4AN4A

Crystal structure of the glycosyltransferase snogd from streptomyces nogalater
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
380
structure length
357
Chain Sequence
QSMRALFITSPGLSHILPTVPLAQALRALGHEVRYATGGDIRAVAEAGLCAVDVSPGVNYAKLFVPDDTGEGFFAEMFARVSAVAVDGALRTARSWRPDLVVHTPTQGAGPLTAAALQLPCVELPLGPADSEPGLGALIRRAMSKDYERHGVTGEPTGSVRLTTTPPSVEALLPEDRRSPGAWPMRYVPYNGGAVLPDWLPPAAGRRRIAVTLGAKLAPLFSEVADVDAEFVLTLGGGDLALLGELPANVRVVEWIPLGALLETCDAIIHHGGSGTLLTALAAGVPQCVIPHGSDTNRDVLTGLGIGFDAEAGSLGAEQCRRLLDDAGLREAALRVRQEMSEMPPPAETAALVALAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Glycosyltransferase Snogd from the Biosynthetic Pathway of the Nogalamycin in Streptomyces Nogalater.
pubmed doi rcsb
source organism Streptomyces nogalater
molecule tags Transferase
molecule keywords GLYCOSYL TRANSFERASE
total genus 104
structure length 357
sequence length 380
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06722 DUF1205 Protein of unknown function (DUF1205)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4an4A02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4an4A01
3G2KA 4GYYA 4RIHA 2PYIA 3E3LA 3MSCA 3G2LA 2Q6VA 3T3EA 2QLLA 2BGTA 3T3DA 2IUYA 1P2GA 1LWOA 4MICA 1WV1A 1LWNA 1QKJA 1C50A 3Q3HA 2JZCA 2PRIA 1P29A 4REMA 4RBNA 2QRPA 3AMVA 2XGSA 1XC7A 2QLNA 2QN9A 3C4VA 4KQ1A 1SXQA 1NOJA 3T5TA 2QN8A 3ZCUA 2G9VA 4M7PA 3OKCA 3L79A 1GPAA 1IXYA 2C9ZA 1JIXA 3T7DA 2F9FA 4RIEA 3NB0A 3MRTA 3RHZA 1L6IA 3BEOA 2GT1A 3GUHA 3O3CA 2GPAA 2ACWA 4NESA 5TMDA 2R60A 3D0QA 2JLBA 1L5QA 4RELA 4YI5A 3NPAA 3TSAA 3OTHA 3CUWA 3MS7A 1JG6A 3MTBA 3RT1A 3DZCA 2ATIA 2X0EA 1H5UA 3VUFA 3BDAA 1NOKA 3T3GA 1PYGA 2C1ZA 2C1XA 1A8IA 2F3SA 2XGMA 1PSWA 2IV3A 2AMVA 2BFWA 4QLBA 5JTUA 2R4UA 3COPA 1FA9A 1GGNA 4AY6A 3MQFA 1C8LA 2FFRA 4RENA 4KQMA 2QRMA 3ZCRA 1C8KA 1O6CA 4KQ2A 8GPBA 3TAXA 4F96A 1NLMA 1E1YA 2XMPA 1P2DA 1Z8DA 2O6LA 3NCHA 3G2NA 2IEGA 1RRVA 1XV5A 1FU4A 2QN1A 2FETA 2SKDA 4X6LA 4RIFA 4F9FA 2R66A 3DD1A 5BNWA 3BCUA 1P2BA 3HBFA 1WV0A 1Z6QA 9GPBA 4EL0A 4MI3A 2C4MA 5JTTA 1FTYA 3PE3A 2OFFA 4X7RA 2H1FA 4FZRA 2BISA 1J39A 4N3BA 1HLFA 1JIVA 1QM5A 3MT9A 3OY7A 4MHSA 2IV7A 1WUTA 4GZ3A 3D0RA 4AMGA 2QRHA 1F0KA 2VCEA 4NEQA 1JG7A 2G9RA 2G9QA 2R4TA 2QN7A 2GEJA 2VCHA 3MS2A 3E3NA 2QLMA 1RZVA 2AZDA 4BQIA 3BD6A 2F3QA 4MI6A 3EBPA 2PYDA 3MT8A 4L22A 1IIRA 2R68A 3IAAA 2QNBA 5TVGA 3Q3EA 3NAZA 1FU8A 3OTIA 2VSNA 3G2IA 4CTMA 4LDPA 4AMBA 3CEHA 3HBMA 1XL0A 1Y6GA 3BCSA 1P4GA 4CDRA 3WAGA 2X6QA 4EL5A 1JIUA 3MRVA 3NP7A 3ZCVA 4NC9A 1YGPA 2ASVA 2WTXA 3OY2A 1FTWA 2X6RA 1FC0A 5I45A 3CUYA 4CTNA 3S0JA 4GYWA 1L5VA 3GPBA 4GPBA 4XI9A 1PNVA 2XCIA 3SYMA 2QN2A 3NP9A 4YI3A 1K08A 1Y8ZA 4N3CA 1L7XA 4RIIA 3MTAA 3NC4A 2ECPA 4N3AA 3Q3IA 4X7PA 3BD8A 4F97A 1XKXA 3OKPA 2AV6A 1V4VA 4MI9A 1UQTA 4GZ5A 5ENZA 3TOVA 3MBOA 3E3OA 2PQ6A 4BFCA 2BGUA 3CUTA 2SKEA 2VG8A 2XGOA 4AY5A 1GFZA 1BX3A 1FTQA 3L7CA 1UZUA 3C4QA 3WC4A 1EM6A 2H1HA 2IYFA 1AHPA 3T3IA 3H4TA 1K06A 5IKPA 3CEMA 1RZUA 4EKEA 3S2UA 4M83A 1EXVA 1B4DA 1P4JA 6GPBA 3CX4A 1AXRA 3S29A 1NZFA 1NOIA 5DLDA 2XA2A 1FU7A 3CEJA 5LQDA 4WADA 1YA6A 1E4OA 1NZDA 3CUVA 1XL1A 4FKZA 2ZB2A 2XA1A 2YJNA 4X7MA 1UQUA 1WUYA 5DU2A 3CV3A 3ZCTA 2G9UA 1L5WA 2PRJA 3H4IA 2P6PA 5D01A 4HLNA 5HXAA 3FROA 1L5RA 3BCRA 1GZ5A 4LEIA 3HBNA 3D1JA 2GJ4A 1WW2A 3S28A 3VDMA 1F6DA 3QKWA 3T3HA 1L5SA 4M60A 2GPNA 4MRAA 3QHPA 2VSYA 4RIGA 1ABBA 1FS4A 2X0DA 3BD7A 4WHMA 4Z5XA 1GG8A 4N9WA 4XIFA 3VUEA 3G2JA 3MTDA 4W6QA 7GPBA 1P4HA 1Y6FA 2AW3A 5C1DA 3ZCSA 1NVKA 3UYLA 3DDWA 1C3JA 1VGVA 1M5RA 2SKCA 3EBOA 3VDNB 2FF5A 4N39A 3L7DA 2F3PA 4BQEA 3ZCQA 1KTIA 2QZSA 5D00A 1GPYA 4G2TA 4EKYA 4GZ6A 3DDSA 2KS6A 3SYRA 1WW3A 4PQGA 3L7BA 3MT7A 2ACVA 4WACA 1Z6PA 2JJMA 2XA9A 1PN3A 2HY7A 4EJ2A 2X0FA 3WADA 3L7AA 3G2HA 3L01A 3RSZA 4YUAA 1Z62A 2QN3A 4HWGA 2QRQA 3IA7A 3OTGA 3RSCA 2IEIA 1XOIA 4CTOA 3ZCPA 3UYKA 1JEJA 2IYAA 4MHOA 2QRGA 3OKAA 4AN4A 3HBJA 4BQFA 1SXPA 5GPBA 2XCUA 3OT5A 1GPBA 3CUUA 5IKOA 3C48A 5TMBA 3MS4A 2IW1A 3MRXA 3PE4A 5TMEA 2GM9A 2GPBA 3S27A 2F3UA 5DXFA 2GEKA
chains in the Genus database with same CATH superfamily
5IH3A 4ARUA 3JYLA 4X85A 4DIOA 2QT9A 3T3NA 2ZWPA 3A6GA 3W8DA 1RWWA 3QE4A 1GUYA 3H18A 3MJDA 1NNSA 5J1SB 2ZIZA 2P3QA 3QX3A 1RYYA 3L4BC 4TWAA 1F14A 3AJRA 2VLBA 4DA6A 2C8VA 1YJ8A 4M54A 1U8EA 4LDQA 5ISMA 1B6GA 4PZLA 4V02A 3PLRA 1RQPA 2IEYA 4GGOA 3AR2A 1XLWA 1JTFA 2JGDA 1QYRA 3T52A 2R5WA 5JAOA 2P1ZA 2I54A 1QYDA 3WLNA 2A9JA 3PI7A 2ZUVA 4FFLA 4L6IA 3E15A 3QK7A 1EG7A 1U81A 3OJOA 1KJJA 4HI0E 2ZUEA 3N05A 1SY7A 1XU9A 2G4CA 2QOEA 1JQJC 4AG5A 1WE2A 5E0KB 5KIAA 4LJ9A 1DHTA 2Y05A 4D82A 5JXWA 4QDTA 5L6LB 3QSGA 2XXJA 3AF6A 2FFHA 1X13A 4PC1A 5AI5A 4GDFA 3N39C 2JS7A 2OD7A 3CRMA 3RODA 1EFAA 4F2HA 3ESRA 4MRMA 4TT8A 3AJ9A 3M0EA 4HQ0A 4KQ1A 4G07A 1E1NA 2I8CA 4NMXB 1NW7A 5T8KC 3T4EA 3UJAA 1RRMA 2OVFA 1GKKA 4BKPA 1G6Q1 2LWIA 1DQZA 3KJIA 4HHEA 4K6HA 2VQEB 2P9QA 1RM3A 2WWWA 1V45E 4KAFA 5K45A 3IIMA 1GR0A 3NIFB 2GZSA 4OL9A 4YJ3F 1U0GA 2W6JD 1RLJA 3KSBC 2YHIA 3AU8A 5IKMA 3CX7A 3O2SB 4B7ZA 4GVPA 3QFFA 4PR3A 4DGSA 4KACA 2XVZA 1OBFO 2XYRA 2V5AA 1MT0A 4ZO6A 3X43A 2CNBA 4CU5A 2LKCA 1ORRA 2B1JA 2H7CA 3AOEC 3IUQA 1SEVA 1N5OX 3A25A 