1RCFA

Structure of the trigonal form of recombinant oxidized flavodoxin from anabaena 7120 at 1.40 angstroms resolution
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
169
structure length
169
Chain Sequence
SKKIGLFYGTQTGKTESVAEIIRDEFGNDVVTLHDVSQAEVTDLNDYQYLIIGCPTWNIGELQSDWEGLYSELDDVDFNGKLVAYFGTGDQIGYADNFQDAIGILEEKISQRGGKTVGYWSTDGYDFNDSKALRNGKFVGLALDEDNQSDLTDDRIKSWVAQLKSEFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transfer(flavoprotein)
molecule keywords FLAVODOXIN
publication title Structure of the trigonal form of recombinant oxidized flavodoxin from Anabaena 7120 at 1.40 A resolution.
pubmed doi rcsb
source organism Nostoc sp.
total genus 57
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 1994-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rcfA00
1JA0A 1RCFA 4DY4A 5FUQA 3KAQA 3OX3A 3LT5A 1VMEA 4YAFA 2Q9UA 3O73A 5LVAA 5TGZA 4PTYA 2Z9BA 4QOGA 1J9EA 3NHSA 2QX4A 4PTZA 1AKQA 1SG0A 5FA6A 4XDHA 4C14A 1AMOA 3O2NA 2GSWA 4CETA 4LTMA 5F4BA 1BU5A 5FX2A 3B6IA 1DX9A 1H66A 4C0WA 5JROA 1FTGA 3NHJA 2QMZA 3F6SA 4Y9RA 3FX2A 4D02A 1RTTA 1H69A 4YAOA 4GR9A 3K20A 5NULA 5B3KA 4H6PA 5LJIA 5LLDA 3OVMA 2Q62A 2X2OA 1CZUA 3NFRA 1CZOA 1XI2A 3HLYA 4QOJA 5F51A 4C0XA 1FVXA 5A4KA 3ESZA 2W5UA 3OX1A 1D4AA 3ESYA 1T0IA 2XODA 1FUEA 1YCHA 1TIKA 1OBVA 2AMJA 2BPOA 4QOHA 3N39C 3FJOA 2QX8A 3FW1A 2Z98A 1QHEA 4U7HA 5EAIA 5B3LA 2R97A 5EA2A 2X2PA 3W77A 4BMOB 3U7RA 1XYYA 3L9XA 2QX6A 4H2DA 3F6RA 4FGJA 2V9CA 1C7EA 4YAWA 1YCGA 3QE2A 1DXOA 4BMPB 1XT6A 1AKRA 2M6SA 1AKWA 1BVYF 4PU0A 1D04A 3L9WA 1GG5A 1KBOA 3ZHOA 3F2VA 2BN4A 2WC1A 2OHHA 3NHUA 4Y7CA 4C76A 3NHYA 2HPVA 4QODA 1QBGA 1AKTA 1E5DA 1DXQA 2F1OA 2MTBA 1AKVA 1CZLA 3R6WA 4N9QA 3HA2A 3UXHA 3NHKA 3ESXA 3SVLA 4HS4A 2D5IA 3UXEA 6NULA 1XYVA 3U7IA 4F8YA 3W78A 2RG1A 2HNAA 3ES9A 3NHLA 2QR2A 4ZVLA 4J8PA 3F90A 3TE7A 2MT9A 1RLIA 2FOXA 4NULA 3RPEA 2MWMA 4DIKA 1OBOA 3KLBA 3QFCA 3NHPA 2MOKA 4QOIA 3NHWA 4ICIA 2FZVA 2V5VA 3JSXA 1ZWKA 2FLVA 4N82A 2FCRA 1D03A 4ZVKA 4DILA 1CZNA 3HR4A 2OHJA 1JA1A 1AHNA 5F12A 2OHIA 3GFQA 4Y9UA 2V5UA 1CZRA 4HEQA 1OFVA 3EYWA 5NLLA 2BMVA 4XDGA 4U7GA 1AG9A 3GFSA 2Z9DA 3FVWA 4NLLA 4ZVNA 3N3BC 1J9GA 4FX2A 3TEMA 3EDOA 4ESEA 2FDXA 2BF4A 3B6JA 3KAPA 4YAUA 3OJXA 3GAMA 1FLAA 4FGKA 1AKUA 1WSWA 4N65A 2KQUA 3G5MA 2BZSA 3D7NA 4GQIA 1I1OA 1YCFA 4LA4A 4R81A 2A5LA 4GI5A 1RLJA 2FZ5A 1YRHA 5LBUA 1F4PA 5LBTA 1B1CA 3QFRA 1V4BA 3OWHA 3B6MA 2XOEA 5LMCA 1YDGA 2OYSA 1ZX1A 2ARKA 1FLNA 1KBQA 4LAFA 3NHRA 4QOEA 1QRDA 2QWXA 3W7AA 2FX2A 1CZHA 3K1YA 5BUCA 1J9ZA 5ULLA 5LJLA 2FVXA 1NNI1 3NHFA 3P0RA 2M6RA 4LTNA 4U7FA 4CF6A 1J8QA 3N3AC 2QX9A 3KEGA 2Z9CA 1FLDA 2B3DA 1YOBA 1X77A 4LTDA 4ZVMA 4S24A 3S2YA 2R96A 3NLLA 3B6KA 2ZKIA 1SQSA 3GFRA 2FAXA 1FLVA 3FNIA 4QOFA 1QR2A 1C7FA 4YALA 2N1MA 1WSBA 2HNBA 3W79A 1YKGA 1AZLA 1FX1A 4YQEA 1TLLA 1ZWLA 3TZBA 5EMNA 1T5BA 4M0CA 3OWXA 3LCMA 3OX2A 4OXXA 3OJWA 2KLBA 1CZKA 4FGLA 2QMYA
chains in the Genus database with same CATH superfamily
1K7SN 2EU8A 2VIIA 1ZGJA 1FNNA 1GZ5A 1KERA 4LSWA 2FGKA 3QWBA 4X85A 5K20A 2I6TA 3CKKA 1KRWA 1ZIDA 1PDOA 1QCCA 2BFFA 1QNFA 2RHHA 3EGOA 4UNIA 1XXHE 3I2YX 3IQGX 4IV5A 3HE3A 1KY2A 4KQ2A 1A7UA 2EIHA 4LHXA 4RVSA 4URHA 3WIBA 3O8DA 4FFRA 3K0SA 1UFRA 2FG7C 5HQ3A 2HPZA 3QVJA 1KKLA 2O7QA 2Z0MA 3SWWA 4NG4A 2F1HA 1FDIA 3NXKA 1T4BA 2QRHA 3KALA 2O4CA 3DJYA 3FTDA 3SM9A 3SS7X 1W5AA 4NCXA 1NJ5A 3ZD9A 1FSGA 2B1IA 3DV2A 4IILA 1E2GA 2H54A 1SPBS 2ZRFA 5FJIA 3ZDCA 4V03A 5IKMA 4EJ6A 4EVRA 1K9VF 1OWLA 1Q5PA 1XQ1A 1NR5A 1P2SA 1IHOA 3A1FA 3GCDA 5ALQA 4PYRA 1AMOA 5CA0F 1I4LD 1TRHA 1T26A 2UYOA 4G0PA 4KN6A 2ONJA 1QK3A 1SVNA 4IJVA 1JXQA 1L5QA 2CFRA 4NZZA 4HC4A 2PBLA 3MWEB 3H1PA 2FQWA 4ZRMA 3LRTA 4ENUA 4CUKA 1IZ7A 4IJKA 5F4BA 5C4IA 3I9JA 3KHKA 2ZT6A 4J9VA 4XLLA 2VI5A 4Z4CA 4F2GA 1EEHA 3U4AA 1BKDR 1ZEMA 3EMVA 4B17A 3LT2A 1W59A 4LOJA 1V3UA 1UADA 4BP1A 1VKOA 3R5FA 3DEZA 4ZZ3A 4J29A 5TE9A 2F3UA 2Y3IA 4NOJA 4RESA 4WEQA 4WJZA 2GYWA 4MIKA 3SZRA 2VP6A 4OATA 1QK4A 1V35A 5TRTA 1P0PA 2I4MA 3DGEC 3E8SA 1T8SA 3FYSA 3EHEA 3P71T 1ZA2A 3UAOA 2P2LA 3ISJA 1OLXB 4B40A 2QVCA 3FFWA 4DREA 4L5JA 1ULSA 4YGYA 5FOVA 1VYUA 4G0NA 3NYRA 3GCZA 3PFFA 2K6GA 4LGVA 3PGMA 5CNMA 1Y1RA 3VVCA 1U63A 1O97D 4KMSA 4B83A 4JLJA 4X8HA 4C01A 4XVUA 1K66A 3JTEA 1EIWA 3LD9A 3NHZA 2HCFA 1EVLA 3LI2A 4BBJA 4BUZA 3SE7A 4NZYA 3WC4A 4QJBA 1B15A 2OG1A 4K6OA 4NQRA 3WB9A 1TPZA 1WNFA 3AGPA 3DT9A 1R10A 1MAVA 4FOSA 2A2ZA 2VFAA 4R69A 3V8VA 3L5KA 4ZJYA 3CUTA 4HLQB 4LYDA 3CCBA 3O95A 4YJ3F 1IBRA 3OT1A 4JLMA 5L3SB 3JD4A 4C6TB 4DLTA 1G21E 1MNQA 2DUNA 2WYHA 3A10A 3A9SA 3PF9A 4NMWA 5FV7A 3FNQA 1OAAA 3UFXB 4DT1B 3QTBA 3TQFA 4ZGBA 3WRWA 2I2CA 3G6KA 3G79A 1FP2A 1JTFA 2QGNA 3LBHA 3Q11A 1E66A 3FYUC 4OOEA 5T67A 3W5IA 4DUYB 1SXGA 1P61B 4HTFA 5IN5A 3JU3A 4Q9DA 4XCQA 2H1WA 1DBRA 2CD9A 2V54A 4BCDA 1PK9A 5JVDB 5B7NA 1IOZA 3ZDDA 4HDKB 1NT4A 4WOJA 5JQGB 4N76A 4S3MA 2HIHA 4U9UA 1L5WA 3CKMA 2GFIA 3CNOA 3TFOA 5EWJB 2Z98A 1D0SA 1FU4A 2GB4A 1TECE 2M6LA 9LDBA 2ODEA 1KK0A 4P98A 2W70A 3RASA 3RS4A 1J70A 4NAUA 1T4MA 3KC2A 4FKMA 4LCJA 3T6KA 3L1IA 4RYLA 1PK7A 1MIHA 2CB9A 3L1HA 2P5TB 3AILA 5AKZA 1AV7A 2XMPA 3IR7A 3SXUA 