4F12A

Crystal structure of the extracellular domain of human gaba(b) receptor gbr2
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
418
structure length
410
Chain Sequence
PPPSSPPLSIMGLMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDAIKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQVCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Gamma-aminobutyric acid type B receptor subunit 2
publication title Structure and functional interaction of the extracellular domain of human GABA(B) receptor GBR2.
pubmed doi rcsb
source organism Homo sapiens
total genus 140
structure length 410
sequence length 418
ec nomenclature
pdb deposition date 2012-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4f12A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4f12A01
2FQXA 1Z2DA 4MS3A 2GBPA 1U2PA 1ZN2A 3HO1A 4N0PA 5TQ2B 3A10A 3MYYA 3H1EA 3QEMA 4JP1A 4Y9TA 4E7OA 3GV0A 2L19A 3LUCA 4LZLA 2VUHB 4PICA 2DRIA 1K66A 2R4QA 1FSPA 3KLNA 4N47A 1M5TA 1USGA 4P1ZA 1JX6A 5DCLA 2PE5A 1DG9A 1GCAA 2PUGA 5T3YA 3FFXA 4W5TA 1D4ZA 4MQEA 6CHYA 4RXUA 2B1JA 2QSJA 3RVQA 1LJUA 4WT7A 4W5NA 4FB4A 3SM9A 1E6LA 3KS9A 3LUGA 2PUEA 1D2AA 1ZGGA 3CZCA 1H9CA 5C5CA 3N53A 4WUTA 5T7BA 3IDOA 3I42A 4IMIB 3OM0A 4L4UA 3HJFA 5JNTA 3H5LA 2O20A 2FMKA 3O74A 3CHYA 1JFVA 4YWHA 4G0OA 4H3KB 4KQCA 4G0YA 5CNMA 4RZSA 4RV5A 3E3MA 4IMJB 5GQSA 3DLBA 2AYXA 4MR7A 5KQPA 5JS1A 1J56A 1Z18A 1ZHHA 3A0RB 4MS4A 4M88A 1LK0A 4MR8A 4EYKA 2QXYA 1JFSA 4IF4A 1YK1A 2Q5CA 4XLTA 4IGAA 4OTZA 4RU1A 5C5EA 2FKAA 3T6KA 1P2FA 2ZAYA 3H5VA 1RZRA 3OQMA 5EWJA 1DC7A 4G0ZA 2VYCA 2QV0A 3OLXA 2IOYA 2R47A 4HYEA 3KKEA 3LUKA 3HEBA 4OLBA 1DRKA 3LUAA 1NXWA 2FMIA 3DZDA 2IPNA 4W5QA 1DCKA 3IP7A 2R25B 3KYJB 4NCAA 2MSWA 1ABFA 4WXMA 5TQ2A 2HQBA 2FEPA 2JVIA 2QZJA 4MR9A 2PUBA 2RGYA 4RWEA 1QO0D 1A04A 1BVHA 4RK4A 3N0XA 4OG2A 3JPWA 1M5UA 3H5OA 1QKKA 2RJNA 5TQ0B 4E7PA 3FDFA 4F12A 2OENG 1W9HA 4MS3B 4WWHA 2FN9A 2RJOA 5HQJA 2CD7A 5IC5A 1TMYA 1JYEA 4TMYA 3QEMB 2F8SA 4KRFA 4LRQA 3H6GA 1APBA 2J48A 2WJAA 2PUAA 3EJWA 1DCFA 1L5YA 1R8JA 4S04A 4Z4GA 1ZESA 4ZJPA 4RXMA 3R0JA 5IEJA 1Z2EA 2MSLA 3H1GA 1SD5A 4MS1A 3CZ5A 4NICA 4PYRA 4MQFA 1DRJA 4MQEB 4QPJC 2HPHA 1DCMA 1RXIA 5BR1A 5FWXA 3LFTA 2IPMA 3D8UA 4PE5B 5JS2A 3FGZA 3LKBA 4ZPJA 1T34A 2A9OA 4B09A 3SQNA 3RVLA 4RY8A 3H5WA 5BRJA 2E4VA 3RH0A 4EVRA 4KFCA 3O2QB 3OMWA 2IPLA 2WJWA 1VRVA 3GRCA 3OLVA 5DLEA 5TQJA 3KSMA 4KPYA 3RVJA 2PLNA 4XFKA 3P9YA 3T8YA 6ABPA 4RKRA 1MB3A 5IUKC 5TPZD 2WWVD 5B3JC 2JVKA 3QLUC 5BRAA 1YIOA 2HQOA 3VNBA 1KRWA 5EWJB 2KYRA 3QEKA 4UHKA 2V0NA 1NY5A 1JF8A 4WZZA 2HQRA 4RK6A 1FFSA 3HM9A 1MB0A 3HSYA 1DJMA 1IIBA 1YK0A 2LP4Y 3Q41A 1JDPA 1PUXA 4JAVC 1E6MA 3UKJA 2NT4A 3ROFA 2L18A 2PMCA 3NBMA 2LUOA 3G1WA 3OLWA 4FE4A 4YLEA 1USIA 1BDJA 1EWVA 2NUBA 1DP4A 1F51E 1MAVA 4MR9B 1BDHA 3CG0A 2PL9A 3N6VA 5GOTA 1TJYA 3QLTA 1RPJA 3DBIA 2FW0A 2PJUA 3MA0A 3QLUA 4Q6BA 1P8AA 1C0EA 5B3JA 2PUCA 2WRZA 4ZMSA 8ABPA 2JVJA 3K4HA 3C3KA 3QLVA 4HNSA 3HXMA 3FFWA 1LBIA 1ZY2A 1ZGZA 2QW1A 3C6QA 3ILYA 2A9PA 4G0QA 2BGGA 2E4YA 3UUGA 1QP7A 5TPWB 4XXHA 3TO5A 3SG0A 3DGEC 4ETIA 3EDCA 1QQAA 3FMVA 3HVRA 4MS1B 3HDGA 3IP9A 2PUDA 4MQFB 4QICA 2M98A 5KC8A 4IILA 4QYMA 1EAYA 2MYUA 3O2SB 5FWXB 4NQRA 1ISRA 4LDAA 3F7NA 3RVKA 4XASA 3L49A 3LKVA 1D1PA 3CRNA 3T95A 5ED4A 3MQ4A 4W5RA 3CG4A 4DADA 1JHZA 5JNSA 5I4CA 3LOPA 4RK1A 1A2OA 4F06A 3OM1A 2MYNA 1BAPA 2GWRA 1I3CA 4D74A 4ZMRA 1Y1LA 2OQRA 2W42A 5D2CA 3TD9A 4S05A 1YVUA 3KG2A 1DZ3A 3N0WA 2QVGA 2CWDA 2HSGA 2VK2A 2L17A 1ZH4A 3H5IA 3MMNA 4YS6A 2PKXA 2WB4A 1XHEA 1DC8A 3OLZA 2P4UA 3L6UA 5KI6A 3OQNA 1DBPA 1OXBB 2FSPA 1P6UA 3RVSA 3RVRA 2XDYA 2JRLA 3EGCA 3HDVA 1U2QA 3HCWA 4KNYA 1EFAA 3JTEA 1DBQA 2FVYA 2FEKA 3CNBA 4YGXB 3RVOA 4KMRA 1SRRA 4N03A 3GBPA 1RZRD 5CHYA 1JLKA 1JFTA 3O1IC 5EWLA 3JVIA 4MRMA 1Z12A 1NXVA 1ABEA 3O2JA 5IUNC 4TLLB 3Q15C 2ID9A 3O21A 3CTPA 5BQ3A 1MIHA 4Z4HA 2PAFA 4RSMA 1QNLA 5TPWA 3ROTA 3QELA 1ZVVA 2YHBA 3RVPA 7ABPA 4N41A 1GCGA 4RXTA 3QX8A 5FWYA 4UHJA 3NHMA 4HNRA 4RY0A 4KK4A 3A0UA 1CEYA 4YV7A 4RK5A 4PEVA 3FFTA 3EQ2A 4YO7A 3UK0A 1GUBA 1P6QA 2L2QA 4KQ9A 1YS7A 3D02A 1PEAA 1NXOA 4EUKA 4Z99A 3F6CA 1OXKB 2IPAB 3OQOA 3MF4A 1DBWA 3BBLA 5IUJC 3K9CA 1U04A 1KMIY 1XWWA 3Q7RA 2CHEA 1K68A 2FXIA 3O1HB 4MLCA 5TPZA 4RY9A 2NT3A 5HM6A 4MGEA 4RS3A 1AB6A 2QR3A 2AYZA 1JDNA 4EY3A 3DLHA 1D5WA 1QMPA 3LUFA 4LDZA 4Z9AA 3HUTA 1QPZA 3HK2A 1D1QA 2ZWMA 4OBBA 3KJXA 3TB6A 2GI4A 3IP5A 2A9QA 3QLVC 2NZUG 3I5AA 1AB5A 4G0MA 4D6XA 1FFWA 4LX8A 4JB0A 3I09A 4O1IA 1JWLA 1A0OA 5HKOA 1YMUA 4JB2A 2M1ZA 5EWMA 4XAQA 2MYPA 4LE0A 1EWTA 1ZITA 3URMA 3BRQA 4ZYLA 4JASB 2IYNA 4MLDA 2JBAB 4JOQA 3LUDA 4XARA 2FQWA 1B00A 1YS6A 4EVQA 2PL1A 3QK7A 4Z4EA 1QP0A 5TE9A 2H3HA 3KCNA 1VLZA 3GA5A 4KK3A 2QU7A 4NV3A 1E6KA 1M2FA 4GPAA 4RK7A 1U8TA 1Z17A 5IBQA 3C3WA 3I45A 3Q7TA 5EWLB 4MRMB 4G86A 3JVDA 3M6MD 2WY2D 2E4ZA 4EYQA 2B4AA 2CHFA 4EYOA 2MYTA 3RVNA 4G0XA 1E2BA 4YCSA 3NNDA 3QELB 3G85A 3JPYA 2IDMA 2R48A 4HNQA 3VNAA 5FWYB 3KLOA 4OLAA 4OATA 2JK1A 3LUJA 4Z4CA 3E61A 4RK0A 4Q7EA 3KTOA 3RVMA 1ZAYA 3C3MA 3NHZA 5CNJA 3O75A 4WXEA 4DQDA 4YR7A 5JNWA 5IULC 3LMKA 1YMVA 3LTEA 1C4WA 4Z9BA 3CLKA 1RXEA 