3HJUA

Crystal structure of human monoglyceride lipase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
291
structure length
291
Chain Sequence
PRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monoglyceride lipase
publication title Crystal Structure of the Human Monoacylglycerol Lipase, a Key Actor in Endocannabinoid Signaling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 103
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hjuA00
1JU4A 4ITVA 2PUHA 3MUNA 4H0CA 1R4ZA 2Z5GA 5CMLA 1EXWA 5HQ3A 4QWMA 3RKSA 3WLAA 3M83A 3A2LA 3W2TA 4NVRA 1XRQA 1VKHA 3GZJA 1VLQA 2XUJA 5CW2A 3C6ZA 1JKMA 2JGFA 4E11A 4HS9A 4OYLA 2WM2A 4JH0A 4WFJA 3DD5A 1ETHA 2XDWA 4ARBA 2WILA 3MVEA 4BTVA 2BUCA 3IIIA 4C01A 1XQWA 3U1TA 1ZJ4A 1X70A 3A6ZA 2O7VA 2XMBA 4GXNA 3UUEA 1FFEA 3G7NA 4NMWA 4UBNA 2WG1A 4UHHA 5AI0A 1SOMA 1WB6A 3WK4A 3NUZA 3FCYA 3FAKA 5HKAA 2RI6A 3R3YA 5CH8A 1E66A 2AJBA 5ALGA 3PFCA 1TIBA 3KOOA 3G8YA 1DX6A 1W75A 5KWIA 1CV2A 1OILA 2E3JA 3TJMA 3TEJA 3ZLTA 1MNQA 3BF8A 4HTAA 4DLNA 3C6YA 1J06A 3VVMA 3RARA 3LIPA 1N5RA 4AZ0A 1YB6A 2XUAA 3FSGA 1TAHA 4BTLA 3BJRA 4DSZA 3LS2A 4MYSA 2G5TA 4G9EA 5J3JA 3F9CA 2PM8A 1P0QA 2K2QB 3E1GA 5JZSA 3HSSA 4G4GA 1THTA 4DNFA 4AQDA 4DSAA 4AN0A 3HACA 4MJ3A 4ZREA 3O4HA 3B12A 3W04A 4UBOA 3D0KA 3WWDA 2BFNA 2O2HA 3OOSA 3A70A 1TCAA 4B0PA 2WIGA 4B82A 2OXEA 1PJAA 4O08A 3FNBA 2YXPX 4UBIA 2WUFA 4EY5A 4GEGA 3ILSA 1BRTA 1E8NA 4X94A 2OGSA 2XUIA 3R3WA 1XZHA 2WUDA 4QDOA 2VTVA 2Y2VA 3H04A 3JW8A 1ODCA 2ZYRA 2HFKA 1JMYA 3GBSA 3R41A 3F96A 4U2BA 5IVDA 3IB3A 5ALJA 1QO9A 5EGNA 2O2GA 2OPHA 3D7RA 2QJRA 5AI5A 4BP9A 5AK5A 1YA4A 5HZGA 3DCNA 2Z3ZA 5LZ9A 3V1KA 5T4EA 1MU0A 4QEKA 3JWEA 5JAUA 4KE8A 4KYVA 4IH1A 1G4HA 1XRNA 3LP5A 3HYSA 2I3DA 3G9ZA 3H2JA 4G9GA 2AJLI 3U0VA 3BL8A 4Y2PA 3WQHA 3EBLA 1UKCA 4OUKX 4FHZA 2P8SA 4HXEB 3SC2A 5E4YA 1QIJA 1HL7A 2PUJA 2B9VA 4ZGBA 4CI9A 1CUXA 3I6ZA 4G8DA 4Y2TA 3G0DA 1H2WA 3WK5A 1VXOA 1JMKC 4EZIA 2OGTA 4RGYA 5CRIA 1FFAA 1CUWA 4C4ZA 3WL7A 3C87A 2JGMA 2HA2A 5ALXA 1CFJA 2AJCA 2XUPA 5AK3A 1Y37A 4UFPA 2HHAA 5FOQA 2VF2A 2G4LA 4Y2UA 4OYYA 4KE6A 5IH7A 2VAXA 1IUOA 2ZYSA 5FRDA 4IHAA 5BV7A 4JYMA 4I4CA 4AZ3A 2D5LA 4HVTA 1YAJA 3C70A 2HA3A 1SCKA 3V9AA 2VAVA 4B6GA 4CG2A 4EUSA 4X3CA 3LIIA 1BROA 2YASA 1G66A 4GWLA 3WZMA 3WYDA 5FDFA 3DOIA 2DQYA 1JFRA 5HF5A 4QLOA 3K2IA 2WFZA 1ZD4A 1XROA 1QGED 5ALIA 1LBSA 1ODTC 3WWEA 2JGKA 1NU8A 1UK8A 4C89A 5H3HA 2PSDA 4Y2YA 1CUZA 1MNAA 4G4JA 4CCWA 4CFSA 1QIEA 3ZV7A 1ZICA 5LZ2A 2WLSA 3WKDA 2WIDA 3BIXA 1XQVA 3HI4A 3TGLA 4A5SA 2ZVDA 4LXHA 2WU4A 1XKLA 5JANA 3X3HA 2XMRA 1ZGBA 4J0DA 3W9BA 1LZKA 4B85A 2O2IA 3WMRA 3QH4A 1K4YA 2B4KA 4MWTA 4BCBA 1R9MA 3I1YA 4LHEA 2GBCA 5EIEA 1N5MA 3BDIA 3IULA 4GBGA 1FFBA 1Q0RA 3O0DA 1BN7A 1Z68A 2ACKA 1BU8A 1WHSA 3JYHA 4GDMA 4N5HX 1DQYA 2GBIA 5AICA 2H7XA 5CT8A 4H7DA 4TVKA 4J0CA 4QE3A 2ES4A 4A16A 3KD2A 2HFJA 4XJVA 1QZ3A 4WCVA 1LNSA 3TRDA 3C6BA 5JASA 3DOHA 5ALSA 4CG1A 3C5WP 2DFPA 3CCCA 5KWJA 2AXEA 5K5EA 4BYMA 4MQMA 2QZPA 2I03A 3V1NA 1WHTA 5C8ZA 4B7ZA 4ETWA 1EDDA 1EK2A 1WOMA 4FFWA 1H2XA 2ONCA 2X5XA 3WK9A 4L3WA 1QTIA 4P93A 1VA4A 4ZWNA 3VXKA 1YB7A 2XUGA 1EH5A 1DWOA 3OC0A 1JI3A 4V2IA 1PV1A 4G1FA 2RIPA 2XUQA 4Y2SA 2C7BA 3EF3A 1EB9A 4LXGA 1WCYA 1TKRA 5AJHA 4X71A 5ESRA 4BATA 2PSFA 3FBWA 3E0XA 3FSGD 5AK4A 1AC5A 2QM0A 2JEYA 4H77A 2CKMA 4B84A 4K6HA 2V9ZA 1DWPA 1VA5A 5AOBA 1CUDA 4KR0A 1W1IA 1UOPA 1O6FA 5AKLA 3A2NA 2QUBA 3G9XA 5JADA 1A8SA 2Z8ZA 1CUBA 1K63A 4UBJA 2J4CA 4HXFB 2DHDA 2XMCA 2WJ6A 5JD6A 3DQZA 1ACJA 4OD0A 3AUKA 4K5QA 4Q3OA 4H7FA 1BN6A 3ICVA 4B81A 3O4GA 1CUJA 4DM7A 5ALFA 3HJUA 3FVRA 4X97A 5SYNA 4TGLA 1U8EA 4QDZA 1UKAA 1GPKA 1CUFA 5E2IA 1T2NA 5DTIA 4M0FA 2WFMA 3F98A 3IUQA 2WKWA 1P0MA 3L1JA 1IUPA 2WJ4A 1CIJA 5ALNA 3L1HA 1NX9A 1JJFA 4GHWA 4OPMA 3HLKA 3UUFA 2EEPA 1IUNA 3FCXA 1ZJ5A 5LIPA 1YCDA 4LXIA 5ALKA 3ZLVA 3W05A 5ALLA 1H2YA 3F97A 5A6VA 5FP0A 3FYTA 3OG9A 5C81A 1EI9A 4H7EA 5AM2A 1F0NA 4E15A 2UZ0A 1ACLA 3OPMA 3B3QA 4N8DA 5D3ZA 3NOXA 2EDAA 4KAJA 5D7BA 1LZLA 1LPOA 3OURA 5CURA 4CIAA 1WB5A 1XZMA 3KXPA 1JJBA 1RWQA 3G02A 1IZ7A 5YASA 4AB1A 2G5PA 1E3QA 1KEZA 3FYUB 1DT3A 1GZ7A 3H2HA 3M82A 2PU5A 1LPNA 3N0TA 3CXUA 5A2GA 1E89A 5T4BA 4KRYA 4WFIA 4C87A 1O6GA 1MX5A 5I7UA 5EHNA 1MAHA 5CT6A 4Y9SA 2VJCA 3O4JA 2AJDA 2XMDA 1XQYA 5AO9A 4JNCA 4FNMA 2WU3A 3C5VA 3PF9A 5AP9A 4DTCA 2BAGA 1CPYA 1I6WA 5K3DA 2OLEA 4FKBA 3G9TA 4IO0A 3Q0TA 5T4HA 4GI1A 3R40A 5KBYA 1CEXA 2HRQA 2OQVA 5I9IA 1P0IA 3AZOA 3QMVA 3DEAA 3EIOA 3P2MA 1FFCA 4AO7A 3I6MA 3DLTA 5LP1A 1EA5A 2ZYIA 1XLWA 4FOLA 1TCBA 5K3AA 2XQKA 3FLBA 4B0OA 5HF8A 3FOBA 3WIOA 4JEIA 2I78A 3H2GA 4FWBA 3T4UA 4X6UA 5CXUA 1XZEA 2WFLA 4HRXA 3ESBA 2WIKA 1K8QA 1CRLA 1VE7A 3STWA 1TCCA 2QXUA 2WG2A 4H7KA 5AM1A 3QMWA 2ECFA 2QR5A 5FPPA 2PSJA 5JALA 4PF1A 4AO6A 1E5TA 3H1AA 3H2IA 4KRXA 3AIOA 1EX9A 1ZIXA 2QTBA 4A23A 1YR2A 3WZLA 5DLPA 2VJBA 4U2EA 2XI4A 4Q3KA 4KJXA 1VXRA 1FSSA 1EVQA 5CT5A 1XZIA 1AZWA 2J4FA 4J0KA 2IIVA 1ZD3A 4M0MA 3HXKA 4DMKA 3VVLA 5CBKA 3H18A 4P92A 2V98A 3C8HA 1ZI9A 3R3VA 4B9AA 4BB0A 4HAIA 3EQ7A 1JT2A 4W1QA 5AOAA 1LPBB 3WK8A 4K6GA 5HQ3B 3GFFA 3ICWA 4Y2JA 1ZOIA 