2GBFA 3HO8A 4D6PA 4X6XA 2QLBA 3H3FA 3TPZA 3SGLA 3DEKA 3PWKA 3BIOA 2G7MC 1RJ9A 2TMYA 3QYPA 2NU7A 2PZBA 3M9XA 3C87A 5EKXA 5ENZA 3STUA 1OWMA 3V32A 3I2KA 4EMUA 1ZD8A 3UGJA 5ARDA 2CJPA 5AK0A 1T9ZA 2OHVA 3FNHA 1IL0A 1JDZA 1AB5A 3EVBA 1XAGA 2NU8A 3RSCA 4HRYA 4BFYA 3OLCX 5EUMA 1KE1A 3PA8A 4EAAA 5BW4A 5L53A 4HAIA 3T06B 3R3ZA 5CDGA 4K9NA 1E20A 2D00A 2IZ7A 2JIOA 4YRCA 5JBIA 3ZJ5A 1ODFA 3HO1A 1GZ4A 2MINB 2JLYA 3Q87B 1T6ZA 3AEUB 2J9XB 4JOQA 3EWNA 4YCAA 2QQFA 2VR1A 1ZOOA 1C9DB 3AF1A 4F8JA 2GEKA 1QB8A 3IMFA 1IBSA 1PE0A 1JR6A 2ZU6A 5A1TA 4O8CA 1Q0UA 1U2SA 1WAMA 3FYTA 4E13A 3GRYA 3WLJA 1GSHA 1Z45A 2NVOA 2ZB3A 4KAXA 2CXPA 2ACEA 3RDPA 3WO1A 5CJ2A 5M04A 1VLVA 4PYOA 3RO7A 4BEWA 4AKGA 3PYLA 1L5MA 2EYQA 2PGNA 2VWGA 1R27A 1L5HB 2XKJE 3A1NA 1ADGA 4OM8A 2IV7A 3N2NA 4LDZA 3RU7A 3QX3A 3V2UA 2FW6A 1T91A 1T4DA 2YR0A 4DUGD 4DDKA 4EPTA 4YRBA 2JLCA 4KQMA 3C3MA 1ANKA 1K4MA 1PX2A 3G89A 4HVCA 4JP8A 4K6HA 4CW7A 4M21A 5EMNA 1VPLA 3X2FA 1KI3A 2XSZD 2QXTA 4MIYA 1QV7A 5AICA 2JJ1A 3ZHRA 2PUVA 3QVKA 1X1DA 4L07A 5FB3A 3K73O 5GJVC 5C1DA 2H8KA 4GPZA 3WQQA 2H1IA 2OUKA 1CUBA 3M6UA 5CNJA 5DIZA 1TZ2A 5AW1A 1IM8A 1RYHA 2PU7A 3AB3A 3QM1A 3C1UA 4HJRA 3MOGA 4FCTA 2BBTA 2I1WA 3NM6B 1S96A 2EZ4A 2DQSA 5JISA 4PC7A 4JV5B 1QVAA 2HQBA 3T1VA 2CUZA 4QUAA 1A2QA 1WE2A 3AF5A 1J2JA 3GUYA 1QF7A 3KLOA 4B6RA 3BOSA 3L4KA 1S3IA 2C9CA 4C0SA 2WILA 1U8ZA 1YTUA 1UXJA 4LZPA 4M8LA 1G38A 1ZC4A 9ATCA 1XLWA 3MCWA 2FPMA 4JQOA 2QW0X 1TEZA 2A3NA 4Y6LA 2QIOA 1IDOA 3VO1A 4CIXA 4X7RA 3UMYA 1G9XA 2DQKA 1VXOA 2I8CA 1US8B 3P32A 4G25A 1E1CA 1KY3A 4XWAA 2J3KA 3PNSA 4ALLA 5BUQA 2A0WA 1E1KA 3WGJA 5B3JA 5F7ZA 2C1EA 1BS2A 2GKGA 1QYWA 1BCSB 2TRSB 2ZJAA 3X1KA 1E69A 3QLUA 1MA3A 4W82A 1RU3A 1H0KA 2J31A 4KQGA 4TPKA 1OBOA 2ICAA 3FPFA 1A9XA 1RRCA 2GAOA 3CGGA 3V1MA 4N12A 5DYGA 3SIWA 1DRUA 3H4MA 4MCAA 5I7WA 2P41A 3UYKA 1E6CA 2RCYA 2YKGA 1ZU4A 1Y5NA 3TBHA 4LE0A 1LC3A 4GBMA 1GARA 3FWKA 5EYPA 3IMKA 2CNLA 2PKWA 3E61A 3EEQA 4HWOA 4BS9A 1UKEA 1V3TA 1I3OA 1JYEA 2J30A 3A1UA 3HP4A 4B7ZA 4MRMA 3V4VB 3P5BA 5TMPA 2OCAA 1VM6A 3ZYCA 4LF4B 4JEUA 2IHVA 1NN1A 2YYZA 4R16A 2J5XA 2GZAA 4LCBA 1JAIA 3Q7PA 2WF9A 2A7QA 5F7OA 3AJAA 2IJGX 3H4VA 3K8QA 4RS3A 1GL9B 1MGOA 4QWWA 1ZHHA 3I1IA 3V4OA 2OBMA 2DFKB 4M36A 5A5GA 1LDGA 3WXBA 4BGIA 2IHKA 3ND8A 4K81B 4BVGA 1JHVA 4AB1A 2HJ9A 4XTRA 3U7FB 4C2UA 4I46A 2XBMA 4DWWA 2VPXA 3AY0A 3KUKA 5HQTA 4OHOA 4A8JB 5GIOE 1QDEA 3IALA 3OUTA 2PX5A 4UUAA 5IWAB 5F7JA 2AXPA 4DBVO 3OZXA 3G0DA 4LX0A 4OAQA 4OH1A 2HT6A 2R6R1 4JJ6A 5IAAA 5MGNA 5ITVA 1UMBA 4IJQA 1LNSA 4H6VA 5AI4A 1M2FA 2O23A 3KAKA 5A3JA 1SVUA 2JI8A 2WF7A 3F4BA 1FU7A 1C30B 4G81A 4JITA 4ER5A 3WQHA 2QRVA 2AXEA 1A4RA 3PU6A 3RI3A 3U1TA 3G85A 4KQWA 2FH5B 3L6UA 4F5WA 5JAZA 1P17A 5C4MA 2Q5IA 1BRMA 4BWVA 1J0XO 3W5DA 4FCCA 3AZPA 5CXSA 3VTAA 4Z4QA 1TYAE 2OECA 1I8TA 3DFUA 4KXVA 1K7FB 2DY0A 3LX8A 1QZXA 4HXGA 5THQA 1HE5A 3MJRA 3DO6A 1JA9A 2UUOA 4MOWA 2JHGA 2VJCA 3OCYA 4OJNA 2AIRA 5IBRA 1OASA 4DRYA 4UOQA 1VJCA 1B8OA 2REQB 4IHJA 2PYDA 4IJWA 5E6RB 2JGAA 5GQSA 3U40A 1N3LA 5A9SB 3EVEA 5BOSA 1JEYA 5A0TA 1FXWF 1U1DA 2OM2A 3MBOA 4M1QA 1P81A 1NRWA 2FZ5A 4X1YB 1DC6A 4BMYA 3SHTA 1J0DA 4FKZA 3V9AA 5JATA 5KVSA 4FQ7A 1RWOA 3BWYA 5LN1A 1MW9X 3E58A 3VU8A 4TUYB 5CP8A 1ODIA 4EHFA 1F5NA 1LPMA 2PD4A 3QVVA 1Q0TA 1E2QA 2BE7A 4MULA 1C9EA 3CUSA 3WWCA 4RHYA 3EPLA 2D3TA 3HBJA 1ZSVA 3IDQA 3OEWA 5IT5A 1AHIA 1FTYA 3ESDA 3KQSA 1KBQA 3OEHA 3PC3A 4TLCA 4RVCA 1I7DA 5I3CA 1Y3FE 2A0KA 1E5XA 1WB4A 2QN3A 2VDWB 4LC0A 4CRWB 2B82A 2JVKA 3GDHA 3P0HA 2IYXA 3AUFA 1EJ2A 3ZWMA 4CV0A 1P7ZA 2V98A 2ID4A 1QRDA 3GZNB 5EP3A 4OHMA 4EGCB 4IICA 2F90A 2GHIA 3EEIA 3PUKA 5EKSA 1CJSA 2QTLA 5B64A 1J09A 4GI2A 3ZLTA 1QIHA 2QKYA 4V1CA 3ZZTA 3B52X 1O6CA 2X9LA 1WWKA 1OXKB 4DADA 2G3YA 5LNK1 4R84A 1ZD1A 2VCYA 4ZP1A 2AI1A 3DHVA 3WY9A 1G7CA 3GLHA 4L0MA 1TGYA 5L4NA 1OXUA 3QLTA 5FI5A 2B8WA 2REXB 2HA4A 3EVFA 4YROA 3DAPA 1MQ8B 1M2EA 2RBKA 3CB4A 1BE8A 3ZHSA 3OLXA 4KQEA 1G55A 3H5WA 2VH1A 4ND1A 1PJ8A 3A14A 3P20A 1DQPA 1K2WA 2CLEB 2H1SA 1T2CA 2WAXA 2WJWA 2ZAMA 5I7AA 1AU9A 5IVIA 3C3PA 4HI0E 1H0HA 4WLUA 2PSFA 3IOEA 1IY1A 1T8PA 4F6RA 3PJDA 1ST2A 1VG1A 2OPBA 3FFAA 1DJNA 3QPVA 4TWRA 4UPDA 5LP6F 3W6OA 2R0QC 2Q9CA 3KJZA 3UJNA 1LLQA 4KQ1A 3S2YA 4YV0A 2CXRA 4FYVA 3NATA 2R96A 2IH5A 2WQZA 4AQ7A 2HK8A 4W5OA 3SICE 3CHYA 3EJWA 5C1IA 1H3EA 5LP1A 5C8YF 1YZYA 1SBZA 3RFFA 4EVIA 3QA9A 1LSUA 5JYEA 3D59A 4IG9A 5L51A 2FSVC 4MI3A 3RVMA 3FNGA 2B61A 1WPGA 4BQRA 2DU8A 1Y5RA 4G6ZA 4V0ME 1WUKS 4R9RA 3PX2A 5AM0A 1GTSA 4P4SA 4IH9A 3VNQA 1RWVA 1JNXX 1FYDA 1C3EA 3PJGA 1I4EB 4FE3A 3DPUA 1VPVA 3THXA 1UDXA 4CVNA 2J3LA 3H9QA 1OSNA 4OXYA 4GC5A 2RHOA 3KQPA 1J8DA 1PZEA 2HWUA 3MWLA 4V0LA 1UJNA 4PNHA 1XKLA 2O2CA 4G0OA 4PPGA 121PA 3TEJA 1WF3A 2ES4A 2GLUA 2NZWA 4C3ZA 1W7AA 4YCBA 8AT1A 4Q9IA 2ENWA 4ZQGA 1PG5A 2BF7A 5KTKA 2H2FA 1ABBA 1SD1A 2AD5A 2DUMA 2ZYVX 2YWRA 1I6KA 4IS3A 1JG7A 1JLLB 3EG9B 3VC7A 2RHMA 3OA2A 4EW3A 2GEBA 1DKPA 1RXWA 3MMZA 4MQFB 4NBLA 3AUXA 4KDEA 3OOYA 2VDMB 3MT7A 4QGGA 4RMHA 2HZ7A 3B20A 4YAIA 1SK9A 1JKMA 3BMNA 2QL7A 3ML1A 4G1VA 2IWRA 1T5BA 4U9HS 4ID3A 4RY0A 4A9AA 3J81A 1JDPA 3I5XA 1TL7C 2RH8A 2R751 4TV9A 5ADUS 1K8YB 