2KW5A

Solution nmr structure of the slr1183 protein from synechocystis sp. pcc 6803, northeast structural genomics consortium target sgr145
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
202
structure length
202
Chain Sequence
MWDERFSQSEYVYGTEPNDFLVSVANQIPQGKILCLAEGEGRNACFLASLGYEVTAVDQSSVGLAKAKQLAQEKGVKITTVQSNLADFDIVADAWEGIVSIFCHLPSSLRQQLYPKVYQGLKPGGVFILEGFAPEQLQYNTGGPKDLDLLPKLETLQSELPSLNWLIANNLERNLDEGAYHQGKAALIQLLGQKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Slr1183 protein
publication title Determination of solution structures of proteins up to 40 kDa using CS-Rosetta with sparse NMR data from deuterated samples.
pubmed doi rcsb
source organism Synechocystis
molecule tags Structural genomics, unknown function
total genus 39
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2kw5A00
3KPWA 4HH4A 1SQGA 3GRUA 1X1BA 1D2HA 2PXAA 1NT2A 3EVCA 4FSXA 3TM4A 5HZMA 4OQDA 1L3IA 2OO3A 4C07A 2NXNA 1NW6A 3MTIA 1VE3A 3HCAA 4KW7A 2YTZA 1H1DA 4V0QA 5EMMA 1XTPA 2OBFA 2OB2A 3FYDA 3V97A 2QY6A 1TPYA 2ZWVA 5CIYA 1M0EA 2IBSA 1KR5A 5DPMA 4JXJA 5EVJA 3HCDA 4X60A 1F38A 5MHTA 1EQAA 2ZZNA 1AV6A 4WXHA 3MB5A 2ZSUA 3VC2A 5K8VA 3ER9A 3CBGA 3UBTA 4A6EA 2ZLBA 4A6DA 1O9HA 4FR0A 3GDHA 5EZSA 3I64A 5FULA 3HA5A 5DWQA 4CTJA 4HRAA 4DZRA 5BP7A 5IKMA 3P9IA 5DRYA 4DKJA 3A26A 1EAMA 3GRRA 2CMHA 3R9XB 2IPXA 2OKCA 3SVZA 1RJGA 1BOOA 5FWAA 5EG5A 2VZ9A 1TW3A 5HOQA 1RJDA 3HA7A 4OBXA 1G55A 3GXOA 1KP9A 2PLWA 2XVMA 1SUSA 5DM2A 2JH9A 3IV6A 9MHTA 1Y8CA 2HTEA 5K0JA 2IDJA 3FUXA 3LBFA 3TFWA 3JWHA 2C7QA 3E7PA 2PWYA 3QV2A 4RTQA 4OBWA 3PTAA 1L3CA 2V7EA 3GJYA 1QAMA 3KQYA 5EPEA 5D1HA 4WVLA 3MHTA 4ER0A 3KR0A 1NBHA 3MGGA 3B3GA 4IV8A 3GRZA 3HEMA 2PSSA 2FHPA 4POOA 5LQUA 2ADMA 5P8WA 2VDVE 3LX6A 4YV0A 2G71A 4E30A 5KQSA 1NW3A 2EJUA 3R6TA 3OFKA 1WS6A 3EVAA 5K0NA 4PYOA 4EQZA 2AOXA 4P58A 3AJDA 2ONYA 1JG1A 1OR8A 3G2MA 1BKYA 2OB1A 5E1MA 1YB2A 5EC8A 3L8DA 5DM1A 3TR6A 4HGYA 3G7UA 2Y1XA 4C4AA 1NV9A 1O9GA 1WZNA 3R3HA 4B17A 2PKWA 3LSTA 3VYWA 4CKCA 4GOLD 4R6WA 3T7RA 2B2CA 3UA4A 2ERCA 2I9KA 4MIKA 4RVFA 1XCLA 2K4MA 5DT2A 3P8ZA 2UYOA 2YR0A 5GWXA 3LHDA 2GAFA 2PY6A 2O05A 1G60A 5CCXA 1RI1A 3TOSA 2P3LA 3Q87B 1JTEA 5C9ZA 1KYWA 2PT9A 3A25A 2AZTA 3LBYA 2NYUA 4EK9A 3FRIA 4EMSA 3C3YA 3DXXA 3UJBA 3KR1A 5GIOE 5E2AA 3FTEA 3SXJA 3D2LA 3OZTA 3M33A 1PJZA 3P9NA 4X61A 1WXWA 2HV9A 2BM9A 4DCGA 5K01A 4MHTA 3HTXA 2G72A 3BWCA 3SGLA 1P1BA 3NTVA 1BC5A 2ZIEA 4MQ4A 2AOVA 3BWBA 3HVKA 4GEKA 2OPBA 2ZZKA 3CGGA 5K0FA 3GO4A 2N47A 3R24A 3FRHA 4GC9A 1RI4A 4K6MA 4XCXA 2JHAA 3F4KA 3RODA 1Q0TA 1SUIA 5CVJA 2H11A 5DX1A 1R18A 3EVEA 3IEIA 2O57A 3S68A 4AZTA 5ERGB 3I5UA 1NW5A 4V0RA 5K0LA 5DXAA 3KPYA 5BXYA 4KVZA 2AVNA 3G2OA 3K0BA 1KPHA 3FTCA 3CCFA 3G88A 5EKUA 5M5BA 3GWZA 3G8AA 3LGAA 2I62A 5E1DA 5JR3A 3EVFA 5E8JA 5E1BA 1WG8A 3CJTA 2P7HA 1R8YA 3G8BA 2ZBRA 5KVAA 5C1IA 5GIPE 2ZTHA 3GGDA 4QPNA 2BR4A 4RVHA 5CM2Z 3TPZA 5FQOA 1KHHA 2XYVA 1VPTA 4R8RA 3PLAE 2R6ZA 1QANA 3P2EA 4KDCA 5E9QA 4YV1A 3MTEA 4AZVA 3HP7A 3M6VA 3OU7A 4QDKA 2PX2A 5T64A 2FYTA 2VP3A 5DX8A 3P2IA 4FGZA 4QQNA 5G02A 4YMGA 4C05A 4Z2YA 2AOTB 5EMKA 5CCBA 1B42A 2G8NA 3EEYA 3O7WA 2ORED 3E23A 3DMGA 1EJ6A 3EVDA 2IFTA 4PCAA 1DUSA 3C3PA 3NJRA 5DSXA 4P7KA 3B5IA 4QQKA 2PWPA 3T0IA 2NXJA 3WSTA 4HSGA 3FUUA 4QVKA 3HM2A 3JWIA 2ZW9A 5EOVA 1R00A 3PFGA 4RX1A 5E1OA 3B3FA 5FA8A 4AZSA 4FP9A 4PONA 2HNKA 1XDUA 1X1CA 3X0DA 2H00A 3AXTA 4CKEA 4ZTBA 1ZHFA 5EMLA 3UJCA 5CVEA 4P7GA 5EIWA 5HIKA 1VP9A 1QAOA 2O07A 5EEHA 4RTKA 3NDJA 3RW9A 3CJRA 4XUDA 3MERA 4BP1A 3DP7A 1P39A 3PX3A 5EQJB 2PXXA 1VL5A 2HWKA 2R3SA 2EG5A 5T6BA 3V8VA 3U81A 3O31A 3P9KA 2IDKA 2YXDA 4ER6A 3E05A 3LCCA 5HIMA 2OYRA 3TLJA 4NECA 3BXOA 5EIFA 3KQMA 2AS0A 3ID6C 4HC4A 3C0KA 1AQJA 5GM1A 5HFJA 2VDUE 1NE2A 1EIZA 3NDIA 4G56A 3LCVB 5F2OA 4DQ0A 3DR5A 4PYKA 3I53A 4RTLA 2AOUB 4LWOA 5ICCA 2P40A 2BZGA 3FUTA 4Y30A 5FHQA 4RV9A 3AWIA 5FTWA 4E31A 4QPPA 5CD1A 2GLUA 3KPJA 1YUBA 3H2BA 5F2KA 2CMGA 3SSMA 2UZ4A 3HCEA 3LDGA 5EKXA 2ONZA 3SM3A 2C7PA 2XBMA 1N7IA 2AOUA 1VQ1A 2YX1A 3FTDA 1XDZA 3EGIA 4HTFB 3UJ7A 3EVBA 3FUVA 4X41A 5ICFA 2JG3A 2UYQA 4GC5A 1N7JA 5LSAA 2ZVJA 4F84A 2PV0A 3KHKA 2HMYB 5FADA 3NWBA 1JQ3A 5CUQA 5DM0A 5EZQA 2NXEA 2UYHA 4QDJA 4R6XA 2IH2A 4GOND 2PX8A 3ME5A 3DMFA 2ZIFA 3DXYA 5D1NA 5DTRA 3P2KA 5KQRA 1ZG3A 3KU1A 4U7TB 5K03A 4BY9E 3TMAA 1NKVA 2B3TA 2I7CA 2NP7A 4O29A 1FPQA 4RSRA 1XDSA 3M70A 2CWWA 3GU3A 4E2XA 2FRXA 1R8XA 3BWYA 5GINE 3CJQA 4IWNA 4HGZA 4PGGA 3EPPA 3OU2A 3A27A 3IHTA 1G8SA 2JJQA 3SR4A 1JG4A 3UA3A 1P1CA 2WK1A 4RVGA 4KWCA 3EGEA 3M6UA 5CVUA 3ER8A 3OZSA 3PS9A 4RTRA 2KW5A 3CC8A 3KPUA 3FPEA 4QVGA 2I6GA 4ER3A 4RTMA 3O4FA 1Z3CA 1ORHA 1L3BA 3P71T 4CTKA 3G5LA 1KIAA 2AOWA 4GBED 4OQEA 4CKBA 5DXJA 4GOMD 3MCZA 3BZBA 4ISCA 2Z6UA 3PT9A 5LQAA 4F86A 5K0EA 3A7DA 1VLMA 3ELUA 2B78A 2PBFA 3OU6A 3M6XA 3NWEA 1YFJA 4M38A 3PB3A 3C6MA 4CXMA 4XUEA 3SSNA 4AUKA 1VIDA 4DMGA 5CVDA 5FA5A 3GCZA 3BUSA 3BGVA 4YUVA 3UJ9A 5DLYA 2GA9A 3Q7EA 1DCTA 4R05A 3NW9A 1QAQA 2AN3A 3UFBA 5U4XA 1O54A 5HILA 3T7SA 2EFJA 1D2CA 3HCBA 3NVMB 3KQWA 4OA5A 1L9KA 3UWPA 2PGXA 2ZULA 1FP2A 2CKDA 3VC1A 4YMHA 2IBTA 3BKWA 2LD4A 1IM8A 4LECA 5T67A 3KQTA 