1GUDA 3GT7A 4FE7A 4Z0NA 1NTRA 4G0PA 5DTEA 1ZH2A 5KWSA 3EQZA 1Z13A 5KQGA 1YTUA 5JNRA 2LIVA 3OO0A 3N8IA 3DGFC 4GNRA 5ABPA 3CS3A 1UDRA 3C97A 1W25A 2H0AA 4H3HB 3KHTA 1ISSA 5DKFA 1ZDMA 1QO0A 4EYGA 2JBAA 3HS3A 4KV7A 1PEYA 1JYFA 3Q7SA 1TM2A 2IKSA 3ILHA 4LE2A 4EVSA 2I6FA 1URPA 4IRXA 3MIZA 5CNIA 2FLKA 2N9UA 1Z26A 4MAAA 4KZKA 4O1HA 2NZVG 4ETNA 5EWMB 4F8JA 1Z25A 4N0QA 2E4WA 1USKA 4ETMA 2ID7A 2GX6A 1BA2A 1JBEA 1NATA 1JL3A 2FQYA 4MYRA 3RQIA 3HUUA 5HSGA 1LJLA 4Q6WA 3JS5A 5FBKA 2FMHA 3H1FA 1GLGA 3H75A 2FLWA 2JB9A 5KQLA 1VKRA 4EGSA 1FQWA 3IPCA 3QX9A 2FMFA 2MSKA 2FN8A 1MVOA 1CYEA 1NXSA 3Q9SA 2GKGA 1TVMA 4TLMB 2FEWB 9ABPA 3H6HA 5CNKA 3SNKA 3OMXA 3S99A 4MPTA 3N75A 3MM4A 3EODA 1VPWA 1WETA 3F73A 3OLYA 4ML3A 1JH9A 1S8NA 2WMYA 4F3TA 3GBVA 5PNTA 1Z15A 2X7XA 4RDCA 2PUFA 3SY8A 3HZHA 2F8TA 1BDIA 2HJ9A 3BRSA 1U0SY 1KGSA 3GL9A 5JNVA 2JCGA 3KYIB 1CHNA 1QP4A 1NXXA 3W9SA 3CKMA 3SAJA 5F64A 5JNUA 3GWGA 3OO1A 4QYWA 1RNLA 3NNNA 4L85A 2RDMA 3TMYA 4DN6A 1SXIA 3EAFA 4RKQA 4YP9A 2VUIB 4Z4FA 1EHCA 4KVFA 3IPAA 3B2NA 3CFYA 5E3JA 1EWKA 4F11A 3O1JC 3TX6A 2YHAA 5KQMA 3M9WA 2A9RA 4H60A 1NXTA 3CU5A 1PHRA 1F4VA 3BILA 2LBPA 3T38A 3F6PA 4MR7B 4PZ0A 4G97A 5IX8A 4P98A 4MS4B 1L5ZA 4TN5A 1LBHA 1PNTA 1XHFA 1Z16A 2LPMA 3GYBA 4D6YA 1QQBA 4Z4IA 2E4XA 4MR8B 4N76A 3JY6A 1FFGA 3LUHA 1SXHA 1HEYA 4NCBA 1NXPA 4KREA 2FTKE 1KRXA 4LE1A 5DGCA 2P9HA 5FBHA 5KC9A 1SXGA 3IP6A 4W5OA 5IEBA 3H5TA 2E4UA 3N0RA 1M2EA 3EULA 3A3KA 2TMYA 3NNSA 3BREA 3M9XA 1PNRA 3HV2A 4JA2A 1TLFA 5TQ0A 4CBVA 2QVCA 4YRZA 4O5AA
chains in the Genus database with same CATH superfamily
1WMEA 2RGGA 1T0UA 4NCJA 1D4OA 3R5HA 3KVNA 1EB8A 1D2MA 1O77A 4Y9TA 1GU7A 2YDYA 3B48A 2GHTA 4HWSA 4LZLA 4X71A 2CMDA 4I5EA 2X0EA 1M5TA 4P1ZA 5D86A 2IHVA 4O33A 5F7OA 3CR7A 2VCHA 5AKJA 1NV9A 5LQKA 1TM1E 1RACA 1WLYA 1M1NB 1V4NA 1XZJA 2X9LA 2CK3D 4R31A 4F7WA 2VJLA 2QZSA 3TQCA 3LTNC 3UAYA 4HQFA 1LJUA 2HBYA 3GZ4A 5DVZA 2PJZA 4YP6A 3RVQA 4CT5A 4EARA 1N3YA 1JT2A 4EECA 3TUZC 4X7PA 2BFCA 3HYSA 1JIXA 3KOYA 3T3MB 1KU0A 3JQBA 4FHCA 1Y89A 4EB8A 1EFRD 3DA8A 1ZK4A 5C5CA 1TAQA 3TTSA 3WDKA 4E3ZA 3OM0A 2Z43A 2BZ0A 4OB6A 4X64B 4MYDA 1WLSA 2Y1LA 2RGEA 1T4CB 4OBWA 4EI9A 1IM8A 2ZRGA 1JDSA 2JGEA 4H3KB 1JHOA 2AYXA 5J4VA 5DB4A 2X6QA 1ENZA 1JG1A 2OZLA 3PF8A 1SBTA 3UENA 1B6GA 1KI1A 1M34E 2G5GX 5DZSA 1UBGA 3H3JA 2WIFA 3MD9A 1PYGA 2XJ9A 4XLTA 5DK6A 5B37A 5C5EA 3R5JA 2QAIA 4LYHA 3Q3JB 1YJQA 4GFDA 1ETHA 4OXNA 4YFYA 1P1KA 4DMCA 4OHBA 3KLBA 3UOWA 1EWYA 2KLHA 4KTVE 2PSEA 1FUUA 2NXJA 1YQGA 2GZAA 2QV0A 5F78A 3RG8A 4O4JA 2V7VA 1GGKA 2IOYA 2PBFA 3IVMA 4CMCA 1IZZA 5H82A 4KI0A 5E6SA 5D3MA 1AZWA 3EXEB 3S28A 3W4IA 3X1ZA 4N12A 1DRKA 3GRKA 3U7IA 3FYUC 4QJ4A 4G63A 3EAGA 1E3SA 1FBTA 3LOQA 8GPBA 2O7NA 1ZN9A 2A30A 3IP7A 3VDQA 5G1NA 2R68A 1EVLA 1OHHA 1PR1A 3H16A 3KYJB 3N2YA 3TD2A 3WWPA 1JXAA 1KJJA 1DO0A 2FEOA 1UPUA 1W35A 3O0DA 1FRQA 1RYMA 2EW2A 5JADA 3GLGE 4RF4A 3V4PB 4E46A 1P8JA 1MGOA 2GD0A 5A71A 4IWXA 3JPWA 4B46A 5DBGA 3ET5A 4TSFA 3L5OA 1Q1QA 1CR0A 5FBWB 1GR0A 4XDGA 4L6CA 5J2TA 1CPYA 3EUWA 4DSUA 3Q8MA 1GPLA 1LPPA 4MMYB 2ZWOA 1UPCA 2XE6A 3FSGD 3DWEX 4OYHA 4UZSA 2VHQA 5B1EA 1DEOA 4B4KA 2HIMA 3GUZA 4CLOA 1S9DA 4F85A 1EG7A 2HEIA 2HA5A 2RGDA 3O4IA 2VDRB 3HJRA 2BWJA 4H4DA 1G3MA 3NGXA 3RTBA 4D5GA 2MSLA 3H1GA 1HLGA 1SD5A 1RQXA 1YJXA 2REXB 4F9FA 1HMPA 3FVRA 4QPJC 1Q74A 1GPYA 2O8DA 3ZWAA 1TJNA 2GCPA 4EEXA 4OO3A 4JGGA 1TQ2A 1WRBA 1F2VA 4ZI7F 4YT5A 1MORA 3K2BA 3M5CA 1AA9A 4YREA 3DEKA 1SG0A 2IUYA 2PRJA 5ILGA 4MUNA 2XIJA 1H2HA 2QUIA 5T41A 5CP8A 1TE2A 4G4GA 4D92A 2UDPA 1CEXA 1DUIA 3M6IA 4EGAA 3RYCB 1RWVA 1QRSA 2CCJA 3M8KA 4OB8A 1MO5A 2PS0A 4BVAA 2G08A 1FMTA 2R6GA 2XRFA 4UD2A 2Q45A 3FTPA 1JLRA 1V0JA 1YS9A 4A23A 4R8KA 4UU1A 4OH1A 5ALTA 5GV7A 2ZRKA 2OMKA 3NP9A 4JP8A 3T0IA 4CM4B 3VC2A 1II9A 4PF1A 2Z6VA 3CLSC 4CQJA 4JLWA 3ZUPA 3N2IA 2WIJA 1ZISA 4W9MC 4CUZA 2PD4A 4KYUA 1R3UA 2P5TB 1IXYA 1BXRB 1AK1A 4KN9S 4WNAB 3CPJB 4AKTA 4WK4B 1FRZA 1WCIA 3NPMA 3OKPA 1J6UA 1XF1A 3PDIA 3PUZA 3G68A 2F67A 3P5BA 5DK4A 3VGPA 4HLUC 2FHSA 5IMSA 3ZK7A 4P5DA 4PWYA 1XQVA 3U1BA 2ZPAA 2Q8QA 4HNUA 1LD3A 3I73A 3KEGA 4C7OB 4QJBA 4OFXA 1BDHA 3G0BA 1TYZA 4B7XA 3EVTA 4DMLA 1G3IA 4TWIA 4ALLA 1UT6A 2IZ7A 4A8HA 4AX8A 3GP8A 4XZ3A 4NE9A 2HCJB 2QQEA 2W6OA 3KJEA 3GXBA 2DKNA 3M1AA 3KETA 1NZJA 1UIRA 4HEHA 3SBEA 3RAJA 1C7QA 1OVMA 4GP7A 4HZUA 4A5SA 3QHPA 4J3JA 5KB3A 3L7OA 1JVNA 3NHYA 4MDHA 2QW1A 3G6KA 1H85A 3HXLA 1R16A 3VHXB 4JI7B 3QOWA 4AZ3B 1DX4A 2B6HA 2G36A 4RUKA 3TO5A 1BKDR 1WOYA 3N8NA 1NUHA 1QPBA 2HX1A 3DO6A 4JGIA 2HA3A 5K99A 2J0UA 5ALVA 2JFFA 1J2JA 3DDNA 3IP9A 5A5DA 4MQFB 4QICA 4Q9KA 1MVNA 4AY3A 2G7MC 5LQMA 2IBSA 3CKKA 3B85A 1C4KA 1TGVA 2PMWB 3EIOA 3LP8A 4JLMA 2C2BA 1PG2A 5J2TF 4XR4A 3S70A 2PFGA 2G9VA 5F9HA 5GZ1A 1UWKA 2GERA 6REQB 2ZUWA 1N92A 3UFXB 4ENPA 1AVTA 5ED4A 2P4EA 5AJXA 4HDMA 5AW4A 1TMOA 3M5DA 5TARA 2EXXA 1DLIA 2GPAA 5IFKA 1XDZA 1XNJA 2EBFX 1T43A 4NZ9A 1W1UA 1ZD9A 2BMFA 3N05A 1KI9A 3NTOA 4HAXA 4BMOB 2JAPA 2HRRA 3HM2A 3GNSA 2GWRA 5E4FA 5IASA 1RWBA 3HL4A 1Z6GA 5EJEA 4BNMA 1WXQA 1VHDA 4QXOA 3KFLA 1KZ9A 4IV0A 4CG0A 1XKXA 1YHYA 4O4HA 2PBRA 3D31A 2BZ1A 1K5PA 3HFGA 1CUDA 3ISJA 1VE9A 