3HJUA

Crystal structure of human monoglyceride lipase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
291
structure length
291
Chain Sequence
PRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Human Monoacylglycerol Lipase, a Key Actor in Endocannabinoid Signaling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Monoglyceride lipase
total genus 103
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hjuA00
4QA9A 5AKZA 4MQMA 3H2KA 3O0DA 4UHBA 5ALSA 3LIPA 3G7NA 4ZRDA 5K3FA 3HRHA 1O6GA 2HADA 5LZ2A 4Q1VA 1J2EA 4FMPA 5E4YA 2BAGA 4C4ZA 1SOMA 4DLNA 3AZQA 1AURA 5AM2A 4ZXFA 4PW0A 2C0PA 1XRMA 4AX4A 3WYNA 4W1RA 1HKHA 4OU5A 5C8XA 3C6ZA 1ZICA 1HDEA 1ISPA 3O95A 5LZ8A 3M83A 1EB8A 4K6KA 4UHCA 5KBYA 4EZIA 3JWEA 5CMLA 4DMHA 4CCYA 3KOOA 1GPKA 3H0CA 4WDQA 3IIIA 3C87A 4QLOA 1KEZA 2FX5A 5ALDA 2RHTA 3FLEA 5T4HA 3LP5A 4WDRA 5AM3A 2H1IA 2QUAA 1XROA 5KWJA 2OCLA 4EHBA 2HM7A 3W04A 2QJWA 4AMYA 5EHXA 4X94A 1A7UA 2VA9A 1ZJ4A 5D3KA 2XT0A 3WWEA 4E11A 1DX6A 2O2GA 4PSUA 1THGA 5CT5A 2IITA 5CTAA 1BN7A 4BYMA 1MU0A 4CFSA 5CRIA 4QDUA 3GBSA 1DWPA 5AKYA 5K3FB 2C58A 3C70A 2Q0XA 1LBTA 4L0CA 1VZ3A 4H0CA 1XQXA 2BUBA 3OPMA 5FLKA 1YS1X 1FFEA 2HIHA 2I78A 3IULA 1EK2A 1T2NA 2QS9A 4E15A 1E66A 1XLVA 5LYYA 2W22A 3STUA 4KE7A 5FUMA 2OCGA 5AOCA 4UHEA 3KSRA 4H35A 4BATA 2RONA 4KRYA 4EY8A 5JZBA 4ZI5A 4B6GA 5CH5A 2CJPA 1LPAB 1XZIA 5JD6A 1DQZA 2XI4A 5JD4A 1EI9A 1GKKA 3MGAA 3IB3A 2PSFA 5CBKA 5HF6A 2BCEA 4NZZA 4ZWNA 2WFLA 1DWOA 4HRXA 4MYSA 2BJHA 4OUKX 5HFNA 3A2MA 3AZOA 4G8DA 4DSZA 1AGYA 1WB6A 1QZ3A 5AKXA 5EHZA 4X6YA 4AN1A 2HFKA 3SX4A 2PUJA 5ALEA 3I6MA 4N5IX 4GBGA 4H77A 3AIOA 3ICWA 3BDVA 3S8YA 4J0JA 2Z3WA 3D59A 5E4TA 1P0MA 3WJ2A 2Z8XA 4EUSA 3WIOA 1LPOA 1QO7A 5ALWA 5AI9A 4EY5A 4Y7DA 1XZHA 2JBWA 2RAUA 1XFDA 1MN6A 4FKBA 4HRYA 5F4ZA 5AM5A 4CG3A 5DYYA 2HU7A 2ZSIA 3MUOA 2VATA 3UUEA 4LXGA 2C7BA 1WHSA 1MPXA 2HA0A 4BZZA 2HRQA 5ALIA 4UBJA 5BV7A 1MX5A 1UXOA 2XUPA 1ODCA 2AJBA 1S8OA 2PUHA 1VXRA 4UBNA 1E8MA 2GYUA 4QDZA 1LPMA 1XKTA 3W9UA 1UWCA 5D3ZA 1QO9A 3WWDA 4MEAA 3WQHA 5LP1A 1UKCA 4D9JA 3I2KA 5K3EA 4I19A 2QXTA 4MWTA 4K6HA 1I6WA 2XUJA 4ZV7A 4Q3KA 3AUKA 4UBMA 3C6YA 3E1GA 3STXA 4AN0A 4J0IA 4FLEA 1NX9A 3WK5A 1KU0A 3G0DA 3WMRA 4AB1A 4UFNA 3H17A 1CEXA 4WFJA 2HRRA 1HPLA 1ZD2P 4F60A 1FSSA 4UFPA 3RKSA 4MXDA 3G9XA 2O7RA 4F21A 4BBZA 1FJ2A 4H7KA 1YAHA 2HA4A 3LS2A 2YH2A 3D7RA 3FYUC 1GT6A 2JGMA 2QKYA 2Z5GA 1TK3A 2GYWA 1EA5A 1CUSA 2WIJA 3K6KA 1U2EA 3DOHA 1CQWA 3LLCA 2OQVA 4EY4A 3FYUA 3AILA 4X00A 1A88A 1W76A 2XQGA 4N8SA 5K3BA 5AIAA 4X6UA 4KAFA 3BF8A 5DNUA 5ALPA 5HF5A 3SK0A 4PSDA 1CVLA 4DNPA 3Q8WA 3IA2A 1X70A 3AINA 5JAHA 3S2ZA 3H04A 5A6VA 4B80A 4H7IA 5HKBA 2PSJA 5K3DA 3HYSA 2ONCA 3O4GA 2B61A 1MT3A 2WHPB 2GZRA 5CXXA 2J3QA 3LCRA 4IO0A 1CRLA 2XMDA 5DJ5A 2IX9A 3DQZA 3BXPA 3L1HA 1EX9A 4X6XA 2XE4A 1XZAA 5LZ5A 4FFWA 1OILA 2WIKA 4KAAA 4B7ZA 2AJDA 1XRRA 1CUEA 1TCCA 1CUFA 1UOOA 1K4YA 2VT6A 3FLAA 4OB7A 1TRHA 1QIDA 2XUQA 3EQ9A 4QDOA 2QUBA 4DTCA 1FFAA 5ESRA 3C43A 3WK4A 4J7AA 3PUIA 4OCZA 5E4JA 4WFIA 3BDIA 2JGLA 3I2HA 4X93A 1XZFA 2WIDA 1GZ7A 5CURA 1LPPA 3F98A 3KXPA 3BIXA 4FLMA 3F97A 3DL4A 4P9NA 3WZMA 1CUYA 1QE3A 2HA2A 4QZVA 2C5GA 7YASA 2DCMA 3UUFA 1LNSA 4Q3OA 5AKEA 1Q0RA 1WPRA 4MEBA 3CXUA 1MJ5A 4K2AA 2XQFA 5A7HA 4DMCA 3A2NA 3FLBA 3EBLA 1LPSA 5A71A 2QZPA 4GW3A 1FFBA 3E0XA 2PM8A 4C4XA 5C8VA 3WL5A 4INZA 2EDCA 4GLBA 1BCSA 1WHTA 5ISMA 1IUOA 1E3QA 1K5PA 3IURA 4DIUA 5AJHA 4DNQA 3WA6A 4LHEA 4QNNA 1CV2A 1XZCA 5T4BA 3WK8A 3O4IA 3QYJA 4H7FA 1YASA 1K63A 1SCQA 4KE8A 5ALRA 2AJ8A 1LZLA 4J0KA 5AICA 2XMCA 1USWA 2ZYSA 5CH8A 4OU4A 2CB9A 1BU8A 2WUGA 3VVLA 3ZLTA 2PL5A 4Y2UA 1TQHA 5FRDA 5LIPA 1QIJA 1IVYA 5JATA 1CIJA 1C4XA 1MTZA 4L3WA 2RI6A 3I1IA 4OSEA 1AZWA 2RGUA 1JU3A 1R88A 3HJUA 3FOBA 1AC5A 3IUQA 4W9RA 1VOTA 2XMZA 3WL8A 4Y2PA 5A62A 3A2LA 4J0HA 5EHNA 2WLSA 2WQZA 4ETWA 5FPQA 4YASA 2PSDA 1CUZA 3C8HA 3V1NA 4C01A 2ACEA 5HCUA 3W9BA 4BCCA 3PFCA 4WY5A 3PF9A 3QPDA 5DLPA 3OM8A 4E14A 1A8SA 4A5SA 3BL8A 3H1AA 3OC0A 1UK9A 3DLTA 3WA7A 3KWJA 3PI6A 2QRUA 4BTVA 4PF1A 1QTIA 2XUDA 4UHFA 1R3DA 1JJFA 2Z3ZA 3KD2A 1MNQA 3QMMA 1SFRA 1ACLA 1TKRA 1ODSA 3NOXA 1QIFA 3PUHA 2WSLA 4G4JA 3RLIA 2XQJA 3ESBA 2I03A 5ALMA 3D5EA 4XVCA 1CUDA 5AK3A 1AMNA 5AM1A 2QVBA 3TGLA 3ILSA 4Q05A 3FCYA 4J0DA 2E3JA 1CUJA 4BVKA 3GELA 2EDAA 1N5MA 4JYMA 1LZKA 2HL6A 1E5TA 1UT6A 1JFRA 1Y7HA 4BDTA 4BCBA 1L7QA 4B0PA 4AO8A 1G42A 2HDWA 3C8DA 1VE7A 2WTNA 4MJ3A 2XLBA 3WKCA 1K6EA 5A7GA 1Q0ZA 4N8DA 1MNAA 2PU5A 2VTVA 2XMGA 3F96A 2CZQA 1NU6A 4UBOA 3AIMA 5ALGA 1BS9A 1H2WA 2RHWA 5LKRA 2XUKA 3WKEA 2Y2UA 3G0GA 4BVLA 3NUZA 3C6BA 1XQVA 3FSGA 3D0KA 1NU8A 5ALVA 4DM7A 4B81A 1WPXA 2IIVA 3K9BA 4X71A 5BWCA 5AKIA 1XZJA 4HTAA 1R9NA 4BDSA 4BC0A 3QH4A 4GDMA 5J3JA 1CR6A 1F0NA 4ARAA 1QIKA 1ZJ5A 2OCIA 4BE4A 2XMBA 2WG2A 2BFNA 1SCKA 3I6YA 3O4HA 1DU4A 4H7EA 5EFZA 4M0EA 2I3ZA 2VJAA 4CCWA 4GXNA 2WHQA 2V9ZA 2WU4A 3AZPA 5ALOA 4Q82A 1DWQA 2VT7A 4NS4A 1JMKC 1QONA 3H2HA 4P92A 2GBIA 1UOQA 3F8SA 3CN9A 1UOPA 1M33A 1VZ2A 3P2MA 1MAHA 1GQSA 5AKLA 3R3ZA 3FBWA 5AM4A 2D0DA 1C7JA 3ZWQA 3WK9A 5JADA 5AI4A 2VJBA 4BAZA 3QZUA 1W1IA 3G02A 