5FXMA 1XKTA 4WY5A 2PSEA 1MN6A 2WQZA 2OAGA 5E4TA 3I2GA 2ACEA 1L7AA 2OCIA 2W6CX 3STVA 2ZSIA 5ISMA 5IVIA 1CUYA 1XZLA 3ESDA 1VE6A 3W06A 1R50A 4FNGA 2VT7A 3UMJA 5JZBA 1PFQA 1NU6A 2XB6A 3T52A 4YASA 1H22A 2LIPA 1TRHA 4XWGA 1FJ2A 1LPMA 4NS4A 5DNWA 1EK1A 1MAAA 3R3ZA 3OM8A 3PI6A 2XQIA 1E8MA 5BWBA 2JBWA 2WUEA 1TQHA 1XZDA 1XZAA 4DGQA 1VJ5A 1X2BA 4IH9A 2DCMA 2HA7A 4BC1A 5HFAA 1DX4A 1AGYA 3DL4A 2J3QA 3ZI7A 1T4MA 1ORWA 3D2CA 2OQIA 1A7UA 4X90A 4KEAA 4I19A 5C8XA 3RK4A 4X95A 1QFMA 3IVMA 1BE0A 2IITA 1DINA 4W9RA 2PPLA 3WYNA 5AOCA 3SK0A 3WA7A 2HA5A 1RP1A 4WDQA 1KU6A 2C0QA 2WIFA 1X2EA 3VJKA 4C88A 3QVMA 4PW0A 1AQLA 1GQRA 2V97A 2PBLA 4OB6A 2NW6A 4FDMA 2VQ6A 2XMGA 5AKEA 2VA9A 2X8BA 3H0CA 3STUA 4ARAA 4Y2XA 3IDAA 1MO2A 3WWPA 4BZZA 3G9UA 3KWJA 1XRPA 4DNQA 5HF9A 1L7RA 5CXXA 2CB9A 5AKGA 3PFBA 3WK7A 5DNUA 3IUJA 2PKYX 3BJMA 2QUAA 4BRSA 3PF8A 3ANSA 2H9YA 1G5FA 5K3BA 5LKRA 4X93A 3IBTA 4CCYB 1Q84A 1WB4A 1YS1X 4M0EA 4G5XA 5HFNA 5SYMA 2R11A 2JF0A 4YK7A 3IA2A 1EVEA 3QYJA 1CUGA 4EB0A 3QM1A 2QS9A 5AKJA 1S8OA 2XUHA 1ZGCA 3STXA 2ZJFA 4N8SA 3GUUA 3D2BA 2RHWA 2D0DA 3RLIA 2W22A 2WUGA 1JU3A 3VJLA 4G4IA 3WJ2A 2XT0A 1F8UA 2RONA 5IVHA 4J3JA 3DJYA 5A7GA 4PV7A 3QZUA 4BZWA 4P08A 3VDXA 4ZV9A 1JJIA 2ZSHA 2JGEA 1QFSA 3G0GA 2IX9A 2WHPA 1Y7HA 4X7BA 3MGAA 2B20A 3G0CA 4RE6A 4BAGA 3O9VA 2CBGA 1QIMA 3FYUA 3VKFA 2ZYHA 2WHQA 4BCDA 2GYUA 1CQZA 3A2MA 4DMCA 3AIMA 2GBGA 4W63A 4HRYA 1GKLA 2HA4A 4DNPA 2RAUA 3F67A 4BVKA 4OU5A 2Y1KA 3WA6A 2HU5A 3PDCA 4INZA 3WKBA 4X6YA 4U2CA 1W76A 4QZVA 1XRMA 3DL7A 3WWOA 2QRUA 3SWWA 4CG3A 3FYUC 3CN9A 2J3DA 3SX4A 1DU4A 5LYYA 2VSQA 4B9EA 3GELA 3E3AA 2CUTA 4QDXA 1QIKA 2BJHA 3BIWA 4KACA 5AI6A 1BCSA 2PX6A 2VJDA 4U2FA 3FLEA 4PO3X 4BBZA 4PSCA 4JYPA 1H2ZA 3AZQA 1A8UA 4DMHA 4EY6A 4X91A 4OSEA 3QBJA 1MJ5A 4EA6A 1ISPA 1QO7A 2HDWA 1R9NA 4F60A 2WSLA 1IZ8A 2HU7A 3M81A 5ALHA 5HKBA 3S8YA 2Y2UA 1DTEA 5AHXA 1AX9A 3QPAA 5AI4A 5HK8A 5K3CA 5HCUA 3IURA 4TPKA 1MPXA 4UBKA 5JATA 3L1IA 2DHEA 4HZGA 1XZBA 5AM5A 1ZI6A 2WIJA 1HLGA 2BCEA 1QIHA 2C5FA 7YASA 3QMMA 2WJ3A 1XRLA 4BVJA 2C4HA 5EIAA 4Y2QA 2AJ8A 1QIDA 5FKJA 2C0PA 2FX5A 5ALWA 3WKAA 2QJWA 5AM3A 1QTRA 1Y7IA 5HF6A 3BDVA 4J0HA 3I2IA 5C8VA 5JZ9A 1YAHA 2CEKA 4WFKA 3DYVA 4AX4A 5ALUA 4EHBA 1GQSA 3EQ8A 1CVLA 4BE4A 1B41A 3BWXA 3ESAA 3O9MA 2RHTA 1SCIA 5JD4A 3I2HA 5CTAA 1BEEA 4FFVA 4C4YA 4BC0A 3FWHA 2VEOA 1K6EA 1WPRA 3OTQA 2HADA 4L9AA 3PICA 4DYHA 3V1MA 4BDTA 3FLAA 2OAEA 2OCGA 5EHXA 1DQZA 4BP8A 2H7YA 2WHRA 2XUKA 5K3FB 4XVCA 4Y2VA 5LZ4A 1BEZA 1CUAA 1H23A 1SCQA 4S0XA 5EI5A 4F0JA 1DWQA 3HABA 4KE9A 1UFOA 4H18A 5KREA 1GGVA 1UZAA 4Q82A 5CT4A 5EHQA 2JIDA 1XRRA 5T4FA 4D9JA 3PE6A 3R3XA 2DQZA 1R88A 2GBFA 4LYDA 1G42A 5A7HA 2XUDA 3H1BA 1GXSA 4ZV7A 2Z8XA 1RYYA 5ALOA 3QITA 4H7HA 4GLBA 4UBMA 4L0CA 1XQXA 5JAOA 4UHBA 2JEZA 2XQFA 3ESCA 3ANTA 3I2KA 3I28A 4U2DA 1OCEA 4MWSA 3AJAA 2WG0A 5ALEA 2QXTA 3WL8A 4U2GA 4H7JA 4PSUA 3ZPXA 1LBTA 4B80A 1U4NA 1SC9A 1XLUA 4OU4A 3E4DA 1Q0ZA 4ROTA 3IUMA 5HK9A 4Q3LA 1J07A 3BXPA 4BE9A 2XMZA 4Q1VA 3WIBA 1QIGA 4K6KA 3N2ZB 3H19A 2V96A 3DKKA 1R3DA 3D3NA 4K2AA 5CT9A 3AFIA 5D3KA 5IVKA 4C4XA 5LKAA 2HM7A 4ZI5A 2HL6A 2OCLA 5JIBA 1HPLA 4EY8A 2ZJ7A 1USWA 4WDRA 4AO8A 2G63A 1UT6A 4FBMA 3WWCA 1ODSA 5CH5A 3ZLUA 4YPVA 4N5IX 5FUMA 1QIFA 4KAFA 4Y2RA 2GYVA 4FLEA 4X00A 3Q8WA 1LPPA 5K3EA 3R0VA 3DYIA 4PNZA 5DYTA 2ZJ6A 5FV4A 1ORVA 2FUKA 3DDUA 4J0GA 3RM3A 3CCBA 2JGJA 4PQEA 2QVBA 1XZFA 5C7YA 1HBJA 1E8DA 1HDEA 5AIBA 3B5EA 2XQJA 3HC7A 5LLSA 3S2ZA 4WJLA 2CZQA 1CQWA 1EDBA 4W1PA 4CCYA 3ED1A 1B6GA 4GECA 1DT5A 3NWOA 3PUHA 5AIAA 1EHYA 4AMZA 4ZRDA 3AIKA 3D4LA 5ALTA 4UHEA 2QT9A 4PSDA 4EY4A 2HIHA 3IUNA 4EY7A 5ALRA 1UK9A 3C6XA 5AM4A 4B83A 4QWWA 1GPNA 1QOZA 1MTZA 4OCZA 3KWFA 3ZWQA 1QLWA 3D5EA 3VISA 2PL5A 4X6XA 3WL5A 1J2EA 4OB8A 4Y7DA 5DYYA 4AXBA 4E14A 1TK3A 2YH2A 3WKCA 3O95A 3H17A 1QJ4A 1W52X 3LCRA 1UKBA 4FBLA 4BVLA 2EDCA 2WTMA 2XLBA 4RNCA 3MUOA 3YASA 3FVTA 2YYSA 5AH0A 1KU0A 2VT6A 4DMFA 1THGA 1WPXA 4KE7A 5DJ5A 4HXGA 4JUIA 3HEAA 2Q0XA 3KSRA 1MX9A 1M33A 3C43A 3I6YA 1XZGA 5LZ7A 2H7CA 1LLFA 2WFLB 4OB7A 3F8SA 5A71A 4F5ZA 3BE8A 3M3DA 3CN7A 4QA9A 4W1SA 5AKHA 5DNVA 1HKHA 4UHFA 3I2JA 5JYCA 2XUOA 2CMFA 2XE4A 4AMYA 2DR0A 4Q05A 2PVSA 5ALVA 4J7AA 2ORYA 5AKYA 2OCKA 4Q34A 2C5GA 2H1IA 2XMQA 3AZPA 4X92A 1AMNA 5JARA 3PUIA 3R3UA 4DIUA 2XQGA 4N8EA 2FJPA 4YX9A 4GW3A 2BUAA 2GZSA 5JAHA 1C4XA 2VATA 3WJ1A 4X85A 4J0JA 2XLCA 4RE5A 2WTNA 1CUUA 4EBBA 5ALPA 3V1LA 3DS8A 1AUOA 2QMQA 4J0IA 2DHCA 2XMSA 1R1DA 1UOQA 1EB8A 5BOVA 2HA6A 1QONA 2QOEA 4MXDA 2QKYA 2RGUA 2BKLA 1YS2X 3HRHA 1EINA 1A8QA 5ALQA 1LPAB 1GT6A 5AK6A 1UK6A 4UFOA 2OGZA 4QNNA 5EHZA 1Q83A 5JD5A 5DTJA 1EDEA 2FJ0A 2GZRA 3DKRA 1W4LA 3C45A 1C7JA 5EFZA 5I8PA 1BS9A 3O4IA 1CUIA 5ALYA 5FLKA 1AKNA 1GKKA 2BGRA 4G8BA 2DSNA 1UXOA 5ALDA 2PU7A 1UK7A 4H7IA 4QDUA 4MQLA 5LZ5A 1FFDA 3AILA 5A62A 4UHCA 1ZD5A 4IQ4A 4G8CA 4BAUA 4QLAA 4ZXFA 4C6HA 1N1MA 1XZJA 1C7IA 3STYA 5CH3A 3QPCA 1CLEA 4P9NA 4XIIA 3W9UA 6YASA 2CJPA 1LGYA 1CR6A 4UHDA 1VOTA 4FMPA 1U2EA 5AM0A 2OG1A 2B61A 5DWDA 1MT3A 1F0PA 2Z3WA 1D07A 1XZKA 1A88A 4NZZA 4BDSA 1YASA 1YSCA 2HU8A 3WKEA 1CUCA 3BF7A 4FTWA 