4AN4A

Crystal structure of the glycosyltransferase snogd from streptomyces nogalater
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
380
structure length
357
Chain Sequence
QSMRALFITSPGLSHILPTVPLAQALRALGHEVRYATGGDIRAVAEAGLCAVDVSPGVNYAKLFVPDDTGEGFFAEMFARVSAVAVDGALRTARSWRPDLVVHTPTQGAGPLTAAALQLPCVELPLGPADSEPGLGALIRRAMSKDYERHGVTGEPTGSVRLTTTPPSVEALLPEDRRSPGAWPMRYVPYNGGAVLPDWLPPAAGRRRIAVTLGAKLAPLFSEVADVDAEFVLTLGGGDLALLGELPANVRVVEWIPLGALLETCDAIIHHGGSGTLLTALAAGVPQCVIPHGSDTNRDVLTGLGIGFDAEAGSLGAEQCRRLLDDAGLREAALRVRQEMSEMPPPAETAALVALAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCOSYL TRANSFERASE
publication title Crystal Structure of the Glycosyltransferase Snogd from the Biosynthetic Pathway of the Nogalamycin in Streptomyces Nogalater.
pubmed doi rcsb
source organism Streptomyces nogalater
total genus 104
structure length 357
sequence length 380
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06722 DUF1205 Protein of unknown function (DUF1205)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4an4A02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4an4A01
3TOVA 2XA2A 1XOIA 2GEKA 3H4IA 1XL0A 4EL0A 3NPAA 3MRXA 4EKEA 3C4QA 1WW2A 3MSCA 3S27A 4M60A 3BEOA 3BD6A 2JLBA 4WADA 1FU8A 2BGUA 4RIEA 2HY7A 2X0FA 2XA9A 4PQGA 1FTQA 3G2IA 2G9UA 4REMA 2ZB2A 1FU7A 2VCHA 4RIGA 3UYLA 2AV6A 3Q3IA 4BQFA 7GPBA 1RZUA 5I45A 2QNBA 3RSZA 4BQEA 3IA7A 3WAGA 1UQTA 2X6QA 1NOIA 4WHMA 2AMVA 4BFCA 1AXRA 3MT8A 1PSWA 2FFRA 4EKYA 3VDNB 2G9RA 1NZFA 1VGVA 5GPBA 2FF5A 3CV3A 4RBNA 1F0KA 2F9FA 2PRIA 3IAAA 3COPA 1NZDA 2Q6VA 3OKCA 2OFFA 3TSAA 4Z5XA 1IXYA 2QRQA 3Q3EA 1Y8ZA 1K06A 3C4VA 3G2KA 1UQUA 2C1XA 3MQFA 1WUYA 3S29A 2GEJA 1L5WA 3VUEA 4HLNA 6GPBA 2ATIA 1GPYA 4MICA 3SYRA 3ZCRA 3ZCQA 3MS7A 1KTIA 1Z8DA 2QN8A 2PYIA 3HBMA 3L7AA 4F9FA 4NEQA 2QRMA 2XMPA 3BD7A 5DU2A 1PNVA 4HWGA 1P4HA 3L7CA 1H5UA 4W6QA 1A8IA 1C8KA 2XA1A 2PRJA 4EJ2A 3CUVA 1QKJA 1LWNA 5TVGA 2GJ4A 3UYKA 2XCIA 4RENA 2QLNA 4N3CA 1GFZA 3CUTA 3BCRA 2JZCA 2IYAA 3NP9A 3E3OA 4CDRA 3MTBA 4MI6A 4L22A 5IKPA 3EBOA 1JIUA 3S2UA 2YJNA 2SKCA 3L7DA 1Z6QA 3MS4A 2C4MA 4GZ5A 5ENZA 3PE3A 4X7MA 1SXPA 3QKWA 1Y6GA 4KQ1A 2R4TA 1O6CA 3G2JA 1E4OA 2GPNA 4XIFA 1B4DA 3NAZA 4AY6A 3MBOA 4CTOA 1JEJA 3BCUA 1WV1A 2O6LA 1WW3A 1L5SA 5C1DA 2IW1A 2R66A 2GM9A 4F96A 1NOKA 2QRGA 1ABBA 3E3LA 2QLMA 3G2LA 1J39A 3TAXA 3DZCA 2QN7A 3OTGA 5TMDA 3DD1A 4M7PA 1L7XA 1SXQA 2ECPA 2R4UA 4KQ2A 3NC4A 3OT5A 1JG7A 3H4TA 3HBFA 1GPAA 5D00A 1FTYA 4MI3A 3ZCTA 2ACWA 3GUHA 3ZCUA 2KS6A 3MRTA 4MHOA 1RZVA 4XI9A 2QN9A 2PYDA 3T7DA 1P29A 5D01A 3EBPA 4EL5A 3T3GA 3OKPA 1Y6FA 1L5VA 2ASVA 3D0RA 5LQDA 3GPBA 1L5RA 3S0JA 2X0DA 4G2TA 2F3UA 1EM6A 4RIIA 2R68A 1C3JA 1FC0A 2JJMA 4GYWA 4KQMA 4LDPA 4X7RA 2QRPA 2GT1A 2GPBA 1GZ5A 3VUFA 3MS2A 2IEGA 3NB0A 2X0EA 3DDSA 1FS4A 3CUYA 4RELA 3OY7A 1GGNA 1P4GA 1JIXA 1XL1A 2XGOA 1RRVA 3NCHA 1YA6A 2VG8A 1L5QA 1PN3A 3G2NA 1XV5A 5TMBA 2BFWA 4YI5A 2VSNA 1P4JA 3CEMA 1C8LA 4N3AA 2H1FA 3G2HA 3MTAA 3T3HA 1P2BA 3L79A 2G9VA 3CUWA 1HLFA 2C1ZA 3T5TA 1NOJA 2H1HA 2SKEA 4AMBA 4BQIA 3L7BA 2IEIA 4FKZA 4AY5A 1E1YA 4X6LA 1FU4A 2X6RA 5JTUA 2R60A 4GZ6A 2IUYA 4FZRA 1JIVA 3D1JA 2VSYA 3Q3HA 8GPBA 2BGTA 2F3PA 3E3NA 3C48A 1PYGA 2XGSA 3CEHA 2P6PA 2BISA 3MT9A 1FA9A 2XCUA 3HBJA 4YI3A 2IV3A 1QM5A 2XGMA 1P2DA 1JG6A 1L6IA 4GYYA 1UZUA 4N3BA 1WUTA 3L01A 1K08A 1LWOA 3OTHA 2QN1A 3RHZA 4QLBA 3CX4A 1Z62A 1YGPA 3NP7A 3ZCSA 1FTWA 1Z6PA 1M5RA 3ZCPA 3BDAA 1XC7A 3S28A 1IIRA 3O3CA 3ZCVA 3MT7A 3D0QA 4N9WA 2QLLA 3CEJA 3BD8A 1GPBA 4GPBA 4MHSA 2QN2A 4WACA 1EXVA 4NESA 3WC4A 2C9ZA 2SKDA 4MI9A 3WADA 2ACVA 5JTTA 3MRVA 2QRHA 3HBNA 3SYMA 9GPBA 2F3QA 2PQ6A 3AMVA 2G9QA 5DXFA 2VCEA 3OTIA 4CTNA 5HXAA 2QZSA 4CTMA 3FROA 3MTDA 3OY2A 3BCSA 3OKAA 3VDMA 4RIHA 5IKOA 3RT1A 4LEIA 2WTXA 3PE4A 2AZDA 5BNWA 2GPAA 1BX3A 3QHPA 4AMGA 1F6DA 3T3DA 2FETA 4YUAA 4RIFA 1V4VA 1NLMA 1NVKA 2QN3A 5TMEA 1C50A 1AHPA 3RSCA 3CUUA 4GZ3A 3DDWA 4NC9A 4AN4A 3T3EA 4M83A 1P2GA 4N39A 2IV7A 2IYFA 2F3SA 4MRAA 4X7PA 3T3IA 1XKXA 5DLDA 2AW3A 4F97A 1WV0A 1GG8A
chains in the Genus database with same CATH superfamily
1M34A 2P9GA 3WRXC 2Q49A 2JI9A 4KMOA 3NPAA 4ZZ2A 4LDJA 1BW9A 3TMKA 3EPRA 4X9XA 1XQWA 2DF8A 4DMCA 1H94A 2H8KA 3QEJA 2JNWA 4MV0A 3VR2D 4F72A 2QZ4A 1X70A 1EAYA 1T1IA 3WLPA 3R5XA 3U7EB 3ND8A 2PD3A 1ORDA 2XSZA 1XQ9A 4P3NA 3D6TB 4RHCA 2W2PA 3MSCA 5AM5A 3V6LA 2IKSA 2FWRA 3BEOA 1A88A 4D9CA 1EX6A 1T5TA 3LAWA 2BEWB 5BURA 4YJFB 3AM3A 2O2SA 5A3JA 3ZXYA 4Q21A 3LQ2A 2J6BA 4M3NA 2AQHA 3TLKA 1YVUA 3R0JA 4EJFA 4HPJB 1BDIA 2F1JA 1CP3A 1EXWA 4QU0A 1M6HA 3KAKA 3PXGA 3E9RA 2B8JA 4REMA 4IIDA 4RE6A 3AHHA 5JLAA 2OXTA 4HVLA 4IH4A 2IZ5A 5LXTB 3VR5H 3BCHA 4GH5A 4A92A 3AUXA 1JEOA 1H65A 2P4SA 3A28A 2ORVA 1MO4A 3IRVA 3LVRE 2VCHA 4RVFA 3L8DA 5KB3A 4B47A 5TPZD 3C1TA 3Q5GA 5FLKA 3BBPA 3ACCA 5FWDA 2B4AA 1GHTA 2FW0A 3B1FA 2YJ5A 3SR4A 1C8VB 4MNTA 5LPNA 2GNPA 1VMIA 3L93A 3WKDA 3CKLA 2HUPA 1B26A 4J0DA 3N2NA 3F90A 4KPEC 4OHXA 4GKJB 2Q1UA 2YIDA 4BJ3A 1DPFA 1HZZA 2FFRA 3B60A 4QYTA 2LCIA 4HAIA 1O2DA 1Q95A 2P69A 3GCXA 3PTZA 1WMAA 3H3JA 4J4HA 3VPFA 3VNQA 2A35A 5AM0A 3S8YA 2IYPA 1I7PA 2J3KA 1AS0A 1QIEA 3WQSB 2Q6OA 2X42A 2FF5A 1SH7A 5LQRA 1M2JA 