3HJUA

Crystal structure of human monoglyceride lipase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
291
structure length
291
Chain Sequence
PRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Human Monoacylglycerol Lipase, a Key Actor in Endocannabinoid Signaling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Monoglyceride lipase
total genus 103
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hjuA00
3VXKA 1TAHA 5CURA 2PUHA 4FNMA 2O2IA 1C7JA 1ZI9A 3BDIA 4GW3A 1DWQA 1F6WA 5AKGA 3C43A 3MGAA 3QZUA 1USWA 3OPMA 1TCBA 3V1NA 4GEGA 3FSGA 4H7EA 4KRYA 4G9EA 1SOMA 1ISPA 1O6GA 3R3YA 5K3FA 1BN7A 2WIGA 2O7RA 5JATA 1YB6A 4J0GA 3RK4A 5AOAA 3WK9A 3AFIA 5DNUA 1J06A 2E3JA 2GYWA 4QWMA 4WDQA 2YASA 2Q0XA 4Q82A 2WTMA 1XRQA 5ALFA 1J1IA 2WG2A 2RAUA 1LPOA 4NS4A 3DJYA 4AQDA 4KAAA 5T4FA 4AX4A 5CH5A 1HLGA 4V2IA 2VEOA 4U2EA 3C45A 3CCBA 2Y6UA 5K3FB 4GHWA 5K5EA 4PNZA 4UBIA 5AK4A 4BZWA 2B9VA 2PSFA 2JGIA 3ILSA 2FX5A 2OXEA 4OYYA 1TRHA 3D3NA 5KBYA 4ZRDA 1H2WA 4X94A 2HFJA 1XZEA 5CH3A 4X95A 1ZI8A 3DCNA 3Q0TA 1CUSA 2XUQA 1F8UA 4H0CA 4F5ZA 4QDXA 4UHBA 1ORWA 5D3ZA 1JKMA 4LYEA 1OCEA 1UOOA 5AKZA 5IVHA 5ALRA 4MXDA 1BEEA 3F9CA 1UOQA 4CCYA 5CXUA 3DEAA 1BE0A 3WWOA 3HSSA 5IH7A 4BDTA 4ZGBA 4BAUA 4UHFA 5F4ZA 5FPQA 3WKAA 5DNVA 1VE6A 2X5XA 1XLUA 1GPNA 1ETHA 2XMBA 4QA9A 5JZ9A 1C4XA 1W6RA 1XRLA 3HZOA 2WFMA 2BFNA 3QH4A 4OCZA 5ALOA 1QGED 4ZXFA 1FFEA 4JNCA 4OD0A 4HTAA 4X93A 3U1TA 2XUFA 2DQZA 2JIDA 4H7FA 3B12A 3FCYA 4XIIA 4ZV9A 3H1AA 3P2MA 4DMCA 5A62A 3PUIA 2ZSHA 4WFIA 2CB9A 4K6HA 1ACJA 4UBOA 4GDMA 3R3VA 1PJAA 1CUZA 4HZGA 1F0PA 1LZLA 1WPXA 3VKFA 3NOXA 4UBJA 1UKBA 3AIKA 1MU0A 1XLWA 2ONCA 4JYMA 1XZKA 3I2FA 2WUEA 3OTQA 1MX1A 4X91A 5JIBA 5HF8A 4F60A 4TGLA 1R3DA 3H19A 1IVYA 1K6EA 2OCKA 4WDRA 4J0CA 2QMQA 4Y2PA 1YS1X 4N8SA 5AKYA 1T4MA 1EB9A 4X92A 4YK7A 2AJDA 4GECA 2WU3A 3I2KA 3QMVA 4JYPA 5DYWA 1ZOIA 5LKAA 4C4YA 3AINA 1DX6A 5CH8A 1W4LA 4AN1A 5ALMA 4C4XA 4Y2JA 4ITVA 3DL4A 1ZJ4A 2QXTA 3QPDA 3G9UA 2JBWA 3LLCA 1TCAA 5ALIA 4FFVA 5EFZA 3S8YA 3H2IA 4Q3KA 2Z8ZA 3IUMA 5LZ7A 3V1MA 2H1IA 4KE6A 3IUNA 3L1IA 1UOPA 4IQ4A 4Y2XA 3H2KA 4BTVA 1MJ5A 4E11A 1PFQA 3ESDA 3ANTA 2XUDA 3O4HA 3IURA 5CTAA 3DKRA 1HBJA 3C70A 2WJ6A 3O9MA 4MWTA 5CMLA 1VJ5A 3SK0A 4BVJA 2Y1KA 1BEZA 4A5SA 5AJHA 3MVEA 5A71A 2DSNA 3V9AA 3M3DA 3BJRA 3A70A 1J07A 1TQHA 4X6YA 2VSQA 5AKEA 1R9NA 2R11A 4FLFA 1YB7A 2O7VA 3FSGD 3EBLA 1XQYA 4PQEA 2I3DA 1VOTA 2D0DA 4W1RA 3GA7A 1GQSA 3G8YA 3QMWA 5CRIA 3YASA 6YASA 1WB6A 4Y2YA 4DTCA 3FWHA 3QITA 3KDAA 4L9AA 1FFCA 3C87A 4Z49A 4AXBA 5ALDA 5KWIA 1CUFA 5HFAA 1YAHA 4J03A 1AC5A 1T2NA 4ZWNA 2XUJA 5CW2A 3AZOA 4XVCA 1X2BA 4MQLA 3ICWA 3WL8A 4QDOA 3FAKA 2PSJA 1E66A 5AHXA 2WHPA 3I6ZA 4BCDA 3DOHA 1VZ2A 1U8EA 5JAUA 1FFBA 4FBMA 2QUBA 1DX4A 2C7BA 4HXEB 5IVIA 2EDAA 3C6ZA 1WHSA 5EHNA 4Y2TA 4BAGA 2EDCA 1W1IA 3C5VA 3WKDA 2V98A 1JJFA 4J7AA 5K3CA 5T4BA 2WKWA 2G4LA 4BAZA 5AOBA 4EHBA 1X70A 2XB6A 2JGMA 5AI6A 2OQVA 2VTVA 3W2TA 3N2ZB 2GYUA 4U2BA 1CUCA 3I28A 3ESCA 2ZJFA 4NZZA 1P0PA 1IMJA 4G4IA 2VJCA 3STXA 4OUKX 3I2HA 3GELA 2ZVDA 5JANA 3IB3A 1DQZA 5T4HA 4AN0A 2XDWA 5EIEA 1Y37A 4I3FA 1UT6A 4B0PA 1VA5A 2I3ZA 4DNOA 2WHQA 4K6GA 1BN6A 4BP9A 2XUAA 3D2AA 5I7UA 4UBLA 1IUNA 1C7IA 1XZJA 1VLQA 5AM2A 4WJLA 5AO9A 4FHZA 5CT9A 5FRDA 4AB1A 3DLTA 3STVA 1XKTA 2H9YA 5AI5A 1DQYA 5JAPA 5HFNA 1CV2A 4P9NA 2ZYSA 3DKKA 2XMSA 1DINA 1XZCA 1QIDA 5AICA 4KR0A 2PBLA 3WL5A 5AI0A 5CT8A 3PE6A 1ORVA 4C4ZA 1BS9A 1H22A 1IUPA 2GZRA 4UBMA 2HRQA 1YS2X 2W6CX 3STTA 4Y2VA 4G8DA 5ALEA 1Q0RA 1ZD3A 3PFCA 3W06A 2WILA 1DU4A 2XUIA 3M83A 5BWBA 5CT6A 4H7DA 5AI9A 4RE5A 4L72A 3ZLTA 4UHEA 1YSCA 1EVQA 3W9BA 3IA2A 3ZI7A 1CVLA 3WWEA 3RARA 5A7GA 2DHDA 5LYYA 4BTLA 4E14A 1Y7HA 2WTNA 1CUYA 3WYNA 3HYSA 3FYUA 1CUHA 3L1HA 5SYMA 3G9TA 1CR6A 5K3EA 1XQVA 1GKLA 3SWWA 3WK4A 2HM7A 3R3ZA 1ZICA 1YA8A 2Z8XA 5AM3A 3STUA 5AKLA 4OB6A 2VQ6A 4H7HA 4Q3LA 2WIDA 3B5EA 3ESBA 2ECFA 4J0JA 2CJPA 1A7UA 3L1JA 3FYUC 5EHQA 4MYSA 1QO7A 1W75A 2B61A 4DLNA 1GPKA 3ZPXA 1ZD2P 1B41A 5T4EA 4FWBA 3D2CA 4EUSA 1VZ3A 3TJMA 1LPPA 3RM3A 3AIOA 4P08A 4E15A 1JMKC 1UK7A 4BYMA 3CXUA 5A6VA 4QDZA 3WWCA 3IIIA 4EY5A 1W76A 3CN7A 2GYVA 1XQWA 3ESAA 5A2GA 4XX1A 2DQYA 1CUWA 3WA7A 3GUUA 5DTIA 2Y2VA 2RONA 1AX9A 5ESRA 4W63A 3FOBA 4UBNA 4IH4A 1QIEA 2OGSA 2CKMA 1IZ8A 3R3UA 3IULA 2X76A 3SX4A 1LGYA 4DIUA 1BRTA 1A88A 3W05A 1IZ7A 1CUGA 2XUOA 1Q84A 3C8HA 4BVKA 5FUMA 1GXSA 4G1FA 1TKRA 1U2EA 4PSDA 4HVTA 3ANSA 1ODTC 2WUDA 5ALSA 1TCCA 5HF6A 3FLEA 3PICA 5ALHA 1VKHA 5HQ3B 1E89A 1XRPA 3ZLVA 4PV7A 3AILA 5HF5A 1H2ZA 1BCRA 4KE8A 2PVSA 4P93A 2HRRA 4IH1A 4Y2SA 3I6YA 4CG2A 3AZQA 1XQXA 1GKKA 5ALKA 4ZV7A 5ALGA 3TEJA 1N1MA 2CZQA 1P0QA 1XFDA 1FSSA 2FJPA 4WCVA 3SC2A 4CI9A 2VA9A 5JYCA 3EQ7A 4KRXA 1QIMA 5LZ8A 1D07A 3IVMA 5JADA 1UXOA 4UHCA 4JEIA 4OU4A 2AJLI 1Q83A 2VAXA 2GZSA 1VXRA 1MAAA 3FVRA 5HKBA 2PSDA 1CUBA 2XUKA 2JGEA 2C58A 2C5GA 3E3AA 2HL6A 3DQZA 1EB8A 4M0MA 4B9AA 2IX9A 3A6ZA 1XROA 1U65A 1MX5A 4KEAA 3C8DA 2PX6A 5C7YA 3ICVA 5HK9A 1MTZA 4H18A 2RGUA 3EQ9A 5ISMA 5CBKA 2VATA 4UUQA 3G9XA 5BV7A 2VF2A 3BDVA 3T4UA 4QLOA 4W1QA 5DNWA 1XLVA 5JALA 1CUJA 1QIJA 