3JR7A 2QE7D 3R44A 4MWSA 4Q9AA 1KEEA 1IEQA 5GONA 3L07A 1SURA 3VXKA 5KYXA 1GA6A 2DFDA 2CKMA 1WPXA 4MUNA 2WJPA 1P9LA 5BN3B 5T4FA 3WK9A 5DLYA 4GL2A 1E8MA 1T2EA 1ZCJA 3GG2A 4HAWA 2XXJA 1VCHA 5KOJB 3RHTA 5GINE 2XTMA 1NM5C 1ZD9A 1K8RA 3E2PA 4RKQA 1A96A 1E2JA 2FW7A 5DIFA 3U7QB 4DLXA 4YRKA 2FLWA 1JHRA 2W6JD 1L7BA 5EJAA 4MVJE 1YBFA 5CHYA 1Z6PA 2G72A 2VDUE 3HBFA 1WOMA 2HXYA 3Q41A 3A04A 4H59A 1BQ4A 1F8GA 4GEKA 4WUTA 4K28A 1SQ0A 1XL0A 4B8YA 3HDGA 4RW0A 5KYYB 1XCGB 3BKWA 3VAAA 4E2XA 1G8JA 1UJBA 3EA5A 4HH1A 1BHSA 4UZSA 1E79A 3KELA 3FRJA 1AKQA 5KOIA 1RDFA 2G71A 3HXTA 3NS7A 3LDUA 1KZ6A 3H6KA 5FTMA 5T4EA 4XDHA 4C14A 4YR7A 1N1GA 5KTPA 4JYPA 3QEMA 1XNRB 2A6PA 3SZ3A 4PGMA 4H27A 5LBIA 1GKYA 1O9GA 1T5LA 1EM8B 2I6UA 4CETA 4WCDA 3DTTA 4TS9A 3HTXA 4ZYVA 3RC3A 3AESA 2XB6A 3QV1A 4FM9A 3UMSA 4X61A 4EAQA 1GZVA 5JS6A 3RYIA 4NFLA 4XAQA 1UM9B 3PNMA 2R2GA 2ZTUA 5KQMA 1E6EA 3ZWAA 1NF2A 2I6QA 2OCGA 3BXEA 2PKQO 2QHXA 5FI0B 4M9XA 2C2WA 3N8IA 1T5TA 2IX9A 4BFUA 4A1OA 1ZD3A 4Y2SA 3AR8A 3BFPA 3OEEA 1BTOA 1FTGA 3JWEA 4ARZA 2B35A 1VCOA 1YDMA 4MJLA 2Q6KA 5DNDA 5FUXA 3ZDRA 2NUPB 4KUEA 1CW2B 3K72B 4B35A 5B6JA 3EASA 4RZ2A 1YDEA 1E6LA 2CE7A 4M2LA 2FPPB 2R86A 4OFZA 4UM8B 4EELA 1Y98A 2GRJA 3FX2A 3OE5A 5AJZA 1SOUA 4AC9A 7ADHA 1ECGA 2X22A 2FE4A 3LHKA 2BBSA 1SIUA 2XOXA 5LYJA 5LOVF 2XMRA 3KB2A 3TB6A 2XZDA 5DHFA 3RVSA 2AC2A 3UV3A 3I2JA 3DBVO 1LPOA 1AGRA 3A70A 3PIDA 3LV8A 2XJ9A 3CEHA 2NUBA 2VHTA 1OLSA 2GO1A 1KEKA 1RRVA 4ZD6A 4LWQA 3NFRA 4S2UA 5ALNA 2BEVA 3WZLA 3IVCA 4BQSA 3I2FA 4HDRA 4L4RA 2EAUA 3OTQA 4M83A 4GZ5A 4DIDA 2BUAA 3OAAD 1ZCFA 2OVFA 3F5SA 4KMMA 4PWYA 3SVZA 4ALIA 4KPFC 1K63A 4CT0A 1T0IA 3A31A 1M8KA 1M73E 3A6EA 4C7OB 3ZKWB 1T2AA 4RK5A 4RTOA 3EFOA 1H2XA 4HQRA 1K86A 1A1VA 4XQGA 2IWHA 1FX0A 4QOHA 4C07A 3GRZA 1JEAA 3VI4B 2DHCA 3DCJA 2PAAA 3FJOA 1AK1A 4M99A 3AMVA 4WXYB 3MWGA 2Y1EA 4KB5A 1XTTA 1YE8A 1ZIPA 2PUTA 3QFSA 4WN3A 4Q6BA 2JJ8A 1MOPA 1FF9A 3B8HA 1GPMA 1HURA 2DUJA 1WVMA 4N9WA 1SVSA 4RE6A 1DCKA 4Q82A 1Z4KA 2OLJA 3TDKA 5LQRA 4G37A 3SBEA 1ULUA 1O6GA 4IQFA 4KVFA 1JPVA 4YJ2F 5EA2A 1C7ZA 4QKQA 4F93B 1LDMA 3HR8A 3VR2A 1X1SA 1GPJA 1O1YA 1ZHOA 2I55A 2QAJA 3Q9SA 3QVSA 4NNOA 1E2DA 3I01A 4I36A 3STWA 1MX3A 4IZHA 3T5TA 3ZNPA 3FCEA 3HCRA 5GZ6A 1UDBA 1EX6A 2P65A 3HRKA 3P9XA 3RKUA 4IDPA 5TLSA 4U8HA 1C7IA 4O4HA 6ADHA 1AO3A 3VJRA 4I3FA 1NFRA 4WSOA 4OP2A 4Y9SA 4ZI5A 1G1MA 1AE1A 5U4QA 1FMFA 1YWGO 4CM4B 5JDCC 3LECA 1QIMA 3NEAA 3LY7A 4LEIA 1XVLA 2V9CA 3ZK8A 5U9CA 1C3JA 4TGLA 3EZ9A 1J06A 1Q7CA 2BP7B 2OFFA 4BVKA 1BKYA 1VBMA 2FMIA 3JRWA 1AKWA 1I24A 2RH9B 2GKOA 4LKOA 5JXJA 4PU0A 3G1WA 3P4UA 4DZRA 1MHPA 1XF9A 2DULA 4LBWA 3F2VA 4UVIA 3BBLA 3WLEA 1Y33E 1XWFA 2AXQA 3UWMA 1PQYA 1TQ6A 3AINA 4JLSA 1DCFA 2Z5GA 1XDBA 3I30X 4KAFA 4OLFA 4M8NE 4PG5A 3UH0A 5TIIA 2AQ8A 4M6WA 1PJBA 1KI8A 4PO1A 2CCKA 2XUAA 4HX2A 3KVVA 3DBHA 5DYWA 2JCYA 1EUYA 2QJTA 2XNDA 3ZWWA 3NHYA 4DJAA 4HXYA 5K01A 3ZE1B 1Y8RA 2NUAB 4CJXA 4P3KA 4Q1DA 4AS2A 3GHHA 4L4SA 5LLTA 3GLRA 1P3JA 4K86A 1NZFA 1DC5A 4POAA 4PGGA 3HHPA 1KJ8A 4D2IA 1UFOA 4YJFA 3DE1X 4Q3NA 5AUNB 5A05A 5E9WA 4FU0A 4WGGA 5ICEA 1DXYA 4IKPA 1MRSA 3PUHA 2D74A 4RMJA 2PZKA 3A8TA 2H4FA 1UXHA 4I19A 4QPZA 1WB5A 2ZR7A 3BMOA 4YRRA 4H4CA 1ZG3A 3DOEA 1V71A 2Q0SA 1QH0A 1AUOA 1W8IA 4GXQA 5EQJB 2DTDA 2FJUA 1I0IA 3VZPA 2KYRA 1DBSA 3DWEX 1BEZA 1KEVA 3NHKA 1ZHFA 3O83A 2YL2A 1JFFA 1EP1B 2IIBA 3ESXA 2X8AA 3JQGB 2HBYA 1RIIA 4FLFA 2BFCB 4MX8A 4NZPA 2QUJA 4L08A 4A6DA 4TKVB 1F2UA 2C92A 3QPAA 1UOEA 4G9BA 3ND6A 4AKTA 1WZCA 2FN8A 3DE4X 3KQQA 3WXMA 5LZ4A 4KNYA 2IEDA 3Q2IA 2DF8A 1D2RA 1V1JA 5K8CA 1R5OA 1KZ4A 1TADA 2DLDA 1VI2A 3G2JA 5EP2A 1MCZA 2GPSA 3LWNA 4GPEA 1Q95A 2C3YA 1PJ3A 5C1BA 3DMYA 1TO1E 5TC4A 2HHHB 2B7LA 4KHZA 5C0OE 3SF8B 3W90A 3OZEA 1UJ4A 3R9XB 3BJZA 5EHIA 1SXJC 4EF6A 2XA1A 1ZUNA 2HREA 4I50F 5ECWA 2YNMC 2PIAA 1FFCA 3FI0A 4JU9A 5FPPA 4IDOA 1P29A 1OQAA 3WKCA 2MWMA 4WQMA 4ALMA 1KJQA 2YASA 3JQAB 3O47A 4I3GA 1AS0A 4EA8A 4ETIA 1KK3A 1N6OA 1KXZA 3W1VA 4IP0A 1R4MA 1YJXA 3MRXA 1X9IA 4B45A 3HYTA 2A86A 2XZOA 4NIMA 2EARA 3GH3A 3OSZA 4REOA 3AKYA 3R3SA 4WJKB 3NX4A 3VDXA 1IM5A 1P4GA 3AVOA 3PK0A 1PEAA 4P7BA 5F4ZA 4DM4A 2FZGA 2J7PD 2P9QA 4MVJM 4TSRA 5K4GA 1T10A 5HTOA 4ASUD 3LL7A 3GJZA 3KLPX 3RAFC 1CIVA 4KN9S 2WTMA 4PPQA 4C7BA 1D5WA 5CCXA 4CN9A 3ACCA 3KKQA 1VSQA 2FCRA 3X2EA 1H5NA 3H2YA 3ZDQA 4BAZA 2VYFA 2J0UA 1E7SA 2ZIVB 3Q7EA 5ICMA 3QLJA 3WLKX 4FOPA 4DS3A 4WNYA 4NXMB 3PKIA 3QMWA 1I2DA 4IJMA 2I66A 4A26A 4CKYA 1JIJA 1O8BA 2B94A 1VOTA 5A6SB 1E1QD 3B1WA 1P1FA 1QFZA 3KD3A 1KPGA 2HFJA 4N4AA 4IH4A 4JROA 1KGDA 2BONA 2FKNA 1R64A 1RTKA 2B4AA 3A4LA 5BSMA 5BR1A 3IE1A 2SECE 4LI3X 1SRRA 2HSJA 4RDXA 1DXHA 5DBIA 4DBLC 2HMWA 4HPXB 3EXHC 2H2AA 4X93A 2A9VA 4ZWNA 2PGOA 3BMCA 2G77B 2X8BA 4F4FA 1RWMA 4GSKA 1OJLA 1Z2CA 5DI3A 4AY4A 4BX3A 5KKCA 3RKRA 2GM3A 2PHZA 4TTPA 1TCUA 2X4LA 4KU4A 4NPHA 3AFGA 3OC6A 1X94A 3U1VA 4AN1A 2HQRA 1DJPA 3D4BA 4MI9A 4RSGA 4RZQA 3L8MA 4CLHA 2HRZA 2HJGA 3R0XA 1HT0A 5C35A 5J23A 1A5SB 2AQHA 2CMFA 2J48A 1FFBA 3GD7A 2BTOA 3WGUA 4CTJA 2N47A 3K96A 3S5JA 3FPCA 2K7FA 5JASA 1KO5A 2OAGA 3QK7A 2YWHA 4K1LA 4OK6A 2D5BA 4LSGA 3Q72A 4F5YA 4B4WA 4L72A 4GXRA 4R1SA 1E63A 