2KW5A

Solution nmr structure of the slr1183 protein from synechocystis sp. pcc 6803, northeast structural genomics consortium target sgr145
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
202
structure length
202
Chain Sequence
b'MWDERFSQSEYVYGTEPNDFLVSVANQIPQGKILCLAEGEGRNACFLASLGYEVTAVDQSSVGLAKAKQLAQEKGVKITTVQSNLADFDIVADAWEGIVSIFCHLPSSLRQQLYPKVYQGLKPGGVFILEGFAPEQLQYNTGGPKDLDLLPKLETLQSELPSLNWLIANNLERNLDEGAYHQGKAALIQLLGQKLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Slr1183 protein
molecule tags Structural genomics, unknown function
source organism Synechocystis
publication title Determination of solution structures of proteins up to 40 kDa using CS-Rosetta with sparse NMR data from deuterated samples.
pubmed doi rcsb
total genus 39
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2kw5A00
2ONYA 5GM1A 2PXAA 3AWIA 1QAMA 1VL5A 1R18A 1JG3A 2ZSUA 1ZKDA 3GGDA 5P8WA 1P91A 4E31A 2N47A 2OYRA 2BR5A 9MHTA 2JJQA 3DOUA 4FSDA 3A7EA 4LECA 5MHTA 2FK7A 5FTWA 3HVJA 3SSOA 1IXKA 3E23A 5CVDA 3EMDA 2XBMA 3NWEA 4QTUB 5FUBA 2UYQA 1VP9A 3OE4A 1EQAA 2HV9A 3PTAA 2XYRA 2DPMA 2XVAA 5K0BA 2NNWB 1XCLA 3TM5A 5EG5A 2FCAA 2FRXA 3E7PA 3LDGA 4IV8A 4PYQA 5K0FA 3H2BA 4GF5A 4X61A 3DTNA 3KQOA 4K6MA 1H1DA 4CKBA 1ZHFA 4QTTB 3V97A 5EMJA 4FSXA 1KPIA 3O31A 3I53A 3PLAE 3FTCA 2P35A 3GRUA 2WK1A 2YVLA 3KR9A 5E9QA 4OQEA 4X1OA 5DM2A 4X41A 2AOUA 3BGDA 4P58A 4PCLA 5HIIA 5GIOE 3VC1A 3HTXA 5K0EA 5K8VA 3TKYA 4RVHA 5FULA 3P2EA 1EG2A 3B89A 3TLJA 4V0QA 2VDWA 3NVMB 1DCTA 3DULA 3BWCA 3LKZA 4HH4A 5KYGA 3KQMA 1KR5A 4OQDA 5GP1A 2CKDA 3NJRA 3UJ7A 4F86A 3K0BA 1X1BA 4PNEA 4P7GA 4WVLA 3MTIA 2EJTA 4IV0A 3SSMA 2ZZNA 4FR0A 2G8NA 2ERCA 2ZIFA 3GIWA 4PCAA 4RTNA 1KHHA 3GRVA 2NXEA 5LQNA 2OY0A 2FK8A 5K03A 4DM3A 4EKIA 5KVAA 2CL5A 2NP7A 2ZTHA 3LDFA 3ORHA 2IP2A 1AF7A 1JSXA 2QM3A 2ZFUA 4R05A 2OXTA 1U2ZA 1YZ3A 1R6AA 2VDVE 4B17A 5FA8A 3I58A 4OA5A 4HG2A 1NE2A 3G2QA 3SM3A 1JQEA 2VZ9A 4ER5A 3G8BA 2AN4A 4PYJA 4QQKA 2FHPA 3T7SA 4BLUA 5DLYA 3NW9A 1NBHA 3KQWA 3KQYA 2UYCA 5HFJA 3TPZA 2ZW9A 4DA4A 2C7RA 2JHCA 4RSRA 1O9GA 5D1NA 2ZWAA 1FP2A 1XCJA 4C06A 3MERA 3B7PA 5KS2A 4PYOA 4EK9A 3X0DA 5LSAA 3CJRA 1D2GA 2O0LA 3FRHA 5T64A 3M4XA 3BKXA 4M36A 3TMAA 4FS8A 1DUSA 3OCJA 3KPUA 3PFHA 4JXJA 5DXAA 4WXHA 1EAMA 4FGZA 4HTFB 4AUKA 1F38A 2FYTA 1HNNA 1FBNA 5LQJA 5E1DA 5HIJA 2JHAA 4RVFA 2JG3A 4C08A 5HIKA 3G5TA 4QDKA 4RX1A 4PWYA 3M6VA 5E8JA 4AZWA 5CUQA 2NP6A 4HRAA 4YV1A 2JH8A 2IH4A 3M6XA 4RTRA 1EJ6A 5HIMA 5G02A 3DMGA 3I64A 2F8LA 2GPYA 1WG8A 1R8YA 3LECA 3OFKA 2C7OA 4M7RA 2ESRA 3BWYA 4P7KA 5ICEA 1ZG3A 2AZTA 3FRIA 3LKDA 3MCZA 1D2CA 4C04A 3FPEA 2OPBA 3R0QA 1XTPA 4MIKA 5K0CA 1HMYA 2PX2A 2PX8A 1F3LA 2QY6A 4DF3A 2PV0A 4YUXA 5K0GA 2YXEA 3G89A 1BOOA 3UJDA 1I1NA 3LBFA 2BR3A 2ZBQA 4MQ4A 3UWPA 3OU2A 3ANXA 4YUWA 3L8DA 2AOTA 2EG5A 3FPHA 5DTMA 5DXJA 5K01A 1VP3A 2I62A 2P40A 4BY9E 3BWBA 3MGGA 4DCGA 3R9XB 3Q7EA 4RV9A 5E9WA 5C1IA 4QVKA 3IEIA 2O57A 2JHPA 4ER3A 2O06A 3P97A 5DM0A 3S68A 3EGVA 5CD1A 5DT2A 3KQPA 3TM4A 3WSTA 2B25A 1YFLA 4NECA 2V74B 3JWJA 4ER0A 5CCBA 1R74A 3BGIA 1MHTA 2P3LA 2K4MA 3G2OA 3JWIA 4GEKA 5CVUA 1SQGA 5EOVA 3UA3A 1O54A 3UJAA 5JR3A 2VDUE 3C3YA 5FCDA 1G38A 1NT2A 3VYWA 5EVJA 3R6TA 3TOSA 3OZRA 4QPNA 3ELWA 4KIFA 3HCEA 3UA4A 1SVUA 5F2NA 4GQBA 2C7PA 2P7HA 2PVCA 5DWQA 4FT2A 2XVMA 4FP9A 3GRRA 3P9CA 3CKKA 1VBFA 1WXXA 3EVZA 3HA5A 4P7JA 3BXOA 4DCMA 2GH1A 3FTEA 3BT7A 3TRKA 1XDSA 4BLWA 1T43A 1OR8A 3PT9A 5DX8A 3EVCA 3EVDA 4GC5A 5FQNA 1TW3A 1P39A 5K0NA 4OBXA 1Y8CA 2Y1XA 3VSEA 5EGSA 5BXYA 2ZZMA 3KKZA 1YFJA 1P1CA 4PGHA 3NTVA 5GWXA 4CTJA 1N7JA 1VE3A 3MHTA 2AOUB 2ZZKA 5EMLA 4IKPA 1D2HA 3EVEA 2PWPA 1P1BA 4MTLA 5E1MA 3T7TA 1BKYA 5K0JA 5DRTA 3GO4A 1RJFA 5CVEA 4YMGA 5HZMA 3SGLA 2AVNA 2YQZA 3NVKI 2ZWVA 4G56A 1RJGA 3GNLA 5EZQA 1WZNA 2HNKA 1UWVA 5HEKA 5FWAA 4E32A 5EEGA 5EKUA 3A7DA 4RVGA 3CJTA 4E70A 2Q41A 1AQJA 4RTJA 1YF3A 5EHGA 1NW6A 4BP1A 2IH5A 3EEYA 3QOXA 1JQDA 2IIPA 2BR4A 2NXJA 1NW7A 5EC8A 1NW3A 4M38A 3I5UA 1WXWA 3ELUA 1NV9A 4V0RA 4Y2HA 2XYVA 2OB1A 2AOXA 3HNRA 1KPHA 2CMHA 2PGXA 3NWBA 3RW9A 1NW8A 3IYLW 5HOQA 2P1DA 3RIEA 4IWNA 5ERGB 2UYOA 3FYDA 4GOMD 4GOOD 3FPGA 4XUEA 5H02A 1KIAA 4YUYA 4F84A 3UFBA 5FHRA 3PX2A 4RTQA 4LWPA 1JG2A 1FP1D 2ZVJA 2AOVA 3T0IA 2PJDA 3HCDA 2O05A 1KP9A 3SX0A 2G1PA 1QANA 2VP3A 3MAGA 3GJYA 3DR5A 3LDUA 4X63A 5CVVA 4KVZA 4YUVA 2QRVA 4KRGA 3UZUA 3PFGA 3GRZA 2P8JA 3Q87B 5EEHA 2I6GA 2ZIGA 2IBSA 3LHDA 4A6EA 1X19A 3C0KA 1EJ0A 2ADMA 2AOWA 1ZGJA 1JTEA 3FTDA 4EKGA 1BC5A 5KQRA 3R3HA 4YUZA 5LQUA 4CXMA 5K05A 1AV6A 2ZBPA 3C3PA 3REOA 4HTFA 4RTKA 4C4AA 4UOEA 1L3CA 2OO3A 3E05A 4AZTA 3HVHA 3LSTA 2YX1A 5GIPE 4PINA 3VC2A 4RTMA 3KQSA 2P41A 4PONA 2H11A 4RTSA 1M6YA 1N7IA 5F2KA 2ZIEA 1JG1A 4U7TB 3MCTA 5EQJB 3KQVA 2EFJA 5DX0A 3CJQA 4GBED 5ICGA 1RI1A 2H1RA 4PYLA 1G6Q1 4HGYA 3SSNA 2HMYB 1G8AA 5FA5A 3G2PA 1QAQA 4RTPA 4MWZA 4KDRA 3B3JA 2PSSA 4C03A 1SG9A 3B3FA 1UFKA 3PB3A 3FYCA 4PYNA 1XVAA 2O07A 1SKMA 2BZGA 3M6WA 5DSTA 3TFWA 3OU6A 4ATNA 5BP7A 1R00A 4OBWA 1L9KA 1XDUA 4GOLD 3UJBA 3HEMA 3P9NA 3ELDA 3GDHA 3G2MA 3R24A 5E8RA 4PIPA 4X60A 1VIDA 4HGZA 4R6WA 3CCFA 3DXYA 3LX6A 5E1BA 5FQOA 2B2CA 3V8VA 3ER9A 