3PFHA 3UJ8A 3HVHA 1D2GA 4R8SA 5CVVA 5GP1A 4ER5A 4OX9Y 3QOWA 4PYIA 2O0LA 5DX0A 3LKZA 4C04A 4DCMA 2G1PA 4FS8A 1WXXA 1KPIA 1NV8A 1UWVA 3I9FA 3A7EA 4BP3A 1FP1D 4X63A 2VDWA 3EGVA 3CVOA 3UZUA 1JG3A 4E70A 3LDUA 3JWGA 4GF5A 1JQDA 1ORIA 4PIMA 3EVZA 2P41A 5B1SA 3FZGA 2XYQA 4BLVA 3LL7A 1G38A 4RTSA 4IV0A 4ER7A 2AR0A 5LQKA 5KYGA 4YUWA 1QYRA 2BR5A 3EEOA 2QE6A 2AOTA 1FBNA 2DULA 2AVDA 5BW4A 1M6YA 2VS1A 4RTPA 5DTMA 5LQCA 1ZGJA 1JTFA 2P8JA 5FHRA 2C7OA 2OXTA 2JHCA 3A4TA 3G2QA 4PWYA 4YUZA 1ZGAA 2IH5A 3LCUA 3KR9A 1I1NA 5C0OE 3KQOA 5DTQA 2CL5A 4EVIA 4PYLA 2DPMA 1L1EA 4U7PB 2QYOA 3ANXA 3TM5A 2HR1A 4E2ZA 4DA4A 2NP6A 1DL5A 1NW8A 2BH2A 3ELDA 3OFJA 4X1OA 5FQNA 4RTJA 3ELWA 2ZBQA 2E5WA 2PX5A 5EGSA 3HVIA 3IYLW 2YVLA 5DRTA 3DTNA 2BR3A 1VP3A 4GQBA 3TQSA 1T43A 4GOOD 2P3OA 4PYNA 1X1AA 2B25A 2EJTA 3GRYA 1SQFA 4C03A 2EX4A 1UIRA 3BGIA 3ELYA 1NW7A 3KQQA 1SKMA 1JR4A 2B9EA 3DOUA 3SX0A 4M37A 5FWDA 4KIFA 3CKKA 4P7FA 1YFLA 1HMYA 1XXLA 3DH0A 3FYCA 4OA8A 5HEKA 2FCAA 2ESRA 1RI2A 1XVAA 3SMQA 1VBFA 3SSOA 5LQRA 3HNRA 4QTTB 3GIWA 3ERCA 3NVKI 4F85A 5K09A 2C7RA 2P3QA 1G6Q1 3AXSA 1SG9A 3M4XA 5DM4A 3FTFA 5E2BA 2FK7A 3REOA 2NXCA 3FPFA 4M36A 1V39A 4PYQA 2Q41A 2IH4A 3HVJA 5LQNA 3HCFA 1I4WA 3PX2A 1QZZA 3B89A 3LECA 2XVAA 5H02A 3B3JA 1MJFA 3AY0A 1EJ0A 4CWAA 4BLWA 1Q0SA 3PVCA 3BWMA 3DMHA 4C06A 4KRGA 3UJDA 1KYZA 4BLUA 1JG2A 4HTFA 1PRYA 1JSXA 1WY7A 2XYRA 2Z6AA 1X19A 1XCJA 1ZKDA 4H0NA 4KDRA 5E9WA 5ICGA 2GB4A 3BKXA 1ZQ9A 1SVUA 3LDFA 1JQEA 1INLA 3TKAA 3M6WA 4KIGA 1RJFA 3EMBA 3JWJA 5K05A 5KS2A 8MHTA 4M7RA 2PJDA 2IIPA 5EMJA 3DULA 2JH8A 4LG1A 5E8RA 3KQSA 1N2XA 5F2NA 4FT4A 2PVCA 3UJAA 2NNWB 3EMDA 3NMUF 4FZVA 3P97A 2YQZA 1NBIA 5BW5A 3DXZA 1IXKA 2ZBPA 2JHPA 2P1DA 2F8LA 5K0GA 1R6AA 3E8SA 4ATNA 3FUWA 1G8AA 3FPGA 3GNLA 2WA1A 5EEGA 3BGDA 3LKDA 4RVDA 1TW2A 2A14A 3OE5A 3MCTA 3QOXA 3THRA 3UJ6A 1IY9A 2V74B 2OY0A 1MHTA 4PCLA 3C6KA 3DLCA 5FUBA 3BT7A 1XJ5A 2GH1A 1RI3A 2ZCJA 1X1DA 3R0QA 3FPHA 1I9GA 4HG2A 4L7VA 4MWZA 2GS9A 1YF3A 3HA3A 2H1RA 2PT6A 5FCDA 4EKIA 3DUWA 2Y1WA 2ZZMA 2WA2A 2P35A 2YXLA 3G2PA 3KQPA 4IKPA 5HIJA 1HNNA 2ZWAA 1KPGA 1P91A 2FPOA 2YUIA 3GRVA 3KQVA 4MTLA 4PIPA 5HIIA 5LR6A 3OCJA 4QTUB 4UOEA 1UFKA 4XUCA 4RYLA 5LQJA 4AX8A 2UYCA 5K0CA 3VSEA 2PXCA 3OE4A 3KR2A 4PYMA 3RIEA 2FK8A 2Z6QA 4LWPA 4DM3A 1YZ3A 3T7TA 4E32A 3OZRA 2P7IA 2ZFUA 3P9CA 4PGHA 4AZWA 1BHJA 3KKZA 4YV2A 2IGTA 1F3LA 1R74A 5GOZA 4RTOA 5E9JA 5GM2A 2GPYA 2OZVA 3G5TA 1RJEA 3I58A 3TRKA 4YUXA 5ICEA 2PX4A 5IH3A 1RI5A 4YUYA 1JSZA 3KPVA 3OPNA 4FT2A 4E2WA 2ZIGA 4PNEA 4PYJA 5EHIA 1U2ZA 10MHA 1AF7A 3HCCA 5EHGA 5K0BA 2BM8A 3ORHA 5DSTA 4DF3A 1M6EX 7MHTA 1AQIA 1YZHA 3TKYA 2O06A 2QRVB 4P7JA 4Y2HA 1FJXA 3FPJA 3K6RA 3MQ2A 2AN4A 3EVGA 3MAGA 4C08A 2IP2A 3G89A 2QM3A 2AN5A 4FSDA 3LPMA 3B7PA 3THSA 2G70A 5JUWA 4RWZA 4E33A 1EG2A 2YXEA 4E2YA 3DLIA 4RTNA 4PINA 4EKGA 2QRVA 1KXZA 4GUAA
chains in the Genus database with same CATH superfamily
5KAMA 3GDFA 1SCKA 1TYDE 4IIEA 3CRZA 4QHTA 3MTQA 4DC1A 3RBZA 3STHA 5HZMA 2ZRDA 2OO3A 1WABA 3DAHA 1ZBDA 4IEEA 4QC2A 1L4FA 3MS2A 5F7ZA 3IHKA 4LK2A 4OMDA 5TGZA 3STTA 4W7HA 3KKNA 2HF2A 3VOAA 2LKDA 2JBWA 4GX2A 4E5VA 4MQEA 3DV0A 1YS2X 3E9ZA 2QQEA 4LQ4A 4RM3A 2OPHA 2JFBA 3HJCA 3PDCA 2FG6C 4G4GA 2YWFA 2IHNA 3NASA 4EY7A 3ZV3A 4A6DA 1CE8B 1EGQA 1FFAA 4Z0NA 2ANBA 3PCRB 4DY4A 4H59A 1QBKC 3KQKA 2B9VA 3A26A 3RRYA 2P2GA 4LE2A 2B8JA 5MGNA 4Q3NA 3TXYA 3VH2A 2CFOA 2QV0A 3EULA 3WGKA 2PRKA 4M8SA 1G2QA 1N6KA 3L7DA 4I1IA 2RI1A 5DI3B 4L8GA 2ZPUA 5LBUA 3PKIA 4YMUA 3NBYC 2FSGA 1EP3B 1M8FA 1ISFA 9MHTA 4K46A 1K5DA 1QIJA 1OV4A 3DNFA 3EN0A 1LI7A 3K3PA 1DFGA 4CT4B 4FGUA 4DSUA 3MTDA 4CCAA 1DHTA 1WXFA 3GBVA 5EPEA 5I7FA 3VHRA 1BJKA 5C4IA 1NR7A 4UD2A 2ADMA 2IHVA 4EA9A 4F2WA 1Z0KA 4ILKA 3HB1A 4IIHA 4R9RA 1OWMA 2G06A 2HF7A 1LQTA 3EDCA 4RF3A 3HI6A 2EW1A 3QJYA 3KOWA 3GEIA 4PQEA 4RDCA 1Z0FA 2YZKA 1Z4MA 2AOXA 4M87A 2OHOA 1WHSB 4LRQA 3CLSC 2IYEA 3ONNA 2W4IA 4INPA 1IHYA 4A2WA 4L16A 2VWQA 1DE0A 4W4TA 3GMIA 5CTJA 4CBVA 4ESEA 2V7QD 1D9ZA 3T7RA 5JAHA 3HGTA 1G7CA 4OOFA 5ER9A 5JFGA 2IYSA 1AUXA 1DG9A 3DKPA 1W2WB 3AESA 4UMVA 1NZFA 3CRRA 1M6VB 1Q7BA 2ENUA 1FU8A 3ZJYA 4I1SA 1EHYA 2ZKIA 1U1FA 5I7RA 1MOPA 2X5KO 5F35A 2GPJA 3KYBA 2FW8A 3VVBA 4D4GA 1A8QA 1RWOA 4BMZA 1E9CA 1ZGBA 5A4IS 1TLFA 2CDAA 1JIUA 3I9V6 4ZGWA 1CIVA 1SOVA 1M34B 3HKDA 3ESCA 2IYNA 2HWYA 1YE5A 2G6TA 2I8AA 1IJKA 5JIBA 1JR3A 4LF7B 3RWMB 3V4FA 5ALSA 2BM9A 5L40A 1FLAA 3BWCA 1N3BA 5ES3A 3ZZTA 3G0IA 2DFDA 1B26A 1GQOA 2N1MA 3I2YX 4Q15A 1HG1A 3OT4A 3PQ5A 3WQHA 1BO6A 5K0FA 5C8YF 1NUTA 1EESA 3K0EA 3G9TA 4DBLE 1C9MA 1FDTA 3R7SA 4ZEWA 4FTWA 1RI4A 3IQZA 3PUWA 3TOXA 1AXGA 1XI2A 3V8PA 4Z9AA 3IEIA 3GLIE 1ZJ5A 3TQQA 4CDMA 2DBQA 1SXJC 2FDRA 5BXYA 2R8BA 5JD5A 1SPBS 1ZFNA 3DE4X 3GNSA 3ZXUB 2C07A 5AVUA 1GEGA 4RY2A 2G1UA 1PKEA 4Q1AA 4AS3A 4W63A 4ZPXA 3RVLA 1SC6A 3G8AA 3V4RA 4HBGA 4LZLA 4FB5A 4TZ6A 3F5FA 2ODQA 2ZJ2A 5E8JA 2ASEA 3WGOA 5BSEA 1G8PA 2BBOA 2IYLD 2IIVA 3H11A 3BFPA 1N2HA 3FSJX 3OF2A 2VXYA 5I7UA 3G82C 1LLQA 5KVAA 1E2KA 2J0VA 1DC3A 5A4JA 1VRWA 2DPHA 3UPUA 4GM0A 3OIGA 4H1VA 4QEZA 4FJ1A 4YCAA 4HN2A 2LE0A 1XZAA 2JFHA 3R5KA 3CZ5A 3OU7A 2PX2A 2QUZA 1Y5IA 1SCIA 1SVIA 4Z2AA 1MXHA 