1RCFA

Structure of the trigonal form of recombinant oxidized flavodoxin from anabaena 7120 at 1.40 angstroms resolution
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
169
structure length
169
Chain Sequence
SKKIGLFYGTQTGKTESVAEIIRDEFGNDVVTLHDVSQAEVTDLNDYQYLIIGCPTWNIGELQSDWEGLYSELDDVDFNGKLVAYFGTGDQIGYADNFQDAIGILEEKISQRGGKTVGYWSTDGYDFNDSKALRNGKFVGLALDEDNQSDLTDDRIKSWVAQLKSEFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the trigonal form of recombinant oxidized flavodoxin from Anabaena 7120 at 1.40 A resolution.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Electron transfer(flavoprotein)
molecule keywords FLAVODOXIN
total genus 57
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 1994-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rcfA00
5LMCA 1CZRA 3N3AC 5LLDA 4DILA 3NFRA 4YAFA 1J9GA 1T0IA 1YCGA 1BU5A 3F6RA 4OXXA 4F8YA 3NHFA 2OHHA 3FNIA 4FX2A 4CETA 4M0CA 2R97A 1FX1A 1C7FA 2Z9DA 1TLLA 5FA6A 2Z9BA 3ZHOA 4C0WA 4PU0A 1CZHA 2KQUA 4FGLA 1F4PA 3NHUA 2ZKIA 4DIKA 4S24A 5TGZA 1SQSA 3W78A 3ESXA 5EAIA 1J9EA 2HPVA 4HS4A 2N1MA 4BMOB 3GFQA 1AKWA 3HA2A 2A5LA 4ZVNA 3QE2A 1GG5A 4N82A 1VMEA 2WC1A 3OJXA 2MOKA 2R96A 4GR9A 4GQIA 4N65A 1T5BA 4QODA 1RCFA 1AKUA 5LVAA 1H69A 1SG0A 5LJIA 3W7AA 1CZKA 3OX3A 4LTDA 1E5DA 3OWHA 2RG1A 3LCMA 1CZOA 3TEMA 3ESYA 4BMPB 1RLIA 3FX2A 2B3DA 2QX8A 3TZBA 1YCHA 2V5VA 2OYSA 2Z98A 1CZNA 3N3BC 1DX9A 2QR2A 3G5MA 4Y9RA 4U7FA 1FUEA 4ZVKA 2QWXA 4YAWA 1QHEA 3B6IA 3F90A 2FDXA 4LAFA 3K1YA 1ZWLA 5LBUA 1QR2A 1XYYA 1AG9A 1JA0A 1AKTA 2FX2A 1D04A 2XODA 3UXEA 4ESEA 4C14A 3SVLA 1J8QA 3NHRA 3LT5A 1QBGA 3NHLA 1H66A 2KLBA 3B6KA 3OVMA 4QOHA 3JSXA 3NHYA 5NLLA 1C7EA 2V9CA 2X2PA 4QOGA 2QX4A 5FX2A 3W77A 3W79A 1D4AA 1X77A 2BPOA 2BF4A 1V4BA 1DXQA 4NLLA 4J8PA 1OFVA 4U7HA 4CF6A 3P0RA 2M6RA 5EMNA 3NHWA 1XYVA 4DY4A 4ZVMA 5A4KA 1I1OA 2FCRA 2OHJA 1FTGA 4U7GA 3FW1A 5ULLA 3O73A 3KLBA 4HEQA 1OBVA 3RPEA 3KAPA 2Q9UA 3D7NA 4QOEA 3NLLA 4YQEA 4D02A 1DXOA 3EDOA 3OJWA 1BVYF 1AMOA 1YRHA 3FJOA 3OWXA 4ICIA 4QOIA 1ZX1A 2OHIA 2QX6A 4ZVLA 4LA4A 5F4BA 3U7RA 6NULA 4YAUA 1YCFA 4XDGA 5LJLA 3FVWA 4C0XA 2XOEA 2HNBA 3L9XA 1ZWKA 3GFRA 1OBOA 2FZ5A 1AZLA 2D5IA 3ES9A 4Y7CA 5EA2A 3UXHA 2MT9A 1FLNA 4LTMA 1WSBA 4PTYA 1YKGA 2HNAA 2MWMA 2FZVA 2V5UA 3OX2A 3EYWA 4FGKA 1D03A 4XDHA 2Z9CA 2BZSA 1AKVA 2F1OA 1XT6A 1AKQA 3L9WA 5FUQA 2M6SA 2QMYA 3HR4A 1KBQA 5JROA 2GSWA 3GFSA 4FGJA 2QMZA 1YOBA 1TIKA 2Q62A 5BUCA 2FOXA 4NULA 1WSWA 3O2NA 4PTZA 4R81A 4YALA 3TE7A 2AMJA 4N9QA 2QX9A 3QFCA 3KAQA 3N39C 3NHPA 3QFRA 4GI5A 4H6PA 1AHNA 2FVXA 3HLYA 5NULA 1YDGA 3F6SA 3NHJA 5LBTA 3S2YA 3NHSA 2BN4A 3F2VA 5F51A 1FLAA 1CZUA 1FVXA 1FLVA 1NNI1 1CZLA 2W5UA 3OX1A 1B1CA 1JA1A 2MTBA 1RTTA 3KEGA 3NHKA 4QOFA 5B3KA 2FAXA 3U7IA 3K20A 4LTNA 1AKRA 4Y9UA 5B3LA 4C76A 2X2OA 1RLJA 2ARKA 1XI2A 2BMVA 3GAMA 1J9ZA 1KBOA 3B6MA 3R6WA 3ESZA 4H2DA 4QOJA 1FLDA 5F12A 4YAOA 1QRDA 2FLVA 3B6JA
chains in the Genus database with same CATH superfamily
3PJRA 3UK1A 1ODFA 3DFKA 2QUAA 1TNDA 4QBTA 4U2FA 3OQVA 3H9CA 5D7BA 2OA0A 4JUDX 2HXGA 1TLLA 3AO0B 5IXSA 4HWSA 4BCCA 4U7WA 5REQB 2VOJA 1CCWA 4AMYA 2FW6A 1T0HB 2EZ8A 4KBYA 4CCYB 4O2AF 3A10A 4L74A 3ANYB 3HKCB 1KJJA 3ZDFA 1NJGA 5L40A 2PUHA 1V3VA 1VCNA 3A26A 5MGBA 1FQKA 4M86A 4LE1A 2IHUA 1CKEA 4PNZA 1X7YA 2YFKA 4G97A 4MITA 3U31A 2HADA 2Z83A 1KJIA 1RYFA 3OX3A 3AP3A 3ZIDA 2V97A 4ZZ3A 1H2AS 2FXIA 3DR3A 1RLIA 3GT0A 4PQYA 1LPAB 3VZCA 1TJ4A 3ILHA 1BVRA 3NGLA 1P4SA 1KAMA 2NWQA 3FCUB 5DB4A 5K0GA 2ZZNA 4PZUA 4EZEA 1TQ2A 3MJTA 4LOLA 1P61B 2OT3B 5KJEA 5EMMA 1QHEA 4JMPA 1U3DA 2ZSFA 3SBXA 4DJEC 3GMDA 3BMNB 1V9SA 3TCKA 5AW7A 1EFRA 1EFPB 3KWJA 1VGVA 2P0EA 3F98A 3BFKA 4E4TA 4YYZA 4B6GA 3I1YA 2MYNA 5B53A 5BPFA 1K8QA 4XI9A 1SHKA 4JLSA 4FDTA 1A77A 3SOPA 5JCPA 1OAOA 1XTQA 2I6QA 1ZGAA 1ZIPA 2FKAA 3EXFB 3G2JA 3LIIA 2CMKA 4RU1A 3K8OE 5B1DA 5H4GA 1S01A 2BSQA 4OGLA 3DKRA 1UXGA 4R16A 2Q5OA 3FCCA 5LZ8A 1CG6A 3AEKA 4PGFA 3C85A 3RV4A 3EC2A 4I5DA 1CF4A 1E59A 4NTZA 5JALA 2I91A 2CL7X 1BCSA 1YJ8A 4YP5A 3FA2A 4OFXA 4XDGA 4MCHA 3UKJA 4JJGA 3U4QA 4YCLA 2GKGA 3MMZA 5CW1A 1RKUA 3S28A 2FN7A 3VNQA 4MWOA 4XLZA 5AMXA 4L0CA 1ZIOA 4UQOA 1M1YE 3G88A 1DV2A 3ITDA 4NZNA 1BS1A 1O3YA 1UP7A 2ZPTX 3BGVA 3G0GA 5DTRA 3KQVA 3PPIA 4GPTA 3B1WA 4TKUA 5AICA 1Y6GA 1NBHA 2PT5A 1Q6YA 2C59A 2UXCB 2GAFA 3ZCPA 2DH5A 1HV8A 4O1IA 1YZFA 2FOXA 2O4CA 3PPXA 4OBWA 4KPFC 3IQZA 4URFA 1QC5B 4EF4A 3BWVA 4MZXA 1F0KA 4RVDA 2P5UA 4E3WA 1W7AA 3FHOA 5AW5A 2DTXA 4M88A 2EU8A 4MVJI 4GKAA 4BVFA 4U2KA 2W0MA 4ALIA 1KO7A 4KQJA 3EDCA 5KTSA 1QONA 4QYIB 2R5WA 4WNYA 2XZLA 7ADHA 1L9KA 2A14A 2PA0A 3OTGA 4ZT5A 4WCFA 4AYTA 3EFHA 3H1PA 5EZ5A 3VOTA 2O5RA 4B3FX 1DADA 4W1PA 4A82A 4PO8A 5KCMA 5AI9A 3WRWA 4NJMA 4AULA 4I1RA 5K1ZA 3DSRA 1X14A 3W8RA 3UJ7A 2HWWA 1QRDA 1SCUA 4KRXA 4ZRDA 1U1EA 1BX1A 3L4BA 4OMCA 5MGNA 2I54A 1NVDA 2WJ4A 3P9XA 3R41A 3LV8A 4RMIA 1AH2A 4RHTA 2DYKA 1EBUA 3JQGA 3V8EA 1TUEA 2AQKA 1W6UA 2AV6A 4FGLA 4IF6A 4E22A 2BV3A 1KK0A 3U61B 2ORWA 2HK7A 1Z06A 2GFQA 4MUFA 4S24A 3FR7A 1Z34A 3CURA 4XAQA 4CEHB 5B36A 4MYUA 4RW0A 3X1KA 1GY8A 4UEOA 1MENA 5IKPA 2QP9X 1DFIA 4ZVUA 1KZ1A 3IBFA 5IF9A 3RYFA 1K7YA 2IW1A 