1KXZA 5EPEA 3A26A 1VLMA 3GXOA 5U4XA 1YUBA 2NXCA 2YTZA 1SUIA 3LL7A 3HVKA 5E2BA 2WA2A 4POOA 1JG4A 3PVCA 3KR1A 1RI2A 2ZCJA 2Z6UA 1RI4A 3C6MA 2ORED 2PXCA 5LQKA 2IBTA 1FPQA 2NXNA 4QQNA 3T7RA 4ER6A 3EGEA 1NW5A 1ZQ9A 3CBGA 4E30A 4DMGA 2PT6A 3AXTA 4QPPA 4QDJA 5BW5A 3GRYA 2PWYA 1I9GA 1L3BA 3D2LA 3EVAA 4P7FA 3M70A 4R6XA 3EVBA 3SMQA 3AY0A 5HILA 5C0OE 3FUWA 1R8XA 3SXJA 3TKAA 3EVGA 1YZHA 3B5IA 4R8RA 3FUTA 1UIRA 3A4TA 5FHQA 3QV2A 3KR2A 4QVGA 2ZULA 4RTLA 5D1HA 2NYUA 5DSXA 1WS6A 3LCVB 1IY9A 2ONZA 3IV6A 4O29A 4KWCA 2UYHA 3LBYA 3LPMA 2PY6A 3FUVA 3G7UA 4XUCA 4EMSA 1NBIA 4EQZA 3ELYA 1G55A 1G8SA 2PBFA 3KPWA 5LQAA 1JSZA 5E2AA 4MHTA 1RJDA 2IDJA 4CKEA 1YB2A 5M5BA 3SVZA 1O9HA 1PRYA 4HC4A 5EIWA 3EGIA 2IPXA 1Q0SA 2AN3A 2WA1A 4HSGA 4Z2YA 4XUDA 3G88A 4M37A 3HVIA 5CM2Z 1M6EX 3DLIA 3OZTA 1ZGAA 4RYLA 4PIMA 1X1CA 3DXXA 3EMBA 3GU3A 2B78A 3LCCA 4PGGA 4R8SA 3FTFA 1BHJA 5JUWA 3OFJA 3HCBA 3UJ8A 3DUWA 3HCAA 2IFTA 2PX5A 3DMHA 5T67A 2GA9A 3HA7A 2H00A 2QE6A 5FADA 2IGTA 2I9KA 3F4KA 5E1OA 4DQ0A 1XXLA 3UBTA 2G71A 4LWOA 5EZSA 2FPOA 3OPNA 3OU7A 5GM2A 1INLA 5KQSA 5CCXA 2YXDA 4F85A 4EVIA 5LQCA 1VPTA 5EIFA 4AX8A 4ISCA 1N2XA 1G60A 3FZGA 3G8AA 2HWKA 3THSA 5F2OA 7MHTA 3P9IA 3M33A 1SUSA 3UJ9A 1M0EA 3RODA 1TW2A 2IDKA 2DULA 3JWHA 2QYOA 2VS1A 3KU1A 2QRVB 1QZZA 3HCFA 1AQIA 2P7IA 5T6BA 2HTEA 2LD4A 5IKMA 3NDJA 3JWGA 2ZLBA 3BGVA 2AOTB 1RI3A 2JH9A 1XJ5A 2I7CA 3HM2A 3K6RA 1DL5A 3THRA 4YV0A 1FJXA 2Z6AA 4E2YA 2UZ4A 4C05A 4ER7A 4BLVA 3TR6A 2AS0A 3AJDA 3BUSA 4LG1A 2P3OA 4AZVA 2Z6QA 8MHTA 2PLWA 3KQQA 1SQFA 3E8SA 5E9JA 5B1SA 3CC8A 2BH2A 5FWDA 4GOND 3ERCA 3G5LA 3MTEA 2A14A 3P8ZA 2PKWA 3OE5A 3P2IA 5DM4A 1JTFA 3UJCA 2BM9A 4E2XA 3QOWA 5EHIA 4U7PB 3EEOA 5CVJA 4E2ZA 1V39A 2G72A 1KYZA 2BM8A 4KDCA 3ER8A 2IH2A 3P2KA 4OA8A 3LGAA 4AZSA 2HR1A 3EVFA 1RI5A 2XYQA 4FZVA 3P9KA 4C07A 4KIGA 1ORHA 2G70A 4Y30A 2OBFA 3EPPA 3DP7A 4XCXA 1KPGA 3PS9A 4GC9A 4RVDA 5LR6A 3DXZA 4RTOA 1VQ1A 5K0LA 3OZSA 2GLUA 2OKCA 3KR0A 1MJFA 1KYWA 2GS9A 3C6KA 4E33A 2CWWA 1TPYA 5EKXA 4CTKA 3SR4A 3NMUF 3M6UA 3HA3A 5K09A 3B3GA 3KPJA 2AN5A 4A6DA 4DKJA 3P71T 4ZTBA 3TQSA 4PYKA 2YUIA 2EJUA 4GUAA 3GCZA 2EX4A 2YXLA 1RJEA 3KQTA 2AR0A 1EIZA 2KW5A 1IM8A 3BZBA 5ICCA 5CIYA 2PX4A 2OB2A 3KPYA 5GOZA 3IHTA 1QAOA 4BP3A 4OX9Y 1JR4A 4L7VA 5DX1A 3A27A 2Y1WA 4PYIA 1L1EA 4YV2A 10MHA 4E2WA 3MQ2A 3HP7A 2R6ZA 5DPMA 5GINE 2V7EA 3BKWA 4KW7A 5LQRA 2GB4A 1NV8A 2P3QA 4H0NA 2PXXA 2PT9A 2CMGA 2B3TA 2AVDA 1NKVA 4CWAA 1Z3CA 3AXSA 3CGGA 3I9FA 4CKCA 1B42A 3DMFA 5IH3A 3DH0A 2GAFA 5DM1A 3DLCA 3PX3A 5EMMA 1PJZA 3KHKA 2R3SA 2OZVA 3FUUA 4YMHA 1ORIA 2E5WA 4DZRA 3O4FA 1XDZA 1JQ3A 3CVOA 3O7WA 3BWMA 3FUXA 3ID6C 2C7QA 1WY7A 1QYRA 3MB5A 3FPFA 3NDIA 3KPVA 5C9ZA 5DRYA 3U81A 2YR0A 3FPJA 3GWZA 5ICFA 1X1AA 2B9EA 4PYMA 4RWZA 5BW4A 3LCUA 5DTRA 1X1DA 1I4WA 5EMKA 1Q0TA 3ME5A 4FT4A 5DTQA 2ZBRA 3A25A 3UJ6A 1L3IA 3HCCA
chains in the Genus database with same CATH superfamily
4NU8X 4GR5A 1DARA 2QM0A 1YBFA 3GOQA 1XBTA 3C1UA 3RS3A 2ERXA 3BD7A 1D6MA 4CQMA 3IFSA 3FCOA 3CIOA 3OZUA 1BX0A 3DOUA 3QH4A 1MC8A 4HH0A 4E88A 2JAHA 1GTSA 3H1FA 3HVJA 4OLAA 1YBHA 4Z0TA 2V7QA 5HWSA 1YZTA 1GG2A 3QTTA 4NPAA 4IXDA 4P3NA 2UYQA 3UM9A 1XHLA 3G0GA 5C46F 3LT0A 2OZKA 3IR6A 3OPQA 3WQSB 1BXKA 5JYDA 4DABA 4MHSA 1JAXA 4GF5A 2YKGA 2QVZX 3EVTA 3KQOA 5CHYA 2J9ZB 4QTTB 3TCNA 3UMJA 3V1KA 3T6KA 3VR5A 3RTCA 1U9IA 2YNMA 4NBUA 3PPXA 4JLSA 1NBWB 3QITA 4JFRA 3S2YA 5H7XA 4X1OA 4BKUA 1YVUA 4DMLA 3A6LA 3COYA 2IOFA 1Z12A 4XCVA 4W5QA 5DBHX 2QP9X 4U9IS 1V5GA 3SZGA 4Z7OB 1CERA 4M1EA 1UXGA 5LLSA 1VJCA 4KE8A 1MAAA 1XF9A 1WM1A 4B33A 1DWPA 2FETA 4KTTE 4MTCA 3SIWA 3KVOA 4ENTA 1VRVA 2ZBUA 1PKEA 2E6UX 4XIYA 1ZRSA 3WGMA 3LKZA 5KYGA 4ZYTA 1GA4A 4HZIA 4PZDA 1FDWA 1V5EA 1V37A 2V6BA 1RVDA 2IY7A 3SP1A 4DQXA 1KK1A 4PNEA 5FEUA 3LH5A 4ZGBA 2FZEA 4LOHA 5CLGA 2EFYA 4RTNA 3ILXA 3WSWA 1QS0A 5FA6A 1KHHA 1T9DA 4DILA 5KO2A 4MHTA 1DOAA 5EJAA 1WP4A 4GUDA 4MDEA 1TX4B 3PLNA 2O59A 1D2NA 1AF7A 4F9EA 4ZVLA 1WNFA 2OK7A 3OTQA 3ZE2B 4D9GA 1V25A 3IT2A 1ZU5A 4OP3A 1NR5A 3WL8A 5ADWA 3G2QA 5EZ5A 1BD4A 1QFSA 3AMVA 1R4ZA 1W25A 4NNJA 5DLYA 1UDAA 2C88A 2EDAA 2C7RA 4RKEA 1A1VA 1N1GA 1ARZA 4S0ZA 2YDYA 2O4UX 5EJ6A 3A32A 2AIRA 4UTZA 5E4TA 4ZT5A 1T4CA 2VUTA 4BJHB 1K5PA 1XZKA 1LBEA 4B3MB 1DIOB 4CM9D 3TMAA 5A4JA 4HLUA 2WM3A 3DNMA 2BFFB 3KHTA 4IIBA 5KWIA 5KNLA 1BCSA 1L7NA 1X9GA 1USVA 4FZ5A 3LVBA 4ILKA 1Y5LA 1THMA 1WMSA 3GQBB 1WUTA 2IPLA 3WNVA 5HQTA 2XNCA 4EAQA 1A2QA 4L0CA 3D0OA 4MQ5A 4QJ4A 4GYJA 4Q1FA 3HN2A 5KNBH 3WK4A 4RTRA 4RD1A 2ZUFA 2DWOA 1ZO8A 3D43A 3OHSX 3NJ8A 3GVXA 3T7KA 4CQMB 2FR1A 1AF4A 4K8RB 5KYVA 1P8JA 1T8YA 2IHKA 1MO6A 2X86A 3IXLA 3WBKA 4KGDA 5A5EA 2JVJA 1FFSA 2W90A 1JSRA 5CB6A 3ZU5A 4O1MA 1BVUA 1T4DA 4PPGA 2QG9A 5IJ0B 1JFLA 2EL7A 4JDUA 3LNTA 2D13A 5UKDA 1QCDA 2ZBQA 4MQ4A 4RD3A 4TV8A 1PD1A 2CV2A 3FYUB 5KJCA 2FZCA 2GOYA 2EG5A 3LFUA 4BN4A 4P0PB 2GKGA 3ETNA 5M04A 3NDBB 1YC2A 2VG8A 1GQ2A 3MGGA 3PQDA 4U7DA 1W93A 1AKTA 1I2ZA 2XGGA 5FLEX 4NCAA 1KJIA 1N5KA 4N18A 1YRBA 3JYNA 3BFPA 1K08A 2ZIWB 5DYYA 1KZHA 5A5FA 3UPTA 1NT4A 3SICE 2P1RA 3TEJA 2O2YA 1XAHA 4DYVA 3P5BA 3JWJA 1FW6A 2UUPA 4C20A 5BUSA 3G2OA 4YMLA 4BLVA 4LF7B 4KRXA 1M8FA 