2FPIA 3O4JA 4YS6A 4AJJA 1IOWA 3LP5A 4CQMB 3ITDA 2AX3A 2AN9A 1VA5A 4QO7A 3DZIA 1ICEA 3L6EA 3HRKA 3LVBA 4IIJB 1ULSA 1WZEA 2C92A 4Y2PA 1G2OA 4E14A 2QT1A 2FRDA 2JRLA 4KXXA 3E7XA 2HRBA 3K31A 4KAFA 4QUDA 1XLUA 3WB9A 3OJXA 5TNXA 2Q5QA 1J0EA 1M10A 1YR7A 5DYWA 3I1YA 1S3GA 3F2IA 2F6RA 2F1KA 2WJGA 4YUVA 5JUWA 5J9FA 1T3ZA 3JVIA 4QE3A 1HE1C 2A2ZA 2FOXA 1VHQA 3KVOA 2DT8A 1NKTA 4BNYA 1G3UA 4RVFA 4GXNA 4N0MA 4XDZA 1EK6A 4LZWA 3T3PB 2WBLC 2C1EA 4UKDA 4HVCA 5IKOA 1G8MA 3UHPA 4MV4A 3VOAA 3EY9A 3W3AH 1P80A 3PTZA 2V0CA 2Y0PA 3CF6R 2ZUVA 3ONNA 1MTOA 3U31A 1DQRA 4WOJA 3NM4A 1P62B 5TY0A 5I5GA 3BIOA 4YO7A 5H7XA 3D3EA 4OHUA 3DZFA 1ZOIA 3UMSA 3LZCA 2Z1DA 2CJWB 2QUKA 2XTJA 1XU7A 3PXXA 3SOPA 4E1AA 1IJKA 2BKAA 3D02A 3EGOA 3R4CA 3VZRA 2BGJA 2Q9UA 1QS0A 3GUHA 4ZV7A 3N2KA 2YWRA 1UK8A 1XWWA 1IJBA 2VJNA 2NNLD 4CF4A 2Q3FA 3NDPA 3MJ4A 1RE0A 4P34A 5EIHA 3TF5A 2QE6A 5AD1A 3L41A 4N3NA 1XHLA 4WXPA 4FNMA 3AR9A 5LQDA 1LWOA 2VAPA 2YZMA 4DDTA 5FDFA 2DHEA 4D80A 4IX9A 5L51A 4I0WB 4KTTE 4YIKA 2DM6A 3IUNA 2WE8A 2GAOA 5KAMA 1Y3BE 1NVGA 3DDCA 1J39A 2BJVA 3AM4A 2WAOA 3IAS6 3ZHSA 1EPUA 5L3SA 3BTUA 1TO6A 4G0MA 2ZITA 1QHHA 2AJDA 3PXAA 4RA9B 4PZ9A 4QUHA 3ZWXA 1KI6A 1RKQA 2XNSA 1I80A 1X7XB 4HVTA 1FY2A 2QX8A 4P3YA 4E2YA 1NMXA 4FSDA 4ZYLA 5C2JB 3CZ4A 4EGCB 2D7CA 3ZTWA 1CS0B 2WWIA 1R2QA 3KSUA 4O25A 1B00A 3KR9A 1H6DA 1FDSA 1YS6A 2PGIA 4OHKA 4PLFA 3T99A 4DJEC 4YMVA 2DERA 2ZIXA 1VL5A 5FULA 4NBSA 4WLVA 5TV2A 3TQHA 5KVCA 2UU9B 1DI0A 2QU7A 3KV3O 1CJVC 2VSFA 3UV3A 4X94A 1XKQA 4DR7B 3HB1A 4NH0A 3SU8A 5HS4A 1VDZA 3PC8A 4MRMB 2V5VA 1P7WA 2WG1A 4ZQIA 3DEIA 4OQXA 5JHGB 3M6MD 4MCJA 2E48A 4ND7A 4EFDA 1SKYB 5ILOA 1FP4A 5IKPA 3LA6A 4DDWA 1QIGA 4R9VA 4B4OA 5J4LA 5L53A 3A2NA 4DV3B 1MB2A 1OTHA 1W5TA 3BD9A 1Z07A 4R3UC 2V7GA 3HLYA 4BNWA 3UO8B 2B4QA 1Z22A 4AY2A 2HF7A 4J2HA 1OGJA 3D3KA 3OQHA 3REQB 1YDGA 2GLTA 2GBLC 1XMSA 3P8ZA 4PSKA 1YSCA 1UAYA 4QC2A 3MERA 3C3MA 4UVIA 4AUKA 1O6CA 4PGGA 4ZEXA 1KY5A 1P75A 5IULC 4JI0B 3LMKA 4HR7A 2EKLA 1ZRNA 3AVWA 1R0CA 1MXHA 3O90A 3CLKA 2JBWA 1AXGA 4HEA1 3V7FA 1HYQA 1M72A 1P81A 3IL2A 3A27A 3HVIA 2BHNA 5A7FA 4LBYA 5TVKA 4IG4A 3AU9A 4D98A 3EVNA 1X1BA 4UM9D 4ZRMA 4DLLA 1ZD5A 1R0KA 2D2FA 2ZS7A 3B6IA 1RHQA 4ZGGA 5JV5A 4GNRA 3M5WA 2H57A 2AX4A 1DMRA 3EEIA 5J5CA 5JASA 4LHYA 1C9JA 1HFJA 1NI4A 4RHTA 4X1KB 2H54A 3BTSA 3G0DA 4L57A 5FQOA 3QGMA 4IINA 1V48A 4AN0A 2WU4A 5LU8A 2XIQA 2QL5A 5KVAA 1JYFA 1T8UA 2IKSA 5C7YA 5HF9A 2FW1A 4KWTA 5FRDA 4X97A 1DCTA 3KTAB 2XCUA 5ANRB 4ALIA 4NDAA 3ESRA 2H6EA 3KT8A 5CBPB 1N1EA 3FSEA 3DFUA 1ECCA 4HN9A 2OZVA 1SUWA 1EWRA 1W0KD 3DC7A 2PCJA 4TKLA 3VR5D 4R2LA 1JBEA 3GLFE 3T5MA 3GVXA 3AM5A 3KR1A 3PR2B 1I4OA 5I7EA 2OAP1 3Q1KA 1P2SA 2QQGA 3AGQA 4YRDA 1GLGA 2CHGA 3DP7A 3D8RA 1TA4A 3VR6H 4RJLA 1PJ3A 2ZYAA 1WDMA 1B73A 2DLNA 4O3FA 4DLPA 2JFWA 2BZGA 4EQZA 2BM0A 3IUEA 4XQCA 1W48A 2GK3A 2WJJA 3UJ3X 3MZ0A 4X1IB 5FI1B 4IQFA 1MLDA 4XPIB 1NNUA 3EIFA 1ESZA 2DWUA 4GQBA 3SYKA 5JU6A 4GR9A 4DXDA 2OGSA 4IQ0A 4ML3A 2K2QB 5CB4B 5DSTA 4F3TA 1AD2A 2UZ3A 5ALOA 5B4VA 1NV8A 2R00C 4NZNA 4O0MA 5F7JA 3JQ7A 4MVJE 4CE6A 3AY7A 3ZE9A 2RIPA 2WZCA 4O4IF 1G3RA 5HMLA 1OAAA 5I9NA 3WJ2A 4DMMA 5EQJB 4B48A 4B47A 2G25A 1U0SY 1KERA 5JNVA 1L5HB 2JCGA 4MW4A 4CMIB 3I1IA 1ZFNA 4WY5A 2CLOB 1TAHA 1PE0A 3F3MA 1RAHA 5J23A 1HT1E 1KYXA 3DS8A 2OC9A 3GWGA 2JATA 1EVQA 1FQOA 1VDMA 3G2HA 3QHQA 4JS0A 4ZVLA 3NNNA 3WXBA 1T2FA 3LNTA 3TMYA 4Z4FA 4WIAA 1VLHA 3DXFA 3HCRA 3PHLA 2XRYA 2GCNA 3HJUA 1FNBA 1KAGA 1S2NA 3ED1A 5A2GA 3HYNA 4CTOA 2YHAA 1EFVB 3UOGA 1MUUA 4WBSA 1AHIA 2ZTHA 3G0CA 4NR0A 4V0NA 1AF4A 4B4DA 3YASA 4MR7B 3B5JA 2Q50A 3JCZA 1QFJA 4JSTA 4KLAA 1LBHA 1ENPA 3EHDA 4K26A 1U28C 2D4HA 3GP3A 4B6FA 2V03A 1QF9A 5DXAA 2FPKA 3THOA 2FSVC 5EJ5A 2O8BB 1SCUB 4PZCA 2O0KA 3RBXA 1E6WA 4NBRA 3AIIA 4YAEA 4EB0A 4KO8A 4DR4B 1S8OA 3K4QA 1NYLA 1AMUA 3FBWA 1TECE 4YDRA 2DBZA 2XKKA 2OAQ1 3EDMA 3I64A 5AIBA 1ISPA 3SS9X 1Z5VA 3A3KA 3FXAA 3VC7A 5BVGA 2BEVB 3PYMA 3WMFA 4I1UA 4JA2A 4CETA 3QVGA 1N0UA 3GDWA 4RPGA 5AM5A 4OAOA 4R4JA 1CUWA 2G1JA 3DM5A 3O38A 4PRKA 3I01M 1YZKA 1U3FA 2X22A 5KBYA 2GYVA 2C4MA 2IIQA 4UNRA 1M8PA 1ND6A 3D6AA 4BNUA 5DGTA 4E7OA 3ESCA 2G6TA 3GV0A 1W29A 2BZSA 2BHSA 4NC9A 4DNXA 3RT9A 2Y67A 1U7DA 2XUAA 4KITB 1UQRA 2X9VA 3O8OB 2NVUB 1NMYA 3GN2A 3QG5A 5ERGB 1NE7A 4KNWA 1QQTA 4QBGB 2H1FA 5U1PA 2CKDA 4RXUA 2B1JA 2QD3A 3VM6A 3GRYA 2FWRA 1HDYA 4WT7A 2VN8A 2ZREA 3LQFA 1P91A 4ZT2A 2NMVA 3O8QA 1CFJA 4MRSA 3B9RA 1D2AA 1X87A 3N8DA 1H9CA 1JB9A 1ODCA 1FW6A 4L5YA 4LV8B 1Y63A 4ZO8A 3T9DA 2WWWA 3U4CA 1DRVA 4ABTA 2H4ZA 1SPXA 1EUZA 2DPYA 3I42A 3IDOA 1P5RA 5EHXA 1PG5A 4D9HA 1LKZA 4I99A 3AZPA 3QMWA 4QO8A 2VTKA 2WIBA 4KQCA 3U7FB 5H80A 4JEHA 3BA1A 1IJFA 1CY7A 3G8BA 4YWJA 4L74A 3VU9B 1A1SA 1TZJA 1XLWA 2JAXA 3E7PA 3COPA 2PL5A 3AR5A 1Z0ZA 4EYKA 1SPBS 1C1DB 1DTEA 3IDQA 4WOBA 4RQTA 3C6XA 4TXJA 3PSHA 2PA0A 4BKQA 1ZNWA 4P54A 4PC1A 4DCGA 4DV2B 4HH1A 3BK2A 3C14C 4Q1BA 2QI9C 5BSUA 2AQIA 1DWPA 2VYCA 3NH9A 3R1IA 1WHSA 4O4LB 3SXJA 2J0QA 4KCGA 4CW7A 4N39A 4PZZA 3CVXA 3R77A 4BLPA 1FLNA 1FUYB 1Q22A 1OX6A 5CAEA 3ZKWA 1K9VF 3OCZA 3FSRA 4QU8A 1XRNA 3FTFA 1PJQA 4JH0A 3WBFA 4V0MA 3TGPA 1ABFA 1HDRA 4PFSA 5DHTA 