2JGKA 2ES4A 4GLBA 1UK8A 5EHXA 4UPDA 5AP9A 2O2HA 5EIHA 4IH9A 4KYVA 4C6HA 2BGNA 3HJUA 3GFFA 3PDCA 3BJMA 2XQJA 3OC0A 4N5IX 3H18A 3HRHA 1Y7IA 1FFAA 5JAOA 1XZIA 3M81A 1GZ7A 2AJCA 3FBWA 3E4DA 1M33A 3I2JA 3HLKA 1E8DA 5EIAA 1CQWA 1SCKA 3VVLA 1LPNA 4LIPD 3ED1A 2WHRA 1LLFA 5FV4A 2WIKA 5AK3A 4AMYA 2G5PA 3D2BA 1GT6A 2ZSIA 2DHCA 3LCRA 2C0PA 4UFOA 3LIPA 1XZDA 4X00A 1F0NA 3VJLA 3QMMA 3FVTA 5C8ZA 5LZ9A 3F67A 4QDUA 4B6GA 4G8CA 1MNAA 1EXWA 5E4YA 5DWDA 1G5FA 2OGTA 2DHEA 1XKLA 4PSUA 5FPPA 5ALQA 2YYSA 1EX9A 1XZMA 3IDAA 1EI9A 3NGMA 4OB7A 4ETWA 1ZGCA 3D4LA 5IKXA 1ODSA 1QFMA 3WLAA 4H7JA 4GBGA 2PPLA 4TPKA 4FOLA 1Q0ZA 2WFZA 3HC7A 2XLBA 1EA5A 3WJ2A 3DDUA 4NMWA 5FKJA 3HACA 3QPCA 4CIAA 2ZJ7A 4IO0A 4BBZA 1MX9A 2Z3WA 2JGLA 2OLEA 2CBGA 3O95A 1CUUA 5JD4A 2JEZA 2OQIA 3V1LA 1OXMA 4UHHA 4CG1A 2QT9A 2X8BA 4PSCA 1N5MA 3WZMA 4KE7A 3UUFA 2CUTA 4X7BA 5HK8A 4LHEA 4BE9A 2XQFA 2GBIA 2FJ0A 1BROA 1CFJA 4EY6A 5CXXA 3WI7A 1RWQA 3QBJA 4ARBA 1L7QA 3O4JA 4C88A 1EDDA 1QIKA 4H7KA 3STYA 2Y6VA 2AJBA 5JZSA 1UK6A 2QXUA 4B83A 1TIBA 3G7NA 5JZBA 1XZGA 3R3XA 2XMQA 4RGYA 3I1IA 4QWWA 1R1DA 4DM7A 4OYLA 2O2GA 1UKCA 4X90A 4QNNA 1E8NA 1MPXA 4N8EA 3IBTA 5A7HA 2WIJA 3B3QA 3WL6A 1O6FA 4BRSA 4U2CA 5ALXA 2HA2A 2WIFA 3EIOA 2XMGA 1UZAA 3IUQA 3C6YA 5SYNA 3LS2A 2UZ0A 2G5TA 4QZVA 3OOSA 3LP5A 2XUHA 2RIPA 3NWOA 2HHAA 3H2JA 4FKBA 2P8SA 3H1BA 1DWPA 3O9VA 2J4CA 2V96A 2XQIA 2DFPA 1LBSA 2WFLA 5C81A 4LKOA 1DT5A 5LIPA 5ALNA 1CUDA 1S8OA 4BC1A 3D0KA 3WK7A 4KAJA 4C01A 4UBKA 4YX9A 2EEPA 2ZYHA 1N8SA 2J4FA 2VT7A 3F8SA 2HU5A 1R50A 5HZGA 3G02A 4C89A 4E46A 2ACKA 1THGA 3H0CA 5FXMA 1SC9A 3HI4A 1BU8A 4QLAA 3G0IA 2LIPA 1K63A 4D9JA 3BIWA 1CUXA 4FFWA 4HS9A 1AKNA 4G4GA 4LYDA 3I2GA 1H23A 2HADA 3ZLUA 4INZA 4B7ZA 1WCYA 4ZI5A 1ZI6A 1DWOA 2ORYA 3DYIA 3DL7A 2XLCA 2PL5A 1ODCA 1QONA 3IUJA 3WYDA 2XMZA 2V9ZA 4DGQA 4WFKA 3JW8A 5HF9A 1G42A 2C4HA 5LP1A 3DOIA 5ALPA 4DSAA 4BRZA 4X97A 4BATA 5LLSA 5AM5A 4HXFB 4RPCA 1EH5A 3EF3A 1J2EA 3CCCA 5AKHA 4CCYB 1N5RA 3D59A 3W04A 3JYHA 2HA3A 3FYUB 4FDMA 3KD2A 4B85A 4J0DA 2VAVA 2QS9A 4BVLA 2VT6A 5AKJA 2QTBA 2WG1A 3D5EA 3KXPA 3OM8A 4J0HA 4MEAA 4QDTA 2BUAA 5LZ4A 4FTWA 1CIJA 2PU7A 1CUIA 4MEBA 3FCXA 1LBTA 4Y2QA 2WU4A 1G66A 2BAGA 4BCCA 3UMJA 4AO8A 3OURA 1XZFA 3WIOA 2C0QA 5ALLA 5JAHA 2DCMA 1Z68A 1GQRA 3V1KA 5AKKA 1ZGBA 2ZYIA 2OAEA 5AK6A 5AH0A 1LPMA 2C5FA 3JWEA 5JASA 2QKYA 4CFSA 4X71A 4RE6A 3RLIA 1B6GA 4BB0A 2OCLA 4K2AA 4UFNA 1BCSA 5LZ5A 4X3CA 4WY8A 3VVMA 2VJDA 5BOVA 1QLWA 3TGLA 5AIAA 4W1SA 4KAFA 4X85A 4DSZA 3O4GA 4G9GA 4GI1A 2QUAA 5DJ5A 4B0OA 1FFDA 4HAIA 1VXOA 2XI4A 1ZJ5A 3GBSA 3DYVA 2NW6A 4EB0A 1K5PA 1ZIXA 1EDBA 3PF9A 2CMFA 1ZD5A 4EA6A 5FP0A 1EHYA 4W9RA 3MUNA 3QM1A 4WY5A 2OCGA 5A7FA 5KWJA 4BCBA 3GZJA 5HQ3A 1YASA 2HFKA 1R88A 4Y2UA 4U2GA 5AM4A 2WQZA 1A8UA 3R3WA 5IVDA 1XRRA 4ARAA 3WA6A 1PV1A 1K4YA 2BKLA 3AZPA 2GBCA 1LNSA 2VJBA 5K3BA 4DYHA 4PF1A 3WK5A 2WG0A 1CLEA 2QZPA 4L0CA 3G9ZA 3BF8A 4MJ3A 3C6BA 5IVKA 5EI5A 5K3AA 1EK2A 4WFJA 2OCIA 5LKRA 5FLKA 1UK9A 3KOOA 1IUOA 3C5WP 4A16A 3PF8A 4FNGA 4KE9A 1EK1A 3WKBA 4I19A 3AUKA 3I6MA 5EGNA 4MQMA 1DTEA 2XT0A 5DLPA 4HRXA 5CT5A 1UFOA 2XMRA 3AJAA 3WL7A 2PKYX 4G5XA 3WZLA 3H04A 1JJIA 3PI6A 4GXNA 2QJWA 2HA5A 2WHPB 1VA4A 3EQ8A 4Q3OA 4BC0A 3VDXA 2BGRA 1QIGA 1WM1A 4K6KA 1QTIA 4GWLA 1P0MA 4XJVA 1QE3A 1CRLA 3I2IA 1KU0A 1UKAA 4J0KA 2B20A 3R0VA 4G4JA 1QIFA 3M82A 2BUCA 3HXKA 5I9IA 5K3DA 2QR5A 1R9MA 1JFRA 3TRDA 3OG9A 5HCUA 1KU6A 4X6XA 4H7IA 1AURA 1MNQA 3HABA 2QRUA 3ZV7A 1QIIA 2WJ3A 4HXGA 1L7RA 4DNPA 3BL8A 3O0DA 2XUGA 4G8BA 5ALUA 4LXHA 4H77A 4C87A 4OSEA 4OU5A 3MUOA 4EY4A 5AM0A 3G0BA 3R41A 3Q8WA 4XWGA 1QTRA 3BWXA 1LPBB 5DTJA 4EZIA 1WHTA 2ZYRA 5YASA 7YASA 3WWDA 3O4IA 4PO3X 4DMHA 5JD6A 1AQLA 3RKSA 1ZD4A 3GROA 4F0JA 4O08A 5FDFA 1A8SA 2XE4A 4HRYA 1P0IA 4BZZA 3U0VA 4OPMA 1MAHA 4DMFA 2AXEA 1HPLA 2JF0A 3F97A 4TVKA 2IIVA 4ZREA 1A8QA 1MT3A 3K2IA 3H2GA 2CEKA 4B84A 3WKEA 1WB5A 2QVBA 4QEKA 2JGJA 5ALVA 5J3JA 5ALWA 3S2ZA 3WIBA 5CT4A 1HL7A 2WUGA 2ZJ6A 5I8PA 4FBLA 3WJ1A 3QYJA 2W22A 2JEYA 3CN9A 1RYYA 3T52A 2WSLA 1EINA 1XZLA 1QFSA 1HDEA 2OG1A 4EY7A 3BE8A 1H2YA 4P92A 4Q1VA 2WFLB 5C8VA 4S0XA 4FLMA 5AM1A 4M0FA 1JT2A 3UUEA 1ACLA 1YR2A 1GPLA 3NUZA 5JARA 4L3WA 1SCQA 2GBFA 3PFBA 2HIHA 3E1GA 2HU7A 1CQZA 3FLBA 4B82A 1WB4A 4RNCA 2HU8A 1QZ3A 2XQGA 4NVRA 1JU3A 4FMPA 5AKIA 4DMKA 3FLAA 4AO6A 1CUVA 3G0CA 2I78A 1L7AA 2Z5GA 3BF7A 2H7CA 1QO9A 2Y2UA 3F96A 5FOQA 3BXPA 3WQHA 5D3KA 4KACA 1HQDA 5E4TA 1VE7A 3A2NA 1AMNA 2DR0A 3BIXA 5ALTA 2QOEA 2BCEA 4F21A 3VISA 3K9BA 1MO2A 1U4NA 2XMCA 4UFPA 2Z3ZA 4ROTA 4CG3A 2I03A 3X3HA 1I6WA 1NU6A 1G4HA 3WKCA 1JMYA 2PSEA 3WK8A 1JI3A 5D6OA 1HKHA 5ALJA 3A2LA 3LIIA 2ROQA 1LPAB 4W1PA 1OILA 4X6UA 5AI4A 2HA0A 3C6XA 3DNMA 1W52X 2K2QB 1E8MA 3K6KA 1EDEA 1TK3A 5D7BA 3N0TA 3VJKA 4YASA 4EBBA 4CCWA 1AGYA 2YXPX 5E4JA 1CUEA 2G63A 2J3DA 3VJMA 2ACEA 1UWCA 4Y2RA 2RHWA 2HDWA 1NX9A 2JGFA 2PU5A 2QJRA 1THTA 4IHAA 5AOCA 1JU4A 2XQKA 2QM0A 4LXGA 2RI6A 4Y7DA 3G0GA 3QVMA 1FJ2A 4UHDA 4I4CA 5AIBA 5KREA 4JH0A 3G0DA 1XZHA 5AK5A 5AKXA 2HA7A 3FNBA 4A23A 3R40A 3W9UA 1SCIA 1XRNA 4DNQA 4AMZA 5ALYA 1X2EA 1AUOA 1DT3A 2FUKA 