5A4AA 2X13A 3GV0A 4NZOA 1RPZA 3T1YB 1G38A 1ZXXA 2J07A 1IOZA 1H2XA 3H1GA 4H0CA 5KJFA 1ZM4A 3GGGA 4BS9A 1JBKA 4KH0A 4QG3A 5K2OA 3TUJC 1PT5A 4NARA 1JJ7A 3P9CA 1RABA 4HQRA 4FKMA 4CR8A 4ZOEA 1E59A 1XU4A 5FO0A 1CUYA 1TAGA 2VPXA 3HN6A 1T1JA 3D8BA 3Q9SA 2XMZA 3TRKA 4K1XA 1MB9A 1Q3KA 3A6DA 4GWKA 1L4MA 5ECGC 5KBYA 4QVIA 1UDBA 1T25A 1P39A 1GCAA 4TM7A 2A3RA 4XYBA 5IU6A 1GCOA 3QPDA 5A71A 3T61A 1GAJA 1ZBDA 3OOHA 5AVZA 2ZZKA 3PGXA 5A7GA 1XZBA 2NO5A 1Z0KA 1GZ4A 2B8WA 3IQZA 4EMUA 5KYWA 3GVPA 3Q11A 2QPOA 1OHHD 4YJKA 3H3XA 1Y63A 3OJEA 4U3JB 3CRW1 3DOCA 5JISA 2FPGB 1GYPA 2C94A 3Q9LA 4QAQA 4QUKA 3WDKA 4YRGA 3TR5A 1JIQA 3BSWA 1XX6A 5KTMA 1A8UA 1PBNA 2ZUWA 1T26A 4IRMA 1UEXC 1NXOA 3MS7A 2WAOA 2Q6IA 1AQJA 3KT3A 3VR1A 1KSHA 1PZXA 1JHYA 4PEVA 4HVTA 5B57C 4X91A 2VJPA 2Z08A 3AERB 5E6UB 4D2IA 2FMXA 2O7NA 2P4HX 4ZGGA 2CV1A 3I30X 1P6UA 1SVNA 2UZ1A 1QG2A 3SK0A 3LTNC 4XVUA 4JELA 3WV4A 3T8YA 3PRYA 5BQ3A 2DBQA 4P2GA 3ICVA 2BBTA 1K89A 1ZY2A 2P1DA 3RIEA 4AYWA 4D45A 5A4DA 2XZOA 2QBYB 2GEDA 3H9UA 1JZQA 3GGJA 4BRSA 2C1ZA 4QE3A 4DRXA 1T34A 1X39A 3K73O 1PEYA 2VPYA 4XB2A 3G6KA 3SX0A 1SULA 1K6IA 1T8RA 2ZI7A 3BZUA 4FBMA 3KJIA 4R8KA 2EQBA 4Q4AB 1WSDA 1KAEA 4TKLA 2E5LB 1AK1A 3QUAA 4BLQA 4UFOA 4EPRA 4HXFB 1PT9A 1DOZA 2DHRA 1D1TA 1DDIA 5ALPA 1GTMA 4EKGA 3A3YA 4N5NA 4CXMA 4FFWA 4YAIA 3ZEAA 2RD2A 1VKOA 3VSBA 2R6GA 2VPIA 1T15A 3UXYA 5JSFA 4C4AA 1KRHA 1SPXA 3P0HA 2B20A 4AZTA 1WR8A 3S27A 1U1FA 4PINA 3GA5A 1XYVA 1FYWA 1QX4A 1AXGA 3JWEA 4BQOA 5BUCA 5KYWB 4JOSA 1CX9B 4TVOA 4XM2A 3F97A 1SVSA 3GL9A 2VRBA 4C3UA 4DIKA 1DQNA 3GB9A 3D6TB 3PDHA 4Z8XA 1CUVA 3BH7A 3FROA 4LVNA 4PSDA 4RTPA 1S89A 5CEEA 3FNBA 3DCNA 1CP2A 2E82A 2XZPA 4EKNB 1MLDA 3CR7A 3FMPB 4JOCA 1E64A 2RJ3A 3OC0A 3PUZA 4IXMA 4MUGA 1HUQA 4WLVA 4C6TB 2FMHA 3UGTA 4DY4A 1TEXA 4Q82A 3W5IA 1QC5A 1L5HA 4E7PA 4DDWA 5KWVA 3SVTA 4OGWA 8ADHA 1R9MA 2I7XA 3DS8A 4C0SA 2VUUA 1Q95A 4IFBA 1RIIA 3NWPA 4GZ5A 3W6OA 3VR3D 4ARAA 4C78A 3Q9NA 3TZ6A 4EEKA 1S2LA 1G5FA 4D80A 3FF1A 3LY9A 1SHJA 4J6FA 4PHFA 3V8VA 3AYXB 4JJ7A 2ZWOA 5A6SB 3T4EA 3I6ZA 3NM5A 3UF0A 4GBMA 3FPCA 2FEPA 5I7HA 3GW8A 2QSUA 5EZYA 5U4XA 3JAWB 2IHYA 3L92A 4NAUA 2JFNA 1IJFA 2VK8A 2EBUA 3JZAA 3Q2OA 4O63O 4QX6A 2Q45A 2HMVA 3NX4A 1XJCA 4H4DA 4GLFA 3TFQA 3QGMA 3VC3A 4BNIA 2J0UB 4JBLA 1M1NB 3SKYA 3BIWA 2GFIA 5HGJA 3NKVA 5C7IO 1QHGA 3ZJ5A 2XDQB 3G23A 4XIJA 5IBRA 5AKYA 5B3LA 1Q1EA 1YOVB 1UDCA 4AJ4A 2AEEA 1JIKA 1YL5A 3GMDA 4WK4B 3DTYA 4FW9A 3UMGA 1N0HA 1RKQA 1SVWA 2P78A 1L4FA 1U8TA 4EVQA 1TJPB 2I4OA 3TRJA 3M70A 2A9QA 4GKBA 4EDFA 4RENA 4KB5A 2XAAA 3AY0A 5HILA 3TKAA 1YI0A 4KZPA 1NN3A 2Y68A 4ND4A 3UUFA 5J2UA 2QW1A 2VRCD 2G6BA 3RS5A 4U2DA 2VQEB 5HF6A 2EXXA 1FNCA 1KQ3A 3DV0B 3TEMA 2N42A 5GZ3A 2UUBB 2PBLA 2VKQA 4HEQA 1KF0A 2G04A 3A6ZA 1IHOA 1X8LA 3G7UA 3N6RA 4XUCA 3RS7A 4AJPA 1VJRA 3KPWA 4GI5A 4CM4B 5KYYB 1GPUA 4JJKA 1UH5A 5BOSB 3ZQ4A 4MKZA 4D4IA 2EGHA 1ODIA 1J8YF 1N2CE 2WTBA 4H3KB 5CDHA 4QD3A 4P9NA 3T9DA 2YFKA 3V2GA 3JARB 1KZ4A 4OFXA 1HDXA 4TQUS 2X2PA 5FOQA 4ZOLA 3GOHA 2VDLB 4L27A 4ZVUA 1EE1A 1PSWA 5LB2A 5EJ5A 2DQZA 2WJHA 1YULA 1WUJS 5KPJA 2Q21A 1LS1A 1T2EA 1YKFA 2IXFA 2YJ5A 4J0EA 1GQRA 1QRDA 4S35A 2WJ3A 2QE6A 5A04A 5E1OA 3TTSA 2HHLA 5AM5A 1J2UA 2OVBA 3KLOA 3LHSA 3RAPR 1B41A 1Z56C 4CMGA 4YRKA 1GARA 2VAPA 2X42A 4AP6A 2X9GA 3QWAA 4DUPA 4ZI3A 4EFDA 2F9MA 4NFYA 3EMKA 2V65A 5KNCA 4X3OA 2CJPA 5F51A 1XR3A 1H3NA 3HUEA 3LTEA 1J42A 3KB1A 2OHJA 4MW0A 4LRWA 1NKSA 4K6FA 4UOZA 4X92A 3N9IA 4KFUA 4Z9BA 3IOMA 4O4HF 4REOA 3V4OA 3ZHQA 3W5AA 5E4FA 1HETA 3ZZ1A 2WVAA 4DR7B 4WBXC 1JMYA 5EPUA 2OGWA 3FI9A 1PJCA 1FRNA 5LYJA 1MAVA 3UUWA 4WA7A 4BLRA 1RI3A 3ETEA 2I7CA 4AJ9A 2WD9A 3LXUX 4P38A 2NVUB 1G18A 1ADFA 4XQ0A 1T8UA 1E6UA 4ER7A 1T0BA 4G36A 4P53A 1C30B 4OHXA 4PICA 1OC2A 4BNGA 4AZVA 1D4AA 5IJXA 2VCEA 1SQFA 1TU4A 1G8KA 1E2HA 5B1SA 1W6RA 5AYVA 4LKRA 4BC1A 5A06A 8GPBA 5KTRA 1PD0A 2CHQA 5CFMA 4QYWA 3TXYA 1S3FA 2IW1A 5DM4A 4N5MA 4C4ZA 5AW2A 1I1QB 3UJCA 7AT1A 4J0DA 1TGVA 3W04A 3T1QA 4ZTUB 2YOGA 2JDIA 3W2HA 1K6EA 2QAGB 2JHGA 5FL7D 4G4GA 4KSBA 3U4GA 4WT7A 1RI5A 1IY2A 4NZNA 4WESA 5FUQA 3U7RA 1AGNA 7REQB 1PTJC 3F4LA 5BRJA 4MVXA 2TMDA 4NYJR 2FFAA 4RY9A 2EWVA 3K9NA 5LQMA 2OCAA 4UU7A 4ZOAA 3RLIA 4A16A 9LDTA 2ZRHA 4GLBA 3D2BA 5BNFA 1PW7A 2XZDA 1YVPA 4RSMA 2ZUEA 2XWBF 3A4YA 3OCVA 3HNPA 1DAIA 2A0UA 4X6XA 5DYGA 4AUMA 2NU8A 4Y0VA 2AEFA 4HLCA 3MFYA 4ISBA 3I83A 2PTHA 5LM3A 2PNJA 1CY6A 3FMVA 4Q48A 4UW9A 2VYNA 1VL0A 4YXFA 4WNCA 4C3ZA 1L5YA 2X14A 2JJ1D 3AFOA 3CUWA 2BI8A 4HJXA 4WKGA 5DBOA 4HNUA 3AEUB 1EESA 4XTCS 1F2VA 2YFQA 5AXDA 1QGUB 3G1UA 4YHHB 3RAJA 10MHA 4YASA 2IYPA 4RYDA 5ALHA 3GVHA 1D2EA 3EWNA 1O87A 1RE0A 3IAS1 4JS0A 4BNKA 4Z51A 3QI2A 1QJ4A 3CGGA 3KQNA 2ZI4A 1GG5A 3NBXX 5IH3A 3LKBA 3DLHA 1JEQA 3UMVA 4EUHA 2BE7A 2ZJOA 1N75A 4HX2A 5A1JA 4BASA 4XGQA 3QBDA 1PJZA 1PUJA 1W1WA 3JQFC 4TLAA 3RBXA 4B7CA 4EJSA 3H04A 1Y34E 4QL3A 4BX3A 2O8CA 1I32A 2A57A 4LYEA 2XHEA 4WTOA 4IQGA 2B36A 4EGSA 5I9NA 2BEWA 1WY7A 1HYGA 3PWZA 2VVTA 5JOQA 1VHLA 3BXFA 1KDVA 1OZHA 2ZAIA 3SKXA 2QMOA 4AY4A 1W4BA 1O9BA 3ZNNA 3ENQA 5G0VA 4X65B 1M2WA 3MGAA 4CIVA 1I4WA 3NC4A 1NE7A 2WW8A 3TQCA 3TSAA 5LD2C 3A36A 1COWD 4J49A 4K86A 