4QFDA 5KJEA 5DBGA 5TMDA 3VPHA 1B0PA 2ST1A 1Q1EA 1PYDA 2YWDA 3MMZA 1QYCA 4N7MA 1R18A 4QJIA 2ZWVA 3HXLA 1FNMA 4D4JA 3VAZA 1REQB 2H11A 2HK7A 3DZGA 3RSQA 3L43A 1K8ZB 5LP6C 1PFYA 1S5PA 3DOJA 4ZJYA 1MA3A 1V2GA 1XZAA 2QTZA 2D2FA 5GZ3A 4DV6B 1HI9A 2D0IA 1HT1E 2C42A 4FZ3A 4S0XA 5BPHA 5CFPA 4CM1A 4XW2A 4N4AA 1X2EA 1ZOSA 1SU6A 2C9YA 4D4GA 2WKPA 3JQAA 4WESB 1UMBB 3TEMA 2AKEA 1NY5A 2DOKA 2QRVA 5AO9A 3V4VB 3GLIA 4F3TA 2XDAA 4L0CA 3B1YA 3O8BA 3Q7EA 3KOYA 4PTYA 4L72A 3EFHA 3R3HA 1USIA 1Y8RB 4W99A 3V1NA 4H59A 1QANA 1F7VA 1F48A 1LSJA 1JA1A 1A9RA 1YKGA 2CJWA 3ZJTA 4EEKA 3N2GB 2FZWA 1JQ3A 4FDUA 4YGXB 5JTUA 3N0VA 2CLFB 1O6BA 1QYVA 3I6ZA 1RYDA 4X54A 5C8VA 2ZIWB 1ADYA 1L8AA 3IPXA 3NLLA 1PP4A 3H3JA 4M2LA 1K2VN 4MK4A 1IWPB 4UUQA 3TLAA 4BLRA 4AY6A 3SCZA 1C80A 3PXUA 3TW4A 2Z8YA 4RENA 2V98A 1MPTA 3BTOA 4JB8A 3DGFC 2EBWA 3TTSA 1L1EA 3W05A 3EODA 4MR8A 4GPD1 1OKKA 2ARKA 1J2TA 2RHCA 2COUA 2YMPA 5CA0A 1P33A 1LBIA 4P5DA 1VLZA 1LTHR 2FQQA 2PHZA 4TYPA 2WMDA 3UAOA 3M4YA 4GIBA 1NW3A 4LOAA 3NT5A 1ICEA 3EJ6A 4W5HA 1KP9A 5JT1A 2FN4A 4CM8B 4YAKA 6CHYA 1MOQA 3RV4A 4GM4A 4QRIA 5AJVB 2Q5JA 3DCIA 3VNBA 1D4OA 4URZR 3HBFA 1WV0A 5CLHA 2O8FA 5EMNA 1RMQA 1V25A 5B2ZA 1DXOA 4MVJG 3GCDA 1KJIA 1SCIA 4X1KA 4YP1A 2VTBA 3EMVA 2VRCD 5AW4A 2GBPA 2ZJ0A 4B6RA 4BNMA 3RI3A 2RGWA 4CF5A 2C4MA 5JXJA 2R6CA 4MV4A 4WJKB 4YCDA 5ALXA 4R1NA 3TGWA 5JCOA 2BR5A 1A0OA 5AUNB 1LLCA 4MZXA 4O0MA 3O8RA 1N2JA 2A9QA 3VNSA 4JI5B 3RVMA 5D5PA 1MH1A 1KETA 2XT0A 3BMNB 1FRZA 2AMFA 3CINA 3D2BA 3IEXA 3UF0A 5C7LO 3B1WA 3RAEC 3EPRA 1DCTA 2QD1A 2CXUA 2VXYA 4HGOA 3RROA 3UKDA 1H8EA 2QL9A 3CYFA 4AJKA 1X7WB 4MHSA 5E3HA 1UMKA 4WBNB 1Z47A 2DWOA 4ZGBA 4PNHA 4WA8A 5GZ1A 5J2UF 4DLYA 4DJAA 3KVYA 2PXCA 3ZKAA 4NCAA 4KHZA 2ZUTA 3A05A 5JWHA 5BVHA 3C2QA 2XTMA 2R6DA 1RPZA 4BO7A 1ZS9A 4QNNA 2OHGA 2Q5FA 3LZCA 2GHQA 1I0LA 2G9RA 1HFEL 4AVYA 5J4HA 3QI2A 2B82A 5LC1A 2GEJA 2EFEB 1ZN7A 1B8OA 1FFXB 1CZKA 2FSGA 2VP3A 4ZZ3A 4HN2A 3W8RA 3VPGA 4G4SO 1PRYA 1JHUA 1LC3A 1TPZA 2IXTA 4LHSA 2AOVA 2I80A 4D0SA 1VCOA 1OW3B 1XCLA 2BP7A 2JLQA 3KQYA 4MR7B 5IC4A 1FUUA 4KWTA 3M8KA 3SI7A 2FZKA 4CGZA 5D3QA 5IT0A 3G8CA 4GBMA 4CT4B 2UZ1B 4EY5A 4R0VA 2I1WA 2EJBA 3AY7A 1GPDG 5FF9A 3D54D 3KDPA 3W1VA 4PLGA 4LOHA 1IZ0A 2AXNA 5F64A 4IHJF 3VR4A 1IIRA 3LOQA 1OC4A 1Y9DA 4UUPA 4RO0A 3SKYA 1AMOA 3TPCA 5B53A 1TTTA 1F38A 5CXQA 2MU1A 1QGDA 3QMMA 4MEAA 5CW2A 3O26A 4JBIA 2Q27A 1DFHA 1U1CA 4H4DA 1E62A 3LE8A 2VJKA 1U4SA 3ZG6A 1JHAA 1GEEA 1GGJA 2ZXFA 3JQFC 4PLCA 4NBNA 1FDTA 1DDOA 1PT5A 2QS9A 3V5NA 4DJDC 4EJ6A 4OX9B 1MQ8B 4EVSA 1QF6A 1EM8A 4LNHA 1Z0IA 4DA9A 1EFPA 1WDMA 1AE1A 4ND3A 3EXFA 3A9WA 1GPLA 2HJHA 2OESA 1Z4OA 3BXXA 5KC8A 1KPGA 1W5TA 5HIJA 4ZKDA 4I5IA 2AF4C 4RD4A 4MWTA 2ZR8A 2EJTA 2AL7A 5DGXA 2RAFA 1ICIA 2HDHA 1YJXA 2Y0CA 2CHQA 3PVSA 2EIXA 1LK5A 1ND5A 4DC9A 1UWLA 2ZJZA 2H0QA 3BMOA 3CC8A 2HCRA 3I6QA 5EZYA 4ZMBA 2HNBA 1RLIA 2C77A 3MXOA 2HO4A 4GP6A 2I8AA 4E30A 2JFYA 4H6VA 1J2YA 5AM3A 3BK2A 2OFPA 2ORYA 1DEXA 1CZUA 1VMAA 1B74A 1NL3A 4R2KA 4C03A 2BGNA 4EIWA 4OLAA 1RTTA 2FW9A 1G6KA 3LHFA 3SBXA 5ICFA 3ZZNA 3H84A 3KETA 1WEHA 1ZN8A 3CMCO 1FVXA 4JGGA 3FPJA 4RVHA 4J16C 1F7UA 1T1RA 2OM2A 1IJFA 4MQUA 3B5EA 1ZIDA 4DCCA 1BO6A 1NV9A 4EYSA 4NEHB 2YXPX 3SFTA 3S99A 3DONA 4BB6A 2W2MA 2XSZA 1PR2A 2WW8A 2O0HA 3K2BA 3PHBE 4G86A 2XDQA 1OFUX 3MWLA 1KRXA 2Q2NA 1XMPA 2XYHA 3O3NB 5ALUA 5K5EA 1FNNA 5L3QA 1SBZA 2AS0A 3GFRA 3E53A 3Q8KA 1GJRA 3TINA 4K6KA 4IJ6A 4N0DA 2P69A 1ZBDA 2PKRA 4GL4A 4ZI5A 3UK1A 2CLIB 2VPZA 3QMVA 4RSGA 1Q84A 1J99A 5ER9A 4RLSA 4YRLA 4F86A 2W00A 3QFCA 1CF9A 3PC8C 1W87A 1BDHA 5DM1A 4II7A 4YJ2F 5A5GA 2O9JA 2KX7A 5IZCA 4RM2A 4POAA 1GZUA 2BFOA 2QD5A 1FOEB 5IW8A 1B2LA 4CV3A 3H9BA 1WOMA 2Y0EA 1ZD9A 6AT1A 3E9MA 1ISRA 3UANA 1DPGA 2O19A 2GS9A 5T41A 4MMXB 4OOFA 4R1QA 1PD0A 3HYSA 3ZHRA 3O95A 5HMLA 2ECFA 1DQYA 4G65A 4WAUA 1DAFA 3N2NA 3A6PC 2ZBVA 3ZHVA 3HV2A 1Q1BA 1EZ4A 2FRDA 1KFCB 3BRWD 1IXSB 3T3IA 3T5AA 5IUNC 2J9FA 1BGXT 4C4RA 3E18A 2B9VA 1R16A 2FR1A 2PNJA 3EMBA 5KNDH 5BVGA 3JVVA 5HWSA 1WMSA 1HOTA 2ZRCA 3AWDA 3RJ5A 1E2QA 3TD6A 1EXVA 2R7MA 2REBA 3A3OA 1E2NA 2D8MA 4HZUA 4GEKA 2WLSA 4MXDA 1G60A 2WF6A 1SUFA 1DEOA 3S29A 4CMAA 2E4VA 3AUYA 1FRVA 2O2GA 1QE0A 3E9QA 4RZ3A 2PA0A 1EVYA 2WU1A 3DGEC 3Q11A 4G6ZA 4HPXB 3QENA 3ETNA 4JH0A 4L6AA 4MV1A 1UAYA 3JAWB 3BRQA 2UYOA 2IYWA 1E66A 5IG2A 1T8TA 2G77B 3ZGLA 1D6SA 4X7MA 3D3KA 4FR2A 2DPGA 3ZZMA 4D4LA 4IKEA 3TMKA 4BY9E 2QTVA 3PQ7A 2X4GA 2NU9A 1SPXA 1ZJ6A 2AI3A 3IUYA 3KB6A 4WGFA 2PRJA 2BH9A 3URMA 1QGUA 4DVGA 5AKIA 5A04A 3BDVA 3QELB 2DKFA 2BF7A 1AKQA 3G8YA 2PS9A 3Q1KA 5F4BA 3B60A 3C3AA 5JOQA 4ZYLA 1Q74A 2VJBA 1XVIA 1BOFA 3KYCA 1BVYF 3Q7QA 4IRUB 1C9NA 3S70A 3NWEA 3P9IA 3A6DA 2PMDA 4G1EB 4RHFA 3EEBA 2FSHA 3PICA 1W85A 3A3NA 1CEYA 2PRZA 3VYSB 1QOPB 3P0FA 4F1KA 2A5FA 1KP3A 2AMLA 4LK2A 3DXYA 4NHEA 1KS2A 2ZSEA 1EK6A 2OZVA 1FFGA 2W2LA 4J1TA 1Z13A 4FYKA 1CDOA 1PR3A 2BGIA 2QW8A 4NHOA 3SR0A 4OM8A 1J70A 1UBEA 4D9FA 1LSUA 4I9NA 2Q9UA 2JHPA 3GI1A 4IL5A 3PIDA 4QGHA 3CLRD 4G4IA 4FKBA 4ZODA 4A0QA 4E03A 5DHQA 1WXXA 2HMSA 3GIWA 1A1VA 2CHEA 4KLZA 4D80A 3EUEA 2JGMA 1J0EA 4CYMA 2EKBA 3FMIA 1NNUA 3HJTA 4WESA 2IU0A 3C43A 3PEEA 4J7CA 5GQSA 1GL6A 4PZEA 4BMXA 2Z9DA 