2A0XA 3IAEA 3W6PA 3IR5A 3H87A 4RBNA 1EDZA 1L5NA 2BE7A 3PC3A 4JC8A 3SZUA 1P4SA 4O2LA 3E0XA 4YJ3B 4D6PA 1P2TA 5E0KB 3X43A 3E61A 1Z35A 2V7QA 4Q4JA 1OBVA 3VJKA 3CQ9A 4CVNA 2V58A 1C0EA 1JJBA 1FRVA 4UW9A 1TQHA 2OD9A 1FQWA 2HA0A 5IF3A 3A0UA 1CR4A 3QPVA 1E2LA 3HM2A 1KIAA 3WZMA 2B25A 4I55A 3RYIB 3CNLA 4DR5B 2ZVDA 5CVJA 4AMZA 4BO4A 4KQGA 5JDCA 1SC3A 5GM2A 1Y8ZA 5H3CA 1DZIA 4LRUA 4YRJA 3IVGA 4GWLA 4I1IA 4AF6A 2I8LA 4ENPA 4PZZA 2EQAA 1FSFA 4FS3A 4U8HA 2OOSA 1AC5A 1Z8NA 4C2AA 6YASA 5JNWA 1SCQA 1E1DA 1IZZA 2J6HA 3LD9A 4R2LA 3JQ9A 4E5UA 2GN9A 3WL3A 5KWEA 2I9KA 2C5SA 2Z8ZA 4FR0A 4OXRA 2J3IA 1YNSA 2CNBA 2GTPA 3GY0A 3K15A 4ZRMA 4KN8A 1JIKA 5FIUA 1SM4A 4EI8A 4EY4A 2ODTX 4TKZA 1JIJA 4FYWA 3TAUA 1NXSA 3OCXA 1RLMA 1X7DA 3IX7A 1BWSA 1KI6B 2V0NA 1VB5A 1K7SN 2A6PA 3IP3A 4LDAA 1PNVA 4Z86A 3TOXA 4ETWA 3AR6A 4UCFA 4LPKA 1T9CA 4MKXA 3T35A 1EPUA 4N82A 3IHWA 4OKSA 2POQX 1XTUA 2DUNA 3NYQA 2FPUA 2OBBA 2PXAA 3SQWA 4XWGA 4DT1A 3UMFA 2NV0A 1J4AA 1RAFA 1U0HC 3FCCA 1QE5A 2IU6A 2R8OA 4N5DA 2XQKA 5EZ6B 5I7SA 1M1YA 4ND2A 4GOKA 2O8BB 2ZTHA 1LWNA 3FWHA 4B4UA 1CVLA 3LZCA 5BW5A 4Q3BA 1AHIA 3DULA 2HWWA 3OICA 3D6VA 3I42A 3D5QA 3IP9A 4QULA 2P3OA 4QQNA 4DA0A 1YHYA 3MHPA 3LT5A 5DM1A 4J2TA 3RYHB 4BX0A 5HIKA 1X13A 3IOEA 3NWEA 2CUTA 5BRJA 2VRWA 2BEJA 3L1KA 3FRHA 3KHKA 3N8HA 3BQNB 1YKGA 3MLEA 4U4AA 2IYAA 2ZBPA 2O3QA 3AM1A 4MGHA 1FDUA 4ZAWA 1LU9A 3ZYCA 4URHA 1SJ9A 4L5CA 4EELA 3ZI0A 4DNOA 3CIOA 4ENQA 1Z08A 2F3RA 3N76A 4ARZB 4JIGA 1TYEB 2J09A 4ZV7A 4C20A 3CLTD 3WLIA 2VTBB 1CY8A 2HMYB 4BO2A 2J5RA 2IF0A 1ETHA 5T7BA 1IWOA 3RB8A 1VMDA 1UOPA 3AHDA 3FYSA 4NE7A 3ZLTA 4OCZA 5MGBA 1JLSA 3H42B 2Y0BA 4OUDA 1I51A 4TQ9A 5K4HA 1K8XB 1ONBA 2AOVA 2I33A 3BMCA 2GN1A 2QE6A 4HNSA 3WTCA 3ZE2B 2YV2A 1Q0UA 1AV6A 4BNVA 1GGJA 3WX0A 4QU9A 4WASA 1GKKA 2Q07A 3FPEA 3PDWA 5BV1A 3QXSA 1YUMA 2FW9A 1CKEA 2H48A 2FJ0A 4GLLA 3LUGA 1OIXA 1QONA 4HEQA 5CYOA 5IBRA 1FMLA 3FCYA 3PL1A 4L8WB 3SKVA 4ER7A 1EE2A 3N86A 5AW9A 3ZZ0A 2HQBA 4YAIA 3UFXA 2G1PA 2C5LA 2BJWA 3PG5A 1LY1A 2PS3A 2VXOA 3PFKA 4DANA 4K87A 4M1YA 4NY1A 4BLQA 3GQBB 5D8DA 3JD4A 4B3RB 1XWIA 5ERGB 1NT2A 2F2TA 2ZAOA 5JS6A 1UWVA 2QRVB 1J49A 2PYZA 2O23A 3LLUA 3WWZA 1GT6A 1EVIA 4D4HA 2R6GA 2B5WA 1GPH1 4WZBB 4JMPA 4ZVRA 2RBGA 4QSHA 3NHFA 1QV7A 3I52A 4H0FA 5EVJA 4FIDA 1SBQA 4GFDA 1AH2A 2BTEA 3RF7A 2DQZA 1PV2A 2QLMA 2WVGA 3R7WB 3RADC 3WYNA 2ZAYA 4EHKA 3KSAC 4KR2A 2A7XA 2WAAA 3DD1A 3S68A 1ZR4A 3IAHA 4TKLA 3U3DA 4DTIA 4QT4A 2VPPA 1U2DA 4DR7B 3LSTA 3GT0A 4KQ2A 5JD5A 1M6VA 1IQUA 2J41A 2BIFA 3MB5A 1TF5A 1Q17A 2J4DA 3NNSA 3ZGYA 3QBTA 3P9QA 4E6EA 3O0DA 1EDEA 2AZMA 2H4YA 2AUMA 4YUZA 2BDTA 2FPRA 3K32A 5KCMA 3RVLA 3SC3A 1P1FA 1L4BA 1NMQA 1R6BX 4MK4A 3ZCTA 4BGUA 4FOPA 4H08A 4EHNA 4MWBA 2Q0QA 5HDBB 1FVFA 1O9HA 4UCQA 4E88A 3GUHA 1VHJA 5HF8A 3TZEA 1XAIA 3SSAA 4FW9A 5HCUA 2BGJA 3LX4A 1MOSA 2IBMA 2W6CX 5LJLA 1JYEA 4N9QA 3RSQA 4UTVA 4EL5A 1NQAO 5MN5A 3NIGB 2W48A 3TG8A 3DLHA 4IWYA 1V47A 2OZLA 3HG7A 4LYGA 1QNLA 4ZDKA 4BNWA 1IY0A 2RJOA 3EGCA 5A71A 1FVOA 2ASVA 2UAGA 5YASA 3AY3A 2P8SA 4OAQA 1TLFA 1SU4A 1UZNA 2XQGA 2H2IA 3JVUA 1SIOA 3WIEA 2AMJA 5J5CA 1P7ZA 2V7UA 4ZVLA 2OAGA 1NVBA 4EZBA 2GHTA 5ESDA 4PPNA 4Y6QA 1E1KA 2P3QA 2ZDGA 2RKBA 3O74A 3FBWA 5DTJA 1OWMA 1QH0A 2R1VA 3JQAD 3CA8A 4B87A 3ZHTA 4WY5A 2XCTB 3GNSA 2OHGA 1R74A 4O1HA 4W1PA 2Y1LA 3ZN2A 5IMSA 1KVUA 2VHTA 4G67A 4NYIR 3S7ZA 2INGX 4II3A 4QOFA 3TFQA 4UM9B 3FCSB 1I0IA 1DKOA 1JHXA 2HK6A 2WHQA 4UNNA 3I6YA 1MX9A 1G8MA 5K3SA 3OSZA 4UNQA 2ZTSA 1ODFA 5FWAA 2VDVE 1Q1GA 4YRPA 2FQYA 1BU5A 4KL8S 4YAWA 2I2XB 1KMMA 3Q8XB 3V5NA 3BF7A 4DV4B 2VRNA 1CJMA 3GLRA 3N2YA 3SJAA 3DO5A 5KHAA 2QL5A 1NW9B 1PJ4A 5JMWA 3RIYA 3J81k 1EUCB 3PXDA 1KAOA 1G59A 1XDZA 1RYNA 4DEYA 3Q9SA 1XRRA 4XW2A 4E31A 5AVZA 4Z4CA 1QP4A 4L5BA 5GIOE 4LY0A 5ICSA 3C74A 1Y4AE 4B80A 1PEDA 2HV8A 3FYUA 3IIIA 2YQZA 3RRMA 3M1IA 2PXXA 2GDZA 5JQGA 4BKRA 2CL5A 5FJJA 5EHIA 1O87A 3D8HA 2WFMA 1SY7A 1BMDA 3PGKA 4B7XA 1KFCB 4C22A 4ICIA 4YGXB 5JUWA 4KUHA 4RVDA 1HH4A 1F48A 4OYYA 1DO8A 5JRJA 5K6RA 1P2BA 4NG4A 4UARA 4D0LB 1RIIA 2JH9A 1I5EA 1ADCA 4Z3OA 3ELWA 1M5TA 4L0QA 4Q4DA 4R40A 4WXYB 5AIAA 3B3GA 4HRVA 1OAOC 2PJZA 5E7QA 3WY9A 4BO1A 5JD6A 1LUAA 4DV5B 2FMIA 3HC7A 3KUDA 1UMDB 5CW1A 4PICA 4ESOA 1F51E 1FYEA 3K1YA 2PZLA 4R3WA 5DPMA 4X66B 2Y1WA 1EIZA 1FU4A 2IQ5A 3KQYA 2IGBA 1NJGA 3M2PA 1UADA 1TECE 1VMKA 5IDWA 4UVGA 4WECA 1OF1A 4AYWA 1AD2A 1LK7A 1VKHA 3LU1A 4PSAA 4DQKA 4JI7B 1U7PA 4L4SA 1KOFA 3BMNA 3BH6A 1Z2OX 3W5HA 5H59A 3WGGA 3KU1A 3NIWA 4JUIA 4CQJA 3A1CA 5BWNA 3V9AA 4HLQB 3F47A 3VZRA 5KDOA 1NFFA 1V48A 2QN6A 1T3HA 2WAOA 1WNTA 4K8OA 1K63A 4K9NA 3SOZA 2A0FA 2ZSFA 5KIAA 1B2RA 3KIPA 1HURA 1VKZA 3QVOA 2Q5JA 4JUBA 2VLBA 5KYUA 4D26A 1AE1A 3I6BA 4RJLA 4WAUA 1KYYA 3NKVA 3ROTA 2QROA 4DVJA 5CLFA 2IUSA 4QEKA 3QVKA 3LFTA 4U9UA 5ALRA 3T1VA 4BB0A 4MS4B 2BY4A 1HQCA 3OP1A 3R7NA 3OF5A 2IZ0A 1MOZA 2OCPA 1L6IA 5EJMA 4GYYA 3BERA 4IV5A 5A3QA 4CKCB 4V2UA 2IIQA 1PX2A 2NO7A 1ICIA 2J7PA 3ORSA 4A23A 3F96A 5FH9A 3NOOA 1K08A 2EGGA 3ROPA 4U2EA 2PBZA 4JJ7A 1MMFB 4MA0A 1G6KA 3BREA 1ZVKA 3P2OA 4JY7A 4FGJA 2GAOA 1L6RA 1CRZA 2GF9A 2VF4X 2NSJA 1CNEA 3MGAA 1A1VA 1ILWA 1ONNA 5LYJA 3R7DA 1L7VC 2I3ZA 2VSQA 3ENNA 4CZ2A 1CFJA 