3C5VA 2OGTA 3WYDA 3STYA 1GGVA 4KE6A 2ZJ7A 1VXOA 3WI7A 2LIPA 4UBKA 4C4YA 4DNOA 1QIEA 4DNFA 4AZ0A 4CG2A 4QWMA 2VJDA 5HF8A 2ZSHA 5ALZA 3I2FA 5LZ4A 3A6ZA 3PFBA 3V1MA 4C88A 4IQ4A 4BP8A 1CPYA 2XQKA 5I8PA 2PU7A 5FV4A 4N5HX 1EB9A 4Y2VA 3N2ZB 4GHWA 4HXEB 2FUKA 4EY6A 2AJCA 2EEPA 1EDBA 4BVJA 4BTLA 4FDMA 1JI3A 2WHPA 3H2JA 4G8BA 4DYHA 4OPMA 4GI1A 5AO9A 5SYNA 1G66A 4NVRA 1B6GA 1EINA 3TEJA 4W1SA 5EI5A 5DYTA 2GZSA 2WFMA 5AI0A 2W6CX 4A16A 4XX1A 5EHQA 3WL6A 3M81A 5AK6A 2YXPX 1E8NA 2XQIA 3B12A 5C81A 3R3UA 2HHAA 1DTEA 6YASA 3VJKA 1QGED 3I6ZA 4GECA 1A8QA 1JJBA 2OQIA 2PBLA 4BE9A 2VJCA 1LPNA 5C7YA 2XLCA 1WB4A 1BE0A 1AQLA 4W1QA 4XWGA 5JZSA 3OG9A 5LZ9A 2X5XA 1AUOA 3G9UA 4U2FA 4YPVA 3AIKA 4IH4A 1EH5A 4ITVA 3DL7A 1MAAA 4J03A 2VAVA 5YASA 4IH1A 5T4EA 1BEZA 3FYUB 4X92A 3JW8A 3D2BA 4P93A 1JU4A 4DSAA 2GBCA 5DWDA 3L1IA 4XIIA 1R1DA 4AZ3A 2ZJ6A 5JALA 1ZD5A 4HXFB 5JYCA 1VLQA 3U1TA 2OCKA 3MUNA 3RM3A 4K5QA 2XMRA 4G5XA 5AI8A 3FVTA 1UKBA 2OXEA 1EHYA 3WK7A 4J0CA 3HZOA 1XZBA 2Y6VA 3G0IA 4EB0A 1QFMA 1TAHA 1QOZA 5KREA 4C6HA 1XZDA 4BP9A 3IVMA 1GQRA 5CW2A 4BRZA 2XUAA 3IUMA 4DMKA 3E3AA 2OG1A 3DKKA 5JAPA 1Y37A 1OCEA 1T4MA 2QTBA 3BF7A 1JJIA 2JGJA 1ZI6A 4JUIA 3QPAA 3DNMA 1CQZA 4DGQA 4QWWA 3M3DA 1UZAA 3I28A 4Y9SA 3UMJA 2H7CA 5ALYA 1J07A 4KYVA 4FTWA 1YAJA 4KAJA 4U2BA 2CUTA 2V97A 4G9GA 3PDCA 4AO7A 2XUOA 2BKLA 5AP9A 1E89A 3STTA 2XMSA 2DFPA 2BGRA 4JH0A 4EA6A 3WJ1A 1O6FA 1TIBA 2WJ6A 2C0QA 5K3CA 4OYLA 2B9VA 2ECFA 5ALTA 3L1JA 4U2GA 4WY8A 4S0XA 1N5RA 3EIOA 5AKHA 3Q0TA 3BJRA 2HA7A 4OYYA 4LIPD 4X95A 3VXKA 1W4LA 3MVEA 5ALHA 3DYVA 1Q83A 1YA4A 4UUQA 2CMFA 2XUIA 5AOBA 1DX4A 3WLAA 3QMVA 1WCYA 2FJPA 1UK7A 1ZI8A 5JD5A 1YB7A 5SYMA 1F6WA 1Y7IA 4X97A 2V96A 4ZREA 3U0VA 1YSCA 4ZV9A 5AKGA 5KWIA 3OOSA 1C7IA 3BE8A 4X91A 2H7XA 1PJAA 4FBLA 4FBMA 2ZYHA 2OGZA 4TVKA 2WFZA 4CCYB 5CT8A 2VEOA 2BUAA 1Z68A 3DS8A 4TGLA 4P08A 5AH0A 1R50A 1BRTA 3D2CA 1OXMA 1CUAA 2GBGA 4MYDA 1VE6A 3WWOA 3HC7A 1QLWA 4UFOA 3WIBA 1CUWA 3G0BA 2WTMA 1IUNA 4U2CA 2VAXA 2OLEA 5AI5A 1ODTC 4BC1A 3R3WA 2QOEA 5HK9A 3C45A 4QDTA 5HK8A 4G8CA 5K5EA 3AFIA 3NGMA 1EDEA 4AQDA 5D7BA 3WWCA 1ETHA 1XLUA 1N8SA 5JIBA 4KACA 4RPCA 3VDXA 2UZ0A 1DT3A 3G8YA 4HXGA 2WG1A 1EVQA 5IKXA 5IVKA 1VA5A 4B9EA 3VJMA 2JEYA 3E4DA 4Y2RA 2WJ4A 5LZ7A 1XRQA 2P8SA 4PO3X 3V1LA 4IH9A 3D4LA 3HXKA 2ORYA 4UBLA 2G5TA 5LLSA 1R9MA 4O08A 3R40A 2HA5A 2RIPA 1D07A 1UFOA 3CCCA 3KDAA 5AKJA 3HACA 2G5PA 3WZLA 2WFLB 4J0GA 3WK6A 1ZD3A 1QIGA 3ZPXA 4Q3LA 5ALUA 4MQLA 2XUGA 4PQEA 1K8QA 3R41A 3V1KA 3ED1A 4XJVA 4NMWA 2X8BA 1EVEA 5K3AA 3KWFA 3FVRA 4GWLA 1B41A 2JGEA 5ALJA 1A8UA 4KR0A 3FAKA 5CT9A 3ZI7A 5FP0A 3SWWA 2DQYA 2WUEA 1N1MA 3DCNA 2AXEA 4JNCA 1H2ZA 2HA6A 3ZLVA 3ANTA 3B3QA 1RP1A 4ARBA 4Q34A 3FNBA 5DTIA 3W05A 2D5LA 2PSEA 4BB0A 3IUJA 4KEAA 3EF3A 1PFQA 4TPKA 4Z49A 3G9TA 2O7VA 5AI6A 3GROA 5CT4A 2JF0A 1DINA 3A70A 4YK7A 5E2IA 1ZD4A 5FDFA 2DHEA 1SCIA 3ESCA 3I2IA 1G5FA 5ALLA 1JMYA 4C87A 4W63A 4B82A 3V9AA 2XDWA 2ES4A 5AK4A 3CCBA 4FHZA 3D2AA 4N8EA 2WIGA 3QITA 1L7RA 4G4GA 3F67A 4Y2JA 1F8UA 4OB6A 2WJ3A 4LYDA 2CKMA 2DHCA 2CBGA 3GFFA 3HLKA 5IVDA 5T4FA 1QTRA 3R0VA 5A2GA 3GUUA 2XUFA 1WOMA 1CUVA 4M0FA 3STWA 3HABA 2XB6A 5ALXA 2WIFA 4CIAA 4PV7A 2R8BA 4L9AA 5HQ3A 3SC2A 1GPLA 2Y6UA 2I3DA 5AIBA 2WILA 3QM1A 1ZI9A 4WFKA 4LXHA 1IMJA 1GXSA 1ORWA 5H3HA 4IHAA 3H2GA 1XRNA 5CXUA 3JYHA 1XRPA 3WWPA 1QJ4A 1XQWA 4YX9A 3DDUA 2B20A 3DOIA 1X2BA 5ALKA 5AM0A 4FLFA 2QJRA 2ZVDA 5JZ9A 5I9IA 1VJ5A 2PKYX 2PVSA 5AK5A 1CUHA 3VKFA 3K2IA 3RK4A 4X90A 1TCBA 1E8DA 3DEAA 3EQ8A 4EY7A 2PX6A 3QPCA 2PSHA 4FNMA 4RE6A 1CUIA 2JGFA 4HVTA 5D6OA 3EQ7A 1X2EA 3IDAA 3GA7A 1WB5A 1ZOIA 2OAGA 4G4IA 2DQZA 1RYYA 5IH7A 1TCAA 3BIWA 4QDXA 4KJXA 3AJAA 1IZ7A 2HFJA 3F9CA 3C6XA 1FFCA 1BCRA 2QMQA 1FFDA 3I1YA 5CH3A 1EDDA 1MX9A 3IUNA 2J3DA 1WM1A 4RNCA 4F5ZA 2JGIA 1ZIYA 2J4CA 3O9MA 3DYIA 4PSCA 3VVMA 3QVMA 1LPBB 5FXMA 5LKAA 1GPNA 4BRSA 2G63A 3HEAA 3PE6A 3B5EA 4BZWA 1U8EA 2YASA 4BAGA 4AMZA 5DNWA 4PNZA 3I2JA 2HA3A 4QLAA 2GBFA 1JT2A 1XZMA 1H2XA 3R3YA 1RWQA 1VA4A 3H18A 4UHHA 4FOLA 4WCVA 2XMQA 1SC9A 4H7DA 4K6GA 1ZGCA 4RGYA 5IVHA 3HSSA 3W06A 3NWOA 4AO6A 5EGNA 5DYWA 1CUBA 3RARA 5HFAA 3TJMA 1HLGA 1R4ZA 2YYSA 4H7HA 1AKNA 2V98A 1DT5A 3ESDA 4FFVA 4RE5A 4I3FA 4UBIA 5JAUA 1UKAA 1CUUA 1EK1A 3ICVA 1CUCA 4KE9A 5EIAA 4BCDA 1MO2A 2WM2A 5IVIA 2O2HA 4JYPA 1XZKA 1MX1A 5FOQA 4B83A 4JEIA 3QBJA 5BOVA 3G9ZA 3LIIA 1YB6A 3D3NA 1XZGA 3PICA 2H9YA 2ZYIA 4B0OA 3O9VA 2Z8ZA 3FCXA 4Y2SA 4Y2TA 5HF9A 1UK6A 1UK8A 5EIHA 1ZIXA 4WJLA 2QM0A 1XZLA 4CIBA 4LKOA 2WG0A 4FWBA 2K2QB 4B9AA 5A7FA 1HBJA 3FSGD 1VKHA 1F0PA 1CUGA 3VISA 1U4NA 1KU6A 1LGYA 2VQ6A 1YA8A 4EBBA 4G9EA 4AXBA 2DHDA 3YASA 4HS9A 4MWSA 4A23A 4LXIA 3G0CA 2G4LA 1XLWA 5ALNA 5FKJA 1YCDA 2DR0A 1W6RA 2XUHA 1P0QA 4X7BA 1G4HA 2WU3A 3BJMA 5HQ3B 1YS2X 1PV1A 1QIMA 3O4JA 4Y2QA 3TRDA 2PPLA 2QT9A 2OGSA 4V2IA 4BAUA 4U2EA 1DQYA 2DSNA 1J06A 4G1FA 2VF2A 4B85A 3WL7A 3IBTA 3ZLUA 1ORVA 2BGNA 5JASA 2HU8A 5AKKA 5DTJA 3N0TA 3CN7A 5HZGA 1J1IA 2JEZA 1CFJA 3WKBA 4Y2YA 1LBSA 3H2IA 3DD5A 3FWHA 1THTA 2QR5A 4DMFA 2GYVA 2VSQA 5JARA 1XQYA 1QIHA 2WUFA 5C8ZA 1EXWA 5I7UA 2QXUA 2X76A 