3CF4G 4GWKA 3DD5A 3GLIE 5BXYA 1DTWA 5CVEA 3ZTWA 1BH2A 4TMKA 1BE8A 4XGNA 3F9RA 2D6FA 2EX0A 4CLEA 3QF4B 3A31A 1OYWA 1PTJC 3OEHA 2HK6A 3DBRB 1UZNA 4LVOA 1R5JA 3EEQA 3K0FA 3QLTA 4WEQA 2I6TA 5FBHA 1SVWA 1POWA 2OHIA 1LW6E 5BPFA 5DX1A 1ZZEA 3KQKA 3AEUB 1R8XA 1JGTA 1W52X 2N47A 3I6BA 4GWLA 4MROA 4MGHA 2WF8A 4Z8YA 3DDWA 1EB8A 3CURA 4EDHA 4DR3B 1TZBA 1V5GA 3R4VA 1LPBB 3EBOA 4ZQIA 3OF2A 3PUZA 3QU4A 5AHWA 4CMCA 4CMKA 4MJXA 4DEYA 3E03A 4Q5IA 1V16B 3B6KA 4CDGA 4Y8VA 3NEYA 4M0CA 3ZWBA 7ADHA 3ZI7A 4PXYA 1ODTC 4UATA 5DE3A 1OQAA 1L4FA 2HB6A 2P2LA 2XVXA 3HA7A 2XUOA 1JSRA 3UK7A 2VVTA 2DPMA 3K4PA 4NSNA 3W7BA 2C9OA 5CA0B 5JWRA 1UPXA 1I8TA 2YHSA 3GBVA 4JA0A 3ZCXA 2MSWA 3ZY3A 5CEFA 2N46A 2C7VA 1JAXA 4NY1A 4LOJA 4BQRA 3FZNA 4NNOA 2BDEA 1OWPA 4TXHA 1ZAKA 4XQEA 3X1WA 4FDMA 3VV2A 4AROA 4BJ1A 5HUHA 2LV8A 1T0PA 1N5IA 1GT6A 3R6DA 2NPOA 4FQ8A 4II2A 1THTA 4OHVA 2CEKA 5JNTA 1YU6A 4CG3A 1ARZA 1QNFA 2W2NA 3SHVA 9LDBA 3IELA 1JYSA 1XF9A 4FHZA 4G26A 4HBZA 3AF0A 1C9YA 3ONFA 2PZKA 2HPHA 2OECA 4N0MA 4L78A 4BMCA 4ES6A 4RTQA 3LU1A 1E3DA 1QZZA 1EIWA 2EV9A 4BAUA 4OFXA 3OPYB 1Z5WA 3D6UA 4Q1FA 1HZJA 3RSSA 4YXFA 4NX2A 2P2ZA 1X1CA 4HBGA 2RIRA 3I04A 3LUAA 2HHCA 3H9JA 4JA2A 1QG4A 4O29A 4P3KA 5BSGA 4IJUA 2NZ2A 1DQNA 1F8XA 1J23A 2JI7A 1TCAA 3IQFA 4I4TF 4E4RA 1FZQA 4QNMA 1ZGHA 2O57A 4OM7A 1Q91A 5T6MA 4W6ZA 2W90A 3CTPA 1VP9A 2P78A 4MGEA 1MC8A 3JD0A 3O4FA 4N3NA 1R27A 2HDWA 2NNLD 1Y7TA 4P2GA 1M6VA 4HNAA 4BNVA 2A4KA 2HSEA 3GZNA 3K7EA 2QQEA 4FSXA 1GSAA 1X8KA 3ZDRA 3BFKA 5HOQA 2YWJA 3D4NA 4IH4A 1Y4ZA 2ZSBA 1OAAA 1O0CA 4JQYA 5KDLA 3OZVA 3P2KA 4YRQA 2RGNC 4MGYR 1BCRB 3GUYA 1KJWA 1Z2EA 4OYRA 3RW9A 1KORA 2CUNA 2PANA 5T64A 4OP3A 1ANKA 3QKUA 4QUHA 1LGYA 3ZUPA 2BGKA 2JLAA 1SKYB 1EVQA 3KEFA 2A8YA 1DU4A 3KKPA 3QKSA 2WJ6A 3UMRA 3HI6A 2AD5A 2EDCA 1A72A 3R7NA 1AURA 3GRPA 1EUCB 4DOMA 5K05A 4YH1A 2FSFA 3JWPA 5AI9A 2QQ5A 2QR5A 4EG4A 1N92A 2AOXA 5M29A 4PN7A 1AX9A 1BXGA 3LXRA 2P5SA 4MICA 2Y4NA 4LZZA 5EKDA 4HUJA 2H1CA 3TLGA 2A1IA 3DFIA 4DMHA 4REMA 3LLVA 3PWZA 4YAUA 4J6EA 2IU3A 1FMLA 2I7VA 2JGAA 1WA5A 3BIFA 5BWNA 5ICCA 3GEBA 3TFWA 2QX9A 4K9PA 3PRJA 3KQNA 3V7YA 2X86A 1Q3TA 1DFIA 4YJHA 2OYCA 1VCMA 2AGVA 2P27A 2GA9A 2WM3A 3U5TA 3W4KA 2V03A 1KAHA 4ZV9A 2QL7A 1W59A 2QYTA 2VP6A 3OE7A 1RAHA 1ISSA 4K9QA 4M38A 5JNWA 4C88A 3L79A 3GGJA 4GRIA 2ENUA 4FYJA 5FNZA 5IPFA 7YASA 2VAPA 4NECA 4NNPA 4R1UA 3QJGA 3G2PA 1QFXA 4OQQA 1U2QA 4YA6A 3IR5A 2PUAA 1VB5A 3PPYA 4LY9A 5FQNA 1MIOA 4E22A 1LVHA 3IDZA 5FO1A 1F9AA 1TIKA 3JD3A 1T0UA 1ZJJA 3N74A 1BMFD 1XTKA 3NIBA 4YQZA 2LIVA 2JCBA 2GEDA 2JGNA 2XNKA 4TQ9A 1UBRS 1T1JA 2YVAA 1P1CA 2J0QA 1NYTA 4YMTA 2DR2A 1YRAA 2AMYA 3SP1A 4Z7NB 4Y6SA 3NBXX 4RHCA 4PX9A 1YB6A 3OTHA 4NOKA 2GPJA 4ZEMA 4CM3A 3J80A 3ODGA 2P2NA 2XF8A 3IAM1 2GAAA 1U65A 2FMXA 1A9TA 2J41A 4E2ZA 3RYCB 1AK9A 1D4FA 3R6TA 1QF9A 4QUJA 3K4QA 2Z2IA 4UTOA 5TT0A 2JJ2A 3L7NA 3RRMA 3VUFA 4BAZA 4JEIA 3BDAA 3PRYA 3T3GA 1G5RA 2QB5A 2C1ZA 2FF7A 2OV2A 4KFUA 5TB5A 1XZBA 5B6JA 2IHTA 1CUSA 2R84A 3IP7A 3LUHA 2CMHA 1H22A 1WD5A 2W2TA 2AEEA 3BF8A 4M8KA 4E07A 3FN4A 2PBRA 2IYSA 1Q12A 2GZHA 1OXUA 4KRGA 3LBYA 3ODPA 4UZSA 4CIBA 3A6FA 5AW6A 4BLOA 1H9AA 1XJ0A 1YUNA 3VKGA 2BFFB 3G0DA 3I5UA 5CGZA 4K9NA 1C3XA 4ILEA 4DDKA 5CM2Z 2NYUA 1YHZA 1TGYA 2A14A 3OA2A 3U80A 1LDMA 5AM1A 2P9HA 3O1HB 2Y92A 3UNXA 1FNDA 2P0AA 5AKEA 1M8FA 5FHRA 4CF4A 1A9QA 2EP8A 2PS0A 4DWVA 1AKUA 1KS9A 4A6XA 1OE0A 4RTOA 1GCAA 1MEOA 5K8UA 1CUDA 2A86A 1ID1A 3CPSA 3D6JA 3K09A 1SHTX 1VLHA 4RZXA 4U0JA 4Q01A 3SF8A 4AJ1A 3IPCA 3WLAA 1SHZA 4ZGGA 1TB4A 3TZQA 4LXYA 4LCJA 3PVZA 4FSHA 2ETXA 3TL3A 5JAPA 9LDTA 1I3MA 2W58A 2Z6AA 4ASUA 1Q22A 4PFSA 2ZIAA 3L1HA 3WZ2A 2WNSA 1KJNA 2N0SA 3BK1A 2M9MA 2Y27A 2QA5A 1G8JA 3G9XA 1U2GA 2QUKA 2V9CA 5E2IA 3BCUA 3GW8A 5K0NA 4BVGA 4DLXA 4FFBA 1P2BA 4K0RA 3ECCA 4QHYA 1R0LA 3WA6A 1XTQA 1QK4A 1WB5A 1YBMA 5D85A 1AIPA 3EGIA 3BSFA 4OQXA 3NYRA 4EYOA 1CJKC 4UTRA 4KGXA 2EARA 3N2KB 4AY4A 3PC2A 1JLKA 1WR8A 1GUFA 1EFVA 3BGSA 1XRRA 4AAYA 1R5BA 1MW9X 1GNSA 1UPFA 1RJ9B 4X7RA 4OL0A 2VOJA 4M8NE 2Z8YM 5FBZA 3DLCA 3FKSD 3PL1A 2W6CX 4MKZA 4OXQA 4Q1DA 4TV9F 3SR4A 2QHXA 1E1RA 5F73A 1AKRA 1CQPA 3OPNA 3X1ZA 1M0EA 1KMCA 5CHYA 4OUDA 4KXFB 3VNRA 5G4KB 4K9KA 2WK1A 5D86A 2QTTA 1D03A 1KMQA 5E7JA 4ZU6X 3M49A 1SG6A 3BC1A 4INAA 1EPUA 3N70A 3O73A 5JSZB 1TT5A 1N1DA 2CFIA 3MQ2A 4HYTA 5CMLA 4H15A 1R7RA 2EJVA 4QGSA 4R3NA 4JLPA 5M7EA 4XX0B 3RTBA 1W49A 4MUEA 3WS7A 2YCLA 3ZGZA 1XZFA 1S7CA 1G5HA 2B30A 3OJWA 5ALGA 1A97A 3T61A 1FUIA 3BJEA 4D0LB 2VYCA 1Z2PX 1GU0A 1Z6YA 2BKEA 1C1XA 1F60A 2EHJA 2D4AA 2J59A 2ZKIA 3HLTA 3BJIC 4X94A 1ETHA 4MS3A 1JFRA 1EU1A 1ZOPA 1B8VA 3N87A 4YIKA 2DSTA 3CWZA 2XE4A 4OYLA 5AIBA 1ZNWA 4AKSA 5EXXA 3ELWA 1NVMB 3ETLA 4BQIA 1XZIA 4HAYA 2WFLA 5SYAA 4GD3Q 2B8EA 2X1HA 4HN4B 5G53C 2B8JA 3SDSA 3TG8A 4LJ8A 2PBFA 4URWR 4WFIA 2YL2A 3FBGA 3KKMA 1Z4QA 2V74B 3IQGX 1R37A 1JQ5A 2XYVA 1CNMA 4AKGA 1JDTA 3WIOA 4KQ6A 1YR1A 4K2HA 4DNFA 1YBVA 2VJNA 4J2OA 2ODPA 2ZRBA 1D1QA 2BIFA 3DF9A 1FU8A 1UMCB 3L4KA 3WNDA 1F8GA 2GBGA 1UJ5A 5FP0A 2BMEA 3C3WA 3K0CC 4KMRA 3I2JA 3HS3A 4Z4EA 3HEBA 3HSKA 4Q1EA 5EP3A 3PGLA 2VF2A 2ZSKA 3OF3A 1MNAA 4WXYB 2HSZA 2JARA 4RL4A 3PEFA 3REFA 4JI2B 2XCQA 4OX9Y 1G41A 