1DIAA 1GZ7A 1JSXA 3VR6A 5JNRA 4NMXB 3PD0A 1PNTA 3CLUD 5K8TA 2J9FA 3A3KA 3FWPA 3JPWA 3D7NA 5IJ0A 5HZHA 2Z6VA 3B2QA 5EINA 3RWBA 5C8ZA 1CY7A 4QO7A 3FR8A 4JMLA 4RK7A 3NXSA 4XFKA 4AJJA 4DNOA 3K0FB 1RRGA 3N2ZB 4C03A 2FEXA 2PKXA 5ALHA 3H9UA 3PIIA 2QP4A 3UXHA 5A5DA 1MX5A 4RM2A 2OOSA 5EGNA 2XYRA 3G2IA 4IDQA 1W6UA 2Q5JA 3AJEA 3QKSA 3QOFA 3U4IA 4JVNA 1A71A 3IXQA 5DNUA 2BFFB 4YRJA 4W63A 3G8CA 5A3VA 2FB9A 2QMOA 2QZPA 3MTBA 4I4IA 5K8UA 4WTOA 4F5DA 5IZCC 2NV6A 3DXZA 5BV7A 2VWHA 2B1GA 4B74A 5HQ3B 5FYDA 5L6MB 5F3WB 3ESAA 1QUFA 3WNQA 1D4OA 2WWWA 4WKBA 1K5GA 1EXMA 4HNSA 4YACA 1EXWA 1NWCA 1PGJA 2HMYB 2QT9A 5ER9A 3E9MA 2W48A 2CFTA 3KG2A 3T54A 3TLYA 3UAXA 3WGVA 1MEJA 1XFAA 2Z4SA 3F67A 1R8SA 4Q37A 3GCWA 4BB9A 5A2GA 4ML3A 1N57A 5CVDA 1N9GA 3K8ZA 1OKKD 4G67A 1FY2A 1UBLS 4JP5A 1N4AA 1K98A 1S7GA 1YK1A 2XKBA 5B6IA 4GM0A 3LP5A 1JJBA 5KO2A 1Z5VA 4G5OA 3E9CA 5JD6A 2I6SA 5FH9A 2XPCA 3R6GA 5JH7F 4CQNA 4HLCA 1XMJA 4ZDKA 1Z0UA 2FSSA 5T8KC 5KJ6A 1O5TA 2OK8A 1J8YF 4Q9KA 4JXXA 3SC4A 4TXMA 1GN8A 3BF8A 4TL6A 5KKAA 3AF2A 4I1OA 4NNPA 3UJ9A 3VNUA 2PTGA 4FNGA 1P75A 1POWA 1QYDA 3HS3A 1F0PA 1ZC3A 4H1HA 4M7OA 2WJZB 3A1DA 3P9IA 5HK9A 5KC8A 3BJMA 1NBMA 1UR5A 4AZTA 4B8WA 3UW3A 1KK2A 3C74A 3IEKA 1GQOA 1GG2A 3AYZB 3MCVA 4N0QA 1L8LA 2YHUA 3SR4A 1FYEA 4MW9A 5D85A 2JFNA 3OKFA 3WJ1A 3LMKA 5UKDA 1P62B 1M7GA 3DAHA 1KWKA 3DL7A 1CR4A 1Z0FA 2GTHA 1PR2A 1GITA 5LDGA 2EXXA 4D4IA 5FBHA 3RIEA 5LFAA 2FPOA 1BD4A 3KP1A 4JOSA 2OB2A 3IAHA 1CVRA 1NBEA 3O84A 4RADA 2AN3A 4IUYA 4WNIA 3WV5A 1Q3TA 3EFBA 1MO4A 1TJPB 1LW7A 2WVAA 4HNRA 2AYYA 2YY6A 2C8JA 2J4FA 1O95C 4FIDA 4IDDA 4HXEB 1Z2NX 3Q1LA 3QE0A 4J7CA 3GI1A 1WV0A 4MRAA 2ZJ1A 3OT1B 1GKLA 3QA3E 3NI2A 3QMPA 3X44A 4BV2A 4G56A 1EK6A 2QY6A 5F33A 3KVNA 2QL6A 3I64A 3AHFA 4IDHA 1LKZA 4BLRA 3U4DA 3UJCA 1WSBA 2QGFA 2QD3A 5TS2A 2Q3DA 3SJBA 3ANTA 1FVFA 5DCLA 2JG3A 1CYEA 3BWDD 4EHJA 3NDIA 2P78A 3KXDA 4UUOA 3T7KA 3HCPA 4D9EA 2ZJ5A 5JD4A 1CUWA 3ESRA 1OX4B 2E4VA 2HF2A 1FXUA 3OHMA 2NVWA 2NGRA 4ESHA 4TWIA 1JLKA 2HAEA 5GJWC 4EZEA 4M1TA 1QWSA 2XZLA 1V26A 1G66A 2AG0A 2ZDGA 3N0TA 2JC3A 3QXGA 4OQEA 4BPRA 3ASUA 5DX0A 3F8WA 4PLVA 3K16A 4PONA 3QJYA 4WCFC 5AOBA 4NK4A 2ID8A 3I9V1 4A8PA 4GUAA 1WSAA 1FDWA 4OYLA 1CDOA 3RVJA 4OMDA 1JVSA 1V37A 4MRPA 4GX1A 2OQIA 4JLDA 3S99A 3DVLA 5J43A 3SXUB 3TAHA 2HBRA 3EULA 3L92A 3M33A 3TZ6A 2BV3A 4AG6A 4EFMA 5JTTA 2JLUA 3W6NA 1J8MF 1AH2A 4JL8A 2C29D 2WOOA 2EKZA 5EZ6B 2P6OA 2NU7B 2Z2YA 2PJZA 4JI1B 1K6MA 3EFEA 4J2TA 4X84A 3I0ZA 5FBVB 3FCYA 1ZPDA 1MVNA 3NTRA 5DBGA 3TTTA 3TSOA 2ZJ7A 5TS3A 2NU8B 3TVYA 1Q21A 3DCYA 3A6PC 1H2FA 5B1YA 1EFTA 1R2QA 1WULS 4YMVA 3O74A 4FHEA 4KLZA 4MS1A 1IMJA 2D59A 2OPHA 1YJ5A 1R7RA 3WJ2A 1DUIA 3K6KA 4O33A 2JKYA 3O4RA 5KYKA 5TQ2B 5E4TA 4B34A 4IZ6A 4OQMA 3OG9A 1L4KA 4ZTUB 1U98A 1PR5A 3QNMA 4HYTA 3RUHA 4JNKA 3CO0S 1ADBA 2A5DA 1R0LA 4G5XA 4R2WA 3TM5A 5IJWA 2EP5A 2PO5A 3BHMA 3TFWA 4RLFA 3FYCA 1RQNA 3U49A 1ESNA 3ZNNA 4B6EA 2VYVD 5HRAA 1A0OA 4XCVA 2RGNC 1NF3A 5B1DA 1G8PA 1UANA 1EWTA 1L7PA 1JG3A 4HMQA 1PK8A 1MJ5A 3QLEA 1NF8A 2P4EA 2BBWA 2PXHA 2VK8A 1D09A 1IZ0A 2PR2A 4IVQA 5FTKA 3SXJA 1LZLA 1VL2A 3DBIA 2WSLA 3EG5A 3H5TA 3UV7A 4TV8A 4WLVA 1YZGA 4HB0A 2DJIA 1KSJA 3AOEA 1SNYA 3WGOA 5LQCA 1UKVY 1TCCA 2HSZA 3K35A 1W4CA 2QAGC 4ND7A 4M89A 4U1RA 4RKRA 2HYIC 2JFUA 4QUBA 2ZYSA 3HB7A 3Q6NA 1JDTA 1NBOA 3Q7IA 4P53A 4WK0B 4ZO7A 2PMKA 4F3KA 1E2EA 4DA4A 5ALVA 2BGGA 2FRXA 3R5SA 1YF3A 1PLKA 4JU8A 4GM4A 3Q1KA 1L5GB 2QIPA 5KNDA 3L6BA 4JR1A 4A4DA 1Z5PA 4P8RA 1GTG1 1F60A 1YNSA 3C7KA 4D98A 5AD1A 3R5TA 221PA 1JR2A 3COVA 5JCPA 3U56A 2QV0A 4K0KB 5F52A 2D1FA 5HPYB 4HVAA 1B0AA 5MHTA 1T9GR 4RHCA 2PU5A 3M4NA 1HE1C 4JLOA 2W90A 2QZZA 4ND2A 4YRTA 3MAJA 3YASA 4F9FA 3FXAA 1JP7A 1XTSA 2B7BA 4NATA 4Q15A 3C70A 2EGGA 4Q4HB 4QTZA 3VOSA 2GPBA 2R25B 3IEMA 3DBRA 5FBQB 3NNNA 1E62A 2I0FA 4A0RA 2ZETA 4UKDA 1ORRA 2OHGA 1K97A 4G0VA 3L8YA 4X3PA 4OHKA 4X00A 1NLMA 5IX8A 3E3LA 4KC0A 2ODPA 3RVNA 4FFMA 3H3XA 4O2LA 4TTAA 4TN1A 3UJPA 4CMBA 1E1CB 2OCPA 3TLZA 5CCDA 1SCKA 1XB2A 2OR3A 4IS2A 3VR5D 2PUHA 5SY9A 3JYQA 3H5NA 3DEFA 5FL7D 2POCA 2V6GA 1CJVC 3OQBA 4UW9A 1DQNA 4OTZA 4CN8A 2ODAA 4K26A 2XWQA 4I4CA 4GPBA 4E6EA 1JFVA 3EPPA 4UEWA 1QHEA 4RIHA 3UHFA 5CLGA 5IM5A 3BHNA 3HFRA 3UCXA 2MU1A 3SKVA 3GG9A 3OURA 4XUGB 5CW2A 2R7NA 6REQB 1I32A 4XGKA 3VH4A 4AQYB 3S2FA 5JC1A 2VK4A 4DV0B 2AF3C 3U5TA 3IUYA 3VH2A 1KMMA 3LP8A 5KHOC 2MJLA 1KDTA 1BQEA 3A6JA 2RE8A 3DOHA 2YXNA 1I7QB 3IUEA 3CPHA 3KXIA 2Q1SA 3S1LA 1ZK2A 1JMYA 2ZSEA 3DZ8A 1W35A 2FXIA 3HCAA 3RFUA 2Q4TA 3MGKA 3PEFA 3UBTA 1GPWB 1M8GA 2DGDA 1H65A 3GARA 2O3QA 2WDPA 4H2DA 2QENA 2B83A 3E4DA 2JJQA 3KRTA 4C4PA 5BVGA 1V8FA 4M7RA 2CWDA 4RJKA 1CK4A 3DZJA 3KYDA 3O3OB 2FMKA 1FP1D 3QY9A 4HYEA 4M7WA 4D9FA 1U28C 3U0BA 1RYNA 3QH4A 3DZCA 2CLMB 2R8ZA 1DXOA 2ZOSA 3QY0A 4B48A 5BSKA 5AVSA 4YRZA 1ECPA 2O2EA 1AKRA 3E3AA 1RJDA 2KHZA 3OMXA 4L5IA 4MV7A 5JNUA 1QG4A 1UMBB 2D1TA 1PT7A 3R5JA 3QPDA 2B0CA 4FONA 4JXKA 1JHXA 4R2XA 4D4HA 2P9YA 4EUHA 5DMXA 3ZHOA 4BN4A 3THSA 2QRVB 2VP3A 2JEZA 5ILOA 5KX5F 3IELA 3KDPA 2F00A 3X1XA 2E1PA 4PZUA 4V24A 4DCOA 2FR8A 1R6UA 3MINA 1V7ZA 1J99A 4CT5A 2WKRA 2P27A 4EY6A 1IY2A 5KYGA 2E48A 