1ZGBA 5DNVA 2H7YA 1P0IA 4QE3A 4KRXA 5FPPA 2ZYRA 1HQDA 4QEKA 5AOAA 3PF8A 1W52X 1H2YA 2OAEA 1ACJA 5ALFA 4E46A 3X3HA 1XZEA 4LYEA 1YR2A 1JKMA 2J4FA 4UPDA 4UHDA 5ALQA 5EIEA 3V48A 4H18A 4H7JA 2O2IA 1HL7A 3HI4A 4C89A 3FYTA 2Y2VA 4X85A 3DKRA 1CUXA 3T52A 1H22A 3ESAA 3H1BA 3M82A 4U2DA 1QFSA 3ANSA 5CT6A 2CEKA 5AHXA 2C5FA 1L7AA 3R3XA 3OURA 4OB8A 2ROQA 1XRLA 3GZJA 2OPHA 2WHRA 4CI9A 3WKAA 3BWXA 1BROA 3W2TA 4ZGBA 2B4KA 2R11A 1Q84A 3STVA 4Y2XA 3I2GA 2NW6A 5JAOA 5BWBA 4W1PA 1QIIA 2BUCA 3R3VA 3OTQA 5JANA 2ACKA 5HKAA 4ROTA 1LLFA 2FJ0A 4L72A 4F0JA 3DJYA 2C4HA 2WUDA 2ZJFA 4M0MA 1AX9A 1P0PA 2HU5A 3H19A 3QMWA 4CG1A 1IUPA 1U65A 2JGKA 4GEGA 1CLEA 1IZ8A 4HZGA 2JIDA 1GKLA 1BEEA 2AJLI 1W75A 3ZV7A 4OD0A 3T4UA 4B84A 1H23A 1XKLA 3VJLA 2WKWA 4FNGA 4I4CA 3C5WP 2Y1KA 4HAIA 4X3CA 4J3JA 3WKDA 1BN6A
chains in the Genus database with same CATH superfamily
1XC7A 5AKZA 2X23A 5EE0A 4LHXA 4UHBA 3S2UA 1CK4A 3IR5A 2P4SA 1WZIA 1GFSA 1L9KA 1SPXA 3HRHA 3T9CA 1PUIA 1JZQA 4FW8A 3I04M 1U7ZA 2CZCA 1D09A 2HADA 1HDIA 1K5HA 4TYMA 3WYGA 3T7IA 1Q2XA 5LQJA 2QEQA 2HGSA 4ENQA 2AN3A 2QTWB 4ZVVA 1KC1A 3U3JA 1A0OA 3A1UA 1SOMA 3RVKA 2QUZA 4UUNA 2IU4A 3AZQA 2Q5LA 5E9AA 2YW9A 3VAAA 5AM2A 1RM3A 4ZXFA 3MWGA 1J49A 2SCUB 5KNCH 5L4LA 2MTBA 4H15A 5K03A 5E6UA 2C0PA 1ZNXA 4UEWA 1OHHA 3OBBA 3OMLA 3D7LA 4JBNA 4F4UA 5LOVB 3BMNA 3ZD7A 1ECFA 4GXRA 1YKSA 3NOVA 3IP3A 1HKHA 4HP8A 4R8KA 4W1RA 5EZQA 4L75A 4AX8A 5C8XA 1V7ZA 2RAFA 3PX2A 1G16A 1YZNA 5F98A 4O0LA 3L7KA 4LWPA 5DCYA 3DEKA 3KO8A 3OT4A 5E0OA 3SICE 4PGHA 2V7EA 1LC0A 5GWXA 5KU7A 2AI3A 2XH8A 1NF8A 3PNLA 1I8TA 4R5MA 1BJKA 5LZ8A 2GM5A 3CE9A 3Q1KA 3AR6A 3I9LA 4IDHA 1UDWA 2VH2A 5CMLA 2AQHA 2PT7A 2BL4A 4NCKA 4PZUA 4RVHA 4TV8B 3U80A 5CB4B 2XCTB 1WDWB 1YACA 3PZBA 1Z0DA 2Q27A 1RJEA 2JZNA 3FETA 3H8SA 3ORRA 3PRKE 3U40A 3QJYA 4BEWA 3MS4A 1CY7A 2FH5B 1NW8A 3GRAA 3LCJA 1WLYA 4I81A 4WDQA 1JEQB 3L43A 4MDYA 3IIIA 4ZZ3A 3C87A 4KXMA 4F5YA 1OJ7A 4XDZA 4KQHA 3QEKA 4M49A 5G0TA 4CHTA 1A2KC 4W9NA 3JWHA 1YB4A 3UHFA 5ALDA 1XKQA 1KYTA 5CUQA 1FSZA 2HT6A 3PNKA 2H1LA 3INGA 4WSOA 4ZTZB 3M34A 2AOXA 3CSUA 3FLEA 1OFUX 4TN1A 3RHZA 5IMSA 4ROSA 5JO0A 2X9LA 2Y8EA 3VVBA 3K4HA 3T7RA 3N76A 3B6MA 5AM3A 2C8LA 1JH8A 3UC9A 1O0CA 4F04A 2VXYA 1X74A 2E6KA 4RS3A 5T8KC 3NP7A 4EI8A 1II0A 1QDLB 2O2JA 2Q4RA 5JLJA 2X58A 3ETLA 4JQSA 2QUKA 3KR9A 3DZDA 4G07A 5D85A 1X86B 4Y6SA 1VIVA 2B4YA 1ORTA 2I55A 3G2OA 4FYYA 4JQYA 3JAKB 3HXPA 4GOND 4KPUA 4JENA 1LQ2A 3BA1A 4DMLA 4R71A 2WB2A 4CJXA 1KO8A 1A7UA 1T8YA 3ZE9A 2LD4A 5LQNA 5IHXA 1KMIY 1H6BA 4CYMA 2XT0A 3WWEA 1INLA 1FVHA 1DAOA 1KI9A 1KZYC 1L7NA 1MOZA 2R6AA 4I6GA 2I4LA 1EZ4A 2XTZA 1JB9A 3OZEA 2A86A 4G8JA 1TYEB 1EM8A 1NPYA 2J3MA 5AUPB 4ZFNA 4KG7A 5TSDA 5CT5A 2IITA 3K0KA 4QODA 1JIXA 3LZDA 1TZCA 4DV7B 2P2GA 3CINA 4GEKA 4BB6A 2JLWA 3FI9A 4I1YA 4BNGA 2DECA 2D00A 5A6SA 1MU0A 2A9OA 4G1BA 1QAQA 5ECDA 3SYKA 1W36B 3T3OA 3UAXA 2PMKA 5CRIA 3ZHQA 4YUAA 3HDJA 4QUIA 4QNMA 5K3OA 1KJ9A 1DWPA 5AKYA 4WVLA 2F2TA 2QRZA 4CNBA 1V47A 3KL2A 3WOHA 3L79A 4AZSA 2OCDA 2R86A 3LO8A 3Q7PA 4JN6B 2RB4A 2OWEA 1YVPA 3O8NA 2IEYA 2QZ4A 4LPKA 2QTRA 4GX1A 2DY0A 1Y42X 1LBTA 1CBUA 2H0QA 2OV3A 1NQVA 1NFQA 3I0MA 3IEKA 1WDMA 1VZ3A 4MMZB 4V02A 5LWHA 2BUBA 4A8JB 2B2NA 5C18A 3FWNA 3PQ6A 1VIYA 1X1RA 2QM7A 2TS1A 4YB8A 1NR7A 1DKLA 2PDAA 2YVQA 3D8SA 4Y0AA 4E2XA 5BWLA 1WMBA 1JDNA 1UBSB 1YS1X 4JBHA 4C0WA 1NBMA 3FRHA 4ZVQA 4ARZB 3QEMA 3JD1A 3PRYA 3DMDA 1U0OC 1LDGA 5C4IA 3IULA 4M46A 3O03A 3RRNA 1NJGA 3PD7A 1VMKA 3CNEA 4RHFA 4E15A 1PK9A 1JKFA 4HMOA 4I5FA 3BTVA 4PRZA 5DP2A 4ETNA 4ZCLA 3GJXC 2RJ3A 5DI3B 3OUZA 2KMLA 2GTHA 5C2JB 3TSCA 2W22A 5EYPA 4ME6A 4CV2A 3K6JA 4KE7A 3SJAA 3I6BA 1DFIA 3GT7A 2WYWA 3TRHA 4C22A 1CZOA 1E1RA 2BR4A 3AWIA 1AY0A 2PNFA 2R6FA 4GYJA 4MROA 4KLZA 3RCBA 2XZPA 4OMUA 1T3SA 3WIDA 3JARB 4LTDA 3IEXA 2O5RA 3E03A 1RHMA 3IMGA 1C1DB 6ABPA 2B0CA 1HY3A 4B6GA 3VQTA 1RYMA 4BY9E 1LPAB 1XZIA 1YZQA 5JD6A 3J81A 1FJHA 3BRWA 1YJAA 3C8ZA 3WMFA 4PCLA 2X8LA 3I45A 1Z06A 3GUYA 3UB3A 2ALJA 1GKKA 1MTOA 4EABA 3KPUA 1YE8A 1H1TA 1WUTA 2F48A 3IB3A 4D44A 4MVJM 1V11A 4B35A 4HNVA 4L5JA 4Z1MD 3U6BA 4POOA 5KU1A 2DUUA 4NZZA 4XDGA 2OHIA 3HZRA 2HV8A 5TARA 4EI7A 5IM4A 3I53A 4TROA 1OQAA 3HY4A 4HRXA 3W4IA 4IYJA 3ZXYA 3WBJA 2F4NA 3WBFA 4RTKA 3VSBA 4G81A 3KVYA 2CUNA 2VCEA 4A73A 2BJHA 3VKGA 2BE7A 4K46A 1ECCA 3OAAA 3R0QA 1EVLA 3AHFA 3AZOA 1GTMA 2FR0A 1DG3A 3MJFA 4DVJA 5LB4A 5JCXA 2HFKA 2HMWA 1MCZA 1Z6PA 4B4OA 1L7BA 4BNTA 2W2TA 2ZRFA 3MBKA 5E7IA 5ICMA 1KI8A 4UMDA 1WETA 2J3IA 1LJ8A 4OMDA 2Z43A 1DBSA 2D1FA 2QJFA 1GA6A 2YDXA 4R1LA 5E4TA 5GTDA 3CRRA 1XDUA 2JLSA 4GE3A 2DR2A 3FBTA 4NU8X 1SXJD 2I7DA 5JH7F 1DRVA 5EIBD 3FNHA 4WFQA 1PDWA 3DTVA 4EY5A 4JI3B 1WWKA 2VK8A 2AR0A 3B20A 3IO3A 1XN4A 4HDOB 4XLTA 3RK1A 4F85A 1NULA 1Z4PX 3PS9A 1RHKA 3ESRA 2VDRB 2EG5A 5NULA 4I1RA 1JSRA 2JBWA 1NXVA 4KXQA 3SBEA 2FI1A 2IY9A 4TSRA 3L8CA 4RIHA 3AY7A 3ILXA 1JDZA 4YPFA 2V6FA 1JHRA 1F2DA 2J5QA 2QV7A 1A8HA 1N6RA 1K89A 1W1UA 3G13A 5DYYA 2CLOB 2ZSIA 1Z6AA 5DTEA 3TSAA 1TM3E 4B7AA 5IKPA 1Z5NA 4UVDA 3MT7A 1GL6A 1N5KA 2ZR7A 1RRFA 2ZWAA 3H86A 3OF5A 3NS7A 3UUEA 4A8TA 4LXGA 