4BO0A 5CJ2A 1CY2A 1TW3A 1VECA 1W2GA 1ZVQA 1XL0A 4CFSA 3L46A 3ZQUA 2XMZA 4UUAA 2WUWE 4C4ZA 4Y6GB 4BE4A 2H4HA 1E3WA 3BKWA 1AKYA 4W8HA 1UBUS 3RQSA 5DW0A 3QSYA 3ENZA 3HYCA 3RC7A 5IKEA 1NSFA 1GFWA 3DW3X 4HGQA 1WDLA 4AG3A 3O1LA 4TWZA 4WKPA 4NARA 1UP7A 3WGIA 4OLHA 3W2TA 3DKKA 4QU8A 2A94A 4OXRA 1LVUA 4ZP1A 3MIZA 4REOA 1JXMA 2GJSA 4ZVKA 5F3WB 1BH6A 1JIQA 2HWWA 3UFXB 4RJLA 3AR5A 4UFOA 1UBCA 3STYA 4BQSA 2KMLA 1I1OA 1ZCZA 1T10A 4H7DA 2QMEA 3PIIA 4QBIA 4FFVA 4ZVRA 2Q2VA 5BQ5A 3ZDFA 3CVOA 4NOMA 4R5MA 4B17A 1QWOA 4KSYA 4OHOA 1FJ2A 5E1BA 3IJRA 2QTCA 2ZBFA 4HS4A 4WK2B 2ZYAA 3AR9A 3A7DA 2OBBA 4A0HA 2W9XA 1EXWA 2JRLA 3FMPB 2HIGA 3D5QA 4QEKA 5JV5A 4MP6A 3D0KA 3JVUA 4NE7A 4HQLA 3IJEB 3O4GA 4U63A 4B47A 4E7PA 4MJLA 4EVRA 2V7QD 4EGJA 5LU8A 2CNWD 3NVDA 3PUWA 1YZ3A 1GRNA 3B7WA 3Q3IA 3SOZA 3JWGA 5JAMA 2UUCB 3HXOA 2QVXX 3BD8A 4JUDX 4INPA 4QIHA 3VTKA 2Y2VA 1X42A 4JU8A 4ZRNA 2AV6A 2V1XA 1V4VA 2X42A 1GG2A 3NDRA 3OCCA 4HWTA 4X20B 2YFQA 1Z73A 5DNDA 4ZHQA 3TR0A 3S6JA 1ULUA 2H8GA 1OFUA 1ZQ9A 2A0YA 2H6EA 3MBOA 4FOLA 3ROMA 2ET6A 3QJ5A 3PG5A 2MIIA 3V4ZA 1NKTA 1B2RA 1XF1A 4PBTA 4K1LA 2BGUA 4US2R 4FOOA 3KYDA 1C3OA 2WFLB 1QP7A 2XGOA 5L53A 1V5FA 1KO8A 1G9XA 2XNDA 3W7VA 2VSQA 2ZRFA 3ND9A 3D7MA 4KIFA 5A2GA 3V8NA 1TAUA 5FBRB 1CUVA 1MW8X 1NVFA 2RONA 2ZWOA 4FHGA 5HKBA 2CVOA 4FW8A 2YVUA 3LLSA 2B61A 1MAHA 4XQ0A 5DZSA 5AJXA 3TZLA 4EA9A 4UM7A 5KDOA 4FGUA 2UVDA 2XMDA 1PJSA 2DPXA 2AKYA 4BNJA 2GHTA 2HF9A 3KALA 3KVRA 1PR1A 2E87A 4XEUA 3LKVA 2H51A 1OXKB 1Y8CA 1K7FB 2WM9B 3WK7A 4YJ3A 4HGRA 6GPBA 5HM8A 5JBNA 3E84A 4QU5A 1BWSA 3MUEA 5EQDA 3INGA 5DLDA 2V5VA 3HL4A 2E0IA 3LDAA 3PRHA 4JL6A 1SFRA 1UR5A 4BYMA 5IZ4A 3WA7A 4CLRA 3MINB 4UVHA 2IVFA 4TXNA 3WWPA 3DMFA 1PQUA 1X1AA 5E4JA 2ZYTX 3E2IA 1GZDA 2NAFA 3CW9A 1IRIA 5DU2A 3W5SA 3HYLA 1ZKMA 4WH0A 2IT1A 4F7WA 4C43A 4MW5A 4G36A 3ZWKA 1R0BA 2NYAA 3DAPA 2B36A 3HU1A 4P4UA 1JLHA 3JWJA 4G5HA 1IJKA 1GM5A 1UWKA 1XJ5A 3U1BA 1K7YA 4DV0B 1RXUA 4D6YA 3AF4A 3DBIA 3F6SA 3FROA 1WY7A 5K03A 2H92A 2GJ8A 1GZ5A 5FO0A 4B4KA 4MLPA 3CW8X 4C3OB 2JJQA 3H2YA 3AGPA 3KOZA 3FRHA 3NIWA 1WW2A 3ADPA 1YH3A 4Z1MD 4TVOA 3SM3A 4INJA 1SVMA 3S28A 3CVUA 2ZAOA 3GBPA 2FUNB 5DLPA 5B3JA 4AKHA 4JI3B 1W5SA 4XAQA 1FXSA 1FLNA 4MQMA 1UWVA 4PAQA 3I83A 4RIGA 3PQFA 5IUKC 3W6PA 5EOVA 5EE1A 2J07A 2R97A 4W1RA 2O2EA 5F5XA 5KJCA 1YR9A 3ZZTA 4MR8B 1PJ3A 2OAQ1 5H80A 1T4DA 5AVOA 621PA 2F8MA 3KHSA 3DUFA 5F3RA 2RCNA 3V32A 4D56A 5BORA 3AVOA 2QSYA 4M1TA 3VV3A 1JVBA 1Q1QA 2DAPA 4BFYA 5IDXA 2BCEA 2YXDA 4N9WA 3ND5A 2DETA 4RZ2A 3V4LA 3G6KA 3YASA 5G4LA 2EF1A 1RI5A 5A06A 2DUMA 3VUEA 3C6MA 5KTKA 1VSBA 1G17A 3HM2A 3KVNA 5JARA 3B2EA 1EDZA 1ADFA 2OG2A 4TKUA 2JG3A 4COOA 2O1WA 5AVKA 5KTRA 2O0MA 2XCLA 2YJ6A 4ESOA 2ZJ7A 5LD2C 3N5KA 5EUMA 1NUPA 2GKSA 4AXBA 1TK3A 1ZHFA 4CCYA 2ZBPA 1ZEMA 3L3BA 4JROA 3AJ8A 2C8LA 1VE3A 2HREA 3L7DA 3MSXA 5TS3A 1DCKA 1T4MA 4RY0A 1ZNQO 2VPXA 4DCPA 2Q6OA 2WJ4A 2XDWA 2CL5A 2C2XA 3RE1A 2Q41A 4GXQA 5DFAA 3F6YA 1OCEA 3MLBA 3UUWA 3DO6A 3VZBA 3TXAA 2RK6A 1F8UA 3HLKA 2FPSA 4YJ3B 4JIMA 5KYVA 2VRBA 2O4CA 4ANFA 3LO8A 1TXGA 2H2DA 4FFRA 1XTPA 1V9CA 2ZGVA 5ES4B 1OFVA 1E6MA 1CQXA 2POQX 4KSBA 5ALFA 2PMWB 2VCYA 3A3PA 2OCIA 2W4IA 4KTVE 3LT4A 1JLLA 4M1MA 3AHHA 1CY4A 5K3EA 3IQIX 3T1QA 3ZV5A 4ALNA 3S2FA 4PQYA 2VP9A 2HF7A 4I99A 3WADA 5I4CA 5JRZA 1T6XA 1XHLA 3FLAA 3N0WA 4OU5A 3HO6A 1TO2E 1VI6A 5CYGA 2JGJA 4KGDA 4OGKA 3U7QB 2I3DA 4D4KA 3DE5X 3EW9A 4UEOA 5TQ0A 1NIPA 1T9ZA 3D8HA 4RA9B 4TTQA 2VWGA 4EGFA 4ZK6A 1A88A 3I53A 1KFJB 4NFYA 3LPCA 3WTCA 2HN9A 3WI7A 1UDAA 3L0ZA 2F48A 2NLOA 3QUCA 4AY2A 2C7RA 4AN4A 4OUDB 4ZOEA 5G4KA 5EIBD 2OMKA 4N12A 2PMEA 9ABPA 2WE8A 3GEHA 3IMFA 4M7OA 4R98A 4FQ7A 4LK3A 4FOTA 3E9RA 1U8TA 1JUDA 3C0KA 4MHTA 2CHUA 4CM6A 2LCQA 1VKZA 3TQRA 2ZM5A 5M2QA 2VXCA 1Q7RA 1OH8A 4HAOA 4PAGA 2YC2C 5HKKD 3QPDA 2WSBA 1KFKB 1U5CA 1WHTA 1O95C 3MRXA 1CHNA 1DQSA 3PZRA 4MWSA 3MD9A 3MCTA 5JQWA 2OQIA 3LCVB 3V6MA 4UD2A 4EW2A 2IYTA 2AHRA 2G5PA 3GQBA 4RD2A 3S27A 1BHSA 3MN1A 1R5OA 1W8IA 3BZBA 4QQKA 3ZWWA 5FLXA 1NT4A 2X14A 1KAEA 4Q1BA 5H5JA 4RX1A 3QFHA 3H2SA 4NBTA 4DXHA 1R9JA 3LOUA 4RIHA 4ER5A 3TX6A 3EVGA 1SUWA 2AZ4A 3Q98A 4TRNA 2PYZA 1HG0A 3FW1A 3NHZA 3P94A 2P68A 1EP9A 2VK8A 1QVWA 4IIYA 3SQOA 4OY3A 4QEDA 1Y4AE 2IX3A 4QJBA 3AF1A 3BA6A 4GOXA 5JVDF 1U2RA 5IM5A 2FX3A 4K0KB 1VHJA 2I33A 4Q7QA 4S2UA 4CKZA 1H6CA 3O8OB 2BGRA 4QYMA 4HWSA 5DASA 4KZKA 1WV1A 4LF9B 5CFQA 2YX1A 1BKDR 3BGVA 1DWQA 1NA5A 3FTQA 3DR5A 3GFOA 4JR1A 1DX4A 1DQRA 4HATA 1N6HA 3I4FA 4OHXA 2GRAA 3R7AA 3BICA 4K6MA 4ZCSA 3Q2OA 5IVKA 3B6EA 4I0WB 4ZVQA 2DJ5A 4WDRA 3T0IA 3DVAA 3MILA 2J5XA 4QDXA 4FEAA 5AQ1A 1ZSNA 2EJUA 2XDQB 5L95A 1QBKC 2AG8A 3HN7A 1CNEA 2COEA 2O7SA 3RYTC 5CBPA 1DKRA 3DZIA 1WW8A 2XBUA 4I6EA 1YFKA 3DLPX 1NGSA 1SD2A 4Q1AA 5A4AA 3K6SB 3UAWA 2PSFA 5DDIP 5E4FA 4H7HA 1L9KA 2NZVG 4XLLA 3T1YB 1ZU4A 3L92A 1SUIA 4OK3A 3E1KA 3TDKA 1X8LA 3EUFA 3UFBA 1NUSA 1L4EA 1TOAA 2OHOA 3I34X 2F43B 3B3AA 3MWEA 4WN3A 1KQNA 3WDLA 5E7IA 1K5PA 1RYMA 1SC4A 2GT1A 4Q3LA 1MB0A 3TIFA 1KGDA 5AVJA 5HJ7A 4I81A 1E61A 1K5HA 3P2MA 1WOYA 2Z83A 3ZGXA 1KQOA 2GPAA 2O14A 1VA5A 1X6VA 1QH1B 4UHEA 5LZ7A 3HDVA 4AZVA 4PINA 1XZ8A 4L4RA 2FX2A 3H2JA 4FCWA 3UN1A 1T2DA 2YN2A 5I9BA 