2AVDA 2VDKB 1IH8A 3L0IB 4PG5A 4B84A 5GONF 2X6TA 1LBQA 5AM2A 4JLBA 3ZHVA 2XGGA 1IIRA 3WISA 4HNQA 1GLNA 1YZNA 3S1AA 4EG8A 4HO1X 3QF4B 1Z7EA 1XZKA 2D0OB 3OOWA 2B9EA 1VE6A 2F3TA 3C1UA 4EPVA 1GGMA 1LV7A 2I0FA 2G5TA 2QYSA 4R51A 5C2JB 5DN6D 4NESA 4PXAA 2UUOA 5ALHA 3THSA 2CVHA 3B70A 1HE2A 3WADA 1BXGB 3MRVA 1YQWA 3RYFA 3AXSA 4BP9A 2FY8A 1F8FA 3L6DA 2V65A 1OAKA 3OU6A 4R1TA 1TUBB 2IYRA 2NUAA 4Z8YA 2DPLA 4CTNA 5LN1A 1T0IA 3G6WA 4I50F 4IO1A 1A9XB 2QXYA 1EP9A 2QK4A 3QKSB 3I72A 1OR8A 2HF7A 5IKOA 1GAJA 3L0SA 4R98A 2Z43A 3RT1A 3B9RA 3V6MA 4BXOA 1JHAA 3PJDA 1PQYA 2A9KA 3SFVA 1MABA 1WULS 3ASYA 1PBNA 3VOAA 3FOFC 5CA0F 1RCFA 4UULA 3H2ZA 3KTDA 4ID3A 4MB2A 2E37A 3JZDA 4HB2A 1F4PA 3ZBUA 5C8VA 1F6DA 1I7NA 1KI9A 1WPRA 5TRTA 4KOEC 4J0QA 1ZCFA 4TQAA 5A7GA 5DBFA 3N8KA 1TQ2A 4HY3A 4PG8A 2IPAB 4FGKA 4CEJA 3QEOA 1K88A 2X8JB 1KDZA 3GG9A 2XD4A 3CCBA 3CURA 4GYJA 5T4FA 4H27A 2XCOA 3ZUPA 1BS2A 1PJAA 1WHTA 5ARDA 1XD2B 5BQOA 1JL3A 1XTQA 1X7YB 5EG5A 2HK9A 5ARCA 2C5GA 2C92A 2PKQP 4AVYA 1C7ZA 1KS2A 1CUYA 4UZSA 2VJOA 4LJSA 5C3UA 2W6IA 3RAPR 5IC4A 4ZO7A 2WV7A 1KR5A 2C9CA 4BZWA 4ARVA 5FA5A 4LUCA 1Z06A 3AHCA 4E07A 3P9CA 2QX6A 1C7JA 3OT1A 3LECA 3NBYC 4E0BA 3AR4A 4HNUA 4YC7A 3TE7A 5EESA 2IYFA 3WNDA 3Q10A 5FHRA 3N75A 1JYSA 2JJ2D 5ALZA 1AKQA 5AM4A 1GP2A 3I8XA 3GVHA 2CV2A 1RCUA 3D6UA 4OGGA 5JLJA 1LFDB 3LUJA 2KLBA 1OAAA 2YNMA 1SKYE 2KE5A 1BVUA 1E1CB 2QDKA 3KWLA 3H04A 2RGUA 3H4IA 3QYPA 4FMDB 1HQDA 2XVAA 1XL0A 2QA5A 3DZ8A 3R74A 1OTHA 4UUOA 5IUNC 3WLRA 4U39A 3GEBA 2D1FA 4AROA 1NI5A 2Q5OA 5KQLA 2D4HA 4S1TA 3FUUA 1Y4SA 1C41A 4EYGA 4DS3A 4EENA 3ZW7A 3L6BA 2ZU0C 4PXYA 2VHCA 3ONFA 4DZRA 1IRIA 2Q7XA 3R4VA 4E5DA 1QE3A 1VQ1A 2AH5A 3ANLA 4JFRA 1U8YA 2CHUA 1FU8A 5HCNA 3DFKA 3PBKA 4QPDA 4IOMA 3K4QA 5E7JA 2I2WA 3COSA 3H9CA 2QX7A 3HN7A 4H77A 4HX5A 1LK5A 2Q0SA 6PFKA 1XDWA 4OBEA 5IF9A 3MLBA 1KI3A 4MWZA 1HRDA 2G9UA 4MHTA 1CNFA 4OV6B 4RVUA 5H8WA 2PUBA 1B43A 4YPVA 3AJ9A 5CFRA 3K6SA 1FP7A 4I2NA 2FQ1A 1SQ0A 4XB6B 2VHEA 2WJYA 3K2QA 3DO8A 3T3PB 5JCOC 1XVTA 1CDZA 3U4MA 1HX7A 2EOAA 1RHUA 1UBTS 4KWEA 4QEDA 4LF5B 1L5FA 4PIMA 4TV8A 1UKZA 3QWHA 2XT0A 3PV0A 1QDEA 3DBOB 3SIPA 1ILEA 1L1EA 2R86A 2W6JA 2QNBA 5F3RA 1O54A 3JPYA 5CX1B 2OMKA 1GUDA 3B51X 4CMKA 4BQEA 1L5GB 3BHNA 4Z0NA 4EDHA 1ZD1A 1UQTA 2K5UA 3H1AA 2R5NA 3OEYA 4GW3A 3AFNA 3UHOA 1UIMA 4JKYA 2J0EA 4WXPA 1GPUA 3RE1A 4RY2A 3UV6A 4C08A 4ETIA 2PKWA 3D5TA 4ZI2A 4UMDA 1TT5A 2I6QA 3IOMA 1QIHA 1MB4A 4RAOA 4YRMA 4X63A 3U3MA 2I4IA 2O2IA 4G24A 4C4YA 4TWRA 1L4KA 3IYLW 3G8DA 3PEWA 5K0BA 3BTVA 4TXNA 1CUSA 4FQ7A 1YCHA 2BEVB 4M9RA 5B37A 3STVA 3NJRA 1DELA 1MAAA 1D9ZA 1QGDA 1A5BB 4YP7A 3U17A 3DE5X 3M33A 3VVMA 2HK7A 8AT1A 3CBGA 2NV6A 3EVTA 3EZ9A 2ID9A 3O9VA 1BDBA 3O03A 4JC5A 1S2NA 4AZ3B 1EFAA 1DBPA 4XXHA 5BSKA 4PRZA 3J81A 1WDTA 1H9CA 2G17A 4Q9JA 1X80A 2Y1DA 3GA7A 2PMEA 5M34A 1QYXA 3MWJA 2XVZA 4Q05A 1GGEA 5FBKA 1NF9A 3UF0A 4GXTA 3WIUA 1VPLA 3FFXA 2AEEA 5GTDA 5TE9A 1VJCA 5D5PA 2O2DA 3EPKA 1XEAA 2X5NA 2FDRA 1ZUNA 5JEEA 2ZAMA 3CMMA 4M9QA 2E4YA 1HYEA 4OHRA 2YWBA 3EB9A 4J9VA 4BLTA 4M0LA 2NUTA 1K3TA 3F9IA 5JZVA 3LY8A 4DV7B 4H7HA 2HH9A 4ED9A 4L78A 2EZ8A 3GYGA 4AC9A 4YXWD 1NVTA 4DIEA 1ESCA 4QFBA 4MTCA 3CWQA 3SYRA 1A4XA 2FG7C 3VPBA 2Y1GA 4YJ2F 3G79A 3HLYA 1TO6A 1F2TA 3IODA 4QNNA 2B8WA 1PWZA 1L1QA 2HLNA 1KYVA 2IY9A 4RM2A 2OFWA 2L2QA 4G9GA 4GIBA 3L7AA 4XFDA 4F9FA 4Q3EA 4NEQA 4A16A 1YQQA 3P96A 3WKBA 1HT0A 3FUXA 5CFQA 4M7RA 4KPYA 4QVIA 3A1WA 4GPIB 4WSOA 1QTRA 2DZDA 2MSDB 3HUDA 1BWRA 4KQCA 5TARA 1R8SA 3GLIA 1M0TA 1XP8A 1MLDA 1T3TA 2QSYA 2YXPX 5A62A 5BR8B 1XN1A 2YW9A 5CFMA 1SUIA 1OYWA 3C3EA 4KX3A 3AX6A 4D97A 1NI4A 1LSUA 1KYXA 4L4ZA 2Y4NA 3WG9A 4WFIA 2XCIA 4IY1A 1R10A 3OX1A 4GEGA 2F1KA 3LFHA 3LZ6A 4I1RA 4N3CA 4AMUA 4BGDA 2JG3A 2AYYA 3JAKB 1AO3A 3N2LA 2C4NA 5DYNA 2I6FA 1Q0ZA 3KSUA 4YFYA 4JLMA 5K8VA 2AJLI 3D7SA 1T1GA 3DBIA 1P62B 3FI0A 3DAFA 4H31A 4IDNA 2UZIR 1BE6A 4OQPA 5DWQA 5EA2A 2RHGB 1KC3A 2JGKA 4GI5A 4L22A 4WFKA 5HDQA 3KK0A 2VUIB 1TFUA 1ZEMA 3VOBA 4NULA 4F2HA 1CB0A 3T7AA 4HATA 3W2IA 5DNYB 3EUFA 3I12A 5CEEA 1I0ZA 2D54A 4RPIA 3IJ5A 4YAJA 3INNA 3ZPXA 4U6NA 3GRFA 3MS4A 2I1WA 3RFUA 4XIYA 3TTWA 5K0FA 1KK2A 1SC4A 5EZYB 3UK0A 5H80A 2HCBA 3WGHA 2R1ZA 1C4OA 1GT91 2AWOA 3D7NA 3LSYA 3PE3A 1NBIA 1SXPA 2JATA 4GS5A 4RJIA 4HDOB 2NZYA 1GQSA 3O4RA 1E64A 2O9JA 2IZ7A 1GA4A 1SG0A 1YR9A 1SOAA 4KSYA 5KX5A 2DERA 4FMPA 2GPNA 5E6SB 1SN7A 3F4LA 2CKDA 3WTBA 1HBJA 3CF4A 1ATIA 2VP0A 1V3TA 3OLVA 4MS3A 1O5OA 2HGSA 1NATA 4BTEA 1V96A 4UHBA 3DAGA 5COBA 3A9TA 3BRWA 3KX2A 1M2GA 1FUIA 3BCUA 1C0KA 2O3TA 3H9GA 2J32A 3FSGA 3C5WP 5ERYA 3WK8A 5J1SB 4FYIA 1KEEB 3QYFA 1IPEA 3KXIA 1FP1D 5B58T 1GRCA 1H6CA 1JA0A 4XYLA 4TZ6A 1IMOA 2YZNA 4TVKA 3T99A 3OZSA 2I76A 4F96A 1HE1C 2Y68A 1VCIA 4DDTA 3D6JA 3ILVA 2B35A 2JLRA 2QTBA 3AGQA 3GBPA 3JASA 3KEFA 4FFPA 5B57C 1PWXA 3IPLA 2XWJI 4LX0A 5FWYA 4I1PA 4DWOA 3EH2A 4JLKA 4PEVA 3U49A 5JZMA 1OWLA 3KELA 3HCCA 3LPMA 3FA2A 4TWAA 3MC1A 4XB2A 1JG2A 1XHEA 5IM5A 4JXZA 1EKXA 3MMSA 1KO1A 1JHPA 4GO1A 4D3YA 2EKBA 2O50A 3ZDBA 2C9YA 1RBYA 4LYHA 4HQKA 3IVCA 4QO8A 2JFWA 4PPFA 1JAIA 3LC2O 3RTEA 5DMXA 4RKFA 5IAOA 1I6WA 1A9PA 4MV3A 4OQEA 2VQSA 5K4GA 1AO0A 3L6UA 4X91A 1QHHA 1ZMOA 