3HJUA

Crystal structure of human monoglyceride lipase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
291
structure length
291
Chain Sequence
b'PRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monoglyceride lipase
publication title Crystal Structure of the Human Monoacylglycerol Lipase, a Key Actor in Endocannabinoid Signaling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 103
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hjuA00
1THGA 3C87A 1R4ZA 2YXPX 4GW3A 1DWPA 1XLUA 1A7UA 5HF8A 1KU6A 2ZJ7A 2BGNA 3VDXA 3WKBA 1QJ4A 1QIHA 5ALDA 3M82A 1E8NA 1BN6A 3KD2A 1H23A 1ORWA 3LIPA 2GZSA 4H7EA 4X85A 5AKEA 3PF8A 2XQGA 4QDUA 1O6FA 5K3DA 4FMPA 1R1DA 3IUNA 3BIXA 4BZZA 1XROA 1EK2A 1TQHA 1A8UA 2PVSA 5AKZA 4HRXA 4I3FA 2OAGA 1VA4A 2GZRA 4N8EA 4Y2QA 4L72A 5EGNA 1CUWA 1YS1X 2VJAA 3F96A 5AKXA 3LCRA 3WWOA 1P0IA 3I2FA 1IZ8A 4J0DA 1XZBA 5A62A 2J3DA 5DNVA 1TIBA 4CCYB 3R3ZA 4EY5A 4W9RA 1JMYA 1CUVA 4XX1A 3B12A 3QMVA 2OGZA 4CIAA 2WU4A 4UBOA 4S0XA 3G0GA 4KACA 5CW2A 2WIDA 5ALFA 3IBTA 5FLKA 2BUAA 1LZKA 4G8DA 5AI0A 1QIGA 4MEBA 1ZOIA 3C5VA 1IZ7A 2WTNA 4CCYA 1E8MA 4BTLA 3H2GA 4FKBA 2BJHA 3BDIA 1E3QA 3GELA 4C88A 1PJAA 3H2HA 3ED1A 3V1KA 2VATA 2WKWA 1LPOA 2YH2A 1AGYA 3HI4A 2JGEA 4JYPA 2RGUA 4OU5A 1H2YA 4F0JA 1QGED 3WL7A 5HKAA 2DQYA 3FLBA 3WI7A 1UKCA 1FJ2A 3MVEA 3MUOA 4MWTA 3NOXA 2QS9A 4QDXA 1CLEA 2QUAA 2YASA 5AKHA 4DM7A 3H2IA 3AZPA 1XQVA 1OILA 5CMLA 3G0CA 4NVRA 1U8EA 5KWIA 2HIHA 1GGVA 1CUEA 3M3DA 4DMCA 3ZWQA 1ZIYA 1J06A 5E4YA 5JAOA 3VXKA 2QM0A 4BVLA 2VJBA 4M0FA 5LZ4A 3I2GA 3NGMA 1XLWA 4B0PA 2UZ0A 5K3EA 5ESRA 4C6HA 3AFIA 3CXUA 3FAKA 1JFRA 3I2HA 5A7FA 5AICA 4JNCA 4CG3A 3IVMA 2C4HA 1ACJA 2HU7A 1EH5A 1W6RA 1YAJA 4QE3A 2YYSA 5SYMA 4BYMA 1YASA 4UFPA 4A23A 1ZD2P 1EB8A 2Y2VA 5A71A 3B3QA 4MYSA 1YS2X 1W76A 1VXRA 3DL7A 1EI9A 4B80A 3RLIA 3OTQA 5AIAA 5T4BA 3WYNA 4QLAA 1MX9A 4L9AA 1DTEA 3IA2A 