4ASUD 4BRZA 1Y8AA 1KWKA 1R88A 1KK0A 3DA8A 3RNOA 1A1SA 4DQDA 3EULA 1W9MA 2ZRDA 3D6HA 1T8YA 2GWRA 4RJ2A 2RGCA 4ODIA 1BKSB 2IIVA 2ZRMA 3AKCA 4RFSB 2X0EA 1N0IA 2ESRA 1WLYA 4OXIA 2QL6A 4HVCA 1N2OA 2EF0A 4LYDA 5EZYF 3TD2A 5HS4A 3LT1A 1BMDA 4IF4A 4MA0A 4TLAA 5C4MA 5MGBA 1M8KA 4GX1A 1VRWA 5KQLA 3QYFA 5DGIA 2C1XA 2WHRA 2HAEA 1ADJA 4MRVA 4JJ6A 3OFJA 521PA 1ISPA 4GOKA 1PSWA 1MGPA 2ODWA 5HFAA 3RJZA 1SN7A 1P7PA 4GM0A 4NCIA 1KZYC 2WUDA 2XBMA 4JQZA 1J90A 3T9CA 1HC7A 4Q4AA 2I4NA 2VC2B 4RK0A 3T7EA 4Q16A 3TTVA 1WXFA 3BIOA 4BFLA 3DKIA 5TS2A 4I46A 5JC1A 3ORRA 4IDDA 4OHFA 3U19A 3L6UA 4JENA 2D00A 4N3GA 3R7BA 2W93A 3UMFA 3PYLA 3T35A 1JJVA 3V80A 1VE6A 3ZCRA 3C1AA 3EXEB 3PDJA 4PM4A 4DJTA 1NF2A 3UGTA 2R1VB 4HAZA 1RTKA 4M9XA 1Z0SA 2C5LA 4Q3BA 2PSEA 2HGZA 4FINA 2QJFA 1ZM7A 2ZUDA 4JGBA 5JZ9A 1D4AA 1WUJS 2OD9A 3JPYA 3RR2A 7MDHA 1U8UA 2NUTB 2CNNA 3E1SA 2REQA 5F12A 3S5UA 4CKBA 4X60A 2A5DA 2VT7A 2CZQA 2XD4A 3DULA 3ENNA 5FI0B 5CBPB 2LE0A 4HMOA 4RA6A 4BYGA 1PLLA 5J4LA 2E3JA 2ZIGA 3OM1A 2FDXA 3KQPA 4WOPA 3LXXA 3OZDA 2NUBA 3WBFA 1J9GA 3NQ41 4Y2SA 3IT3A 3TPZA 2YY5A 2ZSUA 2Y76A 4WOCA 1GUDA 1XD9A 1Q11A 1QS0B 1U0OC 1YUMA 3O0TA 1FTYA 2Q4BA 1UFKA 1JPJA 4YRDA 1I13A 4UHJA 4EPVA 4IICA 5FHQA 4TTSA 5ANRB 3GT3A 1LTQA 3EC2A 3KIPA 1GARA 3N8IA 5BN1A 2YWEA 1JHOA 2ID8A 2NZJA 4EI8A 2NAPA 3LCMA 5ICSA 1A3CA 2Q5HA 2FZ5A 1E7SA 1RPTA 2GPWA 3QVOA 4PVCA 2HL6A 2ZB7A 2I78A 2IOQA 1IN4A 2PN1A 3PYXA 2FB9A 2FLVA 1Q0RA 2FY8A 2Q29A 2QRLA 1GTL1 1P44A 1PG2A 1HDGO 2ODAA 2P9FA 2X4DA 3OY7A 4K5QA 5A9RA 5LR6A 4Y3UA 2EL9A 2MOKA 3KO8A 3JQ6A 4N48A 1BG6A 4F3RA 4YN3A 2CB0A 1HTTA 1DOAA 4K9SA 4DSZA 3P19A 1ZK3A 3HB5X 3ZBQA 1PLKA 3U48A 5KB3A 1NURA 1ACLA 3F1KA 3LQ4A 3KZNA 4ZQEA 2GK6A 3TLCA 3FWYA 2AFHA 4HQ6A 1EAYA 4U2BA 4PE5B 1FLAA 1UBMS 1U9IC 3IHTA 2WPDA 3KSRA 5P8WA 1N5JA 1YR6A 4LXUA 3K05A 4OGGA 1YMVA 2B7CA 1DKLA 1O77A 1QLWA 2PLAA 4NJEA 3P96A 3CVWA 1RCTE 4HRXA 2WMOB 1GR1A 3OO1A 4GX2A 4EB0A 1PSZA 3QHAA 3DHNA 1OLSB 3PDWA 3PXEA 1MO2A 1N9KA 1GAJA 2BFNA 4QYWA 1ZNZA 1JHQA 4LYGA 4WZBE 2FUKA 4X65B 4I3HA 1DT3A 1GVNB 3PC7A 3PK0A 4CEIB 1HL3A 4POOA 3GFGA 1GXSB 3ASUA 1YTLA 5IN5A 1XPOA 4B76A 3E8SA 1GGVA 3BMNA 2BTOA 4U2EA 5TDHA 5IWCA 5EKUA 2JL1A 3FJOA 3VBEA 4WZZA 3W77A 3RYHA 2G76A 3OE1A 4L9AA 3PCRB 4Y7DA 1MQAA 1FQJA 2JI4A 1Z2DA 2QAGA 1H2HA 2R1ZA 3M83A 4PW0A 2AT1A 3NTQA 2FZEA 2C5FA 4BPBA 1O3YA 3VOAA 5CFMA 4L85A 4K3UA 4HDCA 1RAGA 4IS2A 3CZ5A 3PTZA 4BVLA 3RF7A 4J1TC 5LJLA 4LJKA 4WINA 1RJDA 1Q15A 2OV1A 4KUHA 3D3WA 3PWKA 1DIRA 3FKJA 4Z4IA 4OHKA 5KNDD 5JNRA 1XQWA 2K5UA 4O4LF 1DOHA 4NOJA 4F1WA 4BU1A 1UBSB 3Q1LA 4OLJA 3MLAA 2BFDB 3PNQA 4CLXA 1P5JA 2EFDB 4LECA 2GD6A 4NENB 4LHYA 2WG2A 3HP4A 3H5TA 1HUQA 4E2XA 5KTNA 1KH3A 3ETDA 3N8HA 4XXHA 1I4OA 3I30X 4MVCA 4F84A 2OXFA 1ZZGA 3BWXA 4FGZA 4XD7D 4URVR 2ZI5A 4H16A 2UZ1A 4KGZA 3MYYA 3OZIA 3UH0A 3ZHTA 1N2SA 1YE3A 1LW7A 5DHUA 3WLRA 5H4GA 2AB0A 5I45A 4Q9KA 1W4LA 2D0PB 1OBHA 4LCBA 3A1TA 4OQZA 2CSUA 5LA6F 1XRSB 1XI2A 2XODA 1W2WB 2OY0A 2H4ZA 1RKXA 4FYIA 1OIWA 3SYMA 4L3OA 2IBMA 1K3TA 5B4TA 4C30A 2IXGA 2Y1FA 2YVQA 1J0AA 4TS4A 1CS0A 2DFTA 3HR4A 3ZH2A 1XD8A 2IOFK 1PJCA 4Z7OB 1V4NA 1T9CA 5E4YA 2CK3D 3ANTA 1U6IA 3ISVA 3I2KA 3M82A 4Z4CA 2QBYA 4P86A 4B3TB 2ECPA 4ZU1X 1WHTB 1B3BA 1WDKA 3ZYCA 2Q9CA 1QRSA 1MNQA 1BJTA 4WCDA 1MX3A 2HK9A 3GQBB 1HQCA 4CIAA 4C06A 4GZ5A 1HE2A 5ALQA 1Y1PA 5KSYA 3Q6NA 3I3SR 4KUGA 1BE1A 2DHQA 3MBKA 2J0UB 4YO7A 3DVSX 1YS9A 1YE5A 2MWMA 4D3XA 2FPIB 1GZ7A 3LIIA 3QV1A 1Y6ZA 1JTVA 1B16A 3G13A 2OZKA 2FCAA 2P6NA 5EPUA 2DLNA 3ZDYB 1GFZA 4D43A 4F6LA 3ZI0A 4P58A 5ERYA 5EE9A 3KK0A 1CP3A 2AYZA 2IWHA 4J0KA 4CCSA 1MJGM 2VYNA 3AERA 1XQ6A 3FR7A 2C2BA 5T4EA 3V34A 1YCFA 1ZD8A 2GPTA 2JAUA 3LF2A 3MB8A 1EXNA 3H4TA 2G67A 4WV3A 1YZGA 2PTGA 1OU4A 3DQQA 5K3SA 3MUOA 1USUA 1M83A 3IDAA 3P7MA 1W30A 1VXRA 2ZSHA 1GN8A 3B13B 1N3BA 5ILGA 4D8WA 1ZIYA 2QI9F 3F6EX 4DV7B 2WWFA 3IOYA 5EGNA 3U4DA 2QLTA 4K87A 5H7XA 3U61B 1YQWA 5DBIA 1QC5B 1QIIA 3HCDA 3QVTA 4IOLA 4EYQA 3RRNA 4KWHA 4M0FA 4L28A 4ZJPA 3QPAA 2O5VA 4HX9A 4LKOA 3SGLA 4JJ4A 2FH5B 4CT5A 2ZB2A 1VIVA 4RDHA 4S1NA 1RLMA 1UQUA 1I80A 4UQOA 4LHXA 2I2BA 1QH9A 3UG6A 2AC7A 4BUJA 2VT3A 4ZMRA 4EBBA 2ECOA 5CVVA 3O82A 4F4DA 4OFWA 2F67A 4L4UA 1W581 1NW9B 2AVDA 3A4MA 3FWPA 3L2OB 4OK5A 4YTEA 2CE2X 1SXJE 2NQTA 4Q3NA 4QXQA 5DIFA 5B1HA 3WXBA 2AJBA 3V48A 4ITRC 4OO3A 3HVIA 5BRJA 2HWYA 1ZOLA 2Q3BA 3QVMA 4D41A 2VH1A 3AF3A 4J4BA 1ZC3A 4IIXA 2DQKA 3N7UA 2GJ4A 3UENA 1VL2A 4KCGA 3ZOKA 2YQZA 5K6TA 4YT5A 3LPMA 1T5DX 3ABOB 3V1TC 3UAVA 5CB8A 4TOIA 1FW8A 2YKGA 4RTMA 2NVWA 2GMWA 2CLEB 3Q9UA 2XQIA 3II6X 4JMLA 3T7TA 5B12A 3BFJA 2QD4A 1TCCA 2G71A 1J8VA 3DOUA 3O2NA 2YNMC 4X3OA 1C3EA 3WK4A 4TVBA 4AJPA 3UBTA 3E2MA 5KX5A 4JR0A 1TUEA 1UPTA 2G25A 4G25A 1M66A 1MV8A 3H1FA 4PZDA 2GCPA 2B6NA 3UT5B 4EG1A 5MDHA 1PWXA 3WLTA 2XKJE 4R0NA 5CCXA 2FZLA 1RKVA 1W93A 3BB1A 1M2GA 2X3UA 1QE3A 4KP7A 1TW2A 4GRDA 2C03A 4PAWA 2C9DA 3FDIA 3CX6A 2XF2A 3LCJA 3K0AA 4JY7A 4LJAA 5THQA 3K1AB 1EHCA 3RARA 2ZPTX 1V11A 3S2EA 2OPHA 1T6ZA 3RG2A 2O2XA 4NLLA 3HDYA 3GLKA 4BLWA 4IQFA 1E6UA 3KYJB 1KAGA 3JALB 2O2CA 3RUCA 4CV0A 2N9UA 3OZBA 2JI6A 3VH3A 2GOYA 5GINE 1N7GA 5JU6A 5EHIA 4ARZB 2AN4A 1NVAA 3DC2A 5B3AA 4LF7B 