1GPLA 1L7QA 2PSHA 1IVYA 3DNMA 2C58A 5K3FA 4F21A 4E46A 4LIPD 1VZ2A 1BCRA 4UBLA 5EIHA 1XLVA 3QPDA 5F4ZA 1OXMA 1P0PA 4WY8A 4AN1A 3G0IA 3I1IA 5AI9A 1SFRA 1ZD2P 5E4JA 4L72A 3C8DA 1K5PA 2JGIA 4FLFA 4FLMA 3STTA 4CIBA 1QIIA 1J1IA 4IH4A 4MEAA 2I3ZA 5DYWA 1UWCA 4LYEA 4H35A 2JGLA 3D2AA 2VJAA 3EQ9A 5A7FA 5FPQA 3I2FA 5BWCA 1AURA 3G0BA 5AKZA 1IMJA 3H2KA 2XUFA 5LZ8A 1CUHA 3WL6A 2HRRA 4BRZA 1YA8A 5AKKA 3V48A 2O7RA 5AKXA 4BAZA 4UPDA 4UFNA 1W6RA 5D6OA 4XX1A 4MYDA 4DNOA 1XFDA 3GA7A 2R8BA 1MX1A 2ROQA 5AI8A 1N8SA 4QDTA 1U65A 1CUEA 1ZI8A 3K9BA 4W1RA 5JAPA 3WK6A 4J03A 3KDAA 2Y6VA 3AINA 1CUSA 1ZIYA 4LKOA 1XZCA 2BGNA 1CUVA 3GROA 5ALZA 1HQDA 1VZ3A 4I3FA 4MEBA 1LPSA 2HA0A 2BUBA 2GYWA 5IKXA 4BCCA 1WM1A 3HZOA 3LLCA 4UUQA 2X76A 3D59A 4Z49A 1F6WA 1QE3A 4RPCA 3K6KA 2Y6UA 2WHPB 5AKIA 4KAAA 5ALMA 3WI7A 3VJMA 1UOOA 3NGMA
chains in the Genus database with same CATH superfamily
2JFVA 1JU4A 3F6EX 3O90A 4KO3S 1C2TA 2Z8YA 3MUNA 1RLOA 3WGZA 4BP3A 5B2EA 1ZVKA 1TKAA 1R4ZA 4LVNA 3WFJA 1XMQB 1EXWA 3PHGA 3KL4A 1BS2A 4G1BA 1PJTA 1YA6A 3JQPA 1PNOA 4QWMA 3RKSA 2XYPA 2BLLA 3M83A 4DB4A 1M1NB 2OENG 4TS3A 2C77A 5DTQA 1YIDA 4ZQFA 3PDJA 5GWXA 3W2TA 3B8EA 3UK2A 4J4BA 1K6MA 4MTLA 4RQAA 3ZK7A 4ARZB 3RAJA 1E3MA 2FGKA 3I05A 4TYQA 1E1DA 3BCHA 2CL5A 2QN2A 3Q9NA 3DBHB 2G07A 1VC2A 3S8MA 2O8DB 3LZ6A 4KUGA 2PUEA 3DZKA 4CLOA 2NYRA 4A92A 2VKTA 3CLSD 3DF7A 3QEAZ 1UINA 3C6ZA 3S27A 3U60B 4HFNA 2XOXA 2O0JA 3JVVA 4CKXA 2OXRA 4QO8A 1JKMA 1KI9A 4HS9A 4X24A 2GO1A 1F8FA 2YZMA 4FB5A 3W5CA 4IRXA 3V1UA 4D81A 3V7YA 5GY7A 5GV7A 1A5SB 3QA3E 5T7BA 1BFKA 2A5FA 4XFKA 4NEGA 2BMAA 4GC9A 3KG2A 3V7WA 1VL6A 1WEHA 5T5QA 3ZU6A 2ZUUA 1SVWA 3PRJA 2Z5FA 3IIIA 2ZTMA 1OZFA 1U9JA 5FUWA 4C01A 1XQWA 3GT7A 2HNBA 1ZJ4A 3FFAA 4O4IB 1C0IA 3GL9A 4A7PA 3A6ZA 3DDNA 5B6IA 4RPIA 5CBPB 1OIXA 4WOBA 1C7EA 4WE3A 2HBRA 4R8LA 1AQNA 3A04A 3H5AA 3ISTA 3ZE8A 4AMBA 3PHHA 3AHFA 4RKYA 1OI3A 4YV7A 3EPKA 2VP5A 4NMWA 3C5CA 4QAQA 1L7EA 3U49A 4NG4A 4E5DA 1US8A 4UHHA 5AI0A 2VJMA 4RD3A 2GETA 1YI0A 3EZXA 4YJ3B 3WK4A 5JXIA 3AM1A 2IPNA 4RZUA 1PZGA 4OLJA 4IHKA 4A9AA 3CA8A 1GPAA 1EIZA 4BO7A 2Q1UA 3SEFA 4LDNA 1XEWX 2IU3A 3AR3A 3LKVA 5HKAA 3GLFB 1E66A 1P1CA 5BV8A 4L28A 2D0OB 5G0SA 1JLHA 3H11A 4LMBA 1TIBA 3K70B 3GFRA 5PNTA 1P80A 3L5OA 4ACAA 2P6PA 4BNWA 3U5TA 1XHFA 3I12A 4PLCA 1ARZA 2PS1A 1CV2A 2DH6A 3C1TA 1GLVA 3FWZA 3JPWA 3MINB 2FW6A 2QY6A 3OSZA 3TAHA 5JAMA 1H9BA 3I9V6 3TPFA 1P2DA 4ZA2A 3DLAA 4B2YA 2WOJA 721PA 2P35A 2ODBA 2Q21A 1JT9A 3OKCA 1MNQA 3B52X 3FZGA 4JZYA 3JQAD 4TKUA 5EE5B 2J3JA 5DN6D 1IK6A 1N2HA 2GHTA 4JYBA 2L69A 1ZUHA 3OM1A 4CLDA 2Z6UA 3OE5A 4G41A 8LDHA 4XH9B 4LZJA 3ANLA 4LUCA 4LYGA 4QUDA 1R5JA 1SVKA 1U9YA 4JI0B 4AY2A 2F1OA 3PEFA 4LHXA 2IHBA 3ZEAA 2ZSAA 4QM6A 5KJFA 1A8HA 4N7JA 1XZQA 1YB6A 2XDQA 5LB2A 1TAHA 2IY7A 3OP1A 2AQIA 2HXYA 2YYYA 4EHKA 4EJSA 5K99A 1G0OA 3PXAA 4G5RA 1RFLA 2ZB7A 4G9EA 2CD9A 2QZJA 5DX1A 3BD6A 1SHTX 1U2DC 3K0BA 1HZJA 1NYQA 1U1EA 2PM8A 2RHJA 2VDQB 3DQPA 3N74A 3AKZA 4KL8S 1JB9A 5C31A 2H5EA 3CXRA 4G4GA 1P6QA 4XUDA 4RVOA 3VHQA 3IT0A 4DNFA 2HEIA 1VM6A 1DXHA 3HU2A 2KJQA 4L3OA 1J9EA 3COVA 3O4HA 4G65A 3RO7A 3VUFA 4R8KA 1JG4A 3W04A 4N5DA 3I61A 2C3MA 1CTQA 1G8FA 3MIIA 5JR3A 2PH3A 1U31A 4FCVA 2IUUA 3WWDA 2WSMA 3HA3A 1NLYA 2H29A 3LDUA 2DFNA 1E3SA 3OM9A 2QUHA 4YQEA 4JU8A 1VMAA 2ZB3A 1TCAA 1QKKA 3A70A 2FHPA 2GKOA 3C7AA 4MQEA 3THYA 5HQTA 3IP7A 3ZEIA 3HJAA 3VHLB 1DC8A 3OJFA 3KR2A 5HQJA 1PJAA 3QLTA 3T94A 3TXYA 2QP9X 2C1EA 3U4DA 4FFBA 3UXEA 3HADA 5AVOA 4V3CA 5K4AA 2IKSA 4UBIA 3Q3GE 4Q9IA 3UJ7A 3RJ5A 3SU8A 1LU9A 4EY5A 2EJCA 3MWJA 1XQ6A 4I55A 121PA 1J00A 3SHOA 4EJSC 5C4IA 3DLBA 3IDQA 1IN4A 3QF7A 1VJGA 5CITA 1H9CA 5CDFA 1BRTA 1EFTA 2XNKA 3E18A 4GX1A 4EARA 1RWVA 3UPDA 1XZHA 4PBRA 1JQEA 2XD9A 4BGUA 4ZOCA 4DEYA 1Y4DE 1YI8A 3SR3A 3GWGA 3S1AB 1GZDA 3R3HA 1IM5A 1XA3A 5DHPA 2J31A 1KAQA 4D6XA 5EEGA 3HCPA 4PZAA 2IYOA 4U6QA 4F6RB 1JPVA 1OPXA 3DEKA 2JGDB 2HSEA 4NKRA 4QOJA 2JI9A 5SY4A 3CGWA 3IS3A 2QAIA 4G9BA 3F96A 3K32A 4XJTA 3B5IA 5IVDA 2IEZA 1DE0A 5E9JA 4D46A 4RACA 1QO9A 1IHOA 4MCIA 3UJNA 3JRNA 1IU9A 2CLHB 5H0IA 4YDQA 2M6SA 2QJRA 2ZBVA 2ZRDA 1RPNA 1VDZA 2CMHA 4RHXA 1U0NA 1YXMA 4NICA 5M29A 3EY4A 1K8RA 2OK7A 1NI4B 3DHNA 3EWIA 3V1KA 5T4EA 4QEKA 4OM7A 4YJGB 3EFOB 4ZI7B 1EE2A 3TRKA 2AR0A 3ICCA 1D2EA 2FR0A 3G5LA 4YBRA 1AQJA 1E79A 4R84A 1N57A 1K8YB 1XRNA 1NJSA 1KMMA 1TA4A 2PK3A 4NBTA 1DTWA 4IIGA 2FPGA 3MRSA 2VPXA 3R0IA 1PLLA 4A73A 4UOEA 3COJA 2V74B 2IH5A 3SQWA 2DFKB 3MWDB 3TKLA 4OHRA 2WF7A 1GSOA 2AOWA 4AJEA 4EAAA 1WUYA 3LL7A 3OTGA 4DWJA 4JP1A 2I67A 3BSSA 4HGPA 4KQ9A 4M0UA 2R6CA 4DRZA 2VK8A 4OI4A 3EBLA 3GMSA 2JLBA 2H31A 2VEDA 1ABFA 1EM8B 3NAZA 4HXEB 3NVAA 4UDOA 4QUBA 4RESA 1B23P 2PMKA 4V3BA 2CVHA 1XRJA 3THRA 5BNWA 2ZJYA 3VPFA 4NMMA 4M7OA 4BNKA 3T3MB 4W5RA 1TGYA 1VL8A 2VHQA 2QL9A 3VH2A 1H6DA 1ZVJA 3CF6R 1AN9A 3DFIA 3NHFA 3PFHA 4Y2TA 3KLOA 2P5UA 1DAOA 1DQNA 1H2WA 2Q62A 4Y18A 2OBLA 4HN4B 3TVYA 1SQ5A 1NRJB 5IKMA 4XCVA 1SC3A 2GZHA 1KZ4A 4TM7A 2J9YB 4TTVA 5IWCA 3CJQA 3E2PA 1YCGA 4QTZA 3TR6A 2EP5A 1NWCA 2JGMA 4EI8A 3KS9A 3P26A 1ULHA 2DT8A 5HVNA 5BR7A 4PAGA 1O4WA 