2AQIA 4DCMA 2Z08A 2NVBA 2PYDA 1MP0A 1NJ6A 3NV9A 1JNYA 4UE6A 3I62A 3KXLA 3U5TA 3QMVA 1XZHA 2BFCA 1ZXXA 4QOIA 1RZRD 5A4DA 1I24A 2WJAA 3OKPA 1XXHE 3PQFA 1EK1A 2AXQA 2GXQA 2PIDA 2ZDHA 2J31A 3DLIA 3WVNA 4I1YA 2NP7A 2WU4A 3K96A 2J3HA 5LQDA 4PQRA 4QUBA 2YUIA 3U1VA 3WYAA 2GI4A 2NOAA 5AI4A 1X7ZB 4MV9A 4AY4A 1B6SA 2N46A 4Q9HA 3ZD7A 2G72A 3ET5A 1R6XA 4GR9A 4O1MA 4CR7A 1E94E 4HLCA 3OZRA 3KYCA 2VK4A 1J5PA 4DXHA 1RD4A 2WZDA 4QPNA 2R8EA 2Y4OA 2X0NA 4C5AA 4CF3A 3Q0TA 2PZBA 4IYJA 1YS1X 2HJGA 4AG6A 1T5HX 3ZR4B 5C1PA 3EXIA 1TM3E 3Q8LA 5K0GA 1D2MA 2AHRA 3ESDA 1C4KA 4OVKA 5JARA 1F38A 2QRPA 3SYMA 1XZCA 3C8ZA 4LMAA 3AF5A 3O2JA 2D4AA 3G2MA 3WQQA 1UT8A 2WR8A 4PIPA 2JB9A 4PGHA 3VUFA 4AO8A 4BO7A 3N0XA 5JWRA 4UD2A 4BPBA 3CG4A 4ZVQA 4NK5A 1FFBA 4CT5A 4MVJI 1P72A 3WRXA 2ZVPX 3DDSA 3LV8A 3QVTA 4O33A 4OQYA 4RELA 4QJ3A 4RDXA 3QV2A 2O0JA 2ZRGA 1E9FA 1QHGA 3I9NA 4OOEA 4CM8B 3PQ8A 3R5SA 2I7XA 4PLPA 4M1KA 3I23A 4WOBA 3WWPA 2JFZA 5JCXA 3ILYA 3VNUA 3PLAE 1KXZA 3F5MA 4QXRA 1W48A 3WAJA 2EBHX 3PX7A 1MTZA 4JR2A 4LXGA 3TJMA 4G8CA 3T1TA 1P2UA 3ADPA 1Y7HA 1ANKA 3L8FA 2CHEA 3OD5A 2CDAA 3OPMA 4F8JA 4JL5A 5EKUA 5HZHA 5KNCH 2R6DA 4POOA 5A06A 4PRLA 1UXIA 5HA5A 1SU8A 1RC0A 1CJCA 2CFRA 3HGMA 2WM2A 1FMJA 1Y8QB 1EGAA 1FFDA 4B44A 4AKGA 3CU5A 4WBNB 3CUWA 3RK0A 2AT1A 3OU2A 3S70A 3U4QA 3R77A 2WFLB 3ETHA 4KMRA 1OXKB 4FX2A 3PE6A 4RV5A 3KHUA 3KEQA 3QY9A 1G3QA 4HDSA 4WZ6A 4Q7MB 3ZBQA 4BV3A 3RFXA 3LBAA 2I34A 4X44A 3E8XA 4DPKA 3H18A 5ALWA 3VNSA 5IJ9A 4C7OB 1J1UA 5JTUA 1AXGA 2AL7A 1ZU5A 3I2FA 5BW6B 3IDFA 1EUDB 4XD7A 5IKMA 1QHXA 2G3YA 2VHQA 1JEYA 2PSFA 1A04A 3OG9A 4Y2HA 3K1AA 1SWVA 1EJBA 2GVNA 4X8MA 1CUEA 2BPOA 4X24A 4G1CA 2HU5A 4IRXA 4C29A 2BKLA 1PG2A 3CRRA 4S2EA 4XPIB 3ZNNA 3KE8A 4WKPA 5ALJA 3DL7A 3TQRA 5F5NA 4UFPA 2FLKA 1TEZA 5B5SA 2XGSA 3ED5A 4JYAB 1TADA 4KU4A 4LK2A 5ITZA 4RTRA 1I1QB 4OHOA 5A9SA 3N2EA 1FOEB 4YCBA 2A1UB 2B1QA 3KG2A 4BRSA 1JPVA 3LGXA 5DCUA 3CLKA 1QHSA 2X8WA 3M49A 1FYWA 3ROXA 1GNLA 1KXJA 4EMBA 5K0LA 1P2DA 5LOVA 4YP6A 1WNFA 3GUYA 3OM9A 3VYTB 4PRKA 4LTDA 5B30A 3UMMA 4Q39A 4Y6RA 3V9PA 5FPQA 4E1BA 1J7KA 3M4XA 2OCBA 2JCGA 1BTOA 1CULC 4ND4A 3FKSA 5HQ3B 5B12A 3GXBA 1GYPA 3W3AA 1XVAA 1D2AA 2PV7A 2C61A 1D4AA 1VIAA 1JQBA 2QW8A 3KPYA 1GAQA 2HAEA 4GNKA 4J7XA 2R85A 4GMHA 3I8SA 3K6RA 1GTMA 1XROA 3IO5A 3KZXA 4LDRA 1Z6PA 2QVYX 4NCXA 3BSFA 2DBVO 1JDZA 4P9NA 5J40A 1Q91A 4C05A 3FG9A 4PG6A 3DAPA 3PDJA 3SSNA 3NT2A 3X2FA 1N0IA 1YZQA 2Q0XA 3TGLA 1JAXA 1QAOA 4EUFA 3FPKA 5HF6A 3QU2A 5GIPE 3AFGA 3GCGA 3UOGA 3SQDA 4NJEA 4YMGA 3DXFA 1JZTA 3HCEA 4QUAA 2C9ZA 3DB1A 3PNMA 1G1AA 2BF7A 4FZJA 4I66A 1QTIA 2HSGA 3TCXB 3UT5A 3KOZA 2JLQA 4EFLA 1TEHA 2Q21A 1GG9A 5JCJD 2X7XA 3Q7PA 4FW8A 3WFIA 5ALVA 4RGBA 2OR3A 5BO5A 4NZZA 1LI4A 1UXOA 1XN4A 3HH8A 1TUEA 1FFEA 2DECA 3FNHA 3X2EA 5KYYA 5F5LA 5BQ5A 5EUMA 221PA 2O59A 2B4TO 2MINA 4C89A 1LPSA 2A7QA 4FDMA 4R9NA 3WLMA 4QM6A 4UVHA 5B1IA 3K71B 4D9JA 3IAM6 4LTNA 4D81A 3BIJA 2O0MA 3UK1A 3QOYA 1Z75A 3NASA 3LT4A 4R5MA 2IVFA 2BR3A 3LDFA 4CU5A 2PUAA 1H3FA 1A27A 2JZNA 5JHHB 1IHDA 3HKCA 3DP7A 4FGUA 1TMGE 4HAYA 5LMNB 2FK8A 4AP9A 1JR3A 2X5OA 1G66A 4ROSA 2F00A 3ZGLA 4TL7A 3Q72A 1VCOA 3C41J 4YH1A 1TB4A 1SQGA 3PC2A 4HGPA 2LDXA 1A2KC 1VE3A 2AEJA 4TLLB 4LRYA 3VOSA 4EKIA 4PHHA 1W47A 3C4JA 3F6SA 2F9LA 2LRHA 5D7NA 1E7YA 5AKXA 2JD0A 4MGKR 2SCUB 1IN6A 1EGVB 3L40A 5CTJA 5DXJA 1CDDA 2WZBA 1G2OA 3EXHB 3G7UA 3NT5A 4IZOA 3RFFA 3OLQA 3K9LA 5KJ1A 2Z4SA 3HKDA 1U3TA 2KX7A 5K9ZA 3LHIA 5J5AA 4JLSA 2A9PA 1PHPA 3NYIA 3WK7A 1ZI9A 2I7DA 2BGLA 3C3CA 1XXHA 3M5PA 3VSDA 4HADA 3JS5A 1IM5A 1KEUA 4AK9A 2QGNA 4Z1MD 1JZSA 5C7OO 1Q16A 4V2IA 2QL6A 4FMCB 4H15A 1PNQA 4L0DA 4P0TA 2G6BA 2ZJ5A 3MW8A 1L7EA 2XECA 1UXHA 1XKXA 2VTEA 3BJIC 4IQ8A 4WEOA 4XD2A 3BDVA 1XJCA 2NUPB 1MAHA 3ISTA 5G4KA 1OV6A 5LA6B 5JXIA 2E5FA 1NNI1 4JOBA 1YAHA 4ITVA 3BFVA 4L2IA 2AYZA 2GO7A 2W98A 4DSTA 3QPAA 3MRXA 1RPTA 2ZQZA 2RKOA 4G09A 4YQEA 4PGMA 4BVLA 2CMGA 4Q12A 2OEPA 1I3NA 4LSMA 4MVXA 1CWUA 2FPKA 2ORED 3E27A 2J3JA 1L7DA 3OC0A 2FW6A 1NULA 4HTFB 4WK6A 5AICA 2NZJA 3C4QA 1U1IA 1J5XA 1CF9A 4GI2A 5EERA 2IEZA 2NAPA 4ZI7F 1WW2A 1OYYA 2QPLA 3QIVA 2FDCA 4AWBA 2FN4A 2YXBA 3NBZC 4LF6B 3ES9A 1A97A 1I36A 3ND5A 4KAAA 4YRZA 4MEBA 3BD6A 1QMPA 2JKZA 2P2NA 3JALA 3E9MA 4KXLA 4YRNA 1SKBA 3CZ5A 3RBZA 1Z74A 1H4VB 3EYAA 2Z5GA 3F8SA 5K5EA 4IPTA 5BWMA 5DGCA 1A1SA 3ELDA 2GVZC 5KSOA 1VKJA 2O57A 1JLLA 2G70A 5LZ8A 3R3YA 4W63A 1V4NA 4EPTA 5BUSA 5C8DA 3A9SA 3MCAA 4KWIA 3VX4A 3I9MA 3Q5DA 4EHBA 1PR2A 1UK7A 3FHJA 3A2KA 2HO5A 2JLWA 1JSXA 1W9HA 3KB8A 3D6NB 3EVBA 1ACMA 4GT1A 3I32A 1Y4UA 3LY5A 3UTDA 2NO6A 1QK3A 3G8CA 4C03A 5DISB 2V3WA 3ZZMA 4Y1GA 3JAMA 5D3MB 4BQFA 5DYWA 1OFHA 2WIDA 3VSAA 4MCIA 3H84A 4JQCA 4PCLA 1XGKA 3UUWA 3KQLA 2GBFA 4OI1A 2P9BA 3WB9A 2VHYA 1TJNA 1ZLYA 1RWMA 4IDBA 4JJ8A 4TLEA 3WA6A 5FLXA 3C3XA 2X5XA 4XGNA 2GJ8A 3IEXA 3TNJA 5EJ7A 2OG1A 1SD5A 3U81A 4HKTA 5GVRA 4BFCA 1U90A 1ZSNA 4B3FX 2QE7A 5BR1A 2ZUTA 4X20A 2XB2A 2XTJA 3JATB 4DQVA 2MJLA 3HVIA 3H1BA 1EX1A 4GBED 5EEGA 1DP4A 4P7JA 5F2NA 1RMTA 4UCWA 3FCXA 3OI7A 5KNDH 1MX1A 5LFAA 4RZXA 4ETMA 5JBQA 5K0EA 4XCXA 2FRXA 3BFJA 3PQ7A 4L28A 1VIVA 4W1SA 2QQEA 1P0MA 5GPBA 4BIIA 4I4TB 4XYGA 3ZS8A 5EWMB 4DLWA 