4C01A 4EA6A 3CVWA 4U7PB 4C4TA 3WYFA 2YV2A 4YR7A 3BBPA 3WQQA 1VLJA 1Y89A 3AOGA 3TIVA 2PZLA 2BMJA 2OOSA 5EIAA 1NT4A 2W6JD 1YONA 3KT6A 1JDVA 3ZV3A 2YJZA 3N0WA 4GBMA 2H54A 3PHHA 4RSRA 4B6PA 3ZHTA 1FBTA 5BN3A 3SIRA 1RRGA 4M53A 2DTEA 5LNK6 4RKFA 3S29A 1E64A 4QL3A 4S1WA 3MJHA 4DQXA 3RVRA 4UUOA 4WOKA 2CLDX 1NF2A 3SYNA 3FCSB 1AN9A 1VIYA 3UWMA 3H3XA 1AOXA 1Y1KE 3E9RA 1PGJA 3ILSA 3QVXA 1ZM7A 4I5IA 4D99A 1YUMA 5I45A 4DDKA 2QIPA 3PHIA 5DMHA 1SC3A 3C3PA 4U0KA 1I9GA 5CM2Z 4N12A 1MW9X 3H2KA 4CF6A 1KFCB 2M6RA 3SYLA 1Y3CE 4XVRA 1GN8A 4FFRA 2J87A 2OV1A 2XE8A 1AU9A 4Z7OB 1DXYA 3GLSA 5DNDA 1EGQA 1GFIA 2YYZA 3KLMX 3UGQA 3MCZA 4GG1A 4C0BA 1E1RD 1NV9A 2W8ZA 2YOHA 3D3NA 2BHSA 4OUDA 3BRSA 1U4NA 3TNLA 4YI5A 3NHAA 5JWOA 1S2MA 4EEXA 10MHA 3U4GA 1EX9A 4UM5A 3KJIA 1RADA 3RUCA 3ZTTA 1NL3A 4H7KA 5L53A 4OQYA 2FWJA 3LA6A 3BH7A 4W7IA 3TW8A 3AR8A 3OJ0A 1T36A 3ETDA 4PXSA 3VR5H 1PEDA 3KQMA 2PZAA 1KEZA 2YJTD 3MGAA 4Z51A 3CNQS 4XVQA 3B3GA 5EA2A 1H8HD 1OLXB 3A1EA 5FPKA 4Q4HA 4OF4A 5H02A 4OXKA 3P2OA 1HA3A 5EE0A 3CV3A 1U8EA 1YA8A 2AR0A 3R6GA 4HB4A 2H06A 1T9DA 1QFYA 1TTHA 3MJFA 5JROA 2O0JA 3CUSA 3EE6A 4MYDA 5A05A 3UYKA 1BFUA 1YJCA 4PWZA 4Q00A 4PE5B 5DBOA 3FTNA 3ZHRA 1B3RA 5BT9A 5BUSA 1QYDA 2Q7XA 4LECA 2RAUA 3W8EA 5K9ZA 5JD5A 6LDHA 3N2LA 1BDHA 1VJDA 2EDCA 2CXOA 3K70B 2O8CB 1CZUA 2UXBB 1VKJA 3NVKI 4RGBA 1LV8A 4CRWB 5DGHA 3EEYA 1MOZA 4S2UA 3EC7A 1Q20A 3GVPA 1NFQA 2LDBA 3X1DA 2EFGA 4X6UA 4DR3B 2GZDA 1QFMA 2F48A 5HF6A 4I8IA 2W42A 4P2GA 3E15A 1N7GA 3ODGA 2F3QA 3GELA 2FLVA 1JDBB 1S2GA 2P62A 2PLAA 1V25A 2C8KA 1G2IA 2WJJA 5HPYB 1QKJA 3G1TA 3DJYA 2O07A 4LNUB 2VAMA 1OBHA 4R6XA 2CJWA 4JA0A 2RH9B 1MJNA 1H2FA 1ZA1A 1K5HA 3JQGB 4IVNA 3LHKA 4Q1EA 3V1LA 4EHIA 3D5EA 1DAGA 1AIPA 4ZEMA 3FUCA 3VNVA 5JQWA 4YXWA 1PCXA 1YNSA 1P81A 3EW9A 2UXDB 1U94A 3QWBA 3V1KA 1Z6YA 2X0EA 2J9FB 1O9HA 3K9QO 4D8XA 1P2TA 4Z1MA 2M32A 3K5WA 1ODKA 4I0WB 5A02A 3EY4A 2IU0A 4OGGA 3DEZA 3UMRA 3CJTA 4ZI5A 1ESCA 4DNXA 3T1HB 2YIMA 1WO8A 5K2MA 2JC3A 1QS0A 1F06A 3PFNA 5CAEA 2J85A 1GSIA 1YS2X 3MWDA 4UDYX 4A7PA 1QQAA 3FGPA 3MXOA 6ADHA 2VSYA 1C9MA 4TLDA 4YT8A 3I61A 1IB6A 5CFQA 2BFDA 4FSHA 1GFSA 4IDCA 3AERB 4LJ6A 4KR2A 3D64A 2IPOA 4B83A 2JIQA 2BM1A 2BP7A 2X2EA 3OKCA 4HQ0A 4NMMA 4OQQA 4ACAA 1DWOA 4ZAWA 3MTGA 4YMTA 1BA2A 4QM7A 1BNCA 4XQEA 2ZRKA 3ZWNA 4RCVA 3LTEA 1V16A 1PZGA 1TYZA 1R66A 4NY1A 2DUUA 4I1IA 1R5OA 3B52X 4P7FA 4DYVA 4ZZ0A 1Y7PA 2DHEA 4GUAA 1JG2A 5BOSB 5AVSA 1TJ3A 3PEUA 3SP1A 4CR7A 3L0BA 1QH1A 1V9CA 2Q3LA 3QHQA 2PVPA 4J3JA 2ZRHA 2CDBA 2WKPA 3ULKA 2J1LA 3OLVA 1YA6A 1H2BA 1N5MA 1QE3A 2VT7A 3QYPA 1GKYA 4KLAA 4K03A 4Q18A 4QJBA 4XX1A 3L77A 2FDRA 1Z0ZA 1C8BA 4YQZA 5DTMA 1KC3A 1GTG1 2WTAA 3O3MB 2I4NA 1NKSA 4HY3A 2ZXFA 3JQAB 4FEGA 4XGIA 3JYOA 2JVJA 3EH2A 5K8CA 4DR2B 3BCSA 3PNPA 3O94A 5FWDA 1XD9A 2ZI9A 4K6MA 4PGGA 5JV5A 1ISPA 4DCUA 3IP9A 4LFAB 4L5AA 1P80A 1FK8A 1KC1A 1LBQA 5JVDB 5EE5B 1ZH2A 1G9XA 3QU9A 3TWOA 1USKA 2P6UA 1IK4A 1IHPA 4NULA 2QF7A 2NUBA 1UP4A 2PHZA 1FJHA 4MS3A 2HCJB 4CMBA 3N39C 3TRDA 2VAPA 3TRKA 2R1VB 3PUIA 2PQ6A 3VHQA 3GRPA 2FUNB 3FCXA 1RQNA 2R1ZA 4RAOA 1FVXA 4O5OA 1YBAA 4J2OA 3DKPA 5H8WA 1JFTA 5EUBA 3MMNA 3EC1A 3GPLA 2IV2X 4ND7A 1JDPA 1F8YA 3E9CA 3GFVA 3DE2X 3AM3A 3F74A 5H9WA 1CRPA 1OILA 1PFWA 3GNTA 2YY5A 4QOJA 3TQRA 3IEKA 3HCCA 3STTA 4ZI2A 4XUGB 1VBKA 3EB9A 5DPMA 1UL1X 1Z4IA 3TTVA 1Q19A 3GJYA 1UK6A 5BSUA 4L3VA 3AKCA 1T9GS 4E31A 4BQOA 3VISA 2B4TO 2HPZA 4HWOA 2DUJA 1HH4A 1JSCA 2MJLA 3DLTA 4FVTA 4JXXA 3M6LA 2HA0A 4WXEA 3HNRA 5BRAA 3AR3A 3HCEA 4R0NA 2OCPA 1VJTA 1X8JA 3L41A 2XZPA 3STXA 3NALA 5K05A 2NACA 3ZHUA 5COAA 5JY1A 2ZS7A 1EBBA 1ZR4A 1IVYA 4O08A 4AIRA 4YAKA 2BKEA 4O6VA 5FTJA 3O9VA 1OZ0A 2HA7A 2JK0A 4M55A 4JODA 4R2XA 4HEA6 3RE1A 4B71A 4GBED 5JARA 1EUQA 1W59A 1UBCA 4UD2A 1UIRA 1USUA 3G79A 2D5AA 1MTZA 1J8FA 2P2SA 2Q9AA 4J0GA 1ZS9A 4IIHA 4YCDA 5B1SA 1JQKA 3WGLA 4ARVA 2H0QA 2N3ZA 2QLBA 4F6LA 4Z4GA 3VU0A 2IEDA 4G8DA 1QR2A 1TJ5A 2J3QA 2XNCA 1DAOA 4HNSA 3H9JA 4ENTA 4QUGA 2G71A 1ENOA 1UEJA 1UK7A 1FOEB 4IILA 5FULA 4LOIA 2IPNA 3A25A 4KPYA 1H5QA 3PD1A 4EG6A 1F0YA 2PUCA 4JAVC 5EGNA 1CUJA 1UM8A 1KGSA 3W79A 1QO7A 2HREA 3VYRB 4MPPA 1Z0FA 2I4IA 1X9GA 3CNEA 3NHWA 3HMQA 2Z2XA 3MD9A 4QUAA 4EFNA 4NV3A 4IBOA 2Y4NA 4N7RA 2H2HA 5LU9A 3A4MA 3ZHZA 2YHBA 1U98A 4DMGA 4IJUA 4TKMA 4IVRA 1ECBA 4QD3A 1HQDA 1GGEA 4EUNA 2W2XA 1W4RA 1CIVA 3GDGA 1J22A 2FHSA 4A8JC 2FZWA 2WHQA 3K1ZA 1I14A 1RQPA 4RH0A 4H18A 4D79A 1ULZA 1ULBA 2KPOA 3IHKA 2IIVA 3BXGA 5BSRA 3PICA 5BV7A 2RD2A 1HT2E 2GXUA 4ENVA 3QTBA 2G1KA 4LMRA 5E4FA 1R0XA 5KNDH 3TPZA 1HE2A 3M3DA 2Z95A 2OZPA 4LE0A 1M2FA 5I9LA 3KUDA 1FS6A 3MAGA 2IYVA 1TVKB 1K2WA 3PUYA 2VJCA 2I6TA 1IHDA 2O5CA 1NF8A 1US8A 5ILQA 1DKMA 3WOVA 2C8JA 2HQ1A 4O4HA 5EQTA 1E5LA 2BSAA 2CC2A 2Z1MA 4BC0A 4UM9B 4IL5A 5DX0A 2DR3A 4CZ2A 4MIOA 4TLBA 5HTKA 1BO6A 1E96A 1U1DA 1QX3A 2FH5B 4IIEA 5AXCA 2OYRA 4N0EA 1Y7IA 4DY4A 1BEZA 3HP1A 3UAWA 1H1LB 2WFMA 3IQXA 3RO7A 5IT9A 1SM4A 1YRQA 3STUA 3P96A 3EWNA 3OQIA 4JJ8A 4C76A 5F9FA 1TF2A 1JS1X 1LU9A 1SXJD 4J9UE 3SM3A 1P0IA 4MJ7A 1FP7A 2BCEA 3B89A 3DTYA 1REQB 1ZHHA 2Z3ZA 5K3CA 1MFPA 3HN2A 1O87A 1A95A 1RLTA 3BE5A 4GP6A 3KDPA 3OJOA 3T9DA 