1AZWA 1YA4A 5H3HA 1LZKA 4EY8A 3A2MA 2R8BA 3DS8A 1E3QA 4U2FA 1NU8A 3E0XA 2BUBA 5LZ2A 4H35A 4FLEA 3WK6A 2H7XA 1QJ4A 2WM2A 3KSRA 3WMRA 2GBGA 2YH2A 4AZ0A 2HA6A 1SFRA 1EVEA 3HEAA 2VJAA 4BP8A 2AJ8A 2IITA 4QE3A 2OAGA 1H2XA 3F98A 4M0EA 2BJHA 2HA4A 3STWA 3V48A 2PM8A 1KEZA 4DNFA 2OPHA 4MWSA 1GGVA 1WPRA 3H17A 3I1YA 4YPVA 1YCDA 4LXIA 2PSHA 2PUJA 5ALZA 1CPYA 1E5TA 2XMDA 4AZ3A 1RP1A 4B80A 4PW0A 5HKAA 4Q34A 2WLSA 4Q05A 3H2HA 4K5QA 4CIBA 4MYDA 4OB8A 3WWPA 3KWJA 3FYTA 5DYYA 3KWFA 1K8QA 2XUPA 3PUHA 4N5HX 4B9EA 4B81A 2V97A 4J3JA 1CEXA 4N8DA 5EHZA 5E2IA 1JJBA 4BDSA 4U2DA 1XZAA 3QPAA 1XRMA 3AIMA 5C8XA 2J3QA 3DD5A 2WJ4A 5DYTA 2D5LA 4AO7A 1ZIYA 2RHTA 1R4ZA 5AI8A 5BWCA 4KJXA 3ZWQA 1XZBA 1YAJA 4Y9SA 1LPSA 1QOZA 2OGZA 2WUFA 3D7RA 4JUIA 1WOMA 4BE4A 5JD5A 2B4KA 1CUAA 1MN6A 1QIHA 4J0IA 2H7YA
chains in the Genus database with same CATH superfamily
2LRHA 4ZQCB 1TAHA 4YEDA 1TKBA 1Z18A 2DSTA 3ZCRA 1N2OA 2MU1A 1WNFA 3R0JA 4OL9A 3E2PA 4C6RA 2PUHA 2GRAA 4Q00A 3R6LA 1JHPA 1X7YA 2WZQA 3BSFA 4CLHA 3OQIB 3GLVA 1DIRA 2EQAA 5IAJA 3UHPA 6Q21A 4ZCSA 4GW3A 3GLRA 4HLQB 4B2YA 1II8A 1F6WA 1QHFA 5K05A 5FBHA 3RVDA 3C43A 1SXJA 4BYGA 2VRCA 4F1JA 3EUAA 3EGXA 3R7SA 3KOUA 5KNCA 5JHHB 1TCBA 2GK4A 3I3OA 2YICA 1VYUA 4GEGA 2B69A 2QAJA 3EBOA 3V1NA 3WLQA 1MRNA 4GOOD 3PYLA 2X5NA 3U4MA 1XVVA 3ZW7A 4FK8A 2BTQA 2OORC 3CLRC 3HJBA 4G9EA 1TZKA 1AE1A 2QTNA 4ILKA 4RXTA 4BKUA 2JLBA 3SJBA 2VDMB 721PA 2VPWA 4OQ4A 5BPHA 2ZRNA 4MB2A 1Z2DA 4C2UA 3R3YA 5K3FA 2P7IA 4QHTA 3BJZA 2QD3A 4P2BA 5IABA 3UNXA 1BN7A 3CEJA 4X9XA 3WV5A 1G20B 1XEWY 3A37A 5KAPA 1U8CB 3RK4A 1BS2A 3WWZA 5AOAA 5KC9A 1GTSA 4CGYA 5AJUA 3D6FA 4NBLA 3SS8A 1ZFNA 1ZCZA 2X7XA 3E1SA 1J06A 1Z0UA 2AG6A 3PI7A 2AE2A 1A1VA 3WZLA 3NOQA 1DXHA 1DPGA 2W2QA 5EN4A 3WDLA 5K0NA 4EX6A 7REQB 1H0KA 1MQAA 2EARA 5DNDA 2G3YA 2M6KA 4D0RA 4CQMA 4Q4HA 2ZROA 3DJYA 1KR5A 1M7GA 3MGCA 4OJQA 4FFRA 4E4TA 4ZYZA 1K86A 2TRSB 4R1NA 5T4FA 1PT5A 2OFXA 5JRZA 1YL7A 3USES 4KMOA 2E1PA 2WAYA 3LTEA 1N2XA 3IODA 5GPBA 4EWLA 4OOEA 1X8JA 2WV9A 3G5AA 2E85A 1HE4A 4UU8A 2C1XA 4M1SA 5CDSA 3CCBA 2J67A 1OZFA 2Z4RA 3CRMA 4DIEA 3GLIA 1G8KA 3COYA 3O8QA 2MDTA 3Q0EA 2DPXA 3B9RA 4FI3C 3W5UA 2ZXEA 3EYWA 5FR2A 1J20A 3T94A 5A1TA 5K5EA 1H9BA 4UBIA 1EFHA 4FZ3A 3GGJA 1EUYA 2QTFA 3H5RA 4WWHA 3COSA 1EFRA 4ZXPA 2G71A 4BZWA 2YX1A 4XQ9A 4DADA 4FYKA 2PSFA 1QH8A 1YT5A 4PGAA 1MP0A 3W7VA 2JGIA 4LE0A 5BNZA 3ILSA 2Z83A 3Q72A 4XUDA 3A6PC 5H7XA 3TI9A 4ZTBA 2FMKA 4MVYA 4M8IA 3QFCA 4O8CA 2P0EA 1M74A 3NWEA 2HIAA 2R60A 3ZNOA 4BJ5A 3FRHA 1U7WA 3L06A 2QHXA 4UARA 4V38A 5I48A 1ZR4A 4BRUA 5HRAA 1V35A 2ZRJA 1ILEA 3Q9LA 2YFYA 3SE7A 4KN5A 1PQUA 3NV9A 5KNBD 2Q5FA 1NBWB 1TGYA 1CQJB 4NYIQ 1L4EA 2C97A 1C1XB 4X95A 3TRHA 2OD9A 1USUA 3LRPA 3Q0TA 3OIWA 1N8NA 2FN7A 3Q11A 1F8UA 1FQOA 5BMVF 5BV8A 1M2VB 4QDXA 3RLFA 2X77A 1NBEA 4YCBA 3EXEB 1C7EA 1W0JA 5JDCC 3FCUB 1YZNA 2XVZA 5D3QA 3SXPA 4LYEA 4CM5A 1N8TA 4JT9A 3I1JA 1WJGA 1KZ6A 2VSFA 1H4TA 2G88A 2ZSDA 3BM5A 1FMFA 1S4QA 1WE2A 2DECA 1KMHA 1A82A 4EGSA 2PUVA 1BEEA 3NASA 1G2IA 2L42A 4RM2A 4TLDA 4YAFA 1YFJA 1H05A 1X1DA 1X3SA 1Z35A 1KK1A 3R7NA 3DEAA 3QUCA 2EHDA 3G3EA 4HN4B 1VSTA 5B64A 1T0IA 2RHBA 3S2UA 4ZCRA 5EIXA 1BXZA 1UBKS 3HSKA 1H94A 3GLTA 2OL4A 1E1CA 4COOA 1M3SA 3OA0A 3BGIA 4C4TA 4AVYA 1DG9A 5DNVA 3TBFA 2JJ8A 2X5XA 4YFYA 1AOXA 1N6PA 4Q6BA 5ER6A 3V8QA 3WFIA 1N6OA 3FOEC 4Q9IA 1GPNA 1ETHA 2XMBA 5C4GB 5AVRA 1N1GA 5AVZA 2GS9A 1U9JA 3ZDBA 1NPYA 1T13A 4HS4A 3HZOA 1WQ3A 2Q41A 3BTVA 3FRJA 1QGOA 1A9SA 1CR2A 1QB7A 2ZTMA 4HPXB 1QGED 2FP3A 4FCVA 4JA2A 4OHFA 4QBKA 3RO7A 3OC6A 1UP4A 2XAAA 3N9IA 4IOKA 1UMDB 2QYSA 3T5DA 1N7IA 1WABA 2W48A 4YECA 4D44A 1L7BA 4W9NA 3HCPA 2OZLA 5HCIA 4MQ4A 4X8OA 2AV6A 2FRVA 2QG9A 5BURA 2NPOA 1BWSA 1XCGB 1SU4A 3A9TA 3RAFC 1K3TA 3QU7A 1FP4B 3KUDA 3PB3A 2N1BA 3VMFA 3HDHA 4MTLA 2VZ0A 1HMYA 2GF0A 4HAZA 3BL6A 2VNIA 4QJIA 3SKVA 1VHJA 4DMCA 3Q7RA 4ARZB 2BDUA 5D8DA 2DCUA 4UBOA 3KYJB 5EINA 1PVVA 4JL8A 5DBIA 2FR8A 5C1BA 2BTEA 3OEHD 2LTAA 2Y1EA 3CIOA 2FRDC 4RVCA 2OKCA 4CKXA 2PMCA 4H1VA 5K09A 1VP9A 3GFSA 3SYRA 4JXZA 3DAFA 4F2GA 2WRZA 1W94A 1WZEA 2DWUA 3IQZA 2W0MA 2MINA 2J9YB 1QV6A 3M49A 4CKCA 1LZLA 4ECEA 4DR2B 1MB0A 3SJAA 1UMDA 2J3JA 4RK4A 3SVZA 1UMCB 5LLTA 2HTEA 1JUDA 4ZALA 1XLWA 1YJCA 2ONCA 4WESB 4LWZA 2WUEA 2R4QA 1E2IA 4EF6A 4I9HA 1L4FA 1U2PA 4ZVMA 1L5KA 1N5KA 4BJ6A 4GI3A 2A67A 1MGOA 4ZJUA 1A77A 4YYEA 3B8HA 2UZIR 3FETA 4JXJA 5SY4A 4F60A 4J16A 4RTOA 1IQRA 4TGLA 1RU3A 3BCUA 1R3DA 2W2KB 2Q21A 4EQZA 2GEUA 5EWMA 3ER9A 1HFKA 1D6NA 1RPTA 1D4ZA 1C8LA 3LDUA 1RJDA 1IVYA 3KVYA 3A25A 4O0LA 3KJEA 4ARZA 1O4VA 1SUEA 1TC2A 1WXXA 4FGSA 2OCKA 4CL0A 4WDRA 3NIBA 2F3SA 1YGPA 3U17A 3RU3A 1QANA 1RFGE 2WWIA 4FYVA 4XYEA 3ZCQA 5I7RA 1GPAA 2OXFA 4Q16A 2FMXA 2PKEA 1GZVA 1PWHA 2IPAB 3NH6A 2QN8A 4Y2PA 5EP3A 3GO4A 4DNXA 2PFSA 1T4MA 4X92A 1GA6A 4Z99A 2BV3A 4NENB 5LA6F 4YMHA 1O77A 1B2RA 3ROEA 4UEKA 1JAXA 4RQUA 3E9NA 4JENA 5E8JA 1SVWA 3HG7A 3QMVA 3WHLA 4YMGA 1ZOIA 4KLCA 1O96A 4FS8A 1C1YA 1PGPA 1Z5OA 4PYJA 2R84A 4BNMA 2CL6X 1TRKA 4C4XA 5JO0A 4N6NA 1FDTA 2JZNA 4JI0B 2QXTA 2I22A 1CBUA 1XDWA 1X6VA 1WPGA 1SM4A 2A5FA 