4TMVA 3RUDA 1EA7A 2ZCJA 1FLVA 1S8FA 2AJCA 4PC1A 4AI6A 3PGXA 2IA5A 3FYHA 3K2QA 5E1OA 3FUXA 4NU0A 1WVIA 3QVOA 5EE1A 1KVUA 2CYCA 1PD0A 2FRXA 4MR8A 1G2IA 1KFJB 3CVXA 2G4LA 1QG6A 3L7OA 4AJPA 1XDWA 2TECE 3L0BA 3MYRA 4OYYA 4HLUA 1OYOA 3M1LA 5IFKA 3OE1A 5DM70 1TIPA 1H6CA 4LJ5A 4D2IA 4IHAA 3RSCA 4H1UA 3AIIA 3LAWA 4FN4A 5KC9A 1AUVA 3QE0A 4DG8A 2C98A 1VP3A 4I4CA 4JYMA 3OKPA 4MHSA 5FUQA 1ZM9A 1UBOS 3BMCA 4AZ3A 2BFAA 4KI0A 2XZOA 4Y1FA 4FD3A 1EWTA 4IIUA 5CX1B 1A9PA 4HGZA 3P4XA 5EWLB 1YAJA 2EEZA 2VF4X 3DTTA 1KWKA 1EJ6A 2ATVA 1QRTA 5LP6B 2JCVA 2X4DA 2VAVA 5F2EA 3TL6A 5J58A 5FOUA 4YRIA 4D6PA 1N1GA 2Z83A 3L4EA 2H1RA 2O9JA 1HURA 3SC3A 1OGYA 2V9CA 4I3HA 3HWRA 2ZRFA 3UB4A 4LNUB 4JI2B 1QHNA 2WPNA 1U4OA 1T36A 1PI3A 2DBYA 1BROA 2SKEA 2YASA 3BXZA 3SE7A 3VZBA 3OCUA 1EGMB 4HDQB 1FS5A 2VTBA 3TF5A 3L7LA 1XMJA 3HCOA 3OZVA 5FDFA 5CHYA 3DEZA 4FNOA 2VJLA 4ZZ1A 1UJCA 1GL3A 3CNQS 1PZHA 2POCA 2E2WA 3OTHA 4TZTA 3EBPA 3AF2A 4JJ8A 4IHQA 4JQSA 4QLOA 3ZDCA 3CX7A 3HYLA 5IZ4A 4BMPB 3RYCA 1OLXB 2F3RA 3V33A 1OYWA 4L16A 1GUDA 2GD6A 3EZ2A 5FD8A 3ZWNA 1N2GA 4YAEA 5DLQC 2WKSA 2IRWA 1XROA 3TZQA 2VIIA 1N2OA 3GJ8A 2ID4A 3SC4A 2YJGA 1QGED 2P3SA 2CE7A 2REXB 1J25A 4RA9B 2P6UA 4XRGA 3K9QO 5A5EA 3UT5A 4G97A 3OX1A 1NU8A 3VNSA 3OLYA 3NU1A 1ETUA 4CEIB 4LRUA 4C0QC 2HCFA 3Q12A 3R7NA 3Q2OA 4Y2YA 3C7CB 3QPVA 3ZV7A 2A1UA 4MQBA 3HUUA 4GVXA 1AKMA 5CA1F 2KX7A 1JG7A 1ZG3A 2FZKA 2P9JA 2YHBA 4L7QA 1NHWA 2BGMA 3BIXA 3MB5A 3GUZA 4BECA 3EZ6A 3EIXA 5REQA 5FUXA 3V4VB 4HB3A 3MMXA 3N2YA 1N6PA 3HI4A 3EARA 1LVUA 3NORA 5JMWA 3W8DA 4TMYA 1LBIA 4U7JA 4FIZA 4KWCA 3GHYA 4Q15A 3RQSA 4DPKA 4PNEA 1G9XA 1UZUA 3LKDA 3QEMA 3JTMA 4M9CA 5JANA 1I14A 4FILA 3BERA 4PC6A 2RHLA 4RZXA 3VNQA 2O2DA 3WB9A 4CKZA 3GB9A 1ULZA 3KOXA 2BR3A 3NM6B 4B85A 1WWKA 5EMLA 1N0VC 4AG3A 4L6IA 2X0EA 1UIRA 1SC6A 1NW7A 4K87A 3ZJTA 3MWEB 1EFPB 1GCGA 2B4KA 2AQHA 2J85A 3DO5A 2GBCA 3PEEA 1TUBB 2EWWA 2Z95A 5EIEA 2CMGA 3SSAA 1CY6A 2IUTA 2A5GA 2PX2A 3CR3C 4WX2B 2FX2A 4ZJUA 3OEEA 1KI3A 5HMLA 2Z2IA 3FWPA 3URMA 1A4XA 1QTNA 4IS2A 2HSGA 5SY6A 3AR7A 1D03A 1JR3A 1B8PA 3ZWBA 3VA7A 3CVVA 1ZR2A 4G0QA 1O0BA 3N86A 5F33A 2GBIA 2VHZA 3AEZA 4MVJG 2XTZA 1ZGHA 2WINI 4MVWA 5JWHA 4C4PA 2UUOA 2Z56A 1HTWA 2W6QA 5BSWA 3N8NA 4MIOA 1VPLA 5KU7A 1BAPA 1LRJA 4GM0A 4J0CA 1QZZA 1JSRA 4A16A 5C5CA 3CISA 4KFTA 3U3KA 1YJ5A 4EL5A 3GRYA 1LKZA 4XJVA 1QZ3A 4EEKA 1LNSA 5JASA 3GG9A 5CR9A 3K9LA 1LFAA 1COZA 5FNZA 4OXNA 5AESA 1UBMS 2B30A 2UZ1B 3FG9A 1UBNA 5IZCA 3UMGA 3JQ8A 4IGAA 1HUQA 3I9NA 2AT1A 3RAEC 1ZL0A 1POXA 2FFRA 4EVSA 1KE2A 3N70A 4YMSA 4P5DA 5BQ5A 4UEKA 1ISHA 1EK2A 2CXXA 3T3PB 2L2QA 3ITNA 5AW1A 2TS1A 4DDKA 4GGMX 5K01A 3WQBA 3U26A 1N0HA 4NFLA 2BTEA 1J70A 3LDHA 4R81A 4YWJA 5T57A 2BEJA 3WK9A 1IBKB 1RPJA 4V39A 2R1TB 1C3VA 2E87A 2NTVA 1ND6A 3NBKA 4L4YA 2IIBA 5AW0A 4HNAB 1VA4A 3RYFB 4UPEA 5MHTA 3SX0A 1KJYA 4GF5A 1NRIA 3RHSA 3JAWA 5DEOA 4IDEA 2FDCA 1KC1A 4E31A 4Z3KA 5BQ3A 1LVGA 1DWOA 3F6YA 3OC0A 1JI3A 1UEJA 4V2IA 1QSGA 3UGTA 1XZNA 1VIDA 1CJMA 2EKQA 2VQEB 3PCTA 3II6X 3ZCTA 1WF3A 4LK2A 4LXQA 5AJVB 2CJWA 4UUBA 3F1LA 2EG9A 4M8SA 2CUKA 3B1XA 3VGJA 4B74A 2C7BA 4E70A 4RTOA 1SBQA 4L4SA 1U2GA 5TMEA 2NXWA 2V3CC 1Z2EA 1A8PA 2FN9A 1JR6A 3IR5A 1BHQ1 3NTOA 3P9YA 4WNYA 3TLYA 4F9FA 5IZCC 1W44A 3KKZA 3O03A 4HEJA 3DZHA 4OY3A 2PLAA 5DP2A 5GIOE 3WYBA 4YCJA 1I8TA 1PVOA 3DF9A 2OBYA 3FBWA 4OXQA 2WZQA 3RVLA 5KX5B 4I5IA 4M9ZA 5AK4A 1AC5A 4FIDA 1AUPA 1IXZA 3PD1A 4EO4A 4H77A 3Q15C 1E6CA 1K6JA 1SIWA 1UJ5A 3RW9A 2WIBA 3W5SA 2V9ZA 4IZIA 1DWPA 4YP7A 1P75A 4GVPA 1PQ4A 5AOBA 1CUDA 2QVGA 2R66A 3E3LA 4LJRA 1H5QA 1EQ2A 2NXNA 2WVJA 1O6ZA 4Q9HA 1RAFA 2QYHA 4C78A 4I1IA 1NN0A 2FX3A 3NIWA 1OWOA 4Q1BA 5HS4A 3GLGE 1E18A 5AKLA 6ADHA 2QUBA 3PE4A 4YCDA 4PYIA 2OMEA 4R54A 4G26A 2GEFA 2QZZA 1XTVA 2ZR0A 4M8LA 1LH0A 3DULA 3TFQA 4I8XA 5DK4A 3S1SA 3N1UA 1PFKA 4ZQGA 4XVRA 4UBJA 3MZ0A 4EFNA 1XTIA 2J4CA 3FHOA 4HXFB 1XWIA 4DM4A 3UA3A 3NNSA 3PUYA 1FTNA 2J6HA 1BG6A 2ZJ0A 4FZJA 3S2YA 3WP0A 1MJHA 4MV4A 4ZQHA 4UM5A 3V6MA 3V2GA 1NF9A 1JE0A 5FF9A 3WR5A 4L74A 3A9WA 4DARA 3BN3A 3EQZA 4HN9A 4PRKA 1ABBA 3PFNA 2GSWA 3G6KA 4M7WA 3DONA 4H7FA 2Y4NA 1W30A 4NYIQ 1JW9B 1TZJA 3HCEA 2R2GA 2WT9A 3LX6A 2M9MA 4B81A 5JH7F 3T7AA 5DM1A 2DOKA 4DM7A 3GZ4A 4MULA 4ZCLA 2FMKA 3GCGA 1KJ8A 3BD8A 4REOA 5ALFA 2Q8PA 3LUHA 4A0RA 4H17A 1L8XA 4BNMA 2Y9MB 1N8TA 2AFHE 1W2WB 4Q4HB 2VBFA 5F1KA 5TVKA 2J7KA 3GI1A 4M53A 1M9NA 4M1MA 4TGLA 4RM3A 5MGBA 1N2BA 1UWKA 1ZRNA 2PN1A 4NZNA 3BWYA 4QYXA 4B32A 3CZRA 1ELOA 1UKAA 3LK7A 5TQ0A 3JWPA 3HJHA 3EASA 3QNUA 3LUJA 1BDJA 3Q72A 3MGCA 4RF3A 3P9SA 4OVKA 2AI1A 3PT9A 1CQJB 2WFMA 2IYTA 4XLLA 3IX7A 3IUQA 2R6GA 3C5HA 1ZLXA 4ND6A 4RYDA 4UZEA 1RRPA 3L1JA 1IUPA 2WJ4A 4R2JA 4K05A 4WBNA 3I9KA 2FMTA 2PUGA 2A5DA 1ZK1A 2G7ZA 4FDTA 5JJLA 2VBGA 1AF7A 2DUMA 2QGNA 2WTXA 5FBQB 3DDSA 2CNKA 3BRWA 3KVOA 4HGRA 5D01A 3DEYX 1L5NA 6ABPA 4F2DA 3UHJA 2QR3A 4JKOA 4CMKA 3T7TA 3VR5D 3QUQA 4EJFA 3HYCA 1J09A 1JLKA 1G9TA 2QSYA 2NU6B 4NU6A 3MB8A 2J32A 1L7MA 4KUEA 2I1WA 3KXKA 4R8VA 3WLPA 2CE2X 1IZZA 5B3JA 1SBYA 4EITA 4PPYA 3I9FA 1E79D 3RHFA 1E64A 3U19A 1E3DA 4YIHA 2K2WA 2RMKA 3QJ5A 