4BCCA 4HD8A 3L6RA 4KO1S 4LYYA 3AI1A 1PP4A 3F1KA 4WXMA 2C0CA 5BSRA 3AR8A 1JI0A 2PH7A 2P9QA 1T1EA 2OHIA 4UBLA 3UAOA 1QZXA 1JSCA 3PUWA 2F1OA 2HLDD 4NONA 3O8BA 3T06B 3EY4A 5A5GA 5JAPA 3G17A 1SULA 4V0OA 2ZUVA 4FOLA 2J30A 2VSXA 3IVXA 1J06A 2FZ4A 5CEFA 1RWQA 1GOTA 1ACLA 3E2IA 1NI3A 2WVHA 4L0MA 1XRSB 2P6RA 2ZT6A 1I8TA 5DTRA 3JR3A 3B7PA 3EN0A 3ELUA 4BO3A 3KWJA 4HS4A 1FB5A 1SUPA 4K9LA 4KUGA 2C1XA 5AR1A 3SBEA 2C94A 3T1HB 2IH5A 1KRHA 5G0WA 4BP3A 4YAEA 1RJ9A 1IVNA 4MLPA 5E1MA 1FLAA 2UXDB 2XDYA 5FFFA 4B35A 1FVHA 4JI5B 3F6BX 3COZA 3DA8A 3AT1A 4GM0A 3HS3A 4H7IA 3TZBA 3M82A 2QMOA 2KWIA 1KU6A 3ZCQA 4KODA 4EJSB 1J2RA 1BH2A 3GLHB 2ODNA 1Z8DA 2WTUA 1UBCA 1T2EA 4BVHA 2WSSD 3GH1A 3HBMA 2VSOA 3V55A 2P5UA 1JW9B 1KIMA 1N2SA 4JDUA 2EZUA 3O8RA 5BNZA 4A2WA 5HX7A 3BD7A 2ATEA 5JANA 2JCSA 3IVMA 1NP6A 1I4WA 2C20A 2PL3A 4LZNA 4QUIA 1O8BA 3JZIA 3PD1A 3P9RA 4LF8B 2ZVJA 5DLEA 3HNRA 3P26A 3I01M 4IEFB 1SOWA 4LDZA 4V0SA 3O8OB 5BN4A 1DKPA 3GAZA 1G5PA 2EFJA 3HP4A 4FYKA 4J9UE 4QBHA 1J70A 5FI1B 5GV8A 1HT1E 4BUCA 1RXCA 3OHPA 4OB8A 2HQSA 3RVSA 2G04A 3RVOA 1OAOA 1PEKE 2NT3A 2Q28A 4NNOA 3W34A 3ZOKA 5HW0A 5K01A 4RQBA 4QOSA 3RI3A 2I80A 3KKMA 2XR1A 4EI2A 5CVTA 3RAFC 3TD6A 2V7XA 2X1LA 2ZYRA 3I2KA 2A86A 3M6XA 3OWOA 1KDVA 4NLLA 3DLTA 1H2BA 1QF9A 1RTKA 2HRCA 1B8UA 3WRYC 4RZHA 5AVUA 4XRGA 1LD3A 1SQSA 2A4MA 2Z8YA 3NTVA 3MWEB 1N5IA 4J0IA 2A4KA 2V9ZA 1NVXQ 4J8PA 1N1DA 4UXJA 4WK0B 5IDXA 1EDOA 2HFKA 2VUUA 1PGPA 3AEYA 3N2KB 2BD0A 3P9ZA 2DWOA 4GZ5A 1AGYA 2VUSA 3SJCA 4YMVA 5HE9A 2NQ2C 3IMFA 5DXAA 5CDTA 5AK5A 3D4IA 3VC7A 2LCFA 2LKDA 4AX4A 2UVPB 3HVJA 4HK4A 3EIOA 1Y6GA 1O6GA 1RJDA 3JRXA 3WO0A 4IMJB 4DA6A 2WG0A 1RQXA 4WKOA 4RCVA 3TQOA 1CZUA 3GUZA 3KRTA 2C7BA 3PT9A 3DFFA 3M9LA 4Q4AB 3RUIA 1U8CB 2R1TB 3EGEA 4G1EB 5DM4A 3ZY5A 4E3WA 3E9EA 4HDAA 2NG1A 2V8BA 1S8FA 1CHNA 1AB6A 3FTNA 4JJFA 1AUVA 3F6CA 4GQIA 3M6UA 4LSWA 1QC5A 1SUWA 2JGLA 2IP2A 2X4DA 3LHKA 1J99A 4J4TA 4LYJA 1UMCB 4EB8A 1YU6A 3AVUA 1XVIA 3PWZA 2IYWA 3W2EA 1YQGA 3GBVA 1HFKA 5AXDA 5IN5A 1ZINA 4DCPA 5BXYA 3UJHA 3GMIA 3OLCX 5HIJA 1IZ9A 3A4TA 3EQZA 2QX9A 3ZIAD 2YMPA 3B36A 4OLAA 1DKMA 2HU8A 2O3JA 1U6JA 3GB9A 4F4CA 1H2WA 1O57A 3GDHA 3CG0A 3DZFA 3QVGA 4NBKA 2V3VA 4BKMA 1SBCA 4MQUA 4LGYA 4MR7A 5ADHA 5FEUA 2WMOB 4KIWA 3PUJA 3LKZA 2DSTA 2RGCA 4Z9FA 5E4TA 4U2BA 2AC7A 4IILA 5FPPA 4B9AA 1WXFA 4QTYA 1KQNA 1JVSA 1NW3A 4CEIA 1R7RA 4EHAA 2JFVA 3NC4A 3QF7A 2E6KA 3HV2A 4MWSA 3T5AA 4LYAA 3I0MA 2VEOA 3O0TA 1OTXA 4MWGA 4ZPJA 5EMLA 2C7VA 4YLGA 2PFSA 2JFXA 1Q84A 5EUQB 4NK4A 4C0LA 1QLHA 5IJWA 5CDFA 1YA8A 1R4NB 3U9LA 3BIWA 2E2WA 2GTIA 1RLIA 3JQBC 1RXUA 2ZRAA 3EEQA 4X41A 3DE6X 1ISIA 4UTNA 3IUYA 5GOTA 2XUFA 2X40A 5A7FA 1X7WA 4AYXA 4MRSA 1AF4A 2EWMA 4QNRA 1JN0A 3CNEA 4GOJA 1I2BA 4BNIA 2RHBA 2QLBA 4JB8A 5BSVA 5J2UF 4WOCA 5C18A 3KPVA 3UNXA 2I6GA 1L5VA 1Y6RA 4R68A 2XMQA 2Y1XA 1USGA 2HI0A 2OILA 2UUBB 5FPHA 5KYKA 3X2SA 3L8MA 3EGDA 3SC6A 5BT8A 5K8JB 1QORA 2Z3WA 1UQRA 4US2R 1OLSA 3IQDB 1EM6A 1UKEA 2D2EA 4OHUA 1Y6QA 2AOUA 3HZOA 3S3TA 1OPXA 4RQAA 2O4CA 2EKZA 2BM1A 2V6JA 2YZ7A 4NU6A 4XSVA 4Y9UA 1HFEL 2RGNC 3RWMB 3LL4A 4EB0A 1O94C 2AFIE 2HHLA 3OHSX 3W78A 5P21A 3IR7A 3B1KA 2FZVA 3HRHA 1X0VA 2BFEB 1YR6A 4J0FA 4J94A 4QYIA 3WJ2A 5DT2A 1M6YA 4A10A 1AT1A 4E14A 3UBTA 4GYWA 4LDPA 2C4TA 2IE8A 4INOA 4X7RA 4F1WA 3ZVNA 4CUKA 1X1TA 3KOUA 4HWTA 1Q0RA 2IX9A 4Y8VA 3JU3A 1TAUA 1E5LA 1OREA 2GPBA 4TTAA 2CJWB 1Y3CE 2ZRQA 3STHA 3SI7A 1S7GA 1FDSA 2LP4Y 1L1FA 3ROZA 2WBLC 5E6RB 3DCJA 3NAQA 5BSUA 1PZXA 4KEAA 3IKTA 4EQ6B 4C7JA 1GGNA 1JIXA 2OLKA 2XGOA 3DFMA 5GADl 2GR9A 2QVLA 4Y0VA 5EC8A 3M4NA 4TZKA 3RSOA 1KKLA 2ZI9A 3FWPA 2TS1A 2COKA 1L5QA 3BGIA 3I4LA 4WA7A 5ER6A 1SHKA 1W88B 3OLYA 3RS9A 1XV5A 3PD7A 2A59A 1SUEA 1R9NA 2JBAA 4P8RA 2ZRLA 5K4AA 1ZZGA 2Z9DA 3I5MA 3JRWA 4DF3A 1Z0KA 2X3UA 1SCBA 2G0AA 4B74A 1YRLA 3C5VA 3QNUA 1QGUA 3Q85A 2FW7A 3WKAA 3V1KA 2WDPA 2ZJ8A 3BXHA 1IEVA 2I4OA 3QK7A 4UUNA 3EOAI 4E3ZA 4XJSA 2JASA 1NGSA 1J22A 1TGVA 5L7WA 1Q1QA 2VJAA 5DHSA 5ITSA 3BK7A 2CLFB 3HFRA 1YBMA 2HF8A 4JC0A 4PFKA 3ZZTA 1D6NA 2ZYTX 2FZKA 3G0IA 5E6UB 5DHAA 3PNPA 2C8JA 4F71A 4P93A 2CZCA 1JQEA 1P80A 2IEIA 1BX1A 1ZKDA 3UWSA 3IUMA 1ZM4A 2NZ2A 4L6CA 5JCOA 3NHPA 2G07A 4DYDA 4DSUA 3O8CA 3V1MA 1XWWA 1U8AA 2N47A 2BBWA 4X00A 1O4WA 4AJEA 4C0WA 3ZHQA 5KOHA 1YDFA 3IR6A 4YREA 4AT1A 1JIVA 1EEHA 2G77B 3LUKA 5AQEA 1JR6A 3Q3HA 4B76A 1RVDA 3PKJA 5C37A 1JHOA 4RXTA 2A5YB 1Y4ZA 1DI0A 3FCUB 3TH5A 5G3ZA 3TTYA 2P6MA 1J09A 1GPWB 3AESA 3MYYA 4TWJA 3C48A 1M66A 4YRTA 4BVKA 2XZTA 1LNQA 1YI8A 2W6NA 3X1ZA 3RU3A 3WBFA 1O96A 1CXZA 3D8SA 4EA9A 3K9WA 2ERCA 3G9ZA 2NIPA 3HY6A 1KMQA 4TTQA 2OV1A 4ZO9A 5FI5A 4WOJA 4A6DA 4DAEA 5JALA 5HRUA 2HYDA 4P3PA 2G36A 1Q3KA 1KI4A 4DAOA 4AZWA 4YHHB 3RTDA 1Z6TA 3V8MA 2EBUA 4KQIA 4KRXA 1MQ8B 3DB2A 2PZEA 4I8DA 4TLMB 4WVFA 3UG7A 4F21A 1PZGA 1AQLA 1G7RA 3MK31 1ESZA 4N3BA 4R69A 3ZDYB 3T1YB 3EBLA 5BYKA 1A96A 4OB6A 3SEZA 7ADHA 5TJ9A 3IXQA 4OXQA 1AQYA 4N18A 1ECCA 2P9TA 3CRNA 3QWBA 4QZVA 1XTKA 2RMKA 1XNQB 3OOJA 5JJ5A 1Q5PA 3UB4A 2PFKA 1M1NB 2Y76A 3IFSA 4JL8A 4M1MA 3GK3A 3KEGA 3L7LA 3VX3A 3KTOA 4D8XA 1SCKA 2N9UA 2PGNA 3QW4B 1SD2A 4RF3A 1UMKA 5A9TA 4DIBA 3UXMA 4LRWA 3ZCPA 5CH8A 1DCKA 3C14C 3SNKA 3BDAA 