4EB3A 4CE6A 2GJKA 1KVTA 4NEQA 5KWEA 1XKTA 1LJLA 5TQJA 4IUYA 1KFBB 3NONA 3OCCA 4IS3A 3PCTA 4TL7A 3JZMA 2Q5EA 3D1VA 4ABYA 4JBXA 3QHPA 1E7QA 2REBA 4O4JA 1RR6A 1OFHA 3RVRA 1CR0A 1MOPA 1N8KA 3GUVA 3I76A 1FU8A 2KBFA 3IX7A 2GHQA 1C7QA 4G5RA 4EX6A 1O8BA 2XKKA 3OQVA 4ETMA 5JLAA 3PXDA 3DZDA 3QKUA 4ZDWA 5CDYA 2AYYA 5CVDA 5TMPA 3EMDA 3IAM1 3KSBC 1QSGA 3ANMA 3OE4A 5A6VA 2V97A 3ZBPA 3PTAA 2XUFA 3MNFA 5ALVA 2NNWB 1V71A 1POWA 2Q0HA 2VT7A 1TMKA 3TLBA 2NV2B 5KX5A 1T1RA 2YS6A 3HPRA 5KYUB 1EWVA 4J3FA 3BF8A 2W6JD 3L0PA 2WOJA 4AJNA 2WEKA 3DZCA 4OKSA 3PUWA 5HX7A 1TCBA 2OBYA 1NASA 4UU1A 2COUA 1NFQA 3RIXA 1QFMA 2DTEA 1I4EB 3KR9A 2JFVA 4OHVA 1US8A 1FTSA 4TTPA 2XT0A 3LP5A 3ROPA 4GVLA 1JWBB 3GMSA 1H23A 3RV3A 1LDEA 4B3SB 1DRJA 4P3OA 1N3YA 2Z5LA 3EWIA 3OVMA 4BZZA 2CLFB 2WMOB 5ALRA 2YJTD 4F3CA 1RLIA 4B81A 1AHHA 3SYRA 1CEYA 1ZVVA 2JCVA 2JIDA 1Z4NA 3L02A 1J0DA 3DBHA 3Q6IA 4UVGA 4X20B 2CKDA 4Z8YA 1U8YA 3S1AB 3ZNPA 1AKNA 2O7QA 1QF9A 1Q22A 2LBPA 3MRSA 3TD6A 4UBJA 3ZQJA 5JS8A 1JHQA 1K4MA 2ERCA 4F6CA 2DLDA 2NP7A 3NFRA 3WZLA 2YRFA 4GVXA 1EFHA 4IEIA 1EFRA 1UMBA 1U3TA 2VT3A 3BIOA 2OMEA 4TS1A 4KQEA 2A1IA 5AVRA 2E5FA 1SBNE 1JQJC 1TRKA 4R31A 4B2PA 4B73A 5C52B 4MEJA 5HF9A 4CLRB 1JSCA 1SOUA 5JYEA 3HHEA 4H59A 2A5JA 1KY3A 4G0ZA 4FYWA 2VBGA 4OSOA 2FOLA 3G8BA 2HYIC 2V1XA 1AIPA 1JEQB 2PL5A 3L8GA 3KQWA 1MNQA 3KQYA 2X9LA 3ND8A 4R98A 3HSSA 2ZW9A 2CDAA 1K8RA 3Q5EA 3FVTA 1QIDA 1XCJA 1F7VA 1ZWKA 2FNAA 3V4RA 5DN9A 4JD5A 4TTRA 4WEOA 4J9UE 5K6AA 2DT5A 1U2RA 4MWDA 1K7SN 1FX1A 3PD7A 4OGFA 4P0TA 4Q47A 5KOIA 3PFHA 1GGJA 2BPOA 1KI2A 2W00A 1K4YA 3WV5A 1TVKA 4D3SA 1QIIA 5HIJA 7REQA 2OECA 2H06A 3IQDB 4LY3A 3IUSA 2P6RA 4PWYA 1TT5B 3PCXA 3BQNB 4JI5B 1VLVA 1K8QA 1MOQA 4M0EA 4X8MA 3BICA 4X6LA 4RY0A 4MR9B 2HRCA 3CVWA 3T3NA 3DMGA 1NI5A 3QFSA 1V4VA 3GFPA 2GPYA 2X0JA 3RVBA 1T2DA 2BGJA 2UZ3A 3W3AA 1CUCA 3UHPA 1PVOA 2CL6X 4K9RA 2LRHA 5KWSA 3GZ4A 3IIEA 1D2CA 5FP0A 3FPEA 4MIKA 3W2IA 2J0SA 2QL6A 3CSUA 5L7WA 5C5CA 4E3WA 4DUGA 4LN1A 4JBHA 1XKQA 3QJYA 5AQ1A 2BR3A 3BHMA 3WMGA 1FSSA 5KYXA 4RVNA 4BNHA 2CLOB 4EUKA 4JQCA 3BT7A 5L4NA 1U7PA 3FSRA 1ORWA 3QLTA 4EYGA 1EX9A 1XZMA 2I62A 3BCSA 4NC9A 4AMBA 3DDWA 3CFYA 4ARVA 4KQ6A 3PC8C 1O94C 4BY9E 3R9XB 2XTNA 3A3NA 1ENOA 5DP1A 3V8BA 1AKEA 3WWEA 3WKBA 2O57A 3CMCO 3ND6A 4IHJF 4QXOA 4EGQA 1SBZA 3EGVA 4RA9B 1F0YA 4RS4A 5AVOA 1L9XA 4LHYA 5EXSA 2IS2A 1G4HA 4CT4B 2O0KA 3D0KA 4P92A 2XE4A 3TIFA 3IEVA 3CZ5A 1JB9A 5LBTA 1N2GA 2QM8A 4TT3D 4EABA 5J23A 1NT2A 3MWFA 4XLZA 3PYLA 5AW5A 5JECA 1A0OA 1XCGB 3JQ9A 4IFIA 4RV5A 2QNRA 4CM9A 1E9AA 3E7FA 2ATVA 3DBHB 3E3NA 3QXGA 1Z06A 3RH0A 4UMFA 4XGNA 4TWBA 2BKEA 4LHWA 4H77A 1JNXX 2W83A 1W48A 1QHXA 1LSOA 4URXR 1T9GR 3KZMA 3FPBA 3OPYA 4GC5A 4LK3A 1EFVA 4Y2GA 1C1XB 5DHQA 2D5AA 1PNOA 5L7TA 1Y8CA 4FEYA 1P7CA 5JWRA 3E18A 3KKZA 3NTVA 2F1JA 1FTNA 3EA0A 1P4RA 6REQB 4DXDA 1EVEA 5IAAA 4P84A 4NYMR 3HGTA 4YLEA 5C32A 6ABPA 2DERA 4ESOA 1DFHA 1R6VA 3B5JA 1P3Y1 5KQLA 1ZH8A 5KNCD 1A71A 2RSLA 1I4OA 1W96A 1FF9A 4AYTA 1AZTA 4OLFA 2C4HA 5DWDA 2ZI3A 1RJGA 1EHCA 2H29A 4IZIA 5A02A 2HNKA 1X80A 1SOWA 1HDZA 4BFLA 5K0TA 4F4DA 1MA0A 2HTFA 5JCJD 2BL4A 3KEOA 5EKUA 3A7DA 4FDAA 1M2NA 1MR3F 4V3BA 3TOXA 4OQ4A 4ESEA 2QTVA 2OORA 5KNBD 4HLQB 1U1IA 2NO1A 4FC7A 3QOXA 4HNGA 2BR4A 3ONVA 2HJVA 2JRLA 2ZSFA 5DBGA 1TTQB 5G1PA 1CUHA 3ZJYA 1EWYA 4L4XA 4QDXA 3DMYA 2HT1A 5I7VA 3WICA 5CCDA 1E96A 2WIKA 3SC6A 6ADHA 5REQA 3SC2B 1LZLA 2DHDA 1U04A 3EFEA 4IDCA 3S0JA 2IODA 1YHNA 4P08A 3O3OB 3FBWA 2F7SA 1VG1A 2GM3A 4O1HA 2JFPA 4XUEA 2QJTA 1P1RA 3W90A 2R00A 2PUDA 2FUG6 4AMVA 4B3TB 1GNRA 3U1TA 3WL3A 3U6KA 2JBAA 4V2UA 5F1YA 3L7KA 5AM4A 1LRKA 4B3JA 2Z1DA 2F43B 2DWPA 3DYIA 4AROA 5CVVA 4MS3B 5EFOA 3C2QA 4UTPA 1CUGA 2Z58A 5D51S 2I0FA 3C4VA 3W77A 2BHNA 3I37X 5AKKA 4EIWA 2RDMA 1OBCA 3NTLA 5D87A 1JTEA 3HJFA 1DHRA 4R5HA 1L5GB 4QXRA 1Y5MA 2JI7A 3TK1A 4F11A 2Q9CA 4J16C 1K68A 1U3UA 4KITB 1Y4SA 1UBSB 2OQ2A 3AVTA 2Z8YM 3FNFA 5JCXA 2FUNB 4A36A 1Y8QA 4IF6A 3HDQA 4L9WA 4W8GA 2FR0A 1JLLB 2ZI6A 3A4VA 3D8SA 3LCMA 2YXPX 1V48A 1B8UA 2TRSB 1F5NA 4D9FA 3J81k 1QHSA 1AKYA 2IU0A 4KQ9A 2HI0A 1ULHA 4RZIA 5AKIA 3WBFA 3I0NA 5F7OA 3GLFE 3A1UA 4MV7A 4B0PA 1O6CA 3F7MA 3ISVA 5PGMA 2DFDA 2J3QA 2QT0A 2YINC 1ZC3A 3IP6A 1CUFA 2OOSA 3KBOA 4GMXA 4IEEA 3TAHA 3ZCTA 4XVCA 1NLMA 3I6YA 4EHAA 3OM8A 5T4HA 1RKUA 2QTCA 4KQJA 3B1YA 4PQFA 3UMCA 1CTQA 1UMCB 3TFWA 3OMLA 1A2OA 1YZKA 3PC4A 4J4BA 4K8OA 2GYVA 4D56A 2BGIA 1G9SA 4FFPA 2ZM6B 2OM2A 1YE5A 1SMKA 2R60A 3ABSB 1ZGGA 2V3WA 3MTDA 3I2KA 3UAXA 3F4BA 4M8SA 4DLPA 2TECE 3OF2A 1FE8A 5G40A 4KQ1A 5KKCA 3FWYA 5LFAA 1TFUA 3ET4A 2YJ3A 3DXYA 5E1BA 1E0DA 1FFAA 4DN6A 3TQHA 3UKOA 2VLIA 4X9XA 1GZ5A 5BURA 2QT9A 1L5QA 1P72A 1H4QA 3C16C 4Y9SA 3TW6A 1TO2E 4D96A 2H7YA 2XITA 3H9BA 2R2AA 2R6AA 3K1YA 4ESVA 3RU7A 1KS9A 2YWRA 1GXSA 1HFWA 2HRBA 4OREX 4IJ6A 1XQVA 1EINA 1WTCA 3WYFA 1PV1A 3B51X 2LP4Y 2A30A 4UHDA 4AO8A 3MFQA 2QX6A 3T7RA 3JARA 3KVRA 4E4YA 1L5VA 2DOKA 3HH8A 2C4NA 3GXBA 4LVUA 4E30A 1YJXA 4FDTA 1SUEA 2FUCA 3DQZA 3KZCA 5FI5A 5BW5A 4MOWA 4QOIA 1KO8A 3KM0A 1P1JA 3D0RA 2O20A 4PVDA 4JUCA 3GK3A 4F8JA 1GU1A 3WWDA 5SICE 1F20A 2QTVB 3V7NA 5EXPA 3GNQA 2H2DA 3VR6A 1JDPA 3ER6A 