2QTGA 1XYVA 4C2UA 1TAHA 2NUBA 3W2FA 3KLPX 4Q66C 4X7PA 1H65A 2YDYA 3VBEA 2ORED 3BULA 2J67A 2MIIA 3KTOA 1J06A 3IMGA 4WZAB 5D7NA 5A71A 3SI7A 5HGJA 4RSMA 4GE0A 4QQKA 4J29A 4EW1A 4QVKA 3JWIA 1JQJC 2FZWA 2RHWA 1CJKC 3D5EA 4IQ8A 2R8PA 2GYUA 4N0MA 4B6QA 4BLTA 2G1KA 4EOGA 4IL5A 2FFAA 2IYFA 3MCUA 1XZKA 2EKBA 2NZUG 5I9LA 5ALZA 3UHJA 4KO8A 4X6YA 1Z63A 4BZXA 4B6JA 1ISSA 4EUFA 5CEEA 4JR2A 3H4MA 1NLZA 1R4ZA 3GGOA 4M53A 4DABA 1F8YA 1EP9A 3C4VA 2Y2UA 4Q18A 2CLCX 3EC1A 1YQ9A 1ZITA 5IN5A 1LX7A 4MJ7A 2WWVD 2H07A 1GG8A 2VBGA 3LCCA 5FNZA 4A0FA 4X3OA 2COKA 4L02A 1KKUA 1U8CB 3GEPA 3KQMA 3SJZA 2IOQA 3INGA 1IBRA 3K6SA 3N2KA 5JRJA 3RUHA 2ORYA 1FLDA 3FSGA 5BV2P 1ILEA 1JAHA 1IY8A 1YZYA 3WFZA 1V3VA 1F51E 1IN6A 2FX3A 3P19A 4YAGA 3FOWA 2OOSA 4J16C 4BYGA 4A03A 2EQAA 2BW0A 1W19A 3SEQA 3V42A 1QHEA 2A78A 2ONZA 1S7CA 1S96A 3NYRA 2E4AA 1CXZA 3KV3O 5LQDA 4MDEA 1KSHA 4V3BA 1ZICA 3VOTA 4DZTA 4EQ6B 2PYDA 3EGIA 1E2IA 5CITA 2IZ1A 5CA0A 4UCFA 4BBZA 1KK3A 4J1TC 2PMBA 3T15A 3H2JA 3K20A 3L93A 5FADA 3SQNA 4UFNA 4DW8A 4B4WA 5C1DA 1HDEA 1JXOA 1T2AA 1S9DA 2AMVA 3RANA 4R6XA 3INYA 5L95A 3TGLA 1LBQA 5KQRA 3H9CA 2R7AA 4PNZA 1ZOSA 2FEOA 4AO6A 4EFLA 1C81A 3DE3X 4CW7A 4E5KA 5AVYA 2NVBA 1MKYA 5AW2A 3FLEA 1FPQA 5TQJA 2BKLA 2V7XA 1U9CA 3M70A 4HDOB 5EA2A 1STOA 2IV2X 3ZE9A 2XIJA 3ZLJA 3ZJTA 1PT5A 1GRCA 2J85A 3O95A 2DAPA 1S8AA 4MS3B 3R09A 3GYBA 1Y3IA 2E21A 3A36A 3AFOA 4PQFA 4UULA 3WGUA 2CXNA 4D3ZA 1XZMA 4A1OA 3ZH9B 2ZOSA 2J59A 3DHYA 1M6VA 2CN1A 1IFXA 4E5DA 5FJJA 4YJ3A 4P31A 1WB9A 1UL1X 2YJ4A 2RGRA 3FPEA 5I8ZA 4RTMA 3EZ2A 3SX4A 3AR4A 3BJIC 1AK2A 2VTDA 2V97A 3IAEA 4CLOB 4E09A 2XKKA 4MVYA 3ZKWA 4YK7A 3LQFA 1M34A 3UAZA 3L8GA 2HT6A 4U1RA 3PNBA 1UJBA 1BXGB 3ADKA 4MS4B 1E94E 3E84A 1JZTA 1VXRA 3E0QA 4S3MA 4URWR 3W77A 3K9FC 2Q5OA 2Z6UA 2MINB 3VNUA 3PZRA 3D31A 8OHMA 4XGQA 2NVOA 4U5XA 4C0KA 3AEXA 3OTGA 2ZQYA 4YP6A 4C0LA 1K6IA 3FVTA 4N0PA 4V38A 5CVDA 4XKJA 5FA5A 1PEYA 5LYJF 1YL6A 2XE6A 1KQNA 1YRAA 5BVGA 3PRHA 1NM5C 4EJSB 1U2DC 3R7NA 3HK2A 1HH4A 3SBEA 4Y2UA 1SBCA 4A0RA 1A0OA 2OLJA 3WLTA 1L9KA 1RZ3A 4F45A 4AKIA 5CXUA 3HO6A 4JYAB 1IM8A 3RYHA 1P7VA 3DBVO 2H8GA 2HQOA 3OKFA 3BHMA 3QITA 1PV4A 3A6EA 5CVVA 4ER5A 3IOCA 4MYUA 4HNAA 2CB0A 3KXIA 4B32A 5F73A 4HI0E 4BTLA 1XD2B 2FX2A 3PDWA 4BLOA 1U0OC 4DCMA 3WIBA 2BI8A 1Y5RA 4M22A 1UJMA 1H6BA 2H0QA 3QFSA 1B16A 2AFVA 1KFBB 5G1OA 1OGJA 3RSFA 2HU7A 2YWEA 4J0HA 4DV2B 3ESQA 2OGUA 4PIMA 1I5OA 2J3QA 3ICQB 1Q12A 5K3FB 5BPFA 1FXWF 2UZ0A 3OT5A 1VL8A 4JA2A 4UMFA 4BOYA 3UXEA 2QTBA 4IH4A 4YRQA 3VPCA 1JJVA 1WMDA 4N8SA 3BH0A 5ERYA 4A2PA 1G1MA 1I51A 2BJVA 2OE2A 2TECE 3LL4A 1IBSA 1X80B 2B61A 5IDVA 1G21E 2IZ7A 3JQAB 3IBSA 4BNTA 1FX0B 2QZ9A 3FBGA 3AJEA 2ZQZA 3EODA 4V0SA 4ZVVA 3PQ3A 2GFHA 4PWYA 5LOVF 1IWOA 1B0PA 3A2LA 2J9FB 4LHWA 2VZEA 1NJ6A 4B48A 3B2QA 3RADC 1L1EA 1SBZA 3OOHA 4LVNA 1GZ4A 4Q21A 3QA9A 4DA4A 1AKEA 1P1KA 5CW1A 1KERA 3FJ1A 4OHYA 2AD5A 3ELWA 5TRTA 2A5LA 2PX5A 3L1JA 4IFIA 4DV5B 5IYZB 3NYQA 2IXGA 1TQHA 2A0FA 1E3JA 4OQFA 1J0BA 1G1AA 3BA6A 3EUWA 1X74A 5KOJB 1JYEA 4IMIB 2ZSBA 4W1SA 4CM3A 5D3KA 1KAEA 2XJ9A 4RZ3A 2AIRA 13PKA 5J23A 2PKCA 4IXTA 5JWRA 3BFJA 1Q57A 2JGJA 3QUTA 2XNHA 3AUJB 3HE3A 4HAIA 4BNXA 3PPYA 5I9NA 2D0PB 4ZOLA 3SEFA 2HO5A 4RA6B 4D92A 3C87A 3SMQA 1MR3F 2H7XA 2IHZA 2OD2A 2O2DA 2UAGA 4JZKA 1XN1A 2H1LA 4OM7A 3L9WA 1G0NA 1R27A 2CK3D 5FWYB 3BDVA 3N2NA 4YCSA 3FTFA 1NU6A 1G16A 1DQYA 3VJKA 3FGOA 2ET6A 3IILA 1REQB 3ANYB 3VV3A 1GTJ1 2WU8A 3IR6A 1N9ZA 3OLXA 5GY7A 4DUYB 3QP9A 5IAOA 1EJ0A 2XUKA 4J9VA 4XWGA 2P0AA 2H65A 2JIRA 2QGFA 1ZRHA 3D59A 4EWLA 4C06A 4FBGA 4L6IA 1E60A 4NFHA 1ZMRA 3A6DA 4K7JA 3PEYA 2VJBA 2X5JO 3JATB 4WLNA 2AQ8A 3GJ6A 3ZE1B 3B6IA 3UCEA 1V8FA 4ZOQI 3UYLA 3QUQA 2WWHA 3G0BA 2I8CA 1EXDA 4M0DA 4B87A 3M6WA 1FYVA 3P9PA 1F4VA 3T3PB 5K05A 1X94A 4ILEA 2QNBA 2GILA 3L6BA 4IJQA 4C6TB 5FO1A 3NRCA 3WYFA 4ZYLA 2I0FA 1JBEA 1LBSA 4GYJA 1ZUNB 1E96A 1ATIA 3RUIA 4D7AA 3QELB 2V7WA 1DO0A 4WK6A 2C3PA 5AW1A 4FZVA 4R2XA 4Q4AB 2OC9A 4MS3A 1H4SA 4RD1A 4BQOA 5IUJC 4LXXA 5DHRA 4OJQA 5B7GA 4RD0A 2WZBA 5IUKC 4PSKA 2E9SA 1P7PA 4X00A 3IKTA 3BGDA 5B12A 3ZDDA 3BD7A 3F6BX 3UJ6A 2OQRA 4RMHA 4YASA 2QRGA 1COWD 3I4FA 3BVPA 2IYWA 4PHHA 4US0R 5BMVF 5C1BA 3E5NA 3AOEC 4E14A 1V16B 4DV1B 5JISA 1RI3A 4Y6SA 1NQOA 4MWZA 5AICA 3PJDA 1ZH4A 3PR3A 5AQEA 3HA3A 5FO0A 3K0CA 3T0GA 4DDWA 5KHLB 5JAIA 2WA2A 1XQVA 2QPLA 4O25A 4LAFA 3F7TA 1CDDA 1PSZA 2AEJA 1QVWA 2G04A 1CLUA 1G5RA 1X9GA 1U2TA 1ULTA 1T0JB 2ARKA 2I4NA 2MINA 1T6ZA 2YUIA 3FH0A 3EXFB 3PNYA 5HKAA 1K4KA 2C8KA 3BHIA 1PR5A 2VJAA 2Y77A 4R4JA 5AI4A 5KC9A 5P21A 1GG9A 2JJ1A 1L8AA 3BSSA 1NUQA 5J2UB 4BKUA 3OZRA 1O4VA 3ZU3A 2DBZA 2FY8A 2G4CA 3C2QA 3K8ZA 4H7IA 1DB3A 3FHOA 4CM7A 4EJSA 1J9EA 5CT4A 2LGJA 1YHYA 3RJ9A 1B43A 4FHFA 3FTNA 3R5TA 4K9NA 2O8DA 4LPSA 2AEFA 1P5HA 2AQIA 2JL1A 1GKLA 1NMEA 2QTCA 3G2IA 5IK2D 3WL4A 2ZE7A 4FPXA 4ON9A 2VDNB 3GD5A 5AUNB 2ZITA 1PKXA 2XGOA 1XD2A 3QXCA 4L5CA 1Q1BA 1CUZA 1KAGA 1N2IA 2PKRA 1NC3A 5SYNA 2X58A 5TMEA 4X45A 3HY3A 4FMDB 2ZB4A 1HYQA 2BFDB 2IP2A 1CSEE 3SS7X 5J4KA 1N2SA 2EWWA 3G9XA 1MC8A 1V95A 3NEAA 4HYYA 1FEZA 3FI0A 4IMRA 4IOLA 3EVNA 3QKSA 2P9HA 1RWKA 2XB6A 1JLSA 1K7EB 1PZXA 