1K8YB 4ECAA 2ZRJA 4K9PA 1AJEA 3CZMA 4FEEA 1WHSA 5AUQA 4D4HA 3GJ7A 4R8SA 1BKYA 5BW6B 1QK4A 3LLUA 3ONWA 2JL1A 4JGBA 1HQCA 1R3UA 3BHMA 3FXAA 3HYLA 2CVHA 3TPFA 3WMGA 5DSTA 8ATCA 5I3ZA 4BZZA 1TT5B 2PN1A 5ALIA 5AXAA 3EODA 4BGDA 1UBKS 1CSEE 5HM6A 2QGNA 4AM8A 1FFGA 1MX5A 5CCEA 1FNNA 2E7ZA 1A9RA 4D81A 4DDMA 1FS6A 1OBFO 1NV8A 1S8OA 4WK4B 5CB0A 1QGDA 2YFKA 3PGXA 4UBNA 8ABPA 1C8KA 2GYUA 2FPMA 2E5WA 1ODLA 3DT8A 2YJ4A 4FS3A 5E2AA 4HZIA 2C2HA 1XKTA 1QU2A 2JCYA 2V45A 1CF9A 4DCVA 3GN2A 5JYEA 2VPWA 2CKDA 2WJZB 5D3ZA 2B1IA 1QO9A 3CNNA 1P5ZB 4B79A 2NU9B 2XRZA 2W2LA 1F0KA 5LP1A 4D9JA 1CF2O 3I2KA 1V6CA 3U60B 2EJWA 1L4KA 5FIUA 1V4BA 1REQA 2I8AA 3QUAA 4MWTA 1IK4A 4BFLA 4XWOA 4K6HA 1Y3FE 1RQXA 1II9A 3AUKA 2WKQA 2ZR0A 4ITUA 2VJQA 4AG3A 1SJ9A 3H9QA 1QKIA 3PEVA 1OC2A 1UQRA 1NX9A 3LPMA 4FLEA 5C8YF 1AK9A 1KP9A 2I2FA 4I5GA 3VUEA 1W0JA 2O7SA 1TDJA 2MR5A 4E46A 4MUHA 4YRKA 4MRRA 5HRAA 3C1OA 4UFNA 3GLIE 1VYHA 1CEXA 2GPTA 1K6IA 3FHLA 3NC0C 2HRRA 4YV2A 1ZN7A 1YF3A 1HPLA 2OZVA 2J3LA 3KT6A 3LX8A 3RU2A 3V3KA 2J07A 4F60A 4FBGA 3ZNNA 4BWVA 5FNVB 4RULA 5K0TA 2FWPA 2RGNA 1EK0A 3B7PA 2UZ3A 3ZIAA 1UM9A 1HG0A 3T34A 3HVRA 4YCSA 2O7RA 4CKBB 4Q1CA 1RHRA 4F21A 4BBZA 3FX2A 1FJ2A 3F3KA 4B3RB 1KY4A 2CJXA 4BGIA 4I1SA 1QP8A 3GLFE 1GQ2A 4EX6A 1H5NA 3GG9A 1W5SA 4CLOA 1J22A 3I23A 2Q3FA 1ZUHA 4PZZA 4RGQA 4EKGA 2PCJA 3LA6A 1D8AA 3PWZA 2X5KO 4HB2A 5KMGB 1TK3A 2GYWA 1EA5A 3BOSA 4LJ4A 4YAGA 2G6TA 5KSWB 2ANCA 1MQSA 3LX4A 2CW5A 1HETA 3ZS8A 3K6KA 2NYUA 2HHHB 1ZW1A 4MDHA 4HEQA 1P2TA 3ISVA 3LLCA 4QYTA 3HK2A 2PV0A 3ORYA 5GZ3A 4EHKA 5FA5A 1XGKA 1Q11A 4DF3A 5CLFA 2JIZD 5IWCA 5JMOA 3QTLA 5HBGA 4RWEA 3D81A 4JMLA 3UB2A 1QHYA 3OCXA 4PZAA 1KP2A 2JJ1D 4TRMA 1J0EA 2MCFA 3T7TA 3WHIA 3WYFA 4ESHA 1V39A 5L4NA 3NETA 1OH5A 4O4IA 1B2LA 1X80A 3OTWA 5HTKA 4RJKA 3KQTA 1L4YA 3AONB 1JTFA 3UWMA 3L8MA 3A04A 5TC4A 4XARA 2UV8A 3KKPA 1XWIA 4LC1A 1WY7A 3A6FA 5F51A 4CM8A 3LA8A 3LP6A 2EJCA 4QGSA 3DZJA 4GICA 5AW3A 5DNUA 4ZICA 4DPMA 3O8OB 2H2HA 3EFEA 4JQZA 4K26A 5E6RA 3RFUA 2W2XA 3SK0A 1CVLA 4ZOBA 4DNPA 1OH7A 1NBOA 1X70A 4XJTA 2QW1A 1Y3CE 4UD2A 2ECOA 3RS9A 4AURA 2WAAA 1P6UA 3S81A 2G7ZA 2QVGA 3C6MA 3S2ZA 4OXRA 3REGA 1SU6A 3H04A 4ESEA 3FTPA 4GGMX 4W8HA 4Y8VA 2DT5A 2QMEA 1KVRA 2PZAA 4IXDA 1IBLB 1CEEA 4XSGA 4ZO4A 4FYHA 4CMKA 4OATA 4J7XA 2IJGX 1XU7A 3L8HA 3SQXA 2YFYA 3ITDA 1KARA 2JPDA 3KBOA 4ITRC 3WLPA 3NYWA 4YIKA 2B61A 5A4AA 1NVVR 5JRZA 1NONA 2GZRA 4MGYR 5K8CA 3M9WA 2A33A 5H83A 1KFEB 5JR3A 2AFIA 4FP9A 1CRLA 3R24A 1OGJA 2XMDA 3DO8A 4KFSA 3DQZA 5L7YA 3BXPA 1CTQA 4LV8B 4AUMA 2A59A 3L1HA 3OBIA 3BD6A 4D9IA 4DILA 1EX9A 2QQ0A 4X6XA 2XE4A 1O9HA 4KC0A 1R66A 2XNSA 3COVA 1B3BA 3KZNA 2OZEA 3PHJA 3V5NA 1WVGA 2HBYA 4Q24A 4GGPA 3P0FA 1R6BX 3ELUA 4ZAZA 2ZATA 4KIUA 4FFWA 5IT0A 2WIKA 3N6VA 3OZRA 4RZ2A 3D6VA 4B7ZA 1MRSA 3AVUA 2BELA 4TKMA 1CUEA 2A1TS 2CXHA 2JIQA 3F4KA 2A1TR 4GVLA 5BP7A 4ZZIA 1JP7A 1X9IA 3RO7A 1ZGGA 3JQCA 4X63A 1SHZA 3WGZA 4AZVA 4Q3NA 2ZTMA 1NXXA 1ZA2A 2D7DA 2VT6A 2ZM6B 1N2XA 4I36A 5DVZA 1PLKA 1QIDA 4QLBA 3M4JA 3P9QA 4FFDA 2QUBA 5JWRA 5A4MS 1N4AA 3F7TA 2PUGA 2PUAA 1NJ8A 2EGUA 2E37A 3NP9A 1C50A 1XEAA 5FH9A 3GJTA 5K6AA 2CLLB 3OMWA 3OX1A 1U7TA 3C43A 2Z2XA 3PGJA 3O1IC 1N4DA 2B99A 4F3TA 2WE8A 3L7IA 4IIGA 4V3BA 4XWWA 3PUIA 3V4FA 4BX2A 4JHLA 3IUEA 2JI8A 3HP1A 4MR8B 4RV4A 2AV6A 4CEJA 3ED5A 2JFNA 3QUSA 3BDIA 4AJKA 4RMHA 2J7PA 1GZ7A 1LFAA 1SC1A 5DX8A 4RYLA 2J3HA 3K53A 4XCQA 4Z2YA 3H6GA 4P4TA 3F98A 1I2CA 4R8VA 3JZIA 2AWOA 2FSPA 2JLZA 1YD7A 1M34A 1NJ6A 4YGYA 5EJGA 5FD8A 3GPIA 2DKOA 2H4JA 2YWCA 2YFQA 4ZAWA 1GM5A 3R6GA 2CHGA 1RZUA 4GP9A 1MC1A 2GI4A 2JHCA 4V0QA 1UDAA 3WZMA 4BRUA 4QZVA 1I80A 1CY8A 1XD8A 5TRTA 5J47A 3KB1A 1Z4IA 1SRQA 2RMKA 4J29A 1P8JA 2Z30A 1RQ2A 4UVHA 3MJEA 1XRJA 3IILA 3KT0A 4NS1A 5DOZA 2FJUA 4PR0A 2WD9A 1IVSA 2IXDA 1FNDA 1W5AA 1V8BA 4YWHA 4Z7OB 3U39A 2G25A 1N8NA 2M6RA 2FPIA 2PAFA 3I1JA 3RJMA 3AUUA 3NDRA 4A9AA 2YXLA 4IUDS 1V3VA 4Q9KA 5F73A 2VYVA 1ZHHA 2GJ8A 3FLBA 2XGJA 1YRWA 2ZDHA 3EBLA 3BA6A 3IQDB 5GZ1A 2R7KA 1JRLA 1NBMD 4E33A 4OLAA 1FYDA 1YFKA 1O96B 3TQFA 2AZTA 4AY2A 5LMZA 3CW8X 1CB0A 2O1EA 5CCBA 4O4JF 1E18A 1UFVA 1FDIA 1AUQA 2BM9A 2OHOA 4HAVA 4P4NA 4QO8A 4TTPA 1JKXA 1SUBA 5A02A 3T9FA 1VPLA 1EUCA 4MH0R 3LQ4A 2WICA 4XTRA 1WHTA 2QL7A 3K5HA 3VYTB 1DUVG 3AF6A 5ISMA 1DL5A 2C2MA 2A94A 3JQGB 3MMZA 4R2MA 4TXJA 5FYDA 3ANXA 1Y6ZA 3IALA 4W9MC 1ZM9A 5I9MA 3ZHZA 3ZY5A 2D74A 2V58A 3JQAD 2EV9A 4MUKA 1ORRA 5B1SA 2B9EA 3TIGA 3ZHCA 2OECA 4G1UC 1F38A 1GADO 4I4TA 5KI6A 4HDKB 1MHPA 4P4GA 3TPZA 2OV1A 4QUAA 5FORA 4DWWA 4M83A 3SE7A 4M9SA 4C29A 3LD9A 1T2AA 4JSYA 1OXBB 3ZJTA 2ZB3A 1A9SA 1IZ0A 2C77A 3O4IA 3QYJA 4KVFA 1R0YA 5COQA 2FHSA 2QTZA 3ONDA 1KIMA 4DQUA 5ALRA 4IWNA 2AJ8A 1KY5A 2XDAA 2A7XA 3LUBA 3G0OA 4Q3AA 3IB6A 2VC2B 4BJ3A 3OIGA 4DYVA 1FRVA 4X3OA 1S3SA 1ADYA 2WF7A 2FR1A 5L95A 3NDIA 2PXAA 3DHEA 4YT5A 4B3MB 2R65A 2G07A 5C1DA 4N1AA 5EJMA 2QRLA 5IW8A 3VVLA 3ZLTA 1TF7A 4P0QB 4XD2A 4Y2UA 2PMWB 3O6VA 3O9ZA 3WR5A 3LRXA 4NE9A 2D3WA 2V54A 5IJ9B 5A1JA 3ZCPA 1IVYA 1E9RA 5ARCA 1U2QA 4QXOA 1RMTA 4BUJA 2GN0A 3RSQA 1CZNA 1V8PA 2IHJA 4FE7A 1MTZA 3HWX1 