ5A 5C9ZA 4DDHA 4LF9B 3JXEA 1M6YA 3C14C 4DZTA 3TDMA 3TOZA 3UH0A 5JYBA 1N78A 4CWAA 5L53A 1ZRNA 2CD9A 5F76A 4RHEA 1EFTA 4JX9A 3N7AA 4CM5A 1H3NA 4RJ2A 3KHKA 2NUAA 4H4CA 1DOHA 2QTNA 4IUYA 1BEEA 1P3JA 4IDDA 3SFVA 3A37A 3K15A 2Y1CA 1YNSA 2WDZA 1QH8A 4BVGA 3AMVA 3T1NA 1JXMA 1E8DA 1WKVA 3EXG1 1II8A 1B14A 3PDWA 3BJMA 4NBKA 4O63O 2H2DA 2BJWA 2Z2JA 5TEVA 1IBKB 3EPLA 1DWQA 3L0YA 3JD0A 4HZIA 4JJIA 5E8JA 2WQ7A 4QQFA 2J3LA 4WY5A 3L5OA 4XZ3A 2IGBA 5FCDA 5BQPA 2XRYA 4DTCA 3H1TA 5CT5A 1DAKA 2H9IA 2IT1A 4N41A 4XJXA 1H23A 5LUBA 4R4JA 2BTQB 4B5LA 5KINB 3PC3A 4MS3B 4JJAA 4MPRA 1KMCA 1PT7A 5KYWA 3LLCA 3PUIA 4FMPA 1XHLA 1P6QA 4D82A 4Q1EA 1E0KA 2OM2A 2JF0A 3AWDA 5A04A 2V96A 2XE8A 4MB6A 1C3LA 1TTPB 4CV1A 4I1YA 1O9GA 1BROA 4DFDA 1NPDA 3Q7SA 5KTSA 3CLUD 4U2BA 4DR6B 3C85A 1ZM2A 2B8TA 4QQKA 1X70A 5TPZA 3W9BA 1JVBA 2B25A 2FN7A 3ILVA 3R20A 4G9EA 4UNSA 1G2PA 1GN9A 1J22A 4B3XA 1HFKA 3KWJA 1EMDA 1AN0A 1QUEA 2BKEA 1Z29A 3N2EA 4WASA 3BWXA 4AN0A 3T4EA 4IWXA 3EIFA 4LFAB 4LYEA 4Z0PA 3K9WA 3B5IA 4JOBA 3C0KA 3N74A 2O05A 3HJFA 2JI9A 2WPDD 1NVXQ 2XXBA 5E1DA 3WMGA 5CD9A 1G63A 3IBYA 1IH8A 2PFGA 4OHOA 1DEXA 1SC4A 3VPXA 2PGNA 1VJDA 1X2EA 2PR7A 2H0QA 3JQ8A 5KSPA 5FBVB 1ANKA 1NFFA 1RZ3A 5EAIA 2VRWA 5JY6A 3K0SA 2UV8A 4TMWA 1JEYA 4WLVA 3KUDA 2XSZD 4B82A 4D3SA 3IAFA 4MINA 1XNQB 2G9ZA 1TK2A 5C7OO 3RF7A 5JC1A 1UC8A 4C6TA 2RCNA 1H66A 4L0DA 1FA9A 2QUZA 3GLRA 1R0KA 3V97A 2Z6QA 1KYWA 4JI4B 1K66A 1J8YF 5IM5A 4L51A 3ROZA 1MCZA 5A5FA 4XRRA 4PSCA 3UV7A 1UJ2A 4Z3DA 4G3XA 4RD2A 1A9SA 4HFRA 3F5QA 4TWZA 5KAPA 1UZAA 3EGEA 4NR0A 1JKJB 4RBNA 2GN8A 3TNDA 2VJMB 3OUUA 2LKDA 1NP6A 3OIFA 1PR5A 1ZK1A 2A35A 2CLEB 2OCLA 2QBYA 2Y66A 1GQFA 3KZNA 1FMJA 4FYYA 2NU8B 4TLCA 2HCBA 3K92A 3E3NA 2VK1A 2PJUA 2FOXA 4GIBA 5CM8B 1XEXA 3HE3A 3TYXA 3ZHUA 3OZBA 5J4LA 5FTNA 1WU8A 4AFNA 2KYRA 3EGDA 4KIJA 5EIFA 5K8TA 1CS0B 2YFKA 3E5RA 4FR2A 4R83A 4UXHA 2IYFA 5HBGA 4BB6A 1LCIA 4DPMA 2WB4A 3PFGA 1Z33A 3MM4A 