5L8VA 1V3VA 1PVOA 5A3RA 3TDMA 1U94A 5ARCA 2GJAA 3QNWA 1Q21A 1AXGA 2AFHB 4TXHA 5DCUA 3W8FA 5JR3A 1UQUA 4MKXA 5B2FA 1YTUA 5A3QA 1WXHA 2A58A 1OLUA 1N6IA 2TMYA 5J4LA 2NV2B 3V1MA 1T8UA 1UM9A 1ZGGA 2FWMX 4BNJA 1JBEA 2QG6A 2HI0A 4FDAA 3UF0A 3IAHA 1NQXA 2WJIA 4Y2XA 3TZBA 5C8YF 3BRCA 2P90A 5EKXA 4HDOB 1LI7A 4WZZA 4HEA1 3ROFA 4LISA 1P3DA 4IINA 2ZATA 3O4HA 3FBGA 5CTAA 4I6EA 3C70A 2BBOA 4MWTA 5CMLA 5FFMA 5EJFA 4S2UA 1RHRA 1O6ZA 2JH9A 2Z5VA 5EZSA 3CLSC 1T34A 4N39A 3LVRE 3L6RA 1E2FA 1ZUHA 4MUXA 5GIPE 2B4AA 1F9AA 3MM4A 1MJGM 3HBJA 5KOJA 5GM1A 2PS3A 1HMPA 4M60A 4YRLA 3KYCA 5JU6A 3TG2A 2YV5A 3AHJA 3EA5A 3FGNA 2GN9A 3ANLA 5TT1A 2DSNA 4S35A 1P44A 4JP2A 3WNDA 3R7WB 3CV3A 2DZDA 3RVMA 4FC6A 1SXJD 4BZQA 3W1EA 3DBRA 1RS0A 1R9NA 1G64A 4GSYA 6GPBA 2R11A 1YQEA 4QFBA 2BMWA 1HOTA 2WSMA 3JATB 1KEKA 1YB7A 4AZTA 1Y7TA 1X14A 4RTMA 2G70A 4XDZA 3EBLA 2WWWA 3NOOA 2NVUB 3CW9A 3V7UA 4ZHQF 4HUJA 5CUQA 1UPUA 4BUZA 1VOTA 4GNRA 3PL1A 4W1RA 4HDMA 1SC1A 4Z4HA 4BBAA 2COEA 3I39X 1X1TA 1NJ8A 2G25A 1LRLA 2JDIA 2C2HA 2XNSA 4Y2YA 1TU3A 1I9CA 4GPZA 6ADHA 3HBFA 1DAFA 4PGGA 1TVMA 3QITA 4ZVPA 1X19A 4KBGA 2VZLA 1ZW1A 2XWQA 4OG2A 3UGKA 5GMOA 1EXNA 4EUFA 3KJXA 5KWIA 2SICE 1D2GA 2J6HA 1CUFA 3IVGA 1L4UA 5HFAA 3VR3D 3TWOA 2GDZA 1P18A 2OZVA 5D7NA 3UWSA 4N41A 2DFTA 4ZWNA 4Z3KA 2XUJA 2Q6LA 3MB5A 1ZC3A 4DV2B 5BT8A 4Z1MA 1EGQA 4ODIA 4PYIA 4F86A 1X2BA 2FSPA 3GJQA 4IXDA 1PFUA 2GK3A 3DC2A 1KJQA 3Q98A 2E21A 2EJUA 3CGWA 3WL8A 1OFUX 1R8YA 2YY7A 1RDFA 4BLUA 4D0SA 3ZD6A 3SLKA 2NG1A 1Z4KA 2F17A 1E7YA 2WU1A 2X42A 1PWXA 3B5JA 3CUWA 3LCVB 4HHEA 3A3YA 5F7ZA 5DO9A 2OHGA 3R7LA 5B3KA 3DOHA 2R6R1 2WVAA 3MQ4A 3H42B 1A69A 1R74A 2PUWA 4O2AA 5IASA 3SHOA 1VZ2A 1U8EA 2HQSA 3KBOA 3IR6A 5JAUA 1GQOA 5KTRA 1S1CA 1KZ9A 1J23A 4JZYA 2D4AA 1NXVA 5LP6A 3DUFA 3EMVA 3QW2A 1NI3A 3NDIA 2HPAA 4UPVA 3GBPA 4MGZR 6YASA 3MBIA 2O2DA 5A5DA 5J5CA 3NHAA 4BMSA 1ORDA 3PDIA 4BAGA 4C4SA 1F5NA 3GGCA 1A4UA 1Y1RA 1Y5MA 2FZLA 5IJXA 3ROZA 1VJCA 2X4DA 4B8YA 4WBNA 3SYMA 5E3HA 3MHTA 1T6BY 2J3MA 4J7AA 5LNK6 3VC7A 2OBMA 3O21A 4JROA 4WSOA 4WXYB 1WKBA 5FAXA 4YWHA 3K8QA 5K3CA 3WLFA 3JAWA 5IUKC 4YRNA 3ZW8A 4A26A 2Z2XA 3VU9B 3ZUPA 5AOBA 1OIWA 2QENA 2UYQA 4Y1FA 1MORA 3QE4A 3EDQA 2GO1A 4WZBE 4J1SA 3M4YA 4B46A 5FYDA 4F56A 1S3SA 3C3YA 4HNQA 3TR6A 3IJEB 5DHSA 5AWFC 4DZRA 1KR2A 2VXCA 3PNVA 4G84A 5AI6A 1FK8A 1Q2UA 1YJ8A 1WEHA 2FSSA 3RKRA 1QZXA 1GZSA 4U2BA 1WW8A 1BDBA 2QTZA 3CNHA 5DWVA 3FVQA 2G5GX 2LE0A 3ESCA 1VM6A 3JQ8A 3SXJA 3CVUA 3OJOA 3GGSA 3N28A 4G4IA 5JS6A 2VJCA 5FADA 5IK2A 1GA4A 4YV1A 3DTTA 3IHWA 3PDIB 4O2AF 3UAXA 3F74A 3MWLA 5E2BA 3I2HA 2P9YA 4MWOA 3D6UA 2J7PA 4HAOA 4M87A 1JH9A 2ZI6A 3FPHA 5H82A 5FWAA 2VDUE 3C8ZA 4QQKA 4Q9LA 3X1JA 4EVIA 5JANA 1G1AA 2AFIA 3EBPA 2IEDA 1AHPA 1JB1A 4DA7A 4YH1A 3CEMA 3ABRB 1I0IA 2VHYA 4MS4A 4G5QA 1V7QA 5DM2A 3QVGB 2WYWA 1CULC 1NF2A 3ANXA 4R41A 4P3YA 1KAEA 1YNSA 3P9IA 5NLLA 5IUNC 5M04A 1V16A 4C7MA 5IDVA 2V9PA 1T5HX 3FUXA 3H0KA 2UUBB 1QUFA 2JASA 4K6GA 4ZOBA 3MOSA 3MAGA 3ODPA 2QE7D 3M6XA 3L82B 4FUTA 4G2NA 1TLFA 1YQUA 2PN1A 3MBOA 4N65A 4ZKEA 2ZWPA 5AD1A 1SCAA 2I0FA 4BP9A 3FVWA 3AEQB 3VMMA 1EXDA 3ANYB 3AG5A 4TXLA 3DWIA 5AHWA 2D59A 5JE8A 4UBLA 3UMCA 3BD7A 3ORSA 1IUNA 1XZJA 3E58A 1KFEB 4FGWA 2FHPA 2RGNC 4M1YA 821PA 4FM9A 4JBGA 1VLQA 1W59A 3A1TA 4KWCA 2QVLA 4RKWA 4DGSA 4FHZA 1Z47A 1OTYA 3NDJA 4HWSA 4HXYA 4BV2A 2CY0A 3NP7A 2AFIB 3DLTA 4ZDJA 3SR0A 1PJ4A 2DLDA 2NU7B 2UUPA 3CH4B 4IZ6A 4RQTA 1RXYA 1MGPA 2ZDHA 4QJ4A 2QBYA 3BB3A 4UVGA 4WCFB 1HDXA 1S2GA 4K6FA 3LA6A 5BRNA 2WY2D 1S2OA 3AYZB 5GIOE 1QPGA 4QOIA 4UOEA 4EPXA 2BE9A 1EJ2A 1CV2A 2GAAA 3HA2A 5CEJA 4P32A 5BPFA 1ORIA 1FFXA 2C3UA 3DKKA 3ST7A 1ZK3A 4ZOAA 2ZYDA 1GZ5A 1QIDA 4P36A 2XA2A 4RZSA 1Q7EA 5ESWA 5AICA 1NY6A 3EGEA 2Q6KA 2Q5IA 3WL5A 5BXYA 3ZHYA 1QKKA 1PNRA 1JB9A 3BXGA 5DMXA 3VR5A 3ZD8A 1PJCA 3RFVA 2NTNA 1BS9A 1T0PA 2GVDC 4OGFA 2IYAA 1QMGA 1IUPA 2J4DA 3LDGA 5DNEA 2IUUA 3RYIA 4R7GA 2BKUA 1TJ5A 1SWWA 2BFFB 2HRQA 2L0XA 2NQTA 1JLHA 3AETA 3D4OA 1E2JA 3O47A 1T4CB 3WZ2A 3SQWA 1ECPA 1R0CA 5JWHA 3DW1X 3CEHA 2YN2A 3U80A 1OV6A 5JJBA 2YQ4A 1SQFA 4R7ZA 4AMUA 1Z62A 4LZJA 4YXWD 5LJLA 4Y2VA 4YMLA 4A15A 5TDHA 2PXAA 2W93A 3H8JA 3P7MA 4L75A 1CC1S 4TWBA 4U9UA 1M1YA 4W4TA 5CYFA 3BUSA 4YCDA 2IYYA 1G7CA 2UVPA 3D0RA 1Q91A 3R0IA 1XIVA 1OH6A 2PX0A 3VHLB 3HUDA 1X77A 1MFZA 2WILA 3IOCA 1ADGA 5JNUA 1RVDA 1VBNA 3ZBTA 4K9DA 2XUIA 1A9ZA 3LXUX 4AN4A 3IP9A 2NAPA 3BB4A 2PZ8A 1NW8A 1NVAA 3CX6A 1GZUA 4G85A 4H7DA 4RE5A 4DDUA 3ZLTA 2G7MC 1BKDR 1ZOSA 4TQAA 4UW9A 1KGSA 2DHQA 4NJMB 4B3SB 4R68A 1QOPB 1A98A 2VF7A 1NG1A 4KBFA 3W9BA 3LPDA 3DXFA 3F7OA 4HFRA 3WLIA 1PD1A 3FI0A 3HXPA 3VU0A 4AJIA 1CZKA 1PQ4A 3JQ9A 2C9CA 1VE1A 1U9YA 2JIMA 4M8NE 1CVLA 1L7MA 1M2OB 3FM9A 4O02B 3GYBA 3RARA 3O03A 4D2IA 1Y4UA 3A7DA 4MVJM 2CCJA 2ZB3A 3FR7A 4MVJI 5FBZA 1FNMA 3MWJA 1Y7HA 4L73A 3GFOA 1CUYA 4J07A 4B4UA 1GDHA 1RYZA 1Y9JA 2NAFA 2QRVB 5IW8A 2G6TA 2H08A 4JYAB 1X7XB 3ZWWA 3B82A 1H9CA 1KO1A 4HY3A 2BKXA 4CF4A 3O92A 4EHDA 3LZCA 4IJ6A 5KX5A 1CR6A 2QEQA 1S2IA 3KB1A 5IFLA 3FDXA 3VPDA 3HA5A 3HCRA 4XOIA 1GPBA 4R16A 3RTBA 4HN2A 4U4AA 1ZICA 2Z8XA 