4IMPA 4IVPA 1WZCA 3F97A 5ALLA 4ZEXA 5JMTA 1GGMA 2WYVA 1RXWA 4D26A 2VHJA 1B0PA 2AZTA 3DC7A 1T5BA 4M54A 2Q4RA 2O2SA 2AZDA 4AQYB 1L4UA 2WNIA 2OL4A 3NBFA 2XF2A 1KJZA 4H7EA 3NAQA 4P53A 1EBBA 5FX2A 5JRJA 1C8VB 4QU9A 3FYCA 4IF4A 4EVRA 1PTJA 1VGQA 2P2DA 5H4HA 1NW5A 2ZT8A 1KYZA 2A9PA 3OPMA 3QEJA 5ES3A 1O8BA 3SEZA 5TEVA 5EXEA 5D3ZA 3NTQA 2C96A 1OY1A 2PY6A 1JWBB 2LIVA 2ERCA 1FOEB 3D64A 4G5OA 5D7BA 4OK5A 1Y9AA 1W2GA 4PHGA 3ZWWA 5KDDA 5CURA 5I5EA 1XAHA 2FMFA 2X0IA 4HNTA 4M2LA 1X1TA 2C4MA 1MJFA 4IFBA 1FQKA 2WY2D 5DX0A 1JJBA 3G02A 3BULA 1A9OA 3TBFA 4BNHA 3TI9A 3LUKA 2G5PA 8ADHA 3G2PA 2GRAA 1YWGO 1ZCAA 2GPTA 3CH4B 3CLHA 3FYUB 1I0ZA 5LU9A 4AP5A 4D79A 4AZSA 4RPGA 3HRIA 3M82A 3QTTA 2DQ4A 2J07A 2EWMA 1RLUA 3VDQA 3NWJA 5C7IO 5KNCH 3JQGA 1D0IA 1RLMA 1WVGA 1CULC 4AZVA 4E5NA 5L9AA 5T4BA 4FMCF 1OI7A 2D2FA 4M22A 3W8RA 5G0TA 3VQTA 1O6GA 2J0QA 3D7NA 2FP4A 1MW8X 3B6JA 4Q93A 1K98A 4PYKA 3T9EA 4PC3A 1SWWA 4F93B 1XF9A 4YI5A 5KMGB 2NWQA 3A4YA 1Z5VA 1MIOB 4OSPA 1MAHA 1UCFA 3UXYA 5LQDA 1EXMA 3IAHA 4TVSA 2QMZA 3C2QA 4J7CA 2GJKA 4F7WA 1X7WB 4DV5B 4KMMA 2ILTA 3I37X 3DD1A 3FMGA 3IERA 2QM7A 3FI0A 3HU1A 4UVHA 4XYEA 5I7AA 4D0GA 1SOVA 1G64A 1X7DA 3O4JA 2JJ8A 4NENB 1T9GR 2FR1A 4E4YA 5I9MA 1A1VA 2XMDA 1MC1A 2NU8B 2C61A 1XQYA 2YJ4A 1F4LA 3VKGA 1Q0HA 1KYYA 4ZVPA 1S5PA 5DNYB 2HCJB 4IDAA 3OZAA 2VPPA 3BE4A 3GVCA 2GM3A 3SHTA 4FSXA 4Q1AA 3CNLA 1YKSA 2I33A 3MWYW 3H83A 2JKYA 2E21A 4RJ2A 4ZVRA 1TJ4A 4B6JA 2C7QA 2WKRA 3I6BA 4LI3X 1GU1A 2OLEA 2KE5A 2WP0A 2NNLD 4FKBA 4CKWA 2WWTA 1FQWA 1FP7A 1M2VA 1F51E 4NPCA 1HQKA 2PRSA 1HMYA 4HX2A 2W2LD 3SHWA 3MJDA 1YVPA 4IO0A 3PR2B 3ENQA 1D8TA 3DO8A 4TMFA 3Q41A 1SBCA 2I6TA 4UD2A 5BT9A 4CG0A 3MJSA 5AUOB 1GWNA 3R4CA 1SBNE 1ECFA 3LX4A 4GI1A 1UMCA 4JX8A 1SIUA 2O8BA 3WQRA 1I2MA 1YMVA 2R44A 3JWHA 5AW5A 3G82C 5TPWB 5KBYA 1RM0A 1LQTA 3IEIA 3BL6A 3R9IA 4L0DA 2F3PA 2HRQA 2ZVPX 4JVLA 2OQVA 4H59A 1ENZA 3QMVA 4BN0A 5G1NA 3WQQA 2DFTA 2RGWA 2NUBA 2HMUA 4NJEB 5HNKA 1IONA 4HGNA 2B35A 2CT8A 1W581 2ZYUX 2OBNA 4IJMA 3NHWA 1FFCA 1NMZA 3P2MA 4R8SA 5AYVA 1P1IA 1P5FA 3VX3A 2G1PA 5K0FA 2PJRA 1T0IA 1UT8A 3GHHA 4NMLA 1RXEA 1J0CA 3EGVA 1PR1A 5FLYA 1I5RA 3TLXA 5ILOA 2O2ZA 1TCBA 4ZZIA 1JHOA 3KTAA 4OREX 3C7TA 2IZ1A 1QS0A 3LO5A 2XQKA 3I8OA 4AUNA 2MU1A 1ORTA 3BEDA 1NRXA 1V4VA 2HK7A 3IE2A 5EPEA 2HGZA 1U0JA 4LOIA 1REQB 3MTIA 2P6NA 2JJ2D 3R24A 4NZYA 3ZGOA 3FOBA 4HP8A 2DZDA 1P2TA 2BFWA 3N3AC 4BLQA 3TBHA 1G38A 3JAMA 1DEAA 1KSHA 1N8KA 1TMYA 1ZCZA 1IYZA 1KDOA 3KCNA 1FX0A 1DQSA 1MB9A 1NXTA 4PIPA 4X6UA 3GVPA 5FEMA 1QO0A 2HO5A 1HT2E 2WFLA 3EE6A 1DIHA 3CZ4A 4LWQA 4TV9A 5F1YA 3SZRA 1PLJA 4HRXA 2SECE 1CEEA 1LXCA 1FVOA 2O8NA 3PC7A 5JG7A 5JLAA 5D3MA 1ES9A 4X3OA 3GLGA 1NBIA 1GGJA 2QJFA 3K8OE 3F5DA 1TCCA 3AUUA 2IUSA 4D8WA 2VWHA 2P9TA 5AM1A 3QMWA 2ASEA 3WADA 1PLKA 4QUHA 1BDMA 3S28A 3E9ZA 4BMXA 4W5WA 3RWBA 1YDMA 2CF6A 4HDNB 4BQQA 1N9ZA 1RRKA 2Q9BA 1CWUA 4RFSB 4JI4B 2AS0A 1VHDA 2YRXA 1SXHA 3H1AA 3H2IA 4NEQA 2RBEA 1T4BA 2A86A 3OFJA 4OKSA 4L4XA 1WMEA 1O5IA 3GJSA 3PYMA 1R6VA 4A4DA 4AY4A 1XPUA 1V96A 1SZJG 3I01M 2H1LA 1ZIXA 1SUWA 1OZHA 1PEDA 1U5CA 2BZ1A 3FPCA 4LDPA 4R2HA 4A23A 4C08A 3MTJA 1ZK4A 2DBVO 1YR2A 3AERB 2PS0A 3JQ7B 5DLPA 6NULA 3NEPX 4WCFC 3UCFA 3GU3A 4BU0A 3DVAA 2VJBA 3ROQA 5B1HA 5LQUA 2VP0A 4KJXA 4XA8A 4PAMA 2JD1A 5HTOA 1LRKA 1OH5A 5IT9A 3FTFA 1NXXA 2AYYA 3H9UA 2J4FA 3SXJA 3VBCA 3KXIA 2IIVA 4KO1S 5K1ZA 2JB9A 5EN4A 1XJ5A 1E61A 3C3KA 4DA4A 2FUNB 3IOBA 4WBNF 3IOMA 1NXOA 3HXKA 5H80A 2HIGA 4PXSA 1YTUA 3VVLA 1VLVA 1Y8AA 2BFCB 3MJ4A 4QATA 4D4HA 1UZNA 3H18A 3RJTA 2GNAA 2CSUA 3RYTC 6PFKA 5G3YA 2OAP1 1XAGA 1ULSA 2VAPA 2V6BA 5AR1A 5HIKA 4PCUA 4RTMA 1FVFA 1F6DA 2GMWA 1E2DA 1H0SA 4E12A 5I48A 5LLDA 4DUYB 1ZI9A 2GZMA 2NO5A 3GJ7A 4QJ5A 4K9KA 4HAIA 5E1DA 3WHLA 2UUAB 1PT7A 4J16A 2NUPA 1EBFA 2W2NA 1NOIA 1KGDA 2VDMB 2V58A 4PVCA 4W1QA 2IS2A 1E2GA 1T1IA 2FEKA 3PZBA 1AO0A 1G4UR 2D74A 2HYDA 2P2YA 2WPDA 3CWZA 4K6GA 2DM6A 2YMQA 3DAPA 3AR5A 1DXOA 1X7XA 4KXXA 4BNTA 1PX2A 4D8VA 2F67A 2IYWA 5HQ3B 4P22A 4R2IA 3DBLB 1AMOA 2X3YA 1I4EB 2GASA 2AR9A 3LFHA 3HZRA 2PQ6A 1NNI1 1JEAA 2I1VB 4MVJH 3WDMA 1TQ8A 1Z0ZA 1ZOIA 3GJQA 3OEWA 4PG4A 5FXMA 2HQBA 5COBA 5KWEA 1GQQA 4IILA 5LVAA 2PSEA 1IXKA 1MN6A 5FEUA 2WQZA 3UMMA 1NLUA 5TDHA 1TF7A 1UBEA 4RLFA 4YXWA 2ZUCA 4DCTA 1COWD 4C4SA 4GSYA 2X1VA 4EVIA 5KYWB 3KSUA 5ISMA 3IJEB 4IX1A 5A5GA 3AF1A 3ESDA 5DM4A 5HFJA 1NVFA 1OT5A 2BT4A 3HBMA 3PL1A 1V71A 4LJAA 3HBLA 2BM0A 4QYIA 1DTSA 4EHJA 1YJQA 1M2EA 1R50A 2YHSA 3BWDD 4LTMA 4Q4AA 4XUEA 4BWGA 5B3LA 2EX0A 2Q4BA 3P0IA 5K51A 2IWRA 1E2JA 1RHQA 1TI7A 3CY6A 4CBVA 5IJ9A 1O0CA 4A8JC 1U11A 3GJ3A 4J7XA 4YJFB 5JZBA 2J08A 3NUQA 2PUBA 1S3IA 4TXLA 4TZKA 4J16C 1J9GA 3TE7A 5JQGB 2ZJ3A 4QEZA 2PKXA 4CTKA 2LIPA 3H5RA 5L4SA 3CONA 1U5BB 1X80B 3MJHA 2JRCA 1BOFA 2ZXFA 5DU2A 4P7FA 1YF3A 4MQ5A 2PGDA 3OTIA 3PD0A 5H3CA 3DEHA 3MMPA 3VTFA 1PR6A 3TPZA 3ZWVA 2FPIA 1Y48E 3KUKA 1LLQA 2PLFA 1SD1A 2IOYA 1EUQA 3G8AA 3TOVA 3N8GA 3MN1A 3LNCA 4E33A 4DJFC 1Z34A 4ZYXA 5E2BA 2OG2A 1KY3A 1X9IA 2ZTLA 3AX6A 1E3LA 3WQSB 2HCBA 1VJ5A 3PHBE 5EVCA 5IBQA 1GTSA 2EHJA 4G5QA 4NOJA 3ODPA 3V8PA 2DCMA 