1JEEA 5AYVA 2CV1A 3FW1A 2W9XA 2IY7A 1OQAA 2P1DA 2ZTUA 4O59O 2I29A 4PG5A 4M0UA 3E8MA 5DN6D 1B41A 2B3DA 2IPNA 2VP3A 3D3KA 1PR9A 3H1GA 3JWEA 3N3AC 4H3HB 5EIBD 5AVSA 4D3XA 4OEHA 2ZI9A 1QOQB 1XJWA 3HUUA 3RC9A 4HBGA 5C3MA 3F3KA 3VMFA 2VRCD 4KBFA 4PZ0A 4XA8A 3L6CA 1B76A 3C1OA 2LUOA 4OM7A 1JE0A 2EAUA 3ELBA 5GONF 3ZU2A 4S1VA 2AG5A 3ABIA 1CULC 1RXUA 1THMA 3JVDA 3QUBA 4MPDA 3S68A 1JA1A 4DMUB 3AVXA 3V80A 1L5LA 1W30A 3ZCSA 2W2KA 4X97A 4R2LA 1FDIA 5AJVB 2QAJA 1RJEA 2QQGA 4U7DA 3MUEA 5JVDB 1JU3A 1QZXA 2JHPA 4RV4A 1IBCA 3OPMA 4FN5A 4QPJC 5E6SB 2RGNC 1L1RA 5KKNB 2AD5A 3B8HA 2XTZA 3F97A 5JSKA 3TMYA 4F91B 5BP7A 1VIYA 1IJKA 1ZH6A 4AWAA 2AZ4A 4L08A 2BH9A 1R4ZA 2X8WA 4RZSA 3WHKA 3QVVA 5KB3A 4PSKA 2QJWA 4EAAA 4DQDA 4MVJA 4C4SA 4EEKA 5AT1A 1H4SA 2Q3EA 4B9EA 4ZPXA 1HI9A 2J67A 4HFJA 3ZKWB 3ZLTA 2EW1A 4R8SA 4PHFA 3NIWA 4OP1A 4R8VA 2UYHA 1W46A 3H99A 3WLAA 5AOVA 5JSUA 3MJVA 4PHTA 5A0VA 2VP6A 3DUWA 2CC2A 2IPAB 3G2NA 3OEHA 1FE8A 1WCV1 3VNBA 4CM3A 4D8YA 2H2WA 1YF3A 4Z1MD 1T1RA 1S8OA 3W2EA 2EARA 3FB1A 2YCLA 3HUTA 4KVZA 4M36A 3ZZNA 4AWXA 1XCBA 3I8OA 3KAKA 2Q4OA 3D2CA 2WOJA 3I58A 2JFVA 4INOA 5T6BA 4YT8A 1CTQA 2DLDA 3PR3A 1L5KA 3JQRA 3P71T 1ZD8A 2IYYA 1M6VB 4RPKA 4ZV4A 5INTA 4ZC1A 2JLWA 1RQGA 1CUUA 2FG5A 2DSTA 2GPYA 2FK7A 3EXEA 4UCQA 5EPUA 5JS7A 5MHTA 1I2DA 2QRKA 3GARA 2I3AA 2JLZA 3NHJA 4Q3NA 1QAMA 1MQSA 1ISGA 2AE1A 5F52A 2FK8A 1XEWY 3KIPA 1A2OA 1K98A 4OGKA 2AFIE 4YY3B 4NCAA 2D5IA 3LTEA 3EIEA 5CNKA 2C8JA 1ODFA 2WJVA 3H9JA 4FN4A 5FOWA 2C58A 3WBJA 1T8PA 5E1OA 2WINI 3DTYA 1SQ6A 1KMHB 1V4NA 2VNAA 2XUFA 1M34E 4YMHA 1ZVQA 1CUSA 2J1LA 2JD0A 4OIFA 4EBFA 4CG2A 1PJ3A 1H4VB 3CEMA 4ERXA 3BJZA 1J33A 1Y4SA 1CUYA 4NBNA 1RTTA 4MWZA 3THWA 1MJGA 3DDNA 2PU7A 3D3WB 2I76A 4J94A 4A6EA 2H3HA 1KWGA 1SK8A 1ZMBA 2XXJA 3QWBA 1QIKA 3Q8LA 1LKZA 4IIDA 1UBNA 4TLBA 1BWSA 2AG6A 5AKXA 4YH1A 3H19A 4JJZA 4B6JA 5I9LA 1ZP6A 3DE2X 5KCMA 3DW3X 2H18A 2IP2A 4DLNA 3I64A 4G0YA 4JBXA 4KU4A 