2A3RA 4UOZA 2HLHA 3HHPA 5CTAA 3Q8MA 5BMVF 3IO3A 5C52B 1H8EA 2JIMA 1XTBA 2NXCA 2VQ6A 2I5PO 1BEZA 4IIJA 2O7QA 3OU7A 3OJCA 1ZUWA 2VDWB 3DEYX 3FDZA 2QJFA 2YWCA 1R6AA 1XMJA 2IYXA 2WJPA 4JNKA 4LZWA 3FDJA 1BGVA 2W2KB 3R8XA 1Y1KE 2I6TA 5DP1A 6REQB 2NYRA 5AVJA 1TU0A 2V9PA 2WJVA 2G6TA 3STUA 1B7GO 3GVIA 1H4TA 1OT3A 3RSLA 1ZM2A 5JYEA 4YFVA 1NMEA 1QG2A 3A6LA 3WKCA 4IV8A 5BQFA 2NAFA 5EIBC 2VCEA 1VP9A 2ZT8A 5FV4A 2JPDA 2X4IA 1EESA 1FLVA 3OMXA 2GZ3A 4J1SA 3BCSA 4WN9A 1KY3A 3C2QA 3VDMA 1B3RA 4B3BA 4GI3A 1JKJB 4K9PA 3O21A 4TN5A 4XGIA 1R9GA 1JI3A 2BI8A 3PFGA 1SO8A 2IZ6A 1G4UR 2I66A 1LS1A 3KVNA 1PUXA 1QQ6A 3JQ8A 4L4RA 3RFTA 3WL6A 5KAPA 1YKSA 1PS9A 2J9ZB 4PHTA 4KXFB 4WCDA 1U4SA 3CS3A 1MCZA 3MWLA 4J0HA 3SVLA 5FOXA 3U4DA 1W4AA 1G2QA 5B1HA 2C7OA 4A27A 2ZB8A 3I2YX 3G0CA 1IZYA 4D9BA 1QH1B 5IFLA 3QOWA 3ESAA 1UPTA 5IVIA 3BD9A 1R00A 5JVDB 5A7HA 3AERA 4RK7A 5AW5A 3Q7EA 1A5AB 3ZBTA 3X0DA 1QH9A 1IB6A 4GMKA 5IJZA 1F7VA 3EZLA 3FF1A 4CLEA 5GZ3A 1NVKA 5DCLA 3HJRA 4UMEA 5AVOA 2FQXA 3WK4A 3ENVA 2YW2A 4B0PA 1M2WA 4BNLA 3O1IC 5AHOA 1PS8A 1X74A 3EXAA 3NM4A 5EZSA 3WJ7A 3AEZA 1W59A 2VPIA 3PDIB 4HYQA 1LDBA 5TQJA 5LUAA 2FR1A 3GEHA 5HYVA 4NYMQ 4M9UA 3QE4A 1YI0A 4P0PB 4HWKA 1PUJA 4MUAA 2I54A 4H18A 4K40A 4RPLA 5TPWB 4QX6A 4YAFA 4EO9A 2EZ9A 3T3IA 5CD9A 1YFZA 5CH5A 2PS0A 2PUWA 3V1TC 1MBZA 2DU8A 3HSKA 1D4ZA 1K66A 2D3WA 1GZUA 3MCUA 5KUTA 2AE1A 3CF0A 4UQPA 3X1KA 2ADMA 4OI4A 4BVGA 3L1IA 3W6NA 1VI2A 1KO7A 1WQ3A 2HA3A 4EUEA 4YXFA 1FFXB 3QLUC 1YZLA 4L5JA 3MTEA 2ZFUA 4GX0A 3C70A 1HC7A 5ESXA 1ZNQO 1J9ZA 3ABIA 3A3PA 4P84A 1HRKA 1XZIA 1AUQA 5CEJA 2IFTA 3ROEA 2JAXA 1TTTA 3UJ6A 3NATA 3BUSA 2P9ZA 2Z98A 4AS3A 4JI0B 3CRMA 3RJMA 2HSDA 2HCFA 2OCDA 2X19A 4LXQA 1QYCA 3QP9A 3KZOA 1VI5A 1I6MA 4HOYA 5C0OE 1GRNA 1NNUA 3NEPX 4HQFA 3TBHA 1BMFA 2XYVA 5L3QB 3E4CA 5LBUA 4YN3A 2EJVA 2ZEJA 3EUAA 3RVDA 3WBKA 2HY7A 2XA9A 1YE5A 3PPWA 1YOVA 3PITA 1I3CA 3CPEA 4ARCA 3P52A 2ZIVB 2A2ZA 3T4PA 1T3GA 5CLQA 1KY5A 2PX6A 1WKCA 4PLYA 3WGOA 1P0QA 1P1RA 3N3BC 3ZLUA 5FPYA 1VBMA 5A2QA 3VV3A 3KSDO 2Q3HA 1MO5A 4UEWA 4RIGA 3N8GA 2Y8EA 2W0MA 2AV6A 5DIZA 1Y3HA 3ZVRA 4WKGA 3QELA 2CXHA 4AKHA 1J9EA 5JDIC 3OP4A 5EHQA 2GEBA 3JARB 2XB6A 2DKOA 2E1PA 4W99A 3A2MA 1IQPA 1P3Y1 4KRGA 1F0YA 1ZMBA 4MQLA 1RKXA 5E9WA 2F1IA 3W6ZA 1HE8B 4ZVVA 4JXJA 4R6XA 1BX0A 4IQ4A 1FUEA 4OU4A 4OBBA 1RVV1 3UKDA 1T9BA 4O8CA 4AKTA 1I6LA 5J4HA 2WD7B 4WZBE 2CY0A 5H70A 4J0EA 2QRJA 3DBRB 1QS0A 3BGOS 3CLSD 3RSFA 3R9XA 4Q1BA 2PZAA 3U7JA 2YZGA 4XLTA 4YNBA 4EMUA 5DM2A 4RTMA 4HDKA 1T43A 4KQJA 4X1OA 4HB0A 2ZI7A 1UDRA 3L8CA 4MPDA 3DKKA 1V3VA 3MSXA 1NVEA 3HEAA 1CEYA 2KSQA 1WD7A 3NKFA 4I3GA 1P2VA 1RXWA 1JHRA 1XG5A 1DIHA 1GNQA 4AO6A 3BXOA 3QTLA 3HBAA 4Y6GB 4BEVA 4AQDA 2FWAA 4CCYA 2XLBA 4NCKA 1RKBA 2F9FA 2PQMA 4PPGA 3A6PC 1QX3A 5ESRA 4OA5A 1W4LA 1H1DA 3P27A 1H42A 3A4MA 4G5OA 3VO2A 1NZDA 2EW2A 5DHQA 5AJXA 4C0KA 3N0VA 3I1FA 3Q3JB 3UO8B 3TSAA 5LQCA 4DB4A 4F6RB 1G4HA 3HMKA 1BD3A 3KT8A 3A27A 1DRJA 3AQ4A 4D8WA 2QRQA 3V7NA 3TGPA 1U2ZA 2IYLD 2XVMA 1FYVA 4MQFA 1N0HA 3E22B 4BWGA 1S5PA 3PIRA 3OE7A 4OAPA 4AZ0A 5IAJA 5EEHA 3HA3A 3A6GA 4M49A 4B6OA 1N7IA 5F76A 2AUNA 3M70A 1K6EA 2OGUA 4LNUA 1X77A 4NZ9A 1IBRA 2XXAB 1GLVA 1RM5A 2Z1DA 3EFEA 3QXCA 4GAEA 1QYWA 3Q5EA 4R4JA 4KR7A 3O82A 5WRFA 2ATIA 1OGJA 3RTGA 1F4VA 3NDBB 1L4MA 3LBHA 3SF0A 1PJ2A 4EY5A 4FD2A 2A9VA 2O7NA 4UJ5A 4M0DA 5KNBA 2NSDA 2O8DA 1RYHA 3QBJA 5FA6A 1BA3A 1XXLA 1F3LA 1LRKA 2YY7A 3U19A 4JJKA 3HI4A 3T9FA 3LCRA 3GDOA 4R54A 1W5AA 2XEXA 5HP4A 4NOMA 3BH7A 3L77A 2WMNB 2AZ4A 2KLHA 4WV3A 2H5EA 3F5SA 4JDPA 1G0OA 1IB0A 1XHFA 1VA5A 1SZDA 4X0EA 1PFUA 2B1RA 1NX6A 1XRLA 4WFQA 1H8HD 4RC9A 1T9HA 2OO3A 3DL0A 3CUVA 1RI3A 4B7AA 2OXFA 4BWVA 1DX9A 3BICA 1JDUA 1JFFB 4C3UA 5B3JC 3C3JA 4G01B 2FWNA 2VBIA 2FEAA 4P5EA 5KKNB 4QPPA 2HPHA 4RL4A 4RENA 2ZIXB 1JR2A 3ZY4A 2PX3A 4HQLA 1BGWA 2JZCA 4BZXA 3SXUB 4ZK2A 3UN1A 1U0GA 1IOLA 3V42A 4Z4EA 3I83A 5FTMA 2WQZA 5AXCA 1DFHA 4PX2A 1TQDA 3KBBA 5F12A 5GMOA 1ZA2A 3K0FB 5KDDA 1TYBE 1Y82A 2YOGA 2A5JA 2HUNA 2OHVA 1WCIB 1Z4OA 2WTEA 4CDRA 1AKTA 4NZMA 2IYNA 2K7FA 1Z25A 2LCQA 2BJHA 1XCBA 4FGWA 3LYUA 4QJIA 3BJZA 3VH2A 4K2HA 3SZ3A 4PC7A 1CQJA 1X7HA 2XNHA 4LRXA 4MPRA 5HE8A 4CQMA 3U48A 1N57A 3CGGA 2R8BA 2BCJQ 4INPA 3N1UA 4M37A 1C7QA 2WAMA 3GLGA 1DZ3A 2IW3A 4H3SA 4YQFA 4RGQA 4FB4A 3DE0X 1XRPA 4JOSA 2B37A 4DC1A 2APJA 1QP8A 3FWZA 4E1AA 4MMXB 3CZAA 2GHRA 4HH1A 4K81B 2VNIA 3RREA 4H7JA 5EI5A 3U3ZA 4HVTA 3AEQA 1ECFA 1WXIA 3DV0B 3GLKA 3VR5A 4DYHA 4MGZR 1V1RB 5EWJB 2GKOA 4FHDA 5KTSA 1UBLS 3R44A 2DETA 1IAQA 2QTVA 5CURA 2C7PA 4AY6A 2ZIAA 1Z5GA 1XVUA 2Q5EA 1ZH8A 1UBFA 3G0GA 1SVLA 3ZWDA 1EP1B 2NN3C 2X22A 1IN1A 1D6JA 1E4EA 3V1UA 1OX4B 2B2NA 1SXHA 1CUJA 1PJLA 4LZOA 1MG5A 2W83A 4OQNA 4L4UA 2P2CA 4KWTA 3LPCA 5FBWB 5DKFA 1Z83A 2Z3ZA 5EP2A 4DA8A 2R44A 1BVHA 4ENTA 1O0BA 1MHPA 2R8ZA 2ET6A 3B1ZA 5EE3A 2O5EA 2HX1A 4ZCMA 1ZHFA 1CQIA 2PO5A 4I99A 1RYDA 2ODEA 3EXHC 3LC7O 4QT0A 2RCNA 3RFCA 3X44A 3OQMA 4Q4LA 3ZKWA 4WKNA 1JG4A 1UWLA 3A7EA 3L6CA 3FAZA 2MSWA 3EXG1 1Q1NA 4IF4A 3G2QA 4LQ4A 1SXQA 1EHIA 3HXKA 3F3KA 5IHPA 4C4XA 3OIDA 3QVJA 3ZEAA 1SRRA 3X1XA 3DTVA 1MPTA 1N25A 4Y6SA 4ACBA 2QY6A 2GFQA 1RWOA 1R12A 2FPGB 4MW4A 3LVFO 1TVEA 