1OB5A 1UIMA 3BX1A 1RPZA 3T61A 4D8WA 3CFYA 1F8XA 3HYNA 3ELUA 1I1HA 1MDBA 3AQIA 4BMZA 1FU7A 2CZCA 3K09A 4D9KA 1CZHA 2QSZA 3GRZA 2H7VA 1LY1A 1RM5A 2GHQA 4H4CA 4KBFA 2D5CA 3NTUA 2XE7A 3JCZA 1GAQA 2XKAA 4OI4A 2IYFA 3E84A 4WY5A 3MRXA 3VVCA 1YR3A 1CP2A 4AN1A 4GI2A 2AFVA 3KZMA 3ZWPA 3LS2A 1J8MF 2HCFA 1GZUA 4LQ4A 1A9YA 3ZWXA 5GPBA 3L4KA 4ZEOA 2IYAA 3AGQA 2XOKA 4BMDA 3CKKA 5FYQA 5BQXA 1B6TA 1CE8B 4MWGA 2PSEA 4JKOA 3VTZA 5DO9A 1CERA 1GHTA 5KWVA 4UUNA 2O19A 4LYAA 3MWLA 4QTXA 1BCRB 2IZOA 3E3MA 1BXKA 3H04A 4XD7D 3D9QX 2W7TA 1GQSA 4PLTA 1VHWA 4ZICA 2VJQA 2GUWA 4ZU6X 4ZAVA 3W4KA 5B1HA 3WLRA 1JLKA 4WJLA 4ESEA 3RSFA 4FINA 3AKYA 1RZRA 4NZ9A 4E5DA 4MAMA 1L1QA 4PPFA 1QYXA 4JYMA 5FWYA 2CBZA 3JQ8A 2VDUE 3AEUA 821PA 1K7XB 2HBZA 2XIJA 3ACDA 1A9OA 1XVAA 3EZ2A 2QAIA 4K7JA 4R01A 1V8BA 4HX2A 2AVNA 2DTDA 5IKMA 5A3QA 3Q8KA 2BKXA 2PRIA 1NQUA 2BUBA 3I3SR 1AMUA 3C6BA 1T9ZA 1DT3A 1BXRA 2QD2A 1TZMA 4LRWA 4WBSA 1RYYA 3C5WP 3CSUA 2OD2A 2SCUB 3FUVA 2A9OA 2E5WA 2HF9A 3KLBA 1CNEA 1WPXA 2KX7A 5G0TA 2WSSD 4I4TB 4E0BA 2BEUA 3ZHVA 1KY4A 4EG7A 3A6LA 2CNWD 3W5BA 2GK7A 4HMQA 3A3YA 3JD2A 1K9SA 2LDXA 2E87A 1P4HA 5GP1A 1G18A 4BNGA 4DMFA 3KSUA 4XQ0A 4EDFA 2ATIA 3PLRA 4GW3A 3ANSA 3A58B 4J7AA 2JCYA 2W98A 3QX9A 4G4SO 4L2IA 1VKZA 1XJCA 2SCUA 5FF9A 5GJWC 5LXTA 1ZMTA 3DBHA 1RD4A 2WJ6A 1I4WA 2M1ZA 3KZVA 1Z2PX 4FZVA 4GLFA 4JT9A 4L78A 2QN6A 2ZR9A 4RH1A 4J16C 5G40A 1L5GB 2QRKA 3U4HA 1IZ9A 4E2WA 2NN3C 4EJ0A 1F4VA 4XIJA 1PQ4A 2PA3A 2GZAA 2IY7A 2X9GA 4RFSB 1NSYA 1HNWB 3GFGA 3PJGA 3MRVA 4DIUA 2J9YB 5FQNA 5KNCH 2UU9B 1T35A 3E9YA 3HA3A 3PYLA 2CLLB 3TB4A 1MXHA 2PNJA 1J8VA 2WMNB 1CLEA 1CR4A 1D0IA 2ZI5A 1YB4A 3CN9A 4IM7A 4LNHA 4LRUA 5AQEA 2B8WA 3S40A 5BOSA 2J3HA 2IHYA 4TQUS 2VNJA 1JWLA 3BVPA 3DKKA 2RIRA 3KKLA 3QITA 2CV2A 4E03A 5EJ7A 2GB4A 4V3CA 1Z0IA 1P60A 2EKZA 3LCUA 3AHIA 4BUZA 3GJ7A 5EKUA 1NVFA 3G2PA 1KK2A 3FWNA 3GJQA 3K96A 1VLVA 3K2BA 1J23A 4J2TA 4ODIA 4AJNA 1QRTA 4Y0NA 1ULHA 2LKCA 3MTDA 4JEIA 8LDHA 1E7WA 1HDCA 4MW9A 2NU6A 2H0RA 3HBMA 1QQ6A 2XDWA 5A0TA 1GARA 2H92A 4OP2A 3PUJA 4RMNA 3D5QA 4OJNA 1FZTA 1ADFA 1WXEA 4KXMA 3P0FA 3PNSA 3PUZA 4MGZR 1P44A 2AYZA 2GTPA 5HIAA 4ZQFA 3H4MA 2HLHA 2Z4TA 3DXFA 1O54A 1IATA 4YRSA 4I81A 4P31A 3ZBPA 2CSXA 1E99A 4BMOB 2PL5A 5SY4A 2V0GA 4CGZA 1XPUA 5B6PA 1GJRA 1RXSA 1O1YA 3DCJA 3FJ1A 2VNIA 4OV6B 1C3VA 3TMAA 4UOQA 5DNUA 1FE8A 5KJFA 1XB2A 2GEKA 2NYVA 1ZR2A 1C1XB 5E1MA 1QGUB 4KH1A 4H3SA 5L3SA 1Z33A 1Z8FA 4UHKA 3TD6A 2OGTA 3FX2A 4F5WA 3EEQA 4NOMA 3EZLA 4MVJE 1PUIA 1TFUA 4G1CA 5H83A 2AC7A 1RYBA 2HJRA 4KO2S 1NR7A 2G9ZA 2FETA 4KQMA 2G7MC 2WT4A 1GD1O 3S2ZA 4X8HA 3NYQA 4L8VA 1Z82A 4ESOA 3R0JA 5KNCA 2O1WA 2F55A 2XEDA 5ALKA 2OO3A 1ZN7A 1I32A 1E79A 2SKEA 2FPRA 4M6WB 3WYCA 5AW4A 4YACA 2NVUB 2QRLA 3OVMA 1XN4A 5ENDA 3FPSA 1V43A 1SD5A 1T5OA 1TIPA 1GYQA 3Q10A 3D6JA 1O5TA 4PX2A 4WK2B 4F7DA 3V6MA 3Q1KA 3Q1LA 3T5AA 3DM5A 4IOKA 1Q17A 1ZO8A 3B85A 1ZH4A 4WJKB 1YJQA 1NOIA 4LZZA 4KIFA 3ITNA 4FFSA 4MVJG 4R9RA 4FXPA 1IXYA 4ACBA 4P98A 1OH8A 3Q12A 1YKFA 3EZXA 1Q6ZA 3N5CA 4OQZA 5FFMA 4PHGA 4D02A 3AV0B 1A4IA 2LVBA 1XTUA 1O0CA 5IUKC 2IYLD 2BFFB 3USCS 1CUXA 1L0BA 1OXVA 1QQTA 1R8YA 2ZJ6A 3R3HA 2VLIA 2ZS8A 4YUVA 3K6RA 4A5SA 4X8MA 2H5IA 4DYDA 1M8GA 4EG1A 4TTPA 4I1OA 4OI1A 1ZIXA 3UAXA 1E9AA 1C80A 3ZCTA 4AP9A 1JHYA 4CMIA 4RENA 4H6XA 2ZBGA 2WG1A 3C0KA 3BXZA 1LD3A 1FVFA 1V48A 3WDLA 3IPXA 3R76A 2FRDC 5DK6A 2OKGA 1JZQA 4JFRA 4F5ZA 1XQWA 4O4LB 4ZQEA 5EE3A 3U3MA 4QKQA 2P4SA 1XWIA 2XQKA 3TQIA 3FZNA 3LBIA 4BRZA 4V1CB 1UKCA 3OZIA 1TZJA 1NXVA 3WK7A 3A1NA 2GXSA 3ZW8A 5K0TA 4IHQA 3P4XA 3G7UA 5KOJA 5HS6A 3ZHBA 3NH6A 4FFWA 5BNTA 4KO1S 4CMGA 1U8XX 3EVBA 2FUG1 4LK2A 4NBWA 1XJWA 3TQFA 3EXHA 3VU9B 4NOJA 5ALNA 2VJMA 4B3MB 2XRYA 1E7YA 1HFWA 1NBME 3MTEA 4FOTA 1M6WA 4NPCA 1TO1E 5C8YF 5LMZA 2BEKA 2QLMA 3HDYA 5GIPE 2C5FA 2A0KA 1RRVA 2AG8A 3LNCA 4JC5A 1NC1A 4HNHA 4LQLA 1W0JD 1Y9JA 3N8DA 2FW9A 4UJ3A 4QT4A 2GT1A 4K8OA 1BU5A 1Q0TA 4RKYA 5ELLA 4IRUB 3IEIA 3OO0A 1GUZA 3HDHA 5K3DA 2XB2A 3V8PA 1Q7RA 1OWLA 3HCFA 2WTNA 3CRMA 2PGAA 3LA8A 2XYGA 4N0PA 1CF9A 1UFRA 1RHRA 3LFUA 3DL0A 4XIFA 1S3SA 3IKVA 1X80B 5EFZA 4CV0A 2P6PA 1YFKA 1LDYA 2OESA 4GU5A 1OYOA 4Z0HO 3P9YA 3GT4A 4YLEA 5K01A 1RTKA 1KP2A 1LBHA 2D2IA 2P2DA 4BB9A 3EPPA 3NOOA 1Q1AA 3FH0A 4BE7B 4E2XA 4RTNA 2DXIA 2VXBA 2XB9A 3A9TA 4GQIA 4YC7A 2AX3A 3N8KA 1COZA 2RCYA 3JQQA 1EJ0A 3PWSA 1JR4A 3NIBA 2XZTA 3BFXA 2DKFA 4HDAA 1U1FA 5DRYA 4CIDA 4HDRB 4ERNA 1CDZA 3ZXXA 4ZHSA 3AI2A 2BM8A 3TMYA 4LX8A 4NU0A 2CUZA 2FPOA 1CJMA 2HDNB 2VFAA 3RC1A 2C77A 1YHNA 3RS9A 1DX9A 1LVHA 1FDSA 3FSJX 5EZYF 4C30A 4UVIA 4NJMB 4IXWA 3UT0A 3HUDA 4AROA 4E88A 3FLAA 2IWRA 4Q24A 3F71A 1AZTA 5FO0A 4K1XA 2ZATA 3EGCA 1VPEA 2ONCA 3H9QA 3TLEA 4AMUA 2EZTA 2WE7A 1QB7A 4KE8A 4YRRA 1PNQA 1E79D 3CZRA 2F7SA 3GEGA 3NC4A 4QULA 5CNJA 4DEYA 5JLJA 4G5QA 1HDEA 1ZK2A 4KAJA 4P3YA 4U3JA 4WLOA 1WLYA 1JILA 1U9IA 5HK9A 1TKAA 4G0XA 1EVJA 1BXRB 4CM4A 3QG1A 5HRAA 2FHPA 3ZDDA 2Z5FA 4ZHQB 1MX1A 1OX4B 2BCGY 4IX9A 4PANA 4E51A 2Q2WA 1MZVA 4LOAA 4W9MC 2BTQB 4GLJA 4TMTA 4MXDA 3WTCA 1FFXA 2GM5A 3CO0S 1KMHA 4A2QA 4W5OA 2ZRJA 1VG8A 4CCSA 1SUIA 1X6VA 3MBOA 3QTLA 3ER9A 4I08A 2GESA 3HTXA 1RRMA 