3TZHA 5IABA 4Y2XA 3UV6A 4AULA 3WIOA 2DJ5A 3GFSA 3DL2A 3PWZA 2ZJ7A 3IT3A 3TCNA 3BWEA 4JDUA 3UQZA 4EL5A 3BB1A 3A6LA 5H7XA 1YBFA 1NT2A 4ZOBA 1T0UA 1DWUA 4ND4A 4IJ6A 1S2GA 1TKRA 1UMDB 3JQAA 1JWBB 3HYCA 2H7VA 1FX0A 2QL6A 4ZQHA 4R5MA 2Z8YA 2G17A 5GJWC 3USZA 4LF4B 3RFTA 1XLTA 3INRA 1BDMA 2FPIB 2A8YA 3I2JA 1H6AA 2B7CA 4ARAA 4S05A 2WM3A 1SH7A 3RT9A 2H4FA 2P11A 1KBOA 2D0IA 3CRVA 1YBAA 1E7MA 1BS2A 4OJMX 3MXOA 3FFAA 4EB3A 2VTVA 3PENA 5F9MA 3IV9A 3EZXA 5BP7A 1J49A 5IM4A 2WYOA 5IYZA 1WU7A 5DRYA 3ZQKA 1QIIA 4G5OA 2IPXA 3B6EA 4PIVA 3ZD9A 5F51A 4LKRA 1VSVA 3Q2OA 4BVKA 4YRLA 3AHIA 3ZWXA 5TY0A 4EYSA 3EPHA 5IWCA 1Z8HA 1H2RS 1H2AS 1Z6XA 1C7FA 3A31A 3DFIA 4JUBA 2XVMA 4BMOB 5JROA 2JH9A 3PIIA 1TVKB 4V2UA 4BBJA 1TYEB 4XDHA 1Y8CA 3K1AB 2IDJA 4BXOA 2BKVA 4P3KA 2PWYA 3D5QA 3S28A 1EBFA 2NSJA 1YVDA 4RLHA 1EUCA 1VPVA 4P80A 2WJYA 3P4UA 1EGAA 5D01A 4ER0A 1N36B 2X0JA 3OX1A 4KFUA 1IK6A 1HC7A 3M9LA 3ZJ5A 3H9EO 1MH1A 5FWYA 1AS3A 5BSKA 5AVXA 1KOFA 2XD9A 3PQ4A 3UB2A 2GYYA 4N76A 1YZVA 3HB7A 4MNTA 4QUJA 3CUTA 4TLDA 2JRCA 1YB2A 4NESA 1NULA 3NUZA 1HQCA 3DQQA 3TR6A 2QAGC 4H60A 3WWZA 3BILA 1U0GA 5FTMA 3SF8B 2CFCA 3HYRA 4YT4A 4WASA 5KKAA 2OUKA 4XGNA 2PZJA 5KKCA 2OCIA 1OCEA 1XEXA 2ISCA 4UM7A 1GSIA 4N01A 2UYOA 2QKYA 2Z9DA 3AU8A 3LHDA 5GWXA 4IZHA 4K8RB 5DBHX 3ZKAA 1ZUNA 3CXUA 3C8MA 5EWMA 1YS6A 1P9OA 3PUVA 3QELA 1PQWA 4PRKA 1M76A 1TGYA 2HF9A 3LBYA 5TV2A 3BG5A 2N0SA 3GVPA 4Q4AA 4FIZA 1IAQA 3RK0A 3EWNA 3S8MA 1LUAA 4QWMA 3L49A 3EFHA 3EXEB 1TJYA 1ZXLA 1G4HA 4IIJA 2XCQA 3OX4A 1VLLA 3D2LA 1AKVA 2QENA 2R1UA 4YTEA 2P6RA 1ECLA 2PL3A 5IAKA 3BJZA 4QYXA 4F6RB 1T4BA 2OAEA 2LWIA 4HN9A 4J4BA 4OLAA 3T3NA 2HY7A 2QD4A 4BLSA 1TAQA 4LJAA 2HNAA 4OH1A 4B0OA 4BTVA 4BVBA 2VHTA 4GC9A 1OH6A 2ZTUA 1ZM2A 1QRTA 4DDTA 2H11A 1QPBA 2OHVA 1R18A 2N1BA 3DEYX 3EVEA 3OI7A 4AZTA 1V11B 1XVIA 2ORVA 1RLOA 3OA2A 5BV1A 3TMKA 2R96A 3TL6A 2D5AA 4JI0B 1OXSC 4AXXA 5IAJA 2VHXA 3DF7A 1Z0AA 2W4MA 4M0CA 5J2UA 4I7EA 2EEZA 3EDQA 3H2YA 4OXXA 2HDHA 1JR3D 1R8YA 1L4LA 3JQ8A 3QYAA 2OENG 4RVHA 4Z3OA 2XODA 3TD6A 3TPZA 4QNMA 1BYIA 5FQOA 4DMFA 3UXMA 2C4MA 2ZRLA 3DTVD 3G6KA 4F72A 2R6ZA 4KWHA 5IZCA 4D26A 1WJGA 4DIKA 4G41A 1O6ZA 1D04A 1D6SA 3Q8KA 2PT5A 4QYTA 4C7XA 3CLUC 3GRPA 4QFBA 2ZUCA 2IP4A 4FGZA 1DKLA 2GLXA 2BF7A 3L79A 5EIBC 4V0MA 1Y9EA 2ZTVA 2H18A 2H85A 1LJUA 3H8VA 2HU2A 2WFZA 3SR3A 2PCLA 3O7WA 3FHCB 4DARA 2Q27A 3PDUA 1BCSA 3ORSA 4H18A 1E9SA 4I55F 1I7LA 1JI0A 4GIBA 1GLGA 1PR0A 1M2FA 1KORA 1TUBB 2VHZA 3AUUA 3BBPA 3QMVA 3WRXA 5JDIA 1C7QA 1EK1A 4XEHA 1QLHA 4HVAA 1CP3A 4XYBA 3L1UA 4IG9A 1L8OA 2I7XA 4FP9A 1W49A 1DOHA 4OIFA 1UKBA 3CWQA 2JLSA 3ROMA 4O3MA 1BH6A 4D3XA 1CZLA 3D4OA 1Q0RA 2FPWA 3MAAC 4ZTBA 4A73A 1D0VA 4XB2A 2FPIA 1V41E 3KHSA 5FBQB 5HCUA 3NIFB 4M83A 3IESA 4XW2A 5FR1A 4BFTA 1GPDG 1T6BY 2AWNA 2D2FA 3CJRA 4HEA6 3MERA 5EQJB 2J7PA 4IDDA 1GLVA 3WLAA 4BDTA 1C41A 2EP5A 3O31A 5HE8A 4ECEA 1Z2OX 4QDZA 1KSFX 4IZOA 2VPIA 3STUA 5FTKA 4RKQA 5DTIA 2IYOA 3H86A 5EKSA 2ZSFA 4G8BA 2HB6A 2NO9A 4RK5A 3K0KA 3C5VA 1RRVA 4Z4QA 2IEIA 3ZHRA 4MPJA 1Z5OA 2C94A 3I53A 3RNOA 3K1ZA 4OIMA 4BFWA 2ATIA 2YJ5A 5FTWA 5CD1A 3AKEA 2WICA 1WDWB 3JQGB 4H4EA 3W5VA 3ZGXA 4A16A 5IDWA 5F2KA 2UZ4A 2QRPA 1PT6A 2HJRA 1H5NA 5FPSA 2VF4X 4JB8A 2QD1A 1II0A 4E4TA 1ICEA 2OXIA 1V3UA 1FVFA 1XZQA 1FLNA 1PHPA 1W25A 2ZPAA 1BE8A 2AR7A 2DFKB 1RRMA 1A04A 1A2QA 3JZFA 5K3BA 3W0LB 1UK9A 1ZM7A 2OTCA 2I6XA 2WYIA 5E3JA 2CUZA 2PO5A 1RYDA 2B1QA 4X84A 4O4JF 4TYNA 1SO8A 2Q6TA 1JQ3A 5CUQA 3WNDA 3JXEA 3VSAA 2WFAA 4RSHA 2PX8A 3NEYA 1GU0A 1N2ZA 3C14C 4C4RA 1QX4A 4CMAA 2HREA 1IULA 2B3TA 1L1FA 4B75A 1E18A 1PSDA 1T3SA 3AHGA 1WUHS 1IHOA 1P18A 2VHWA 3D7NA 5HF8A 3GU3A 2VF7A 1M1ZA 4KACA 2QPTA 4MP8A 1DWQA 4RDIA 3OTIA 1JJ7A 4BVJA 3Q8MA 1FTGA 1NWCA 3CURA 2XMPA 3B8HA 3LY7A 2YIDA 3AEQB 4MAMA 4BZQA 2HJ9A 4MLCA 1JH9A 1N92A 2KW5A 4JCOA 4IJKA 3UANA 3PQ7A 3TLMA 5J5VA 3TD2A 1OXTA 1DIGA 1ZL2A 2MSLA 5ESWA 3V2GA 4BC1A 2PLRA 4G23A 4RHCA 3LVRE 1E2PA 1L7AA 1O4WA 3OZ7A 4FYHA 3W9SA 4BEBA 1QFYA 2ZEJA 4TXNA 1NOIA 3PPWA 3I3SR 1OYVA 5M2QA 4ZMBA 3U6BA 5BT8A 1G17A 1XTQA 1ZNWA 3I42A 4PZ0A 1NJSA 3B51X 3LQYA 2O0JA 4JQYA 4JGGA 1YS1X 1EU1A 1LSOA 4D3DA 1VLMA 1ECCA 1IZ9A 4MV9A 2E5LB 2W6NA 1WZEA 2I03A 3QK7A 2XHZA 3KFXA 3OOEA 1UQUA 1NVDA 3PNLA 3T3OA 1RWBA 3GCZA 4BQPA 1HR0B 1KAOA 1P2FA 4UHHA 2G3YA 2JFPA 3V7FA 1UC8A 4ITUA 2O1EA 1JLMA 2BGIA 2P4SA 3NDRA 3AHHA 1KTVA 2O2EA 2P5SA 2W6ZA 2EFJA 2ZE6A 3L4BA 3MRXA 4AJEA 1T0BA 4Q3DA 1Y9ZA 1RKVA 1N2CB 2PGXA 1Y9DA 3CZPA 3TIGA 3VC1A 4Z9YA 1IHXA 3JRNA 1BZYA 1M8GA 4RPJA 5T67A 3I6BA 4X1KB 3IXMA 5JECA 3H5NA 1HGXA 4EI9A 5HYVA 4OX9Y 4LEIA 4KWTA 4URHA 3VU3A 1KDPA 3SKXA 4XX1A 4YGXB 1VBNA 4OGGA 1UWVA 1NV8A 2CVOA 2P6NA 4WNAB 4EUHA 5BSWA 1KEKA 4REMA 1DRUA 1HL3A 4C9BA 3AINA 3KEQA 4PBRA 2VPTA 4JYZA 1PGPA 3NJ8A 4GF5A 2VTBB 3OUTA 1ISPA 5ARCA 1CY1A 2C2HA 2JASA 3FZGA 4LY9A 2ECQA 1T3GA 3M83A 3U09A 1XD8A 2QYTA 3BXZA 5G1PA 3K70B 1RJ9B 4H27A 5DNWA 5FI5A 2MSDB 4ZQBA 5FLYA 4Z4EA 3L7NA 4G0PA 4JUFA 2R86A 4XVHA 1FNSA 3DXFA 3IFSA 3P9SA 4UTXA 4RJ2A 2PJRA 2FZ4A 2B4TO 3EQ2A 4IIFA 2FV8A 5JE8A 3UIEA 5ALNA 1FDVA 3A4TA 4M8KA 3V4PB 4MRSA 3Q6MA 4IY1A 3E3MA 2JIDA 2XQGA 4AYXA 1FQWA 1SEVA 