2KS6A 3NUQA 3L02A 3A1SA 3AR3A 1N2JA 1RZVA 3RODA 3A70A 3KOYA 3UJ7A 1IE3A 1WKBA 3SX4A 4ALMA 3N87A 1L3CA 4FE3A 1FXUA 1VYVA 3PUYA 1Z88A 4JI6B 4MOWA 2FKNA 3DONA 1S3FA 2RK6A 4RYLA 4G1VA 4N6GA 2RH8A 3B48A 4JP1A 3NHYA 3DHEA 4WLEA 3BWEA 4CEHA 2WFAA 3DC2A 1N9GB 4GWGA 3FF4A 3K0EA 4NMLA 3SLGA 4YBRA 4X1KB 1BDJA 3ZEIA 4WESB 4ZIRB 1T0JB 5G0UA 4PBSA 2OQVA 3COWA 3G13A 2FSUA 5FORA 3ETCA 1QKKA 3UT6A 5C5CA 3QXGA 4ND5A 4ZHQB 1SBHA 1WUHS 5IRCD 1WMSA 1G3RA 1KPHA 3WYGA 5FADA 1V7ZA 1L4LA 1OLUB 3GJTA 5CNJA 1M34B 3PQ4A 3M5WA 1Y8CA 4DY6A 3LUHA 2FEKA 2HDNB 2Y9PB 1ZLXA 3AY7A 2BUCA 3C45A 3MERA 4RHXA 4ESHA 1BW9B 1SXJD 4IXMA 3GRVA 2N1BA 2H00A 4ZT2A 3ZHYA 1GZSA 4X84A 1E8DA 4GMDA 1QRRA 2V7TA 3H5OA 3CUKA 4JWTA 4QTZA 1AA6A 4YVFA 1U3FA 3NBAA 4IQFA 2XYHA 1KVRA 5IBQA 3GPIA 1NDHA 2JARA 3WBJA 4X6XA 3ZJYA 5CG1A 1W36C 3I76A 4GMGA 1LC0A 4DXDA 2XSZD 1KMHA 2ZJFA 1IONA 3OPQA 1KU0A 3T7RA 1E3TA 4MCAA 5DX0A 5HKLA 4A0QA 4O4JF 1WKVA 4MVJD 3IV7A 3LCVB 1RPNA 5DP2A 1Z47A 4LI0A 5J1TB 3SHTA 4CYMA 1ZOIA 2RAVA 5AOCA 2FGKA 1US8A 2KBFA 5A4FS 1HDYA 1UAYA 5EMJA 4C06A 3ZLJA 3N39C 3TNDA 5I7VA 3HK2A 2C84A 3SXPA 4W9NC 2GM5A 2VPXA 5AJTA 1T9KA 1ECGA 5E95A 3FPHA 3FPGA 4X3CA 3S2FA 3QBVA 3H6KA 2PFGA 1PR5A 4OK6A 4S0ZA 3RTCA 3SDBA 2MWMA 3N0RA 1RADA 1XJ0A 4TLBA 2IXFA 2EATA 5JO9A 4F4UA 1UK6A 3ADOA 5FUBA 4P4TA 2XHEA 1QCDA 4UTXA 1M5UA 1Z2DA 3G2HA 4ZZ1A 3BQMB 3SJUA 3LUFA 4A0SA 4G3XA 4K9RA 3SYNA 1ZX1A 2G9VA 1E61A 2H16A 1E66A 2RHHA 1T9ZA 2YHBA 5T8KC 4GRIA 2VQ3A 2XIQA 4QXMA 4PFSA 4FKZA 2IHZA 2IQIA 4HQNA 1SPBS 4F2PA 5K6AC 3C6XA 2ZJ7A 1II0A 1II8B 2BM0A 5HFAA 1GZVA 2PGJA 1LSOA 4EG6A 2JGNA 4LHYA 5ELMA 1QFXA 3A10A 3RS2A 4KFCA 1NE2A 3CUEF 3D1JA 5ITVA 5CNMA 2I6UA 2AA3A 3GJ0A 1T25A 4O1IA 2XUAA 3MGBA 4EEXA 1DWQA 2C95A 2R7NA 1XEWY 2EWWA 4K9DA 4FHFA 4PO3X 3A9UA 1V16A 2IHUA 3VBCA 1NMYA 3FM9A 3K31A 3ZC3A 4C4RA 3R3ZA 3FZNA 1DEAA 4B6GA 1DJNA 3L4KA 1FPQA 1VLHA 3GUCA 1JWBB 3ED1A 1A9SA 4Q4JB 4QQFA 4FLFA 2BH2A 2G80A 2NVUA 3BRCA 2H2AA 1WIWA 2BHSA 4JYBA 3B38A 1HMPA 1ZRHA 2E85A 2QJOA 1J2YA 4TTTS 4RPHA 5FLYA 1TZKA 4I55B 4O5AA 4DCCA 4F4FA 2B34A 3GZ4A 4WD3A 1KZ9A 1DJMA 4Y9RA 2EP7A 3AJAA 3S6JA 2HRRA 2ODBA 2WC1A 3IP8A 3M6VA 4GBGA 5K03A 1J23A 1FPMA 4HP8A 3BXXA 1T1SA 4I7EA 4QRDA 3QVVA 3RG8A 1SPXA 3GCWA 1EFRA 3SX0A 1M7BA 5KWSA 3DXXA 3U6KA 1MJ5A 5CIWA 5GP1A 2IYUA 1MB2A 2M98A 2FEWB 2VP9A 1IQRA 4A8PA 2E87A 4EGCB 1FEZA 1UJMA 4HDRA 4AF7A 1D03A 5DMHA 3M5CA 3CSDA 4BIMA 3BTUA 5AHKA 1ULTA 3BN3A 1AQJA 2ARKA 3K9BA 1FS6A 2YBEA 5L45A 2DPMA 1Z68A 2VHWA 3GEIA 3NOXA 3IERA 5KYNA 3ZCVA 4P3KA 4D8UA 1D6MA 5CCEA 3T0IA 4ALIA 3OT4A 5IXJA 6NULA 3SDSA 2NT4A 3ACBA 2PEYA 1JV2B 3PEEA 2AFHE 3HRIA 3QG1A 4LHXA 4P4UA 4DT1B 1W6UA 1C1DA 2FX5A 4WACA 4CUZA 1NLFA 1P1IA 1M1YB 3E23A 1EGHA 2G25A 4HAUA 4NU8X 1S8OA 3H2GA 3PJFA 3AWIA 3Q41A 1B0ZA 3TI9A 4G5QA 2FU5C 3MJEA 3Q11A 3DJYA 3DV9A 3LCCA 4BO6A 2YJ6A 3R4CA 4IF6A 4AP6A 2ZRIA 2Q8NA 5TDHA 3Q0IA 4C43A 2C0PA 3EC7A 2OLJA 4TVBA 3IBYA 2OT3B 4RIHA 3BXEA 3IVRA 4JU9A 2ZB4A 3R0IA 5FTWA 1HEIA 3QI2A 5JY1A 3K0BA 4Q5IA 4OB7A 1G21A 4YP1A 1DEHA 4WXHA 2I1VB 4UM8B 3R7FA 4CFZA 3NEYA 5LBTA 2VYND 4IZHA 4KXWA 5CD1A 4F38A 4AMGA 3GQVA 4URYR 2EEZA 4EABA 4EATA 2OBLA 4C1NA 1Z5UA 1DJLA 2FSIA 3AUAA 4OJYA 4RVNA 1H66A 4C2BA 5L3VA 4KFTA 2OPHA 4XRRA 1Z3IX 1MG0A 3E82A 4OUDB 2JJQA 5FWNA 1NUQA 2VHUA 2ZITA 2J45A 4P31A 3TIIA 1NW8A 3BMCB 4HGRA 5GONA 1KSGA 4EYEA 3GEEA 4CETA 5CDHA 4XSGA 3AIIA 1YDHA 2I99A 3OIFA 2GK4A 1NSTA 2H4JA 2WIAA 4HAXA 4P6VF 4TPKA 2VJMA 4ND1A 3WRYA 2JC3A 4KYTA 4C4ZA 3COJA 3AHFA 1Q83A 4WZZA 1IZ0A 5THXA 2JVIA 4M7WA 3CUUA 2JIZA 2HBRA 3A26A 4GZ3A 5AYVA 1ELOA 1LVHA 3RWOA 4XVQA 1RHKA 4B43A 4YMUA 2DEUA 1UH5A 1DRVA 1M7HA 5FKJA 3UFXB 1ZUHA 3ANNA 3WNVA 5JZ9A 2WICA 1QIKA 2WINI 1F7UA 4Z9YA 3EG9A 3V4VB 4AUMA 3I8OA 2A0UA 4A8TA 2ZS7A 2QP3A 4JNCA 4WINA 4YQZA 5IC5A 1Z4NA 5JV5A 1PT7A 1Z8FA 4OGLA 3S44A 1ZN9A 4Q7JB 5GAJA 4I50A 4F85A 2Z95A 2AW3A 3P2YA 4Y0NA 1ZVVA 3J7AC 1X1DA 1JNXX 2ZE8A 1PD0A 2ZYSA 5IUKC 3K6JA 4D4JA 5LNK6 4LJKA 3NHWA 4F7DA 4R9VA 3NANA 4V0RA 5AKKA 1HK7A 1MA3A 1U7XA 2BEUA 2PVSA 2ZTMA 3PS9A 2EGHA 5CLJA 3DBLA 2QMEA 5CA0A 2GXSA 3ZUGA 2JLXA 3SFTA 1JKFA 1M3SA 1U4OA 2DFDA 5JECA 2CFCA 4WGGA 4B2YA 3OX2A 4JR0A 3QVLA 1E2DA 4JEHA 1NP3A 4OY3A 1V43A 3KKEA 3D6MA 5EE1A 1IBSA 3V1LA 1H2XA 1M6VB 4X7BA 5E9JA 4S35A 4MMZB 4Z2YA 4LSGA 1ZIYA 2GCGA 1CHDA 4O02B 4KSCA 1L8XA 4KXVA 2AOWA 5AJZA 3BTSA 1G8AA 4BYGA 4UBKA 2YMMA 4ZU3A 5MHTA 3AC0A 1GU7A 3MJHA 4PQGA 3W90A 3QI7A 4LV6A 2HBZA 3RAEC 1NYQA 5BR7A 2IHTA 2ZZKA 4U7DA 3CM0A 3GN1A 4P98A 2J3LA 2WJ6A 3UIEA 2ZB2A 1D8TA 4QDJA 3T4XA 3TLCA 4BHTA 3NBQA 1E5QA 1YS2X 4FQ8A 1KF0A 1GDDA 1PVVA 2CYCA 2DKFA 3AU9A 4HFRA 2Q2VA 5FTJA 2OZLB 1JQLB 4M1QA 1DADA 1VL5A 1M8KA 4Z7OB 9MHTA 4JJIA 1QAMA 5AOBA 1C2TA 2ZR7A 2QRKA 3NT4A 2UYGA 4I5GA 1WZNA 2WABA 4BFZA 3BZBA 3B6JA 3HSYA 5AW8A 1NTRA 3RSZA 1ZGGA 4O2BF 4D9NA 2P4HX 3JQBA 4TSFD 3VYUB 2NPFA 4CDGA 1A76A 2PKXA 4QRHA 4YONB 2BM8A 2ZQ5A 5DSZA 1LF0A 4HAVA 5MDHA 3K53A 2OCYC 4CBVA 1B3BA 2R1VB 3OM0A 5JIBA 1E5DA 4Z7QB 4PNZA 1Y5LA 3EXEA 3GT4A 4IS2A 5BORA 3DMFA 1FP4A 1GPKA 4JP3A 4M54A 4QDUA 4XM1A 4U3JA 2F7SA 4Y2QA 1WHSA 4ZJUA 1GEEA 2FX2A 1JQ3A 1OT5A 4UHJA 3EEYA 2GYUA 2GKSA 3I2GA 2ZPAA 