4RF3A 2X41A 1OAKA 2CB9A 3IEXA 4EW3A 4AG3A 1G8JA 2UZ4A 1TQ4A 5EIFA 4I50F 4C4RA 1NTOA 1WHSA 2XWPA 2EERA 1RPTA 2WU3A 4DMRA 3GLGA 1QDLB 1WCIA 3FVWA 3LCVB 3FZEA 5U4QA 4YXFA 2HSGA 3HUFA 1RAFA 3CLKA 1WXHA 2AUMA 4WNAB 1OBOA 3QVSA 4Q9IA 1EDDA 4NMWA 1EX7A 1FFDA 2X7JA 5INTA 4LYEA 5H9VA 1CS0B 3ER8A 1P4RA 3NEPX 2VF5X 1JQBA 1ZJ4A 1L7AA 3FKJA 3ND8A 4GC9A 4Y2JA 5EI5A 1XEXB 3D4OA 3CG4A 3EOAI 5FEMA 2EQBA 4U9UA 2HMVA 3RAGA 3DPSA 3ZZUA 2P9QA 1QOQB 4FOSA 4JJEA 3AUFA 2ZQ5A 4M3NA 4MVWA 3WVNA 2ODQA 4ZVPA 3ZZMA 4OJYA 1V11A 1PEAA 1D7OA 3KHTA 5EXSA 3QI7A 3ASUA 2FSGA 4MQBA 3AF1A 4TS4A 5I4KA 3L6OO 1P9LA 3PK0A 1EEXB 5GIOE 2IZ1A 3JY6A 3BORA 2FEPA 4OHFA 2PX6A 3H2HA 1YR9A 4PAMA 4Q3AA 4YJ2B 5EP4A 4A6PA 1K66A 4I3HA 1W5FA 3UT5B 1U2SA 2Q3JA 2DPLA 1UOEA 1NR5A 4G6ZA 1EWQA 1KO5A 1T4CA 3KC2A 4INZA 1R8XA 4MV3A 3ETEA 1LPPA 3CCFA 2WF5A 4V0OA 3M6UA 1WS6A 4JYCA 3RSSA 2G63A 4XYBA 3QPDA 4GPZA 4JGGA 4FM9A 3I9MA 2OUIA 2YYSA 4MLCA 1NN5A 3AFHA 4KEAA 3U39A 3VR4D 4CKWB 2DRIA 4F2PA 2R7NA 2EGHA 3LLUA 1MT0A 4OK3A 1KYYA 1WCYA 2JLQA 2RHBA 3EFOB 4I9FA 4KE6A 4YCJA 5JS2A 3U49A 3H0KA 1A82A 1Z0DA 2CLIB 4JROA 4PYJA 1B0ZA 4FYXA 2AD5A 2HHAA 2W2NA 3WLPA 4BQEA 1Y80A 4RGQA 4BQQA 4HGZA 4MGKR 2CNWA 3AUUA 4RK6A 4LBZA 3G59A 5YASA 3ZK7A 3E7FA 3SE7A 4ZQBA 1WKBA 1QIJA 4XFJA 1B42A 2DHRA 3UPTA 2GO7A 3DGEC 3BMXA 3WQSB 1W36B 5HIKA 2VRWA 1RRCA 2IEGA 3OE5A 2XGMA 2R7MA 4MW4A 2B3DA 4WN9B 1XK6A 4ZCRA 3GUCA 1VPDA 2V5VA 3HCDA 4LXXA 4MGHA 3NQ41 521PA 3TPCA 5B1EA 1DELA 1MEOA 4YDSA 1FUEA 5HMMA 1WUYA 3KZNA 3OOHA 1NNEA 3CBQA 4I55A 1L8AA 3O82A 1NBAA 2Z2ZA 2XECA 4BGUA 5HK8A 4EJFA 3IQDB 1EGVB 4HWRA 1LF0A 2VN8A 1IEWA 1KKLA 3HJFA 1W48A 1O0SA 1EIZA 1O4VA 2IF2A 3CEAA 3NAGA 3COPA 2W43A 4HADA 4NP6A 1Y42X 1AO0A 1XE3A 5I51A 2B1IA 4RQAA 4MZDA 4B3CA 5KVVA 3DVAB 3L79A 2OHVA 3V7WA 1F8FA 5D2CA 3DXXA 1Q74A 2WB4A 4QUHA 3EZYA 3R8FA 3EPRA 3NXKA 1JWBB 4ATNA 4K6KA 4L72A 2W6ID 5A5GA 4EG3A 1YBVA 2XWQA 2BEUB 2WAMA 3CEPB 4LG1A 3TG2A 2POQX 1J42A 3ELYA 3NLLA 2B2XA 3FYUB 1ZFNA 5FPTA 4A0QA 5CRIA 1MG0A 2GCIA 2V7XA 1JEYA 1H9CA 3BD8A 2XYHA 4ZVLA 3TPFA 3L7BA 4FU0A 4MR9B 4OYHA 2YZ7A 2BH9A 2W58A 3DOFA 3IBYA 1WU7A 4MRMB 3TIFA 5JOQA 1DAEA 1T1GA 2W70A 1FJGB 2WKWA 3FVVA 1GUFA 1E4EA 2AWOA 4DA8A 1SRRA 1TCAA 3IPCA 3QMPA 3QX7A 5AJUA 1YZYA 2GGSA 1ULAA 3NTLA 4MYRA 2CCGA 5L7WA 3N2KB 5JJKA 2X8JB 1ORVA 1NULA 1ULUA 4BGIA 5C5DA 3EIWA 1G6KA 4FCWA 2ZWIA 1UWCA 5GZ3A 2B92A 2YV5A 3F0TA 3MS7A 3S1AA 1U0RA 1SXHA 1Q0PA 1Z18A 2ACWA 4B8ZA 1KEEB 3TUJC 3FHTA 1OH6A 1G38A 1WXGA 1FLVA 4OK5A 5ITWA 3WXBA 3RNLA 1B76A 4ZOQI 4S2EA 1R8JA 2EIXA 2JFVA 4GMGA 5KDDA 4WLEA 2RB4A 2P41A 1CR2A 4W5JA 5A7HA 4AURA 2G04A 3AF3A 2JFFA 3AG5A 2WSMA 2BD0A 1WMBA 5C46F 2J33A 4NYJQ 4DREA 5IPFA 1UJ2A 4CEJB 2AKYA 3Q41A 3OCYA 4HAWA 5B3JC 5BNFA 4UCWA 2YWRA 2G72A 1D09A 2VYVA 4UU1A 2FQXA 3F9CA 3PDJA 4PAWA 2Q2OA 1QGUA 4KQFA 3D6NB 3Q7TA 4QU9A 1Z75A 2C03A 2ZRFA 1AS3A 2GEBA 4GOXA 5DLPA 5TMEA 4NCAA 1N5LA 2H5EA 3BEDA 4R6WA 1P5JA 3DHNA 3OIGA 5LU8A 2HA2A 2AW5A 2WPNA 3OE4A 1C1HA 2XUGA 3R3VA 4RGVA 1GPWB 1YC5A 3TTUA 4E5SA 3BAZA 3WQBA 2F1JA 2QTMA 4WPGA 5B37A 3IOCA 3SR3A 2ZZMA 3U3JA 4ZDKA 5C2JB 3MRSA 4KGXA 2C94A 2X9LA 2C2OA 3VKWA 2UVPB 1XAJA 3G85A 2I3GA 3UO8B 2VJMB 3H17A 5LUBA 2HLNA 5DWVA 2V7PA 2H00A 3E27A 3H2IA 5CYFA 1ZL0A 1RP7A 2JKZA 2YZ2A 3O0TA 4IFEA 4LJLA 3T7IA 3SLRA 3U4AA 1N33B 3R20A 2X5KO 3N58A 1C8KA 4QVGA 3R0ZA 3E61A 4V0NA 2FDXA 1UM9A 3K6KA 3HB7A 5T4FA 1WW3A 1ZWLA 3PUWA 4HYYA 5DI9A 4D43A 2XCRB 2E4WA 5AI0A 4IZHA 5F3WB 5A0VA 2V7GA 4DCGA 1QBGA 4OSPA 4TMYA 3KQSA 4KRFA 1Z26A 3PJDA 1FSSA 5KYYA 2KBFA 3EF1A 3H5OA 4BO6A 2F8SA 1CETA 3T4UA 2QW0X 3EF0A 1X7XA 4KVGA 4AJKA 4IDGA 5FYDA 1HTTA 5SYAA 3RROA 5JSQA 4EG4A 3QY0A 4FR0A 4EABA 1T8YA 4RL4A 4YVFA 3B70A 1VZ2A 1B1AA 4XR9A 5CXXA 4ER5A 3M9WA 1VRVA 1HFEL 5JTUA 1E92A 1GV0A 3KR1A 3GJTA 4OHWA 4QO8A 4DG8A 3C3DA 1O6BA 1IN5A 3D6UA 3DOHA 3KO8A 1G5TA 3O8OA 3BN3A 3COWA 4G1UC 4ENPA 2BL4A 2WYHA 1N7IA 4P33A 1QFZA 3OT1B 3PV0A 5LQNA 2JIMA 3A1DA 5B7GA 3KQQA 1S8OA 3CZAA 2DX7A 3OQPA 3OY2A 1JSRA 3NBYC 3Q3HA 4MS4A 3VRHA 1W5BA 3EA5A 1M5RA 2CVFA 4EENA 2XGOA 5EXXA 1YRWA 1WSBA 2OHGA 3R5XA 4G0NA 4L4XA 3KCNA 4PINA 5I5GA 5SZKB 1XIVA 3RRYA 1B8PA 3CX6A 3NWPA 1XD8A 1GDDA 1M10A 3EUFA 4JLMA 1QH9A 2OGZA 2P4UA 3Q3JB 4LXUA 4OLFA 1VE6A 2BKLA 3WJAA 1KNQA 3LM8A 5L7TA 2UYCA 4ZYTA 2AZXA 2VP0A 3VKFA 5AK6A 5BVHB 2G40A 4E30A 1TCBA 1M8KA 8ATCA 1AQ6A 5IM4F 5IDWA 1N1MA 4R9UC 3VPCA 2DT8A 3PCTA 1G41A 4ZALA 5TPZA 1SY7A 1CIJA 3PRJA 4JT4A 3B12A 3MT0A 3P2KA 3FKQA 4HYTA 3W7VA 4MIKA 2JDIA 2BISA 5CB4B 5JXWA 3ZWOA 3VFDA 1HE3A 4PC1A 3AM5A 2XW6A 1DTSA 1XD2A 2FN8A 2HRQA 2IOYA 3W8FA 3B53X 5JQGB 1J9ZA 5KNBD 2BFEB 3C15C 1OYYA 1U5AA 4BLTA 4A2PA 5EUQB 1SCNE 4U2CA 1GEGA 4WN3A 1F4LA 5DHRA 3GXOA 5JBQA 5BN1A 2V4MA 2OD9A 2QJWA 4XFKA 4F4HA 4Z7NB 3KKOA 1M34B 3ZHOA 2CWWA 5JMWA 3SJ7A 3FWZA 3OIYA 4ZCTA 5ALEA 2IWHA 1GQQA 3QU2A 4UU0A 2ZWMA 2GN8A 3VPXA 1OFGA 1IQPA 2PWBA 4X8LA 4CKBA 5AW9A 5SYMA 3HRKA 5E2BA 3VPSA 4I6JA 4FW8A 1NW9B 1ODIA 3B51X 3FSRA 1XEWY 2A0UA 2FFQA 2ZRAA 1JQJC 1EKXA 2HI0A 3VV2A 5HFNA 3L8ZA 1T2EA 421PA 2O54A 3E22B 1P0QA 2TMDA 2AR7A 4C6HA 1J06A 3HACA 3JASB 3PQCA 1QVAA 4MQMA 1G20A 