3EA0A 2CE2X 4F86A 1E2QA 4MR9A 1QYXA 4JUBA 3IKJA 5F1YA 3S3TA 2D3TA 1QCDA 1ZBDA 2GZ3A 2NX2A 1Y9AA 5FUMA 3W3AA 4HWGA 4ZQHA 4GPEA 3I28A 3THSA 1I01A 1M5UA 2XE8A 3ER6A 1G5IA 4C5CA 3W77A 3OPYI 1ZC3A 4DLKA 3TCNA 1S2MA 4IFTA 5ER6A 2FWPA 5KNBD 5B1DA 5K4HA 2O2IA 3UXMA 4DW8A 3RRFA 1NE2A 3HGTA 1XZAA 1JYEA 4N6NA 5KU7A 1M6WA 3TIXB 3IX7A 1W4BA 2B69A 1AHHA 2HUPA 3R5KA 3KYDB 1V16A 2CNBA 5BUSA 4J7UA 3LL7A 4Q18A 3COZA 3K2QA 3M83A 4RAOA 3K1JA 3R0JA 4BJ5A 4JP2A 4B2LA 2C97A 4C5BA 4JI2B 5TT1A 2GLXA 1G7RA 4XGNA 5HR5A 1WEHA 1PLKA 1RXIA 2HPHA 3R5FA 4YROA 5AKGA 3FGPA 4CV0A 2ZANA 4E5YA 1PW5A 5ICCA 2NU9B 3T4XA 2HMYB 3FUTA 1EMDA 4DUGA 5LZ4A 3WGIA 1IWPB 3BD6A 5HF5A 3PA6A 1BW9B 1O8BA 1NBIA 4EYEA 3SDSA 2VHWA 2VQSA 1K7CA 1XTZA 2XUGA 3NZEA 3R3WA 4D45A 5DMHA 4MMZB 3JQ8B 4UZFA 4G5QA 1M34A 3RHFA 4CKWB 1RAEA 3M6WA 2O8CB 4IW3B 4DCVA 4JK3A 4MVJF 4BMYA 2EFCB 3P9YA 5L8VA 4X8OA 1DE0A 2VQFB 1YCGA 1LNZA 3KDSE 3AVVA 2DOKA 3BS4A 2XF8A 4OMDA 1K2WA 1KKLA 4D3YA 2VTEA 3F6RA 3MAAC 4M1MA 4MEBA 3KV1A 3SZGA 4TXLA 4I55B 3WWDA 5EIFA 4L95C 2C2OA 3HKDA 3LU1A 1KE1A 2INGX 1NYRA 3U2QA 2C2ZA 1AIPA 2CL7X 4WI1A 1NY5A 5AKXA 2PUWA 5F1OA 4XPZA 5I4BA 3J81A 3IDZA 1UZAA 2IYRA 1GNVA 4E21A 3O26A 4G9BA 1SELA 1SUEA 5B57C 2FPLA 1WXEA 1DBIA 2DWCA 4MUGA 2JFQA 4OGWA 1F14A 2QG6A 4K6OA 1EWVA 1T6NA 3CT4A 4TMVA 1MAVA 2AE2A 4FIZA 4B6JA 2GCIA 2JFGA 1HWYA 3ZI4A 2COUA 3IT3A 2PJUA 3ROZA 8OHMA 1LDGA 1JR6A 8ABPA 1RYNA 4ER3A 5ADUS 4EBBA 1NURA 1K4KA 2FMXA 2I2XB 3B6ZA 4FYVA 4WSOA 4PPNA 2CL5A 2F1HA 4X85A 1WTAA 5CJJA 4JT8A 3EG9A 2ZB7A 4Y2SA 4UVEA 2XVAA 2CB0A 2B7CA 2WAAA 3RUCA 3RS0A 4AS2A 5FEUA 5GGXA 4P7KA 4DJAA 1MXFA 3FNEA 5AKLA 1P29A 3UUGA 3V8BA 4IRMA 1AMNA 13PKA 4QFMA 2BW0A 1FJXA 2M6RA 1FFHA 3PXBA 4NJMB 4RS4A 4ZPXA 4C2AA 1CFZA 2CHVA 4MQ6A 1FU4A 3HDGA 3D4NA 4ZCTA 9ATCA 1FRNA 1O54A 2J5RA 4BKMA 1NC1A 3TEJA 1L1RA 2CXXA 4OXXA 1YL7A 1KDRA 2C4UA 4KIUA 3AK4A 4NQRA 3ZGOA 4BNNA 5I8WA 3DH0A 3CE9A 4F91B 3HHEA 3UWSA 1D1PA 1OYVA 5E9AA 1NVWQ 4L4SA 1Q0SA 2Y1CA 1UFRA 4DADA 1GAJA 3U09A 1VBFA 2VDNB 1R0WA 1GVHA 4R9SA 1G6OA 1PU2A 4RK1A 5HILA 1A2OA 2IITA 4QNMA 2H08A 2XYGA 2YRXA 3DFZA 5C5DA 2PGAA 3HJFA 2MYNA 3IJEB 2YXLA 1DBRA 3HCNA 2ZR9A 4ZMRA 2W42A 2PH3A 4GZ3A 1JSRA 16PKA 1GNRA 2PRZA 4Z53A 3LLSA 3OFVA 3NWOA 5FI0B 3TQRA 1PBTA 4AP6A 1O94A 3CO0S 4OQQA 4RF2A 3W5IA 4AJLA 3OLZA 3PDWA 4ALMA 2O7RA 5IN5A 5D84A 1HLDA 3BD8A 3NYRA 3P19A 4JQZA 3VTAA 5CLHA 3FGOA 4R41A 1QMGA 4H6WA 3HDVA 4L72A 3VR6A 1P0FA 4RE6A 1SXPA 2OV1A 4DSAA 1LW6E 3WLQA 4YRKA 4MKFA 4DRXA 1CRZA 2FEKA 3EEBA 1M8JA 1ZSNA 2BMAA 2GN1A 5FIUA 3WBJA 2OQVA 1TPYA 3IB6A 3WQRA 4CLRA 4S2EA 3I6BA 3CRRA 1FLDA 1K6MA 4IYRA 1T29A 1DTSA 4HDSA 1DJLA 2E3JA 4O08A 1EXDA 2VBFA 2P9FA 2HK9A 3IULA 3Q15C 1X15A 4FTWA 2C7PA 1Z4LA 4ILKA 4G3XA 1CQZA 4B31A 3IHTA 4JKYA 3BRWD 1E5QA 3SCZA 3T7KA 4URXR 5DGXA 4P22A 1L1FA 2WD8A 3GROA 2ZXEA 3A58B 5KOYA 4RY0A 3HL0A 4UU7A 2J7PA 2ZRJA 1VP9A 3C5CA 2HFJA 4DIEA 5CFQA 3AP3A 1QFMA 4ZVRA 3EQ2A 3WYFA 2GZ1A 3G89A 4PO8A 2IC5A 4F4HA 2VK4A 1VJGA 2HWWA 3NHLA 2NYAA 3SPXA 1W1IA 3BEDA 5L4NA 1OXKB 3GVIA 1W85A 3NANA 4FDAA 4LPSA 3ERCA 3GJRA 3F4BA 2HK7A 2CHEA 4ON9A 1TRKA 3T5TA 2C3UA 5IWAB 5DHFA 2ROQA 2GRAA 3HJCA 4M0CA 5LC1A 2Q9CA 1MCZA 3L0DA 1NF9A 2WHEA 2ZSHA 5FL3A 3ZZ0A 2XUQA 1Z73A 2EYQA 2HOQA 2ZWMA 1P4RA 3H11A 4X92A 4OBBA 5K1ZA 2GS9A 1SC6A 1XEWX 2PMBA 3IP5A 4ENTA 2HXSA 2OESA 3HUEA 3QWHA 2O8EB 3MS4A 4JKIA 2I3GA 2I3AA 3FYTA 4UUMA 2PY6A 4NATA 4S35A 2IY9A 2YWCA 3DTVB 4JB2A 1RC8A 2CLEB 1WMSA 2W2KA 3RKUA 4FC7A 2QJOA 4IFBA 4PNPA 4AF7A 1UBLS 2GJSA 2UYCA 3DNMA 3PQ4A 5IVIA 4A8JC 2XV1A 1X19A 4DZTA 3O4VA 5IXSA 3H8VA 3DNFA 4FZJA 2JLYA 2QQ5A 3K8QA 4FLFA 1KK3A 2Q1XA 2PT6A 1HH4A 1DQYA 3DZCA 4HAWA 2QRHA 2JI6A 1SU7A 3GVCA 4K9QA 1AHPA 2PRYA 5KYNA 1Z28A 1DG1G 2F3RA 1XT6A 3IT1A 5EWLB 2XOKD 5L3ZA 1GZDA 5FWNA 4EMBA 1QV6A 4DQ0A 4EG6A 2NM0A 2LV8A 4FBGA 1BQEA 2D74A 2YMMA 3CEPB 1GTJ1 3N86A 1SZCA 2O48X 1N2HA 2CEKA 4Q3LA 4UAUA 5FWDA 2F62A 1J7JA 5DPMA 4OA8A 4A91A 1PDVA 5DBEX 4A82A 1KU6A 4R1UA 1J9GA 1RYEA 2ZZKA 3MWGA 3ZDYB 2FE1A 3KLOA 5CA1F 3NAMA 4BQQA 4BB6A 4DA6A 5FYQA 1G1MA 2ZIUB 3NPAA 3EE6A 3L1VA 4AY5A 4KR6A 4RK0A 2H00A 4AM8A 3GG9A 2RHGB 4W7SA 1ZAYA 1YR9A 4L07A 4OUDB 3CW9A 1N3BA 3LBHA 4B3BA 3S1LA 3ONVA 1QE5A 3N7UA 3NDIA 3PIIA 4EKEA 3H1TA 4L16A 1OFUA 1PYOA 1V4VA 1SFRA 1W19A 3NH6A 1U3UA 3PCRB 4I9HA 1A9XA 1MV5A 4LRSB 3HXQA 4C08A 4U3JB 1N5LA 1PSWA 2B7LA 3D8SA 2GAJA 2G70A 1V1RA 4NZYA 4P4UA 1PJ8A 3C87A 4TLEA 3K0KA 4ZO7A 3PC2A 3FVVA 4MWZA 3RBVA 2XMPA 3ESZA 5F12A 2WICA 1QB8A 2H52A 3EFOA 1FK8A 2W00A 4KHZA 3MJEA 4IDDA 2NAFA 4PYNA 1ZLYA 1V35A 2H0AA 2HRZA 3SHWA 1C0LA 3L02A 4LBWA 2XQIA 5AFSA 5LOVB 1ZDMA 3UUWA 3G2PA 4GM4A 2YFYA 4QU5A 3V6LA 1N6OA 2YJ4A 2OXIA 3W9UA 5J5VA 3VR5H 1ULUA 3PPIA 1PWEA 1ATIA 8ADHA 2IS6A 4MGYR 3SBDA 1U7HA 5GIPE 3RWOA 3VKGA 4M1QA 2SKDA 1NA5A 3DDUA 3KOMA 5TMDA 1QH8B 4NK5A 3L8CA 4J3NA 1PR0A 3O8NA 4C30A 1XRRA 2PUTA 4KJXA 2CUNA 4ZA2A 3FSGA 3R6TA 4LRYA 4EKYA 2DF8A 2ZUSA 3CXUA 1DZIA 3IUMA 1NATA 2ZB8A 3NATA 1Y98A 2J4CA 1MRZA 5DIFA 2HWYA 3SP1A 2V8OA 1NIJA 1G5QA 4JENA 2V7WA 3WZ2A 3B1JA 5A6SB 4YJFA 3CISA 5GVSA 2ZBVA 3KK0A 5KQLA 1UC9A 3SJCA 1H2YA 1VIDA 5FA8A 