4MUIA 2VUSA 3H4MA 1AGYA 4MYTA 4OF4A 1WU8A 3KZXA 3AL0C 3L0SA 4UREA 2OCKA 2GZRA 4J4HA 2LD4A 1QO0D 3MM4A 3CZQA 1BS2A 2DTDA 4QTYA 3Q7SA 1ZDMA 5AP9A 1A7KA 1SUDA 1YB5A 2IHYA 3K2EA 4W7HA 2WSYB 5LB4A 3VYRB 3LECA 2C5EA 4QPDA 2PM8A 2W11A 1QP8A 1QO7A 3EAGA 2HYIC 1DKNA 2W37A 4HNTA 3R74A 4QU9A 1NNI1 4OBEA 1Z6PA 3L9XA 3ZJYA 5EMHA 1RXSA 2GTPA 3GGDA 5AKGA 4DR2B 3NGXA 4WXHA 5CK5A 1DJMA 2HMWA 2R0QC 3KR9A 4YUAA 3W5AA 2QORA 1DAIA 3QPVA 1TM2A 2ZT6A 4ON9A 2WAAA 1UOPA 3KOUA 4DIEA 4EF4A 1XCGB 4DNXA 2HQOA 1VPLA 1P2SA 3JQGB 4UEQA 4CTOA 1KL7A 2H8KA 1HFWA 4RZSA 3PFCA 2IZ1A 3IUMA 3UT6A 2G07A 1ADCA 1DRKA 1OLXA 3T0GA 1TMOA 3KLBA 3TRJA 4P22A 1YJ5A 3ZBUA 1ZAYA 1EEXB 3WYFA 1FL9A 1MJFA 1XVAA 3QY9A 5CFRA 4FGKA 1HYGA 4TZ6A 2C98A 4Z9AA 4MUHA 4BU0A 1FRQA 4B8YA 2HADA 4F6RA 5K7SA 3OSUA 1K86A 2OUIA 3H9CA 3KXDA 4UU7A 2PCJA 2UYCA 3DOCA 3LBNA 5L7WA 2XWJI 3ORHA 3EDYA 3M6IA 2DUJA 5H3CA 2CGEA 2WR8A 2D5CA 3M9WA 1WDWB 1S4QA 5B58C 2QG4A 5HCIA 4DUPA 2P9YA 3NI2A 5CITA 2BKUA 1JSXA 2PGIA 4QODA 4D0RA 2B34A 5B6IA 4BX9A 3ZKWA 1BD4A 3OLWA 3OOJA 1ZGAA 3QWIA 3OM0A 4IM7A 4MGKR 1IXKA 4RVFA 3Q41A 4RVGA 5ECYA 5CDTA 4JKIA 2PL3A 3BYZA 3TLBA 5AM2A 1QV9A 4M4SA 4FLFA 3ZHSA 2XE8A 3E3LA 3UK0A 2WD8A 4C6TA 3NAQA 1NLUA 3ZNQA 4S1VA 4P7KA 2JLUA 4BVJA 3R7DA 1YJBA 1W88B 2CF6A 5BUCA 4ICIA 4J0GA 3TTWA 3QPUA 3UK2A 2QTMA 1M73E 1Z33A 3T7JA 2G4LA 4XQGA 3I45A 3KTFA 4MKHA 3BMCA 3TF5A 4ZDWA 2Y67A 3MEQA 3MJFA 3DCYA 3PYMA 3QYAA 2FE4A 2V1UA 4G8DA 1LLQA 1CQJA 4KIUA 3N7AA 1M6WA 4ARZA 2O7RA 3QPWA 4V0KA 3H7AA 3VVBA 3WIDA 3WISA 2HMTA 4D6XA 3AUFA 6Q21A 3DMHA 5I7WA 1D2RA 3Q3HA 5A02A 2NXWA 2PRIA 5I7AA 4FFDA 5CBKA 3SY8A 2BI8A 3EGCA 2FK7A 1XCBA 5TGDA 3BWVA 2UYYA 1E2MA 3AMVA 3FYHA 1CDEA 3H2IA 3I58A 3L5KA 1WUIS 2V4MA 3HKEA 4BP1A 4LGVA 1GRCA 4AJEA 3N28A 4RH3A 1VG1A 5EJ8A 4A8JA 1VL8A 3SYLA 4RKEA 4S2EA 4EZBA 4CL2A 2CXTA 5LN1A 2B5WA 2ZB3A 4LC0A 2HF2A 4HJRA 2BLNA 1C1XB 4QUBA 3MJ4A 2G9VA 2I4LA 4QSMA 1DWOA 1Y37A 3OX1A 4KXVA 4US0R 1DLJA 3ZPXA 1RPJA 3E7PA 5D84A 3HDGA 4YV7A 3DV2A 1MTOA 1JIXA 2C9ZA 4TUYF 4UNSA 4ZIRB 6ADHA 4I7EA 1MO3A 3H9GA 4RIEA 4NABA 2XB9A 4IIGA 1IYZA 1JLRA 2BFBA 4Y6OA 1Q7GA 3G68A 2BDUA 2ZRKA 3JAKB 3MWGA 1YIDA 4LOIA 4P0PB 1TUIA 3AVVA 2QEQA 5EIHA 3MAJA 4W8OA 4P5PA 4BQNA 4HFMA 4D98A 2V7BA 1BXGB 5I9MA 4YRJA 2WYOA 2NU6A 5GM1A 3QVGB 3ZIUA 4D44A 1RQ7A 1AOXA 4YHHB 4ZHSA 5CR9A 4MYSA 3KXPA 1IU9A 1OTHA 1O4VA 4R84A 1TLTA 5E6RA 4ZWNA 5ADUS 3TL6A 2YUIA 4RFVA 1N77A 1XMIA 3V1YA 4HNSA 3H5VA 4MQBA 3MGAA 3TZBA 4B3IA 4EW3A 2QRUA 5MF6A 3G7NA 4Z0NA 3R24A 2B8NA 2BHNA 3NHUA 4O5OA 1G20A 4L51A 3JTEA 4CIXA 5CEEA 3FI0A 3V4SA 2ECQA 4PS0A 5B1SA 1SWVA 2EJCA 2XQJA 3ZQJA 1GPKA 3H86A 2PT9A 3K8QA 2AK3A 1XNHA 4IIDA 1JS1X 4U9IS 2WQZA 1OLUA 1ZISA 3EDMA 3FPCA 5AJWA 4WNAB 4XYEA 2ZJ5A 3E5MA 4P36A 3SNHA 3N5CA 4YJGB 2FOXA 4ISBA 3IH5A 4JITA 4AJ4A 4BZQA 4CVNA 1NJFA 5HNKA 1P1BA 2FKNA 3HJHA 3F2IA 3M3PA 4ECEA 2YZ7A 3T5PA 4KQMA 4XUCA 3SLRA 4Q82A 2Q5OA 3CHYA 3IPYA 3QGMA 1N3IA 3QNUA 1WXDA 4IO1A 4K1XA 5DBOA 5IAJA 1N5MA 3QXXA 2D54A 3TO5A 3WLJA 3RLIA 1N78A 1A82A 2UKDA 1OFIA 1AU9A 4S1TA 2V8BA 1VLJA 3IEIA 4J75A 3RADC 3ESZA 2WDZA 5A0TA 1ZK2A 1J9EA 1W4RA 4MA5A 3VR6H 4O4JA 4XQ9A 1MO6A 1T15A 4XPIA 1KEZA 3KJFA 4TLDA 1ATIA 2HSGA 2VWHA 1Z4LA 3GCWA 4F9FA 3BHNA 5DGTA 3MGGA 1KH1A 1DSSG 4EMBA 4WLOA 3R9KA 1CC1S 3KQUA 4NCJA 1C9EA 2J46A 3JVDA 3P8ZA 1NJSA 1LF5A 3H3XA 1RC8A 3IUSA 3L8CA 4PNEA 3Q88A 1PV4A 4NVRA 3L8MA 1UZAA 4Q9AA 2C4TA 3NEAA 2PCLA 4IMIB 4OXXA 1BRMA 4LSWA 3VDRA 4W5RA 3PE3A 4L5AA 4BGDA 1F17A 4WOJA 5AW5A 5IDWA 3D7NA 3SJBA 4HP8A 4DLAA 1Y3CE 4GLJA 2A9PA 2ABWA 2EQAA 2FGJA 4DIBA 4YUXA 3ANSA 3C5CA 4HXYA 4JYAB 2OWEA 3SKXA 1N2BA 1PL0A 1WHSA 3QBVA 1RM5A 3UBMA 1JIVA 4QZVA 3TBHA 4NMWA 1A95A 1N75A 2C3MA 2PH7A 3IQEA 1CY1A 1GG9A 1T5HX 2AJLI 3FLMA 4R6WA 1G20E 4I4IA 5IVPA 3O03A 1QDUA 3K8OE 1RAFA 5KU7A 2VYND 3T94A 4ZO9A 1TF5A 3GV0A 4R2IA 1MZPA 2HQ1A 2HRQA 2IJGX 1SCKA 2FEKA 3K4HA 4M76B 4DHEA 1P1KA 5U4QA 3AILA 3WFZA 3G5AA 2W4MA 1KPHA 4N5MA 4XD2A 1KR2A 2QN7A 4R7TA 2PT5A 2IP1A 2P67A 3NV9A 3EIUA 4M7WA 5JYBA 3HCEA 3DTVB 4RZHA 4BFWA 1KO5A 4ZOLF 3IODA 1NI4B 5CTJA 1QIFA 4KOEC 3STWA 5KNBD 3PU6A 4K2AA 4PPNA 3P9YA 5BUQA 4HFRA 2G1JA 1JWBB 1QGAA 1N0HA 1VLQA 3K70B 4YMHA 3U09A 3LRXA 5C1PA 1NNLA 1XDSA 1OLUB 3INTA 1AC5A 3HYRA 3ZH9B 2PJZA 4MR7A 3OLVA 3VO9A 5IBCA 1HZZC 2QMOA 5EHZA 5HFNA 3ZNPA 2NZWA 1SBYA 1W25A 3KVVA 1MPXA 2V8OA 5GP1A 4ZYXA 5TVGA 2FVXA 4YJ2A 1OIXA 5EJ4A 1G3UA 3ZVMA 3OTIA 4KU4A 4G9EA 5DCUA 2NZUG 1CY6A 2IA5A 3PTAA 2RD2A 1Y42X 4FYMA 4N65A 1G1AA 1T3HA 1YQDA 2I99A 3ZOZA 1Z8HA 3H1AA 4XASA 1ESZA 3D6AA 4GNKA 5EMJA 1M74A 2BSAA 2E82A 5DCWA 4YRMA 3Q0TA 1KJ8A 2FLKA 3B52X 4ND2A 3ZV6A 5EE0A 2DQSA 1NKVA 4GMDA 1K6MA 2I6SA 1XZQA 1E2DA 3MMNA 4N8SA 2W48A 4ZPXA 4BJHB 1OASA 5EJEA 1L5MA 1IL0A 1XCMA 5EJ9A 2WAXA 3IAFA 1IHOA 1YTUA 3CT4A 1L3CA 4NF2A 3NP7A 1WXWA 3DB2A 2J48A 3Q8XB 3R0QA 3GXBA 1PEYA 4LQLA 4GSLA 4YK7A 4EPTA 1WETA 3CLVA 3KYIB 3AFIA 5HCUA 2NYRA 2EWWA 1DBQA 3ZQKA 4TKVA 5KYWA 4N41A 3SMQA 1FTWA 4U9HS 3CKYA 1XAIA 4ZAXA 4IG9A 1GGKA 2PZBA 1NSTA 4NG4A 1R6BX 3S1LA 1AK2A 4E31A 4B32A 5A4KA 4XWAA 2IXBA 2PY6A 1YRBA 2QIOA 4I5DA 3NHYA 1WUHS 4ILKA 5IAKA 4TL7A 4C0LA 2E18A 3KOOA 4G0PA 3LL7A 4MVJM 