1OI4A 1C4XA 1FP4A 4KBGA 1KQFA 1MHTA 4MHTA 3JAMA 2P91A 3SHFA 2O8FB 1BCRA 1N2ZA 2V6BA 3NPAA 5AW2A 1P8JA 2GCEA 4CMHA 4EQ6B 4U9IS 3DW1X 5A4AA 1KVSA 1P31A 1KU0A 1OLUA 2I2XB 4UM8B 3Q7EA 3UXEA 4ED9A 5K2OA 2ONYA 4P4GA 1E3LA 2P6RA 1Z25A 1RI4A 2BSXA 1AF4A 3EFOA 1LRLA 4HUTA 3L8MA 4H1UA 2E2WA 4XCVA 4ARUA 5CDHA 1W2HA 4R51A 3T35A 1NW8A 2WFLA 4KDEA 1L7EA 1VSQA 2XNJA 4BN4A 3I1IA 5EWJB 1KJYA 2V8OA 4HLNA 1WNTA 3S44A 4KR7A 3E4DA 4YIKA 5BWMA 1AGXA 2FCRA 5J5CA 3FOAA 1DL5A 1A7KA 4DNFA 4YQEA 3MG9A 3MWFA 3WKBA 3A1UA 3D3WB 5H82A 1KJNA 2AIRA 4NDAA 2IPMA 3FNRA 3IDAA 4MI1A 3TO5A 4EITA 1JPVA 1OWNA 5F4BA 1G7SA 5ERGB 1K7CA 1URPA 3BZBA 3GCWA 5AQ1A 1FPQA 1VL6A 3BK1A 2XGSA 2DWOA 1X1AA 2WIDA 4MQ4A 5F35A 4TMKA 1SXJA 1MVLA 3ZWWA 2DVMA 3ZU6A 4R40A 2C07A 1KY5A 2IDZA 1G1MA 2J3KA 3ANNA 3TW4A 1EAYA 2PD6A 3GMIA 2YTZA 3IP6A 3LLVA 3PZRA 4RVNA 3AETA 3S7TA 4BGVA 1QE5A 1PKEA 2O8EB 4D0GA 3AFOA 3LE8A 3E0XA 3MJCA 2P9FA 1XLTA 4N0QA 3IAXA 1CHNA 4RVFA 4RWEA 3IPRA 3KR0A 4N6OA 4ER3A 3H19A 1IHYA 4QQKA 9ATCA 4WACA 5J47A 4C6SA 3ZWVA 4D56A 3KKEA 1FQJA 1MKYA 4ZO6A 3ZU2A 1SK9A 1SCKA 5JS1A 5IWCA 3VUFA 5TJ9A 4D46A 2IH4A 2FWIA 1O94A 4FYVA 2Z09A 2ENWA 1P0MA 3GZJA 4LSWA 2X9NA 1ZH0A 1PU2A 3DA8A 3L49A 3K9WA 3VNBA 3N2EA 2VSNA 4YIHA 2H08A 4XSHA 1FFXB 2B5VA 1ZI6A 5J58A 2D0PB 2EL9A 3AHJA 2Y1CA 4ESVA 2P2YA 3X1ZA 4ZDJA 1KAOA 1PLKA 3N5KA 3E7PA 4ZI7A 2JZOA 4EVQA 1ZEMA 1JI0A 3N2NA 1QV9A 3HCWA 3HU1A 2KQUA 1MO2A 1KI4A 4U9HS 4YP6A 1OGIA 3A2NA 4G26A 4JFAA 4MIEA 3LL7A 3GN2A 1IOZA 4C7JA 2P7HA 1HNNA 1ZZGA 2EG9A 5DNVA 4D0RA 1RJDA 3DHYA 3EYAA 1GTVA 3DKIA 1BJRE 2WVAA 3QE2A 4BNYA 3GPBA 4AU1A 2I4LA 2VJPA 1CEYA 1WUKS 3V1MA 1Y5IA 1F3LA 3JATB 4R9SA 4XYGA 5DGXA 4DIFA 5GJBA 3BIFA 3K9CA 3T15A 3K05A 1TMGE 3M5PA 1GDHA 3P8ZA 3H83A 4G23A 1DIGA 2PEZA 2QJRA 3CLSD 2NG1A 2WF7A 4C43A 1VSTA 1ZUNA 2IUYA 2PFKA 1Z39A 2CNKA 2PBZA 2NXNA 1NVEA 4N5LA 3O8CA 3DS8A 4OFZA 5JAHA 1XRJA 2FX5A 2FX2A 3LQQA 4D1YA 1HE4A 2XI4A 4NV1A 2Z4SA 3UA4A 3V9AA 3RADC 1YOVB 1Q84A 4F6CA 1DC4A 4RVHA 1LBIA 2WTMA 3C3JA 4KR0A 3K0CC 4M8KA 1WU8A 1SEPA 3CUTA 4FHEA 1XJ0A 5JCXA 4G4IA 4GBGA 3ST7A 1OA1A 1RI5A 3ROMA 2R6R1 1Z4NA 1YR1A 2WVGA 4GC5A 2EKBA 1WIWA 3JQ7B 4ALJA 5BMVA 2W83A 2ZRNA 3PHBE 1E2JA 4KYUA 1QGAA 4LXGA 3NJRA 2B9EA 4YN3A 1SXIA 3GPDG 4NICA 4HEQA 1OBVA 3ZLVA 1R4AA 1PR4A 4A6EA 2XQIA 5ALPA 1N8NA 2XUIA 1N3YA 2IJGX 2QJTA 2J0VA 2TSYB 2QAGC 1E4VA 3EJ6A 3VYUB 3WZ2A 2C2XA 4A27A 5B7PA 1HT0A 5HF8A 5C31A 2BMWA 3TOXA 4MP3A 4D9BA 1T5IA 2XDYA 5JQGA 2E1RA 1XXHA 1XZNA 1TDJA 4RJIA 4PBTA 1IBRA 4PG8A 4I50B 1VIVA 2P35A 4Q3BA 4HNGA 2BY4A 2F62A 2F59A 3ONFA 4PYNA 4H1TA 4RUKA 4EEZA 1F0PA 4BECA 2FSSA 2GHIA 2XD9A 2HM7A 7MDHA 1ECLA 4TXHA 2HU2A 1ELOA 1QCDA 2O14A 1JAIA 2Z9CA 3CNLA 1GZ7A 3GLFB 4OXIA 2HV8A 5T6BA 2E4UA 2G36A 1QKKA 2FN4A 4LFCB 1U02A 2GARA 3OQOA 1SZCA 2PKQO 1X8XA 4TVKA 3LPNA 3WL4A 2F3TA 1DRKA 1CRZA 1IMJA 2PX2A 3OC0A 1B2RA 5EZSA 2C7RA 2PH7A 4DC9A 2GNOA 4NJEB 4WASA 4YQFA 3JRWA 9LDTA 5L4SA 2X23A 1R88A 4KH0A 4B6EA 3RS5A 1N6RA 1TKCA 4BNZA 1VSBA 1A27A 4CKCB 2HIGA 3HZRA 5DN9A 2GN6A 2FLWA 3IUMA 2WY2D 3SNHA 3MUEA 3RWBA 3ZWBA 1ZNZA 5B6JA 1ATZA 3LWBA 4QLOA 3FFTA 4ITRC 5IHXA 1ADBA 4TQAA 5I3CA 1R6TA 4XPZA 1IUOA 4GMFA 3SQMA 5G02A 4R8LA 2XXJA 2EDAA 2D8MA 5JCZA 2C2YA 1DS6A 2JFXA 1ZI9A 2WIAA 1H05A 3H4TA 2O2GA 3PNKA 3A6FA 4MYCA 2G5CA 1DJQA 4HZUB 4NVRA 3TNJA 1IB0A 1OFUA 1MO4A 3L2OB 4C9BA 4MA5A 2NO7A 5FUBA 1DRUA 2PWPA 2UYQA 5HEKA 4AKIA 2B1RA 4BX9A 1GU0A 5B57C 2GHTA 4UM7A 1Y48E 3WRYC 3M4XA 4GWGA 5CFOA 4PLWA 4L5IA 3D0KA 4ZMRA 2BFBA 4M1KA 1Z4KA 4O4IA 2CK3D 2OLEA 4O1MA 4WQMA 5IT4A 1KSFX 2R8OA 3CRZA 3LTNC 1JEJA 2ADOA 2ZVJA 3BGDA 1SUDA 1KI7A 1K68A 3GJ8A 4QYIA 3EXAA 3SM9A 3SFTA 1BDBA 3QJ5A 3VR3A 2C57A 4WESB 3W2HA 4BEJA 1SXPA 2RK4A 4LQCA 5FOXA 1GLGA 2BDUA 2K2WA 3H8SA 4PONA 2AS0A 2H4ZA 2C3YA 4PYKA 3IMEA 4UDNA 4Q7JB 3DLCA 1W1UA 1OH5A 4URYR 3SEZA 4BLUA 1T9GR 6Q21A 1ZUNB 5C5EA 2VI5A 1FFSA 3WMGA 1JA0A 1VIAA 5J9FA 4TMXA 3BE4A 1E2HA 2V1XA 2GVZC 3Q87B 5EKSA 5FBRB 5DM60 4PIVA 1Q1EA 3V8RA 3AKDA 3H3FA 3NNDA 5J2UB 4AK9A 1H1LA 1QIMA 3FRJA 1XNRB 4HCJA 3FKSD 3A1CA 4GP9A 1VLZA 1JE0A 1U0TA 2P4HX 1X2BA 1PG5A 2P9YA 3KS9A 1J20A 3KUCA 3W3AH 5JSZA 2GJ4A 3A3NA 4JSTA 2GAAA 2CXUA 3IOEA 1ISHA 1ZY2A 2OHJA 4NOKA 2BFNA 3EMBA 2Q1XA 3D1VA 2X5XA 4F4UA 1G9TA 4GMKA 5EXPA 4P3XA 3ECSA 3G13A 1H0RA 3LUHA 1C50A 1UWKA 3DO6A 3EZFA 3U2QA 1XDGA 3FPHA 4MDHA 4BO8A 2GBGA 2B5OA 2QVYX 1NVKA 2PMCA 1TZ2A 4LDPA 1U3FA 5DJ5A 4Q7MB 3WNVA 2Y2VA 2HAEA 4DAOA 5B58C 3VH1A 2YRWA 4KSYA 4TV9B 5CM8B 3L7AA 2YVKA 3PVZA 5AVYA 1LC3A 5EQFA 1JNYA 1GFWA 4EHBA 1GRQA 1O9GA 1ONBA 2VNKA 3DYVA 4MUIA 5BWLA 1HX7A 2VJDA 1XMQB 3K8ZA 2UYGA 4RBNA 1NLUA 2HF2A 1QNFA 3DE6X 2HSDA 2RGWA 3N05A 4UUPA 2Q8QA 3WGYA 2P9ZA 1NMSA 2ZJ3A 2DHCA 4IXDA 3QEKA 4QGAA 2ZYGA 5C3MA 2B4KA 2O2YA 3IB3A 1W30A 3K8QA 1V3QE 4GZ3A 4L0MA 3A6EA 3L40A 1AHNA 1CT9A 3KJNA 4QFMA 2WYOA 3OD1A 4Q1CA 1A88A 2PMEA 1XVVA 2HBYA 2YZMA 3L8DA 4M0LA 3ER6A 1PDOA 1FFCA 4YGXB 9GPBA 1NF9A 3UMSA 3ZW9A 4ZTBA 2NXCA 3KZ1E 4DYHA 4YPVA 5CPBA 1AKRA 1CUAA 1TX4B 3KWLA 1T2UA 5AOVA 2GAIA 3FYHA 5G4LA 3T95A 1DMRA 2AN4A 4I19A 3BGOS 3HJGA 4RQUA 4ZQCB 5HX7A 1H23A 4R8KA 5JNSA 3U1BA 3KWMA 