1SG9A 3CRQA 3LYHA 4I4NA 4OHPA 3X1YA 3W6ZA 2HA7A 4BN5A 4GNRA 2G72A 1RPTA 2GCEA 2YIMA 4F3YA 1C1XA 2GSDA 1Y8ZA 1DX4A 3FGPA 3GRPA 3NOVA 2ZYGA 4JHXA 1B0ZA 2OZVA 3DXZA 3FMFA 4LY6A 3ZI7A 3S3TA 3KZMA 1RZRD 3ZWKA 3NDIA 3WOVA 4Z51A 2ONKA 2RHGB 3H1GA 4Y0VA 1T2EA 1WUHS 1R0LA 1P5JA 4KC0A 2FPXA 1S96A 2AQKA 5J5AA 1B0AA 2OQIA 4KO8A 5CYFA 3R74A 3CVOA 4MKRA 3MQ2A 4X90A 4PSKA 3CMMA 3CRZA 4Q4LA 5F2OA 3ER6A 3RS2A 1CRPA 2QPTA 3T3HA 4Z7NB 1Z3IX 1XT6A 3HR7A 1H9AA 4BIIA 1IQUA 4M1WA 3NP7A 3FUCA 4O4HF 5C8XA 5C34B 4MA5A 4PZ9A 5JS1A 2DERA 1D6NA 2O7QA 2XKJE 3GEIA 3NR2A 4MV1A 4X63A 4W5QA 4IEIA 3PI7A 5FL3A 1IFXA 4W9RA 3L4KA 2R00A 3HWX1 4P0TA 4DXHA 1JR2A 2V1XA 1OWLA 3M6LA 2RH4A 4YY3B 1QQTA 3SK0A 4FDAA 2HPZA 4QBTA 2JGNA 3WNVA 2BE7A 4B6PA 3GZNB 4NDNE 5KQPA 3EVNA 5CB0A 4ARVA 2GBPA 5CCEA 2EGHA 1JVSA 4HNVA 3CRMA 2GRJA 2Q45A 4M99A 1BH2A 2WIFA 4MGKR 3OU2A 4FXPA 5F77A 4L5BA 3WHIA 4CZ2A 1YCFA 3QVMA 3PVCA 1VB5A 5JY1A 2ZI3A 4GSKA 1R8YA 1FU7A 2FDRA 2X0KA 4I5DA 5BMOA 5KYUB 4YUVA 3AESA 1ZMBA 3KAQA 3HVRA 1TRKA 4NX2A 1JBQA 4POOA 4ZT7A 1X1DA 1KPIA 1CD5A 2D06A 2GXQA 2NW6A 3KEGA 4MKZA 1WW2A 1FYEA 3E9QA 1E6EA 1KYVA 4E2FA 3BM5A 1RYNA 5DDIP 1T5SA 1YRHA 2BFDB 3WVNA 3F4KA 3JZFA 2D2EA 3D0QA 3FCSB 3GYBA 1K92A 2HRZA 3UMRA 2IHNA 4ZDJA 3PITA 3IDAA 1WS6A 4OHWA 3GH3A 3RKRA 4BQOA 4NK4A 1Y1QA 3HLTA 4U0JA 2NZ8A 4WW0A 3OIUA 3G9UA 4EG1A 3AVVA 5KSYA 1NW8A 1CB0A 1UAGA 2QX6A 3DBRB 3DOJA 4UCWA 1ZNYA 1XRPA 3ZHCA 3OLQA 1YVRA 2O6LA 3TOXA 3SOZA 1C1DA 1Q77A 4DNQA 1U7TA 1Z0FA 5CLHA 5CXXA 4CRWB 2CYAA 1DBIA 1CXZA 4D6YA 3RE1A 5JCJD 2AC4A 2C9ZA 2H4XA 4BX8A 2HK6A 3A3OA 3DE6X 5DNUA 1HZZA 3D7MA 3NC0C 2QYOA 4IEFB 2Q07A 3BQMB 1Z35A 1RYBA 1PDVA 1B0UA 1K5HA 3PUVA 5LBTA 1KVTA 1C3XA 1OX6A 2XADA 4LSGA 1M75A 4J3NA 1MENA 3ANSA 4WXYB 4UM9B 2ZS9A 1SULA 3AGPA 3N0RA 1XNJA 3E8MA 5ES4B 3IBTA 4Q3NA 1WDMA 4KSCA 4RMIA 1Q21A 2YZ2A 2OP0A 2W6IA 4ZC8A 1LQ2A 3L77A 1Q84A 2PT5A 1ECLA 2Y1CA 5JSQA 3B1VA 2RIRA 2PXXA 1H0RA 2PFGA 4G5XA 1JJ7A 4EHLA 5JUWA 3QFFA 2BFFA 1MVLA 2OB2A 2WJGA 5LM3A 3LOUA 3LBYA 4AIRA 2K5UA 3GGSA 1EVEA 1G1MA 1CUGA 4P7BA 4X54A 4X84A 5CLLA 4IIJB 3RT1A 1Y34E 4OLFA 3PKZA 1QVZA 1BJRE 5FTMA 2AXQA 2VP4A 3B9PA 3VSDA 1JNYA 4HFMA 3KTDA 2C5HA 4DTIA 1ZGCA 1ORDA 2FZWA 2P3QA 4A8HA 4YYZA 2ZJFA 4N8SA 3ZBUA 2FWNA 4WGFA 4N4AA 1VBMA 3D2BA 3GFOA 1QLHA 2RHWA 4FQ8A 4X8MA 5FYQA 1KTIA 5F9FA 3WAGA 4KDCA 2ZLBA 1AM4D 4KU4A 4YREA 1OC2A 1NUUA 4HWOA 3MRVA 4JENA 2JFPA 4OXKA 1MA0A 4PTZA 1IXSB 1JU3A 3BD9A 4LXTA 3RRNA 3VJLA 1H4QA 2WAOA 3HLYA 2E48A 3LF1A 2VDWA 4ZU6X 3ZBPA 4KPEC 1OWPA 3HMQA 2IIPA 4NU8X 2GZAA 1ZAKA 2W0MA 3T4XA 3O73A 3VV3A 1X92A 1Z2NX 3KJZA 2XGOA 2FQ1A 4L4RA 5E9AA 3FYSA 2YHAA 3NYWA 2Q6LA 1XKXA 1MDBA 4KXUA 4WASA 3W5JA 4RDCA 4WINA 3WRYA 4IR7A 1OIWA 2RG1A 5F5NA 4U00A 3AF5A 2HWUA 3QZUA 3HB0A 2JIMA 3ROPA 3VDXA 3WNCA 2JGEA 1EVYA 1SCJA 4OP1A 1KI1A 3E5RA 4WLOA 3RGGA 1HDOA 4I9UA 2AXNA 4TQ9A 4AURA 1XNRB 6REQA 4A82A 5IU6A 3HXMA 3PC8A 2C5AA 3OAAD 1ZWKA 4O4LA 3ELBA 3DE0X 3ELWA 3NIDB 1DFGA 1EK6A 4EYQA 1R3UA 3PPIA 3G0CA 4RE6A 2E4XA 2V5VA 3MJEA 2RK4A 3KQMA 2ZUDA 3KSBC 3I92A 1ZDMA 2IYSA 4BCDA 1PG2A 4WACA 3QXCA 4R0MA 4C2UA 3AB8A 4G09A 4MAFA 1UJBA 5A9SA 3S7TA 1CQZA 4A8PA 1QV9A 3L1VA 2VK1A 2V7UA 3VH1A 1T9KA 1L1RA 1VG8A 1Q57A 2W5UA 1SA0B 1JHUA 2W93A 3CNNA 3JQEA 3QE3A 1FFGA 3GGPA 4ZHQB 1FFHA 1GQ2A 3EZGA 2GBGA 1RXIA 3VUEA 4HRYA 1GR1A 2WJVA 3PRHA 1NUHA 4F84A 1O96A 4LGYA 4KQGA 2BYTA 4FINA 2H4HA 1BDHA 3O8DA 1E63A 1WZIA 5HJ7A 1UM9B 3HB7A 2Q49A 3D7LA 1IEXA 3W4IA 4DKXA 2ZWIA 4TLAA 1NQ5A 3LQFA 2HO4A 3Q10A 1LBHA 1U3VA 3GJ0A 2F4VB 4P3XA 5EFOA 3NXKA 3IXQA 4INZA 4JQOA 2PQMA 3ILYA 4YWHA 4MWDA 2PMWB 2Q1XA 5DIFA 4ZI3A 3C15C 3M3HA 2C78A 2QD3A 3F71A 2E85A 3QEBZ 5I7RA 1E7QA 1YOVA 5BOSA 4U8HA 3AW8A 4FFRA 3FPHA 2P1ZA 4M37A 4CG3A 1HSZA 2YYAA 1FZQA 4C4TA 5KQLA 3A1SA 1O95A 4DZTA 3EOBI 4GMHA 3CN9A 5EWMA 3SVZA 1UPXA 2HB6A 2X19A 4YRRA 3PE3A 3HSKA 1JFFA 5GQSA 4FHDA 1O1YA 2BFBA 2Z6AA 2J3DA 4ZAYA 4EMBA 5JAQA 1SRQA 1RAIA 2Z4TA 4JROA 1E2EA 1ZSYA 2I3BA 2ZE5A 4RPHA 4TTPA 5DGDA 5LYYA 3FPEA 3IC5A 1W34A 3HYRA 5EIWA 4GPBA 2AA3A 2L42A 1AD2A 5FIUA 3WNQA 4BO9A 1Z7GA 2Z9DA 3B89A 3QKWA 3CQ9A 3E3AA 2Q8NA 3R8FA 2CUTA 4D0RA 1QIKA 4UKDA 3T12A 1CVIA 5AI6A 3UOGA 3N2KA 1G6KA 3SKXA 4A91A 2Q9AA 2XXAA 4PM4A 1CR4A 1FSGA 4E6EA 3KFXA 4ZKDA 3I58A 5BR1A 3QX8A 3I6IA 4PO3X 2HMYB 5KB3A 1Z4KA 2ZUSA 1UPUA 3CKLA 4TZ0A 4QOSA 4YMGA 3K0AB 1ZOLA 1GUBA 4OFWA 4Q9NA 2CL7X 4JVSB 1WXWA 4PSCA 3T9BA 3TCNA 4PLHA 1PS8A 1LD3A 4NE2A 4ZP1A 1T0PA 4PVDA 4BUZA 2X8JA 5KZMB 4MJ7A 3R4VA 1U0SY 1ZJ6A 3C3CA 4LCJA 3QBJA 3C1UA 5ECDA 4V0OA 2J3KA 3M1AA 5TR9A 3KQHA 3B38A 3LGXA 4XPZA 3RIYA 4MWBA 4R2MA 3SFZA 2P65A 1T4GA 1ONOA 1O95C 1P4SA 4D3FA 3HEMA 4R1TA 4HDAA 4G1EB 1IZ8A 1E9VA 2HU7A 2ZANA 5TXGA 3R9KA 5JS6A 2DUWA 3DR3A 1H94A 5K8UA 3GJ6A 3S8YA 2D2IA 1Q15A 1YL7A 4JS0A 1J1ZA 2DTDA 1N6OA 1AX9A 2AOTA 3BGIA 4RCZA 3TOSA 4DC0A 4EW1A 3RVPA 4DLYA 2ZCUA 3TZLA 3DUFB 4YS6A 4AWAA 4F9TA 1Z33A 2OV1A 5HCUA 2CJXA 5DK6A 2H1HA 3IDSA 1FDOA 4N3AA 2ZUFA 1AK1A 1UBKS 2XB8A 1P7VA 2R6R1 4EAQA 2C0CA 2P4QA 3WGJA 4YXWD 5JEEA 4MEJA 2QTAA 2WIJA 5HILA 3RHZA 1E60A 3TKAA 3DCIA 