4EM6A 2MSKA 1BJKA 3ZG6A 2JD1A 2VHJA 5BSMA 3Q9SA 4Y9SA 3QXCA 4D4IA 4C1BA 1O95A 2ZI6A 3SC6A 3SNKA 4M1EA 2X13A 4HDQB 3H99A 4EG0A 2ZRBA 3WB0A 1RQ7A 2DB3A 3OLYA 4QHSA 5F51A 3OWHA 5AM2A 3HTXA 1PT7A 5LM3A 3D1JA 4Q34A 1PJ4A 5I45A 3ROXA 4R9NA 4FI3C 1O5IA 3HWSA 1D6MA 4MA4A 2GYUA 2F8TA 3O4GA 4G25A 1RRPA 1UZUA 5AJUA 3MJVA 3H4MA 3BRSA 4MCIA 3ADBA 5EC8A 1AS2A 3KVVA 1T5DX 4IFIA 4EG7A 3U19A 3BB3A 4E5DA 2G77B 5JNUA 2OHFA 3G13A 4UCXA 4FX2A 3BMNB 1O08A 1GUAA 2OCYC 3DMTC 3W2FA 3K7EA 4R5MA 4B6SA 1G8AA 3CMMA 3LYAA 4H1HA 5CGQB 3P0FA 2GQ0A 4QVIA 2J33A 4MQ4A 4U02A 1N3LA 2IXFA 1GSIA 2X2FA 2TECE 3WWYA 3HJNA 3DJFA 1I32A 3CW2A 3O1JC 2I7XA 4M7PA 1VKJA 4LYFA 4EK9A 1J23A 3AIMA 3HY4A 4JEMA 4JN6B 2IUUA 1P1JA 5BYKA 3HR7A 1X77A 1N1DA 1TXGA 1YDHA 1P5FA 1EVKA 5EUQB 2GBIA 2XE4A 2XWQA 3UK6A 4Z4IA 4A0GA 1Z4NA 1U5BB 3D2BA 3IVCA 4KQ2A 4UEKA 3RSFA 3URKA 5AM4A 4MW6A 1GNTA 3ZX5A 4GL2A 2B82A 5DGCA 2EP8A 2MWMA 3PPXA 2WZBA 4W5OA 4N8SA 4Q1DA 1LC0A 3H5TA 1ITZA 3GLFA 1ZJWA 1HYBA 4IEFB 2SNIE 1TC1A 3F4LA 1P44A 4HX2A 1F3LA 3T54A 1ZH8A 4WX2B 3BL5A 2B2XA 1Z2DA 1Q92A 5JBQA 1EIZA 3I72A 3ONDA 5HF6A 5ITVA 1U6JA 3II6X 3ND8A 5AQ1A 4AKIA 4HGNA 3BF7A 1XELA 4DLAA 3KIPA 1E9SA 2QP9X 1WUYA 2L19A 1E3QA 4ZV9A 3NTUA 4DDUA 1LBTA 2DRIA 5LQRA 1FYWA 2O3JA 1ZBQA 1STOA 4MWCA 4FOSA 4ZK2A 4L78A 5BT9A 4TV9B 5EUBA 2YVLA 2DQ4A 2BHRA 2VQ3A 1WABA 1E2PA 3LC7O 5FV7A 2DYKA 5EN4A 2KHZA 1V11B 3IH5A 3U0BA 4N54A 1E6LA 3UXYA 2Q3EA 1T9CA 3RBAA 4Q7MB 3WB1A 4U7WA 3JASA 1SKMA 1X1DA 1XNRB 5DGHA 4LVCA 3UV7A 1LLQA 3BHJA 3I8XA 4HGPA 5BV0A 3DDHA 1B0ZA 2Q07A 4ACBA 1HETA 4EY6A 2TYSB 4DCTA 1Z82A 4RFSA 3PUWA 4JX8A 3E3MA 5TXGA 4YO8A 4U4AA 1XSEA 4GQIA 1Z75A 3H18A 4MS4A 4BP1A 2QT9A 1H94A 3BH6A 4TXNA 5C7IO 3SM3A 1GL9B 1NKSA 1W93A 1WX1A 3WGNA 2QXYA 3VV3A 2D1SA 1IUPA 4KFRA 5E95A 1CJBA 2FKAA 1KMQA 4DIUA 3PS9A 4HSGA 3D8NA 4MVYA 1EFUA 2OBYA 3T7DA 1YVPA 2JHPA 3OQMA 3R9WA 3M2TA 5B1HA 3V1KA 1DC7A 4EIWA 2QTFA 2CV2A 2XQVA 3KVYA 5DHQA 4LYEA 3SQLA 3MJRA 2AKYA 4XOUA 2W0MA 4C21A 4BNIA 4UEQA 3HKCB 3OMLA 3DXXA 2ASEA 2HF8A 2FHPA 2X6RA 3I1JA 2Q9BA 2F17A 2D62A 4LZAA 2ZI9A 4HH0A 3IEKA 3KEMA 1Y1RA 3SF0A 2GXAA 1TA0A 2D1TA 1EFPB 5DN9A 3TCXB 3EVAA 1EBBA 4QU0A 3EPJA 2CJFA 2HI0A 2QYSA 2PUBA 1JHAA 2WJHA 3KAKA 2B8EA 5REQA 5KNBH 2RGYA 3QKUA 4MGHA 1YZTA 2WM8A 3K9QO 3BMQB 1YZNA 2IHYA 2QIPA 2CLLB 3TSZA 3H5OA 1QKKA 4ARCA 4G37A 4OJQA 4OP3A 3UKOA 4M99A 1RMQA 4Y1FA 2C31A 4KOEC 2VBGA 3IIJA 4KP7A 2P6PA 3AUYA 3X3HA 1FS4A 3BWVA 1UFOA 3CZPA 3OM8A 2GBFA 1CZOA 5CXQA 4HH4A 3F7MA 3QEMB 5AVUA 3HCPA 3QH4A 3TGLA 4OQ4A 1UDBA 1VPLA 1F8XA 3HUDA 3KB6A 2XQGA 4II7A 1U6KA 3NV7A 2EF1A 2QPLA 2YZNA 3LGSA 1VTKA 4P2BA 4PPGA 5CLQA 3WRXA 5B3LA 2Y9PB 3CONA 5F76A 1TUBA 2KW5A 3LFHA 2O3RA 2YS7A 3LPNA 4DMGA 1JEYA 3QVUA 3UKDA 2HDNB 4FEYA 4GMKA 3PF9A 2GAAA 2ZTMA 1DCMA 1A8UA 5BR1A 1ZQ1A 2GF2A 2Z8YM 4RMNA 1NMEA 4YYEA 2ONKA 4TQGA 2XBMA 4MMXB 4D79A 3LC2O 4BNGA 1A5TA 1YBVA 1WKVA 2Z6AA 4QEZA 4ACAA 3SQMA 4J0KA 1NUTA 1U90A 2BAGA 2FEMA 5KDLA 4WERA 3LLCA 3DMDA 3F90A 4EX6A 3SHFA 5JQGB 4NENB 3LFUA 4YP5A 3JAMA 3KQHA 1VSUA 3S27A 3AL0C 3ZJYA 4PQRA 2D4AA 1Z7BA 4FYHA 4U2CA 2W71A 5AOBA 1GP2A 2C5FA 2C2HA 2N0SA 2Y27A 2A8YA 2BKXA 3DR5A 2X0DA 3DT9A 5B3JC 5KX5B 5IRCD 3LX5A 3P9IA 5IF9A 4ZVMA 3E9MA 4TUYA 5DWVA 3VNBA 4O63O 3OJEA 4IGFA 1BGXT 3QEKA 4TKUB 3UBMA 3F96A 1K5DA 2D0DA 4JA0A 4TT8A 4A6XA 2AUTA 3WLMA 1W581 4US0R 3IT2A 4N3GA 2YHIA 1DJMA 2ATEA 3N8KA 4Q12A 2QD5A 1AXRA 4L9AA 1PUXA 2QN1A 4W1SA 1HT2E 2PYZA 4A15A 4TTQA 4JYMA 1J06A 3P0EA 1G20B 4WJZA 3OLWA 1E7MA 2Q3DA 2BBSA 4CQLA 4EY8A 1W5BA 2QQ0A 4AJHA 2DY0A 5EKXA 3ZW9A 4BBAA 1Y9DA 1HYHA 3OEHA 1Z6YA 1TU0A 2AOXA 5FJIA 3UK2A 3K6KA 4U00A 1V1MB 3PEWA 3QLTA 1K4YA 4ARVA 1L6IA 1JSCA 2EKDA 2BTOA 5DV9A 1AGPA 4P7FA 2P11A 4C6RA 3SFZA 4RDIA 1KQNA 3EXIA 2WWTA 3C3KA 5E6RA 2KLBA 2FR0A 1NOJA 1KH2A 3HXMA 4UVGA 1MJ5A 4DILA 4D3DA 3HYRA 5FPHA 4OAPA 3LY7A 1YC2A 1K6EA 3MGKA 1ZY2A 4GOJA 5D1HA 1K8QA 2YBDA 3JW8A 4DCNA 3ZVKA 1HDZA 1Q6YA 4MLPA 1EHYA 2P7HA 3GNTA 3T7TA 1VKHA 4OQFA 5DHSA 3G17A 1RI1A 5TPWB 3IP3A 3OTQA 3S4YA 1F3OA 4YT4A 4AUMA 8AT1A 3TXAA 4LDQA 1XYYA 4V02A 4BQOA 1UEJA 1ZJ5A 1UC5B 4ND8A 3GEGA 3O83A 1QM5A 2VPQA 3OVMA 1P5ZB 1TFUA 3PL5A 2FPRA 4WOCA 3WO0A 3WKAA 4RTKA 3RVKA 2XR1A 5TT0A 4DXHA 4DCUA 3TLZA 4YLYA 5KS2A 1EXMA 2C2MA 2X76A 3DOJA 1N0HA 1W0KA 4A10A 1G4UR 1PTKA 1KYVA 1EK0A 5LCXA 4YAWA 5L95A 1XD2B 3MOSA 4LQ4A 1IUNA 5IK2D 3UK1A 1KZHA 5F9MA 2EJUA 4YCNA 1XDSA 3UXEA 3IV7A 3WIEA 1GKYA 3ZY2A 2I3ZA 5KYYB 1BHO1 2OQRA 4B4WA 4GZ5A 1XPRA 3MGCA 4AIRA 2FUG6 1ZJZA 3N0WA 4X8MA 5B6IA 4R98A 4YPOA 3MMNA 5AW0A 2GD1O 1S3FA 2DFVA 2WB4A 1DC8A 1Q1ZA 2QQFA 3V1NA 3ACCA 3MT8A 4G8JA 1QU3A 1RJ9B 1JECA 4GIBA 2FX5A 4B6EA 5L45A 2P9GA 4IHAA 5LP6B 4G41A 1AX9A 4M9RA 3T34A 2H4XA 1HL3A 3T9CA 3UWOA 5CA1A 2E9SA 1NULA 2CFOA 1NBOA 3IAHA 5H5JA 5CHYA 4KO4S 4Z1MD 1ODLA 2VDLB 1PG0A 1XTIA 4B4VA 1EXNA 1N5KA 4ASUD 4E07A 4RDHA 1O0SA 1TF2A 1XEXA 5JSFA 4XYGA 2GASA 5ELLA 5BSVA 4HSEA 3SSOA 4ZEWA 3S68A 4IIJF 2LXNA 4UMFA 1JPUA 2Q46A 4IOMA 2FWMX 3PUJA 4X3CA 4KIGA 4A8TA 2AEFA 2AI2A 3NM6B 3H65A 4ZOAA 3MWEB 4NZPA 3UOAB 4CUJA 3OOHA 3SXUB 4GPZA 4HMPA 5F7XA 3RJZA 2A5LA 1E2GA 3BGIA 1FP1D 