3DHEA 4A6XA 4Z1MD 2IPLA 3CLTD 4OB6A 2XWPA 5IT5A 4G09A 4TV8B 4H7HA 3PR2B 3ICCA 5DM1A 2GCNA 1V1JA 4HUQA 3RRFA 1BGVA 3ZTWA 2WIDA 1LC0A 2OOSA 3B5EA 1QHGA 3EGDA 1YJ5A 1NAIA 3GNSA 5TARA 5CPFA 4UQOA 3EZNA 3E9ZA 1R6DA 1F9EA 3FYUC 2A0UA 3IIEA 4QGFA 2H57A 4MYSA 3S40A 1H4SA 4YPFA 1NI4A 3A11A 2EQ5A 2UZ4A 4X1OA 5F1OA 2B61A 3IP1A 1I3OA 2DH5A 2QY9A 4EW1A 3DA8A 1ESMA 2B5VA 1QG2A 1R7RA 2Q1WA 3EDCA 4B87A 1DJMA 4URYR 5T4EA 3NEJA 1SOVA 1UCFA 4R9NA 1BVRA 1BHO1 2H07A 1VZ3A 2PCJA 3N7UA 1G291 4UE3S 3I5YA 4Q47A 1YOVA 4TRMA 4DPKA 1ZO8A 3AIOA 1P2VA 2P1DA 4MIKA 3EGOA 1IHYA 2FSUA 1Q6ZA 4BYMA 1FFSA 2WAOA 3CXUA 1XJ5A 1CIVA 3IIIA 4BJ1A 3TLGA 2P2GA 3WIDA 4EELA 3LUKA 3UXYA 3I32A 2VQFB 2DXIA 1V1MA 1HFJA 3NC4A 4NE9A 4Q66C 4X7PA 2GYVA 1XQWA 2KJQA 4GPAA 1HQYE 1WB9A 2O5CA 3G2QA 4Z8XA 4NMXB 3CRW1 1J9GA 1GT91 2FB9A 4RD3A 3LSTA 2PXCA 3GUUA 5DTIA 4WLOA 2W83A 5JS7A 1EZ1A 1QRRA 3GJSA 4AJ9A 1UQRA 2X41A 1AGRA 1GUYA 4KQWA 2O2CA 1BVUA 4MV3A 4TTSA 3T9DA 4ZHQA 2TECE 4UBNA 2FW8A 3VM6A 3FMGA 4Q1AA 1ZKDA 3RAJA 1Q6YA 2O0JA 1T3HA 2XCLA 2EYUA 4GZLA 1G19A 3HB0A 4IDOA 1GADO 2ZM5A 1NW3A 2B7CA 3PQ5A 2PUAA 4GM0A 3CH7A 3JQ7B 4D0GA 2FMTA 3W6OA 1DEOA 3GJ8A 2BZSA 5A5GA 1CRPA 1XXHA 5L7WA 3WLLA 1BRTA 2QD1A 3MJSA 1Y7PA 4UDNA 1IZ7A 3DWGA 3A0RB 1LK5A 1A4XA 4HQOA 4JJKA 1OWNA 5J23A 1N2EA 1V1MB 1JHUA 3C8HA 1BXRB 1KXJA 3ENQA 3SG0A 5K8UA 3NHMA 4CN8A 3KEMA 1GXSA 1I1QB 1XCOA 3NHFA 1Y8RB 3NHLA 3NC1C 1JG3A 2ADOA 2FPGB 4G1FA 2XHZA 3ND9A 1N9ZA 1TKRA 4XYGA 2A9RA 4Z54A 3CH5A 3A4YA 4HVTA 4XB6B 3TKYA 2BR4A 1QRDA 1QH1B 3D7LA 5ALSA 3PUYA 4X6LA 1ISGA 1V3QE 3SMVA 1QLHA 3WFZA 1S2DA 2OD7A 5HF6A 3T9CA 4N3NA 2UYGA 5DLDA 4ENPA 5K01A 3WGOA 3WNBA 1FLDA 1C81A 4N7JA 4QO8A 1Q15A 5HS4A 3FLEA 3PICA 2BZ1A 3HS3A 1BD3A 1VKHA 4WK6A 2HCTA 4QOEA 1KEWA 1X80A 4KXXA 3NHYA 4HQ0A 3RWOA 1E89A 1FXWA 3LHDA 2FWAA 4GI7A 5D01A 1V5FA 3AILA 2P9QA 2JLAA 3OFNA 4MA0A 1OWMA 4MYTA 3CF2A 3RG8A 3PXAA 2PVSA 4LVUA 4MB6A 5H16A 4AIRA 3E9EA 1BXGB 3FPSA 4IKPA 2H1RA 4Q9KA 4IH1A 1W581 3T3EA 5JEDA 1W7AA 3ZDRA 3TYXA 2CDAA 4RFSB 3J80A 1EVZA 2XD9A 3N07A 1FDSA 2GJ8A 3ZHUA 4YGYA 1T5TA 1FQKA 1XTBA 2JCXA 3R24A 3R6WA 4DFDA 5A4IS 4GUDA 4UU0A 4CG2A 3FJYA 3TQRA 5ALGA 3ROKA 3GZTB 3TEJA 4EI2A 2XCTB 1QU3A 2H1LA 1L4HA 1D0SA 1Z7EA 2X2OA 3S2YA 4A0HA 1L8LA 3GGGA 4GP6A 1H8EA 2CZQA 1IOLA 2FSVA 4HJXA 4V0KA 4WTOA 2MOKA 4XJTA 3RBAA 1LF0A 2FJPA 4HGRA 5JMOA 3TZKA 5JYCA 1NNLA 1VKZA 2EGUA 3NALA 1GN9A 4KRXA 1ECLA 1Y6QA 3VHQA 4P82A 1VBMA 3IVMA 3R7DA 3UB3A 1UXOA 4JX9A 5JADA 5AW1A 3BX1A 4UHCA 4JEIA 4L8LA 2A9FA 3DVQX 1L1FA 3QEBZ 1R0ZA 1W5FA 1IDOA 4KNYA 1HLDA 3OTHA 2Q6IA 4KFUA 4IL5A 4DOMA 2R00C 5MGNA 3UPUA 3SJUA 4W99A 3GJYA 4OI1A 5ADUS 1G9TA 4NONA 1EGVB 1Y8AA 4JLJA 5AW9A 4CRWB 3WLTA 2G83A 4BWGA 1F17A 2J7KA 2QVZX 4WMLA 1ISFA 1T1SA 4X8MA 2JH3A 2IZ5A 3OZXA 2G9QA 3KCNA 2MTBA 3R5TA 5LN1A 4IMJB 3S1AA 1CEQA 3OEWA 4TVSA 3QLTA 3F5DA 5AUOB 2RHLA 3ZVNA 1W36B 1YQTA 3AESB 1EBFA 2JGEA 2C58A 2GKGA 5F9FA 3NOVA 4BZPA 1EG2A 1ZJZA 2J3KA 1WMSA 1NRJB 2TYSB 3KQMA 5GM2A 3RTGA 1M76A 2FKNA 2VNHA 1UPFA 3DQZA 3NYRA 3K09A 1EB8A 4JLDA 2HXSA 4ZVTA 1TGVA 3FSJX 1W4ZA 1R8QA 2QLTA 1FP4A 1V7CA 3N2NA 4HF7A 4FW9A 5AMXA 4C7JA 4CNQA 1JR2A 1XROA 1U65A 1MX5A 2Q3EA 4HWTA 5ENDA 2G76A 4TXNA 1W19A 5SZHB 3LWDA 2C03A 1JAIA 2ID9A 2W6JD 3LF2A 4XSVA 2PX6A 3ICVA 4Y6LA 1ZJJA 4CMBA 4NOMA 3RROA 1V5WA 3BK1A 2AZDA 1BA2A 3GDHA 3P9XA 3RG2A 3KX2A 4XVUA 2ZVJA 2UZAA 5HK9A 3O38A 1MTZA 1ORTA 2H4HA 2RGUA 2Y1WA 4I4TF 1RQLA 2IY7A 1HYGA 4RJ2A 4RMGA 3RSGA 1U5AA 3FMPB 2QRPA 3NR2A 4UUQA 3G9XA 1EX1A 3IP6A 3JQPA 4L16A 4I4LA 3ONVA 2QZ4A 2EP7A 1QVZA 3M89A 3Q2OA 2FFRA 2NGRA 3D8HA 1KDZA 3TD9A 4KV9A 5A5VA 3AJEA 2A7XA 3VTFA 1FS5A 2NV0A 1HE1C 4E88A 3O8CA 1E1QD 4HDSA 3TNYA 4F4HA 3R76A 4G37A 2WM3A 2JFHA 3OHPA 1QIJA 2ES4A 1E9BA 2PS9A 3CVJA 1PUXA 5JNSA 3T3OA 2IXGA 4UPDA 2O2HA 5JCJD 2H63A 3B6ZA 2BFCA 2YFHA 3HJUA 3OTIA 4MRRA 3WGHA 1Y81A 2JHFA 1G6OA 3BJMA 2P5TB 4EDHA 4N5IX 4C21A 2IXAA 2C5BA 1NYTA 2YYAA 3ILXA 2IYTA 3PGLA 3PIDA 3MWFA 5FUWA 3ELUA 5LOVA 1UWKA 1F4PA 3HU2A 5E7JA 1E7WA 5A3SA 1D2EA 1Q1BA 1D1QA 1OI4A 2DE0X 1RWXA 4NZMA 1MTOA 2O8FA 4RDHA 4A1FA 1XU7A 2QUHA 1FDWA 2XF8A 3OLQA 4NK5A 1NUPA 2IQIA 5BR7A 3TTXA 3O74A 3VVLA 1LPNA 1X1AA 2PRYA 5CJPA 1HOXA 4N9WA 3DLBA 3QE0A 1F2UA 3VR2A 1FE8A 3EF0A 3FRIA 5ADHA 2FETA 3OE4A 3U13A 2FQ1A 1SBZA 1W5AA 1WQ4A 3D2BA 1CG6A 3FUTA 2CL7X 3GRVA 3TECE 4RLQA 4ES6A 4QBFA 5L51A 1NXQA 2C0PA 4RSGA 3RSLA 1ZYUA 4Y9TA 1FF9A 3VJLA 1XTQA 3GRYA 3C7DB 3LPAA 4YJGA 5LBUA 3DZKA 1KE2A 4FOSA 1DEAA 1T25A 2HTFA 3IPXA 3NIGB 4YQFA 1ZR2A 1JH8A 1Q22A 2PH1A 2PKRA 3JQDA 3UWOA 2Z8YA 1TOAA 4HO1X 1CX9B 3QIAA 2DHEA 1PHPA 4E51A 5HQTA 1P7ZA 1AKMA 6PFKA 3ZZTA 1EFPB 4PSUA 5IAKA 3KQWA 4CEJB 1XV5A 3IQGX 3SYKA 5ALQA 5E3JA 1BHSA 1YDFA 3N2KA 4RD1A 1XZMA 3RS5A 4BY9E 1G5RA 1ZL0A 1DWUA 4H08A 5KTYA 4LGMA 1TJNA 3FGOA 3HDGA 4B3XA 3DBHB 1Z2NX 3KQOA 1J2RA 1KO8A 3UJHA 1XTUA 2ENWA 3VZCA 1ACMA 3ER6A 1X1BA 2R1VB 1F60A 3ENWA 2ZKIA 5EHIA 3D4LA 3SPXA 2I7XA 3E5RA 4JXKA 2P77A 1NONA 2DPMA 1C8VB 4II2A 1FYXA 1ODSA 2WABA 2Z58A 3JPWA 1U11A 1T8PA 1AVTA 3ESZA 4WJKB 4LJKA 3SFZA 3DE2X 5I3ZA 5CFZA 