4FONA 2XH8A 3L8YA 1ZCJA 5I3CA 3A9VA 2IEDA 1PNOA 5CDSA 3SS9X 1EWKA 1XJWA 5IYZF 2PJUA 1ZNWA 3H8VA 1GN9A 1N9ZA 2Q41A 3KQHA 1VSTA 1Q6YA 4L02A 3IAAA 2RGNA 3T4EA 4EGQA 3S81A 2QZJA 1SHJA 1QBKC 2AJ8A 2PT6A 2VAPA 3A31A 4S1WA 5FT9A 1D2GA 5HM6A 5H83A 3OCWA 4MTLA 1N0WA 1XFAA 5BWLA 4W5NA 1W73A 5K3DA 3WYFA 1Q44A 4Z5XA 3OE1A 4R1OA 4BAZA 1YWGO 2C83A 5FP0A 4NZOA 1UFQA 4X92A 1IHOA 1KSJA 3QXXA 3FOBA 1ID1A 3FYUB 2XKJE 3GDGA 3ZD9A 3MQFA 5JQGB 3SSMA 1DBQA 3ZE0B 1UJBA 3MFYA 4J2OA 3T41A 1WB9A 1U2QA 4S1NA 3WLAA 1GQQA 3EODA 1PZFA 5FUVA 4Q7KA 3TYXA 3L0OA 4B73A 4K6FA 4GQAA 1XQ6A 2SECE 3TUJC 3NIDB 6GPBA 1YBHA 3BJRA 2ZTLA 5ERXA 4JKIA 1N2CA 3TCKA 4B17A 2PWPA 2WEKA 5BSTA 1DU4A 4DBLC 4H6VA 1AF7A 2N3ZA 2PYIA 3OCZA 3JXEA 2ZPUA 3KQMA 2B7BA 4JL6A 2VR1A 2Z6VA 2AX3A 3GIDA 4AKSA 4XDGA 4XTRA 5TT1A 1RJEA 1USWA 4IIXA 3D4PA 3M6FA 2YDYA 1WOMA 2AFHA 4EKDA 5FYDA 3BYZA 4QUDA 4TUYF 3BMNB 1DG3A 4ZOLF 2ZPTX 1RABA 4GE0A 2JHFA 1ZSVA 3M6LA 4YAUA 3I04M 1WPGA 4Q4HA 1USIA 3ETNA 1OQAA 3ZE9A 1AZLA 1B0PA 4P5PA 4BWYA 5KYUB 3R20A 3OO0A 2MOKA 3OCYA 1TLLA 2YHIA 4GC9A 1X3LA 2FF7A 2HSEA 2FH5B 3TFWA 4H60A 3ZH2A 1XBTA 1NKTA 2YV5A 4DA4A 1JRLA 2XAUA 3DFUA 1UCFA 3INRA 3OJXA 4TTIA 5ICCA 4P36A 4GP6A 2PGDA 3NYWA 1YVPA 3PICA 2H7VA 4PXSA 3NOQA 2J9XB 2YYSA 1AUPA 2ZLBA 3AI3A 3ND9A 5C4GB 1I5OA 2CK3A 4P7KA 5T6BA 1ZNZA 1U0TA 2PMWB 1W4CA 3H7IA 3R3JA 3SBOA 1A77A 1IUOA 3ZXIA 5B55A 1H1LA 3TQQA 4Y9SA 4YJ2A 1GL7A 4TOIA 1DMRA 4AS2A 2ZB7A 1WAMA 1BDMA 2ID4A 3PCTA 4IL5A 2IT1A 2PIAA 1G17A 3VGPA 3ZZNA 4C7KA 5LYJB 4JQYA 4OKNA 1V9SA 1O5IA 4J91A 1VLMA 2XUJA 2YZ2A 3K2EA 3LBFA 4KQ1A 4PNPA 5DO9A 3FGNA 4QGAA 1IVSA 1ZOPA 4K9MA 3ZDAA 2OK8A 1I4OA 3S1AB 5H4GA 2JFUA 4XIFA 5EQTA 2OUIA 4NFYA 1FX1A 2Z1NA 2H4WA 2NADA 1LC3A 4ZJYA 2YOFA 4CN9A 2FUG6 2ZRPA 1W581 2P7HA 4OIFA 4TM8A 3GFVA 1ZN2A 2H2DA 3MBOA 4LW8A 3Q9NA 3AV0B 5L3RA 3ICCA 4P81A 1BXKA 4R01A 3WLHA 1U5BA 4UFOA 3TD2A 3RYFB 1E2EA 3DDZX 4XH9B 5FF9A 3ZDRA 1QLJA 4I9FA 4IGFA 5ES4B 3FTCA 4EW3A 3WNQA 1DUIA 2FJUA 4V3BA 1PAUA 2NUAB 1L5SA 3OIVA 3O8NA 3VPGA 4HT3B 1XDUA 2H1WA 4BMOB 1NSFA 4NZNA 4FEAA 3STYA 5HGJA 3CNOA 2J0UA 5T6MA 5EKSA 4OFWA 5L95A 3N5KA 4B3DA 2X4GA 4K9OA 4W7IA 4BXOB 1RNLA 3U61B 3H8WA 2ZSIA 1EXMA 2BONA 2EFYA 2YFYA 2C3YA 3NTUA 1MABB 1DRWA 2QN7A 2RDMA 3HYLA 3IVAA 4RHYA 1QF7A 4M36A 5BNTA 1OZHA 1N2ZA 1BNCA 4YYZA 1B6GA 1HGXA 1N2EA 1VHDA 3OTOB 2QD5A 2B0CA 1F9AA 1U5CA 4N7RA 1XRQA 4BQRA 4EUSA 5I7UA 1QYDA 2GZMA 3HUTA 4B2IA 4D0NA 2QTHA 4OP1A 4CEJB 1YJAA 4IMRA 4OJNA 3U44A 4OQXA 3I3OA 1R27A 1S3IA 1SXGA 2KPOA 3E9DA 4H3HB 4N0QA 3TE6A 1Y63A 2QL7A 2YYAA 3L0DA 4KXQA 1VHWA 5BN1A 5A6VA 1HTTA 2IKQA 3CJRA 1L8OA 4S1PA 1WHTB 2ISSD 1ZVQA 5BYJA 3TNFA 4F2GA 4MKZA 5ICMA 1TLTA 1K8RA 1UAGA 2IPLA 2XB8A 2YFHA 4AN1A 4LYEA 4W7HA 3UCXA 2VYQA 2YJTD 1XLUA 1EYZA 4QLAA 3T7DA 1ZMTA 2FEOA 2O2GA 3FNEA 3CWZA 4CT0A 3LQYA 4P92A 4IIEA 4N65A 4Z7JA 1Y6FA 3OT1B 3KOWA 5G3YA 3AONB 2ZJ2A 3FOZA 3QEMA 2VYCA 2BWJA 2BFBA 3G8BA 4G86A 4IX9A 5E2IA 2R3SA 3CT6A 5HZMA 1B8VA 2J9FA 2HU7A 1KGSA 5D87A 4QL3A 2CGEA 2JI6A 4TLAA 4Q7LA 4K9SA 4CT4B 2O2XA 1CE8A 2ZUDA 2WHRA 3ICWA 1YF3A 3E5HA 4NJMA 3OE4A 3NBUA 2IEAA 1I9GA 4ZARA 3ZTTA 4M7OA 3KFXA 3VOTA 2GPWA 4JCOA 3PFFA 1RWKA 4ZVUA 1WXQA 2JIOA 1OWOA 1R0XA 3G0DA 3QSGA 1T6NA 2AR7A 2E48A 1E2KA 3ZKAA 5HIAA 1QO0A 4H9GA 4DBVO 2L19A 1A71A 1W87A 3FR7A 4YMSA 5IS2A 3ZDEA 5L40A 2RHDA 1UBNA 4REQA 3QLUA 5G1NA 3QEBZ 1XZPA 2RARA 4DLUA 4OD0A 4PAGA 1GPLA 2IPNA 5DCWA 3OJEA 2JF0A 3G49A 1K7XB 4L9RA 4KQ6A 1GUZA 1UP6A 3BRSA 3CONA 1LLQA 1BJTA 1FFSA 4UPEA 4EHFA 3OZXA 4CLRA 3K6SB 2XRZA 4EF4A 2FEPA 2UZ1A 4D57A 2RGEA 3PHBE 1M76A 3HXOA 3IJRA 4TZTA 4CDNA 2P9YA 1D2HA 1T2VA 2G40A 4TV8B 4ATNA 2DUWA 2NNWB 1G8GA 2CLLB 3KOXA 2JA1A 3L1JA 3ZVLA 3OQ6A 1G7SA 5G0VA 2NZ8A 3LQRA 5DTMA 3T3HA 3QFSA 4V1CA 2VPZA 3LNTA 5KHOC 3H6GA 1PJRA 2WWXA 3NM6B 3UKJA 2JFNA 3GZNA 1J6UA 1E6UA 4HZGA 1OOEA 1OXXK 3NUGA 2MR5A 5BVHA 1GA6A 1YO6A 1TYZA 1TM5E 1TT5B 4G8DA 4US0R 5HGXA 3LPNA 3NBXX 4IIFA 1WBDA 1ISHA 4TLDA 4U5QA 5SYNA 3WNCA 4CM5A 1F8UA 1EX9A 1N6IA 4EX7A 5LKRA 1KJWA 2AB0A 5JDIA 5CLGA 1T5SA 2RGRA 3L82B 4R8KA 1QR2A 2XTNA 3KB6A 3IEUA 4FFLA 4ZC1A 1UZLA 3RVRA 3Q6MA 2XMSA 1PK7A 4G5SA 1CUXA 4G8BA 3VYRB 2OBMA 2C2GA 1DUVG 2IYTA 2PGLA 3BWDD 3PQ3A 4LYFA 4OMUA 3WGTA 1NUUA 4LQCA 2H5LA 1EFPA 3KWMA 3A9CA 5IEJA 2B94A 2D1RA 1YFJA 3K70B 1X80B 3WWYA 2IYYA 5A05A 3Q98A 1DBIA 4OXIA 3RH0A 1QIDA 4Y1EA 1TQ4A 5EIXA 1MV5A 1WETA 2XCUA 4ZAVA 4ENWA 3K70D 2AI1A 4KJXA 1JH8A 2IA5A 1E59A 2B92A 4LY3A 3MMPA 1G3UA 3T6KA 2VVTA 3C0KA 4Z0TA 3U6BA 5BN5A 1ZUNB 2IY8A 4G9EA 4R2HA 3ENZA 4D8YA 1FDTA 5EJAA 4EUNA 3RUFA 2NUTB 2FB9A 3P9NA 2IJGX 4JXKA 2MT9A 3TKAA 2NO5A 3NEJA 4MUMA 3UMCA 5IT4A 3G0BA 4HZUA 4MH0R 1K86A 1W8DA 3NZEA 2HWXA 4QBFA 1Q7TA 4C7XA 1JGTA 1Z62A 2J48A 1F2TB 2ZJ6A 2QW1A 1NUSA 4TWBA 3W5IA 3UG6A 4DM7A 3ICQB 1ZA1A 3FY4A 4GPTA 4TV9A 1C3VA 2IK8A 2OM2A 4AKEA 1NDQA 5LZ2A 2NSYA 2PO7A 3OIWA 13PKA 1GXSA 2YHSA 1UDCA 5FBQB 3C3AA 4RHUA 4GX1A 3OFVA 1F20A 4LBWA 2PU7A 4UKDA 3D3KA 5CNIA 5JO0A 3QXHA 4CKZA 3GLIB 2IS2A 2LTAA 3TFOA 1A7JA 3WC4A 1BCRA 2SKDA 2QX4A 4JLAA 4P1ZA 1Q2UA 1YS7A 1NI4B 2ACVA 2JH3A 1YB5A 1IDOA 4RZQA 1PR4A 4CMIA 2OHHA 3ERCA 3O8QA 4GU5A 4MQ4A 4C7BA 4UJ3A 4ZAFA