3OJXA 4MS1A 2PPVA 4W7SA 1MABA 4YRFA 4MRAA 4LC1A 1W2HA 4JWKA 2CMDA 4J8PA 4N0EA 3FPCA 4YJHA 5AKKA 3DE4X 3PJDA 1GZ4A 3IAS1 3WBKA 2Q3FA 1VECA 2X3FA 5JOQA 3HUEA 3RSLA 2OG2A 3W5SA 1VBFA 2PVPA 5LMCA 1NONA 1ISHA 5BNIA 1XAHA 3WGMA 1ZRMA 5TDHA 1T5OA 3U3JA 3FZNA 3KUKA 3O26A 1GLGA 3R6TA 2IPMA 2EIXA 2DTXA 2P69A 3AI3A 2BGRA 1KRHA 1QZTA 3GG2A 3I01M 5AK5A 5EE0A 3HR4A 3VR0A 3VR3A 2DETA 2FLVA 4LHWA 4GOND 1SBTA 5IPFA 1UK7A 1GU1A 2H4XA 2XI4A 2G67A 2PQMA 1K8QA 2DG2A 2WRZA 3LK6A 3OLXA 4U6NA 4URUR 4A2WA 1K5PA 4P82A 3UMJA 2I6FA 4KYVA 2ASVA 3F78A 1F20A 3MJHA 3MJFA 5FV7A 1J2JA 5DW3A 3W8EA 2O5CA 3KQUA 1UZNA 3P19A 4X00A 1CSEE 2A6PA 4Y0VA 4YPOA 2W4MA 4YWJA 1NNUA 2JAHA 4DA6A 4DA8A 4ITUA 5L51A 4WECA 3D02A 1NI5A 3FSEA 1GNQA 4Z7QB 3VR4H 2VNSA 4MDHA 1U3DA 2QNIA 3E3AA 3O1HB 1QG6A 4Y9SA 4FK8A 1G19A 1X7HA 3H2KA 4FJ1A 3VI4B 3C2QA 1A8IA 5JQGF 3DJYA 5I45A 3UWKA 1DU4A 1X19A 3B82A 4R1OA 3OQOA 1C0EA 4PTYA 4U2KA 5MFPA 3LT5A 2FEMA 5AKYA 4ZVKA 1EX9A 2CL0X 1DC7A 1XRJA 2QUIA 4PY2A 2FN9A 3EDOA 4EQZA 3FR8A 2WU1A 2ZSFA 3EGCA 2H1WA 3HCNA 1E1CB 4ZYWA 4X94A 2W6JD 3GFFA 2HU5A 1MRZA 1R3UA 1HX7A 4V2UA 2PPLA 1QX4A 4MW7A 5TQ0B 4PYLA 4KNWA 2ZRNA 4Y30A 3ORFA 1CJBA 1WWKA 3E9ZA 3VPCA 5IX8A 3IP9A 1H1TA 2JNWA 4OY3A 1BX1A 3B12A 3M33A 1YVUA 1WD7A 3ZDBA 4QBHA 3ZG6A 3TQFA 5JUWA 1CV2A 1WOMA 2FMTA 4RK1A 4UEOA 4ZV9A 5HK8A 4B7XA 1E7SA 3JQEA 1NMZA 3U4QA 3TUZC 2B4TO 4ZKDA 3T35A 3EIHA 1NJ1A 4IDPA 3RKRA 1RRKA 3E82A 3FX2A 5A1TA 3QNUA 2JH8A 1R6DA 3HNPA 1CVRA 1YJBA 2YUIA 1YQQA 1M1UA 5JNWA 2R8RA 3IQHX 2D5CA 2W43A 2C29D 2JJ1D 5DISB 4L4RA 3WB0A 5IBCA 5PGMA 4KR7A 1ILEA 3VGJA 4G5OA 2F2TA 1RR6A 3RIGA 3FLEA 1JFRA 3TTYA 3VC7A 4EPVA 2CCGA 2RI0A 1QYIA 3QLJA 1A9TA 3RDPA 1NQXA 3FHCB 5KJCA 1QHIA 3AHJA 4B6QA 3D6FA 3KUXA 2FFRA 1EJ6A 2I4RA 1PGJA 3I8XA 4LVOA 1R4MA 3QYFA 2GD0A 4DLSA 1YS6A 3DB1A 1PGOA 1F7UA 1WPRA 2J0QA 1BDBA 1OXTA 1ZFNA 1WTAA 3PRKE 2YXBA 3H1BA 5EEHA 3VUEA 2WIDA 2EEZA 2FPLA 4GPTA 4MV0A 