2ONKA 1PL8A 2NZUG 4OQYA 3KLMX 1QGYA 5EJ5A 2CNNA 2HKIA 1I6LA 3PWZA 5C3MA 1HO3A 1RJGA 3R9IA 1Q0TA 1QH8B 1JP7A 2I62A 1QV9A 2J45A 3PC4A 1H5UA 3X1WA 4C5BA 4WASA 2IY9A 1H93A 5KCMA 2PX2A 4X61A 1EVYA 2IDJA 1PR5A 4A8HA 2G04A 1N4DA 5HXAA 4F4JA 2V6GA 4PZAA 3GZNA 4Q6WA 4HNTA 1P2GA 2GA8A 3O6VA 1XD9A 2JAPA 1Q57A 3C1OA 4P0TA 2P3OA 3MJRA 5D1NA 1XWFA 3FH0A 2R1VA 3MCWA 3OE1A 1P9RA 1ULSA 2I7VA 2A5GA 5EVJA 3V8NA 3BVPA 4CHTA 2Y71A 2J5KA 1A9PA 1ONOA 3HZHA 3KKEA 1MG0A 2I7CA 3R23A 4ID3A 2FSIA 2X2PA 3NFRA 4KXYA 2X0JA 1BMQA 4QGAA 1KEPA 4ZAFA 4QPPA 4ZT3A 2HV9A 3VTKA 3O1LA 4F1WA 5I5EA 1G2OA 3WOVA 1CUUA 5JD4A 4MRMB 1NZJA 3L0YA 3E8MA 2FCAA 2W43A 3PENA 1EDOA 4QLBA 2DBVO 2QT9A 3INRA 5CVDA 5H4HA 3INTA 2IIQA 4LZOA 4AZWA 1DJOA 4ROSA 4YWJA 2CLDX 2FMUA 4ZEXA 3VKGA 1Q50A 3R6DA 4YNBA 3U6KA 4PSCA 3UOGA 1M0TA 5LQSA 5JCOA 5REQB 1NI5A 4LC1A 2IRWA 2ONZA 4XQGA 1J0AA 1VRWA 4KE7A 2XWBF 3UUFA 1BWRA 1WUJS 1KYYA 2NO5A 4O4IB 2BBTA 4X7BA 3RIGA 3VA7A 4DWOA 4DPLA 1N33B 3MWEA 1GU0A 3OPYB 5EVCA 5B1DA 1E98A 1BQ4A 3HL4A 1TC1A 4I50F 2GBIA 2HD4A 2GXSA 3BD9A 1IBCA 3ZEIA 3A9UA 2BN4A 3THYB 2WTBA 1M73E 3BN3A 4B2PA 3T9BA 4CKEB 2AC2A 3V5NA 4EI8A 1VGQA 2WJVA 3ETLA 5GONA 5P8WA 2ORWA 3V42A 1WCIB 2UZ3A 3JVDA 2QU7A 3A27A 2RSLA 1JKJB 1QK5A 1S3FA 4IZIA 4MRMA 3UEOA 1WUKS 2F1JA 2QV7A 2HR1A 2JKZA 4LF5B 3M34A 1Z3CA 2RMKA 3P9SA 4A10A 1WG8A 3ZKAA 4PZDA 2AJBA 5CIWA 1KK2A 2J46A 3IDZA 4EMTA 3N6XA 5EJ2A 1S7CA 2QGNA 5JZSA 2HMUA 3GXOA 3VZPA 2WT8A 4TMFA 1TIBA 1RWPA 4MVJG 4Q7EA 3B1YA 3K1AA 4MUMA 4F7WA 1XZGA 3EC1A 3SQOA 4MH0R 2NU9B 2R87A 1WUHS 3CINA 1VI6A 1XTIA 1I3NA 3CZMA 3I1IA 4DIFA 5JH7B 5LA6B 3OWOA 4QT4A 2R97A 4DF3A 1P1IA 2FDCA 1E4EB 3ZHSA 4YAUA 4IFEA 5BY2A 3TXXA 3LYUA 3N75A 4BVFA 3LLSA 1JA0A 2CLSA 2HJWA 1W5SA 2P4QA 3C6QA 3F6SA 4BFYA 3THYA 5C4MA 1HR0B 4HB4A 1CJBA 4N8EA 3TMAA 4CMEC 3UKOA 2BMJA 4JC5A 3SX0A 2X9NA 1Q1GA 4R31A 2XGJA 3IR7A 1YRLA 1LU9A 4OAOA 3MMSA 4YIKA 4FFBA 1F1JA 1MJNA 3RVSA 5L6MB 1D8AA 3D0QA 1NLUA 2PANA 3MW8A 4AY3A 2CXQA 2QRGA 4BRSA 5KTOA 2C20A 4QULA 1C9NA 1SXGA 2I3AA 4YRDA 4ZA2A 3PVCA 2HT1A 3WLSA 3MPOA 1RQ2A 3PQ4A 2XMGA 3UHOA 3IUQA 1TZ2A 4QODA 4L3OA 1NZFA 3BXXA 3VYUB 2BT4A 1YU9A 2OUIA 1OFVA 2G5TA 4PTZA 1QQAA 2PMDA 4HBZA 2ZI4A 3LP5A 4XEHA 4DDTA 3JRXA 4QVIA 1YI1A 1LBHA 1OFTA 5FWYA 3OA2A 4FWTA 3ASZA 5BUQA 4E2YA 1E4EA 2J0EA 4V0LA 5F4BA 4JGBA 2FQWA 3H2JA 1VPDA 1UP6A 1W9MA 2GBLA 3RFFA 5T6MA 2Z1NA 3QLVC 3O4RA 4KO3S 1XQ9A 2J4CA 4DUZB 1I32A 1KNQA 1PSZA 2QN6A 2C84A 1D1TA 2V96A 3CSUA 3IO5A 2HXGA 5CDFA 4EM6A 4BGVA 4R1UA 3QY0A 4A73A 4JBYA 1DDGA 1F12A 1LBSA 2F3UA 2WFLA 4KIJA 4OUDB 5C81A 4C6TA 4LKOA 1DT5A 1N2BA 3LX5A 4MMYB 3Q7TA 3MTIA 2Y0BA 2A8YA 1GTJ1 1CUDA 4HDCA 2ZTHA 1N0WA 1NWCA 1EMDA 1KJZA 1S8OA 1XZNA 4Z9XA 3RJTA 3TB4A 3WK7A 2VQSA 2GJSA 4BJHB 1XPUA 1G6Q1 1YACA 4YX9A 1DKQA 3K9FC 3ZGVA 1GR0A 4PHCA 4PX2A 2ZYHA 3MCVA 4R54A 1N8SA 4LTDA 5JH7F 5FI5A 1SURA 2VT7A 1E2QA 2HU5A 5KTNA 1CZHA 2JS7A 2H1WA 3PBKA 2YCLA 5HZGA 4FD2A 3L49A 1BSVA 1KZYC 1LNQA 2ACKA 3F6YA 3JQAD 2C5HA 3UO8B 5KYWB 4M1MA 3G5MA 5CVEA 1THGA 1IN8A 1W34A 3A6HA 5FXMA 2C2ZA 1JG4A 1YGYA 4QU8A 4IDAA 1BU8A 4IWYA 5DULA 4DT1A 1YR1A 2YFKA 3E53A 3NJ8A 3CG0A 3O4VA 1P7YA 3TLKA 2O52A 2XDYA 4OBXA 2XBUA 4R2MA 4C29A 1VGVA 3GLIB 3LXXA 1S5PA 1EAYA 4V3CA 4DR5B 5JRDS 3QVUA 3VKWA 4YP5A 1WV0A 4G5RA 3G85A 3OOHA 1I0LA 4GKAA 4INZA 3G2NA 5TE9A 3C8MA 4F7DA 3BGVA 4D25A 3OWXA 2ANCA 3ZD7A 2NN3C 4OJMX 1VGRA 1DIBA 2UXCB 1MOSA 5K0TA 2FPWA 3K5WA 3DYIA 3UY4A 1KZGB 3GHHA 4MA5A 5TGZA 2W5UA 4RGQA 3JAKB 1JLSA 1B8UA 1Z83A 2FSHA 1A27A 3GDOA 1ODCA 3LDHA 4GOJA 3TPFA 1N2CB 3RS9A 2ZS8A 3JPYA 2XMZA 1GAJA 2NZVG 2RC6A 3IOYA 3QEMB 1VJGA 4AZ0B 1P7WA 3FD8A 3JW8A 4D3DA 2AKAB 1OYVA 2VDNB 1PT9A 3FTDA 3B36A 4H4DA 2R3SA 1SVUA 5EXSA 4UMFA 4LBYA 4KDRA 2H16A 3F8TA 3IQIX 4LZPA 4XM1A 3ZNQA 5DGIA 2DM6A 4GOKA 2EV9A 2IHZA 4E70A 3DOIA 4KU4A 3EVEA 4QATA 4XFKA 5J2UF 2MIIA 5ERXA 2C61A 4YRMA 3HFSA 3JVEA 2LDBA 3PGA1 5DBFA 2IBMA 2YWFA 2AZTA 3TL6A 3WHIA 3PGKA 4B34A 4ZIRB 1V8BA 3EEQA 1G2QA 4FCCA 2Q50A 1KH3A 1V3TA 3KXLA 4HXFB 4JS0A 1EH5A 4MI1A 2QQEA 4RPCA 1L5YA 1GILA 1HSOA 2O59A 3CCCA 5AKHA 3EZLA 1I01A 5C8ZA 2C07A 2PA3A 3ASYA 3WRXC 1PVDA 4JLPA 2YXLA 1ISRA 3BMOA 3PD1A 2GPSA 3DE1X 1KZ7B 1ZCFA 4QYIA 4RANA 2YOGA 3E7PA 3FNEA 4TTVA 4C2TA 2X0KA 1FRZA 1RPJA 2HA3A 3FYUB 3O0TA 4FDMA 4FIZA 3OOYA 4RFSA 3TX2A 4QSMA 1DTSA 4JOCA 1DC4A 2HLHA 2VAVA 1U28C 4BVLA 2FQQA 1TAGA 2IEZA 2VT6A 1YZYA 2WIAA 5L6LB 4NBTA 1CK4A 2WG1A 2IVZA 3D5EA 1H1LB 3F5QA 3KXPA 5M2QA 4D97A 4FLFA 2B30A 3PX2A 5SY6A 4UC0A 1U8ZA 4XYMA 4CUZA 1DB3A 1CIJA 1HRDA 1SC4A 1J0CA 2IDZA 2PU7A 3PNYA 5B58T 3T1TA 1O94A 4K0RA 4BLTA 4X0EA 3KV3O 4K3VA 3VPXA 4QOFA 3T34A 1GL3A 1V6SA 1UJ6A 2H1HA 4G26A 3FPCA 1G66A 4MCIA 1QCYA 4FHEA 5DN9A 4ECAA 4JNKA 1HZZC 2WUVA 4ND6A 3OIYA 4M2LA 3JQBC 3N87A 5L3QB 1FNBA 2OMKA 3TW8A 4OHVA 4BEWA 4BCCA 2XF2A 1DNPA 2P69A 3GT3A 1LF5A 2QTVB 4MUAA 3BPSA 4A82A 2WQ6A 4Q4AA 3QF7A 1ANKA 1XZFA 1XNHA 4J8PA 3CX3A 5JJ5A 2FEKA 1L7OA 1Z07A 2C0QA 2DFLA 3T4PA 4CIAA 4QPJC 3R5KA 2X22A 3F9IA 3NM5A 1LTHR 4H7PA 2P6RA 2LWIA 1MFPA 1DMRA 5I9TA 4H3HB 3ZWMA 3GCGA 3D5TA 5EMNA 