1EXWA 2PM8A 1GPNA 4P9NA 3L1HA 4FLFA 3PI6A 4FNMA 4XJVA 2PUHA 3G9TA 1QIKA 5AH0A 4O08A 2CJPA 2CMFA 5HKBA 2HFKA 2PUJA 3MGAA 1UFOA 1LGYA 1EVQA 3W05A 2QJRA 1F0PA 1A8SA 3N2ZB 3SWWA 2DSNA 2PL5A 1TRHA 1WB5A 1LPNA 4X6UA 2VAVA 3I1IA 1MNAA 1DT3A 4I19A 4CG1A 3LP5A 3PICA 4DTCA 4DGQA 4LHEA 3W04A 2WSLA 1XZMA 4AO7A 5CRIA 2VAXA 4DNOA 5AIBA 1AQLA 1MJ5A 4ZV9A 1U2EA 2JGJA 3O0DA 3QH4A 2WUGA 3AIMA 5IVKA 2JF0A 2Z8XA 2ZSHA 3C6BA 3WYDA 3DKRA 1DQZA 4GXNA 1VE6A 2X76A 3A70A 5ALQA 2H9YA 1VXOA 1MX5A 5CBKA 2ZJ6A 3F98A 1Y7HA 5ALYA 1BEZA 4ARBA 5K3FB 2QZPA 4AX4A 3AINA 3WL6A 3F67A 1ISPA 3EQ9A 3FOBA 1K4YA 4FHZA 5CT9A 2C7BA 1TKRA 2WG1A 2FUKA 4DSZA 4CIBA 2VEOA 3KDAA 4Y7DA 4P93A 1EDDA 4K6GA 5K3FA 4Q82A 5HF5A 1TCCA 5ALOA 5JD6A 4RGYA 4M0MA 4DSAA 3WKDA 4X6XA 5CT8A 5IVHA 2PPLA 4NZZA 3ZPXA 3E3AA 1CRLA 4ZWNA 2HA0A 5HFNA 3G0IA 2V9ZA 3H2KA 4FDMA 5HF6A 3HZOA 3WK9A 4M0EA 4AB1A 4G5XA 5E2IA 5ALSA 1FFEA 3O4JA 1Q0RA 4KAAA 1UK9A 3C5WP 1QLWA 1XZJA 4QZVA 4E15A 1DINA 1XZIA 5ISMA 5AJHA 5JAPA 4GBGA 5AOBA 3WWDA 1NU8A 4I4CA 3C6YA 1K8QA 3OOSA 4KE6A 5JATA 2XUIA 3FYTA 5AKKA 4FLEA 3B5EA 5AP9A 4B6GA 2HHAA 1Q0ZA 3R0VA 3JYHA 1BS9A 5D3ZA 3D7RA 4P08A 5DTIA 4CG2A 1R88A 4WFIA 5KREA 4F21A 4X92A 2Z3ZA 1F6WA 1E89A 5FP0A 2OAEA 3I2IA 3DCNA 2XUKA 2Y1KA 3DDUA 2XUJA 4QDZA 2O2HA 2QTBA 1WHSA 2DCMA 1JJIA 1XRPA 4KAJA 4RNCA 3FLAA 4FNGA 3D3NA 4C4XA 4FOLA 1CUGA 4W1SA 2XUGA 2XMBA 1SCQA 3L1IA 5JYCA 1BCRA 4AN0A 3RM3A 4WDQA 2DQZA 3HACA 5FOQA 4DYHA 5AKYA 3DLTA 3D2AA 1AMNA 2HA6A 5K3AA 2HL6A 2O2IA 2B61A 1OXMA 5CH3A 1EX9A 1G5FA 1QZ3A 3PFCA 3W9UA 4A16A 2GBCA 3QPDA 5F4ZA 4EB0A 2O7RA 5EHQA 1P0MA 2I78A 2B9VA 4H7JA 4KEAA 3VJKA 3WMRA 1XLVA 4AXBA 2BGRA 4E11A 5C8XA 3OM8A 4UFOA 1C7IA 2GYWA 3WK4A 3KSRA 3WQHA 3HABA 5ALGA 1MAAA 5JZ9A 3QMWA 4U2FA 4UBMA 3WK5A 1N1MA 2WFLA 4H7IA 2B4KA 5IVIA 4IHAA 3RKSA 4C4ZA 2AJBA 3HRHA 4PO3X 5FPQA 3LLCA 4G8BA 4UBNA 4Y2TA 4LYDA 2CBGA 4QDOA 