2OXTA 2RHBA 5ERYA 2IGBA 1ZGCA 2C3MA 3FWNA 1W52X 2OGZA 4KLRA 1E1RD 1TU0A 2XZTA 3AFIA 2E4ZA 1QQTA 1U3FA 2AHRA 1UC8A 3JYHA 3ZE0B 5LWHA 1Y1KE 2QRGA 4TT3D 2BZGA 3CU5A 1OIXA 3G2PA 3GXBA 5HJ2A 5CD9A 1E58A 1I6WA 4B9EA 1W46A 1LPAB 3JTMA 4H7IA 5I9MA 4HGNA 3SI7A 5BOSB 4PYMA 2O7VA 3WL6A 3RRYA 1JEYB 3MRSA 4GF5A 1TEHA 3FYHA 1GGNA 1RC0A 1RMYA 3DEAA 2IX3A 4LWZA 2VDVE 2QRPA 2WG1A 3BVPA 3LLCA 4X45A 4ZHQB 4FJ0A 3T34A 2XA9A 2O14A 3T94A 1NAIA 2ZRBA 1WXWA 3JQCA 1CC1S 3EMBA 1TA9A 5CBPA 1CS0A 2AEMA 2ZBVA 1Y1SA 1QFXA 2QRNA 1KEWA 4FFWA 2ERXA 3R9KA 1I2MA 4AKIA 4Z9BA 2MR5A 1NL3A 4BNJA 1USVA 2Z3ZA 2ZJFA 2XZPA 3DWFA 1P9WA 1U5CA 3T5BA 3V7FA 2VJLA 5AKYA 3SFVA 4BQPA 3NM5A 1ZCAA 2C5HA 1IUKA 4PX5A 3OZIA 4GO1A 3D9QX 1B76A 2HBQA 4JLVA 3AM1A 1G2IA 1ZVQA 3AKDA 3MM4A 4U7WA 3NP7A 1P5JA 2IEGA 4UZEA 4CM9A 2WQ6A 3U7IA 2FPKA 1H9BA 3QI2A 4ARSA 1EJ6A 2NG1A 1H42A 1BJRE 2RG1A 1G20B 1OFIA 2Z56A 3AK4A 3MERA 4FD2A 1MOQA 3OE4A 4LRWA 5FBWB 5C1PA 2BFMA 2C9MA 2VJMA 2V45A 4I14A 5T4HA 2F43B 3EISA 4I8XA 1VE9A 4BU0A 4ZCPA 4DMRA 3OE7D 4V1CB 5KNBD 1XTUA 4Y6QA 1ZQ9A 3FNEA 1QZTA 2RHRA 1D2GA 1G9TA 4QHYA 2XGMA 3OZTA 4JFRA 4L2IB 1I0LA 3GRCA 2MT9A 1SIBE 5FBRB 3GLHB 5TNXA 4A2WA 3GJ5A 4C4OA 1RXUA 1PGOA 5ENVA 5FWAA 3IPAA 1XELA 4BKRA 2ODTX 1NMQA 4RZXA 1GRVA 3IDSA 3KR9A 2WPNA 2Y0DA 2YVUA 1JVNA 5I4IA 1COWA 2AH5A 1ZISA 3BSWA 4K6KA 4QUKA 5AKXA 3U6KA 1KGSA 4IAOA 1WA5A 3NHPA 4WKOA 5CA1A 2YX1A 3G1UA 4URWR 1OLUB 5HOEA 2O8FB 5JMPA 4JLUA 2FZVA 2PRZA 2ZTLA 3EA0A 2VDNB 5P21A 721PA 4EEXA 4F6RB 4BNUA 2I6GA 1SXIA 1ZNWA 3IPCA 2JDID 4PIPA 3BGIA 4QULA 1ZVJA 2GKSA 3P9NA 1QE5A 4D42A 1CQJB 5BY2A 4KVAA 3DZDA 3T9BA 3ZS9A 3OPQA 1VPDA 2HK6A 2W7TA 3PFWO 5DNYB 3DMFA 1JA1A 3P1JA 2VT6A 3ZVKA 2UZ1A 3QSYA 1MZPA 3I8SA 1B2LA 3PNLA 1MGPA 1W44A 3AIOA 2GZ3A 3EY4A 4D9MA 2W93A 2WK1A 2P68A 1OFTA 2ZANA 1IHXA 3KOZA 4FNAA 3TJZA 4P4TA 4P4SB 3DGFC 5LUAA 4N5NA 5D3MB 3PRYA 3NJ4A 4TTVA 1XLTA 1E0AA 4Z8YA 3PE3A 2NPIA 3VMFA 3THXB 2W2PA 3IFSA 4B6SA 5LMNB 4J0DA 4JC5A 2OESA 1RWBA 4WFIA 3ZIAD 3DDHA 1JHZA 3BL6A 3EAFA 2EWMA 3L8ZA 3GRRA 4OBWA 1I3NA 2HCJB 2LGJA 3S8MA 4UHHA 2HMUA 1SBTA 5CGQB 1A5ZA 3Q3VA 4CM6A 3GDWA 4H0CA 8OHMA 1T1GA 2D4AA 2H9IA 1Z5NA 4INJA 2EKQA 2EQAA 5IKXA 1DVRA 4Y2GA 3S4YA 3T95A 2ZR8A 4D99A 5EE1A 3T7SA 2GA9A 3BMNB 5JRZA 4HQOA 3QUBA 5TGTA 1M1YA 1GL3A 3RU3A 1I1OA 1OR8A 2BT4A 1FYVA 1UXKA 2CMHA 4TV9B 5GAJA 2R1TB 4A5OA 1KEEB 4BMSA 1IRXA 5GONB 5A2QA 3PJFA 4KFTA 3H65A 2Y1LA 4EJMA 4V0RA 4W5WA 5HBRA 1RP1A 5JDIC 5MGBA 1UK7A 1AD2A 3EOAI 1EFRA 5LBUA 1KAGA 3CZ9A 1KZHA 5DP1A 1FTWA 2O1SA 3KYIB 3NALA 2I29A 3N53A 3QU4A 5AKJA 4ZCIA 1BE0A 5BR4A 1L8AA 1TLTA 3CH6A 3BWXA 3TX2A 5DHUA 1W0JA 1O54A 2P9EA 3NDPA 1NVUQ 3DONA 4BB6A 3K70B 4EX7A 4DA6A 1FZQA 2ORWA 2V5AA 3RIMA 3T4EA 4JBXA 3HDHA 1Q1QA 2CLCX 1YCDA 2Z3VA 2FUG6 3BE4A 2AZMA 3L0SA 3M6WA 2WMYA 4NZ9A 4QL3A 4DTCA 2CNKA 3QKRA 2NM0A 1U7PA 5DXJA 3HP1A 3HCWA 2YCLA 3VKWA 3M3PA 1J39A 4PPYA 2EEZA 2XE4A 3L02A 4GGOA 4OK3A 4BASA 2VH2A 2PVPA 3L4BA 1LDEA 1EUCA 1HT1E 1WDTA 4XPZA 2NZVG 1SXHA 2GBLA 4QTYA 4H3VA 3EEFA 3LC7O 1CCWA 3I01M 5H3CA 1V9CA 1B43A 3QEMB 5JYBA 2E6KA 2OV2A 4JWKA 4DUZB 1JI0A 5D8DA 2CV2A 4ARCA 5B2FA 2DCUA 2GN4A 3F6BX 3EPKA 4PAQA 1N0WA 1ZMTA 4AX4A 3BE6A 2PE5A 4GT1A 5U4XA 2QD5A 2YZ7A 1Y1PA 4FSHA 3AESB 4LTNA 4BMNA 4CF6A 1PL0A 1RWKA 2J5QA 2UZ0A 3N6XA 5CX4A 2OLEA 4MLZA 2JGRA 4K9LA 4ZQBA 4PM4A 4GNRA 4Q4JA 3IL2A 1FE8A 4N1AA 1P1KA 1SUEA 2I2WA 4R5HA 2J08A 4ZV9A 5HZMA 2GN9A 2N42A 1OXSC 3E3NA 1FLDA 1G0OA 1LBQA 2D8MA 4H08A 4UXJA 3BHJA 4YRQA 2GBPA 1DEAA 3ICEA 3ROGA 2GFQA 1QQ7A 4ARZB 4NHOA 3WHLA 5K9ZA 1XAHA 4V38A 1RVDA 1XZHA 4KQ9A 3AO0B 4DQXA 5JMWA 1W4BA 3CUUA 3SHOA 4RVUA 1W0KA 2E0IA 5EZYF 1W5FA 5JQWA 3OTWA 3B6KA 1AUVA 4AJ9A 2CVHA 1Q12A 2F6RA 2QU7A 4BO0A 1NJ6A 3RADC 5E6UA 2BR3A 2ZKIA 2RGBA 2WZBA 1U2TA 5EHQA 3K0BA 4ECAA 1W2HA 4ZZ2A 4EABA 3K9NA 1K08A 4KIGA 3C1OA 1IB6A 2IHJA 1JN0A 3A6ZA 4WA8A 2A1TR 1P7PA 2D2FA 1T43A 2O0LA 3H9BA 4QDOA 2BEVB 2FAXA 5EPUA 1SOWA 4JAVC 1U2RA 1V9SA 4M0DA 4HDRB 2HQ1A 1RKQA 2ZJ6A 4MH0R 5KINB 4BWGA 1TD9A 4L6IA 4RGBA 2AB0A 4CU2A 4MUMA 2FQXA 1Z8NA 1VSTA 2W2LA 1A2KC 3DTVB 3G3EA 1TM7E 3CNNA 4WZBE 2I4IA 3EFOB 4JT4A 2PGIA 3EWSA 4MPDA 3VUFA 4URVR 3RV4A 1FX0B 1YK0A 2IA5A 3DTNA 3ENQA 3SDSA 5M2QA 1LBSA 2E89A 3CXUA 4O4LA 5ETJA 2FP4A 3WNBA 1W2WB 3SZUA 1N8TA 2PQ6A 1YRLA 4ER3A 3KXPA 4BC0A 4UASA 3SK0A 5B7QA 1QE0A 2PLNA 1K8XB 1UBEA 1ND5A 3FTQA 3GJ0A 4FTWA 4PNPA 2BDTA 4QEDA 5FEUA 2XCTB 3C7DB 3BL5A 3MFYA 4GDFA 4OUDB 3T7TA 5IKEA 1YE5A 3IQZA 1VRVA 3JASA 5F73A 2ZI7A 2NO4A 4D4JA 5CFPA 2ZE7A 3Q2KA 5LA6B 1AKEA 3L1VA 4CUJA 1E9FA 1Q3HA 2X41A 3AFOA 3CF2A 2CLHB 4Y8VA 3EH1A 3KUDA 3IJ5A 4AJ2A 3B5EA 2WAAA 2ZIFA 4HGYA 4D0SA 1VL0A 1RI2A 1T15A 4OXXA 2CJWA 3I6YA 5CAEA 3H1GA 4J3JA 1Y9AA 3DVQX 3H8SA 1HEIA 1JGTA 4C04A 2H5LA 4PC6A 4XEHA 5JJCA 1NHWA 1HT3A 1N6IA 5KWIA 3JQ6A 3K1ZA 3W04A 3INGA 2ZCJA 1PR9A 1QO0D 4KNVA 1DU4A 5A1JA 2DUWA 1IPEA 1H5QA 1VMEA 4O4HB 4PZPA 4G4IA 5EI5A 3H2SA 3E22A 3ZS8A 1TTPB 1HSOA 5CJPA 3CZ4A 4KWHA 1FJGB 4OKNA 3GYGA 1PWEA 2PZAA 3A4TA 1QP0A 3BZBA 5A4DA 5KU7A 1NI4B 3B2NA 4P80A 3IEIA 1BROA 3MCTA 5E9AA 4D97A 2ACVA 1HE8B 1RJGA 3JV7A 4ZMBA 3ZTTA 1BHJA 3HV2A 