2P27A 1HA3A 1Z68A 2ZGVA 3ZHRA 4G0ZA 4JQSA 2W6MA 2GB4A 3PDWA 4HH4A 4QUEA 2Z56A 3RQIA 3V1KA 5AKKA 1EA7A 3LCCA 3ZR4B 3IYLW 4PS0A 2X6TA 3LX4A 1RZUA 1VKJA 2PRKA 4HPWA 5AK6A 4HVLA 3H5OA 2VJLA 1R8XA 1EWRA 2PXXA 3QEJA 4MIEA 1K9VF 3KDSE 5GAJA 2GCOA 2W42A 4ITUA 2DY1A 2XKAA 4R2JA 3WBJA 4DCUA 3K73O 1V8FA 3RLIA 4XWOA 5CA0F 2I66A 4CMIB 4AT1A 5JW6A 3AH8A 1VE3A 1LSOA 5H59A 4EW2A 2IXFA 3OX1A 5B5SA 2J33A 4KFSA 1ISHA 4TMZA 3UK1A 1IN7A 3E05A 5KYVA 4BV8A 4WZBB 1QGZA 1QLWA 3IJRA 3GG2A 2R79A 3PSAA 4RJIA 3TGLA 3ND6A 1RBQA 5AIAA 2V1UA 3JRWA 3PQ3A 4X63A 2I65A 4EJSC 4KAFA 5AT1A 1FZQA 1KI9A 1IG0A 1QKIA 1G4AE 2DKNA 3IDQA 4JB8A 4Z9YA 3VO2A 1AU9A 2FZEA 1E20A 4Z2AA 4YJHA 5KYKA 5FUBA 3WQQA 1RACA 1UBRS 3QKSB 2WF5A 1O1YA 4NBWA 3R6GA 3W5HA 1IULA 2WMOB 2MMCA 4B3TB 3X43A 1S01A 4JLKA 5F51A 4BFWA 4B2IA 4GT1A 1E1LA 4BQNA 1UJ4A 5TF4A 2C2OA 5TQ2B 3Q3EA 3PHBE 1QB8A 1VXOA 1BXRA 1ZJ5A 4QUKA 1IPEA 5JPDA 5L4SA 3RUHA 4XWYA 4ZPXA 1JTEA 3T6KA 2YN0A 1VE5A 2X4GA 4X3OA 3FNFA 5I9BA 3WRYC 1T43A 2NW6A 3Q6IA 2NT4A 3PHIA 5JMPA 3IKMB 3L8ZA 2V0GA 3NP9A 4JJAA 2AN5A 3QLUC 4LX0A 2ZIEA 1VL0A 2AFHA 4ZK2A 3DE0X 4LSGA 1G20A 1JLLA 3H5NA 3DHNA 1EHYA 1KI7A 1M6VB 2VYNA 4F72A 3GRUA 3QM1A 4MUKA 4KHPB 2M32A 4DLUA 4WY5A 3FHCB 3ROMA 3SZLA 1M67A 2DG2A 2RH5A 3A1DA 4UMDA 2VP5A 4XGRA 1VIAA 2X8AA 1H2BA 2RH4A 3D6AA 4BCBA 4PQYA 1BX1A 5HQ3A 1YASA 2QQ0A 4RTPA 5CEEA 1WXFA 3QKSA 4I8IA 1UZLA 1VKOA 2HO5A 3DGEC 2J48A 4CL3A 4U2GA 3P9PA 5JYBA 1L6RA 1KYQA 1OBVA 2BDEA 5LWHA 1T9DA 2WQZA 5AM4A 3LC7O 3C8UA 4UCWA 3VNBA 3WRWA 2HSWA 3E9DA 3GVPA 1A8UA 3KU4A 3R3WA 4MKHA 5J4KA 2ZI7A 2DGDA 3HJTA 4D3XA 2UXBB 1XRRA 4N3BA 2PY6A 4KQCA 1ZQ9A 3RRNA 2VL7A 1IBLB 3K15A 3HKEA 4C5AA 4CM4B 4EITA 4IGEA 2JI4A 1NJFA 3EMKA 1NV9A 2BKLA 4HNAA 5LYJA 3RSSA 2BJVA 1KAOA 1PJTA 2W37A 3FYDA 5DKFA 3HO8A 3F47A 4ZCMA 5HE9A 2VJBA 2PKQO 2XIQA 4DYHA 5CB4F 5HIJA 3SMQA 1TYDE 4LK3A 2XNJA 1C3OA 2WG0A 4CIVA 1U4OA 3BF8A 5PGMA 2HN9A 2VF4X 1TO1E 4IDPA 1F1BA 4M22A 5EXEA 4FC7A 1W36D 1M6NA 1IC6A 2GHQA 1I4TD 2I4TA 1WDWB 1UK9A 2TMKA 3BTOA 2VDJA 4NZ9A 3RUPA 4AUMA 3S5UA 1BZYA 1DRJA 5TY0A 5KUTA 3UT0A 4WOJA 4MVXA 3RW9A 3I30X 2V0NA 2RK3A 5WRFA 1JQ3A 3IMCA 4ZFNA 4EF4A 4M38A 4FNGA 1DBIA 4B3MB 1CQJA 1VLHA 3OM9A 2BMDA 5J2TB 1M1YE 2GJKA 3DQPA 4ND5A 5EE5B 1AMUA 1UDCA 3R4VA 4L15A 1B8NA 5TMPA 1YONA 2WP0A 1N9GA 2B8WA 3HKEB 3JV7A 1LSJA 4PGHA 1VYVA 3PXEA 4HRAA 4A0GA 1DQNA 1MIOA 1P1RA 2H4YA 3NRJA 5EUMA 3H4VA 1UMBB 4HRXA 5DLPA 3ZJUA 2W2LA 2CFCA 3AL3A 3J7AC 1UFOA 2DUUA 2K2WA 2E7ZA 3EVFA 4JOSA 1V5EA 1L7VC 2OUKA 5J59A 4OLAA 2HJ9A 1KHTA 5H83A 1JJIA 1OWPA 2VCYA 4IQ8A 3I0MA 4J94A 1K9SA 3PI6A 5CEFA 3FMFA 3WIUA 1R6AA 2HA5A 3L8DA 3VBEA 2G9ZA 4JC8A 1PK9A 4HGZA 1PJ3A 1SRRA 3D3EA 1E3IA 1D1PA 1EUZA 3U26A 4MUHA 4TTAA 3E8SA 4Q1FA 2JLWA 1PFWA 4BLQA 3U9LA 4Q5IA 4GWLA 1OX4A 1P8JA 2PKWA 3R8XA 3TR0A 4W8HA 1GLVA 3EK2A 4R2HA 5CDHA 1K8XB 1IPHA 4ZJYA 4MHTA 1RC0A 5B7QA 2VWQA 2XKJE 3H1EA 3D6VA 1UKAA 4J0KA 4LMPA 3UK0A 2AF4C 1Y5LA 4AKHA 4Q9NA 2A84A 1QIFA 2ZQ5A 3UAWA 2CNLA 3V34A 3NTVA 1L5WA 3UPTA 4AWAA 4LJ8A 4H17A 3HXKA 4LMAA 3H83A 3UGTA 1JDNA 1SD1A 5FAKA 2Q5QA 1EFTA 4TV8A 3SY8A 4FX2A 5CAEA 3NWPA 1XMJA 4MP3A 3WICA 4REMA 3OX3A 1ZH0A 2A5JA 3IBGA 4IIJF 1JFRA 5BOSA 3OG9A 4UM7A 3PXGA 4HNUA 1OFUA 3LUBA 2H5LA 4Q7MB 2WYOA 3K0SA 3T3NA 4JJ6A 5IMBA 1NG9A 4TYWA 4I9UA 2VHXA 3UT5A 5IG2A 3IE1A 3C98A 3P27A 1VTKA 1MNQA 3P0IA 4HMOA 4KFCA 2A5YB 4LFAB 3PGJA 3E7XA 1QHSA 4MUFA 1IZZA 1U9CA 5DHPA 2UU9B 1LK0A 2IK8A 3FFWA 3MJVA 1HKUA 1L7RA 2P9ZA 2WMNB 3KFLA 2D2IA 4UVEA 1T2FA 2BSXA 2NUPB 3BL8A 3ZOKA 4P6VF 4ZOQI 1P91A 1CP3A 4I0WB 1RWMA 4NEHB 3N53A 4JQOA 5E2AA 2P2DA 3T1YB 3PSHA 2VHUA 4QTZA 4XLLA 5C53B 1PJLA 1ZINA 1ZIPA 1R9JA 1Z8FA 5HUJA 1TYCA 4CL2A 3MUOA 3P0RA 5AM0A 1X42A 2GARA 1AS3A 2OO5C 3E82A 3DMGA 3GG9A 4ID9A 4KVFA 4R2IA 4J4HA 3O93A 4CI0B 1T6ZA 3NKLA 4NZPA 2CHEA 3HB7A 5DTJA 4EZIA 4MDEA 1VBKA 4RMJA 2PX5A 4G4SO 1WHTA 3DZBA 1LC3A 4FS3A 5YASA 1GZ4A 3EXIB 1GAWA 1XJQA 5MGBA 4EYGA 2P9EA 1GL6A 5EJAA 1EG7A 2HV8A 3U7QB 3Q8LA 3NS7A 2I2CA 4I8DA 3DKIA 4MSUA 2FXIA 2VYFA 3CLUD 3GD5A 3KCQA 5I9SA 3RKSA 2J08A 4DKJA 1OAOC 3D4IA 1ZD4A 1DIHA 1FXWF 3GROA 4BFXA 1ESCA 1A8SA 5LA6A 2J59A 2YTZA 1ID1A 2I6XA 3E03A 4KK3A 4QXAA 4U8GA 1FIUA 1P0IA 4OH1A 2GXQA 5ADWA 1DDIA 2PQ6A 4ZI3A 4DDWA 3EQ6A 5CJ2A 3PRKE 3DPIA 1XO1A 3IQEA 5T3UA 1M7HA 4QG7A 4BVHA 1HPLA 1VB3A 4MQFB 3TR5A 2JF0A 2YC4C 3TSYA 2H2AA 4D45A 4F2WA 3T06B 1APBA 2IIVA 2YC2C 1A4RA 1RNLA 3IC5A 3ZKWA 2HMTA 1A8QA 4RVGA 5F3WB 3V6MA 2PBRA 1F6BA 3TLCA 3K2IA 3WP1B 1Z5UA 1QDLB 3O2SB 1E59A 1F8YA 3PJFA 4NF2A 1PX0A 3QPBA 3ZVLA 1ZK4A 2WWRA 5BSRA 4INPA 2WSYB 1U0HC 2PX4A 3BAFA 3EWAA 2JI7A 1UBMS 2X9LA 2QVBA 4IIEA 4RW0A 5DXAA 4L1KA 4C07A 1GFWA 4GYJA 4HNGA 4R2WA 2C78A 1SHJA 3IPRA 1MO3A 3QVOA 1FTGA 4WNAB 3WIBA 1DV2A 4JI8B 4KN8A 4EQ6B 1HL7A 2EWVA 4NNPA 4CF5A 2C4WA 4LJ4A 1IONA 2CVPA 2EZ8A 1CW2B 2OZPA 4URFA 2HJSA 1QVAA 4OBBA 3OLYA 1G5QA 3QV1A 4ZP1A 3SBXA 2DKFA 5LL6P 5A03A 3BL5A 1J5EB 4CKBB 4FBLA 2PLAA 4V2UA 5IWAB 1P4RA 1T6XA 2W22A 2XYRA 5IF3A 2JEYA 3I0NA 3IE0A 2SNIE 1P77A 1TPYA 3FDZB 3TUIC 4DA4A 5IU6A 4ALIA 3HJRA 2JC3A 1NIJA 1UBNA 