3LP6A 4MKIA 3T3HA 1AQ6A 3VOSA 5EJ9A 3OKAA 3AVOA 4JJ6A 4QXMA 1F60A 2QOEA 2YJ3A 3GY0A 2O20A 1XWIA 1CDEA 4URZR 5JYBA 3ZEIA 1FSFA 4F1KA 5IEBA 4D96A 5KX5B 3KJGA 4G9EA 3S1AA 2ZBQA 3ESXA 1W6RA 1TE2A 3IYLW 1KDVA 1NRXA 1T5HX 2BDUA 2XDYA 2PS9A 1Z28A 1UDWA 3JQEA 3NH6A 3ZY4A 5AW6A 2PUEA 2RHGB 2XXBA 5BV0A 3FJYA 2X0NA 3H7AA 5D5QA 1WKCA 2ONKA 2H1CA 3GZTB 2QX7A 1LPNA 3ETJA 1IVSA 1FLVA 3KQQA 4QZVA 2V54A 4KR0A 2VPZA 5FWDA 2JANA 3D0QA 2HA2A 3MD0A 1XXLA 1UH5A 3NAZA 5HEKA 3WV5A 1W1IA 3IKMB 5FUWA 2FOIA 3UFXA 4O4HB 3E2MA 1JLLB 4B8ZA 2QUIA 3GLUA 3PXBA 5JJKA 2IVFA 1VMIA 3C5HA 3KYJB 5EMHA 3K70D 2MYUA 3JQGA 2RK3A 4LJRA 2I7VA 2OG2A 1ADFA 1YZKA 4XX0B 4DRZA 1EM8B 3QE9Y 4FNOA 4Y6PA 4WL0A 3C1OA 2FTKE 1EK2A 2JFUA 5D00A 5C3MA 1K88A 3BJRA 3O4RA 4RQBA 4XR9A 5TPZD 1A8HA 3QZUA 3AONB 4NBWA 3NLLA 1JA1A 1KYZA 1O95A 3SFTA 5BN3B 1WY7A 1N7HA 1R4MB 4BCDA 3COPA 4ENTA 1IBKB 3WXBA 1KAHA 3FMFA 1W5TA 2IYXA 1Z6AA 1U6JA 2GEUA 4H3HB 4ZYYA 1MABB 4YIKA 4ZT3A 3RFXA 4YGYA 1ZL0A 2TSYB 3L04A 1C30B 3LYAA 2PH5A 3QY9A 4HP8A 1U63A 2LBPA 2BFFB 2V3CC 2DJIA 1N5JA 2WE7A 1XPUA 3WRYA 1J5EB 1QCCA 1UKCA 1XF9A 3U7QB 4YC7A 2GD2A 2ACEA 1CZNA 2JVKA 1WDTA 3L7BA 3IR7A 5CXSA 3RYIA 4UUBA 4Q9IA 4DSTA 1JQAA 1MC5A 3VTFA 1CEYA 4AJHA 3LHIA 3KAKA 5EKDA 2IPNA 1EFVB 2F00A 1H8EA 4QG7A 3ZXXA 1IBMB 5FX2A 1NXXA 5H4HA 4B7CA 4EG6A 2JIOA 1M9NA 2ZAMA 1BD3A 4IDBA 3PVZA 2ZIZA 4J0KA 1E0KA 1WLSA 5TQ2A 1QHFA 2AC7A 2I6SA 1I5EA 1Z8NA 2I2DA 4H1HA 4HXFB 7MHTA 2BJWA 2D8MA 1BEEA 2YXLA 4QQFA 5B6JA 2H4WA 3GRVA 2FPOA 3C3AA 4F60A 3NAGA 1CZOA 4K3UA 5C32A 3O4IA 1DAGA 1UFKA 4XUCA 2GJ4A 4GPEA 3Q9SA 1S2DA 4LQCA 1NVUQ 1T5TA 3JTMA 4PF1A 4UUNA 5ETJA 1JPVA 4ZGGA 3T7TA 1PWHA 2FFQA 4KYTA 3ZLVA 2II6A 2GXQA 5CNKA 3KETA 1H93A 4O4IB 4EKEA 3V9AA 1R74A 2OP0A 4DB4A 5E9JA 1TA0A 3TTSA 4TTTS 4YUXA 1RM5A 1Z47A 1DADA 2C42A 5KTPA 1P1HA 4YUYA 2I6UA 1EWKA 3OPNA 1A76A 1Z45A 2IHJA 1DKPA 2C92A 3HCCA 3QLUC 4D0SA 5K0BA 2OHIA 4Q47A 4C0HA 5LP6C 2TMGA 3DEHA 1HDCA 1OVMA 5AW9A 4HT3B 4F9GA 3PNQA 1YU6A 4E08A 5KBYA 4LTMA 4G4JA 3E4CA 4W9NA 2JJMA 2BH9A 2Q4OA 3CWZA 3EGWA 2PL5A 4FWTA 3UXHA 5DK6A 5IAAA 4LHVA 2JAWA 2YWRA 4YECA 1VZ2A 2ATXA 3T5CA 3THSA 2V6BA 2VTBA 3ANNA 4DADA 1U7PA 3O75A 3UCXA 4D25A 2O59A 1X38A 3OCZA 3OFSA 5EP2A 1Z75A 1JMVA 1TKBA 3WFIA 3R74A 4PINA 3TTUA 4BU1A 2O7QA 1W0KD 4LRWA 2CVPA 4GUAA 1ZIYA 1VJTA 3PE3A 4Q3BA 3REQA 4HH4A 1LGYA 1BXZA 1QG0A 2C95A 1NQTA 2HFJA 2JI9A 3EVCA 4FOTA 4RF2A 1U0TA 2RGWA 3H5VA 1U8XX 1ID1A 2HCRA 2AFIE 4MDYA 1RIIA 1YQUA 2WF8A 1QG4A 3S27A 3LNTA 3V4ZA 3MEQA 4D81A 1GCGA 3G8DA 3UATA 4P7BA 3HJFA 4BQNA 3PUHA 2WTNA 4PN3A 1OE0A 2ZZNA 4WXHA 1KKMA 5A3SA 4F11A 3FVRA 1ZK3A 1HT1E 2E82A 4EBFA 1OIWA 1KXJA 3FWYA 3MWGA 1U3TA 4XOIA 3I64A 4XPZA 4A8JC 4EI8A 3FCEA 4QYMA 1E2HA 4ENPA 3WS7A 1JAXA 3IDFA 3MJHA 3PFWO 3ADDA 4K26A 3OIYA 4IINA 1VHJA 4EGSA 2HU8A 4EITA 4DV0B 4X20B 3H5LA 2NADA 4L0CA 3GXOA 1FP4B 2W93A 4M7OA 1CR0A 1DRVA 3UMRA 3OZIA 1Z56C 2MR6A 2D8AA 2YS6A 3KUDA 4DUGA 3W5JA 5AJTA 1PDVA 2HTEA 2QQ5A 4MTCA 3GROA 3F5DA 3OQHA 4LCBA 2G1AA 4O4HA 3EBLA 1L5MA 3NYWA 3DMDA 5EXSA 3T5MA 2ZXFA 4X8HA 3AVQA 1OAOC 1YIAA 2FDXA 3ZWMA 3DVAA 2YZGA 1KZGB 2VK1A 1I2BA 3ZK9A 4AIRA 4M98A 3PPVA 2BFEA 5FB3A 2P9YA 3LIIA 4NS4A 3OFKA 4QDUA 3BRSA 4P4GA 4LMPA 4JZYA 2GUWA 2Y6VA 4I8DA 5HXAA 3IUYA 4RIHA 1EM6A 4QXQA 2OMKA 5E1MA 3CNHA 5EC8A 2GK4A 1KQFA 1CB0A 3LF1A 1QGYA 4GM1A 5TJHA 1L8QA 2BGNA 2F3QA 4QAQA 3AFGA 5BN3A 1AHNA 2FUCA 2BFMA 2HJSA 1EFLA 1UFQA 1YZLA 4RY0A 3QVWA 5CU7A 3S5JA 1GGKA 3F67A 3T7EA 1GSHA 1MABA 1NJ2A 4FGJA 3BSYA 2ERCA 3LA8A 3LUFA 4F5DA 2I9KA 3WLFA 3AVTA 1TIPA 3P8ZA 1ZMTA 3OY2A 1EXWA 2BFFA 4MGHA 1G60A 2Z9BA 4KXUA 4M0UA 2X40A 1PEDA 4DLRA 4FR5A 1HE1C 5IN4A 3PC6A 3KOZA 1NLYA 2CL7X 1WE2A 1DLIA 1CVRA 3ETGA 2FQ1A 4HDMA 1A7AA 4UE2A 1GPKA 5GIOE 3FTEA 2E6UX 3QU2A 3JARB 3SXJA 3PQ2A 4GMXA 4BBPA 3ZVNA 5HIAA 1EFVA 5HZKA 1EXMA 1XZPA 4JK3A 5FR2A 2WSSD 4QU8A 3WBJA 2GZDA 1VGVA 4DG5A 2ZIEA 1C4KA 1U0LA 2ODBA 5J40A 5M34A 4OHXA 2ZZKA 3WYCA 1IBLB 5T3YA 4OL9A 4HYQA 1GRNA 3V2UA 4MINA 4GPTA 5AVSA 1R9JA 1W581 3AUFA 2VVTA 1UJ5A 3Q7RA 4BB0A 5CLFA 4LPKA 3EGDB 3QLJA 2EKDA 4UXHA 1C8KA 2O7NA 1M0WA 3GYGA 2NLOA 4IEIA 3FVQA 2P65A 4I6GA 3HNOA 2AG5A 1RHKA 3A4NA 2OWEA 4AP5A 3MJSA 4LJSA 1RXWA 1LRJA 4MGIR 2ERYA 4Q39A 1ADYA 2XY4A 4AJIA 4K86A 4O4IA 1UOQA 4ZQCB 5ELMA 1WG8A 1W85B 2X7JA 3MN1A 4TZKA 1PR9A 1EYZA 4ED9A 1W4CA 5LB2A 5K6AC 2ZTHA 3L7CA 5DWDA 3UKOA 4JBYA 1CTQA 4JXXA 1A4RA 1QIFA 2RGCA 4MA4A 4C7KA 4H0FA 3U49A 2GAAA 2CVQA 1RCTE 3GGCA 3HFJA 5FFMA 3TZQA 2Z5GA 5T64A 3ZGYA 4PXAA 4ENVA 2XUHA 3LVBA 3QBVA 4KO3S 5GZ6A 5DX8A 4XGRA 3SXUB 4E03A 2P9GA 2JFVA 2DQKA 4PPNA 3MA0A 3BA1A 3H1GA 1S01A 1ULSA 1MUUA 1TVCA 1X7XB 2BMAA 3JZDA 5JHGB 5JARA 5D2CA 1EP2B 5K5EA 1E4EB 3DAGA 3FBTA 5LJIA 5BW8A 3NTOA 2GEKA 3KT6A 2OM2A 3CNLA 2A88A 3C3EA 2RHTA 1U7DA 4TLLB 1OT3A 3R8XA 1QQAA 2ZAGA 1Y48E 3B82A 3E27A 3PA6A 5DSXA 5CM8B 2VP4A 3PPIA 2WAYA 5IC6A 5KJ6A 1RPZA 2H4JA 4QOEA 4RK6A 2ZJ1A 5EOVA 5JFTA 2W83A 5E0OA 1H2YA 3JQ7B 4BB9A 4ZZIA 2WMNB 3LTEA 3TNLA 2CZQA 3X0DA 1JJFA 3F97A 3JAKB 3LUHA 2XWBF 1P2TA 1Z26A 3AFHA 5C7LO 1OXXK 1G9SA 1X3LA 3LRXA 3NDJA 3EXHC 3ZLUA 3FNIA 1G6KA 4M2LA 4UPVA 1JKJB 3PIRA 