1Y8QA 1FB5A 2C42A 5KSYA 1ZMBA 2AHRA 3FUTA 2I99A 1S8AA 5CCDA 3WTBA 3ZZNA 4Q37A 1TO1E 1T1GA 2VP4A 2ID4A 3UKOA 2O3UA 4LOHA 5FNVF 3CEPB 1AZWA 3IBGA 2P3LA 2RGUA 3MGBA 2WY2D 5IKOA 3WQRA 4HAZA 1YBFA 3KOYA 1R88A 1UM9B 1TLFA 2FLKA 5G4KA 4CQLA 4O4LF 1G2PA 3EWAA 2C7PA 5KQRA 3BH6A 4J8PA 1I94B 4MO2A 5IC6A 2O0HA 2Z9BA 4JLVA 4W9RA 1F0YA 1M34E 1MEOA 2XMZA 4RCVA 3U3OA 4Y2PA 3HMQA 5EZYA 1ISIA 3G82C 1JPJA 5A4JA 1E0SA 4D92A 1JYEA 4MVCA 1JJAA 5EKXA 3SU8A 3WSVA 4ETWA 1SQ5A 1EU1A 4FILA 1CUZA 2VQDA 4L73A 1D03A 4NCJA 3TQOA 4YUZA 1RXWA 4G23A 1YWGO 1GSAA 2CZGA 3HKDB 5K0LA 1JHYA 4WA8A 5HCUA 4J3NA 2JHPA 1Q14A 2NG1A 1UBRS 2Q1SA 3I4CA 1PP4A 4TS4A 1PJLA 2ZUUA 3B60A 4F91B 4EA9A 1VC2A 4CMGA 1IDOA 1XB2A 1A77A 4RTNA 3B9BA 3QPDA 5DLPA 3ZQKA 4E14A 3I73A 1YO6A 3HKDA 3K35A 1A8SA 4ZRNA 4YRTA 4ZQIA 1KSGA 3S99A 4FDLA 1JFFB 1ICEA 1PNRA 2YQZA 3JVEA 4YS6A 3VPAA 3DLTA 2XPCA 3V32A 4WGFA 1U9JA 3BGVA 3NAZA 1BZYA 4WNIA 2HQOA 2QRUA 3FFXA 1W34A 4BTVA 1QTIA 4L2IA 4E5DA 2DM6A 3U4HA 3TSZA 1EFVA 3JD4A 2O48X 1AH2A 3HSYA 1GZ5A 4KLNA 4NJOA 2MYNA 1U7HA 2FZKA 3QXGA 2IWHA 1N1GA 3HVUA 1U2GA 3OZTA 2LGJA 3SBDA 4N18A 4NATA 4B8ZA 3OT5A 2G72A 2QN2A 1GRNA 4AMGA 4QYWA 1QHXA 4C03A 3SHWA 4GYWA 3ILHA 2VJOA 1TKRA 4C04A 3NOXA 1QIFA 1O3YA 2PLNA 2WSLA 3FUXA 4G4JA 4IOKA 4P3PA 3MTJA 1CZRA 2FZWA 2I03A 4NU5A 3D5EA 5CVCA 3S40A 1G20E 5GV7A 4XVCA 1NKVA 1V6AA 2AE1A 2GYYA 4HX9A 2FQWA 4Q3BA 1JALA 2OBBA 3GQVA 3TUZC 5AM1A 2QVBA 1YDMA 4AG6A 2GRAA 1YRQA 5EWLB 2VQSA 3G7SA 3SFTA 3D0QA 2RBGA 4KHZA 1J0AA 2LP4Y 1MO5A 5ED4A 3IQHX 4LF4B 1W1WA 2OD7A 3FDZB 2Z09A 5L3RA 1CE8B 1V2GA 4MWOA 3P0RA 3OZDA 2A1UA 2AZMA 3DMNA 3ETEA 1CUJA 5TT1A 3QENA 1WBJB 2XJ9A 5JH7A 5K20A 5BV1A 2EDAA 2OFOA 3IV7A 3MQ4A 1QAOA 2PKEA 4TTJA 3PZRA 2IVFA 1E20A 4TT8A 5KHAA 3VA7A 4OX9Y 2NPFA 2WIAA 3EGDB 3ZZ0A 1XV5A 1OXUA 2Q0SA 3EIEA 5KKNB 3MC1A 2WWYA 2W2MA 1B00A 3BEOA 1WV1A 1E5LA 1ZG3A 1Z6QA 2GCNA 2J9ZB 3RG2A 4EO4A 1I4OA 2GD0A 4QSMA 3TZKA 3GEPA 2OXCA 4BDTA 3W77A 1Y1KE 5KIAA 5KJ6A 4AO8A 1G42A 4KQ6A 5F7ZA 1FPMA 2XNCA 2R68A 4UEKA 1FJXA 5KYNA 2NYVA 4YRSA 2GSWA 4N03A 2HW8A 4BQQA 6AT1A 3C98A 1JXQA 2UYQA 4FHFA 3CRW1 3QU9A 3PSAA 4HH3C 1Q1AA 3ZHYA 1PJZA 4YV7A 1JEQA 5BPFA 5TJ9A 3MMNA 4DJEC 3HUEA 2NT4A 2X5JO 1ZUIA 2RHCA 1YJCA 2JC3A 3DXFA 3R5XA 4N8DA 4CKEB 5INTA 4FC7A 1FYWA 3R7FA 4KR6A 4JVSB 3ZBUA 3K8QA 2Z98A 1NJ5A 1T3HA 2XMGA 2Y1FA 3B7GA 2ICAA 3F96A 3RUPA 5J2TA 4DV4B 3W7AA 1CYDA 2DEUA 2NP6A 4YLYA 4MQUA 4A3SA 1D2HA 4GRDA 2FSVC 3PLNA 5ALGA 2W48A 2NU8A 5KTOA 5EP3A 1TK2A 4PWYA 1JXOA 3GGCA 4MGEA 3SS7X 1T0IA 3IVRA 3S2FA 2BMAA 1Z0JA 4F06A 5C0OE 2IZ1A 1WL8A 2YYYA 1DBIA 4NMLA 4NPAA 2Y2UA 2E85A 1OYVA 3FCOA 1H94A 3DV0B 4KQ9A 2BFEB 2BM8A 2GGSA 1YVRA 2YJNA 1Q1EA 5LJIA 1UBFA 1GCOA 3NUZA 4OEHA 3D3WB 5JNLA 1EIWA 3SVTA 4Q7KA 2CXTA 2PZKA 1Q22A 4Z7QB 5FO0A 4Z6KA 2GCOA 1QQAA 4XOIA 1Z56C 4DM7A 4ZYLA 1QHFA 1EX1A 2HRCA 4OGWA 4RHEA 4BXOB 1E69A 4CKWB 3OKCA 1EGMB 3HL4A 1WPXA 2IC5A 1QGUA 3AHIA 4HNHA 3VZDA 2GKOA 4TQAA 2VTBA 3IP1A 2ZRPA 4NV0A 5EXSA 2C03A 3R8XA 3HGQA 1JEJA 1OV6A 2Z1NA 3IE2A 5ECYA 3R6WA 5CX1B 4Y6GB 2A0UA 4H0NA 3JQ7B 5JQGB 3JYQA 1IQUA 3AI7A 3D6TB 4P3KA 1F20A 3C4VA 3HJAA 4WERA 3PRJA 5HMMA 1FVXA 5ED0A 3SD7A 4BC0A 3WAJA 3QH4A 3TD2A 2J46A 1ENPA 3OFNA 3GEGA 4EB8A 3NONA 4R6WA 3JASA 1H5QA 4HPWA 4ARAA 1U80A 3U09A 1M8GA 1QIKA 5G2OA 3D8HA 3RC2A 5JHHB 1HORA 4MAAA 3KUUA 5HMLA 1YULA 1ZKDA 1TPYA 2JJMA 4TM7A 5IEBA 3UJ7A 1JEAA 3A14A 1NR5A 4WZBB 3RV4A 3RUHA 3ZW7A 2GASA 4NJEB 4GPAA 3I6YA 4F2PA 4Z3OA 5HWSA 3ZNPA 3GT3A 3AJRA 2H3EA 3F9IA 3LT2A 4HN9A 4M0EA 1Z2CA 1PK8A 3TRKA 2J67A 3R6TA 2I3ZA 3H9CA 5CEJA 3F3YA 2D7CA 3OJEA 3ZE6A 4M1TA 1YFLA 3GJRA 3ON5A 3T0GA 3RWBA 1KERA 1L3IA 1ZUNA 3AZPA 1KK1A 1Q6ZA 5ALOA 1XCBA 3OZIA 2QY6A 3SC2B 1JILA 4Q82A 1DWQA 5C5IA 5K0GA 4A1OA 2VT7A 4TWIA 1SKYE 2I6UA 1EAYA 3L4BC 3L4SO 2YZMA 4AJJA 2GAJA 4O4JB 4TSFD 1S7CA 1GYRA 1CRZA 1X7ZB 5JLAA 2QP4A 3CN9A 1KPGA 1NG1A 1JLKA 1F2UB 3P2MA 1WKVA 2FRDA 3MWJA 3PC6A 2EW8A 2GVNA 1M83A 2KPOA 3RWOA 5ITZB 1G4AE 4R5HA 3NBFA 4UUPA 5CB4F 1MFPA 5JSHA 1C3OB 2GRJA 4JX8A 1IHOA 2H18A 3QPWA 2ZLBA 4G0PA 1NATA 3FFTA 3WK9A 4QDKA 1P61B 5IHPA 5JADA 2JJ2A 2H16A 2KLBA 3I5UA 4L4UA 5B58T 3S6JA 2VJBA 3R9XA 1UP6A 1QMGA 4BNUA 1O8BA 3NWJA 1G9TA 4BAZA 2XADA 1XU4A 1DZ3A 2PH7A 3QZUA 2DHQA 3Q3VA 4NBTA 4KSCA 2QR2A 3GHHA 1SK8A 3GDWA 3W2IA 1Y8ZA 3FDIA 4GPTA 4M0UA 4PY2A 1A8IA 1W47A 6LDHA 2UXDB 1DDGA 4KE6A 2H4HA 4TXLA 2ZJ7A 1CY1A 2H07A 4FYXA 1PWHA 4YONB 1JZTA 2IUYA 2LIPA 3OWHA 1N2HA 5LNK1 4C4YA 5EJ6A 3ER6A 1GRVA 2Y1OA 3ZV6A 4Q3DA 1UPBA 3PHHA 4OHMA 1C9MA 3F47A 5DW3A 3O90A 1OFHA 1SOUA 1U0HC 4QWMA 4HNGA 3ZZMA 1EUYA 4CTMA 1SELA 2Z6QA 4D9HA 2PS1A 4MCIA 2NUTB 4OFBA 5HF8A 1NNI1 4LOAA 3RB8A 1G6KA 1ZCZA 4CGYA 2VPYA 4V1CI 5F9FA 3E23A 3FCUB 5LZ4A 3PFBA 3O8OA 4MHOA 3MSXA 1FPQA 4C88A 4IQ4A 5GPBA 2X8JA 4DZRA 4M87A 1EAMA 4UVEA 5I9TA 4PLHA 2QJTA 2Q6LA 2QAGC 3PNYA 4ZQFA 1Z4OA 1PI3A 3K0CC 3K72B 1CS0A 1E59A 2B8EA 2GO1A 3G5UA 1WUHS 2W6ID 3M6XA 5I8PA 3LT0A 4OY3A 3WNZA 3JQBA 3MZ0A 1NXWA 2I91A 4X41A 3RUDA 3FPKA 3FOFC 1TCUA 4W5RA 2IYNA 2FUKA 4K87A 2AJCA 1ECBA 1E2GA 2EEPA 4P86A 4YLGA 1O5TA 