4GXRA 4XCXA 3UC9A 5JMWA 1VBFA 2AMJA 4IILA 3CUEF 4EDFA 2Z2JA 5FTMA 1V37A 3M9WA 4L78A 1MH1A 4YJ3A 5LZ2A 1ZM7A 4LWPA 3LUGA 4HNRA 4P92A 3SFVA 2XXAA 2WFLB 1BC5A 1RWBA 4OUDA 3RHSA 3OFKA 3DAYA 1DZ3A 2ODAA 1N2IA 2ZYUX 3KXIA 3ZH2A 2H92A 4FLMA 2OHFA 4IG4A 4ACAA 4DRYA 5KWSA 2HUNA 1XHFA 4GQAA 5LDHA 3WE7A 3LJKA 3L4JA 1ACLA 1EE2A 1DG3A 5E9WA 4ZVLA 1P31A 1HNNA 3F49S 4IV0A 2GJ9A 1W85A 1ZNXA 1XB2A 2OGWA 1OMOA 5SZJA 4DV0B 2QRLA 1T9GR 5EJ4A 4DANA 1WF3A 2V7PA 1SCQA 3C48A 4C3OB 4PZEA 1FU8A 1L5SA 4S1WA 5G1NA 1P1KA 3AR5A 3W5BA 2O54A 2ID7A 1F3OA 3QJYA 4JLOA 4CCAA 3FLBA 2WM8A 1V9CA 1WB4A 4NOJA 2HU8A 1SA0A 3G2KA 1N77A 4MP8A 2HEGA 3OZEA 2CHQA 3AERA 2HZ7A 3K4HA 4U0KA 2ERXA 4KPYA 4E31A 3CFYA 1IJKA 4C78A 3I73A 4NVRA 5AKIA 3M6AA 3VYWA 3KQVA 1YS4A 3FLAA 4DMKA 3KQHA 4JXXA 2QN1A 3E81A 3OKCA 5T8KC 2CLHB 4DCSA 1PJBA 4CPDA 1GNPA 4X1YA 4HK4A 2QT0A 4L74A 2CFSA 4R4JA 3ZZ0A 1E64A 3L92A 2Z2KA 3HCOA 1PR4A 4MYRA 3NTQA 4PN7A 4RPGA 4H60A 3BF7A 3PTAA 1I7DA 1TM4E 2ADMA 5D2CA 2CDRA 4JBIA 4Q21A 3JVIA 3EQ2A 3A06A 2PDAA 3HCAA 5DM70 2OC4A 2AMVA 2MINB 5D3KA 4C0KA 4DIKA 3O90A 4MYCA 5HKKA 4WKCA 2UYOA 4A36A 3HB5X 2QTGA 2JFOA 1RC1A 3EOAI 1H9AA 3P9NA 2QA5A 4BX0A 5BSWA 2R8XA 3WDMA 3ZZ1A 2C0CA 1WZUA 2IEGA 3QBTA 4RZIA 3M2TA 3UK6A 5EMKA 3AP3A 5ALTA 3TSZA 1E5DA 1SXIA 4F5WA 2C3PA 1AN0A 2JCSA 4FT4A 3NHRA 1QGUB 4ZU1X 2WAXA 5AVVA 1JYSA 4Z6KA 2QT1A 4ALKA 4JLSA 3SNKA 5AOVA 1MO2A 4EFDA 1DX9A 4V3BA 3UJCA 1P5HA 2QJFA 4XIYA 3NBXX 1E1DA 2Q1UA 1PGOA 2R7MA 4TTPA 4UFPA 3GMTA 1T15A 4FZRA 3AEUA 4KSYA 3TW6A 2AXPA 3OQHA 1FXSA 3P9CA 1ESEA 2V55B 4CG3A 1VCHA 1G0NA 3OCUA 1EWTA 3D4PA 4Z0PA 4ZI7A 3BYZA 1DAPA 1Z0FA 2PSEA 3QELA 3DR3A 4NPHA 3WK8A 2BJWA 2P9GA 2W8BB 1VQ1A 5EJ8A 5TIIA 4TS4A 3GV0A 4MPTA 1FUUA 4JSYA 3Q12A 4AF6A 4BEJA 2QX4A 3MIIA 1P2UA 1Z88A 2VBFA 3DE6X 4B32A 5EJ9A 3BAZA 3E5HA 3C4JA 1PYOA 2AOUB 2D2EA 1OILA 2ODNA 4L4XA 4PXYA 1N0IA 3CKLA 3T3HA 3ZVMA 3HKBB 3NUQA 2HA0A 2E48A 4I99A 4NS1A 4DDVA 3LRTA 2K2QB 3FDIA 3HEBA 4H4CA 4ZV4A 1EDEA 3WYCA 3RJMA 3EZYA 3O26A 3MLEA 4JLUA 2V8OA 2JIZA 4O6VA 5COBA 4EGCB 3LBHA 3DP7A 4ACBA 3SSNA 3D64A 4LOAA 4CJXA 5IMSA 3QE3A 2QTTA 3GVXA 4GKVA 3O8OB 1OVGA 5FT9A 4OQDA 1FU4A 4LPSA 2WB2A 4FXPA 4S1OA 1LEHA 4QL3A 5E6RB 1T3GA 5C80A 1XZ8A 3CKYA 5IN4A 1H2FA 2CFIA 4QDJA 1J25A 4F2DA 3V9PA 2DRIA 3WRVA 2ZRPA 3I9NA 2HDWA 5M29A 1FRNA 4L7QA 3FTNA 4XR9A 4D9IA 1OW3B 2QL6A 5FTLA 4PRLA 1KEEA 2QJRA 3FWYA 3EG9B 1NJ1A 3GFVA 4MW0A 4C0QC 4CU5A 5CDYA 1Q0LA 4FMCB 2GUWA 3DUWA 4G5SA 3QEOA 3MJEA 3CM0A 3L84A 1BGWA 1R0WA 1SBQA 2VDQB 4FEAA 4JLMA 4TL7A 4Y7DA 5KOHB 4J6FA 1Z5VA 1P62B 4BB9A 1M2JA 4LYYA 4WXPA 1ZH4A 3S55A 4I5EA 3LT5A 3WNVA 3MWGA 3F6EX 4G36A 3CH6A 1AKVA 3WQBA 3R7WA 1VJ1A 2E55A 4OHCA 3JY6A 1KBOA 1ENPA 3JD3A 2JRLA 2W70A 5IYZB 3H0EA 1I14A 4RV5A 3ZGOA 4IJKA 3SHVA 1R0RE 4GUAA 4BO8A 1NTOA 2G4VA 3G0DA 4JY7A 3ZK9A 2D6FA 1XZHA 3IX7A 3UMBA 5HFJA 5AK5A 3GUCA 1CY4A 3UA3A 1ZOPA 5AKXA 2H06A 1JDVA 2QL5A 2V45A 3DPSA 3GFPA 3ZHOA 5KO2A 1PZMA 3VX3A 3FNBA 5FOTA 5TQ0A 3DT8A 1B42A 1UXGA 2GF9A 4RQBA 2P2YA 2F90A 3R40A 4NQRA 1RAFA 5KDDA 3B52X 3K09C 4PC7A 1PS8A 5AESA 1KEEB 2VH5R 4QJBA 4RY0A 2A0YA 4AMZA 5BXQC 3HLYA 2MSNA 2ZIAA 4FFDA 4RLFA 2IPMA 4KDFA 4OVKA 4EJSB 3G7UA 2OKGA 2R1TA 2QPLA 2RHDA 3P9YA 5G4KA 2FUKA 2VT2A 5KNBA 2ZCUA 3NHZA 5H3LA 2GCIA 4R2KA 4PONA 3CG4A 5H3HA 5K51A 4EHNA 4YRGA 1SKMA 421PA 2FFJA 4WXRA 1KRXA 1VCOA 4FHCA 1KKLA 4QM6A 1JSLA 1U0OC 2APJA 2R8BA 3QNMA 1OC2A 4TWJA 4WN9A 3RCBA 3L9WA 4U2FA 3RKUA 5JC1A 1NU8A 3OKPA 1ODIA 2FHSA 2FWJA 4WW0A 1ZMBA 2COKA 2H17A 1OZ0A 1U3TA 2HRBA 3U7JA 1X86B 2RGWA 3WK6A 4BNDB 5CDGA 3ZD9A 2OZEA 4IDNA 3I9V1 1QJ4A 2IUEA 1MA0A 2PJRA 1GPWB 2GBGA 2DOKA 2X9VA 2YH2A 3EXHC 3UA4A 2G7ZA 1EJ0A 3HVIA 3AVWA 1OASA 3QFFA 4YP1A 1EVEA 3AETB 3L8EA 2CV1A 2BFBA 4CTJA 2IBTA 4NCAA 1YBHA 3IAUA 2YV3A 3BGOS 2FP4B 2PXHA 1K0UA 4TTTS 3R7FA 3VNRA 4YRIA 5L9AA 4UHKA 2VRNA 3N6VA 4OK5A 4JUCA 3RRXA 3L46A 3PQ2A 2YINC 2FJUA 1B6SA 4C3VA 4EKGA 3V4SA 2B92A 3M4ZA 4DARA 3ASUA 4L50A 1JPJA 3Q7QA 2B3TA 1OB2A 3HQ4O 3AKEA 3JZAA 2PM8A 2QUIA 4JEHA 1OAAA 2VAWA 3T9EA 5KI6A 3WGIA 2IYOA 2FUEA 3ZU6A 1NOKA 2PCLA 1PL7A 1QQ5A 1P7CA 4COKA 1RPAA 2VQ3A 2IX3A 3NONA 2OPHA 1DOAA 1KMNA 4FIDA 4U1RA 1E32A 1IEXA 3FZQA 4AG3A 4UCFA 1JHDA 4Q7QA 1T3ZA 2NUAB 1Q77A 3I1YA 4YPVA 2GLXA 3MRTA 1F2TB 2V3CC 1BYUA 4HADA 4LXIA 1TMOA 1AGXA 1H69A 1PG2A 4QASA 5F2KA 2PWYA 2MSKA 2PMWB 4B4VA 4BNDA 5CDTA 1QBKC 4GGOA 5AVKA 3WSVA 5B57C 5ICEA 3G8AA 1VJDA 3BZWA 2NUTA 4FSXA 3JWPA 3S4YA 3RFUA 3TJRA 4QTXA 3AEKB 1MDBA 2HRDA 3CLRD 1DGQA 1RAIA 1WKVA 2PL9A 3W9YA 1S6YA 3GA0A 2YMLA 1JIIA 3HKCA 4RKRA 3OQJA 2G06A 4BWVA 3OFJA 1TI7A 1M34E 3IAXA 4KFTA 3GJTA 3FYTA 3H5VA 1JVBA 1G8SA 1UFQA 4PAQA 4C0SA 3TBKA 1YRQA 2FPUA 2H1CA 3KZ1E 1AH2A 2B9EA 3DHYA 4KQIA 4MAMA 2D13A 1DBPA 2WWFA 3OEHA 4H27A 3PFGA 4TLLB 2V74B 4XD2A 1HFEL 1MEJA 3DNPA 3GIDA 3PXCX 1G2PA 3ZE1B 2Z1DA 1AXEA 4P4GA 1CEXA 2VRCD 3LA8A 1Y4DE 1ECJA 2AGVA 3W6PA 4Q12A 1BYIA 4HDAA 4HVAA 2BFMA 4BDSA 3C3XA 5HJ2A 3EB9A 2FK7A 5E95A 3KRTA 1YCGA 4PFKA 2UYYA 4BQSA 2GILA 4L5AA 3N0VA 5TJHA 3L7NA 3NORA 1U7HA 4KKVA 1OH7A 2CLLB 3QVWA 3HL0A 1R64A