2M1XA 3KQPA 1BEEA 5HK9A 1C8LA 5ALYA 3H2SA 3C6ZA 3RAGA 5JDCA 3K9GA 4MROA 3R7SA 2GRJA 4L51A 1ULAA 3RTDA 3VNQA 3OTGA 1GRVA 2IDJA 5FFNA 2V6BA 4CF5A 5JBNA 2WT9A 4KRGA 5EJ9A 2JHAA 1V7QA 4B7ZA 1YKSA 3SQWA 2GTHA 1P2BA 1O57A 2QN8A 1UDXA 1RM3A 1DC3A 3KSZO 2PRSA 4E5KA 2ZI5A 2EVWX 1UPFA 5ECYA 1V4BA 3A1NA 4B3HA 1Q1NA 1KYIA 4HFNA 2VZ9A 4NG5A 1I7PA 2VP0A 5FI3A 4EY3A 3IXLA 3VBCA 2IKQA 3SDZA 4BDTA 5L3QB 3CT6A 1JQLB 1T9ZA 1WF3A 2PKQP 4N8DA 1IQ0A 1SH7A 4AAYA 3VVBA 1GQYA 1UOOA 1E79D 3LG2A 1CT9A 2G04A 1ZM2A 4TVSA 1QU2A 1TO1E 3DR3A 3SN6A 4WZ6A 4ZEVA 4DLVA 4Y2QA 3I61A 2CVHA 2JGRA 2A0YA 1GCOA 4MJ3A 1INLA 3D3QA 1RM4A 1Y6QA 2LRHA 1DWQA 2C4HA 4WESB 4QJIA 2GNPA 3SF8B 1RLJA 2A1IA 2C4WA 2FW9A 2I99A 5A3SA 3HB5X 3V4LA 3DXZA 2G7ZA 2YZKA 3AUUA 4ZAZA 4R1PA 1P73A 4I1VA 3ZD8A 4BE4A 3DWGA 1IVSA 3O9MA 1JFFB 1UM8A 2X58A 3DBRB 3P27A 2C83A 3A28A 2FUNB 4HAVA 4ZANA 3WI7A 5EJ8A 4NV3A 3WGTA 2OLJA 3KPWA 4GPAA 4EW1A 4PX3A 5JR3A 1EUDA 4C3VA 3CRMA 1Z17A 1Z88A 2ATIA 1KJ8A 4WGGA 3NWPA 2ZETA 3C5WP 1ZJ4A 2ADFA 1LNQA 2ALJA 2AZDA 3CB4A 4FFLA 5G41A 3U3RA 1N5IA 5HGXA 4X62B 3MCZA 5C5IA 2YIDA 3RAFC 1E2HA 1M9NA 2XCLA 4KR0A 3VI3B 3IKTA 3B3JA 2AEJA 3BMCB 2F9FA 4U2BA 1SXQA 1TW2A 3FNRA 3D7SA 2B20A 1QIIA 1Y6JA 1QDUA 2GJ8A 4OYYA 1Z2PX 1ZUNA 1DTWA 3DZ8A 5H59A 3CLTD 4YRTA 3MEQA 3GFPA 2VUSA 2V4UA 2VHCA 3OZTA 1W6RA 4BLSA 3ZWPA 2ADOA 3AB8A 3D2AA 2O2ZA 2ZRPA 4GE3A 5E3IA 3T7EA 1UODA 2X8JA 2C5AA 1J90A 3GGJA 4B0PA 3O4HA 1Z56C 3RADC 5EXEA 2ZZNA 1G8YA 2W4IA 1NP3A 3SZRA 5H0IA 1QHEA 1JI3A 1NJ1A 3AEUA 1TO2E 5AK3A 3M5PA 3VZPA 4NCHA 5F98A 3KUCA 4RH0A 1JU3A 1XA3A 1OF1A 2IV2X 1VHTA 3ZN2A 4KPUB 2AEMA 2HA0A 4KEAA 1J0DA 1I0LA 1RKVA 1B42A 1KJYA 2ZAIA 1I94B 4UXHA 3NJRA 2OR3A 1QZ3A 5EIBD 3KHTA 1RP7A 3PI6A 3BG5A 1ZOLA 1QAQA 2PZJA 2WE7A 3HLTA 2YVAA 4PSUA 3OLQA 3W05A 3ZDBA 1VJ1A 4IRXA 4F2HA 4G4IA 1P0QA 2IT1A 2QMOA 3I3SR 3OICA 2FLKA 4BLQA 5KNBA 5CURA 4UUAA 4RKFA 1CRPA 2IXTA 1SVOA 2QAGB 3F6EX 3EFEA 2FWBA 4HS4A 3LECA 5E1DA 3ODGA 4RL4A 3UG7A 5CFNA 2FJ0A 3DCNA 2J0EA 2MJLA 2I65A 3IQZA 3HMQA 4ZZ3A 3D6HA 1CRWG 1X3SA 2H5LA 2KX7A 4C0XA 2QUJA 1FX0B 1W8DA 5BUZA 3DO8A 1U2TA 3ENQA 3GH3A 4HJRA 1OBFO 5A4MS 4HD8A 3V1TC 1FVHA 4F6LA 1SBHA 4YCMA 1EESA 1MTZA 5JDIC 1CZHA 1JXMA 4LC9A 5K0BA 3V7UA 5TR9A 2R97A 5C9ZA 1CYEA 4CLEA 1GTG1 1BN7A 3NBKA 3OMXA 3LRTA 5EP4A 1E4EB 3UYKA 4NMMA 1K4MA 4XD7D 2CSUA 1XVAA 1XZ8A 4BMVA 3UMBA 2FI1A 3G5TA 4JJ7A 3L8ZA 4UBJA 1QYVA 3DEAA 4WFIA 1P0MA 2W6ZA 4GZLA 4I4NA 1LDNA 3QJ5A 3HZHA 4RVUA 3WSWA 1NQXA 2WINI 2FPSA 4LZOA 4ENWA 3Q87B 1Z9BA 1BHSA 1G63A 1S89A 4AC9A 1M1YB 2FV8A 4RJJA 4LRTB 2AZMA 3TSAA 1KBOA 2FZKA 4Y6LA 5IJZA 3CZRA 2B92A 4XVUA 3UVEA 4DKXA 5CB4F 4YA6A 1XQXA 4PRLA 3IMEA 3PHCA 4QJ3A 2A9KA 4QOGA 3AM1A 4BYGA 3A6DA 4TYWA 5M04A 1QO9A 4KO3S 4RKYA 5K6AA 4PZYA 1VFNA 2H63A 4K8RB 5KQMA 4BC0A 4EJSB 3G8CA 5ALQA 2ZRDA 5BY2A 2O2HA 2WIDA 4MKXA 4BP3A 4TLDA 4DWJA 5IBPA 3WFJA 1FTNA 5FOSA 3H1BA 4TN5A 1C3JA 4Y6RA 5IG2A 2Y2VA 3UCXA 4ZTZB 3K0AB 3IBGA 1QQBA 4BO3A 3HY6A 3JY6A 4CLXA 2AMFA 4NCBA 1OLXA 3PE4A 4PPQA 2VRWA 2X0JA 4PONA 4LE1A 2JAQA 2BRUC 3HNOA 4JJFA 1ZCJA 3LT2A 1SXGA 1JQAA 4A0QA 1ID1A 5J1TB 3AESA 1WVGA 3K9NA 4M9CA 5M34A 4MDEA 2DQYA 1Z6TA 3C3PA 3M9XA 4H7IA 1P61B 4IIUA 1PWXA 4PVDA 5AW1A 2YKGA 5A5GA 3RBZA 1VIMA 4FP9A 4XYMA 2B0JA 3F7TA 2XWSA 3L7YA 2XUKA 3TLKA 3DB1A 3T1HB 2CLSA 3CX3A 3OIYA 1E7RA 2O8NA 1XVIA 4JB8A 4P6VF 2DECA 1GRNA 4FZVA 3TOZA 4R83A 3UJ9A 3BFVA 4OHCA 4C7MA 1ODSA 2BKLA 3JWIA 5ITZB 3AJRA 1ONSA 2FEAA 4M0KA 4BRZA 4KSBA 5JAIA 3IE2A 1XDDA 5E9WA 2QX9A 3OD5A 4XFJA 3W06A 1KEZA 1UP6A 4BE9A 1C4OA 5AW9A 5BV2P 1TB4A 3SR3A 4BQRA 5I7HA 1IOLA 1WG8A 5HQ3B 4PBTA 1I2DA 1IC6A 3EG5A 3LUGA 1M0SA 5CFRA 3PWSA 3CZCA 3CNEA 2VPZA 4ATNA 1R4NB 1NN0A 1OT5A 1X1QA 4MPDA 2Z5LA 3PEUA 2V6IA 2N42A 2RHMA 3CB2A 1LEHA 3EIUA 3GD7A 3RU9A 1SUDA 4EMUA 3GWZA 3BORA 3ORRA 2JJ1A 2HLPA 4LWOA 4DVGA 3V46A 1AE1A 3RYCA 1G21B 5JS1A 4WAUA 3FCXA 5JOQA 4UNNA 2P1ZA 3QPCA 1JILA 4M88A 3TNYA 4LW8A 3D3JA 3HBNA 4CKBB 1HFWA 2J67A 2PKWA 5JRDS 2CJYA 2B8JA 2G83A 2PMKA 3IQFA 4CG2A 4O59O 4CM4A 2Q6LA 3FNQA 2ZWIA 1B8UA 4XE5A 5H70A 5KUTA 4LWPA 2OEPA 1HM5A 4J6EA 2WA2A 1U7WA 3MMSA 3FCCA 1O58A 4BL5A 4XW2A 3P2YA 3WMRA 3EN0A 4WNAA 3D4LA 4HYEA 5JO9A 3LUKA 3JRXA 3I92A 2P65A 3UQYS 2YY6A 3D4OA 4UXIA 4KPFC 1FZQA 4QECA 2K7ZA 2C2KA 3BRWA 3IHWA 3WL7A 3R3XA 5T8KA 3C1UA 4C7OA 3N39C 3X43A 2X86A 5LA6B 4PINA 3NCHA 2I34A 4B8YA 1ZIXA 1E3JA 2VSQA 1JHPA 3GCZA 4O4LF 4RZ3A 1DV2A 4TMTA 2C7OA 2WSSD 4S0ZA 4JHXA 2G82A 2JEZA 1L4KA 3DE5X 1KOGA 3OJLA 3Q6MA 2BN4A 1I4LD 1ECBA 2A5JA 1XMXA 2J9XB 2RHDA 2WTNA 5AKEA 4F12A 4HFMA 2H4HA 2M6LA 3H97A 3QKIA 4J9UE 2R87A 4JFAA 1L4YA 2VJMA 2VTBB 1Q1GA 3CWZA 3VHXA 4RLSA 4AZ3A 1KO1A 2WJAA 1APBA 2TMGA 2CF5A 3EGWA 2FDCA 1L5YA 3S8YA 1V95A 3ZE8A 3TLYA 1NQWA 1JMKC 3VZBA 2GEKA 4ZJPA 3FRIA 1U1IA 4YHHB 1MO6A 2QAJA 4FGKA 3GN1A 4KGXA 1GN8A 4KZPA 4KXVA 4JXXA 3DOIA 1KGDA 2COKA 3MQ2A 1P31A 1HKHA 2PIAA 2V6MA 2I87A 3CW8X 3N28A 1ZN7A 1RIIA 1N5DA 1W52X 4MQFA 1DX6A 3RC7A 5HJ7A 2AC2A 3B36A 3JQRA 3WX0A 3ANMA 5IYZB 1SUFA 2I4RA 4NX2A 4TVOA 4E4YA 3N2EA 1YBHA 4UNQA 3LKBA 4FVTA 1B26A 1Z0IA 2Y1EA 1SKAA 1SVWA 4ZPJA 2JLCA 6REQA 2BH2A 