3BIWA 1R50A 1XKTA 3AILA 2XQJA 5ALRA 5E4JA 3UUEA 3WWCA 4DNFA 3H04A 1U4NA 4FWBA 2JIDA 3WLAA 6YASA 5EHNA 3A6ZA 5HK8A 4UHCA 3BWXA 3IUMA 3AZOA 5T4HA 1NX9A 3QZUA 5HZGA 2BCEA 4BE4A 2C58A 4N8SA 3IDAA 1CUJA 4HRYA 1WB6A 3PF9A 1EHYA 3P2MA 2VF2A 5T4EA 4LYEA 1XZAA 4HZGA 3FSGA 3QBJA 3S2ZA 3I2KA 4WY8A 1CUCA 5AKGA 2C0QA 2AXEA 4K6KA 3D5EA 1UZAA 2XMQA 4FTWA 4UFNA 1QIDA 5AI5A 1HLGA 5ALMA 1LBSA 4B84A 2WM2A 2XLCA 1JU3A 4H0CA 1K6EA 4EA6A 2WIJA 2OG1A 2QUBA 1ZICA 5ALNA 5JADA 3ESAA 3HSSA 1IMJA 1UK7A 1AX9A 1UT6A 4XWGA 2FJPA 1QTIA 2HRRA 4XIIA 4TGLA 1W52X 5AI8A 5ALPA 2PU7A 1QFSA 2GBFA 2CB9A 1THTA 4MXDA 4DLNA 3L1JA 4MQLA 2ZJFA 5JZSA 2I03A 5EIHA 3STTA 3FLEA 3QYJA 1UXOA 2OGTA 3WK6A 5E4TA 3DEAA 3EF3A 3KWFA 1ZI6A 3IIIA 4U2CA 1LNSA 3WIOA 4HXFB 4N5IX 5LLSA 3ANSA 1MU0A 2OCKA 4X94A 2HA3A 5DLPA 3TJMA 3YASA 4J0HA 3S8YA 3O4HA 1CUHA 5ALHA 2JGKA 4F5ZA 1ACLA 2VQ6A 3NWOA 3FNBA 1D07A 1BRTA 2O2GA 1LPMA 4LXGA 2ZYIA 1HQDA 2P8SA 1QO9A 4X90A 3F97A 4OPMA 4E14A 1XZCA 3G0BA 3HXKA 5D7BA 1B41A 4HVTA 4DNPA 1T4MA 1QIIA 5C81A 1VKHA 2IIVA 1WPRA 2JGFA 4Y2XA 3ESDA 2XQKA 2GYUA 3BF8A 3D59A 3CN9A 3EQ8A 5A6VA 4FBLA 1PV1A 3KOOA 1XQXA 1K63A 1CQZA 1X70A 4G8CA 5AO9A 3T52A 4OB7A 3DD5A 4B85A 2PSDA 3DOIA 4GEGA 2G4LA 1ZI9A 3WZLA 4LIPD 4ZRDA 5FRDA 3STXA 3DL4A 5A7GA 5EHZA 1AC5A 1Q83A 1CUSA 1QO7A 1USWA 4ITVA 5AK5A 5IVDA 1CFJA 3OG9A 2J3QA 4X91A 2H7YA 4QDTA 2WFZA 4TPKA 2AJDA 1GXSA 1DWOA 4D9JA 5DYTA 3V9AA 5ALVA 1QTRA 1CUIA 1GZ7A 4RE5A 4AMYA 1CPYA 3FWHA 4ZI5A 4JUIA 3V1MA 4H7DA 5AKJA 1VZ2A 1W1IA 1R9NA 4WFKA 5CURA 5T4FA 3CCBA 2ORYA 4B0OA 1CUYA 5EIAA 3ICWA 4P92A 1E66A 2J4CA 4N5HX 4W1QA 5DNUA 1YSCA 4LKOA 1G4HA 2K2QB 1ZJ4A 4H35A 1FFAA 1GPKA 1XFDA 2O7VA 4MWSA 5JAHA 1A8QA 3R3WA 4UHDA 1B6GA 1CUDA 3C8HA 2ACEA 3WJ1A 3ILSA 2FX5A 3I1YA 1FFDA 2XMDA 4DNQA 4BBZA 5DYYA 1P0QA 1XZKA 2QOEA 3K6KA 4C89A 1H22A 2W22A 3R3XA 3BJMA 4WCVA 4Y2UA 3AIKA 1LPSA 2V97A 3G9XA 