1Z83A 4JLAA 4WBSA 5ECWA 2C5FA 1R0ZA 3QMMA 3ZZNA 4R9UC 3ZJUA 1W1WA 1EWQA 2ZG6A 4WN3A 4DT1A 1X3SA 3OHMA 4KSYA 4AQ7A 4KBGA 4W82A 4C6TB 1RSZA 3CE6A 1CE8A 1J24A 1IG3A 1CW2B 3AR4A 1YRLA 1XL1A 1BZYA 1OLUA 3EMDA 4AJ4A 2JH9A 4YRKA 2FX5A 2I7DA 3AV3A 5DYNA 3WKAA 1QQ5A 5L3QB 2PBFA 2QJWA 2R8RA 3L7DA 1EP9A 2X23A 4M38A 2ZYTX 3C3AA 2CDAA 1JIXA 1QTRA 1SCDA 2O2YA 3AYZB 2FCAA 2GFQA 4HDMA 4N9WA 1R9JA 2GAJA 2OZLB 4CETA 3GIDA 2OBMA 3BDVA 1Y1RA 3I2IA 4JKYA 5C8VA 3RAFC 2CLKB 1K2VN 3IPRA 1YAHA 2CEKA 3NYQA 4Z1MD 3HU5A 3DYVA 4U02A 4HH3C 2I6GA 1NUQA 1I4WA 4AX4A 1MQAA 4DLVA 4UPVA 1K0UA 2AHRA 2PT7A 2LZ0A 3EQ8A 4Q24A 3U1BA 2WDZA 4O1HA 4DWVA 4G56A 4TWIA 3O9MA 3L02A 1SCIA 5JD4A 1YZLA 1YR9A 4PRLA 4C4YA 2PTGA 1P1FA 1IRIA 5AVJA 1HFWA 4L9RA 4Z9FA 4DQLA 3FWHA 1TFRA 3AFNA 1KC3A 1T5HX 4HDSB 2BJWA 1K6EA 4HAWA 1Y4SA 1FUIA 1G8YA 2QGFA 4RK5A 5CX4A 3CV3A 2VR1A 4JAVC 5IN4A 4MUKA 1G3IA 1HT3A 1X1BA 4OJQA 3SBEA 3SHQA 3UMSA 4DYHA 4BDTA 3BKWA 3OMWA 3ZN2A 3KBBA 1KP9A 3KD3A 2JCXA 3LGSA 3OPVA 5ITZA 2VZEA 4QSHA 4NU5A 3E9YA 4QTTB 2Y66A 1UL1X 2JVKA 4LVUA 2BWJA 2Z1MA 3PB3A 3TW8A 1Y3BE 4KDFA 2L0XA 1KQOA 3PX3A 5IAOA 3RNLA 2XUKA 4UNRA 2C99A 3EGDB 3WYEA 1U80A 3OJCA 2RI1A 1L5SA 2R60A 1SCQA 2ONZA 4F0JA 1Z0AA 5CFMA 1O94A 4ZVQA 1DWQA 1ZISA 4OFBA 2ZZNA 1KIAA 1VG0B 3QIAA 1KZYC 1GTL1 4MV6A 5JS2A 1GGVA 3MRTA 1BDIA 2JFQA 4UM7A 1L4BA 2ZBPA 3FTDA 1GG5A 2ECKA 3FUWA 5TJHA 2W6PA 1AGRA 5CT4A 2WLTA 5EHQA 4ENRA 4L3VA 5IYZF 2Z2YA 3BGSA 3EGWA 3LP6A 3CPSA 4K6OA 2XW6A 2N75A 3I5AA 4Z0NA 2H92A 1R6XA 2D0IA 3BXHA 4GLOA 4YECA 5LOVA 4O1IA 3OKAA 3RSGA 1LY1A 1X1AA 2YUTA 3QLVA 3R3XA 4N54A 4EUFA 4EF4A 4KNYA 5DWVA 2ZREA 2GXSA 1G42A 4LYDA 2XUDA 1ITZA 3OUZA 1FMLA 5BN3B 3AUFA 4AX8A 4HLCA 3IB6A 1GXSA 2P91A 3LLUA 1Z6TA 4ZV7A 4B73A 4CR8A 4G0VA 4Z4GA 2FRVA 4WLVA 4G01B 5EQTA 1SHLA 2ACWA 3I0MA 4GLBA 4RSHA 4UBMA 5DW3A 1WMDA 4P4TA 1GDHA 3K6SB 1T5LA 4UHBA 2P90A 4BO0A 3NTXA 4ZD6A 4WZBA 3BCRA 3RVOA 1VBKA 2N42A 1YRYE 4UEWA 1Z12A 3ESCA 3H13A 5HJEA 4Q4JA 4B3CA 2I6SA 1I3KA 4DEXA 1ZH8A 1USIA 4W7HA 1L4HA 1LF0A 4TTJA 3AJAA 4L5JA 2IY8A 1KI6B 2ZBRA 1SVOA 2IKQA 3ST7A 3LQ1A 5E3IA 4R01A 1O94C 4BMVA 4G37A 1KSGA 5DYGA 3GXBA 3N58A 4IG9A 4HQFA 3P5SA 1Q0TA 4WEQA 1CJCA 4D80A 4R40A 3VKVA 2F00A 2IDZA 4TMXA 3BMQB 1T2AA 2PL3A 4F4IA 3EGEA 1MF7A 1Q0ZA 3CRW1 2LXNA 4RLQA 5HK9A 4Q3LA 4XR9A 1J07A 1CU1A 5L3SB 3HGTA 3V4SA 3TI7A 3OZWA 4K40A 2WWVD 3W1EA 1N78A 2CLOB 2RJ3A 2XMZA 2GN0A 4EH1A 4PHCA 3WIBA 1EP1B 1QIGA 3L0DA 2XVYA 4UAVA 4FFDA 5E9QA 4K6KA 3ITDA 3P7MA 1N6LA 1OIVA 5FJJA 3N2ZB 2W8BA 1OLOA 2NO0A 2CVFA 3UQYS 2FUCA 1GSHA 1T91A 2QJOA 2W6ID 2RSLA 3AF3A 4MW4A 2JLXA 4EBFA 1JIQA 1VECA 2AG0A 4W8HA 2HHHB 2ZJ8A 3ENZA 2RDMA 3D3NA 2Q5IA 3U09A 1T1GA 3LWZA 5CT9A 3K16A 1J90A 3O4FA 4GC5A 1NFFA 2GBLA 4OQZA 3DZCA 2VRBA 5E8JA 4L15A 4D3XA 5JO0A 4Q3DA 5A4IS 2O3UA 2H1OA 2QIPA 4PXYA 4CL0A 5CCXA 1QGDA 5LKAA 3FPSA 3BMNB 2OCLA 2QW1A 4BV8A 1HL3A 3ZY2A 3QV1A 4FC7A 3M6UA 2PD4A 4MKXA 2GAFA 2WSBA 1KDZA 1L9XA 3WLTA 4CT0A 3DMYA 2QMUA 3C3JA 1RACA 4MQ6A 4PN3A 3KOMA 1PJBA 1XBTA 1THMA 4LG1A 3BK7A 5JTTA 4F1WA 4LK3A 4BMOB 2IYLD 3HKDB 4IX9A 3MHTA 4TYWA 5GJWC 4FBMA 4JXJA 4DJTA 5A1JA 1ODSA 2XHEA 3G1TA 4QXRA 2DG2A 2NU7B 5CH5A 1M0WA 1PEYA 1KETA 5LQCA 5TY0A 1T8WA 1PZFA 1ZFNA 3C48A 2AEEA 4C6SA 13PKA 1QIFA 4WZ6A 3DMRA 1WDTA 2PJZA 1BWRA 1IULA 1OC4A 1ZXXA 2GYVA 4QPJC 2R1VB 2GN8A 1NI3A 3DJFA 1IHXA 1LPPA 2H06A 2EW8A 2PL1A 3CEJA 3FMPB 7REQB 5LA6F 4PNZA 3RODA 4C0KA 3VC3A 1OV4A 1Q20A 3HTXA 5FNVA 4DJ5X 5FV4A 2AG8A 2OZEA 3DR5A 1WCXA 4J0GA 3FZQA 1SKMA 3HUDA 2W2XA 4HXYA 3TVTA 3Q40A 5KCZA 1RPAA 1E5DA 3L2OB 2PA0A 4PO9A 4D3ZA 4Q1DA 3ENKA 2BKAA 2QVBA 3QG1A 4A1OA 3VYVA 1AXGA 3CLKA 1GZ3A 3QI2A 1HBJA 1HDEA 2AK2A 4BFSA 1XDBA 4PSAA 1FFXB 5CDSA 3F47A 1W88A 3ZVRA 4NXNB 1V2HE 2SCUB 1PZMA 1U3FA 2YIVX 3MT9A 4LHVA 2JD2A 3ZY6A 1B8OA 2NU9A 8OHMA 4TS4A 5GPBA 1Z7WA 4GBED 4I14A 4D25A 1HE8B 1N4DA 1OGJA 1TKCA 2EZUA 2NPOA 5T3YA 1JHXA 4IYJA 3E9MA 4WZAB 4JSRA 4BX2A 4FN5A 2H4YA 3LT5A 2NXJA 5EUMA 2HHJA 4CLOB 2OWDA 1JAHA 2AMVA 3VH4A 3F3YA 1PZNA 1Z8HA 3FROA 1GG2A 2UYGA 3CZPA 1JDVA 1SXGA 2FQYA 3NCTA 4PANA 3T38A 1FW8A 5IJAA 3HB4X 3EJ6A 3PS9A 4GOLD 2O3RA 1ID8A 3NWOA 4YA6A 4Z53A 1BTOA 2R8XA 4INOA 4TT3A 3N6XA 4P86A 1U02A 3ZWXA 5EKDA 4YQZA 4RWZA 2HUNA 2NAPA 2QRJA 3AIKA 3O82A 4RMJA 4O2AA 3AKEA 1P7PA 4WOPA 3TSWA 3I9OA 5ETJA 1IDOA 3D6AA 3KXDA 1XEXB 2XAAA 4P32A 1II0A 1F8GA 3DXXA 2R86A 4B3MB 3D8SA 1F48A 5A3QA 4M8KA 3C3MA 4L2IB 3NYIA 4KQ1A 4U6NA 3GV0A 4YP6A 3ZHSA 1UK9A 4ES6A 5AM4A 4HT3B 1OXUA 4NF2A 1QF6A 5BW8A 1R16A 3FNFA 1ENPA 1JIVA 2X1LA 1QM5A 4KPGA 3D5EA 1WF6A 1XG5A 2D5IA 2FQWA 1CJBA 5LJIA 2WYWA 1ILWA 1US8B 1Z4OA 4D41A 2VYVA 2V7XA 1E7RA 2WJYA 3NEYA 1J2EA 3CINA 2Q3HA 4US0R 3N05A 4LJKA 3WIEA 4AYTA 4KR7A 5IDVA 1T3GA 3O4RA 2YH2A 2Z04A 4C0XA 3KYBA 5CIWA 4IZ6A 1VHQA 3ZHZA 1GSAA 4ZJZA 1NF2A 4JEHA 3RH0A 2GQ0A 2FPWA 1TYAE 1XK6A 3R3JA 2H5JA 3SC6A 3GLHE 1VCIA 4EYOA 3LCRA 2JI8A 3V2UA 1PX0A 1EFVA 1WD5A 3AGQA 4BVLA 4H1VA 4TN1A 2ADFA 3LUGA 3LX8A 3A7DA 3VAYA 5G0UA 3MUOA 1SUBA 2HMWA 2XOEA 1GTVA 4MWOA 4UE6A 1MO6A 4HYTA 4Q19A 3MCTA 5BSTA 4DMFA 5A2QA 1THGA 1XV5A 