4CMIB 4FYXA 1WZCA 3P9KA 421PA 4EHKA 2SICE 1SCNE 4BAUA 1OU4A 2QX6A 4LC0A 1H2XA 3BXHA 3NT2A 3M5DA 5JS2A 2HH9A 2JKVA 2PU5A 4BUJA 4Z4IA 1TM1E 2BEWA 2JDID 1L4YA 4J0QA 2XCTB 1V4NA 1D4FA 2F17A 3LC1O 4I5IA 4ZVPA 2IXBA 4B6RA 3MQFA 4DFDA 2PUCA 1FP4A 1WA5A 2WUDA 3QPVA 1ECFA 4MR8A 2IYAA 3W8EA 1Z7EA 4R7TA 1T4MA 4ZIRB 3UMFA 1FTWA 4ZDKA 1T8YA 2GF9A 1R0RE 1OU0A 4XPIB 3IV7A 3H0CA 1UPXA 1VDMA 1DKOA 1H94A 3M82A 2RAPA 3GQVA 3K2BA 1FDSA 2F1RA 3KJXA 1K1EA 4RJJA 1P0PA 1YAHA 3ABOB 1LVHA 3D2AA 1YCDA 2AX3A 4LISA 1OBVA 3NAQA 1HETA 3TKLA 5AOAA 4EM6A 1X1TA 3NWJA 2I71A 1Y1LA 4Q6BA 3GZNB 2F4NA 1PZNA 1AKWA 2ADOA 3CX7A 1TRKA 1IRXA 4QOSA 5D1NA 2BGWA 3GFGA 5ECYA 4MW2A 1N2JA 4R9VA 1USUA 2PA3A 3MC1A 2ICAA 1ZJYA 2IEGA 1XXHB 2BF4A 3TZKA 3RU7A 1HRDA 2QMQA 4G09A 2LV8A 2VNKA 1QRSA 2W2NA 2XWSA 3RS9A 2XECA 3DTVB 5HRCA 4IFEA 1L4KA 3IA2A 4WBSA 1CG6A 2XNCA 3GQBB 1BRTA 3BD9A 1I0ZA 1RHQA 3EZ9A 5JC8A 3PXDA 3AC0A 4MQMA 2J0UB 2I6GA 4AMUA 1JR6A 1E7YA 2WZDA 3BMXA 4BCCA 4G1BA 4B3IA 1RKUA 1VFPA 4IVPA 1N2EA 2BIFA 2WIGA 4BE9A 3TLZA 4P6VF 1GZDA 3S2FA 2FQQA 3JARA 5KAPA 1OHHA 1Z0UA 4Z3DA 2OG1A 1L5YA 3I0NA 5DCWA 2QTAA 3OCXA 3ELUA 3ED1A 3INTA 3H8WA 4FHGA 4ARIA 1J0AA 2YFQA 1HX7A 1JLRA 4FHCA 1CRZA 4CQLA 1KK0A 2OGTA 3RAFC 5JXJA 3NU1A 3CB4A 3TRDA 4AM8A 1SEPA 5GPBA 3ILYA 1N6PA 4Q3CA 3UK7A 4JLAA 2UUPA 1G63A 1DC6A 1CYDA 2BZ0A 1M5UA 2GA9A 3S1LA 4F9TA 4AXBA 4BLRA 2QL9A 1ATZA 1RYNA 2ZDHA 3MINB 3N75A 4XLLA 5CW2A 5HILA 4D42A 2XZDA 5J4YA 1Y7HA 3BD6A 4JUDX 1YMUA 3RWOA 3N8NA 3W3AD 2JGMA 3DZBA 5JV5A 3P9ZA 4ZJZA 4EDHA 2B1IA 4NCKA 3HVHA 5IT4A 2BUBA 1P80A 2V4MA 5GP1A 5I7SA 5KB3A 1N0HA 2RHDA 1HK7A 4PZ9A 1W85A 4Y2YA 5LZ5A 3A1TA 1U0FA 4DMKA 2R68A 4TQUS 2PG3A 3GJRA 4HLUA 3VMMA 1TZBA 3D8HA 1THZA 4H6VA 3NIGB 4V0LA 5E4TA 4EEXA 3JWGA 1QRUA 1E62A 1GDHA 1QWOA 3TX6A 4CLDA 4AP6A 3ZGZA 2PKEA 3ER6A 4Z0TA 1LY1A 2J0EA 3ADOA 4D9GA 1OX5A 1BWQA 3KXDA 4GYKA 2OHXA 1O8CA 2EZUA 3QG5A 3OQVA 4OHKA 1DDOA 2FW0A 2QMZA 5AT1A 3L6UA 3ZHBA 5KVVA 2JLUA 3I0ZA 3E1SA 3K09C 1ONSA 2C9BA 4IXWA 4B7AA 3PDIB 1GLNA 3IAXA 3N7UA 3FG9A 2XCOA 2Q8NA 4BFLA 2QNIA 4RY8A 2GJ9A 4J1SA 2OXTA 4ZYUA 5JAZA 1FMFA 4A2QA 3CO0S 4WDQA 2ECOA 1EFKA 2G40A 2JK1A 3IJPA 2X2PA 3E03A 4JI6B 3VM6A 4Z49A 3TEFA 2BC9A 3I12A 4UBNA 4HLCA 2YMQA 2CVFA 3JQ7A 2Y0DA 3VPXA 3WMFA 1E99A 1OAAA 2G36A 2QRUA 3OFJA 1XTIA 4Q0MA 3MNFA 1THGA 5LP6F 1TRHA 1TKAA 1PR2A 2HLDD 3HVIA 4NHEA 5IULC 2UU9B 2CUNA 4MPRA 4ALMA 5IBRA 1NBMA 2OK7A 3ZCXA 3AJAA 1PL7A 1ECBA 4RK4A 3RLIA 2PS0A 2X0KA 4NPCA 3L6CA 4BRZA 2CYBA 1NF8A 4G5RA 1P62B 2X1HA 1B0UA 4OQQA 1SCAA 4ZXFA 4II3A 2B9EA 2I4IA 1W36B 1L7DA 1PTJA 2R7KA 3G5AA 5MN4A 1OB2A 1UZMA 3BCSA 3CR8A 5DTJA 4L78A 1I2ZA 1XQWA 3AZOA 4IDOA 4JXKA 1Z5PA 5B58T 1G7SA 2Q8QA 4AS2A 4BO4A 1PQYA 1ZCBA 3FHLA 5E6RA 2O0HA 3PWKA 1GGNA 3C5CA 4R0MA 5K4GA 3DJFA 1RLJA 5AOVA 3QXSA 4CV3A 1HZJA 3AXSA 1SG9A 3BCRA 3X1JA 4RGBA 1YS9A 2NXCA 2WT9A 3EIQA 1VIVA 4KMSA 2ACKA 1FK8A 1PR3A 2PZAA 4XPIA 3SJAA 1QZZA 4QPDA 1KVTA 1U81A 3AY0A 3K4HA 3VNRA 2LVBA 4LI0A 4CLEA 1J7KA 3HO1A 1ZISA 2ZBFA 4YMWA 5JNUA 3QX7A 1ENYA 2WKPA 4OFWA 2FEWB 4YT8A 3N7TA 2YNMC 5ALEA 4LJ9A 5U1PA 3HABA 2QG9A 3TNYA 2CNNA 3OT1B 1JQEA 1V5EA 2NQ2C 3B6JA 1P4JA 2P5UA 2BSXA 1S3SA 5KNLA 3HDGA 3SXPA 4FGWA 3DA8A 1CF2O 4ZCPA 4LG1A 2O8CB 1YA8A 4DLKA 5FORA 4QSMA 4NYMQ 3FBWA 1HOXA 4I99A 1W8IA 2FJ0A 3FOBA 3QEMB 1SU8A 5ADWA 5L3QA 1QIKA 4L8FA 1R8SA 3KSRA 1NI4A 4CCWA 4GXQA 4YRBA 3FUWA 3WIDA 2CLIB 3GQBA 3WXMA 1WMAA 2A14A 4XH9B 1Z22A 5IF9A 3QOXA 2J0UA 1O95D 1VGQA 3RJZA 1IY9A 3E0XA 1BE1A 1NP6A 3QF4B 4NH4A 4B44A 4JLVA 4WEOA 3NHPA 2A7QA 1LS1A 1IIBA 4RK1A 2GH1A 3S1AB 1K7CA 4L7VA 3VNAA 3QJ5A 2KPOA 1Z6YA 2ZZMA 2PT6A 1E61A 1UMBA 5EZYA 5BUQA 5CDFE 4OQ4A 5GMOA 4NDNE 1KPGA 4C78A 4S12A 5HIIA 4F46A 4DQLA 1FFSA 3I61A 2D1QA 4GQIA 3OQMA 1E1MA 4MUNA 5ALPA 5L3ZA 4OB8A 4IJVA 3RSCA 5KVQA 1QZ3A 2X77A 4HGQA 3TF5A 2YW9A 4G1FA 2BDEA 4M0EA 3D8BA 1JVNA 1AA6A 4AZWA 2QZ4A 3PD7A 1M2HA 2Y3IA 4FDVA 5L45A 4E4RA 3MINA 3LMKA 5JO9A 3TW6A 4OTZA 2PQ2A 1L5GB 1GQRA 4XSVA 1GSAA 3KK0A 1B1CA 2DFTA 2JAXA 2ZWPA 1UKAA 1X13A 3K05A 1BJTA 1NG1A 3LG2A 4EI7A 1CR1A 1U3FA 4TGLA 4BV9A 4N0DA 1ELOA 4FYKA 5AK0A 5L53A 3FNQA 1NNI1 3G9UA 2H0RA 1AQIA 2VK4A 1Y3AA 2MSCB 3FGNA 2R00A 1KEZA 2Q0HA 5MGBA 1JE1A 2HHAA 2O06A 2YVUA 4X1IB 3RTCA 4EW3A 4YWJA 4JI5B 5HF6A 3NEJA 4NULA 1DWOA 1NKSA 2OAP1 1V5IA 4B73A 5CCDA 2FRVA 2FN4A 1O6FA 3AX6A 3EEFA 4BO2A 1VE9A 3LA6A 3V32A 2XMBA 6REQA 4K87A 1S5PA 2C98A 3G8CA 1J99A 4TMYA 2AXNA 1KXZA 1YQGA 2RJ3A 3EBOA 4MUEA 5DWVA 1XMVA 3QE2A 2OBXA 4W1QA 1SQGA 2I54A 5FUQA 4X8MA 1M75A 4RF4A 2PX0A 1FZTA 4B2PA 5K8LA 3IJRA 2DHEA 4PR0A 2E1RA 3GB9A 3GJ8A 3VPHA 3ORYA 2YTZA 1EWRA 1BH2A 4FCCA 4DN6A 1P5RA 1XR3A 3ISVA 4MIYA 5C31A 3U3RA 4ETNA 1GZSA 5BT9A 4RZHA 5TR9A 3UEOA 5L51A 3IAUA 1SUWA 4OCZA 1ITZA 3ZD6A 2FJPA 2C5LA 4OYRA 5TLSA 3CBGA 3IOBA 2PAAA 3PJGA 2YMLA 3MCWA 3SSAA 2PUVA 3BH7A 3LGSA 4MPTA 4IJMA 3MS4A 3UT6A 3JAWA 4Q48A 2DEUA 4N3NA 3O0TA 4QA9A 4CTJA 3KKQA 4JGIA 3KEGA 2DLNA 5DMHA 4TSRA 3UGTA 2DZDA 2VDQB 1W4RA 1LNSA 1RJGA 1BOOA 1FTNA 1P8JA 3AR5A 1U0NA 1LPPA 4RU1A 5E7MA 2WF6A 5FPYA 5T4EA 1DNPA 2BMVA 1ZNXA 3QU4A 3W9BA 5KSZA 3AVXA 4QPCA 4ZV7A 3QG1A 3DYIA 