2IOFA 3OHMA 1X1QA 4ZOQI 2O2ZA 4AQDA 4ZMSA 2ZTHA 1WXQA 3S81A 4KVFA 2C2OA 2M1ZA 1G1MA 1WKCA 1Z74A 3HB7A 3O9MA 5EMMA 2OMEA 4BCDA 2DWPA 3F1LA 4Y2QA 5C0OE 4I1SA 1EWKA 4YCSA 3QM1A 2PE5A 4QELA 2A5YB 4F93B 5KTYA 2FMHA 3KPWA 3T12A 4B1FA 3KHTA 4R69A 1YS2X 4W5JA 4DLKA 2NP6A 1YZUA 1Z4NA 4NJMA 4UUNA 1NBME 2IE8A 3RIYA 3GGSA 5EJGA 1HK7A 3A1DA 3N2EA 2QPTA 1E3WB 2IPMA 3I9JA 3HADA 4MI9A 3AVQA 1WSBA 1P77A 1XZMA 2HOQA 1C9MA 2ZBRA 1NBIA 2QP9X 1B26A 1KAMA 2IIBA 5CNIA 4F2PA 1S96A 1XDUA 2PQ6A 4RTSA 4K6FA 1VYHA 4BFCA 1WG8A 2YIMA 3RTGA 1P2FA 4QXRA 1GQRA 1WXHA 3UJNA 4ZAVA 3TUJC 1H0HA 4NE2A 3TLKA 3C4QA 1LBSA 1UZUA 1SC3A 5DWDA 3WC4A 1BCSB 4DLVA 2RJ3A 4AD8A 1AHPA 2D4HA 3BMCB 5AW0A 2XZOA 1ESMA 2OPBA 4UHDA 3BH0A 3C1UA 2HBRA 2ZRPA 4C3ZA 1DC3A 5E8RA 2NX2A 3NDPA 5LMNB 2WQ7A 2AOUA 5FYQA 3GZJA 1XPRA 4O4HB 4TVKA 3B3FA 2QUBA 4WTOA 3VVCA 1NVGA 1PZHA 1SQGA 3REOA 3SF0A 4O4IA 3TCNA 1EBFA 1P4JA 2CCJA 5H0IA 2HJRA 1SELA 4YRNA 3BMXA 1DXQA 2OXIA 1D04A 3VNQA 2PVCA 2BHSA 2R1UA 3MUNA 4M89A 5DWVA 3AFHA 3I8XA 4IZIA 2IS2A 1EXMA 1QOZA 1UFVA 1YA6A 1TQ4A 1HDEA 3SKVA 3BQMB 5ITVA 1U7WA 3CW2A 1LPPA 2AF3C 4PO1A 3P52A 3W7AA 1XVTA 4AJ9A 3E9CA 1U1FA 2NXNA 1Z38A 2XUPA 3EXIA 4JBXA 2AG5A 3ON5A 1LEHA 1QRRA 4E1AA 1XQ1A 2WILA 1OXVA 2PLFA 3VZSA 1VXOA 3NM5A 4YX9A 1NYLA 3ZJUA 3OH8A 3FSEA 4V0NA 2GZAA 2GSWA 5G1PA 1QK5A 1Z83A 2PVSA 3DVRX 1XP5A 4BC0A 4CIVA 5HXAA 3ROGA 4EUHA 3S8EA 5K0SA 3MA0A 2Q0QA 2VXBA 5IS2A 1WXGA 1ZNXA 5E6SA 3UMGA 3ZE2B 4BPRA 1P1FA 3P2EA 3PXDA 4C0BA 3HWX1 3LWZA 3PC6A 3A1FA 1P7YA 4HDRA 1V6SA 4XD7A 4OMDA 4YUVA 3RQIA 3D6MA 4QUGA 1VL1A 3GFFA 3VU9A 1UKYA 1ZGBA 3A2LA 3QKWA 2GYVA 5ADWA 3RTEA 4BAGA 1ZR4A 4J0EA 5JG7A 2YMQA 4RVNA 2NU7B 3KFLA 1K1EA 2Q3DA 4XSHA 5BQOA 4CCWA 1CIVA 4PXAA 5J2TF 2OC4A 2VSYA 1IHUA 1D9XA 4XJXA 1OAOC 3DKVA 2HNKA 4B3SB 2HGSA 2QRNA 2ZFUA 4L57A 2I6GA 3HMKA 4IQ4A 3THSA 8ATCA 3PFFA 4A2PA 1FSSA 1BDIA 2WSSD 4PC6A 1QTRA 1U90A 1ZD2P 4YAOA 1IBMB 2QDXA 3FDFA 2HHHB 3FZEA 2G4VA 2E1RA 3C4JA 3PFNA 1L4HA 5ALKA 4Z5XA 1XRJA 1QHYA 2ZLBA 4V0RA 1XYGA 2BEJA 1FTSA 1MV5A 1IULA 2IL1A 3MTIA 3FSRA 2W6OA 1Z2NX 1PK9A 2VA9A 4O4LA 2FPGB 3H5IA 1XTUA 4W6QA 1NJ8A 1J8YF 3LI2A 4B4WA 3HJFA 3MTEA 5JDCC 5GONA 4GX5A 5AM4A 2IPNA 1LQUA 1U8CB 3UWMA 1GYPA 4PSCA 1NPDA 5LZ8A 1JU9A 4K03A 3ZHOA 3EGXB 1A5TA 1GTJ1 4IXMA 4B83A 2XOXA 3C8HA 3B7GA 3QEMA 1BYIA 1J0XO 3IUEA 4GE3A 1MRSA 1KBQA 1ZSYA 1QH1A 2G82A 2Q49A 4WZAA 1H05A 4Y2XA 2HCTA 4I4NA 4IWXA 1MEEA 3OPVA 4RHUA 4F9TA 2ZS7A 3M6LA 3R7LA 3EDQA 5HPYB 1KOGA 4WJZA 1ESCA 2NSHA 3ESDA 1BEEA 2XKBA 1KH2A 4IVQA 4QQFA 1KZ1A 2ODNA 2P1RA 3EPHA 2VHZA 1UK9A 4ZO8A 2OHXA 3A9UA 3KFVA 1G8KA 4EKYA 4HXGA 2OUKA 2AC4A 2WT9A 1YHNA 3U4IA 5A7HA 3OU6A 4C05A 3A1VA 3IJ5A 5HE9A 1GNTA 3DUFB 3LY7A 5KSPA 4CQLB 1QKKA 2DWCA 2C3YA 2WA1A 3FCXA 5CK4A 3CSUA 3I72A 2WKSA 4RZQA 5H70A 1DBPA 2IGTA 2X0FA 3SHWA 4UBLA 4IXNA 4FN4A 2JFWA 3KWLA 3ZY5A 3G2HA 2HC9A 1T91A 3KYBA 4HQKA 3LLMA 2VO1A 4FDTA 3WSVA 2NADA 3DLTA 1E6KA 2QRQA 3E7DA 3IA7A 1V1JA 4WBXC 3JQQA 3W6OA 1O9GA 3THOA 4LUCA 5FTWA 3ZWVA 1F8YA 4JVNA 1ZCAA 2VAXA 4I6JA 3SSNA 5JZVA 4A6EA 3QH4A 3H2HA 3OCZA 4UM9B 1JMKC 4JGIA 1OXBB 1OXXK 4GZMA 4QLOA 4Y0AA 1ZINA 3T9DA 4A26A 2VTDA 2UXCB 3ZQ6A 1Y3AA 5C3UA 1L5KA 2W70A 2XB8A 5EJAA 2JC3A 4BIIA 1GAWA 1P2VA 4OQYA 4C0KA 2C2ZA 4OJYA 1UXJA 1GSOA 3F5QA 4HTFA 4YT8A 3INRA 3EGDA 4D1YA 1J09A 3PGMA 2GUGA 3H3FA 5HKAA 5JFTA 1DNPA 4R54A 2Q5EA 3WP0A 4RH1A 5E4TA 4LF8B 1FNSA 4I9UA 3EG5A 4CQMA 3JZMA 1C4OA 3A9CA 4IH1A 5JZMA 3WWYA 4X93A 2QTFA 2YBDA 1ZGJA 2QAIA 1G8GA 2LDBA 1H8HD 2VPPA 2WM2A 4PC7A 1QYWA 4DABA 3TW6A 1U3WA 1Z5GA 3EXG1 3EPJA 2DQ4A 1IM5A 2GNPA 3LPDA 4UD6A 4XRRA 1E8DA 3RUDA 4R5HA 4A0SA 2CT8A 3ZDDA 1QU3A 3IJPA 3RVLA 4XB1A 2CXRA 4CKEB 4HDSB 1UXIA 3KTDA 3QYPA 1DB3A 1B0UA 4JKYA 4N7JA 1HNWB 3LP6A 1JAYA 2F6RA 3IIIA 1O57A 2FNAA 1KYQA 3AJEA 2NXJA 2QLBA 5SY4A 1MXFA 4LMPA 3Q87B 1V96A 1T2CA 2RK3A 3OLXA 5EUCA 2IW3A 2A88A 2DQZA 3FHCB 4DYDA 5BWCA 1YS4A 4XYGA 5I9LA 3AUTA 3C3XA 4NS1A 4TUYB 2XMGA 1J0CA 1IY2A 1XDGA 4EELA 2CF5A 4EWLA 1NMYA 1T2UA 4RF3A 4B3CA 2DFPA 3OE5A 3UWDA 5A3VA 1RCUA 3GEIA 5GZ6A 2J4DA 4MDEA 4DDUA 1LJUA 4BKQA 1ZD4A 3Q72A 4UC0A 3WL8A 5KOJA 4E5NA 4ND7A 1BD3A 1DS6A 1B7GO 3P26A 5G2OA 4JSTA 3I4LA 1EHYA 1O58A 3K53A 3BM5A 4PSVA 4DCMA 5F98A 1TYEB 1LDNA 3NANA 1Z6AA 4F1JA 1R4ZA 2NUPB 4G0NA 2BBOA 4MV9A 3QVVA 4TZ0A 3N2GA 4BV2A 5K3BA 1LQ2A 4ZCTA 1II9A 5K6AA 4RPHA 2H2FA 3NRBA 3IIEA 1TNDA 2LDXA 5EVJA 1LI7A 4YP6A 3GUHA 4H4EA 5HX7A 1WPRA 2O3TA 3WZLA 2ZJFA 1JPVA 2ATEA 3CEPB 3QEJA 5KNBA 1V5WA 4QDZA 5GMOA 1KHHA 2QM7A 3O5AA 2GO7A 1N6NA 4YCCA 4KE8A 3AVTA 5AKYA 3USCS 2NVOA 3EDCA 4Q6WA 5IXSA 1CG6A 1ADGA 1Q2XA 1WB4A 3EXAA 5JUWA 4GFDA 1AZSC 2HJVA 1R6UA 1PJ8A 3SJUA 4K9OA 2EBFX 3A8TA 4CF3A 3O1JC 4MIOA 2OK8A 4QARA 1FCJA 3T1OA 3CONA 1LF0A 3TSYA 4OEHA 3HVRA 2VBFA 2V55B 1N4DA 1U2ZA 2EL7A 1A69A 4EEZA 3DBHA 3LM8A 3QKRA 1U1IA 1T9GR 3EWSA 1EFRA 2P2DA 2FE1A 3FGPA 3QKTA 4XYLA 1L4NA 2C58A 1U3CA 1UDCA 4XDZA 1G21E 4RJJA 3FVQA 3TLMA 3I9MA 3LF1A 1N7JA 2WJIA 3R3SA 1SUEA 4G0YA 3FM9A 1KOLA 4ETIA 3FPBA 4CEHA 4G24A 1MAWA 1YJCA 4G1MB 3E9DA 3L8DA 4QLBA 2NWQA 5IT5A 2ZANA 2R4UA 4L5YA 3FOZA 2D1SA 3QPBA 5I4KA 1FTNA 5JATA 1A2BA 3PSHA 1EMDA 5DHSA 2X0RA 4KXWA 