4ASUA 3REFA 3N2KB 2NYUA 2BEUB 4O29A 4XSGA 1ZD3A 1JJAA 3H83A 1Y42X 2OO5A 3FUVA 2HV8A 3D7SA 1ZIYA 1HXHA 1G8SA 2HJ9A 2P5SA 2OFPA 1JKJA 1JEEA 1SUAA 3VYUB 2I22A 4I5FA 3N70A 4TTJA 4CKEA 3LY5A 5IYZF 5F52A 2H51A 3LQ4A 3ASVA 1G7RA 3THXB 4EJ2A 1Q0SA 1RXUA 2JFUA 3I2GA 4OQPA 2EW8A 1KEZA 4YAEA 3QKSB 2OXIA 3II6X 3A4NA 4JI1B 3ZE7A 4PIMA 1X9IA 1RWMA 3EMBA 1WDLA 4OUDA 4CRWB 2HL6A 1GZHB 2OCIA 2O2ZA 1MXHA 2NU9A 2IFTA 4RAOA 4CCAA 5IZCA 2Q4TA 2H00A 4FYYA 5J4HA 4AWXA 1L4GA 4RXMA 5IH7A 3C6QA 1Y5NA 4RHXA 4X7RA 5EZSA 4I4LA 5TF4A 1E2DA 3V7FA 5K1ZA 4HGNA 2VNHA 4FUQA 5LQCA 4G3XA 2CXUA 1I2BA 3IPRA 3W06A 3TXXA 3DBLA 4DRZA 4A1OA 3FOFC 4WZZA 4FYJA 4LVOA 2WWIA 5EP4A 5K3FB 1EDEA 2BLNA 3UT6A 3H84A 4C7BA 3HS3A 1ZNYA 2VP5A 2VS1A 3HB9A 4DCOA 1YNOA 3H5IA 1B7GO 3J7TA 2P7IA 3O8BA 2QTFA 3Q7IA 4KQWA 2FJUA 2HTEA 1FFDA 1K7EB 1NWCA 4Q6BA 1VL2A 1F1BA 3ZQKA 4E22A 4KNYA 3V4LA 1VI2A 3U7IA 2JH9A 3GZNB 1OFTA 5JY1A 5DU2A 1U9ZA 5TMBA 3PE6A 4LOAA 2H92A 4AF7A 2IEBA 4F06A 3KJHA 3OSZA 5IABA 2KM1A 2IEAA 3BH0A 2PLWA 3V7UA 3AR3A 3MRVA 3P2YA 1V8BA 3P45A 3PX7A 3L0SA 2B34A 1QR6A 1QV6A 2V6IA 4JNKA 1DAFA 3K8YA 3M4NA 3DR3A 721PA 1OILA 1M2EA 2PGLA 1KO4A 4FHGA 2PDAA 1CLUA 1HGXA 2QN8A 1BDIA 1GY8A 2EGGA 3PUHA 4HB4A 1SKUA 2BDUA 2FFRA 3V4FA 3W7BA 4D1YA 3VJRA 2Q6TA 2IYVA 2BM8A 2XDWA 3OQPA 4G0WA 1AQ6A 4BKRA 1SPBS 1VB5A 3VMMA 1N1MA 3EVFA 2XYQA 2CLKB 3C3WA 3IJPA 3RUEA 5AVWA 1PT8A 1T0IA 3CH5A 4IPTA 2OFOA 4BDTA 4GLOA 1DC8A 2O9JA 1VQ1A 2VK4A 1F8GA 1U2PA 3CTPA 3W8NA 3OKAA 2JVIA 4N76A 1N3IA 5BSUA 3EEBA 2D1YA 1RBMA 4C0KA 1WXEA 3BDAA 1KZ1A 4QOSA 1Y4UA 1BS2A 4A8JC 2GKSA 3VVLA 1ZOLA 2JZNA 2ODEA 2WT9A 2HMUA 2NZJA 4HYTA 4H1VA 4G5FA 1ECFA 5IMSA 3I9LA 5HCNA 3MCUA 4JI8B 4IEFB 3P0JA 4KQMA 4LZOA 1H65A 1CZKA 2ZXUA 2XCTB 1SBQA 3Q2KA 9LDBA 2D3WA 4FYKA 5ESRA 3KJNA 2DUJA 4GNKA 5DVZA 3BMCB 3RYHA 3NCHA 4L7VA 1MO2A 2F1KA 5DX1A 4D57A 1JVSA 1RAIA 4B7ZA 4AJLA 5GMOA 3RREA 4YRBA 2R6ZA 4JP3A 1V3UA 1YRAA 3QIAA 4KW7A 3THXA 5IVKA 3DQPA 4NK5A 1WVMA 1L8AA 1U02A 2B82A 3O8QA 2P3QA 1I6WA 4H0NA 2Y9PB 3E0QA 1W8IA 4TKUA 2J9GA 3RIHA 1UZLA 1N25A 2XPCA 5FWXA 2XXAB 2JIBA 2VF4X 1WU8A 3FFBA 4J0QA 1HT3A 2PD6A 2Z98A 4H7EA 4R40A 5B30A 1VFNA 1QQBA 1F8XA 2QORA 1C9JA 3S70A 1X14A 2AR9A 5AMXA 4YMHA 3EQ6A 4LV5B 5A5GA 3L5OA 3ISTA 3MJHA 2FDXA 2UYYA 4GR4A 3R0JA 4W1PA 2HPHA 1PWYE 3BL5A 4G1FA 3ZH2A 1FTWA 1FXUA 2DHQA 3MMXA 4LJ9A 4DQLA 1L4YA 3AUYA 5JROA 2H4WA 2PPVA 1VJ5A 1NLUA 1T9KA 2YR0A 1EGQA 1UKCA 2PVPA 1DTEA 3OF5A 3IB3A 1RYBA 3OLQA 4O4IF 3EFOA 1HL7A 3W6PA 5K45A 4CCSA 4OTZA 2OV4A 3MUFA 1CUJA 1JQBA 3V8NA 5K3FA 4BN5A 3W79A 3A25A 4UUOA 1RHMA 2HF9A 2J08A 1J7JA 2ZB3A 3BGWA 3PHIA 2QGNA 5B3JA 3RU3A 3RC8A 2FE1A 2P1ZA 2QXUA 1VL5A 3W9BA 4X7BA 2VJOA 1ZYUA 1J2YA 3KWFA 1TGYA 3Q7TA 1FY2A 2WIGA 2OXEA 3W34A 1E0JA 1O5OA 2C5BA 1YZVA 2VTDA 5ER9A 2XGMA 4RK4A 4JBIA 4TKVB 1Z38A 4HADA 1GAEO 4G41A 1CULC 2BJHA 4KVFA 4DPLA 1KK3A 1XZJA 1JRLA 1DX4A 3EIQA 2HV9A 2WD7A 4LJ5A 1ZCJA 2BEVA 3CS3A 3DV0A 2PLAA 3HMKA 4AX4A 1H2AS 2F55A 1QB7A 4IV8A 3IPLA 2QRKA 3HBNA 3HLKA 1Q57A 1H1DA 1YBMA 1FFCA 1Q7CA 5EKDA 4GMKA 3LY8A 4FI3F 1AKQA 2GN8A 3FWPA 3L4BA 4IMPA 3ZJTA 4OBEA 2RB4A 5CH3A 5E6UA 1AGRA 3FGZA 4JUDX 3DFKA 5FNVF 2XUHA 1ECLA 2TMYA 2PCLA 4YRRA 2FPIA 3BXEA 1J20A 1O08A 4F91B 2HBRA 4PCLA 2OV3A 3ELBA 5HZGA 2KE5A 5D86A 1XQ1A 5H81A 5BSWA 1WU7A 2QTLA 3X2EA 2J7KA 4KZKA 3EN0A 1A4XA 1IN4A 3M0EA 4L3VA 5LZ8A 4X71A 5BQ5A 3RARA 3VNVA 1L7AA 2GCGA 1D07A 1E7SA 4LI3X 4M0MA 4OQDA 4IM7A 4JQYA 4DCUA 2H18A 2O8BA 3AHHA 5HKBA 1YCFA 4Q34A 1GPWB 4UEOA 2NACA 1E3TA 2ZYRA 2ZYVX 3P4XA 4I1PA 5DI3B 1HYBA 3W7VA 3W5BA 2JI9A 1W88A 2DH6A 2AMFA 2NXEA 3IPYA 2FK8A 4Q39A 4TTTS 5INTA 2GJ8A 1SIOA 3MAAC 4OHKA 4TLLB 1TPZA 1ZRNA 2JGEA 2V6JA 4LV6A 5AVVA 3D1JA 1I3CA 1X1RA 3M2TA 1ZP6A 3FB4A 4MRPA 3UK6A 4Q12A 1RZRD 3JD0A 4EW3A 4E7OA 5FA8A 4CF3A 5JNSA 4Q4LA 4FLEA 2VZ9A 1ODLA 3M7IA 4F1JA 2AN4A 4YP0A 1XDBA 2ZG6A 3IBCA 3QOFA 4MW1A 4X1YA 4E4TA 1KQFA 2X0NA 3LUJA 2B3DA 1NBHA 3BMXA 4JEIA 5CG1A 4RE5A 3N2GA 1OI4A 4IH9A 3OTOB 4ZQEA 2NUAB 3FYTA 3C8UA 1GVHA 3WMWA 4JVSB 4PYOA 1UQRA 1XYGA 2GZHA 1C9EA 1ZGCA 1FVHA 2DSNA 2GHIA 3FRHA 4IYJA 1ADCA 3EEIA 3NDRA 2CXSA 4CL8A 2DBVO 2IHTA 1G7TA 2BC9A 3F6EX 2Q3MA 4PSKA 4JKIA 3R76A 1Z6PA 3KBBA 3ZI7A 4DQVA 4V39A 3KZXA 4RGYA 4RVFA 5CB4A 1DIBA 3QJ5A 1LPBB 3AY6A 4IVQA 3H99A 4Q9AA 1NLFA 2PZGA 3I01A 1U28A 5BWMA 3QX7A 1GO2A 2VNKA 4KSYA 5KOJB 3E2PA 3JAWA 4TN1A 5IF3A 4RHTA 3AP1A 4ARUA 5IJ9A 2FN9A 4HWPA 1GP2A 1YKGA 5G02A 2Z0MA 2IV2X 1TK3A 3WP0A 4NU0A 1RKXA 4BMSA 3EUWA 4UDXX 4WZBA 4PRLA 3FRIA 3GGOA 3DE6X 3V80A 4A10A 4R7GA 4EW1A 3SM9A 1Z5OA 4DF3A 1ZKMA 4DDTA 1XI2A 3REGA 4E6PA 2VDPB 3T94A 2EP8A 1ZSNA 2Q4EA 3SN6A 1P3DA 2EWWA 1JQKA 1GDTA 1AM4D 1EVIA 2VI5A 2BHRA 2QQEA 3DWIA 3RABA 1VP3A 1M5RA 2D0IA 1ZIOA 4YDRA 4FBLA 4UNSA 3UKDA 1B8VA 3H8VA 1Z4KA 5TQ2B 3V9AA 2QUKA 4FKZA 4PAWA 1GL9B 1AUXA 1JA9A 1YQUA 5IVPA 121PA 4I1YA 4DHWA 3QPUA 5CD1A 5F7XA 1HO3A 1Y8QB 2JK1A 4R2JA 1YFLA 5EE0A 4JIMA 4NECA 4CV2A 2WTUA 4PZAA 2ODWA 4TGLA 3KVNA 1XVIA 3M6LA 3HP1A 2XA9A 1Y6ZA 4OJTA 3H2KA 4NQZA 4QRHA 4JI2B 2GWRA 4JL5A 3T3MB 2YFYA 5CDSA 5F2EA 4ZCPA 1NULA 1UPFA 3DHWC 2Z09A 3I5YA 3LUCA 4CTNA 1PNTA 5IASA 3S1SA 