3RRZA 2KSQA 1KI3A 4G07A 3VH4A 1V71A 2QTVA 2O2XA 2I1QA 4ER5A 2JW5A 4MZDA 4BVBA 1MA0A 3JARA 3AB7A 2IPLA 2Q4DA 2WJWA 3MLAA 3OMWA 4RESA 4R2HA 4GT1A 4KPYA 5FLXA 4ID9A 3WHKA 1HA3A 3HJGA 3KPYA 3RVJA 4TSKA 4EGJA 4Y3UA 4R5HA 5SY9A 1RAFA 3QEOA 1RP1A 3S2SA 1ISFA 3C45A 3QFFA 4IDGA 5DM4A 5JYCA 1IHDA 3FIJA 3OUZA 4E4RA 5JCOC 1EWQA 1H4VB 4FMCB 3KJGA 3JRNA 1OJLA 1TVEA 1YIDA 5AJHA 1XG5A 1GUYA 3QFSA 4CQMA 1YASA 3GJ6A 5ENZA 3MELA 1KRWA 3KWLA 3C6BA 3FDIA 2XOKA 5FADA 4FOPA 3WSTA 1YKFA 3DOCA 3FVTA 2CFTA 1TCBA 3SKYA 3U37A 3BYZA 3ZKAA 3FHTA 2C7QA 4PNHA 1I14A 1BCRB 2IFTA 3LRXA 4U7HA 3TDKA 3JQDA 1EDOA 4NMLA 3Q41A 4PAWA 4MPPA 1NY6A 1UXOA 3QRWA 5T4HA 3SZOA 5GGYA 4E13A 5JFTA 4G5XA 1RU3A 3RFVA 2QLNA 5KJFA 1AKVA 4IOJA 2Q0HA 2RHCA 3I9V1 4I55F 5CYGA 5CW1A 4GX2A 4DSTA 5I9IA 1VIVA 2PL9A 2XLCA 4D7AA 1IVYA 3RSOA 4EH1A 3V2UA 3DZHA 5EEHA 4OKSA 5C8YA 3ZY4A 5BORA 1Y33E 5KTRA 4OI1A 5KPJA 4LFCB 4TMXA 2DUNA 4J0FA 2R86A 3SJUA 1D7AA 1JQDA 2BVNA 4WKOA 3TPZA 4KXWA 1A4XA 4WV3A 1TDJA 1KEEB 2GJKA 1C7IA 3NHRA 2P67A 3H5AA 4E94A 3F46A 3OE4A 2A9PA 2ZYVX 4KLZA 4W9NA 1ORTA 1WBJB 4WZBB 1T26A 1XEWY 4ENVA 1CJTC 4KU4A 1QP7A 1T1JA 3QA3E 7GPBA 1LLFA 1PQYA 3UCEA 1R27A 4CIBA 4KMSA 2X5OA 3CF2A 3T4PA 2WI8A 2A9FA 5D3QA 3RU7A 5JYDA 2AXPA 4C3OB 2PZLA 4I5GA 1JDJA 1P6XA 1P7VA 2IXGA 5IN4A 4QM6A 2D1RA 4LQCA 5FV4A 4CMEA 1XVLA 5KINB 1UDCA 4D4KA 4P4TA 3ZNQA 3U16A 1NBME 1X0XA 1YR6A 1YU9A 1ZICA 4HKTA 5EE0A 3F7NA 4H7HA 1N36B 3RTGA 1CUUA 1KI7A 4Z7NB 5E7JA 6Q21A 3BTOA 4D0NA 4EUNA 2X5JO 3CG4A 3KT3A 5EJMA 2KBEA 4K2AA 3KKZA 3VH2A 1CZNA 3W5CA 3U4MA 1P1HA 4JBYA 2O0MA 5LFAA 3VKUA 2I2BA 1UF9A 4F06A 5LJIA 4RA9A 5K3DA 3HA7A 3ROKA 2P2YA 4QDOA 4V03A 3CNQS 3VX4A 4WJKB 1X7XA 2AQ8A 3PJFA 2YIVX 1DT5A 4PCAA 1MW8X 2QVGA 1CRLA 1MABB 3D7MA 5AOCA 2L17A 5L9AA 4P8RA 3K0BA 5IF3A 1J2RA 2PX0A 4OJTA 4EX7A 2JLSA 3L07A 1GJRA 1RYHA 3DEFA 1V8OA 3BIJA 3EVDA 5E2AA 3HCDA 5H3CA 5CEFA 1LLUA 2RI6A 4GRAA 5I7WA 1KK2A 5K01A 2EG9A 5FFMA 5IAAA 4PHTA 2C7RA 4ZVOA 1UEIA 1SCAA 3EEFA 4K9LA 5A3RA 5KNLA 2FW6A 4A36A 1M54A 3FM9A 4US1R 1U9IA 4E5UA 5AW5A 4NE2A 1DPGA 4MRMA 1VBNA 4CDRA 1M2JA 1YJ8A 3LHKA 1M2VB 4MUBA 1M1ZA 3WOHA 4LDPA 3PHIA 5CX1A 2IIVA 4D9BA 3VPSA 3ISTA 4FT2A 1KH3A 5JJCA 4O2LA 2DSTA 4C0SA 2SCUB 1G98A 5EHZA 1TIKA 1JPNA 1NJ8A 2CXPA 3L93A 4S24A 1YRHA 1G5FA 1S96A 4N41A 5IZ4A 1CLEA 3JZIA 3QU2A 3U4GA 4HWTA 4B3XA 3CR8A 3TOVA 1L4HA 2GD2A 3DQPA 3REQA 4MI1A 4NP6A 4K9KA 1M6EX 3ZD6A 4GEKA 3B7PA 2H4JA 2ZB3A 4JLDA 3WL8A 3UTDA 5JTUA 4RTOA 1T15A 3GMSA 3QSYA 5E6UB 2YUTA 3FYDA 4Y9UA 3RRYA 2XZPA 4OOFA 4CM6A 1KH1A 3F6CA 1U8UA 2JAUA 3U39A 4H4CA 1RI4A 5AKYA 3OFSA 1MQ8B 3IOBA 1XWFA 3LIIA 4ZC1A 3K9WA 3KKPA 3UJNA 3LIPA 2A57A 5TSDA 1YI1A 3TLGA 1KZYC 4KC0A 4JC5A 1ZM3A 2YJ3A 3W79A 3W78A 1E1YA 1EDDA 2VNSA 3O84A 4P3KA 3V8PA 1AKEA 1DFHA 3VJRA 2B25A 4MJ7A 3EXG2 3Q3VA 4NK4A 3RC3A 3VUEA 4D0LB 1UJ2A 2X23A 4X1KA 4UBMA 3MS7A 5J40A 3IELA 2CNWD 4YCAA 3B9QA 5ELMA 3VGJA 1JG2A 1ZMXA 4PWZA 4EAQA 4PYOA 4R01A 4RVCA 4XLZA 5I7OA 4JB0A 3I09A 4LMBA 1MBZA 5FYDA 4HPJB 3I8OA 4BO1A 5D51S 1YNOA 4WY8A 2MHCA 2Y2UA 5AVJA 3VSEA 4ZCRA 3L6DA 2WEKA 2VHVA 4LE0A 4OLFA 4F45A 2F1OA 1GWNA 3ACDA 1G8FA 4UOZA 2JBHA 1K88A 1N7JA 4KYVA 4Y2YA 1J9EA 1MF7A 4C43A 1KFEB 3OZSA 4ZDKA 4MWOA 4V0LA 1XTJA 4OA5A 1JH8A 3ZYCA 4BO9A 1PS9A 2PX2A 5K5EA 2H3HA 4MV7A 2DUUA 2ISQA 3OX3A 4QQ8A 4F5WA 2PUVA 1G3QA 3LCUA 3DL7A 3DBLB 3FPLA 4DJTA 4EA6A 3H87A 1PKXA 1X2EA 3EARA 4L5IA 2FF7A 3C3WA 3Q7TA 4X1IA 5E38A 3BQMB 4QL3A 4NMWA 4XPIA 5CDFE 2HXYA 4N5DA 2E4ZA 1SXJB 4EYQA 3QW2A 4EYOA 5CB4A 2IHKA 2OK8A 2QVXX 5BN1A 3VNUA 2X5NA 3CN9A 2HGSA 1KKMA 2N47A 2I66A 4X63A 2UXCB 2PGLA 2Y4OA 2IDMA 4XWYA 2XUJA 2GT1A 1IBSA 3VQTA 2C9DA 1FXUA 1CZLA 1J2TA 3AWIA 3QNUA 4GICA 4V0RA 4YCDA 1RZ3A 2MR6A 1L5HA 3HDJA 1ECPA 2HHLA 1ELOA 4CMIA 4C0AC 5KKCA 2JLAA 4NABA 2XADA 1G59A 5CR9A 4UUQA 2A3NA 3K30A 5LMCA 3TTUA 1EHIA 1ZGJA 2IYXA 2LW7A 1F0PA 1UT5A 5K0SA 3HKEB 3ETJA 5FBZA 1Z35A 3TM4A 1YMVA 3CLSD 5BUCA 3HP1A 2QX6A 3K72B 2XTAA 2IW3A 4B3TB 4EJMA 2RGCA 2XUDA 3GK3A 3GT7A 4Z0NA 3STHA 2BKEA 2E49A 4D57A 2OMEA 5CVTA 1ISMA 1Z13A 3GGPA 1EFVA 4N18A 2LIVA 2VYVD 1TJ4A 2Y66A 2PGDA 5TIIA 4ZIRA 2G1AA 2YIMA 3KKQA 4IJ5A 2FFJA 3WP1B 3Q85A 2XMRA 1AC5A 1XD9A 3UF0A 3VPHA 3I0MA 4PG8A 5LSAA 4L28A 4M1WA 3G9TA 2BUAA 4DLYA 4MNTA 5BSFA 3DMFA 1HE8B 4MB2A 3Q7SA 1FNNA 2O8BA 2KQUA 1SCUA 1WOMA 3BMOB 4LE2A 2PVCA 3TSYA 1URPA 4C03A 4QWMA 4GYJA 2CHQA 5CYOA 1XZFA 4D99A 4QTTB 5AHOA 4FNGA 5IAEA 3E82A 4UEWA 1LSOA 4LY3A 5G4KA 3TI7A 3MCTA 1F2TB 3DDZX 4GECA 2BCEA 1NJSA 4I81A 4PC7A 2CLKB 3RYIA 3WHPA 3AF4A 2JFUA 3OIFA 1XZNA 3OIWA 4MYRA 2JJYA 3EHEA 3HGQA 4YRJA 3T5BA 3EMVA 5LOVF 4X6XA 4BNFA 5C31A 1YOVB 4RVNA 5IJ9B 3E1KA 3E8SA 1U7ZA 2QXTA 1FLAA 1PLJA 1U6IA 3Q3GE 4GYWA 2FDXA 4OHRA 2WWYA 3ICQB 3H0EA 3WLEA 4JUCA 4KV9A 4W5HA 4YUXA 4GLLA 4DR2B 2GN0A 1S8AA 3OZAA 4LZZA 1PR4A 3X1KA 1JG7A 1TYBE 2F43B 3U26A 3BXXA 2F3UA 4DMRA 1KXZA 1PL0A 1Y37A 3CX4A 2VHZA 1LY1A 5IBRA 2NVUA 3A14A 3GJ8A 3EX7C 1XC7A 4DRZA 5BUQA 3E5NA 3QMVA 3FJ1A 3RSZA 4DDKA 3F73A 2BIFA 3C3JA 4NV1A 5C4MA 1VMAA 2H06A 3ZK9A 2Z2KA 5JCXA 1PNQA 5PNTA 3WLSA 2CLFB 4NVRA 3FOEC 1V8DA 3ANYB 2BDEA 2BJWA 3N1UA 2IVFA 