5IT9A 3GXOA 5HMLA 3CE6A 1CUHA 1PZFA 3VYTB 1WP9A 4J49A 1C1XA 2A0UA 2X0DA 2HXGA 3HJHA 3TUIC 3RRNA 1ISPA 5DWDA 4BRUA 1ECCA 5C5EA 1ACMA 5PGMA 5KS2A 3LOPA 4XD7A 3ZWDA 3F74A 1SUBA 3ENKA 4Z9AA 4RTRA 1P0IA 2BGTA 4M6WB 4U7JA 3RS9A 2A35A 4C7MA 3PE4A 3DDNA 3K0CA 3QENA 4C2TA 1CR6A 3FJ1A 3DBHB 3EIQA 4LIPD 1A9SA 2CFCA 2FETA 4QPCA 1CUJA 3QG5A 3HB4X 5AJVB 2XE6A 3BXXA 1M34A 1SUAA 3CWZA 3MYRA 4HNHA 4JCOA 3H2HA 1Y8RB 4GP7A 4DR1B 1F1JA 1G6HA 4BZPA 1MB2A 2OLKA 1XZFA 4IIEA 3T5GA 1PL7A 2DPHA 2JW5A 2HDOA 1J97A 1JQEA 4UD6A 3U37A 1Z7GA 2ZDHA 1E89A 1PAUA 3N0WA 3OJOA 3AX6A 4G0ZA 5SV2A 2JS7A 4YJFB 2ONYA 4FBMA 4F85A 2OD7A 1SMKA 5FL3A 3OCUA 3C5HA 4R54A 2ECQA 3KJNA 3LT1A 4KO8A 4M8KA 1RAIA 3BMOB 4K9DA 4P22A 4WLNA 4Y9RA 3TMYA 3TQIA 2JBWA 5TQJA 1A8IA 1RTTA 3BXGA 1KTIA 1RXYA 2QXYA 4N6GA 2QN6A 1ZSYA 3UM9A 2ZSFA 3MWYW 2JGLA 2C5LA 2WIKA 3OFND 3QKTA 4TVBA 1XZ8A 4ZFNA 4QPDA 2C99A 4FILA 1UP6A 5SYAA 4BTEA 4BNMA 4EGJA 4ZT6A 1U1IA 3VSBA 2OL4A 2ZWIA 3H84A 1Z18A 2P75A 2D0IA 2X2OA 3I9MA 5EESA 5GY7A 4FS8A 4WCVA 3MLBA 1EP2B 1SOMA 4ZAXA 5BRAA 1XTBA 2OCDA 5JNWA 5I4BA 1LPSA 1TQHA 4ZODA 1I14A 1QG0A 4K8RB 1OFHA 4JJFA 3HJUA 3ZU6A 4WXRA 1YO6A 5HKAA 2UV8A 4BX8A 5SZKB 4KAAA 1XEAA 4DRZA 5J4HA 3RROA 2WJJA 5IARA 2ZYDA 3ZPXA 1QFMA 4UDNA 2YNMD 3OKAA 2GAFA 1SVOA 5G53C 1ZUNB 1ICIA 4DR5B 4YO8A 3F2IA 2FUEA 4TKUA 4D44A 2ZRGA 5ALEA 1IG0A 2O2JA 3L6EA 5B57C 4JBWA 2N1BA 3L8DA 5C1OA 1KL7A 2X3UA 1MHTA 1JXOA 3WLNA 4LZNA 1ZONA 5IEJA 1R4MB 4E22A 2CNOA 4JP2A 4C0BA 3PXXA 4MV3A 1VGVA 1RWQA 4UTPA 4N3NA 5EAIA 3WDKA 5A06A 2QORA 1XEWY 3IPXA 1Z4IA 5AW9A 3UXYA 2FCAA 4MWZA 5EJ9A 5JVDF 4L8LA 1QP4A 1NX9A 3LC0A 4W1SA 1EYZA 4FGSA 3DOJA 4H3KB 3ICPA 4AP9A 2A30A 1Z6TA 2VYNA 1TT7A 3GZTB 3JQFA 1S4MA 3DZHA 1KETA 1G9SA 4DLVA 3KOUA 2J0UB 3MCAA 1QAOA 3U7RA 4XWWA 1AV6A 3PVSA 3TJMA 5FFFA 4KGXA 3L04A 3H4TA 3MUEA 2OORA 4OHXA 2ZYRA 3CVXA 3BH6A 1D6MA 2B9VA 3CVOA 4LXIA 2AF4C 2MSCB 4EB0A 3KR2A 2O6HA 2QLLA 2EFJA 4FYKA 4RE5A 2BUBA 4AN4A 2F1IA 4MYUA 4URXR 5JY6A 3HWX1 1P18A 2Q46A 4ZI3A 5F35A 3FWHA 1FNSA 1QMGA 3KNZA 3MQFA 1N92A 1NQVA 1PVDA 4MVXA 5A04A 1WABA 1EINA 2PEZA 3AUYA 3BMCB 1RLUA 1M76A 3AQ4A 3HKEA 3L84A 3ELWA 1QXSA 2ZPAA 3DCNA 3LUCA 4GNKA 4WY8A 3TLKA 3FFXA 3WJAA 4M86A 1B8PA 3K4PA 1W87A 1HYBA 3TPFA 3WLPA 2MMGA 2VNAA 4D8UA 3F9CA 3OZVA 4NJMA 4UE2A 4JI6B 1K4YA 1JQKA 7GPBA 1ZN9A 2H6EA 4AYTA 1NDQA 1OI2A 2A5FA 4D43A 2NO1A 4EM6A 4TYWA 1DO8A 3GV0A 4ND5A 3OZ7A 1UH5A 3EEYA 2BC9A 2BFEA 2CF5A 3UF0A 1KFKB 3DE0X 4AKHA 3KQNA 2CVFA 2GPAA 2XQFA 1XVUA 3GGCA 1XZPA 3DQPA 2YZKA 3HR7A 4HG2A 3OT5A 3AY7A 3AUTA 5LM3A 1P60A 3K6SA 4O0LA 4MKXA 2J9FB 2NSHA 4YP6A 2COEA 5IJ0B 3MWFA 1V95A 2VPWA 3O1HB 4TSFA 1N1EA 1CEYA 3GRFA 2AC7A 3H75A 4JJ7A 4QODA 3L7CA 3UFBA 4LK2A 1SCJA 3TZCA 1RP7A 4Q05A 3ROMA 1CY6A 1JZSA 1P19A 2AN1A 3NTXA 4QLAA 4Q4AA 4UE6A 5TARA 2H9AA 3ILVA 4CMGA 1V96A 3WFJA 4XX0A 2CXSA 3MTEA 3NC4A 1UC4B 5F98A 1HYQA 2DWUA 5HKKD 1Z22A 4UHEA 4LYJA 4II2A 4QU8A 1DO0A 3H18A 2QJRA 5H8WA 1NJSA 3QKSB 3WK5A 3MB8A 2N9UA 1EKXA 4H9GA 1E9RA 1S2NA 2ZI5A 4PQFA 1HE4A 3VR5H 1XZQA 2H5IA 4A6XA 2WKWA 5CVCA 3FKJA 1IULA 5K8JB 1VDZA 3ORHA 3FM9A 1LWNA 2PO7A 1L5VA 2Y1KA 1MW8X 2W98A 3FOWA 2QW1A 3ZY2A 1LS1A 1HV8A 10MHA 1ADJA 1GN9A 1ZH0A 5BQFA 1IN1A 2JKVA 1DJLA 4TTRA 1C7RA 1HBJA 4G5GA 3AF3A 4XB6B 4BQIA 2VQDA 3HDQA 4KJZA 1EAYA 5D86A 3BXHA 2GARA 2HGZA 1SBQA 1YI1A 2HNAA 1C8KA 4P33A 4TMTA 2IY8A 5F23A 3ELDA 1TYZA 2BFDA 2NO7A 4K46A 2Z57A 3HXMA 1ORTA 4HEA6 4XR9A 1UL1X 3SEFA 1ZM7A 4RABA 1XA4A 2WWTA 1C2YA 1N9GB 3PLAE 2YMQA 1N0IA 3HI6A 1JQAA 1WUIS 4GMGA 2BEUA 1V16A 3GFVA 1X7GA 1UBFA 5CFQA 3LPLA 5C7OO 2C7OA 3PXCX 1UPXA 3JVEA 4BE7B 4M49A 2P9TA 1PV2A 4XE5A 4Z3KA 4OP1A 4F5ZA 1A5AB 4E1VA 1EG7A 4R7TA 4G0WA 1H5UA 2BE9A 2CXUA 4YRNA 3IEUA 3LUPA 1QJ4A 1FFHA 1Q1NA 3NHWA 3WMWA 4IFIA 3BJIC 4HD8A 2E6UX 3BRWA 4MW7A 2VP2A 4MRRA 3VHLB 4ETWA 5JNTA 1FU8A 4QQNA 1H1TA 3LUDA 2FLVA 4BQFA 5JI2E 1DOAA 2V0CA 5AHKA 4BNWA 5FLXA 5AHOA 2IS1A 4IDGA 1DPGA 2JFZA 3RF7A 3QJGA 3D5QA 3WYEA 1RAAA 4JKYA 4QFMA 5AXDA 4B4DA 3Q5EA 3KYCA 1GDDA 3JXEA 2NAFA 3IGFA 3R4CA 4M60A 4BMCA 1EI9A 1SBCA 2YJ6A 4TRNA 2X40A 2BTEA 1M8FA 1I5RA 2ZKLA 1LRJA 3EUFA 3E9YA 2XYQA 3TLGA 1W2GA 1NWHA 1O95D 1RNLA 2GPYA 4JGGA 4NX2A 3E0QA 3A1SA 2XNSA 3KB8A 4O63O 4FWBA 4YHBA 4CL8A 4DR3B 2FEMA 3SYKA 4BIMA 4XDGA 2CLOB 3VYSB 4EQ6B 4U7GA 3ABOB 4TMYA 3UT5A 1SCNE 3GLIB 1L0BA 3K8YA 3D1JA 3EVGA 1N6NA 2NTJA 1EQUA 5HJ5A 5GGXA 4XVQA 4M53A 4N8DA 4ZCRA 1DC3A 3ZY4A 1POXA 3OU2A 4URUR 1RRFA 1V7CA 2GHTA 3LH5A 4GBED 4UEQA 5KVQA 4P58A 3B12A 5JC8A 2H00A 1L7AA 5EJGA 2VZ0A 3WZ2A 1FZTA 3W9SA 1G98A 3KJXA 3LUBA 1UZAA 4XB1A 1M1YE 1F3OA 3HZOA 1VRCA 2EJUA 1TQ2A 4HGQA 2IF2A 4TZTA 2VT3A 1KMNA 2XCQA 1Q74A 3DXYA 2H1FA 2M98A 2NSLA 3A0UA 3BBPA 4HYQA 3MFQA 2W2QA 1FVHA 2ZCVA 4IYJA 5JPIA 5T6BA 2HU8A 5JBQA 1JJAA 3F3KA 2ZS9A 1XL1A 3GDGA 3A4MA 3IP9A 1XRMA 3HCFA 1JB9A 4OQXA 3WLIA 1EDDA 2VSQA 1RE1A 1E9VA 4KFSA 3HL4A 4RJJA 1KQ3A 2HMVA 3SX2A 3ETNA 3PRHA 5K4AA 3SD7A 1O4WA 1O0BA 3K32A 4R1OA 5EIAA 3ZW8A 1DAIA 3LWZA 3BB4A 3W6PA 3O2SB 3G8DA 5KNBH 1OCEA 2R6HA 1A88A 3N6VA 4IQ0A 5F78A 3WYBA 4JENA 1B74A 1YZFA 2XOEA 3NEPX 3R20A 4NZNA 4QFBA 3M1YA 2HF7A 3CNEA 1OHHD 