2FVXA 3IAFA 4PC1A 4P7JA 3UTCA 4DCMA 2X2EA 3N8GA 1OH6A 2GGSA 3L41A 4S05A 4RFSB 3QV1A 4ZCQA 3ZIUA 1VMEA 4L9AA 5DGIA 2LCQA 3VSEA 4JB3A 3WBBA 2FDCA 2IL1A 5C51B 1D0IA 1P1CA 1Z15A 2WYWA 1QS0B 2C58A 2HADA 4DTIA 3MHTA 2AOUB 4V0LA 2AE1A 3LK7A 4IKPA 4RIIA 1LK5A 2A7XA 3EVEA 4B2LA 3LA6A 4IGKA 3FCEA 4MPTA 1VMKA 4RPGA 5AHWA 3AM5A 5DRTA 3DEFA 3AETB 1M2KA 3M4ZA 3G5MA 2XRYA 4L73A 4MIEA 4CN8A 4JHLA 2A9FA 4PZLA 2IRWA 1FUIA 4KXWA 1B6RA 2IZZA 1EWRA 4C2BA 1GPYA 2J32A 4MPJA 1SELA 1QFJA 1RCFA 1XEXB 2PRIA 4GSLA 2Q3HA 1N0WA 1U0LA 2AMJA 2P5TB 1ZJZA 3O38A 4AO7A 3OJOA 1S7GA 2EJVA 2AOXA 2CWDA 3RVMA 3T3IA 2X8BA 3C5EA 1GIAA 4UCWA 3FYDA 1XPRA 5JXIA 5FR2A 3PL1A 3LUHA 4MINA 2GFQA 4C21A 2IE8A 1H0KA 2A3NA 2A7QA 3BJZA 1E1YA 5AVKA 3T0IA 1KI4A 1K75A 2PV7A 4BNZA 1MIOA 4YUVA 3WO0A 3WGVA 1GRVA 2AHRA 2C2YA 5BV8A 1ETHA 2JCSA 3WFJA 3E27A 3QNMA 3C3JA 3Q87B 3RVJA 1Z62A 4BOYA 2GNOA 2R8PA 3ZDAA 3KB8A 2DQSA 8AT1A 1ATZA 5FPKA 3LFHA 3C0KA 4Q7MB 4UBIA 5A0TA 2NQ8A 2XY4A 3KSMA 3PYMA 3TJMA 3WLQA 1BC5A 4CU2A 4YUZA 1JEAA 5DYTA 4L16A 4X8OA 4JJ4A 1ODSA 3HVHA 2E48A 2ZIXB 2Y3IA 1W5SA 1MRZA 2QRLA 1E9RA 2UZ1B 2BTQB 2I4RA 1WXQA 2E9SA 1K3FA 3AOEC 1XQ9A 1VSBA 1J2RA 4G85A 4O1IA 1ZJ5A 2IOYA 3W9UA 2BEVB 4ETIA 2X8WA 2YH2A 3SEFA 4HGYA 4KGZA 2QVLA 5I7AA 3IDQA 3ZHUA 4EO9A 3ZHXA 5BVHA 5KHOC 5LIPA 4M87A 4KN6A 5DGDA 2H07A 1FTYA 1R0LA 1S96A 4H4EA 4ZOCA 4ZEWA 1UFKA 3T9FA 1I4TD 5HJ2A 4PO8A 4XQEA 5FH9A 4W1SA 5FEMA 4N7BA 1XSEA 2IGBA 4ZJUA 2JFYA 4WZ6A 1FK8A 1KS2A 3ORYA 3UXMA 4CMAA 5JWOA 1PFQA 2CY0A 3U7QA 4CL0A 2LDXA 3ELDA 2WZBA 2H48A 4CL2A 3AVWA 4BCBA 4KFTA 2YY5A 3UMYA 1GCGA 5E8RA 1EVYA 1UM9A 1C7IA 1WXHA 4R6WA 3SEQA 1AKRA 3X1YA 5I4CA 1M0WA 4DR2B 4EYOA 1MFZA 1WY5A 5LMUB 3BRWA 4JYAB 2GBFA 1CEXA 3Q3HA 4EM6A 1U0NA 4A2CA 4W9RA 1ULZA 1P4AA 2B21A 3S7ZA 2EKQA 3FYSA 4RM2A 3HVKA 4B9EA 1IZ0A 1EVLA 2SBTA 3U0VA 1NVVR 4AN1A 4DLSA 3O90A 2R11A 1GZ7A 1WKCA 3GDFA 1NJGA 1DLIA 1OASA 2O3RA 3R0VA 4K9SA 4MARA 4YCDA 5DK6A 4UMDA 5KOYA 1OU0A 4N6GA 1YR6A 1U4OA 4G0VA 3E8MA 1PNQA 3W8DA 5CXUA 2O2JA 3UGKA 1KBOA 3NNNA 3ESRA 3AXTA 4NR0A 3WK9A 1FUUA 3N58A 1F9AA 1Z5GA 3AW9A 3SJBA 1JP7A 3TTUA 3FPSA 4B3HA 4D82A 5BMVA 3ZOKA 1K9SA 5AR1A 1U11A 1ZK3A 2LKCA 2Z56A 3EVBA 3RU9A 1PR3A 1RZ3A 1S8OA 1QHHA 2FPRA 2PL3A 2YMQA 5EWMA 1LI4A 4P4TA 4X1YB 5DEIA 2XTMA 5HYVA 3U60B 3UATA 1UIRA 2DKOA 3KR2A 4RTLA 1U7ZA 2GBGA 3ZE0B 4I1RA 1IY9A 4EB0A 2PT7A 5F3RA 5IC4A 4Z4FA 4RD0A 1ZVMA 4AECA 5EL0A 1GT91 5TQ0B 2EC5A 1UJ4A 3TTWA 2NPOA 3OQNA 2PBFA 4RF3A 4Q3EA 2R8YA 2B4YA 3MWDB 1FCJA 1KTIA 3V2UA 1OJLA 1NVUQ 3KUUA 3ADCA 3C70A 4FXOA 4R7ZA 4ZVTA 3UY4A 4CNBA 2WA1A 4G8BA 2O5CA 1IQUA 5FL7A 5JZMA 3SVLA 2R0QC 3DLIA 1R4NA 4NMMA 1DAEA 1BNCA 1XD9A 4U7WA 4O5AA 3NBYC 1EBFA 1T3GA 4FGJA 2PX5A 3QEMB 4MS1B 4ZHSA 2Z4SA 3OWHA 3RWMB 1FC0A 1OA0A 2FX5A 2OESA 2Y0BA 2W8BB 2GKOA 3X1XA 3DWGA 1M1UA 1TT5A 2AJ8A 1W1UA 4K46A 2V59A 3A3PA 4N5LA 5FBLB 4YA6A 4NHEA 3MW8A 3OPNA 5TPWA 1INLA 1C9YA 4Y6PA 1KZ9A 5FOTA 1CY7A 2IXEA 4YIKA 4D9CA 3KUKA 1PV4A 3FIJA 3WRXA 5I3CA 2ZS9A 3ENKA 3BRCA 2B2XA 4F5ZA 1CB0A 3WLOA 1KH1A 1Y1KE 2IDMA 1DT5A 3TLZA 3YASA 4ZGWA 1CKEA 1NUAA 3D5TA 1A69A 1AS3A 1G98A 1Z4PX 2HU5A 1VG0B 2M1XA 2H9YA 2Q49A 3RVQA 3U9LA 3JD1A 3AESB 3HCFA 4RVCA 1UL1X 2PH7A 1U6JA 4XM1A 2LD4A 1Y5IA 4FNMA 2B6HA 3DAOA 1SHLA 5ECDA 3AV0B 4PRYA 2OGTA 5ALWA 1E62A 3THRA 3ENZA 3NHLA 2GCOA 3VAYA 1VYTA 1Y7HA 4CEHB 3UXEA 2BF4A 1GGVA 3ADOA 4NSNA 2OA0A 4XQGA 5GONB 1EG7A 1CNMA 4MP3A 1NJ2A 2BOVA 2QUBA 4O2AA 1L5OA 3V1NA 3I28A 3MK31 1M3SA 1NVVQ 4CG1A 4AZ3B 5CB0A 1AKWA 1PJSA 1O96B 3E22A 2XUDA 4GOJA 4IVRA 3SFZA 3RIMA 4EB6B 2HXGA 4QTYA 5HQ3B 2R7LA 1HDIA 3MTEA 3IBSA 4GZMA 1NBOA 2Q4OA 4R9SA 4K7JA 3QELB 1N57A 3LX5A 3RYIA 2JLQA 2G72A 1KYZA 2W6ID 2F3UA 1N6LA 2IE0A 2ZYWX 4GGPA 4H1TA 1BXGA 3EIEA 5TPZA 3LGAA 2AKAB 1II9A 2CDBA 2F17A 3PA6A 4H7DA 2BMDA 3EQ9A 1TJYA 3C7CB 4EBBA 1WABA 2WSBA 1M7BA 5HPYB 3CZPA 3KKOA 4IIYA 5BR7A 1ZA2A 3N0TA 2DT8A 1Y8RA 2ECFA 3IESA 2ZWPA 3SJZA 4BNXA 4AIIA 1KYWA 4ZCLA 1Y37A 3M82A 4H1UA 5H9VA 4EG1A 3WYAA 2IJGX 3CX6A 3Q8WA 5IS2A 3PNMA 4WK2B 3V8EA 5CMLA 4LYFA 4MW9A 1VCHA 2BJWA 2HUNA 2XSZA 1GTL1 2XWPA 3H2JA 2W2LA 3QJGA 4B3BA 3RT7A 4A6DA 4YRMA 2NAPA 4A9AA 4DNFA 4O4LB 3Q15C 3WK6A 2HCBA 4JGGA 3D3NA 3KQTA 4TYQA 5ECYA 1NP3A 2Y4OA 4L7QA 4XR4A 1WHSA 2NZVG 2Y0DA 3G9UA 3ZPXA 1LTKA 3B13B 5ICCA 2HMSA 5KVSA 3V8PA 2OCDA 1VA5A 3WJ7A 1HYHA 5TDHA 4FVTA 4LGCA 3E81A 5EP2A 1PR1A 2FH5B 3GYGA 2A0YA 3HJNA 2GK4A 2QE7D 3CLVA 3HP7A 4KK3A 5B1YA 1C7JA 1LQ2A 2XGOA 2GZAA 2VPPA 3D8HA 4G9GA 3A14A 5CLLA 1HLGA 2MINB 2PRJA 3QF7A 3RRNA 1GZDA 3D7LA 3GLIA 4ID3A 1L5RA 1XTIA 4XEUA 4GKKB 4CHTA 2GAFA 3NBQA 4C0AC 5L9AA 1XEWX 2G5PA 2GI4A 2H4HA 3FGNA 2OZVA 2RK4A 1MX1A 4B4WA 1MJGM 3O4FA 1VFPA 3EXHC 4DCJA 4QUDA 2HAEA 5TPWB 1OZGA 3REQA 2GESA 4RIGA 3FTNA 2RGUA 3H6GA 4EO7A 3AINA 1YS9A 4MUXA 1EGHA 3NUZA 3KJQA 2XRMA 4QXMA 3R7AA 3QLVC 2ZJBA 4C9BA 3T1NA 4P6VF 4CIAA 4YFVA 3OIYA 4WFJA 1BCSB 3SR0A 3UV3A 1IOVA 3LUDA 2X0EA 1ZZGA 1MB3A 4LOJA 4P54A 5KSWB 1D4FA 3DP9A 3JQCA 5E3HA 2FXVA 2FSGA 3E3AA 4GX0A 2WJZB 1SZCA 1CRPA 1QIJA 4LRSB 2JJQA 4HRXA 3PKZA 3EJ6A 1JAIA 4BCDA 5C80A 1P0PA 5AVXA 1ONBA 3MWEA 3EMVA 1Z6ZA 3S2FA 5KTOA 3Q2IA 