4YJ3F 4BNKA 3WADA 4EL0A 2C3PA 2P67A 1E9RA 2ZE6A 1POWA 3L0ZA 5F23A 1W8IA 4I66A 4N65A 1XEAA 2BMWA 1KO7A 3ESQA 1DBVO 1GRRA 1R88A 2Q1SA 3D7KA 1OC2A 1T2NA 3GYGA 3Q4GA 4MR8A 2POCA 4D7AA 3I3OA 4ZOEA 2ZBUA 3CVYA 2ZJFA 5EMJA 3F6SA 2QRGA 2XMBA 3FR7A 1HNXB 1GAXA 3HCWA 2VP2A 2NP7A 1E2HA 5CIYA 3WJ1A 2BISA 1KMMA 1JZQA 1KMIY 1Q17A 1KYZA 1U9JA 2QTGA 1DKUA 2X8JA 3CLTD 1IRXA 1USUA 1KU0A 3JR7A 5ALHA 2FQYA 1ADBA 2IW1A 4XIIA 2LRHA 1UL1X 1OZFA 4N5LA 1W2WB 4BQRA 2RHCA 4EUHA 5I9IA 3SIRA 3DL7A 3IHLA 4II2A 1GTZA 4WLUA 1VLVA 2D8AA 4FWIB 5F1KA 1M74A 4KN6A 4FYWA 4MO2A 3R7WB 1QGUB 4A27A 4BFCA 1EHIA 1FU4A 4CKEA 4HEJA 2YJZA 4YAGA 1E9BA 5DSXA 1ONBA 3GLTA 4RF5A 4K3VA 3MQ2A 2B4KA 3NHKA 4XDGA 5EKTA 5LNK6 2YICA 5T7BA 1S8AA 2PA0A 4EM6A 5GMOA 3UK7A 1D0SA 4IOJA 1ZYUA 1CC1S 1OAAA 1GAJA 2QX8A 3DO8A 2AOUA 3AL3A 4MAFA 4M38A 1QIHA 1SBYA 4EHAA 1I6LA 4B3JA 5FAKA 2OCYC 3LS2A 3IPAA 1P75A 4V1CB 4XVUA 1YVPA 3O03A 1VZ2A 4NG4A 4E2ZA 5LP6F 2IYLD 5NULA 4AKSA 5E1BA 4GU5A 3ILYA 1CJVC 1J0BA 4MK4A 3PRJA 2JGIA 5GWXA 1RMTA 2RG1A 3QFTA 5ES3A 3RROA 2LDXA 3HCCA 3PR2B 4FDVA 4JR2A 4A2QA 2EDAA 5EJAA 4V0RA 4MUYA 1G21B 1VE7A 2XPCA 1C30A 3OKAA 4R71A 5AUOB 4N6NA 1JAIA 3MCTA 5LKRA 4YRQA 2CB0A 4P4SA 4W5OA 2VBGA 2BKLA 3EEFA 1Q0TA 3D3JA 1IJBA 4EKNB 4GBMA 2ZR9A 3JALB 4LC0A 1JLLA 4A0QA 1P0IA 3IB3A 4RM3A 5DIZA 4UEJA 4KXLA 2YR0A 2NTJA 4FONA 4EMBA 2Z6AA 1OJ7A 1PQ4A 2VO1A 4G4SP 4IEIA 1MB9A 3DAYA 4TZTA 3MPOA 1GSHA 1X86B 3MYYA 5JE8A 3ZJ4A 4V0SA 2XOKA 1IJFA 4A6PA 3K70B 1UMCA 4L9SA 2BFPA 2O6HA 4OAQA 1U0SY 2IZ1A 4L57A 4WBNA 3CRRA 4OBXA 5FBQB 4EZIA 4F9EA 3P20A 3JY6A 1E1RA 1W87A 3CKLA 4R2XA 1NSTA 1HT1E 5EOVA 4CI0B 3V9AA 3WWYA 4M0KA 4FUQA 5ITZB 1IWOA 1KP2A 2HZ7A 3PFIA 4N18A 4WKPA 3CF0A 1A82A 3W6PA 4E4TA 4IS3A 4R6XA 2NN3C 1H2WA 2DY0A 3CZMA 4RSHA 3CKYA 4XYGA 4WBSA 4WOJA 3BOSA 5HWSA 3PKZA 1LPAB 4MMXB 3RB8A 2FEWB 3CR7A 4MVJG 4G5YA 1WUHS 4EVQA 3V00A 2G82A 1VLHA 2HSWA 1LBQA 2PK3A 3FWHA 4AJIA 4JY7A 2Z4TA <