1Q12A 4IV0A 2UXDB 2PA3A 1IPFA 3LHSA 5LOVF 2GILA 3KOYA 3VKHA 2NMVA 4CKEA 1NPDA 1NZJA 1EX7A 4OHKA 2Q0XA 3ZE0B 3HKEB 5IHPA 3OCZA 1I7NA 2QUIA 3A9RA 3LT4A 1NHGA 1XZGA 4FJ2A 3P0JA 4L0QA 4TLEA 4ZYWA 5BN4A 4A2PA 2W98A 4MVXA 3KYIB 3IT2A 1L5FA 4KMOA 2H7CA 3N28A 4QLBA 2ZUBA 5HCIA 1R5NA 3G2IA 5CA1B 1HQCA 1VFPA 2C97A 1SXJE 2DWUA 3D7SA 3HKBA 3NFYA 3PNBA 4JOBA 5HIJA 4RTRA 4LJ9A 2ZSBA 4ISBA 1U2QA 1KVQA 5CVCA 3NHMA 1PTKA 3IEKA 1EVZA 2HZBA 1TQ6A 3LBNA 4MQUA 3KJEA 1P1JA 1AHHA 1K3UB 4N1AA 4L76A 4KPUB 3C8UA 4BYGA 2XUOA 4AS3A 2CMFA 3E5HA 2G9QA 3T5BA 5IDQA 5IPFA 4GBJA 2XE4A 3G8BA 3BMOB 2CWWA 5CIYA 4UARA 2IHUA 5I6DA 3IUEA 2WJZB 2DR0A 3OX2A 4IG4A 1JHRA 2BIFA 3VGPA 3EDMA 4L50A 3U9LA 4AP9A 4AG6A 3VFDA 2O8FB 1U3TA 3O1LA 3RS7A 5HP4A 5AKYA 1A9ZA 4QD3A 1NYRA 3G0HA 3F6PA 2XMQA 1MP0A 1KP3A 1ECGA 4X92A 4K0RA 4LDJA 3H8VA 5JARA 2DXIA 2N1MA 2MT9A 4E0BA 2WZCA 2DHQA 2B34A 4N8EA 1QAOA 3GX1A 2VDUE 2H2GA 1IG0A 3GGDA 2BEKA 4FFBB 5LB4A 3B1JA 4IW3B 5FL7D 1DC5A 4RXMA 1IB6A 4GW3A 2R65A 3SDSA 3VR4D 4YC7A 4ODIA 3CSDA 1AKTA 4IUCS 1A82A 9ABPA 5JISA 5JAHA 2C04A 1AV6A 2VATA 3R77A 1PVDA 3WJ1A 4X85A 1L3BA 1DRWA 2Q41A 4RE5A 4FKMA 2P7HA 3L7AA 3RSFA 1Y1TA 1CUUA 3UJ6A 2M1ZA 4J2TA 2IY9A 4B33A 1TEZA 3BBLA 2Q29A 4D57A 4N40A 1JDNA 1MX3A 1V5GA 2WBLC 4IXWA 1A77A 2P11A 3IKJA 4G2TA 2QMQA 1SBHA 2WU8A 5CNJA 2DHCA 1MXFA 2XMSA 1W48A 1T2FA 1C14A 2WUVA 2QTRA 2C2HA 2FAXA 3JVIA 1RQ7A 3ND5A 3CW8X 1E1LA 2HA6A 3U62A 1NT2A 1QONA 3DMFA 4F4DA 4FHCA 1VLHA 2XB4A 3AC0A 3MM4A 1T4CA 1WR8A 3MUEA 4JB0A 4FYJA 2DTEA 2HSWA 1IEVA 2RGUA 3G2LA 3M4YA 1O97C 4OJYA 4XPIB 3AY0A 1EINA 5CNKA 1A8QA 4IXNA 1FP4A 1Z5PA 2FVXA 2VS1A 4BFWA 5LSAA 5M7EA 4WLEA 1PUJA 4ND3A 4RJJA 4JXXA 4CM1A 2PUDA 2X8LA 2OGZA 3V42A 3PQ8A 1Q83A 2RGGA 3QA9A 5DTJA 5CFRA 1UF9A 3KQOA 1B8UA 3DE7X 3KKNA 3K5IA 1C7JA 1DTWB 2NYUA 4RZ3A 2XGSA 5EFZA 3F5FA 3WLSA 2I7TA 3UBTA 2RHBA 1VI5A 2R47A 2VPTA 4DN6A 4M0KA 2IF2A 3NS7A 4IS3A 4Y6PA 2GHRA 5EZQA 1A98A 3KQTA 4R05A 3AW9A 3B1ZA 1AY0A 1NFQA 2J6BA 1X8LA 2OT3B 2A9QA 2FWPA 3GUVA 3IBGA 4PTLA 5DB4A 4FS8A 4W7IA 4ZKEA 4AL4A 4AY3A 4D9MA 5BUQA 2ZB2A 1ZPDA 2IX3A 4XWWA 3B7GA 3PX7A 3ACBA 4URVR 4QDUA 1XVTA 4ZVTA 2D2VA 4YV2A 1AK2A 1FFDA 1FTYA 4OGWA 4JSYA 2OBXA 3KQPA 4UHCA 1FA9A 1TQ4A 2VXBA 2YWHA 4JY7A 2V03A 3ZHTA 5LQRA 1RI1A 3AK4A 5KVCA 4DQKA 1KZ7B 3FE2A 1WMBA 4YRAA 2JFUA 1GPBA 1DADA 1RM5A 1GDDA 4C6HA 4LF9B 5IJZA 4BTEA 1WP4A 1VPVA 1N1MA 4D3YA 1XCMA 1OA0A 3Q1KA 3FGOA 4TRNA 2VJQA 1I3CA 2W43A 3HN7A 1LDMA 3O2QB 3T7JA 2MINB 1ZN7A 3TMAA 5CEFA 4XIIA 3UWPA 1JXAA 1WRBA 2IYNA 4B34A 4Y2HA 5L45A 4B71A 3W9UA 2DLCX 5C7LO 4MR8B 5JVDF 1IN6A 4DQ0A 4TKMA 3GFQA 4WK4B 1I1QB 1NBHA 3KALA 3ZQ4A 1E3WB 4MV7A 1VOTA 4FMPA 1GP2A 5EJ4A 1U2EA 1F06A 1Q0QA 2YY5A 4HPJB 3FDZA 1U0OC 2B61A 1U1FA 4IWNA 3ROGA 1FXWA 1G5TA 2JLVA 3OHPA 5KAMA 1F20A 4IDGA 2AEMA 4RL4A 1FDSA 1R18A 4AZ3B 3S8EA 2Z3WA 2IYVA 4JUBA 1KE1A 1D07A 3KQQA 1XZKA 4KIUA 4PLWA 4INPA 1E2BA 4V02A 2IXBA 1GA4A 4QUEA 1P9NA 4NBLA 2X0FA 2R4TA 4U7FA 1ZUD1 3D81A 4IIHA 2D1TA 1EG7A 3P9QA 2AKEA 4J9UE 1U7WA 3MMNA 1GPLA 2PSHA 4IXTA 2OB1A 4N48A 5ENVA 1G8PA 1EWVA 4TSKA 4JIMA 1Z4LA 2C58A 3O4VA 1FDWA 1GKUB 1KOJA 5JDCA 1PT6A 1NUTA 2VTBB 4N3GA 4E46A 3CJRA 3AR8A 4R3WA 1J0BA 3RCBA 4KXMA 5L7WA 1WG8A 5IXJA 3CE9A 1OXMA 1JAIA 1W85A 2D62A 1TADA 1CHDA 4FYKA 3NIGB 3W8FA 2Z43A 3HVJA 1Y6JA 1Y1KE 2PQ2A 5SV2A 3DM9B 1RQLA 1YOBA 3G0IA 3H42B 1R37A 3O5AA 4ME6A 4NI5A 4M86A 4DA9A 4HADA 4LW8A 2AI3A 2D13A 2D1RA 3GLHA 2OTCA 4MV3A 1K5DA 2LWIA 4W8OA 2OVBA 3RC3A 3ZK8A 4TT8A 1P19A 1OBOA 4HKTA 3RTGA 4DAEA 3FFBA 1GO2A 4GOND 5G02A 3MBIA 2JGIA 4FBGA 1NL3A 3TDMA 3A4VA 5K8VA 2GPJA 1P4AA 3STTA 2QA5A 2ZBUA 3UWSA 1ODJA 1QQ7A 4QU5A 3NHPA 4RIHA 3L8YA 4LWZA 3DWEX 2XYHA 4MEAA 1OASA 1XMVA 3VSBA 5TARA 3QUBA 4UNQA 5CB8A 4I3GA 2JVJA 2V7PA 4N7BA 5BSHA 4P7GA 2MMGA 4AKEA 4H35A 3Q8XB 3GT4A 3ZWCA 1XLTA 2YXNA 3P4YA 1UPCA 1A5BB 2IDKA 3CUTA 2JFOA 1M34E 2Z09A 3SS9X 4K81B 2YMMA 4BWYA 5K6AA 1W47A 1AURA 3W2HA 2AG5A 2DWQA 1GNQA 2IC5A 2I7XA 2BMWA 1IMJA 1G20E 1LX7A 3H75A 4FW8A 2PKWA 3CLUC 2Z8YM 1Y81A 2XUFA 3H2KA 3I72A 4R3NA 5LZ8A 3VNVA 2W6MA 1CUHA 3OETA 5JXWA 4CLEA 2BFOA 1FW6A 2M1XA 1W4CA 3QEMB 4TWZA 2Y1EA 1SXJA 1QHFA 1ZOPA 3GFTA 4AK9A 2F48A 5H70A 1YA8A 3KYJB 3C3XA 4XQCA 5BNIA 2QQEA 3BL5A 4B3BA 2G09A 1I3MA 2XZLA 5DHSA 3SQDA 1FTSA 3ZJ5A 2WD7A 3Q3EA 3CLVA 4CLRA 3K5HA 1W6RA 1C1HA 5KNDA 2DWCA 3QFHA 4OQFA 1QVVA 4XX1A 3OFSA 4YUWA 3RYIA 4TKVA 3RU2A 5BMVF 3P2JA 1Z5GA 1JQDA 1MX1A 3IAXA 4P1ZA 4DA0A 1A95A 1BMTA 2Q3FA 4P3NA 1E92A 2Z4RA 2Y76A 1D1TA 4D97A 4PCAA 2BZGA 1HDYA 1DAGA 4RZHA 4HDRB 2CDBA 2HJHA 5EKXA 3WX0A 2EKZA 4XQGA 4EW3A 2QZ9A 3GRRA 3QVWA 3K9BA 1XLTC 4V1CI 4J03A 2GS9A 3A9CA 4OGFA 3CFYA 4LBWA 2W2VA 3K1ZA 3ZIAA 5C5DA 1V1RA 3IQXA 4CM8B 5CNIA 1FRFS 1HKUA 1SKQA 1ULAA 1TEHA 1VCHA 1NSFA 4RFLA 5K6AC 4KIFA 2ISSD 3DUWA 3HM2A 3D9QX 3QLEA 4H3VA 1WV0A 1AUQA 2J59A 3PGLA 3EH1A 3FRHA 1LPSA 1L1EA 3ORSA 1FZTA 1LSOA 4ZALA 1SXJC 1LW6E 4Q3EA 1ST3A 4NCXA 4UUQA 1L4MA 5LUAA 4H9GA 5JMPA 1Y42X 2CNBA 3FGNA 3OMXA 1Y8QB 1JJAA 4IEEA 4BZXA 3TRJA 1Y5LA 4P4LA 3DKPA 4Z49A 1WBJB 2ACVA 3B8HA 4JDPA 1F6WA 1QE3A 3IO3A