3VSDA 4EW6A 4EYEA 2VQSA 5AP9A 2P6PA 5J1SB 4MUHA 1JBQA 3D6AA 4NAHA 1ID8A 3H2JA 5TEVA 4MS1B 2QTNA 1D6NA 3X1MA 2BUCA 3FPJA 2EWVA 3Q0EA 2AMVA 1P4RA 4MW0A 4TUYF 2CL0X 1YL5A 2ZCUA 4AURA 1DMSA 3ZIUA 3F7OA 3FCOA 4ISBA 5EKUA 3DV0A 1GUAA 1QVVA 2CVQA 3PX3A 5P8WA 4DCVA 4A8TA 5DXAA 4D81A 1JFRA 4EOGA 3S28A 1EDOA 3BB3A 3DMTA 2VXCA 3D0OA 4GYYA 1QU3A 5FF9A 3O9ZA 3W5AA 3WG9A 1FK8A 2WT8A 2WFZA 2Y1GA 2HCRA 3P9PA 5KTYA 2H59A 3JWPA 4CIWA 2FDRA 2YN0A 2OXEA 5ARCA 3TD6A 1C0IA 3UMJA 1OXTA 1R9NA 1YQDA 2JD1A 4X94A 3PXBA 1CUCA 5J5AA 5LJLA 2HRDA 1T3SA 5AM5A 1UOOA 4NYJQ 4DCNA 4UUBA 2AE2A 4MHSA 4IIDA 5JNSA 4TV8B 2UZ4A 1ZUWA 2PKYX 3I4FA 4MRSA 4MWBA 4Z4IA 2JRCA 4NMMA 3KJQA 4E5SA 4YRMA 1A8UA 2EJWA 2WD7B 5CH8A 1FFDA 3THWA 1F0NA 1DEXA 1ONNA 5F5XA 1XZLA 1NW7A 4B4OA 4F97A 4EL5A 2FP3A 4Z4EA 3KT6A 2B3DA 2FMFA 3V8QA 4WOKA 1X77A 3NETA 5IDVA 1Z4QA 1LTHR 3LY5A 4FPXA 3SS8A 4BQNA 4QQFA 1GV0A 5LB4A 3ROTA 1L7MA 1SHLA 1M7HA 1XCOA 1Z3CA 2EW8A 2X5OA 1YR1A 2O1EA 3IIKA 3TXYA 1Z07A 2Z1MA 3EIWA 3D4NA 2RAFA 4AICA 5BMVB 4DLAA 1T0JB 1R18A 5AM2A 2GF0A 5ADWA 1PJTA 1N2GA 3FHLA 1A4IA 1Z0SA 1MO5A 4OGGA 4IGAA 2PLFA 3MN1A 2GJ4A 1GFIA 3QI7A 3VR1A 4Z0NA 3WLLA 4A23A 5CFLA 5L8VA 3KTDA 2ODBA 2G17A 2ZIUB 3STHA 4LS3A 4UDYX 4YUVA 1MLDA 4IIJB 1P74A 2C2XA 3AG6A 5KCZA 2V6FA 3L1JA 5DT2A 3S1AA 2PUAA 3D02A 4KV7A 2GPTA 5KOYA 4DOMA 3C6YA 3LJKA 1MIOA 2WWFA 4UJ5A 4TMKA 5DFAA 2VP4A 3NCHA 3H11B 1I10A 4LWPA 3ZW7A 4KO3S 1K7YA 2BFBA 1VIYA 3DMGA 4O5OA 2XB2A 2IU0A 3KEMA 4E2FA 2NZJA 1SQGA 1WMFA 1RI5A 1JILA 1EXNA 4C7KA 5FADA 4B4KA 3DNMA 1LX7A 1YBHA 4UULA 3V1LA 2B4QA 3JD1A 3A9TA 4E7PA 1C5KA 2CEKA 3HP7A 4DB2A 4MWCA 3URMA 3HB0A 2JLSA 2HV9A 4CMAA 1L5ZA 1U7XA 2A92A 3FNFA 4IUCS 5F2KA 2Q1UA 3ZQUA 3PBKA 1ECFA 1TUGA 1YC2A 2IFTA 4JLWA 1A9ZA 2F3RA 2VHJA 3S1SA 1ZWLA 3EWIA 3NYQA 1SZPA 3GIWA 2EG5A 3T3MB 4Q7KA 5IM4F 3OJFA 3PNKA 1DLJA 4IIXA 3IVGA 1J0CA 2IYSA 4M98A 1NLYA 1ULTA 2VNJA 1N7HA 2IW3A 4REQA 1A97A 3N05A 3ETDA 5G2OA 1JA0A 4ZXFA 1LNQA 3P8ZA 4BBPA 1ECJA 2Q28A 4HGZA 4CM3A 5C5IA 4HL6A 4PSCA 5CDHA 2LUOA 3HU1A 1TRKA 4GZ3A 2HCTA 2O8CA 2VPZA 3X1DA 1GRCA 4LMAA 3U16A 2QLNA 3KKOA 2YJ4A 4XQ0A 1N2CE 2NNWB 2X42A 3HPRA 4JYBA 1E2KA 1T3TA 5BVGB 1WV1A 2B2XA 3CMMA 1DAKA 5GWXA 5L3QA 4I9UA 3L0OA 3KYDB 3MD9A 4C4AA 2XSZA 2KB0A 1E64A 2PH7A 4MYSA 4MR9B 3TL3A 1C8LA 1KY4A 5JW6A 3ZVNA 2I1VB 2RMKA 3TKAA 1QHSA 2XQKA 1WDMA 3T0FA 3RHZA 3JY6A 1A8SA 1QHIA 4KI7A 5L7TA 3SOZA 2XA2A 4QGAA 4BMZA 4DEYA 2NO6A 2QR5A 5CDFE 2BGWA 3LVFO 2E18A 2EL9A 2VBCA 3I92A 1KR5A 2H1HA 2ZGVA 3ZQ4A 4E4RA 4EG4A 4JB2A 3P9ZA 1CVLA 1V1RA 3DR5A 1QGYA 1SB9A 1VGRA 2PJUA 4NF2A 4XYBA 4AZSA 1RCTE 1I2CA 1R5BA 2HA0A 4D0RA 3MINB 4IRXA 1RXSA 2GJ9A 1WUTA 4EL0A 3N2IA 5IXJA 3G5AA 3VZCA 4PZYA 1EJBA 1H6BA 2QLJA 4LCEA 3A05A 5TMEA 2Z8YA 4UHKA 2J5RA 3JSAA 3K2BA 3HWWA 3NGMA 3NBQA 5LQJA 1GGVA 4PPFA 2CBZA 4PVCA 5HG0A 2GCPA 2WMNB 3WGYA 2C2BA 4JODA 1KVTA 4DANA 3G0HA 1HH4A 4CQMD 2J85A 1XTJA 4P0PB 1MKYA 1P0CA 5ESDA 1FUUA 3R1IA 2OBNA 1KORA 1C2TA 2ZTMA 1NBIA 2H2GA 3FUXA 5KHAA 3VYUB 3R3YA 1GCGA 2NYUA 4BB5A 1NVVQ 1XHLA 3VBEA 1H4SA 1P5ZB 2AMFA 4RA6B 1X7WB 4LBYA 2C04A 5EY5B 5CBPB 1CS0B 3AHJA 3CSUA 4ROTA 1NMEA 1KMCA 4BJ6A 3EIXA 1LVUA 1ODSA 1Z06A 1QAMA 3IEPA 5EMLA 4J91A 5K3SA 3BA1A 1KSFX 4DDMA 1FS6A 1N5RA 1MO3A 3AEZA 3GVXA 4O29A 4BMXA 4OOFA 3SQWA 3CYFA 3RK4A 3K53A 4RZIA 2CL5A 2W42A 3NRJA 4QTTB 4JASB 2CC2A 4I1UA 1TJ3A 3PGKA 4L1KA 3EAGA 1WQ1R 4IF4A 5FWXA 2VJMB 4IFTA 4L8WB 5B58C 5KDOA 4GYWA 2XUKA 2ZRCA 3OP4A 4O1HA 5D1HA 2OV8A 2FZ4A 4G3XA 4BNHA 1HDEA 1QRRA 5CPBA 4DW8A 5AW3A 1R88A 3OM9A 3P2KA 4QDZA 4TMVA 2ZSKA 5BRJA 3BTVA 2CVPA 5C7IO 5JSUA 3T3HA 1ZRSA 3D31A 5KEIA 1L4NA 1YVRA 1GHTA 2NO5A 2VEDA 1V2GA 3CZ5A 3FPBA 3A6GA 5AOAA 5EVCA 3VPXA 1M10A 1C81A 1U2QA 5CA1B 4QTUB 4UAUA 1MH1A 1YGPA 2YXLA 4PC1A 4PVDA 3FW1A 4UMDA 1UIMA 4KN8A 3V6LA 4DMMA 1YMVA 2AN5A 4WOPA 2ZRHA 4YAGA 4EY4A 4EO4A 2OZPA 4H1WA 2FRDA 1CE8A 1R8XA 4CYMA 3ZCQA 1T3ZA 2Q1TA 1RADA 4II7A 2FW8A 2NIPA 2DPXA 3BTUA 1KP9A 2RIPA 5TDHA 5IAGA 1XTPA 1FFEA 1HO3A 1YR7A 3RT9A 2F8SA 3FAKA 4HB2A 1N5LA 3MXOA 3TL6A 3TOXA 1KRHA 1Z2EA 3IE2A 2GT1A 3K9QO 3AVQA 4FINA 1O77A 3TPCA 2UZ1B 5JXWA 1FFXA 1GZSA 3KOYA 3O9VA 5JSFA 1PV1A 1QOPB 1UOQA 3B36A 1ZN8A 3UHOA 1FDUA 1RI1A 3QVOA 4ZKEA 4TS4A 1B6TA 4A73A 4AMGA 3PGVA 3AR4A 5FT9A 2FPGB 4MQ6A 13PKA 3N7AA 4RDCA 4Y2UA 1JR3E 3WYDA 2X0JA 3FMVA 1C7EA 4WVFA 3IQDB 3RG2A 4CKCA 5FNVF 1C3LA 2CN1A 1N2OA 4CLOB 1B26A 2ZRAA 2HSDA 1B41A 2XBLA 1BW9A 1HDYA 3B3FA 1DHTA 3GZJA 4E4YA 1VLZA 4RVGA 2WWYA 4A2CA 2FY8A 4D5EA 4RIIA 3TUZC 1GYQA 2I6XA 1T6NA 1T2VA 2DWQA 2VDJA 5HW0A 5JSZA 2WT4A 2VQFB 2E4YA 7REQB 1JFLA 1WIWA 3PNYA 3LAWA 4WKCA 4RZSA 4DUPA 1KA9H 5TR9A 1T9GS 4Z6KA 4K9RA 2QT1A 1Z37A 4HX5A 1XDSA 3AG5A 2LR0A 4LOHA 3V4PB 4KN5A 2IXAA 3K15A 4FFSA 5EFOA 2QMHA 2J5BA 2EFDB 4J1NA 1P5FA 3DYIA 4HLUC 3GQBB 2ENUA 4G86A 3C8ZA 3MWKA 3QSGA 3C7AA 3I4CA 3AEKB 3IKTA 1W36C 5ALFA 2NWQA 3N2YA 1AKTA 1O9BA 2VRCD 4Q1EA 3DZGA 3UJ6A 4EARA 1UODA 1J7KA 1GU7A 1ADCA 3JQ9C 5ILQA 5HR5A 2C7QA 4GP6A 1GCIA 2REOA 1ZXXA 4D4KA 2ERCA 3UUFA 3FHOA 3ICQB 2GA8A 4K87A 4JJAA 3U7EB 1H8HA 3PR2B 5F9MA 1M2OB 3QX9A 5E0KB 2C97A 2QW8A 2JI7A 5BYJA 1CZLA 1JIVA 