1FFGA 1QYCA 2O3UA 4MP6A 4A73A 2JASA 2PCJA 4JJ4A 2HLPA 5AM5A 3SS7X 3UT6A 1LTHR 2QN3A 5CT8A 4EGFA 2WE8A 1B93A 1TU3A 1VL0A 4A6DA 4PFQA 2OG2A 1VJRA 3F3YA 3E22A 2XNDD 1UMDA 4IMIB 3WNDA 1C41A 4NJOA 2FQ1A 4OVKA 1FQOA 2QA5A 4X20A 4KVFA 4XIIA 5HFAA 4K26A 5HUJA 1PVOA 1UPTA 2ON6A 2CXTA 4QEKA 3Q3IA 5ILGA 1EG7A 1FIUA 2H29A 3SX4A 2J59A 2WNIA 1DIHA 4TXMA 4HJRA 2GUGA 1TJYA 1OI2A 4X6XA 1SCJA 4EPTA 3AL3A 4I9GA 2DJ5A 2IHJA 2YXDA 3CRNA 1IE3A 2WA2A 4HNAB 2NQ2C 3I9NA 1TJNA 3ILVA 1NX9A 4XTRA 1JJ7A 1SMKA 3FE2A 3IOYA 4LDAA 4OHZA 3RQIA 3TZEA 2IYNA 4OD0A 1GTSA 3VXKA 1DIRA 1M2JA 2ZCVA 2QZJA 5KREA 1YB5A 3V4OA 5CGZA 2ZM5A 2QN7A 3OCXA 3L7NA 1WOYA 4XYEA 3IMCA 4YV0A 2BZGA 2ZSIA 4G84A 1UXJA 4RY9A 1PR1A 2DPXA 4F86A 1BE0A 1MAAA 5IT5A 5JZSA 1QP4A 1CFJA 4KGDA 3RUAA 4ZQHA 1U8FO 3A9SA 4R8VA 2C1EA 4X91A 5EL0A 5EMHA 3KV1A 1E63A 4YPOA 4GS5A 2DH6A 5CLGA 4EL5A 1IBMB 5HQ3B 1I5RA 1WB5A 1KI2A 1E9EA 3RC7A 1DC5A 1RI1A 1N8TA 2RMKA 2QD4A 1EJ2A 1KEVA 2BGUA 2CLKB 3BEOA 3FPGA 3OPNA 1HBJA 2X1LA 4DBVO 4I2NA 4L0DA 4UUQA 4Z86A 2O3JA 4F72A 4ZZ1A 1NJSA 1BN6A 4AJOA 1I5EA 4IWNA 3RD5A 1XJ5A 3TS1A 5CIQA 2D2XA 4CLEA 2PUBA 2EJCA 3ZJTA 5JFTA 4RC9A 2OCYC 4NBUA 2YYYA 4JWTA 2I80A 5AVZA 3WZMA 4MW1A 3CUVA 3H8WA 3A36A 4UQLA 4WADA 3WBJA 2XZDA 2CNLA 4FFMA 3EULA 1X39A 1QRSA 3UGTA 1E94E 1LPOA 3M1YA 4OHPA 1P2BA 1XZQA 3OCUA 5G4KA 4PZ9A 1ZWKA 3OUZA 5AVUA 3WGJA 2G1PA 5KU1A 1NZJA 1U9IC 4OSOA 2A1UA 1DNPA 5TV2A 1WD7A 5BRNA 4O59O 3HFRA 3EXG1 4FILA 2IS4A 5T5QA 3AB7A 3L7KA 5CB4A 3ICEA 1VI6A 2IUTA 5FUQA 4I9HA 4JLWA 2M6SA 1V11B 3CLHA 2R60A 3DBLA 2H4XA 1TUBA 1QQ7A 2QMZA 1BDJA 1W94A 3E05A 5BQ3A 1PWHA 1FYFA 1T3HA 2XUHA 4LJSA 4RESA 5IAJA 4U2DA 5DSZA 3SK0A 5KBYA 1FMJA 2WQ7A 4I7EA 2B34A 1J0EA 4N49A 1T8UA 1TVEA 3HADA 4WK4B 4A16A 1I7DA 2AJCA 3OFSA 2MSLA 2YW2A 5CVEA 2BKAA 2GK6A 1SIUA 2P5YA 2JEZA 4JUAA 4II3A 1JA9A 5DDIP 4Q3LA 3O8DA 3QA9A 2HT6A 4V2UA 4OM8A 5FQOA 2IFTA 5BR1A 2NYRA 4OI0A 1XDDA 2VHWA 1RABA 3REQA 2YIDA 3D0RA 1TJPB 2CF6A 2Q1UA 4GO1A 4BASA 3OTWA 3UUFA 3RTBA 2Y2UA 3EF3A 3T4PA 2ZQYA 2R6FA 5K45A 5F12A 4FP9A 4LC0A 4PYMA 5LWQA 2VDOB 3DFIA 3VVLA 2G6BA 4OI2A 3KOWA 1IMOA 5ESXA 1T0IA 3KD3A 2OV3A 3C5CA 1ST3A 4LMAA 2R97A 1TC2A 1ESDA 3I8SA 4GH5A 4TV8F 1GFZA 1TYCA 3B60A 2R00C 2V7QD 4PLHA 5IBQA 5JPIA 2ERXA 3CUEF 5EHIA 4ZHQA 2F1HA 3N6RA 1EZ1A 1G4HA 1KEPA 2VF4X 3HXTA 2FP4B 2A94A 4GZLA 3P7MA 3U60B 1I80A 2EC5A 4ZREA 3LG2A 3ROPA 1VMEA 1RJFA 1HTBA 1TU0A 2O8VA 4FONA 3SQWA 4R2KA 4CLXA 2F00A 2XTMA 3H8JA 1W0JA 1H2EA 3KZXA 3P0JA 1VE9A 2OUKA 4OHRA 4CN8A 1BA3A 3GMSA 3L7YA 4CQLB 5GADl 1JQ5A 1NRXA 1IXSB 3KSBC 4YONB 1I4EB 1E4OA 3PRHA 3WP1B 4E32A 3EVGA 3CKYA 3DZHA 4XYLA 2V7UA 1YHYA 2HC9A 1ZCBA 5FD8A 4BV8A 1V6AA 2V7TA 4AICA 4PSCA 4JC0A 5CM9C 1SCDA 3NM4A 3IBGA 3PXEA 4KVZA 2WD9A 4YAWA 5LP1A 3OOSA 5DLYA 5E3HA 1HMYA 2GBPA 2H59A 2W22A 1G291 2ZDGA 1K9VF 4PR0A 2Y71A 1F8UA 3PEFA 4X85A 4D0SA 3NT4A 4BMSA 5AKZA 5C8XA 3F3SA 1U0BB 3RTDA 4M0DA 4PYOA 3ZWKA 1CQWA 3AHFA 1M1YB 2AC4A 2JJ8A 2WA1A 5C4IA 2ZRQA 4P08A 1TT5A 3ADDA 4OHYA 3O7WA 1R12A 3DR5A 4EQ6A 2XTZA 2F3RA 4IF4A 3QVLA 1QWOA 1UC4B 1QBKC 2VP3A 3CN7A 1QU2A 3JZFA 2RGGA 4Q82A 3E9NA 4RD1A 1TM2A 3LUAA 4HLCA 3RYCA 1SPBS 2GA9A 1MOPA 2OQRA 1QG2A 3DOOA 3NORA 2I87A 2H4HA 5CXQA 1Y8RA 1QAOA 4MI6A 5KKAA 2G4VA 2IBMA 3ZLBA 4P38A 4ICIA 3ZLTA 3GZ4A 1F48A 1G0NA 2IGBA 1PJ3A 4QPZA 4AMGA 4YP1A 4CIBA 1EM8B 3TF5A 3QLUC 3LOPA 2YMMA 2EW1A 1XPRA 3VSCA 3RLIA 3GQBB 1WUIS 2BWJA 4G36A 4XYMA 1M1NB 3TLKA 1P1FA 4LJ9A 2DPMA 2OO5C 4G8BA 1AJEA 4JYZA 3BXFA 3G9QA 1JSXA 2CUKA 3D5TA 1OIVA 5EPUA 1Y3FE 4IXNA 3RREA 1FL9A 2I8AA 2R5FA 2QN1A 1GITA 3VAYA 4XJSA 4MI3A 2AEMA 3COSA 4TXLA 1YNOA 3U7FB 4R0MA 4H6PA 2QQEA 4QTUB 2PSDA 3HA5A 3W5CA 4RHYA 5KVSA 3DT8A 1A7JA 3I62A 1M7HA 3T38A 4BFVA 5D3KA 3CIFA 1I3KA 2ZRGA 4CCWA 4TRNA 2F67A 4H0FA 1CUZA 1NHGA 1QGDA 2YUIA 5T4BA 1IOLA 4AFNA 3JAKB 3RIHA 3EGIA 1JKXA 1T2AA 2JFQA 1V5GA 3DC2A 4IDEA 1Y3BE 1F51E 4NESA 3E0QA 3VMFA 3F9RA 1JAZA 1LPNA 4F2DA 3Q85A 5FAKA 2Q3BA 1YQTA 2CJYA 1QIFA 4IH9A 1I4LD 1Z6QA 2V6MA 5C37A 2AC2A 3IT0A 2ZE5A 4D5EA 4N0MA 2C29D 2OMEA 2PWAA 1CB7A 3PYMA 3N7AA 1PR3A 3ORFA 4HWPA 1C8VB 1DB3A 4LZOA 1U0GA 2FW8A 3KSAC 3Q3GE 4Y30A 4Q66C 1BHQ1 1XTSA 4Z9BA 3RTGA 3L7DA 5BSWA 1K7FB 3OIWA 3G2OA 3GFQA 4C0LA 2RGUA 2QI9F 1C3OB 2J7PD 1IZ8A 1ONPA 5AJWA 1ABFA 5I01A 3K6JA 3MWYW 1XEFA 4EPWA 3UFBA 1OXUA 1C7JA 4J3FA 1CE8A 1PJRA 4BNNA 3NHZA 1HYQA 2OAQ1 1E5XA 1XVLA 2BZ0A 1SK8A 5HGJA 4IG4A 3IESA 1DVRA 3TDKA 1T2CA 3VNSA 3U3ZA 6AT1A 4TN5A 2IEBA 3A4LA 2O2EA 1ODSA 3LQ1A 4O0MA 5E2AA 1C4KA 4C7OA 4BV9A 3T1OA 2NTNA 4HSEA 1NDHA 2EKDA 4WZBA 3DMHA 2QWXA 4POAA 3F90A 4LBVA 5J23A 1JLLA 1HDXA 5G0VA 1Y33E 3IEVA 2PZMA 3U0VA 3BXEA 1N3LA 1CPYA 3FG9A 1P0CA 3JPYA 1SOUA 4JB2A 3ONEA 4KJZA 4NC9A 1M2OB 3UA3A 4DIMA 6YASA 3H0EA 4DLWA 3HXMA 3RVSA 1H5UA 2DLDA 4PLVA 1MHPA 1UDWA 1ZP6A 3B1YA 2EW2A 3MT8A 3VC7A 5B6IA 1WDMA 1XZCA 4YRCA 5K51A 2BGNA 1K97A 4GRIA 3ZUGA 5K8UA 1FNNA 4LNAA 1I6LA 4ZT7A 1NHWA 3TSZA 1JJIA 3NBAA 1O2DA 2H5LA 2FP4A 2CFRA 2OQ2A 4PO3X 4WBXC 4YHBA 3GVXA 2CCJA 2XUZA 4MR8B 4ZI7B 2PGNA 1G3MA 5CLIA 2WHYA 3PR2B 3UB3A 2NO1A 3W6NA 4PS1A 3QEMA 4YS6A 2VZ8A 4IYJA 2VKQA 4M38A 4PSAA 2LD4A 4U63A 