3GPBA 3H4IA 5EN4A 2CLSA 2C7QA 3V00A 1PUJA 2FGKA 3QV2A 1ZWKA 4NBTA 1IXSB 3H9BA 2GBPA 3UB3A 1OI7A 5GTDA 2DLCX 1X2EA 2BBSA 2NO5A 1Z13A 2TMKA 2Y93A 3KR0A 3ET5A 4HFMA 1N8NA 1QZUA 2YHIB 1O94A 5K45A 1U99A 1J70A 4GSKA 4CG3A 4BRSA 1HDGO 2XTZA 3BL5A 1JI3A 2G28A 4CIWA 2OXEA 4IXDA 2AXEA 3GJTA 4ZRMA 1C3LA 2OBLA 4ZV9A 4P53A 4R83A 2C2BA 4EJ2A 1ZN7A 1U9YA 2BGGA 1V37A 1QNLA 2OB1A 1RTTA 2BEJA 2VPYA 2WC1A 1AGRA 3CU5A 3EIOA 4IYJA 4NJMA 4K0KB 4PAWA 1H66A 3G17A 5AI6A 4PW0A 1VECA 4EHLA 4X7RA 2RD2A 2W6ID 4BMVA 1IN7A 1JQKA 3KM0A 2C58A 1NV9A 3JQCA 2HDNB 3PXCX 5EL0A 2RKWA 3NHKA 3BIWA 4IBOA 4UFOA 1CP2A 2O4UX 3OT1A 3VSBA 1L5HB 2XB8A 5AW5A 4A23A 1ORRA 3VKGA 3R7BA 2F90A 4PGAA 4MWOA 5DT2A 3HR7A 1N5KA 2IZ6A 3UHFA 1P2SA 3CX3A 2ZI5A 1NDQA 2W4QA 1IWPB 1VKOA 3I45A 3RVSA 2O8CA 4A5SA 4IP0A 3QBTA 2YIMA 2YJNA 3AUAA 4PX9A 4RXMA 1KJNA 1ZKMA 3NHUA 4YAKA 3QEMA 3FYHA 5B7PA 2A1UB 1L6RA 5E2AA 4ARZA 3EXG1 5LB4A 2J07A 2I76A 3IAS1 5KJFA 2WIDA 3KDSE 2V7UA 4MEAA 3LY5A 5E6SB 3I62A 2GARA 2V98A 4S2UA 1TZKA 2W6JA 4AYWA 1W9HA 5JRZA 3FTQA 3H99A 5KYVA 2LIPA 2XSZD 4Q3EA 1DSSG 5SY4A 2VSXA 1HSOA 1KZ4A 1X3SA 2FN3A 2OV6A 2B8WA 3JWPA 4TSFA 1IK4A 2WBLC 3W04A 1N0WA 1VB3A 1CNFA 3OJEA 1JDVA 2N47A 2ZRQA 1OGYA 1GPLA 721PA 1LS6A 2OESA 3EWIA 5TXGA 4U7FA 1GZ6A 3EG9B 4BDSA 5ENZA 4MB0A 3LBIA 1H4TA 2HIMA 1GILA 1E9AA 1SFRA 2K87A 4L50A 1Y3CE 4MEJA 2YJTD 5DISB 5FP0A 1Z3IX 4PZZA 2ZYIA 1JDUA 2KS6A 2GPNA 3E15A 5ERGB 4V0RA 1T8SA 4YA6A 4WJKB 1OYOA 3CEAA 3K0BA 1SZJG 2Z08A 3GWZA 1SHTX 2WM8A 4CEHB 3EVFA 2IY9A 2OV1A 4BNLA 3GPIA 1SHLA 1UXKA 4W7IA 1DAIA 5CNIA 1PW7A 3JYHA 5K6TA 4V0OA 5LOVB 3IUBA 5IUNC 1XAGA 1U65A 2PRZA 2QPAA 3CVWA 2XMGA 1YNOA 4JBIA 3S70A 1N75A 1JIVA 4XRRA 1V47A 1EGVB 1YFZA 3H5IA 4N18A 1SCQA 1KU0A 1C2TA 4U9HS 1L4BA 4JT9A 3GA5A 4Q3OA 2C4HA 2NTJA 3FCSB 4Z2YA 3JAMA 4OFZA 5KU7A 3AF6A 3OQJA 1TPZA 4HJXA 2C4UA 2G8NA 3C6BA 2B20A 4ZO8A 3TVYA 3IURA 2JGDB 2OC4A 1Q95A 3MRSA 4KXFB 4PCAA 2VAXA 1GGHA 5ALHA 3H2ZA 1TDJA 1JFFB 4B0PA 3HZOA 3MLBA 2EP7A 4YV7A 3O3CA 4A5OA 3T95A 4RX1A 1IQRA 3VJLA 3KT0A 5J3JA 5GZ1A 1Y3BE 4PONA 5AHOA 1X1CA 2WHYA 2Z8ZA 4IHAA 1RQPA 2FLKA 1JXQA 4HRXA 3ZGVA 5L3VA 2OL4A 4G24A 4P7GA 3HWX1 2XLBA 3EEQA 3H9GA 4MR9B 2XT9A 3TW8B 3RW9A 1NXOA 3RVNA 1GGVA 1I3OA 1P39A 3F5QA 3Q8WA 3NUQA 2OD7A 4PFSA 3UAVA 2CB9A 3A4IA 2I6TA 2CFIA 5T6BA 2VYFA 3CUEF 2H54A 3QY0A 2QTTA 1FFGA 1YK1A 2D1FA 3L6EA 5HIMA 5I9IA 2ZAIA 1T24A 2HSGA 2BEVB 3L8FA 1JNXX 5HFJA 4PZUA 1LC3A 2J3DA 1ZY2A 2WG1A 1GPAA 1ZI6A 1NQUA 4XVQA 3QPUA 3LBHA 4UQPA 3GLGB 5IVKA 2XHEA 3JPYA 2QX4A 1CW2B 4RV9A 5E2IA 5LLDA 3IUSA 3ZQ4A 2OVFA 1ZYUA 3ZD8A 5JTUA 3AP1A 1EJ2A 1EVZA 2GN0A 3NP9A 4Y2TA 5CPBA 3LQKA 3ZW8A 2PJZA 3TOZA 1CJVC 2HGSA 5JADA 3RVBA 4CGZA 1YCHA 4BZWA 1Z2AA 3FPAA 2NYRA 2ZUUA 3C43A 1WR8A 4O8CA 4UM5A 4DQKA 5HJ2A 5KYYB 1SKYE 2BGMA 4IQ4A 3NZEA 2EIHA 1GPBA 4WZAE 1WUYA 2PH7A 3ADBA 3O1HB 4RYDA 4GI5A 2JRLA 5IMBA 1B00A 1VSBA 4KE8A 5FL7A 5INTA 2IHYA 3BJMA 3DMFA 4KK3A 5DTRA 2ZJ6A 3JWEA 3WLRA 1X77A 3GG9A 1DFHA 2JCVA 1CVIA 1XEWY 4K1LA 1FXUA 1A9YA 3N2GB 2G5PA 3SOPA 3H13A 5KNCH 2F3RA 4C20A 3I09A 1NSYA 3GMDA 4DKXA 1KS9A 4E5MA 4F5YA 3RE1A 4IWNA 2EOAA 5BSVA 2NUPA 2I6FA 3Q8XB 3QMWA 3RKSA 1JW9B 1NA5A 4G5SA 1G2OA 2WK1A 4ZVNA 1J1ZA 1MB0A 4WGGA 3WTCA 4CMKA 3EUFA 2ZXUA 3EGEA 4WKGA 2EDCA 3TCXB 4MQ6A 3OA0A 3OPYA 3DOOA 4IDEA 4D3FA 4L15A 3FKJA 3NKLA 3R7FA 1WTCA 4EG1A 2JEYA 2G08A 4FUTA 4X85A 1RYMA 2C29D 2IE0A 2QP9X 2A1UA 5KTSA 1YOBA 1ZHOA 2NU8B 3LC2O 1XEWX 4MWDA 2AFHB 2CJWB 5BN4A 5AVQA 4ML3A 1WW2A 3TFQA 4A8HA 2FUEA 4DREA 2YBEA 3K9GA 5GJCA 3FOFC 3AWDA 3NWEA 2CFTA 5BWMA 1USIA 4DJFC 4BNJA 2EKQA 3EG9A 4R05A 5GADl 5DYGA 2WIFA 4Q4DA 2H5EA 1IJBA 4BO0A 3ST7A 2CKDA 2X9QA 4MW0A 4NFSA 4EKNB 3A11A 1IB6A 1HTTA 3KQTA 1PJ4A 2GASA 2REQA 5GV7A 3FOZA 1C8LA 1UOEA 2RGAA 5J2TF 5SYAA 4DEXA 2H29A 5FLEX 3T7KA 2SNIE 1W6UA 3CYFA 3HN6A 4FX2A 4C04A 1ETUA 1Z18A 2NNLD 3L6RA 4RHFA 4F3YA 1H9AA 1BMFD 2Q2QA 1KJYA 4J0FA 2DG2A 1FP1D 1QGED 1D5WA 3CVOA 4INOA 3H3JA 1VHLA 1BAPA 5K3EA 4DWOA 2IGBA 4QHYA 4OAQA 4WJLA 2VR1A 3MG9A 3FXAA 3SF0A 1GPJA 3ZHTA 5DBEX 2X9GA 2AR0A 3KYCB 3FMGA 5LU9A 1RAAA 5DBFA 1LV7A 1XO1A 4TV8B 4XIGS 5F3WB 5LQCA 3WHIA 1BTOA 2D4HA 4GFDA 2GBCA 2ASVA 4TVKA 4WY8A 1DEKA 2FWRA 3QVGA 4JJ8A 3FGPA 1PVVA 4MUKA 5K0ZA 1ZGAA 1VCIA 2H6EA 3K9WA 2ODNA 3FDIA 5AKYA 5C0OE 3RSHA 4QGHA 2EKZA 2JJ8A 4RHYA 1JFFA 2VP5A 4YCBA 4U7PB 2GVDC 1E0AA 4YYEA 1A9QA 2C8LA 2QHXA 4FBMA 2X0EA 5IVPA 2C2YA 3ZHCA 4ZYTA 4RD2A 4GLBA 1P1FA 2UZ1B 2P67A 3FDFA 4G9GA 4KK4A 3B1WA 4NOMA 3RK1A 4QTZA 3TAHA 5IH7A 2WD7A 1I4LD 1ZJ4A 4C0JA 1LSSA 3GJ5A 4ZN6A 4IIYA 5C3UA 4L0QA 1G3RA 2R4UA 4R98A 4RV5A 1JA0A 2C2KA 3UK1A 4B3SB 1I30A 2HADA 3LKVA 4MR9A 3TW8A 3AUKA 1O96B 2EJTA 2WSYB 4WK4B 5JSYA 3TSYA 1J9ZA 5AW0A 2UYYA 4MEBA 4WXRA 2WJPA 3EHEA 1DC4A 5AM5A 1M0TA 3D7KA 1EVQA 2P9JA 2WD9A 3DOUA 4NMLA 5SYMA 4MWCA 5DHUA 2B35A 3HP4A 2CY0A 1U9JA 4U7HA 2VHQA 4UZFA 1Y1KE 2XYHA 2EGHA 1IRIA 5F3DA 1KMCA 4PICA 1QHGA 4QTTB 3OQIA 4A91A 5AVOA 4BMPB 1SB9A 3VU0A 2J9GA 2XMDA 3BFKA 3ZWOA 2JAQA 2BKAA 3S6JA 4E5PA 1II8A 5A4AA 3K0CC 1Q6ZA 2RHRA 1GUYA 1ZSNA 5ENDA 4BECA 4QPJC 1JJAA 1KAMA 1NBMD 2ZBEA 3LHSA 2W2MA 4GPIB 4KQFA 1YTUA 1U98A 