1F8FA 2A57A 3PUZA 5BQOA 1NKVA 4Y2QA 4OSOA 4Z3OA 2ZXEA 3R6DA 1AOXA 1RZRA 3AJ9A 1TO6A 1YB5A 2ZEJA 5E3IA 1GLGA 3H7IA 5TY0A 3MG9A 5H83A 3SLRA 5K05A 3KQVA 4UFNA 3SNKA 3GEPA 3QKRB 1N8SA 4FDVA 3B1YA 4U0JA 3D3KA 4F8EA 1C9JA 1CHDA 2UAGA 4PSUA 1Z83A 1U99A 2PKCA 2VTVA 4OA5A 3D6VA 4RLSA 3M83A 3OC0A 1EUCB 3W78A 3D7LA 1LQUA 2PQ2A 3IXLA 4UDXX 5CPFA 4AJEA 3CEPB 4UVHA 4LNUA 4R1LA 4JBHA 2ZJYA 5IWCA 3EFHA 3IP7A 1WP4A 2WKSA 3WNZA 1RRMA 2XUDA 4H35A 4AUNA 1LB1B 3F90A 1A04A 2PT6A 4GRDA 2X7XA 1TAGA 3QLUC 2XUOA 3Q8LA 2O3RA 1MRZA 2IYZA 5AK4A 3MLEA 4NCJA 1KHHA 2HMSA 2ISSD 1UBGA 4LOAA 1I94B 1LZKA 2Q2VA 2LWIA 2XE8A 4QJIA 4WZAA 1VJTA 4K6GA 1Q1ZA 1Z5WA 4QBTA 1V5IA 2WIBA 3RTBA 4Q4JB 1ADFA 2G5PA 3FUTA 1XMIA 3HG7A 1SR8A 1SCDA 3BIWA 3HBNA 2HJVA 4FYWA 1DOHA 3KKKA 4BEBA 3NVMB 2O3JA 5KSYA 5EUCA 1G5IA 2AMLA 3FTPA 4YR9A 3U39A 1M2HA 2J6CA 1HDIA 5IW8A 3RVDA 5KUTA 3I2GA 2WAYA 3E1KA 2HEGA 2AFHE 3JSXA 3OOHA 4IXWA 2GEJA 2ANCA 1H2RS 3CW9A 4D57A 3L1KA 5EIBC 3B1JA 1LF0A 1GNLA 1D2EA 3PRJA 3MQ4A 3HR4A 1HWYA 1QLWA 2H3EA 2M32A 2ATCA 3N28A 4K6CA 5E6SB 4GEGA 4J0GA 3U4GA 4FNOA 4O3FA 3FY4A 4M55A 1YS2X 2OOKA 1QYIA 4A1FA 3N87A 2VHWA 3PT9A 2Q2OA 4AVYA 1KDPA 2JKZA 4CPDA 1IAQA 2JEOA 2W00A 3FNRA 4FSXA 4QYMA 2OUIA 3KZCA 3AIKA 1XZAA 5NLLA 1PZNA 1L4EA 3QFFA 1WUYA 1SCIA 1X1AA 3UKJA 4UQLA 3BX1A 3KB6A 2RKBA 3UTCA 2J09A 4WK4B 3PHBE 1TMGE 1ODTC 1RKVA 1KAHA 1TC2A 3E9DA 4BYGA 2I76A 2NADA 5G0WA 3I6MA 1YHNA 2H92A 2BCGY 3A37A 3PITA 2JIBA 4EX6A 5IUJC 4EG3A 5DH9A 1E6UA 2VXOA 3F97A 4O4LB 5DLQC 4AMVA 2FP4B 2W6JA 1VKHA 1U31A 2D8AA 2IOFK 4LRQA 4Q93A 2GVNA 2H65A 2LDBA 2Q4EA 2ZWAA 3A3NA 3L0BA 1U7ZA 5SZJA 5TT1A 5JZ9A 1GJRA 1NHGA 2I7TA 3G2QA 1YR9A 1E3LA 4DLKA 2PZFA 4DGQA 1V0JA 3JASB 4N7RA 1PLLA 2BKVA 1IUNA 3URKA 1FDRA 3WRXA 2J3DA 4R2MA 1P77A 2A1IA 5CIYA 2LRHA 3A6KA 3TD9A 4TYQA 4QD3A 2VJQA 2FX3A 2CJWB 5CAEB 3PZBA 4L9AA 4MVJI 3C48A 4GKBA 2BYTA 4QFCA 4YRAA 4WADA 3BHIA 1F2VA 1X13A 4IBOA 2C4NA 3C3CA 3FOCA 3HYLA 4OREX 2I99A 1KOLA 3KS9A 3I37X 1VFNA 1TKAA 2D2XA 3D4IA 1XZEA 4Q02A 1C3VA 1Z9BA 3UXMA 3ZWVA 5JADA 1G8HA 3ZHYA 4L0DA 3I72A 1R6DA 2BFPA 3NASA 3SDBA 4C6HA 4K9QA 3ENNA 4P38A 2XYVA 1SU6A 3BK7A 2ZSUA 3UNXA 4OPMA 2XV1A 1F7UA 1QTRA 3J80A 2W0MA 3GRPA 2R00A 3IBGA 2Q3HA 2NVUA 1JEJA 1EZZA 2GCEA 1JHUA 3ETEA 1P6XA 1LQTA 2VHCA 2WLTA 4UBNA 4ZT7A 4DDTA 1HK7A 4D3FA 2PL3A 1XZIA 4DCPA 5DLDA 2JZOA 4P0QB 1WKCA 4OM7A 5DTQA 5I9BA 4B75A 1QR6A 1Z6YA 1VG8A 1NDHA 2IYNA 3C6QA 3CV3A 3DE6X 1Y8QA 4HSEA 2CVZA 2XB9A 3O7WA 3QIAA 3UMCA 2FPRA 3A7EA 3H97A 3KEQA 4ZALA 3UK0A 2DBYA 2Q1WA 1VA5A 3JQEA 5BUCA 1G3QA 2IU3A 1LGYA 3T3NA 2BSQA 1C8VB 1XVAA 1KO8A 1JJ7A 4BVHA 3R3UA 1W19A 3K1AA 2CZGA 1G7RA 1HDZA 4KCGA 2AT1A 2MSDB 1LSOA 1M34B 4PAOA 4YMSA 3AY6A 3G9XA 3QRWA 4YXWA 4I9FA 4PX2A 4LYAA 3HYNA 2JAOA 3LWBA 5CM9C 5CX1A 1XRNA 2HEIA 3EXIA 3GLFA 1U02A 2NXEA 1QTNA 4L5YA 1PTJA 3HV0A 1I4OA 4CQLB 4MROA 5AOCA 3D3NA 3PFHA 3EK2A 3OAAA 4CLXA 2Z6UA 3EIEA 4DMCA 1J42A 1DPFA 5ES3A 3ONNA 3A1WA 3N58A 2V4MA 4S05A 1NQWA 3EVZA 3GGGA 3L06A 1M1NA 1NURA 3TSAA 1QO7A 4FHCA 2ZT8A 5IBQA 4MWGA 1UZUA 4W9NC 5GV8A 3SR0A 4IYRA 4BB0A 4UPEA 1E3JA 5LU9A 1GEEA 2Z5LA 3PDCA 1S1CA 4OI1A 3CN9A 5EJFA 4JQZA 2GR9A 2IITA 1VE3A 3JD0A 5HA5A 1M0TA 2CZQA 2WU0A 4Z1MD 3KQUA 4Q4CA 3OQNA 1KH1A 1BXKA 1QH9A 2BM8A 2P6NA 1YA6A 1TUBA 1HXHA 4BLPA 4RO0A 1PJCA 1VHQA 4BGVA 4CCSA 5CFRA 2HWXA 1J56A 1L6RA 3E5HA 2H1LA 4OMUA 4WE3A 4C6RA 4OL0A 4FCVA 4LNAA 4YS6A 1A5TA 3OQHA 1WB6A 3MJHA 1L4UA 3MYYA 1JIIA 1WO8A 4XUDA 5IJ9A 2DRIA 4D3YA 3R5KA 2FUG1 3JQBA 1Y6GA 2PNFA 2HI0A 4Q16A 4ABYA 4YMTA 3FNIA 3W5HA 5F76A 4G8BA 1RXEA 5L9AA 4IGFA 4OGFA 3R0QA 2HX1A 2ZBRA 3D6HA 4HQFA 2XUIA 3QVWA 4G65A 1TK3A 3RVOA 2IS6A 5JZSA 4E33A 3ACDA 1I0ZA 1WVGA 3K2QA 1SBIA 5ESWA 5K6AA 5KSWB 4TL9A 2V1UA 2EBHX 2C31A 3NU1A 2PXAA 1K0FA 4G8JA 3B3GA 4ZAYA 2WYVA 4TKUB 4XRGA 4JI3B 2OWDA 1D8TA 1QCDA 4WECA 3UWPA 2LXNA 3CIOA 1HRKA 1VZ3A 2HY7A 1M6VA 5E9JA 1LQ2A 4PYJA 1VBKA 1INLA 3I0NA 4JQCA 2V7BA 4L8GA 3SR3A 3G9QA 3H1AA 4YP9A 4JDPA 1NUQA 4AM8A 1JT2A 1ZMBA 3RAGA 1VIAA 1UM8A 4FDAA 4YCLA 1FRQA 1P2VA 5EE5B 3TZBA 1U9IA 3RUFA 4D3DA 1X7YA 2O48X 1QU2A 1XPJA 3OX2A 1C3OA 2FV8A 3H5AA 4ZU3A 5DBFA 1OF1A 4B3JA 5KB3A 1ILEA 2VYQA 1QYCA 2YMLA 4G85A 1SHZA 4C2BA 4R40A 1YAJA 2YV3A 4CIVA 4RTNA 3IP6A 3VTFA 2PVCA 3HCEA 4BE4A 1UXIA 1K8ZB 4YAFA 5ILGA 4Z9YA 4LGYA 1U80A 1WLSA 2ZE6A 4RACA 2LBPA 3O3CA 5ALZA 4XDZA 2BJVA 3FGPA 4JBLA 2QAIA 3DKRA 3TO5A 3MGCA 4LQDA 3K8OE 4YMWA 5DX1A 3QTLA 3HKEB 4ABTA 1CRPA 4RF4A 4W99A 5TT0A 4TN5A 3W5BA 2HFKA 1Q7GA 4XZ3A 3T12A 2QRZA 2PKEA 3T99A 2W6QA 2HDWA 5K0NA 2NSDA 3DLPX 2LVBA 4ZOAA 3TG8A 4C4TA 2CV1A 4NJMB 4NYJR 2QX4A 4P3OA 4YUZA 4C7JA 1RC8A 1TMOA 3L40A 2IUYA 3EHDA 4NBVA 2JAXA 3CZRA 2F9MA 4JP1A 3T1QA 1XALA 1CNFA 3WISA 1KI9A 4O2BB 2DWOA 4H7JA 3KWFA 3ZXYA 2HXSA 5F1YA 1B00A 3S5UA 4FMBB 1KYVA 2PAFA 3L0DA 3UB3A 1OH5A 4LY9A 2OC4A 1R3DA 1XE3A 3U60B 1DTWA 2OQRA 1BYIA 1U0BB 3TKYA 3TCNA 2OXRA 1ZGBA 4IDCA 3AUAA 4LC1A 4F96A 2VRWA 3HMQA 4F4CA 2VZ8A 3K6SB 2GZ2A 4MAAA 2A1TS 3RYFB 1DRVA 1GL6A 2AG1A 3F5MA 1T5DX 4DNFA 3OLWA 1HM5A 1Q14A 4MQUA 3LGAA 4ARAA 4OH7A 3TDMA 2GNOA 2VS1A 1ACJA 1U94A 2YY7A 4AF7A 5KTNA 1OLXA 4JVMA 3IAAA