2OYCA 2ZUEA 1K7XB 4CYMA 4JR1A 1SHZA 4A8JB 4BZXA 1YNSA 3WICA 5D5QA 1WY7A 2BTQB 2E82A 4Y67A 4HT3B 1CHNA 1COZA 1FU7A 2NGRA 5DHRA 2VO1A 3U3ZA 5C37A 2RE8A 1Y6GA 3VU9A 3NYWA 1WWKA 3PQ3A 4W1PA 4ISBA 4EHLA 1LV8A 1FXWA 3O4FA 1FFBA 2BFCB 3DC2A 4YP9A 2J0VA 3MUEA 2PBZA 4PBRA 4US2R 4TPKA 3H0CA 2VBCA 4IV5A 1JDVA 4AJ9A 3TG8A 3BGOS 1BWQA 1EWKA 3N9IA 2B5VA 4JI3B 3U49A 1UDWA 1M0WA 5SZJA 3ZU6A 3IT0A 1Y7IA 4O4LA 4QBTA 3GGOA 1P4AA 4NKRA 3ELBA 5KKNB 4B5KA 2BEUA 3PPYA 4MVJP 3EXG1 4KUEA 4M0UA 2LPMA 1ZN8A 5ERXA 2NVWA 4GBED 1LVUA 1E4YA 2UYGA 2G9NA 4IIFA 5HCNA 2CYCA 4GI3A 2N1BA 2EJTA 4IEIA 1TCAA 3IALA 2NG1A 1G20E 2F00A 5FKJA 2A84A 4L8GA 2EFEB 2AF3C 3I3OA 4AYXA 1A9PA 3MJSA 3P9QA 3R0QA 1IM2A 4O4JB 3UICA 1M2EA 1JPJA 4HYTA 3B82A 3EXHB 4MWBA 5BWMA 5D3MB 5GONA 4WK2B 4KRYA 1F7VA 1TLFA 3TUJC 3C2QA 2V74B 1QAMA 4MWDA 4NOJA 2FWIA 3GEIA 1CF9A 1X7ZA 2JDID 1I6LA 3LNCA 5LBTA 2P1DA 3DM9B 2BUBA 4DJFC 4COKA 4FGSA 5FH9A 5IHXA 1Z08A 4UTOA 1P4JA 2G5TA 5ICSA 1G8KA 1KF0A 2L42A 1A9OA 2EKZA 3KYDA 2WOJA 1EI9A 1LTQA 3RSGA 1GA1A 5CDGA 3EFBA 1FSGA 3GFTA 3SVLA 3MGAA 1GCAA 1W47A 1YRQA 2JA2A 3GLHE 1VMDA 3LQKA 3NXSA 2HJRA 2HU7A 3O82A 4E6EA 4QX6A 1VE3A 1BEUB 1U2EA 2AWOA 3GFGA 4PQFA 4QYIA 1DARA 5DSXA 5IK2A 4EPVA 3MCAA 2OCDA 3LW8A 4INAA 3VH3A 2WKQA 4L4ZA 4CLOB 1UPXA 4FJ2A 5FPPA 3UG6A 2QMEA 1ZINA 3S7TA 2R7MA 1KI8A 1BW9A 2XKAA 4JXJA 1MB9A 3VHLB 2IGBA 3VYVA 1ZOOA 3ZXSA 4B44A 1P19A 3FMFA 4TV9F 2UZAA 1Z5UA 2JF0A 2WB2A 5KQPA 2O8CA 4I7EA 3GUYA 4D46A 3JVVA 4IEEA 2XBLA 4RD2A 3ZVLA 3ZU4A 4FPXA 1I1QB 1VI2A 4GM1A 1YXMA 3OTHA 5C80A 3RC2A 3SSNA 2DTEA 2Z5GA 3GAAA 4R81A 2ZT8A 4AKGA 1RLTA 4ESOA 2SKEA 1MIOB 2RHBA 4I55A 4Y1GA 2DLCX 3A7DA 1DQPA 1M1UA 1NQTA 1NLMA 4JL6A 4OL0A 4Z1MA 3UB4A 2QN6A 2YWFA 4ASUA 5GAJA 4EO7A 1W7AA 1Q1AA 5CB8A 3D59A 2DUMA 1L5MA 3D7LA 3L8MA 3SX2A 3T1YB 2Z9CA 4BZWA 3G82C 4CDMA 5IU6A 2FB9A 5CJPA 5KTOA 5TC4A 2WV7A 3C85A 3BJEA 1XCPA 2ATVA 3DBVO 2K2WA 4Y7DA 5DBOA 1DCKA 1N6NA 2WHYA 1WW8A 2WOOA 2OA0A 3ANSA 1JLLB 4BKOA 3TNDA 1LDBA 3FZGA 3VDRA 5F5XA 2JIDA 3E7DA 2A5GA 2JRCA 8LDHA 1F17A 1PZNA 1BYIA 3GJ5A 3TE6A 1MX9A 1BVHA 3DZGA 2B30A 5JLAA 2PYDA 3HA5A 1PKEA 4N1AA 1VPVA 4JJ4A 5F2NA 2WJ4A 1XCGB 2DHDA 1Q3HA 4JBGA 2JZOA 3R0IA 4M1SA 2WC1A 2OENG 2QRQA 2R60A 1TTPB 4B82A 2B8NA 2DKFA 2YINC 4C7JA 4F96A 1R00A 4II3A 1R66A 2X0RA 3DO5A 4QYXA 1KFCB 2Z6QA 2J48A 2QTBA 2PUAA 2VK8A 1R0YA 4OQDA 2AQHA 3IJ5A 3T1VA 4Z4GA 4XQGA 1QVZA 1RQPA 1UAGA 4GXTA 4GAEA 4C7KA 5C52B 4JV5B 4NYMQ 1Z63A 3KFXA 3CZ5A 4NICA 1ZA1A 3R5SA 3OG9A 2J3EA 2I2CA 1CUAA 1V45E 1E79A 1B41A 2QY6A 2GEUA 1JLSA 3MCWA 2CSXA 3QTBA 2C29D 1DKQA 2IPMA 2NUTB 3N59A 5JS2A 3QENA 4E12A 3QFRA 4PHFA 2XB9A 4P82A 5F1PA 1Z3IX 4M4SA 4TTRA 1DEHA 3A1EA 1P5JA 1YQWA 3MINB 1C3OB 3S0JA 3SXPA 3PXCX 5E9QA 5F1KA 4P0PB 5IAKA 1OZFA 1WAMA 4BJ3A 1ADCA 1J8QA 3BDAA 2HHHB 2JLXA 4J1TC 5BR7A 2MINB 1NWHA 1U7XA 3AUSA 1YVEI 3PXDA 3TE7A 3TXXA 4JB3A 1NVFA 2PLNA 2R1VB 4DNPA 2AOVA 1Q7CA 3KWJA 4GKVA 5IC6A 3ES9A 3MGGA 3QW4B 1XL1A 2HLNA 4JUAA 3DE0X 5C46F 1G5TA 1M1XB 4G8BA 4DC9A 3KUDA 3PL1A 4QA9A 5THKA 4IVRA 2RIRA 4FGZA 5HYVA 1PSDA 3A3YA 3L8DA 1CY4A 3NRBA 4JQCA 1GZ5A 2BGMA 1KMHA 4BO7A 5EWJB 1CJCA 2GF0A 2KYRA 5E1MA 4QKQA 1YCDA 2H1HA 2IZ5A 4RANA 2Z1MA 5JVDA 2OV6A 5JQGF 2HF9A 1I3KA 2HJGA 1YMQA 5FNZA 1BN6A 3FF1A 4B0OA 2OCIA 5JXHA 4X66B 4A1OA 2Q8PA 2Y93A 4NCNA 5EFOA 4YJ2A 1DINA 3C6MA 1FDOA 2BLNA 3CBQA 3D4PA 4GBJA 3PRJA 4O4HB 1HNNA 1XKLA 4LJ6A 5DXJA 3QE0A 5K7SA 5KX5F 5GWXA 2IQ5A 3VAZA 1XRPA 1ZOPA 2BI8A 2CXNA 1F51E 2GILA 3EZLA 4DCOA 3TZCA 2IA5A 2IY8A 3WZLA 2EIHA 4CM7A 4EUHA 2YMPA 1HQYE 3QBEA 4PSVA 3KCQA 4YBZA 2B36A 3TQQA 4NG4A 2PSDA 1ZWKA 3AETA 4XUCA 4DHWA 2VT3A 2XDAA 4P4GA 1OT3A 1U8FO 4NBVA 5CM8B 2ECFA 4AKEA 2IHTA 4JQSA 4WL0A 3GF4A 2RAFA 3QFHA 2C9ZA 3W6OA 3UUEA 3WGZA 3U7QA 4RKEA 3M6LA 5KYXA 1LBIA 3DCJA 2E85A 5KKAA 4C4OA 5LQCA 1T9AA 2DC1A 2B8TA 4E2FA 2LD4A 2IW1A 3VSDA 5ALPA 3OQIB 4KDCA 1TYDE 2JI9A 4MWEA 1HLPA 4PIMA 4ZO6A 3OUUA 1G41A 3I76A 3PVCA 4LBZA 4XXHA 4AZWA 3OE5A 3F74A 3NTLA 1GZVA 1T0BA 3AIOA 1D1SA 1XDWA 2CZGA 3EYAA 4I4CA 5CMLA 4ALNA 4ARZA 2BGWA 1XRLA 3ZOZA 2ONZA 3CKYA 1E1LA 1DOAA 4W8GA 3O2SB 4N0EA 4BO6A 3BDIA 4JYPA 3ND9A 1KIAA 3GAMA 4PLTA 1PI3A 2ZBFA 4XASA 4CKZA 2XXJA 3V1MA 4NXMB 3MQ4A 2C0CA 3FTCA 1XTKA 3QHAA 5JNSA 5DGDA 3W8NA 2ZR7A 2AF4C 1OD6A 4AJEA 1X80B 1RWMA 2ZVJA 3ZW7A 1L4BA 2I2WA 1DRUA 2R96A 2VDUE 3OFND 1Y8RB 3DTVA 3RK4A 3HFSA 3K2IA 1O97C 4PO9A 1XRJA 4JYZA 1YHNA 3KT6A 2QTAA 4LSGA 1GNPA 2VXCA 4DG9A 4OQYA 1J5XA 3M1YA 1U65A 3W5BA 3W7VA 2SBTA 3O47A 2A59A 5DBIA 4PYMA 5JRJA 5L3SB 3WWOA 2HTFA 2F1JA 4P31A 1RVDA 3RVSA 4F3KA 1U2QA 3P4XA 2X9QA 3R5TA 4IIVA 4XD7A 4D97A 5U9CA 1IUKA 1KI6B 3OPQA 4ZXFA 3RVOA 2G9QA 5JXIA 4MB0A 3R74A 4EEKA 1SRRA 1Y3HA 1G5HA 1QOQB 2A0XA 1JFTA 5EWLA 5JQWA 2FUEA 4QPPA 5AT1A 4NEQA 3CV3A 3UT5B 5I4IA 1BE6A 3PNOA 1Z5NA 3ILSA 1L5FA 4A5OA 3HB0A 2V3VA 1BMFD 1J25A 2V65A 2ZIXB 3QG1A 4L76A 4Q93A 4DPKA 5ESXA 5LP6F 4M0DA 4G2NA 3VC1A 3UYLA 3ZE7A 3WFZA 3RNLA 2GHQA 4RSGA 4WY2A 3L8FA 4WE3A 1CB7A 3T3HA 4G1VA 2A0KA 1AKRA 4AI6A 4G1EB 2BEWB 3A9UA 4NNPA 1JSLA 4CIAA 1FFAA 3R6DA 3GAFA 3JU3A 4X1YB 4LEIA 2B4TO 2ZROA 4BNTA 1W6UA 3AVTA 1WV1A