5U1PA 4H7PA 2RHMA 1B1CA 3ZY4A 3QWHA 4FINA 5IH3A 3IUBA 3WYAA 1T9KA 4DDKA 2Q29A 3K9GA 2WB4A 3AHHA 3MLEA 4HK4A 1AHPA 3KC2A 2REOA 2ZJ4A 3IQZA 3KLBA 1I6KA 4N54A 3VH1A 1BHO1 4D45A 4DYHA 4F6RB 1QHSA 2O5EA 1BHJA 1I5RA 1NHGA 3DG9A 1UQUA 1M2NA 1G66A 5SYNA 2D5IA 3DC7A 1WDLA 4BNIA 3JATA 1Y9JA 2FPSA 1OFIA 2P9EA 2QTFA 3QFSA 5A9RA 5HE8A 2DLNA 1VIDA 5DYTA 2OV2A 3EFBA 5J59A 4RJTA 2GZSA 3MCWA 1I7QB 3E3OA 1DS6A 1E62A 5ES3A 2W6CX 3Q6MA 3W1VA 1FL9A 4A16A 3R9IA 3BSWA 4E09A 1Z08A 3FPAA 1T6YA 3FSJX 3GCWA 5EJ2A 5J4HA 3DAFA 3WL6A 1ISHA 2FR8C 2SNIE 1NRWA 4FSXA 3ZTWA 1G64A 5AK6A 4UCWA 4Y6QA 2FN7A 5DLYA 1Y33E 3TLGB 4L7VA 5D2CA 4BE7B 1HE3A 3ZE2B 2Q0QA 2GJ9A 2HHAA 2XA9A 3SYRA 5KAPA 3W8FA 2CJYA 3ZD8A 5LMCA 1BFKA 5T7BA 1E5QA 3I6ZA 3O94A 4I3GA 5JZOA 1N2CE 3L9XA 1T25A 3FFBA 4WN3A 4PPFA 2CMKA 4Q7QA 2Z8YM 3AT1A 1JHXA 2Y0EA 1JSXA 3FWKA 3EHEA 3DDNA 4NYIQ 4PIMA 3E7PA 3ZV3A 1YVEI 5E9QA 3WGUA 4CV1A 2B35A 5C7YA 5ES4B 3GLFA 2R60A 1CJUC 2JBHA 1GUYA 4CM7A 5KYYB 5AVUA 1OFGA 1ST3A 1U98A 1W19A 1UPXA 1TZMA 3I92A 3LLMA 3NRBA 1HYQA 3KYDB 3OG9A 3JVUA 1RVDA 1XMVA 2XY4A 4U2FA 1W4RA 1HOXA 2DPLA 4M55A 4UUOA 1JX6A 2FFHA 3FD8A 4R0MA 4JBXA 3TB6A 2GERA 2YFHA 3BFJA 1YFJA 1E3DA 3FR8A 3Q12A 1P4HA 2QQGA 3ENKA 4OXXA 4C07A 1JB1A 3DL7A 3IX7A 1MAAA 5LU9A 1J2YA 4HB4A 3MRXA 2PZBA 4IH1A 2ZSAA 4P7KA 3VH4A 2QNRA 1XZNA 1R0ZA 3PL1A 1FP6A 1YB1A 3I9MA 3UAVA 4MKZA 421PA 3ZWPA 4GPEA 2Z2KA 1M7BA 3IE1A 3V46A 2O8DB 2ODBA 1I4WA 2OYSA 4DR7B 3GYBA 4UAUA 3KVOA 2PT5A 2PYDA 4X62B 3FOZA 2BMDA 4GOKA 4A4DA 2G4VA 6Q21A 1C9YA 2ZUEA 3GEHA 1C30B 2JRCA 5DWDA 3RNLA 4OQMA 4OXKA 3HUDA 3I9V6 5GIOE 4KFCA 4WOBA 4Z9FA 4OI1A 1ZD5A 4HXFB 5JYCA 3AEQA 1A9XA 3QPBA 3T4EA 2ZE5A 2YHIA 3I2YX 3E48A 1KZ1A 1Z0ZA 4ZVTA 3G9QA 3IPCA 1SM4A 3OZWA 4RK0A 4WOPA 3BRQA 3RYIB 4BJ5A 4QU5A 4NE7A 1EUZA 2VHVA 2C97A 2LCFA 5JC1A 1YB2A 3WNDA 4OX9B 1BC5A 5E7MA 5EEHA 3WOVA 1FS4A 2XRMA 4K88A 3NTRA 4BWGA 3MW8A 4CODB 5KNBH 5DHQA 4WBXC 4AZ3B 4E5NA 5BN3A 3H2ZA 2ZM5A 1XXHB 1YQGA 4O4IF 5CD9A 2NM0A 2V7QD 3KJQA 3GHYA 1QO0D 1YBAA 1KVSA 3HZOA 4J0CA 4LY3A 2Y6VA 4FE4A 4BX8A 2X6TA 3KAQA 3MBIA 3B1XA 4AIIA 2DWCA 3EQZA 4ZT7A 3ZWDA 2NMVA 4MI9A 4R6XA 1UXGA 2REBA 3DGFC 3L0OA 4TWJA 2OFXA 2QTGA 3BWVA 1HXHA 3O3OB 5KVQA 3OE7D 3F49S 3B9QA 4IXNA 1PFVA 1VSQA 1PKXA 4NBUA 4O3FA 1EE9A 2FN8A 3K5PA 3A9SA 4RA9B 4BRZA 1MG0A 1UF9A 3A06A 1YDGA 3CR3C 4DMKA 4PPQA 5CIYA 3WXBA 1WDTA 1E2NA 1QRAA 2G7MC 4LHYA 3UJBA 3LFUA 2ZI9A 4HN2A 1B76A 1TVKA 5JAPA 4U6NA 3A37A 4BB5A 1PFGA 2WM9B 2WZBA 1R12A 3AR2A 3P32A 3OIWA 1I2BA 1QRRA 1RW4A 3VPBA 5JEDA 1WQ4A 2I34A 1PQ4A 3CZQA 4YUXA 1OB2A 3KOXA 1K6MA 3WB1A 2JFYA 4FR2A 4FXPA 5IVPA 4RD6A 3TMAA 3QW2A 5COBA 2JCSA 1J9EA 3A27A 3IR6A 4J49A 1T4MA 4DC0A 2QTBA 4AP9A 1JJIA 1M9NA 4GM0A 4RV9A 1MJNA 3LXUX 1HMPA 1ZI6A 3L49A 3ZU2A 4JLDA 4IZIA 2FMIA 4AJ9A 3CVXA 4JUIA 4KAXA 3ITKA 4XYLA 1E9CA 1HNWB 3DNMA 1D6JA 3C24A 2B4AA 1TM5E 1QPBA 1UZAA 2E5FA 5FWNA 4DUZB 2WWTA 2A92A 2JLXA 1D7OA 4DMRA 2QTLA 1N5LA 3QVJA 3GY0A 1LDMA 4FYIA 4NSNA 3QKTA 1T8UA 1ZH8A 3DEIA 2RK6A 4KYVA 1NMSA 1UMKA 2CCJA 3GRVA 3KAPA 4FTWA 3M4NA 4ZIRB 1YAJA 4ZMBA 2PSSA 3K09A 2QE7D 4KGVA 2AFIB 2YY5A 3NATA 2GN9A 3SYMA 3OKPA 4C5CA 2BJVA 1IAVA 2A6PA 2LR0A 3FMGA 1TEXA 4BWFB 1ENOA 1VJ1A 3QW4B 1SKYB 4PINA 4E2YA 3PPYA 3AM3A 4D99A 1FTYA 1RQRA 1P7CA 3JYNA 1OW3B 1Z8FA 3PDCA 2RKWA 4W7IA 4AMVA 4CWAA 5EQFA 4AO7A 2BKLA 2OBFA 3CBGA 5DHRA 3EGIA 4JLOA 3RFFA 2RB5A 3WHLA 5B55A 1E5XA 2W6PA 1O4VA 1VKZA 3OECA 4MKHA 3GJYA 3NEAA 1NZJA 3STTA 4BQIA 2BGRA 1UBMS 2B1RA 2I4MA 2IW1A 3FDFA 4JH0A 5CB6A 2Q5IA 5GADl 1P1RA 2V7WA 1XCPA 3R0XA 2QZJA 3QVXA 5HQJA 4JUFA 1TIBA 1QH8A 2C0QA 2WJ6A 3D5TA 2Q4OA 2YJZA 4JJEA 1Q0PA 4QAJA 4B71A 5B6PA 5FUXA 3TLCA 1TQ4A 3N05A 3OZBA 5IANA 4QU0A 3IT2A 2ECFA 3I0ZA 3L1JA 5KZMB 4DCCA 4B8YA 1R0SA 4FFBA 2X1VA 1VKRA 1V5GA 2FTKE 3BZUA 3EIOA 1U99A 5BNTA 3Q0TA 3KT3A 3AVTA 1X77A 4A8JA 2HA7A 5CLHA 5IDXA 3GRUA 1DKUA 3X1XA 2AB0A 3AG6A 1TGVA 1MB4A 3AFNA 4R1NA 3UFXB 2IOYA 1FUYB 2V4ZA 2SKCA 3AF5A 3EH2A 1U8ZA 3HB9A 1WZUA 4I9UA 1UBJS 4NENB 1YJXA 3VXKA 4JUDX 5DGIA 1TRKA 4RLHA 1W4LA 3AU8A 1TD1A 3DDHA 2AOUB 3UMCA 4IUBS 4JVOA 1R5OA 4UZFA 4F12A 1M7HA 5ALHA 1EJBA 1XYYA 3DYVA 3LPAA 4CM8B 4DCNA 1FFHA 1L5HB 3NX4A 1ISSA 4L4RA 2ZOSA 4M76B 5K8UA 4DMGA 4MQ4A 1C80A 3TECE 4YJ2A 4CIAA 3SF8A 4O3MA 3CH7A 2XUIA 1PDVA 1B0AA 3WLAA 3QMVA 4NCHA 2XEDA 3DOCA 5G53C 1UK7A 1ZI8A 1ZN9A 4M38A 4JHXA 1BE1A 2DKNA 1G3MA 1UP4A 1OT3A 1X15A 5ECWA 5AXCA 4ZZ2A 4ZREA 3A10A 2ZSBA 3RKRA 4D8UA 4G0NA 4AKEA 5E2BA 3WIVA 2HNAA 1PEAA 5A05A 1MT0A 2Q21A 4WZBE 1C2TA 2BDUA 3L8DA 5HQTA 2BE9A 4I14A 5AKGA 3ND7A 2IHBA 5KWIA 4NC9A 2QLBA 1HC7A 5ITVA 2D2VA 4HGPA 3OOSA 2PL1A 4KPUB 3ZNOA 1X3SA 1ZGJA 1NN0A 4GRAA 4AF8A 4DIFA 2GKSA 2H7XA 2JS7A 2WSYB 4X91A 2FQXA 3H42B 4ZVLA 3LYHA 4UPEA 4I50A 5A4IS 1IVNA 2A5DA 4OI2A 5EYPB 2NVUB 4CT0A 2PUCA 4GAEA 2OGZA 5IJAA 2WOJA 1K2WA 2YBEA 1Z8HA 3COYA 3H7AA 4MPJA 1C9KA 5D87A 2FUCA 3HJNA 1WS6A 2EFGA 4IG9A 4GOMD 2WFZA 2FZLA 3K1JA 4FCTA 4NOJA 4CCYB 5CT8A 1BGXT 2P1ZA 1GTZA 2R6GA 4K1XA 3Q8MA 1MD9A 2P7IA 1U6IA 3EXG2 4TGLA 2NYAA 2V7XA 3EPLA 4L4ZA 1ZCBA 1NUQA 3NJ4A 3OO0A 