5TPWB 3ZQ6A 2JGFA 4YMUA 5KVQA 3MWJA 1K27A 3A1SA 4KQ2A 1A69A 2WQZA 2YVUA 4NBSA 3VSEA 1DG1G 3W2GA 4UEWA 1TECE 1HYBA 4QWWA 2BGRA 2QEQA 1Z5WA 3DL2A 1KI8A 1QHYA 3L9XA 3C3CA 1GSAA 2PX8A 4HXEB 3JQDA 3SPXA 3OZTA 5CBKA 4BNVA 4D0LB 5F7ZA 3E53A 4BLRA 1X86B 2RK6A 3GGGA 1EYZA 1W5EA 1OXMA 5HF9A 5KAMA 1PP4A 4E1BA 4LSGA 3GRRA 4JOSA 5DW3A 4BVEA 2EJWA 3ELBA 2ZI7A 1YL6A 3A4TA 3F46A 1E1QA 5EIHA 1NRWA 4EB8A 4EHLA 4QO7A 4MULA 3NH9A 2NXEA 2UZ1B 4ZC8A 4DLPA 1J6UA 2HOQA 3KQOA 4Y6PA 3IKTA 4Y1FA 1Y4DE 4I4IA 3BFJA 3GJZA 1TOAA 3AWIA 5B3KA 1QAMA 2HUNA 4R05A 3R8CA 4C2BA 3NOQA 4IIDA 3NJ8A 1WBBA 1Y9AA 2FTKE 4UEQA 4BVLA 5IJ9B 5IUNC 2ZYSA 2IHVA 2O3QA 3ABZA 3JYLA 3GC6A 3F5DA 3E9EA 3QJYA 3ZE1B 1ETHA 2WMYA 4N40A 5JASA 3EG5A 1A7UA 1MB9A 3L0DA 5J63A 3ODPA 4BPRA 2Q4OA 1FDTA 4O2AB 3KVNA 4C2AA 2DETA 3FCAA 4TV8B 4UMFA 4DVGA 4MCIA 1C5KA 1C0KA 2GK3A 2NVOA 2CE2X 3QUCA 4FMDF 3ZY4A 3A0RB 2DLCX 1VBFA 1A1VA 4G1BA 4DS3A 4P9NA 2IHNA 2CSUA 2ATXA 4V03A 1PYOA 1JKIA 1YI8A 4OQLA 4Y9TA 3T9FA 4PZEA 1M0SA 4PIPA 5GQSA 4GX2A 5CTAA 4QPDA 3NT5A 1M7BA 2ZULA 3JSAA 2ZVDA 5H1YA 5FBHA 4ZYUA 1ESNA 5CDGA 1XNGA 4KVAA 5FBZA 2RI1A 3R44A 4MKXA 4M1OA 3UFXB 7ABPA 2OZEA 4WOPA 2PRZA 3TEJA 1BRTA 1GNRA 4KAFA 3S4YA 3VGJA 3WJ2A 3ZV7A 3QF7A 2K5UA 3M70A 3WLEA 5CYPA 2ZT6A 3TNFA 3V8VA 4B1FA 4HTFA 1IUNA 1RHUA 1UFQA 1EWKA 2HTEA 1XRNA 3R3UA 1UDAA 1U9YA 4O29A 2MMCA 4U7JA 3USZA 4LJRA 2CW5A 5LYJA 2VT6A 3PNLA 4QBHA 3D54D 3RB8A 3VKVA 2ASEA 4LCJA 5GZ1A 3QK7A 3ZCSA 2AJDA 5LMNB 5EVCA 3W6PA 1FW6A 2WIKA 2W6ZA 3AMVA 2J67A 3QVVA 2H31A 3OG9A 5F1KA 5FOTA 2RG7A 4CWAA 4DWVA 3VU1A 4A1OA 1XP8A 2C5HA 2ZAMA 3OZEA 3HJCA 2UKDA 2EVWX 3FI9A 1UPXA 5T41A 3WYGA 1NVUQ 2ERYA 3I9FA 1XCJA 2AN9A 4MKGA 5HE9A 3P0RA 3IDZA 1RFLA 2O7NA 4FHZA 4HAOA 4LY9A 1NJ5A 1XZLA 3HPQA 1WPGA 4RVSA 3TECE 4PYIA 4F5EA 4EAAA 2CUNA 3OEHD 1ZA2A 4Q3NA 4YJGA 4JIGA 4D74A 5JS6A 1RM0A 3SKVA 1DFHA 1COWD 3AUTA 3PC7A 1G7TA 1NU8A 4JQSA 3YASA 2FEWB 1R0WA 1L4KA 2DU8A 2DGDA 1PR9A 1VMDA 1X8LA 1YZNA 2VJNA 4MLDA 4RADA 4CQLA 2O2SA 1GTMA 4OREX 4D4JA 1Z6XA 3F6CA 3FMOB 1PJCA 3QEJA 3UJDA 3GFTA 2Z5LA 3ETCA 3W5HA 3S1SA 1THMA 5LJLA 4KR9A 2O0KA 4NHEA 1K5GA 5FI0B 3TUZC 3WLHA 3VR2D 1YMUA 2D5IA 4ITUA 4QPCA 3H65A 3ICPA 4UBIA 1TGYA 2GF2A 4V39A 2PZ8A 5L3VA 2OVFA 5L4LA 3AKEA 1U7XA 1B0PA 3ZTWA 1UXOA 3W06A 4X3CA 2B2CA 1N7HA 4JYAB 4RF5A 2VYQA 5K8LA 4OMFG 4NNJA 3AVYA 1NZDA 2VJLA 4PYRA 1GLNA 2Y1DA 5JDCC 2GZ1A 2R6HA 1FRVA 1MXFA 5ITZB 5K4GA 1OOEA 4KPEC 2VDVE 3K72B 4JNCA 3WQHA 1ACJA 4FNOA 3CX8A 4IGFA 4FN4A 4DHWA 3KB2A 2C20A 3IUYA 5A7FA 2QXUA 3MEQA 4L9SA 4N41A 3K53A 1MQ9A 4LZWA 1YZTA 5AKYA 1BMFD 2LTAA 2MTBA 1ECPA 3KEGA 2NPFA 1FMLA 1FP6A 1O8BA 2OAGA 2CMDA 3HJNA 4B79A 4BV2A 1PJZA 1A5SB 3IBSA 3DVQX 3ZQ4A 3OOWA 2RHDA 1ZONA 1DQZA 1B16A 1E6LA 1XDBA 2IYPA 3G82C 2XJ9A 1H0SA 1XQ6A 2H0AA 2O1XA 2W6QA 3MINB 4UNNA 1U9CA 3CT6A 5AXDA 2LCIA 4DLKA 4H35A 5DX1A 4EATA 5G2OA 1M1XB 1L5HB 2EOAA 4NCKA 3WQRA 5K6RA 1KGDA 4ID3A 3P2YA 1MRSA 1UAGA 5AVKA 4KXFB 4MUYA 1IVSA 4BAGA 4F60A 3OKFA 4KK3A 4AXBA 4IS2A 3GP5A 4MUMA 3SS8A 1QHSA 1HRKA 1SUEA 4QIHA 1SEVA 3WK8A 5F5NA 3DTTA 1OASA 3ROXA 2BEWB 1P7WA 4Q47A 2D62A 4RMHA 721PA 3THYA 4AN4A 1VOTA 2UV8A 1KY3A 1EXNA 1NUHA 4L1KA 5K0LA 3FTPA 1YQQA 4KZPA 2VSOA 1BE1A 2FVYA 5KYWB 3LKVA 5BSKA 4MRPA 2JPDA 1CVIA 2YNMD 4K3UA 4REOA 2QK4A 4BAUA 5JNRA 2GCPA 3PX7A 5C80A 2Q6OA 3LC0A 3QXHA 3DT9A 1NPYA 1FDVA 2GNAA 4Q48A 4XIYA 3OX4A 4B81A 2HT1A 4EVRA 5TT0A 1QTQA 4K6OA 2IHZA 3K09C 1X38A 2ABWA 3GZTB 3LXXA 4TVBA 3IX7A 4KP7A 4HXGA 2A9FA 3H4IA 4QOSA 1RIFA 4IS3A 4WCVA 4E5PA 4UTVA 2QS9A 3SVTA 1RZ3A 4EY5A 1JKFA 1LWOA 1KKMA 2EFHB 4G0WA 5HJEA 2DJIA 3G8AA 4YP0A 1TD9A 1G3QA 1EEHA 2FMXA 3OTIA 1Z36A 1V4BA 4BNWA 2B9VA 3ZHXA 5HIJA 2LXNA 3AHEA 3A32A 4JI7B 1XYVA 4IAOA 4KXVA 1HLFA 3L4BC 1C9DB 1I1OA 4YFYA 3RC8A 2O8CA 3O73A 3IE1A 2RAVA 4FFLA 2XUQA 4WJZA 3CVOA 4EZBA 3L7CA 3X3HA 2DQSA 4EW2A 4PZAA 2VA9A 1JT2A 1T2DA 3HVRA 5K3OA 3NFYA 4FEYA 2WT8A 4RFSA 1M5UA 2GR9A 1F7UA 3MIIA 4G1MB 4WZZA 3WYAA 3PU6A 3FWKA 4EVSA 3TTYA 1YDMA 1O5OA 3LJKA 1MJGA 2C0CA 1VG9B 3U1TA 2H9AA 4JR2A 2CNDA 2PLRA 1JTFA 2ZSBA 5TMPA 2XMSA 2V5UA 4FFDA 3LGXA 3MHPA 4YLYA 1NP6A 2XXAB 3ROQA 4KNWA 4C6TB 3KB6A 3OY7A 4WGFA 2Y1EA 3JD3A 1WDWB 1Q14A 2G80A 1MC8A 2GZSA 1XD2B 2P0AA 1K4YA 4FS8A 2IA5A 4WDQA 4J0DA 4WEOA 4WK0B 1BGVA 3LU1A 3NWEA 2BFPA 4F6RB 3I5YA 5BV8A 4M9XA 4Y2VA 3KQUA 3ACCA 3HU3A 1JKJB 3N2GB 4MB0A 5FTMA 1U3TA 2YWFA 3LUJA 4HR7A 1NNI1 5JD4A 2RSLA 3KQPA 5CCBA 4FXOA 1JR2A 4HFJA 1HO3A 3U7IA 4XASA 4IO1A 4MLPA 1E5TA 5E4TA 1KR2A 1NVAA 1P1KA 1Z4OA 4XWKA 4RCZA 4K9KA 3HKBB 3ESZA 3NKLA 3DP9A 2O5EA 4ZOEA 1RC0A 4HHEA 1QFXA 4C3OB 1TTPB 1ZUIA 2O9JA 5FHQA 4PCVA 3TLMA 4HK4A 4DILA 3GLIE 2J4FA 2UUAB 1PFGA 2RGEA 3UXMA 4Q3EA 2OHHA 4LF4B 3OJEA 3CC8A 3EVFA 4MUNA 4HNTA 2BC9A 1NDQA 1PLJA 3TK1A 2ODEA 1IN1A 1ZUWA 4NPHA 1II8A 2CFIA 4CKYA 5DHSA 3GLHB 4OK6A 4CHTA 1PLLA 1C7IA 1J4AA 1D3AA 1P39A 1TM4E 4G4GA 4Q03A 3VH2A 2BEVA 1FFWA 3GIDA 4Y9DA 5CGQB 4TLMB 1M1NA 4NCXA 5JSYA 1KHTA 3EPLA 3TVYA 2CHGA 5C34B 5FL7A 1U8ZA 2BP7B 1G5QA 1H4TA 2JBAA 5JBNA 3T12A 4AIIA 1I0LA 2NVWA 4DCVA 4M99A 1KA9H 3LT0A 3ASZA 4KWHA 1KEKA 3LW7A 4GPD1 2EGUA 3QUQA 2IOFA 2FWAA 