1VE1A 2UV8A 3OWHA 4Q9AA 5DEIA 4EHAA 3L3BA 2VJPA 5MDHA 2IIBA 4U2DA 3BIJA 4KLCA 3E7XA 2GFIA 3ANTA 1OPXA 4K6HA 3F6EX 3U4MA 3BN3A 1H0SA 4H0NA 4RKFA 3WQSB 3SC3A 2FU5C 2HYDA 3PV0A 1OXMA 2Z3VA 4OBBA 4F3RA 4GMHA 2ZPTX 4BEVA 3UC9A 4ERXA 4EJSC 5KS2A 4JB3A 4M7RA 5K1ZA 3BXEA 3LUDA 1WXQA 5EMJA 1A50B 4CUKA 1KVRA 1Q83A 4C5CA 2L82A 3DO5A 3EZLA 3JS5A 3TD9A 3CHYA 2RC5A 4TKUB 1YD7A 2WIBA 1HLPA 1RXYA 3WBBA 1NG9A 3CF4G 2WM2A 3EMDA 4UNPA 3WGMA 1WSDA 2Q6VA 4O1HA 3VU1A 4YP1A 1LNZA 4E21A 2F43B 3WNBA 4EMBA 1M2JA 2WA1A 1BHO1 3LKDA 4IIXA 4YLEA 1OXKB 3UK0A 4BKRA 4EG4A 3HJUA 4R8MA 1PV1A 2CMFA 5KQGA 1S89A 4JBGA 4NH0A 4CHGA 3GJ4A 3AHEA 1VA5A 2EIXA 3OO1A 1ZRMA 3RPEA 1WPGA 3EF0A 3OCYA 3CW8X 3FWNA 2H08A 2NU8A 5BWBA 4I1RA 4E2FA 4EHHA 4AUKA 4UAUA 2X13A 2CLEB 4BU0A 2AFHA 2IJGX 1XTRA 3GA0A 3I6YA 5EESA 2G4VA 3EUAA 2IPOA 2HZBA 1KH1A 3EZGA 2ID7A 3FMVA 5JPCA 4TS3A 1P73A 1IXZA 2C5EA 3OE4A 3M4NA 1AZTA 3RKUA 4BKOA 1HLDA 2XKJE 3QVOA 4D98A 1Z0DA 4G8DA 1YZ3A 1AF4A 3ZVLA 4NZNA 1XLTC 4I6JA 4UARA 1KRXA 3ESDA 4R7ZA 1RYZA 2W2VA 3LDHA 3HCRA 1JF8A 5AKHA 2C5AA 4CKWA 3A9CA 2Q1UA 3GCXA 1K66A 2WYWA 4PLGA 1VE7A 3W2IA 1AB6A 3GCWA 4JUIA 5EWLB 1TFUA 2Y4OA 3L0IB 4LGMA 4E2WA 3FY4A 1MG0A 4D4JA 1NAHA 3HN2A 1JHAA 2I8LA 1ZSVA 1OZFA 5AJUA 1F20A 2DUJA 3HFRA 1S6YA 2QNRA 4AIIA 3ZHYA 1ZP6A 4K81B 1QTQA 4K6CA 1YQQA 2NZWA 3UH0A 3ZK7A 5TB5A 1P3DA 2IXEA 5JQWA 1UBOS 3INNA 3TBFA 4JJKA 1QGUA 1RE1A 1IUPA 2D2IA 2QR2A 4A3SA 1WDLA 2SKDA 4E33A 4EUKA 1NWHA 5IU6A 5HJ5A 1F7UA 1FDIA 1J2YA 3FCUB 2JZOA 4RTNA 2WP8J 4BVHA 2D0OB 3KV1A 3KYCA 1IVNA 2GCOA 4ONEA 1P7ZA 4OQMA 2XB2A 1LBIA 3ZXYA 1PN3A 3D1LA 5JVDA 1D2HA 1PIWA 4GX0A 4ZD6A 4TV8A 1TA4A 4Y9RA 3FI9A 2W70A 5AJXA 3NPAA 3EZ7A 2BT4A 1E7SA 2D7JA 3NH9A 3O4VA 2H4HA 4AJ9A 4ENUA 2WTAA 4FZJA 1SD1A 1L5SA 5D8DA 3PJRA 1MA0A 2OCKA 1J8QA 4NEHB 4QYIB 4KPUB 5DNAA 4UM9B 1ZK1A 2CW5A 1OJLA 2ZLBA 4PG8A 4TKMA 5DNUA 2FZLA 3DE0X 3A1EA 4MI3A 3C39A 4LBYA 4Q34A 1CNEA 2EFCB 2FCRA 1E3IA 1ZJJA 3CF6R 1KE1A 4B3MB 4ZAFA 4O63O 1GEEA 2FAXA 3OBIA 1N8SA 1O96A 1IIRA 1DJOA 3I9LA 3PQCA 4GI1A 5EJFA 1JHZA 4OV6B 4D9CA 1G55A 4WOBA 1HI9A 2Z0MA 1DBVO 2A9KA 2W6OA 3IALA 4BMSA 2W2XA 1NQVA 1NMYA 4BX3A 1FMLA 3LXUX 1PT7A 1NXPA 3NIDB 4JB2A 2FFHA 3JWHA 4LTNA 1HRKA 1S1CA 1JQBA 2QLTA 3AR6A 2XWPA 1EX7A 3OMXA 4C5AA 2AZ4A 1E2DA 3IOYA 2PJUA 5CA0F 3A4LA 3KZMA 1NBHA 4J6EA 2JAHA 3C7TA 3ND7A 5JAQA 3PEWA 3GVIA 2FHPA 4G4IA 1QQ5A 2ZJ4A 2NU9A 5BV7A 1YZTA 2HSDA 4AMYA 5BNWA 3KWMA 3ROPA 4EP1A 3JD0A 1U2RA 5DYNA 4BQEA 2XNJA 4RNCA 3IMKA 3ENWA 1CUEA 3QLTA 4RAQA 5FI0B 3P2MA 4GVLA 1AHIA 2ONYA 1Q50A 2DOKA 1G5IA 2NX2A 2PRYA 3GLIA 5DM1A 1Z4IA 2BYTA 2G9RA 3GAAA 3R0ZA 4XDZA 3VKUA 1XLWA 5K4HA 1V5GA 5FWAA 4PAOA 3EW7A 1JHMA 2H9IA 1NVFA 5TGDA 1FNBA 1G8YA 1UBSB 4BS9A 1BYUA 3AF5A 1FVOA 1Z9BA 4MA0A 2K4MA 3MWYW 4MIKA 2C88A 4YJ3F 2O2XA 1NFQA 2PY6A 2O05A 4ZVKA 5JMTA 4Z54A 2QLMA 1ZCAA 3ZBUA 1KEWA 3CSUA 2YV5A 4F1JA 1G42A 1QOQB 4J7CA 4UQOA 5IZCC 5IAEA 4HBZA 1AQNA 2HC9A 4CKBB 3KB8A 3L6OO 3BL6A 1M6NA 5BQ3A 1N5LA 4NICA 5BUSA 5JS7A 4RVUA 2WB2A 3CXRA 1F48A 1R0CA 4UU8A 4BFCA 1MAWA 1FS5A 5LA6A 4DCGA 4MWGA 1TJNA 3SJUA 4DWJA 3EPLA 3BRWA 1G21B 1WW3A 1U3UA 3BWBA 2VIIA 2OQVA 3ZU6A 4B43A 5JQGB 2Q0XA 2W11A 4INAA 3ZDXB 5LUBA 2VQSA 3OICA 4HDRB 4WN9B 1YKSA 2BD0A 1YTLA 4L75A 2QMHA 4R2MA 1WF6A 1FUEA 1XVUA 3N7AA 1BW9B 4F4IA 1BN7A 1GUZA 5JDIC 3WRXC 2OZPA 4TV9A 5F98A 3I5UA 5K0LA 3RRXA 4HV4A 2JGRA 5EERA 2C3UA 2VHEA 2NPOA 4KVZA 2AVNA 4Y1RB 2GN4A 4IWXA 1E1RA 2VNSA 2PEZA 2YVQA 1YVUA 4RFSB 1ZN8A 5CIWA 4AU1A 2P2NA 3QRWA 5ALLA 4Y6GB 3IQWA 4I5DA 3K73O 5E1BA 3FYTA 1EFUA 2I3GA 1MO2A 3P20A 4Q4LA 5CNMA 5EYPB 1GZVA 1Z2NX 3BD8A 1TEVA 3K71B 1B7GO 4CU5A 3R3YA 4Y1GA 3G02A 5KTMA 5B57C 5A9SA 4P54A 3B9PA 1G5TA 1QORA 1TI7A 1XSEA 4WY5A 4ZVOA 5TC4A 1V4BA 5TX7A 1L2TA 4BO3A 3DD5A 3CVJA 2E2WA 3MTGA 3USES 3QBJA 3STWA 5B2ZA 3DO6A 4A6XA 4DWWA 1C8BA 1ST3A 2HPZA 1UPFA 2FLVA 4N5DA 4RDHA 1RPAA 1GCAA 2ZJFA 5WRFA 4KGXA 4L85A 4BVLA 2G9VA 5ESDA 4L51A 4CM8A 5CCBA 2KE5A 1FSZA 3L2OB 2EFGA 3HCOA 3DKRA 4J0EA 4Y9DA 5BSUA 4ALIA 3DMGA 3HYNA 2PO7A 2V4ZA 4ESVA 1I6MA 4P82A 1CT9A 2SKEA 5EUMA 1XELA 3N76A 1GY8A 1QZTA 2Q1SA 2QD3A 4MKHA 3WJ7A 5KWEA 4BVAA 1T8TA 3W5AA 3QGMA 4S04A 4OP1A 4B31A 2IODA 1JKMA 5HK8A 1P74A 3B13B 5B1HA 3B3FA 1JKFA 2IOYA 2WZQA 4H6XA 4L0DA 4DDUA 1AKNA 1WAMA 4ARUA 5J58A 1QQ7A 1NM5A 2EZ8A 2H00A 3A58B 4KQMA 3RK4A 1Y5NA 2XUJA 3ESBA 2E85A 1H2BA 3IXQA 1KYYA 1OLSA 1PJSA 2E87A 1FSPA 1CEEA 3CUUA 3VDNB 3FB4A 1CUAA 1A2OA 2D5CA 2WTMA 3K0FA 1VL5A 5I4IA 2YL2A 1OLUB 2ZYUX 2NV2B 1SUCA 5AHXA 3LF2A 2OYRA 1TYBE 5AQ1A 1QGZA 4QHSA 1FMCA 3AU9A 2PT7A 4ZOLF 5EPOA 3L7LA 3D81A 2R84A 5KNCA 1N5RA 2OXCA 1W1WA 3BWXA 3NNNA 3FLAA 1MTZA 1XQ6A 4AMZA 3QVXA 1YUNA 5HM6A 3TSWA 1KEVA 3BEDA 1UC9A 2NSDA 1A2BA 3H9JA 1ZN9A 4EPYA 3N6VA 1YJ5A 1RQLA 4HZIA 4HZUB 4CN8A 5HJEA 2BGKA 4E31A 1ID8A 4AK9A 3KQLA 5LMZA 1XDDA 1C7IA 1VC2A 1SUDA 2WQZA 2ZBGA 4HH0A 4JOSA 4YRFA 4LGYA 1XJCA 1G64A 1IQ0A 1V6AA 4NBLA 2IU6A 4GECA 3U4IA 4JL8A 2QN6A 4KXLA 3ADCA 2PGAA 2QJOA 1E1KA 5TPWB 4IOJA 2L42A 3AUSA 2AMJA 2QJTA 2OSBA 3NHYA 4OHBA 2X3YA 4HTFB 5JDCA 1U3CA 1VA4A 4EL0A 4TRNA 4QXPA 4CMJA 5LBTA 3VKWA 2PV0A 4WN3A 3O2NA 4WHMA