1M1YA 1CRQA 3GG9A 1IMOA 1NVVR 3IERA 5DHRA 2CVFA 4M6WA 2R6HA 4YDSA 4IFBA 3HJAA 4G4JA 5GGYA 3RRBA 3V8PA 1OXSC 4UULA 4DY6A 2G88A 2BHTA 4RSMA 3RB8A 1O0SA 3WFJA 1Y1LA 2HJ9A 4WASA 5IDQA 4GKJB 1NDQA 1JU3A 3LGAA 3PEVA 1EA7A 3P9NA 4OHCA 5INTA 2EG9A 3ZDAA 3NBAA 1CD5A 2R8RA 2O6LA 1XTVA 3NCHA 3FHJA 3OUZA 4HRVA 1RRVA 1F2VA 4ZI7A 1GA4A 5I7RA 1RI4A 2J30A 3B7PA 4U3JB 5BNWA 3HYTA 3BXEA 4PLPA 3UPDA 3GLUA 1JL3A 4NU6A 3JYQA 1U1EA 1Z22A 4MW4A 2QTLA 4N8EA 3ZWNA 2IU4A 2FLWA 3NAGA 4B3BA 2H7VA 4CMJA 4X3PA 4PPFA 5A6VA 4YMIA 1TQ2A 4B44A 3B9PA 2KB0A 4CETA 5A9SA 3O94A 2OFFA 2YCBA 2R7KA 1OI3A 1MRZA 1K8XB 2GFQA 3D43A 3BMOB 1NAHA 4WWHA 3NDBB 2DT5A 4E5DA 1ZK4A 3GLHA 1U3VA 4X45A 5F77A 5GM2A 3TTYA 3UUGA 3TW0A 1P2TA 4PAMA 2ONJA 2E7ZA 4G41A 2BEVB 2ZPAA 3SZMA 5F9HA 4AU1A 1GL9B 3KSUA 1QH8A 1C7ZA 1SB8A 1DT5A 2BTQA 4KR9A 5LDGA 4RD1A 2PZMA 4L76A 2VQ6A 4Q9HA 5FWXA 4QFCA 1CP2A 4COKA 1Z88A 2QRHA 3NWJA 4W1QA 4KYVA 3R3VA 2V0NA 1D2HA 1CTQA 1QJCA 2WWTA 5UKDA 4WXMA 1ZN2A 4GHWA 1Z07A 4DBVO 4DLWA 1BGWA 1YAHA 4BX8A 2WWRA 3QLVA 2PZJA 3OLZA 4Y2PA 1R6AA 1FRFS 4FJ0A 1YNSA 5CLFA 3EB9A 3SC2A 1RZVA 3B3JA 5JS6A 1XMOB 4KO8A 2AZDA 4QPJC 4Q7MB 2GWHA 5ARCA 2I1QA 5B58T 2QU7A 5HDQA 3AEYA 4ENVA 2XBLA 4BLTA 3JY6A 3P2YA 5JFGA 4J7AA 3BGIA 3MMXA 4MUXA 1OI7A 4MWGA 4UBNA 4PFKA 1AHIA 4MRNA 2KYRA 3I28A 1J22A 2PS3A 3OQ1A 4H35A 2VYVD 4PZUA 4B2PA 3M5CA 5AK3A 2RB4A 3F98A 1UM9B 3KJNA 3N3BC 5DK6A 3FUUA 3RM3A 1XWFA 4R4JA 4F2DA 4B31A 1G59A 4KE6A 4HB2A 1U7UA 3NBZC 5GIPE 2ISSD 4MRRA 1UDWA 5K4AA 4MVJD 3SBDA 1I2CA 5JAUA 1XKQA 1SIWA 4AICA 3GR6A 4Y2RA 4CLOA 5CLJA 1LLDA 1O7JA 1Y6GA 3N6RA 5EWMA 2B1GA 2R25B 3DL7A 1GIAA 3K15A 3RU9A 1P2UA 1TKCA 2QIPA 3AKEA 3GEGA 3V6LA 5I8PA 4R2WA 3DMPA 3EDOA 3I01A 5IVDA 2YFHA 2H9AA 1PE0A 2HIAA 5CCBA 3PUVA 1VMKA 5I8ZA 3HDJA 2QV0A 2G04A 3TJRA 1JKMA 2X6RA 5JANA 4K9MA 4IJ5A 1W5BA 4HY3A 5AKZA 1XQYA 1OLSA 4JS0A 3ZQ4A 3GGGA 4QG3A 2PWZA 3A37A 5FUWA 4PV7A 1QFZA 3X1DA 1C1HA 4OGFA 3HA3A 4PEVA 1MX9A 1DEHA 1CJCA 3CG4A 5A9SB 1H2EA 2E4WA 2P91A 4KITB 3LA6A 4C6TB 4XI9A 2W0MA 4XIYA 3RBXA 4EH1A 4A15A 1UFQA 4IDCA 3U4AA 2J9FB 3FSGA 1O8BA 2ZDQA 3PX2A 1GFSA 3RYHB 4EJMA 4JI8B 3A3YA 2BCJQ 3JXEA 5TQ2B 2B0CA 2IHKA 1K3FA 5EMLA 1MVLA 3BD9A 5DXJA 3KPUA 2E6UX 4RIIA 3MTAA 2W6NA 4BN4A 3DAHA 5IARA 1UAAA 1YI1A 3I9LA 3DP7A 4N3AA 4YRFA 1ZM3A 3SX4A 4MULA 4EO9A 2GN9A 5BV0A 2BKAA 1HE8B 5BV2P 2ETVA 1P5FA 1YDWA 3AW8A 1K4KA 3GJ8A 5FTKA 3TOVA 2ZRGA 3VR4H 1SOUA 3BSYA 4EOGA 2Q3FA 3L6DA 3K6KA 3A0RB 1O5IA 3C7DB 1HE4A 2D5BA 3QLVC 5LQUA 2BGGA 4FYXA 4KVGA 1TCVA 4PO8A 3AI1A 2SKEA 5A6SA 1DAPA 5LB2A 4QYTA 2Q3LA 1D2AA 2YWCA 4HF7A 4KBYA 3OZRA 4OYHA 5F21A 1VKRA 1VL6A 3FUXA 4UDYX 2I6QA 5IKXA 4S05A 1Z0DA 4F5WA 3ILXA 3DEIA 3BJMA 3C45A 1BQ4A 1G7SA 4QC2A 3GRFA 1OYVA 1W85B 3FIUA 4XWYA 4EYKA 1OLXB 2CYAA 1XGKA 5JAQA 3RBAA 1BOOA 3ECAA 2BGMA 2Y1KA 2W6QA 3EY4A 3QVUA 5KU1A 2Y6UA 1U8FO 3M5DA 3ONNA 1RYHA 2K2WA 4IIJA 4TLCA 4BGUA 4C6SA 1NG9A 1MVNA 1ZCFA 3QVXA 3CGWA 3KZCA 4TL6A 2WSSA 1FQWA 2XNDD 3MFQA 5KWVA 3EXHA 1H2XA 3B78A 4JEMA 4PPYA 5CAEB 1FVOA 1J06A 1FXUA 3UWSA 2BJHA 2IWRA 3OTWA 4HX5A 1WPQA 3SE7A 4ER6A 5EVCA 2VJYA 3IURA 5CP8A 1NVDA 5DX0A 3DHVA 4OI1A 2VAVA 2OFXA 2G0NA 4MKXA 1OTYA 3RHFA 2YV4A 3L7OA 4XIJA 4MPRA 4GF5A 3NNDA 1NVEA 3I5XA 5H02A 1Q95A 3KWFA 2QTBA 1NMEA 1N5DA 1SCNE 2HRDA 1QB8A 1T5SA 3A6ZA 2GETA 1BEZA 5IYZF 1AQ6A 4ARBA 3OZTA 1XJWA 3LKBA 1C3LA 4A9AA 4HWOA 2Z2XA 4IFTA 2HHLA 4FE7A 2R48A 2VJAA 3BB4A 1UK6A 4CWAA 3U7HB 4RH0A 1TYZA 1CQWA 3OJ0A 5F9MA 3U7JA 5L3SB 1Y7IA 1TEXA 2WYHA 3DE6X 1NUUA 5L45A 1GUZA 3L8FA 1QP4A 1FUYB 2B5VA 2WVGA 3NHWA 3TZ6A 1BRTA 1YVEI 4YJDA 3NHFA 3WGVA 4QTXA 4IRMA 2QQFA 1T5LA 3WQSB 1ZH2A 3L7MA 2RBGA 1FFCA 4V1CB 3PGXA 1RFLA 3GFVA 5DLQC 4GMGA 4Q03A 3E8MA 5FOXA 4DLNA 3VYUB 1UBOS 3J7TA 4UM8B 4C6RA 2X0DA 2QE7A 3K9WA 3OG9A 5DGCA 3ROZA 1ABBA 1SCJA 2QR3A 4MUFA 4KHPB 1RXWA 2HXSA 1SCDA 3B6MA 3DMGA 4JVMA 2WJZB 3TVTA 4GI1A 3MFYA 4XOUA 5A1JA 4I19A 3R5JA 3TQHA 1J1UA 4H3KB 2XZLA 3NBUA 3AKYA 3B2QA 4X7BA 2VDNB 4ER3A 2F3RA 2WP0A 3WL5A 2IEBA 3O3MB 3R9IA 5EEHA 5JNSA 1T8UA 3I2GA 2W83A 1L4KA 4JC0A 5K6AC 1SHLA 3G2JA 4TV9B 4KFCA 2MR5A 3V8EA 1KRHA 1Y6FA 4JR2A 3FLBA 3X1KA 3BBPA 3E9EA 4IY1A 3RVBA 5EZ6B 3GGOA 1B0ZA 3FCYA 2FWBA 2YFKA 2VDLB 3AEZA 3Q7TA 4S1WA 5THKA 4YV1A 1F0YA 2XH8A 5JIBA 2RGAA 2VQFB 3C3CA 3IVXA 2P4EA 3VDNB 5DBFA 4H1UA 1CV2A 2P1DA 2D7DA 4KPGA 2AW5A 4W4TA 2ACEA 2JGIA 3ZWCA 1NNEA 1IY8A 2GSDA 3HCAA 3CNHA 2H5JA 1DAHA 1YQTA 4Y0VA 2H63A 4WZAE 3PX3A 3KB1A 3M6MD 3QX8A 2ZIXB 3N76A 4IGAA 5E3JA 3UVEA 4A0GA 3ZZ1A 4MQLA 4NG5A 3EZ9A 2HCFA 2QQGA 2D7CA 4FYHA 4WNYA 4GR5A 1NW5A 5IVHA 4P0TA 5LKRA 4LJRA 2X8JA 1CZLA 5KSWB 2PU5A 1P6UA 1PD1A 2JCXA 4BQQA 3SDZA 2PQMA 4WACA 2C2HA 2IIPA 4EA6A 4PGFA 3LK7A 1TEHA 4DUGA 2VK1A 3R8CA 1H1LB 3RNLA 4G0OA 3MJCA 3BKXA 4FMDB 1T5IA 1GTG1 4XIGS 2AX4A 1PGJA 3H0EA 3IBTA 3WHLA 1L7OA 1WIWA 1IBCA 4BV3A 4TTPA 5HZGA 2AX3A 5KKAA 4NV1A 3UGJA 4I50F 5HK9A 3P9SA 5HW0A 4RDIA 5JD4A 5CIWA 4ZOLA 5L3SA 2O2SA 3GJTA 3A6LA 3G9ZA 1JEJA 2WKWA 1WBBA 3MWYW 3T8YA 5DN9A 5IT4A 4FN5A 1DKMA 3GF4A 4KPUA 3H65A 4ND5A 3UGKA 4EK9A 3FFXA 3ZC3A 5AW7A 3ZEIA 2YINC 3GO4A 3PFWO 3U3KA 1CR2A 3FCAA 2OC9A 4XUDA 4NL4H 1GQ2A 2JVKA 2WAMA 3S2GA 4FIZ