2CFSA 4FDLA 5K0BA 2O48X 3I6IA 1X7ZB 1A9OA 4L6CA 1IY0A 2NO6A 2GD0A 2Q2WA 3VPSA 2RGXA 3VAZA 1ZM3A 2XLCA 3DDZX 4RFLA 3S44A 1YQGA 5BWBA 1ISPA 5EMJA 5AJZA 4FSXA 3SYMA 4H1HA 4PGAA 2PKQO 1UZNA 1U7TA 3NH9A 4CKEB 1PYGA 4I4IA 4KIWA 4YT8A 1HQYE 2A35A 2CFCA 2WJGA 3QQPA 1PHRA 4IJVA 4PC6A 3ZCSA 4BGVA 4LZWA 3A06A 1Q7TA 2BVNA 2CVQA 1SA0A 3E9DA 3EEQA 4Z99A 3JPWA 3SS8A 1C3VA 4E5NA 5GJCA 2W8BA 5EJEA 1WDMA 5TS2A 1SURA 5FLXA 1L7RA 2PANA 2C9OA 1ZUNA 4ZDJA 3MIZA 2C7BA 1PL7A 1S2MA 1X6VA 1C0LA 3IQHX 3P2EA 2CHGA 2REOA 4HWGA 4NKRA 3NVMB 4XEHA 2ST1A 1PI3A 3DE5X 2FZVA 5EIBC 4GFDA 3CVVA 1ML4A 4IJQA 3EISA 4JL8A 3PG5A 2ZETA 4LJLA 4LY6A 4F86A 1GFZA 5LMZA 1G3QA 1DIHA 1K6JA 2BJVA 4F3NA 1BX3A 4WJKB 3ZWPA 2ZIFA 3AY7A 5JH7B 4A23A 3G0DA 4ZI7F 4DEXA 1ESCA 3WZMA 3CO0S 4WGGA 1DXYA 3CXRA 1A2BA 2IPNA 1NQWA 2QM3A 1YBAA 5ALLA 2PKXA 5LQSA 1MC5A 3K0CC 2VIIA 3AVUA 5B3AA 3QVGA 4HG2A 3FFAA 2JVKA 4FILA 4LHVA 4UM8B 1ZPDA 2A9KA 3I3SR 1TZKA 3R20A 1BDBA 1G21A 3EXG1 2ZOSA 4Z4GA 2Y67A 3GPCA 4JVLA 2X0DA 3RVOA 2NUPB 1QIHA 4ZEOA 3PQ8A 1E63A 1MAUA 3FVQA 1I51A 4ML3A 3TNJA 1O9GA 1G5RA 1JXOA 3JQAA 4R51A 1LGYA 4KR3A 2RGRA 3KL4A 4K87A 5EUCA 2R65A 2RHMA 4PY2A 5LSAA 1M8KA 1WB4A 3HK2A 2IU4A 2RKWA 2WYHA 2CE7A 4C5AA 1SHKA 1G0OA 1PGJA 3EXEB 5JVDB 3SJAA 4R71A 5HUQA 1ZIDA 3BN3A 2O6HA 1NFFA 3IPAA 3RSCA 1M6WA 3FH0A 3MWLA 3KSRA 3E3MA 3M9XA 3ABZA 3QXJA 4WOJA 1YL6A 4E3ZA 3NHSA 3A1VA 4MUKA 4C0LA 3NH6A 2PZLA 3WK5A 3ACBA 3IAS6 2O5VA 3ZY5A 2VH2A 3GBVA 3NIGB 4BFUA 4QUJA 3A6KA 5FUMA 4ZQHA 1GM5A 2P4SA 1MP0A 2XJ9A 3JQFA 1B3BA 2Z3VA 5DEOA 2YJZA 1MZPA 4M8KA 4QIHA 5EJMA 4Z54A 3B6IA 4IS2A 5BSTA 1ZR2A 2QTNA 2R8XA 2WG0A 1JUDA 3HO8A 4LTNA 1ZISA 4GXQA 4NX2A 3TLEA 3COPA 1I0IA 2ID7A 2QL9A 2F3RA 2RFLA 2G67A 4E2FA 3HB7A 2B8JA 4WX2B 3C1AA 3TLXA 1TUEA 3ZJVA 4JLDA 5TF0A 5FJJA 2GCOB 2YV1A 3L8DA 4JJ8A 4QHTA 3SMVA 1LS6A 2HBQA 2KBEA 2VZ8A 2F6RA 5FTNA 2PIAA 3HBAA 1WLSA 5J5AA 3QTLA 3S1LA 4WBNB 4GXRA 3WL4A 3WE7A 3H3JA 4MW7A 5JS1A 2P9FA 3D6HA 5AK5A 4YCCA 2XCQA 5DT2A 1EMDA 2B5WA 2B25A 1HOTA 1BFDA 1JGTA 2DE0X 3AH8A 3K8OE 1HYQA 2A5FA 3BGIA 3KLMX 3QI7A 4GEKA 5EOVA 2ZYHA 2XADA 3QPCA 4ZVSA 3L8YA 3ZGOA 1DBRA 3Q7RA 1CLEA 4BFTA 3KEFA 1KNXA 4W82A 1C4KA 4QASA 4Z86A 4G4SP 3TUIC 2W4IA 1JDVA 1QTRA 1X8JA 2YASA 1A97A 1U0JA 1Z2DA 3B2QA 3FXAA 2PMWB 1E1QD 4OQQA 2H17A 4JI3B 3LO5A 3A9CA 3VOBA 4OLBA 1THZA 1T1SA 3L7AA 4HS4A 4RZ2A 3Q8LA 4ZRNA 2A6PA 3HA5A 1BKDR 2IUSA 3A3KA 2GH1A 4UD6A 3T9EA 2PRKA 4B79A 3Q72A 4M53A 3MVEA 3ODPA 3DOIA 3L43A 4J8PA 5LZ5A 1IUOA 5D5PA 4OBXA 2O8NA 4ZOLB 3PJGA 2XDAA 2WIBA 2CE2X 2BGNA 4DUYB 5JJIA 2OUKA 3K7EA 3L7BA 1KZYC 3K53A 3U3JA 3RUIA 4IOJA 3SBXA 5C1PA 3S8EA 5IHXA 2XMPA 2HW8A 2HCFA 4Y1FA 3N05A 1HI9A 1MIOB 1HTBA 1TQ6A 1VJ0A 1YJQA 3MQ4A 4G56A 2QA5A 2PFGA 4GPTA 4YYEA 4RJJA 4AJEA 1GR0A 1IM5A 3DFMA 1JI0A 1AOXA 1Q77A 2JATA 4ZIRB 1GPDG 1C1DA 3BORA 3L3BA 3U17A 1B1CA 3GDWA 2OL4A 1NOKA 4UUMA 4QUGA 1IY1A 1OF1A 3MYYA 1OIVA 3K0HA 1QF6A 2C84A 4JJZA 1QOPB 5B7GA 5T8KC 3TN7A 1BHSA 1XLTA 1DTWA 1JI3A 4O02B 1KK0A 4PZZA 4LGYA 2IEGA 4WZAB 3WWZA 4QKQA 5IBCA 2QR5A 4ARZB 1AZWA 2DFVA 4WUTA 4WNAB 2V9ZA 2XDQA 4GX1A 3TVYA 1YFJA 1LK0A 3FPGA 4HVCA 1EK0A 4BEWA 4LRUA 1QIGA 4WJZA 1M1ZA 2FRDA 1P18A 5F1PA 3TOVA 1HEIA 1V47A 5A4MS 3AC0A 2GNPA 3P2OA 5JD4A 8OHMA 2PUAA 2WAAA 1QANA 1GQFA 2XXBA 3AUUA 2Z9DA 5CFRA 5CDTA 4I50B 3O2QB 4YB8A 4HLNA 1E9SA 4W7SA 3VVBA 2I6GA 4BV9A 2JEZA 5CT6A 1OLXA 2O3SA 3ML1A 3GQVA 4DADA 5L95A 3R1IA 4GXTA 4BQNA 2H4FA 1EFUA 1CUIA 2OLJA 3OPMA 3SKVA 2CNLA 1U99A 2VTEA 4FQ5A 4J1QA 4UOEA 3L0IB 5TGZA 1GZSA 3MJDA 4CI9A 1XK6A 3LSTA 2C5GA 3VC2A 1CR4A 3FZNA 3KQSA 3RUFA 4FR5A 4JJ6A 4CV1A 1Q5PA 4JQOA 4RTSA 1TKAA 4YRFA 3QXXA 1XXHB 1O0SA 2J41A 3Q6MA 5FTMA 3STTA 5DX0A 2HPAA 1CEQA 3CJQA 3ZDQA 4RIFA 3B8HA 6NULA 1YZGA 4F5WA 4PIVA 1YDFA 2EU8A 2QIPA 3LUAA 2GBIA 3MGCA 1PL0A 1EEHA 1SVIA 2JAOA 2RAFA 5DULA 1XB2A 4DA9A 1TO6A 2JIQA 2YVQA 4U4AA 4JKOA 4Z4QA 4YCJA 2QZJA 1R1DA 3OZCA 1LVGA 1PQYA 1R00A 1OFUX 1LNZA 2V96A 3PTLA 1EA5A 4FE7A 4XPZA 5FNVA 4B84A 4DM7A 1VIAA 1ZVJA 4WCDA 5BYKA 1M8PA 2ZATA 1NVMB 1KEWA 4MUHA 3K8ZA 2LXNA 4FNGA 2V7TA 3G9QA 4GW3A 4OB7A 4TMVA 3MN1A 3UWMA 3WVNA 1WJGA 3BTOA 4WIAA 4EY3A 3BM5A 3O47A 2CZCA 3KHSA 3O4RA 2B2CA 4HAXA 4PAQA 3I61A 5KSZA 1P4HA 1H2WA 1TKBA 2H1LA 4V24A 1NW9B 3T1HB 2QB5A 1VLMA 2QRQA 2GPAA 3RDPA 3WLNA 4EVRA 3CTMA 5JMWA 3EXHB 4UQPA 1NQXA 4MUEA 1XJWA 3HWWA 1RDFA 1EFPA 3JXEA 1DC4A 3RSQA 2I8AA 2VJMB 1F2TA 4KIUA 2CNNA 3LRPA 5C31A 1YTLA 4MI1A 1HNWB 3GARA 2KSQA 5BQOA 2VEOA 1DQPA 4C89A 2IX3A 1XUOA 4N03A 3GCGA 3X1KA 2GJAA 1Q7GA 4WPGA 1PJRA 3R9WA 1G9TA 3EHDA 4OFWA 3KKPA 4XQ9A 5CTAA 3QELA 2EKDA 4NMLA 1CT9A 1G4AE 4LZZA 3G5UA 4QPPA 3KQUA 4HTAA 1PZHA 5CPBA 3R40A 5LC1A 3C1TA 2AYZA 4QPJC 2OMKA 3G7NA 1IATA 2EEPA 4P4SB 3EVGA 4IFTA 1OJ7A 1VXOA 2ZTMA 1BE6A 3WMRA 3MOGA 4JNCA 1SXIA 2ZULA 1G3IA 5IEBA 4BNVA 1DAOA 1JLMA 1HT2E 1BWPA 2HIAA 2G4LA 2RI1A 4XOIA 5IXSA 4KWCA 1QTQA 2FQYA 1I94B 2CXNA 1JMKC 1DELA 1T9HA 4EJMA 2D06A 1TD9A 2F3SA 5H70A 4B35A 3D8TA 4EQZA 4G63A 4ALIA 2RGBA 4J2HA 1JHVA 4TTVA 2E4WA 1AXEA 4FGKA 4HS9A 1Q7EA 3TI7A 4XWKA 4V03A 3KCNA 5JNRA 2NYVA 1MO3A 3AHFA 2AN3A 2W0MA 3K1TA 4CZ2A 1RXEA 1F17A 3MLAA 