4J03A 1YRYE 2FPGB 1Z5VA 3CEMA 4B3BA 4ZGWA 1I9CA 3W5AA 3U7JA 1D04A 3LUPA 1GR0A 2ZJ8A 4BJ1A 1O8CA 2L82A 4EM6A 5A1JA 5I48A 4MWTA 5CFLA 1LS6A 4D97A 4PG7A 1XELA 2OQVA 3TCNA 1XRSB 1AV7A 3QLVA 4OOEA 5DYYA 5SYNA 1MC1A 4BQIA 2EEPA 1MG5A 4QFCA 1QB8A 5KX5F 1F12A 2DPHA 2D2VA 4TYQA 3K4QA 3AWDA 2CN1A 1V0JA 4X1KB 2P90A 3SYKA 5B7NA 1FTGA 2QTRA 1XTKA 3E3AA 3HMKA 2GYVA 3MQ2A 4OATA 1IU9A 1C0EA 2NTJA 3AUKA 1YDFA 3IS3A 1XTBA 4EMTA 4CUZA 1A8SA 1ZGCA 3PNYA 2WJPA 1SUAA 3T0IA 3UJ8A 1IOWA 2XH8A 4P3KA 1FNSA 4I14A 4L0QA 2G3YA 5CNMA 2E82A 2FV8A 4NEHB 2UYHA 4ZYLA 3EDQA 3TD2A 3IHLA 3EXEB 3LF1A 2FFRA 2OV8A 3HDTA 4FFOA 5CG1A 5IZ4A 2FW7A 4C0SA 3BFVA 5IH3A 2BJVA 5EJ4A 1NI3A 1KOJA 1S2OA 1TO6A 4IMJB 1Y1PA 5CR9A 1TXGA 1PI3A 3BULA 3KT8A 4OIMA 5KYNA 5ADVA 2VK2A 1QYIA 1NVVQ 1ZD4A 3P52A 1TIBA 1Y4UA 1MTOA 3IGFA 3LY9A 3SLKA 1KDTA 1C2TA 3IP3A 2GXAA 2WFAA 3KU1A 2VIIA 3TM5A 4M9CA 4P4SA 1WSAA 4ZEVA 4J2HA 2ECQA 2FUCA 3M82A 3STWA 3WY9A 2EZ4A 4TZKA 5LDDC 5AK4A 4GI5A 5FBWB 1X1EA 3E6AA 4ZD6A 2OXTA 2FPLA 5J2TF 2RGAA 4CT4B 2N9UA 1TM5E 2IPAB 1CUYA 2W5UA 3S1AB 2ZW9A 4N18A 4RCYA 1NE7A 2AOTA 3CHYA 4Q4AA 5DLEA 5E6SB 4J4HA 4C88A 5I4BA 2CV0A 2JJ2A 1CUBA 3AR6A 4B2PA 2QP3A 3GLVA 1HL7A 3OTQA 4MV7A 3P9CA 3VO2A 1X3LA 4W1SA 1LSUA 3TQOA 1WBDA 4FJ0A 3HZHA 2FRDA 4DRXB 4Y2QA 2OC9A 3EVAA 2DUNA 4I36A 2OB2A 4TKVB 1YXMA 4YJFA 5TE9A 4DCOA 1Z45A 2IC5A 1GO2A 2HU8A 2O1EA 2PWYA 3OPVA 5HJ7A 3BDAA 3Q4GA 1PGPA 1IZZA 3GVIA 4BWGA 3F73A 4AJIA 5LYYA 3G2MA 5MF6A 3PFBA 1XZGA 4YRQA 1J9EA 3BK2A 5D3MA 2HCTA 1L7NA 1I3OA 4M21A 3AM4A 4B8YA 5KNBA 3N6XA 4GEGA 4HDKA 4YREA 4ITVA 4UMVA 1Q0RA 3JWEA 3EEOA 5AJXA 3GJ6A 1XAGA 4RXUA 4LXIA 2JGRA 1CDOA 1M1ZA 3ZU3A 2C98A 4B43A 2I1LA 2ZCUA 3L1KA 4NMXB 2NXWA 1RLOA 1VCHA 2HMTA 5DYTA 1MZPA 2ZWPA 4N7BA 3QFSA 3BGIA 1M83A 2YASA 4DMCA 1M6VA 1LH0A 3PKIA 4RACA 1AHIA 1PJTA 4LAFA 3TZ6A 5AD1A 5LZ4A 1ML4A 2C2GA 3H3JA 4B76A 5J40A 2X8WA 2Y0EA 5T57A 3CT4A 3ZU4A 3G68A 1E3DA 1I8TA 3V6LA 3VDXA 5HUQA 4DRYA 1SPXA 1TYDE 2QTLA 4ZEWA 1I1QB 1T1JA 4Q02A 4ZQIA 3VJLA 2GM4A 1A5ZA 4B34A 4L6CA 1AUVA 1IN8A 1T9AA 3GLUA 2OK8A 2OWEA 4A8HA 4ZOLB 3NCTA 3WDMA 2YQ4A 3WMWA 5B3JA 2WFZA 2OCAA 3F8TA 4JVSB 1N2GA 4QWMA 1GZ3A 4NG5A 5AHOA 5GY7A 4D3XA 5FTNA 2ZIZA 4ND8B 5DBEX 2YQ5A 1DDGA 3LHDA 4YP9A 1UMKA 2GD2A 3T5MA 1JXQA 3FUUA 4UBMA 3OCVA 3WLKX 1LSOA 1UC8A 1YVRA 3WNCA 2R6GA 3DT6A 5TMBA 3ZCXA 1GT6A 5HOEA 2XOEA 2E0IA 3FHLA 4QSHA 1W88B 3UMJA 5LC1A 2PKRA 4L9AA 4ZODA 3RC2A 2X9QA 2GWHA 3IRUA 2V6GA 4Q9NA 5K0BA 1YQDA 1SKUA 2PMWB 4BO7A 4PHTA 1HSOA 1CJSA 3UOAB 3DLIA 1EJ6A 4KXYA 4K87A 1SHJA 5FLKA 5KQRA 3G1WA 1T4CB 2NV2B 3QQ5A 5DTQA 4Z3DA 3SSOA 3U3KA 4N9WA 5F76A 2M2IA 4D6PA 3TE6A 2AKEA 2DBQA 2N42A 1E66A 4TTVA 2XKKA 1AC5A 1U28C 1U31A 4B0OA 2NUAB 3R0VA 4FPXA 3TTWA 2BN4A 2WJZB 4M7WA 5AW6A 1Z4JA 3H2GA 4RTQA 2IEIA 3KSDO 4EI2A 1FC0A 2X2FA 5EMKA 4UHDA 4P7JA 1JG4A 2DFPA 2WZDA 4IP0A 2ODBA 2YW9A 5CB4F 3PQ2A 3PZBA 3SEAA 3V5NA 1VRWA 4NV0A 1A4RA 1WEKA 3GDHA 4RAQA 4EL0A 1T3ZA 4GI1A 4B5LA 1L4LA 1XC7A 1V1RA 2G07A 3SOZA 3A11A 4A5OA 2WWWA 1Q0HA 2XVYA 4ZVTA 2C04A 2BH2A 4KOAA 2H07A 1DBWA 1RAHA 2X5JO 3MCWA 4ALLA 3VPFA 3GZNA 4YASA 1F9EA 2YFYA 1D2NA 1VZ3A 3QPBA 5DVZA 1JL3A 1JX6A 2WV7A 3PE3A 3H6GA 4KKXB 4NHOA 5FCDA 2ZZKA 3DDHA 1JIVA 2PRSA 3TLJA 4CMAA 2AUTA 1BTOA 4GXRA 3ZDBA 3WO1A 4F71A 1KFBB 1OLSB 3CR7A 2LP4Y 3ND9A 1V9LA 1NA5A 2IYOA 2UAGA 4S1OA 5DOVA 4E70A 2R751 2ZIXB 4K40A 4N65A 5LVAA 3QW2A 1WRBA 5JHGB 4O8CA 1L7RA 4WDRA 1XRQA 3G6KA 4H7JA 5K0NA 1F2UB 1E1DA 4ZKDA 3LMKA 2HO5A 3WL7A 3DPIA 2O20A 5JCJA 3TX6A 3Q5EA 3VR6H 1JNXX 1E7SA 2EJUA 3HE3A 1JDJA 3OMWA 3PUHA 4MVJH 4D9JA 2I2CA 5HQ3A 3NCHA 3QEBZ 3BHIA 3T7JA 1A7AA 2XLCA 4V24A 1RPJA 5JSKA 2V7WA 2I4RA 5K3EA 4DG9A 1A0OA 1R64A 2PE5A 5KYXA 1CUWA 1H3FA 3IJRA 4CPDA 4HRAA 3SDZA 2AEJA 2B4AA 3JQFA 2BE7A 5TC4A 4GGMX 1E0SA 2QRNA 2WOOA 4WCFC 3SHVA 3O4FA 4P92A 1V1MA 2JLAA 4B33A 3MD0A 3RVLA 5FH9A 4G09A 4TT3A 5DZSA 1ILWA 2A1TR 2AKAB 3D3JA 2RBKA 1Z88A 3KUUA 4JSYA 4G0VA 3F8SA 2G28A 1PJ4A 2RCNA 3E48A 4ZXPA 5IAAA 1SU7A 3GEMA 3W2FA 1BKDR 3DDNA 4UU7A 1G8YA 1NVMB 1MB0A 1R10A 2JH9A 5BV1A 2Q5CA 1PV4A 2CL0X 5AW3A 3GB9A 3CPSA 5JCOC 2FP3A 4MS1B 3VPAA 3ZC3A 3PTAA 1GQOA 1WULS 4YMWA 1MUUA 3ROZA 1LRKA 1F6DA 5COQA 2QPAA 3FNHA 2Y1XA 5LP6C 1XZ8A 2AD1A 3A9VA 1PDWA 3IOBA 4M36A 3CR3C 3NHMA 3BL6A 1M72A 3A6JA 3Q5GA 4JJAA 1O5IA 1QWSA 2V4UA 1A5BB 3QVGB 2VK1A 4LBWA 1X1CA 3VZPA 1L5NA 4PPQA 3CONA 4YK7A 3I0MA 1I4OA 4MRRA 3G0OA 3QMMA 4PZPA 4X3OA 4C7XA 4Z4FA 4TL8A 1DGQA 1SQGA 1GNSA 3KIPA 1V26A 1WVIA 1J5PA 2B7BA 2HXSA 2JARA 4NR0A 2PMFA 5AI8A 1NJ1A 1N25A 4INPA 2AJ8A 2SBTA 3H87A 1MC4A 4J29A 2RIPA 1QH8A 3BT7A 4JP5A 4U6QA 5DWDA 1ZU4A 3HR7A 4X93A 2JG3A 5DGTA 1SU6A 4ZT4A 2IS6A 1P1CA 1Y4ZA 1XUOA 3EBOA 4UTXA 3R0XA 4HUQA 5EHZA 3IAEA 3R7SA 4ZJUA 2QM7A 3THXA 2VHCA 2VP4A 2D3WA 4M0MA 5A5DA 2XGJA 1JMYA 1RDFA 3THRA 2COKA 5JNLA 2RJOA 3R3ZA 2ZOSA 1ZGHA 2VYNA 3KEMA 1YFZA 5C4GB 3T3MB 4DRXA 3FYUC 1LVUA 1Q11A 3C16C 2QLNA 3ORRA 1Q77A 3OUUA 3R75A 3KPYA 3GCXA 4LPKA 4UNSA 1E62A 5KYUB 5CDFA 2Z9BA 2Y8EA 2CZQA 1JYFA 3VU3A 3KTAB 4RM2A 2JFBA 4MGEA 3RHZA 2H3HA 2BHLA 2VQEB 3KD2A 3JVUA 4A8JA 1G63A 1Q12A 4LQDA 2QB5A 5F1YA 4W7SA 2DQ4A <