3EF0A 4BLPA 3FE2A 1DKPA 2JI7A 3ZE1B 1C0KA 4OFXA 4F8YA 1OR8A 4JXXA 2QLFA 4EQ6A 2ODQA 2RJOA 2BEWB 2VK4A 2GBGA 5GAJA 4CF4A 5KNCA 5KYKA 1P9NA 4E30A 2CLEB 4D6PA 1AO3A 1SB8A 4KWHA 1KMNA 1VE6A 1FLNA 3LL7A 3TSOA 3EPJA 3JSAA 3QOWA 4K28A 5I8ZA 1L7XA 1PR3A 1SCJA 1PYDA 5G4KB 3AV0B 3VM6A 3BULA 4CG0A 3PYLA 4EY3A 4M89A 2WTMA 3UWDA 1C9NA 3CS3A 2IV7A 3ZWYA 4U2CA 3VTZA 3ZX5A 2ECPA 2BVNA 2GMWA 3JR3A 3H8JA 1PBTA 4FSHA 4I6JA 3ZUPA 5KYGA 2O2DA 1SY7A 3RT9A 3W4KA 3EG9A 3AUSA 3ICPA 4Q1DA 4O6VA 4ZQHA 5FWYA 1LBEA 2BFEA 2Q5HA 3PITA 5ERXA 4U9HS 2V7UA 1ODTC 1KYIA 1GILA 2W11A 4QYXA 2RGDA 3H11B 3QVGA 5HK9A 1TJYA 3C39A 4OHRA 3QTTA 2YS6A 1MIOA 4HNAB 4QDTA 1PW5A 2WWGA 5HK8A 4HRVA 1WHSB 4G8CA 4F38A 4IRXA 3T1TA 4IV5A 4ODIA 2XKJE 2VHTA 3VPDA 3AJ8A 4IP0A 3WWYA 3MSCA 3GFRA 3WWCA 1ETHA 4B4DA 2NQ8A 4BO7A 1U9ZA 3H5NA 2DETA 3ZGXA 4WLFA 3QX7A 1ISFA 3JZMA 5HRUA 3FNIA 1N8SA 2OL4A 1CJVC 3VDXA 3A28A 3ZEIA 1P7WA 5H02A 3RE1A 4HXGA 3SZ3A 2WG1A 4HVCA 1EVQA 1ZVKA 3MWYW 3NGXA 1I14A 2IDJA 1SBYA 4B9EA 3DULA 2D5CA 3L3BA 3V00A 1M1YE 2HV9A 3VJMA 2BP7B 2P9QA 4GR9A 3KSAC 4RY8A 1MO3A 3VR3A 2ZYUX 4WKBA 3W6OA 1JNYA 4V0LA 1L7EA 3E9ZA 3I5XA 3RSZA 1VYTA 4PO3X 2GXAA 5TQ2A 1QWOA 1ZSYA 2ZU0C 2N1MA 3D4LA 4MS1A 5FBWB 3IAHA 4CIVA 3ID6C 2VRNA 3WHKA 3FYSA 1HNXB 4JP5A 1JFTA 2O19A 2JVJA 4MV6A 3KQYA 1C3LA 2ID9A 3CPSA 4IGEA 3ST7A 1XCMA 1OXXK 1XMIA 4X24A 1R9MA 4O08A 3RVLA 3EEBA 1Z07A 2HB6A 3R40A 1FQOA 3HBJA 5REQA 5KDOA 5DT2A 2I0FA 1F06A 1T0PA 3C4QA 1QTQA 3N87A 3IUYA 1LTQA 1MIOB 5IARA 3FPJA 2FW6A 1K6XA 1OZ0A 2FG5A 2JJ8A 3FM9A 1QB8A 2D7JA 2P6NA 1RRKA 3ND5A 3K9CA 3G1TA 3MIZA 1GHTA 2X1LA 4FEYA 4NV3A 4PLZA 1CY4A 3QWIA 2P68A 4RDCA 4J0GA 3F6PA 4EFNA 3BB4A 3F5FA 4Q6WA 2M32A 3UQZA 2UYHA 4AWXA 1CQPA 1IB6A 3EDMA 4D6YA 1QRSA 3D8RA 3H9BA 3BREA 1DXYA 1QGZA 1QIGA 3B2QA 3MCAA 4Q3LA 2CHVA 3FJOA 4DC1A 2CY0A 2RI1A 3KFLA 1TXGA 4DCJA 4MQLA 4DTIA 2YKGA 4QYIA 5KYVA 1T24A 2XUGA 1I0LA 1M76A 3KUDA 4DRYA 3R9XB 3QOFA 2O8FA 4BO5A 3GVHA 3U19A 1PNQA 2GN1A 2BGJA 3E7FA 3K1YA 3VOTA 1Z36A 4YAIA 3A3NA 2BEWA 3PCXA 4IO1A 3R41A 1K7FB 1V48A 4WXEA 1K27A 2UVPA 3V1KA 4HPXB 4DV1B 3QPVA 4XASA 3R8FA 3IKLA 1XL1A 3UHAA 1GIAA 1IAQA 2PZGA 1JU9A 1L5SA 1F14A 2VZLA 1TJPB 1HSOA 1PN3A 2ZBFA 4YAUA 3FVRA 1NVTA 1H0KA 2ISCA 3N0WA 3PC3A 1F5NA 1AVTA 1B41A 3DEYX 3QKSA 4ZDJA 4LA4A 4YAOA 1XLTA 3ZGYA 1O8CA 1EGAA 1DKMA 1QE0A 2X0RA 4YR9A 3FAKA 3OPQA 1O94D 5JJLA 3SWWA 3UGQA 3QVVA 1T2VA 1U81A 3E15A 3KJEA 4JT2A 4TM8A 2IUUA 4ACAA 1P9OA 4K6CA 3LHIA 3KTDA 4EBFA 5EZYB 1UFRA 1XDGA 4JNCA 1YDHA 2WF8A 4RL4A 3DMFA 2C2OA 1LSJA 5JRDS 2OBXA 5EPEA 5T3YA 2E1RA 5DNCA 3NGLA 1EDOA 1Q0SA 5P21A 2BZSA 2E1PA 3OQNA 1YZKA 2VVTA 3CSSA 1MPTA 1ESCA 1S3IA 2R1TA 2BISA 1NBME 2K4MA 4V1CA 1Z6ZA 1NW4A 1U9CA 1CEYA 4G0MA 1OBCA 1LY1A 3IUSA 4F5DA 2QTAA 3FNBA 1A9TA 3B3GA 3QY9A 3CUYA 3DL2A 1WXDA 5G0WA 2JIRA 2ZYWX 3ZGLA 1R4MB 1SIWA 3EXHC 3LAWA 4CDMA 2RGYA 3V8VA 4EVSA 1ZCJA 1PFQA 2PR2A 3K4PA 2X0EA 1UODA 4JC4A 3HRKA 4IPTA 2JDID 4D0GA 3G9TA 5A04A 2O7VA 4DA6A 5HOEA 2BLLA 2EBWA 3GROA 3ZDFA 4FVTA 5TB5A 2JCBA 1YR3A 2AQKA 1DINA 1PFWA 2JF0A 3A70A 2EVWX 4NHOA 1M8FA 4YK7A 5DHPA 5KC8A 1UEXC 3DLHA 3RTAA 1Y8QB 2PQ6A 4IDAA 3H0EA 1ZD4A 2G4CA 5FDFA 1SCIA 1GLVA 1ZESA 4ON9A 5FWDA 1VBKA 2NU7A 4UUMA 1ZK1A 5B6JA 3UMSA 2KQUA 4NENA 2EHJA 5F9MA 2XXBA 1KR2A 3HXTA 4YRCA 4OIMA 1EVJA 4GD3Q 3DB1A 3IQEA 4JA0A 2XDWA 1GXSB 2JATA 3CONA 3FKQA 3ETCA 2YWEA 1Z29A 2RGNC 4KOAA 4TKUB 1T6BY 5AK4A 3TR5A 3E2PA 4FHZA 4BNNA 4N7BA 4CLDA 1IJEA 3DWEX 1QYCA 4G56A 1Y63A 1A96A 1J2RA 1NYTA 3ISTA 4U4AA 2ECKA 3CT4A 5C5CA 4N49A 4PYIA 3VNSA 1YC2A 1U2DA 1ZKMA 5FL7D 3OE5A 1SUWA 3ZDXB 5GMOA 1G20B 1UIRA 5IVDA 4QG3A 3ESYA 1AQYA 1WXFA 2F17A 2Y0BA 3A0RB 3CC8A 3ORSA 1CCWA 3KALA 1TTPB 3P1JA 1GPBA 4DA8A 1IWOA 4E5PA 2O4CA 3U3DA 3UH1A 2J0SA 2FOXA 3R0VA 1PR5A 3EXIB 5EUQB 1G8FA 5HZMA 1YR8A 2EWMA 1KYYA 1WOMA 2XUFA 3DBHB 3HDTA 1RYBA 3JVIA 5CVTA 1CUVA 1NDUA 4M1EA 5AVOA 1H1DA 3OICA 1XEWX 4I4NA 4CM9A 3A11A 3KZVA 5DM70 3TR6A 4R2KA 3F5SA 2D2EA 4EHDA 2XB6A 4N65A 3Q3GE 7GPBA 1A2OA 3O8QB 3V55A 3X1MA 1DCKA 4J4BA 4EELA 1T3LA 2PHZA 5EIOA 1E0AA 3Q9NA 4FT2A 2F3UA 4NF2A 4PV7A 4RZQA 1E7WA 4UE2A 3DTVB 1VPVA 2RGGA 4PG7A 1OBOA 1NI5A 4LQCA 3QFFA 3OKFA 1KOLA 2I3DA 4QREA 3ZJ4A 4F92B 3QFRA 2FPRA 4BIMA 1QBGA 4BGUA 2QLMA 1BWPA 3EXEA 1IXSB 3KVNA 4KVAA 2JFXA 5CGZA 3ML1A 4QOJA 4LXHA 5EKDA 4N3AA 4KN8A 1IMJA 3ASZA 1BO6A 2XBLA 5DGXA 4ZAVA 3U62A 4GZLA 3UWPA 1Y6FA 3RVRA 1KHTA 3H2GA 3UANA 1Y5RA 3EXG1 4DLUA 3ZJ5A 3NHJA 3M6VA 1XDZA 3MTGA 4FYPA 4QTYA 1Z5PA 2VZ0A 2CF6A 4ZVMA 5CM9C 5F3WB 1RPJA 3TTXA 1W4CA 3NTQA 3KDPA 2W98A 3ROZA 3ZV5A 3EAFA 2ZRAA 1QJ4A 2ZBRA 2ZITA 3K9HA 1WSBA 1YMQA 2VDVE 3JQFA 4RK6A 1TVKB 5E4FA 4DR3B 1FYFA 2FUG1 1R6VA 2XT6A 5ALKA 3VZQA 3RSFA 1SXJA 5IBQA 4MWDA 2QJRA 5JZ9A 4HV4A 2AL7A 4JR0A 4ZVOA 5I9IA 1E96A 1IEQA 2PVSA 3BHJA 4L5IA 4NRDA 2V1UA 1LK7A 1JQKA 2I6QA 3M7IA 4NL4H 3N2GA 5SZIA 2GPAA 5JCOA 1XU9A 3P96A 4KODA 3BXEA 3FCAA 2C29D 3I09A 1ZVQA 2FYTA 3QPCA 4EVQA 4FNMA 1BXGB 1YNSA 1HL3A 1GL7A 1PF7E 2WYHA 4D0SA 4BQFA 3UWOA 2IP1A 4ZO9A 3VNUA 4ZYUA 1LH0A 3GH1A 3EEFA 3MAGA 1RLUA 3QXCA 1P39A 1TYZA 4FOTA 