3O91A 1OMOA 3T9AA 1SIBE 2HCJB 4LZJA 4GECA 3HBJA 4X7PA 1XO1A 1JA0A 3K4PA 5D7BA 4I4NA 1C4XA 2PMDA 2VHXA 4BVBA 1JLRA 2P2GA 1YMQA 2FR8A 1IDOA 3HCAA 4XARA 3ZK7A 4KQHA 1J25A 1M6HA 2P2SA 1WIWA 3GT3A 2LNDA 3OTWA 1FUEA 5FADA 1MB4A 3VHXB 5DNCA 3L1VA 1X7HA 2IGTA 2Q5CA 3WAJA 3OTGA 4PYRA 5IT9A 3ZVKA 2FWAA 3VZRA 3BK7A 1J0CA 2OKGA 3OPYI 1ZI6A 5B4UA 1TEZA 2H1HA 2Q1YA 4L8WB 2WSLA 4MVJD 5ADHA 3OCWA 5EESA 1YRHA 4HSEA 4WZBB 1DPFA 3CYFA 2OV8A 1HZJA 3IERA 5JBNA 1AV7A 1G6HA 2R62A 2WWHA 3I6QA 4YQYA 4N39A 3C3BA 1SUSA 4F3RA 1GNSA 5AD1A 4OI4A 5EWLA 3ZU2A 4PRZA 1NHGA 1N8TA 2DULA 2M6LA 4BNTA 1FSGA 1I36A 5AJHA 3J81A 4H17A 3UMRA 2D3TA 2R4TA 2WF7A 5TS3A 4KR9A 3DKPA 4FJ1A 2I3GA 3DVSX 3FY4A 1PJAA 4RJ2A 4Q9IA 2XNDA 4I4CA 5ELXA 1XJ5A 4YY3B 1DL5A 2W2XA 3AGPA 2L17A 4M8NE 3VISA 3NOOA 3DDNA 1GUDA 4JVMA 5IK2A 5CA0B 3E53A 1EFCA 3GLFB 3K05A 3KOMA 4DSOA 2IYOA 1ZR4A 3P52A 4QU8A 2YNMD 4IX1A 4N4AA 4QBFA 1QQ7A 4LHZA 2P65A 4NBTA 1BWQA 4DLXA 1ODJA 4WNIA 4LSZA 2NUAA 1ZM9A 3WFZA 1IHDA 4EHLA 4W1RA 3WGQA 4BO3A 4E46A 3RAFC 1EM6A 3C8MA 1R3UA 4GNRA 1OLUB 5JCPA 4KE9A 1Z0AA 2MYTA 3CEMA 7ADHA 1AB5A 5AW1A 1UINA 3D59A 2GK3A 4OA8A 3UO8B 4IH1A 1G20E 3OM9A 4G8CA 5IZ4A 2PAAA 1XALA 2P6MA 1F6BA 1YDHA 2QAJA 3LIPA 3QVVA 2P2CA 5A7FA 2JFFA 1WEHA 4AM8A 1KPGA 1KJ8A 2Q6VA 3TW0A 5IX8A 2X22A 3I5MA 1QP0A 1U0RA 5ARCA 3K4QA 3KR0A 3L4SO 2Y0CA 3A9UA 1DHTA 4NBWA 5ED4A 4QOHA 5HMMA 4JMPA 3TLAA 1V9SA 3AZPA 1JNYA 1T2VA 1QRUA 3U4QA 4GYWA 5HFAA 4IAOA 2ZAOA 3ZY6A 4QQRA 3WQRA 4CW7A 4AJ1A 1JT2A 2F59A 1WSBA 2AN5A 3I34X 3ORFA 5CYOA 4D3FA 1Q44A 4KV7A 4TUYB 1J8VA 1T91A 3UK7A 3H2SA 4RHUA 2G80A 3PC2A 4OXXA 4BV3A 4GKJB 1TZBA 2KW5A 3PNYA 4U6QA 3JQBA 3OPVA 1GRRA 2JIOA 2QZSA 2BEUA 3KRTA 3P9PA 3IHTA 4RE6A 2W93A 5AKJA 4UASA 3INNA 4RGQA 1JLHA 4CCYB 2BFOA 1PAUA 2EQ5A 2HMTA 2QRUA 2IP4A 1Q84A 5DPMA 4IJ5A 5T6MA 3Q9UA 3H0CA 4MWEA 2G82A 2AB0A 4U2EA 4Z7JA 4HGPA 1NI4B 1TYCA 4GLJA 3ZZUA 2XF8A 4JDPA 3U7GA 4NMXB 4UEQA 4Y2PA 5EE1A 3RRFA 3WLSA 3C4QA 3SE0A 4Y1EA 2ISSD 5DM1A 1EXWA 3WLMA 3D4LA 4V02A 2G1AA 4PX3A 5CLHA 5L53A 4U02A 4O3MA 4FBGA 2C8KA 3DZIA 4BXOB 2PM8A 1JQ3A 1DXQA 5SV2A 2FVYA 2JCYA 3UG7A 2YZGA 4HFRA 2SICE 3FYUC 3VVMA 1XZPA 3ICOA 4DLNA 4GPBA 4LC9A 5ICFA 4QGSA 4LJSA 2QYSA 4HDOB 4CKWB 1X1DA 1ONPA 5IWCA 3L4JA 3K4HA 1S0UA 2V3CC 2EX1A 3S5UA 4Y2YA 3TH5A 1V4BA 1B2RA 2DAPA 2D0OB 3EARA 3IMCA 3U9SA 4F71A 4QYIA 1Y7LA 2D62A 3EXEA 5FOWA 2XWJI 1JG3A 1E1RA 1ZKDA 5P8WA 3IEPA 3E9YA 1V8FA 2R8RA 4TLMB 3ZHOA 1CRLA 3FZYA 3U1BA 4FCCA 3TBFA 1NG1A 3Q98A 5IZCC 1Q16A 4DR1B 4NATA 3RFXA 2XKJE 4UUPA 3KDAA 1JHUA 3NWEA 4IG9A 3TL2A 4RCZA 2V7GA 3VTZA 3ZW8A 1Y9EA 2W11A 3AEZA 3HJUA 3HFJA 4I55B 1VL8A 3CNHA 4G1VA 1PR5A 2BONA 4PYQA 3CW2A 2WKPA 3K32A 1N1DA 4K9KA 5J2TB 1ULBA 2DFPA 4DLUA 3EEFA 1WZ2A 3LYAA 2HF7A 1RPTA 2BDTA 2C77A 1P1IA 1YQ9A 3F71A 4G4IA 4MZXA 2P9GA 4NLLA 2ACWA 4YACA 4C4XA 1VCNA 1D04A 1EHIA 3R9IA 4CIDA 2OBNA 2ZRGA 4D8VA 5JD6A 2VF8A 2CT8A 1CQWA 1NDUA 2IHUA 3DMPA 3PUYA 4TS9A 1C0EA 3M6IA 4NICA 4RETA 4X95A 2O0HA 1YJAA 4NU5A 5HIIA 3PGKA 4M0LA 5EXXA 4BX9A 3DZHA 4JYCA 2BFAA 3W8EA 3LPDA 4GPZA 4ZTZB 3JASB 3WGJA 4NVRA 3TKYA 5KYXB 3AY3A 4G5XA 1OI7A 2VDWA 3DM9B 3T3PB 4CT5A 5I7FA 1O6FA 4HH4A 1GITA 1UFQA 2QZ4A 3D02A 3D3KA 3ZG6A 1FFEA 1CJCA 5TNXA 1GRCA 4TQGA 4UCFA 2HN9A 4TL9A 3IVRA 1VBMA 2O2XA 5GP1A 3T5GA 4DZZA 1HNXB 5HMLA 4HAYA 1NNEA 2A9JA 2R6R1 3GH3A 3QQ5A 3EPHA 3GFGA 5G2OA 3SSMA 4CUJA 4FR0A 4Q1AA 5U9CA 3I6MA 4GL4A 1XWFA 3UV6A 5LQNA 2CLDX 5ITVA 2J4DA 4M0DA 1T4MA 3LSYA 3OLVA 4WINA 1SBHA 3OP1A 4MGIR 4TTSA 4YP5A 3OUZA 1LW6E 2NUTA 2JCBA 4MNTA 2ZJZA 3UK2A 4LQDA 1A7KA 2JIMA 2RARA 3I58A 1N2OA 2X5OA 3GNTA 1U4NA 2Q28A 4LDJA 2X1HA 4UHFA 4D9HA 1RWKA 3C5WP 3E15A 4QQKA 1DBSA 3M1LA 3TNYA 1XEFA 2REQA 3T7SA 4G5OA 4BLUA 4C43A 1RSZA 1U7UA 2DY1A 3AM3A 1YIDA 2CBXA 3RLFA 3V4SA 5BVHB 4LFBB 1KRXA 1N5JA 3FIUA 5BV7A 1YCHA 2JHCA 4Q7JB 4B46A 3CB4A 2JFBA 1M67A 1C8KA 1X3SA 3DMNA 4UBLA 5CDFE 5L3VA 4A0RA 5AXBA 4AZ3A 2HLDA 1JE1A 4UAGA 1LQTA 3TQFA 1R9JA 4YI3A 1T1IA 3D4NA 2I76A 1K63A 5EJ2A 2ZRFA 1YJCA 1EAMA 1PEDA 3FLEA 1Z39A 3Q7SA 4M9SA 1K98A 1I4DD 1MF7A 5AHXA 5LUAA 2H57A 3VOAA 2J3EA 1XVLA 4O4IA 1N92A 3DKIA 5LKRA 3JAMA 2Z6VA 4MUBA 4ZAFA 3AHDA 3HXLA 5A7HA 3E3OA 5FOXA 3PUVA 1LBIA 4AZWA 1BXGB 4Q21A 2H85A 2HNBA 3QVTA 3IV9A 1CUZA 1E2LA 4XXHA 4KUGA 2TYSB 4QLAA 3TPCA 1MEOA 2HKIA 2R86A 3UWOA 4RORA 2HHCA 1PS9A 1EK2A 4BPBA 5ALMA 1T9GS 1EX7A 3MGBA 2DXIA 2OPBA 4ITRC 2A1TR 1E2JA 2JNWA 9ATCA 2JLZA 4MYUA 3TDKA 2QSYA 3RFCA 3V3KA 3LOUA 1H2RS 5EIOA 3UJDA 1I1NA 3R0IA 4B6SA 4R9VA 7YASA 1FDIA 1K66A 3WHKA 3AKYA 2ILVA 3IV7A 4RC9A 1A50B 3UWPA 2MU1A 5BSMA 1VCOA 4M9RA 4ZMRA 1JYSA 3ZWWA 3HB0A 3CF4G 4IZHA 4GMGA 3ABRB 4ZZ1A 3GLGA 5AVUA 1RYHA 4KKXB 1CYEA 4FC6A 1M54A 4QUBA 4COKA 5EIBD 4A6PA 3SWWA 4FFOA 3AF4A 5BT8A 1NQUA 1SVOA 3SF0A 5K7SA 1OBHA 2O06A 4G24A 5MF6A 5HK9A 3B7GA 1GAXA 4TSRA 4GOXA 3T7JA 1UT5A 1U2GA 2FG5A 5SY9A 1WPRA 2MINA 2KB0A 3MWDA 3O8RA 1ECPA 5JR3A 3OWXA 1VG8A 1UUFA 5BSHA 3LT5A 4OI0A 1DQZA 2J48A 5I4IA 1C29B 3UA4A 3X1MA 5FWYB 4PZPA 4QBIA 1AUVA 1TK2A 1WZCA 2VQDA 4EZIA 2PG3A 4UQOA 3WIVA 1LDMA 1JDJA 4IZOA 3FOWA 5K4HA 1P6QA 3GLVA 3O4HA 3HSYA 3ZLTA 3KETA 3VOSA 4Q24A