4JIGA 4M1ZA 5DHFA 3RG8A 1Z5VA 2P77A 2QYOA 2PUEA 3GA7A 5GGXA 1WB5A 4RJ2A 4YROA 1WXWA 1SHKA 4LMAA 4EYGA 5H82A 4DJAA 3E82A 5I5GA 1XMXA 4KGXA 3RASA 4MTLA 3U3XA 4PXYA 1DC5A 1RYYA 4DA7A 2GR9A 2QU7A 5BPHA 5BMOA 1UBOS 3KYBA 3X2FA 3ZYCA 1NRIA 5AUOB 4ENVA 2QRVB 1OAOA 5JQWA 1S0UA 1CJKC 1FXWF 2UDPA 1W9HA 1IM2A 1MJGM 2DX7A 2OZLB 4R51A 5L3QA 3F9CA 3NORA 3RADC 1JDPA 1Q3KA 1KJIA 1PEYA 3QYPA 3UOAB 1B4DA 1TJ5A 2PWYA 4DMMA 2O8CA 5FF9A 3HN6A 2GQ0A 3HPQA 5LUBA 1XXLA 5FUWA 1NUUA 2E18A 2GF2A 4MLPA 4TWBA 1EDDA 2W6JD 4IKOA 5LSAA 5AW7A 3DFKA 2WNIA 4WW0A 1OXTA 2OXRA 4XM2A 3IUNA 3NTVA 3AOEC 1NJ1A 3TL6A 2R8ZA 2Y67A 4MMXB 2NTJA 5IS2A 2PTGA 1YQXA 1K7YA 3CA8A 3VVMA 4EJSB 1C8VB 5I8WA 1ZD9A 3E9DA 4EHIA 4OKNA 2N0SA 5FXMA 3D31A 4NLLA 4WXRA 5LKAA 2NTEA 5LPNA 2E4WA 3EARA 1N6NA 1GPNA 5IT9A 2Q7OE 1QPZA 1OU0A 1ARZA 4BRSA 3IO5A 4PNPA 3OJXA 3PE6A 5LP6C 4QASA 2YASA 3PDHA 5L3SB 4F4JA 4RBNA 4JI6B 3E61A 1JKJA 1KA9H 5CDSA 3I2JA 3K6RA 3ZU6A 3VMFA 1V9CA 1NZDA 1IJKA 4BN5A 2BSQA 5HX7A 1G6HA 2I2CA 1M67A 1R15A 1TNDA 2R47A 3A6EA 3E53A 1Z9BA 4TMYA 2DH6A 2FFBA 4OO3A 2KHZA 2PT9A 4ZC1A 5IBRA 5BSHA 1ZXLA 2YNMD 2AMLA 4IOJA 5AESA 4C0SA 2X0JA 3WGVA 3AUTA 4RTOA 4S2EA 4UHHA 4FOLA 4DV6B 1O0BA 2I9KA 1SC9A 1VSTA 1GRQA 1ZGCA 3DZ8A 3ETDA 3H75A 4K6GA 4RGYA 4TTTS 5G1NA 3ZX4A 4BP3A 3CW2A 2YICA 3RS5A 4MB6A 4D74A 2Q07A 5CA1B 3NWOA 2BMWA 4DZTA 2YJ5A 5FI1B 1E63A 2G0NA 1MQ9A 3BAFA 1KJNA 2HMAA 2INGX 2LDBA 4RABA 1NVDA 2CXSA 2LRHA 1B42A 2NVBA 1X1EA 3KPJA 1HLGA 3B2EA 1WPQA 3MBOA 3OE7A 1QH8B 4JJGA 4WBNB 5J2UF 1JR3E 1RXVA 3F1LA 4ZYVA 2HPAA 1FLVA 1H1LB 2B34A 2B8WA 3MOGA 1O5IA 2DWUA 1WUIS 3DONA 1AKNA 1DC6A 1DT5A 4H7HA 5GVRA 3CKLA 1TMYA 2X4GA 3LECA 4RE5A 4S1VA 4JP2A 1RKVA 1XIVA 3CWZA 3WLIA 1UKAA 2C94A 3D3JA 4LJSA 4ZGWA 1AKTA 2EQBA 3ICVA 1W5FA 4PC2A 2ZREA 3DZFA 5L3QB 4FXOA 4WV3A 3VU9B 1X0VA 4RELA 1N5IA 2B98A 4N3NA 3VYWA 3AX6A 1XZKA 2FX3A 1MX1A 1V2HE 1XRSB 2R4TA 3ILYA 1Z47A 1Y34E 3BE4A 3P52A 3DNFA 3QBJA 3EHDA 3FRIA 3N8IA 4JEIA 1I2MA 2TMDA 4FT4A 3CRNA 3IOEA 4QEDA 4QRHA 4WOJA 1WSAA 3ZUGA 3G9ZA 3G85A 4ANFA 1XVTA 4NMMA 3BXGA 4N12A 3LIIA 2VHZA 3D3NA 3ZJYA 4Y6PA 4F45A 3PICA 1PLLA 2H9YA 4DPLA 1X9GA 4KXLA 3TAHA 3DBRA 1NJSA 4YCBA 3H9JA 1ADGA 2D5BA 4GI5A 2QL9A 4RH0A 2Z8ZA 2C4NA 2E21A 1RRMA 2LBPA 1ZU4A 3KELA 4Y2SA 4O0MA 4Y2TA 2W7TA 1J8QA 5KEIA 1SXJE 1UK8A 3ENNA 3HUTA 4GOOD 1LEHA 4LW8A 3G1WA 1NPTO 1ZIXA 3R5SA 2JEOA 2F3SA 3OUUA 4AKHA 4UREA 1SUFA 5F5LA 3KQUA 1NBWB 4QRIA 4UOEA 4CIBA 2VTDA 4X20A 3KR0A 1ML3A 1P1FA 1EJ2A 1TFRA 4DWVA 4DDWA 5A7FA 1N0IA 4ND2A 3V4VB 5I7HA 2FU5C 5HCNA 3TL3A 3G79A 5BV0A 5EE5B 1DG9A 2OILA 2AI2A 3H13A 3VISA 4TTRA 1ZD8A 3DE4X 3K9WA 3I8XA 4IFIA 4XIFA 3X2SA 1ODJA 1L4FA 4D98A 2ST1A 4F1JA 3DHYA 4ICIA 4J0FA 1ZVJA 3NTOA 3W2HA 4CIWA 4HS4A 5G0VA 1LB1B 1NRXA 3OZGA 3RS2A 5CA0B 2AMYA 1D0IA 1ZHFA 1LA2A 3K9LA 2W4IA 3HKBA 3P27A 4FM9A 2X8AA 2IQIA 4AXBA 4NZPA 1VMEA 1BDIA 3QE4A 4YCNA 1P4JA 5K4HA 4LXIA 1ENZA 2FK8A 4G84A 1SVIA 1GNPA 2FPWA 3KEQA 4IYRA 1DMSA 5FKJA 4QBIA 2PKRA 3S44A 5L40A 5I3CA 1XR3A 3PYMA 4AICA 1FSGA 4Q3EA 4INOA 2DFKB 2NZ8A 5C3MA 4YIHA 4X7BA 2PQ0A 2XKKA 3GUHA 3KKEA 1T15A 4TV8F 3D6AA 1G4HA 1GO2A 5HQ3B 4LOLA 4KNWA 4Z53A 4GQAA 1PV1A 2NU8B 5BWMA 3JALA 4E5YA 1T13A 1ZK3A 1VCNA 5EVJA 2J6BA 2ENUA 3F3SA 3IBSA 2DSTA 2QB5A 3TRDA 2QT9A 3OM1A 5REQB 4KR3A 5FLYA 3NIWA 4B1FA 4V2IA 1MABA 3DHVA 5EJ4A 2IS2A 1P1IA 3HCDA 1G8SA 3I01A 2JFQA 5TQ2B 3TI9A 3UATA 1QP4A 3N07A 4BAUA 1JBKA 3AKEA 2IHUA 4MCHA 1XTVA 5JTTA 3EZ6A 3FTCA 1DEHA 3CLTC 3QSGA 7MHTA 2QGZA 1M66A 3NT4A 1QCCA 1S5PA 1DQYA 1TJNA 3GOQA 3O91A 2DSNA 3L7OA 1RC8A 1QR2A 4L8VA 1ZK2A 4EYEA 1ULZA 3R20A 2A9VA 4NZYA 2Z5LA 3WL7A 4JC8A 2CNOA 2C7QA 3QBEA 3VDQA 1TF5A 4ZMRA 2VJPA 3JASB 4EGSA 1HH4A 1ORVA 4X65B 3PFFA 3RKUA 1QRTA 3HWRA 2IS4A 2WHXA 3DZCA 1E61A 4JWKA 1VCMA 4NQRA 4AN4A 1KIFA 2RI0A 3URMA 3QVWA 4MGKR 1X9HA 2Q4BA 5DN6D 1J1IA 2ZDGA 1CFJA 3WKBA 3HXLA 4KTTE 1TECE 2PVPA 1U1FA 2MMGA 4FZJA 4IJWA 1NOJA 4IDEA 4XB2A 3GLRA 4NFYA 1B74A 3OWXA 3DD5A 4RZSA 3PR3A 4PLCA 3VHXA 5KB3A 1YZYA 5JNUA 3JPYA 1XYGA 4MKGA 7MDHA 1SQ0A 1DNPA 2G1UA 3LT5A 1GCIA 2ZWOA 2ZBVA 3R7LA 1RYNA 3GLTA 4N47A 1DQPA 2HSDA 2EIHA 3PDUA 4U9IS 2GYVA 2VSQA 3E9YA 1BD3A 2ON6A 4UNPA 3C2QA 2GILA 1SIOA 1EXWA 3AEKA 2Q6TA 1Z0KA 1KJ8A 2R751 2HC9A 3FRJA 2YWBA 4MVYA 4ZT2A 1ZGBA 4BU0A 1EEHA 5E7JA 1ZZGA 4OK3A 4BX0A 2C00A 1C4KA 2NADA 3LNCA 4DA4A 4G5FA 2J5KA 2Y68A 2LE0A 3FGZA 3FPLA 2WZQA 4RTMA 5JS8A 1B26A 3DXXA 3VYVA 2Q8PA 3AEZA 1T10A 1P2VA 2ZJOA 3RUFA 3NB0A 3PF8A 4Q7JB 1OJLA 3FCEA 5CHEA 4PS0A 2CSUA 2ZBGA 3PR2B 4IX9A 3MCUA 4EX7A 4F71A 1H2YA 4L6CA 5FTJA 3ZI0A 1U3TA 4UQOA 4JYAB 4E12A 5J1SB 3TOSA 1VG8A 2R1TB 3TXXA 1QQBA 5A03A 1NLZA 4NAHA 2AK2A 2OBLA 3NQ41 4GI2A 3TKLA 2ZUSA 5E0KB 5ALFA 3KQKA 1HEUA 4P4SA 4YJ3F 1IM8A 1PD0A 2RAVA 1TQ2A 4MR9A 2ZP1A 1ZNQO 3GI1A 1CWUA 2WU1A 1R4MA 3X3HA 5K0ZA 5HDQA 4ENUA 5IAAA 1K7CA 2E9SA 2VUSA 3BHNA 3MB5A 3QX8A 3AW8A 3GVXA 4CTNA 3GNQA 1ZAYA 3EC1A 1XNQB 2HXGA 2XRYA 2J4FA 2EP5A 4I8IA 4UHDA 2KE5A 5TR9A 5EIEA 5BUSA 3ENQA 1S2LA 1FFXA 2J3KA 2JH8A 3E22B 3HKEA 3W7BA 4PFQA 4EGFA 1QP0A 5JYDA 1KEKA 1I1HA 1VBMA 2HLDD