5DWDA 2OQIA 5BWCA 4X00A 3H1AA 2VJDA 5ALLA 3G02A 2Y6UA 3GFFA 2X8BA 5BWBA 2EEPA 2WTMA 5KWJA 3U1TA 4X7BA 7YASA 1IUNA 4AQDA 1MX1A 2ROQA 2H1IA 1JU4A 2Y2UA 2WIKA 4AN1A 1GQRA 1KU0A 3EQ7A 1ZGCA 1LZLA 3M83A 5ALWA 5AI6A 3R3UA 4EBBA 2DHEA 3WL8A 1TK3A 2GBGA 4WY5A 2Z5GA 2BAGA 4J0JA 1EVEA 2AJLI 5FPPA 1UOQA 3W2TA 2BKLA 3V48A 3C6XA 4K5QA 4Z49A 1VOTA 4AO6A 2BUCA 1O6GA 1J1IA 2ES4A 2OCLA 4IH9A 2JGLA 1CQWA 4OB8A 4Y2JA 2CEKA 2LIPA 5AM5A 4JEIA 1ZD4A 4GECA 4EZIA 3D2CA 2PBLA 4KE7A 2R8BA 3QM1A 3IB3A 4KR0A 2VJCA 2XDWA 2ZYSA 4KAFA 4EUSA 1KEZA 1F8UA 2OGSA 4J0GA 1HPLA 2WJ4A 4BB0A 2HM7A 1YB7A 5FUMA 1HKHA 1VA5A 4Q3LA 4CFSA 4W63A 3U0VA 3WWEA 1J2EA 1BN7A 5AK4A 5BOVA 1CUBA 1UKAA 4EY7A 2XMCA 2PU5A 4ZXFA 3UUFA 5LZ9A 3C43A 1VE7A 5I7UA 5D3KA 1JKMA 2WU3A 1WOMA 5AKLA 3N0TA 3I6YA 4UBIA 3FSGD 5AM4A 4BC1A 1YB6A 3VVLA 4BP8A 3AUKA 1UOPA 3QPCA 4X71A 1DQYA 1XRLA 4HS9A 4RPCA 3FCYA 3H19A 2DR0A 4BAGA 2VT7A 4YK7A 3FVTA 5CXXA 4PSUA 5AI9A 2WHPB 3C8DA 1XZLA 3H2JA 1FSSA 1GT6A 1S8OA 1QIFA 2ZSIA 4A5SA 3V1NA 1VJ5A 1XQYA 2G5TA 3D2BA 3TEJA 3PUHA 3ICVA 1U65A 2RHTA 1XRQA 3SX4A 2QVBA 3R40A 5ALTA 1CUAA 2WHPA 4K2AA 5CT4A 4HXGA 4YASA 2RHWA 2HA7A 2WHQA 4MYDA 2WUEA 3OPMA 3DYIA 2DHCA 4KRXA 5AM1A 4X6YA 3O9VA 4C01A 4J7AA 4BDTA 1QIJA 2XMZA 4KE9A 2HU8A 2WFLB 5CH8A 4FFWA 1ZJ5A 4QWWA 1GQSA 2HDWA 3F9CA 3A2MA 4PQEA 1C4XA 1AZWA 1R3DA 4KE8A 5LZ2A 3DKKA 4PNZA 2XB6A 1CUUA 3DOHA 5EIEA 4OCZA 2WG0A 4RE6A 2BUBA 4ETWA 5LKRA 2Q0XA 5ALZA 5K3BA 4ARAA 5EI5A 1XZEA 4BRZA 3DS8A 5JANA 1BU8A 2ECFA 2ZYHA 4G4GA 3SK0A 2Z3WA 3QPAA 1CUFA 1YA4A 3I28A 4V2IA 2RONA 1WB4A 1MO2A 1AURA 4KRYA 2Z8ZA 3E4DA 1H2XA 5DJ5A 1R9MA 4G9EA 1SC9A 5EFZA 4BCBA 3KXPA 3JW8A 4J0KA 2XMSA 3ZLUA 5D6OA 1PFQA 2C5FA 5ALIA 3BE8A 3G8YA 3DJYA 1F0NA 4W1RA 3H18A 2XUPA 5AM2A 4U2GA 4HTAA 2RI6A 4UUQA 2WIFA 2JGIA 4QWMA 4BCDA 3WK7A 5CTAA 1EDBA 1E8DA 2H7XA 3AZQA 2D5LA 1N8SA 2XI4A 2WJ3A 5EHXA 4BE9A 2HU5A 1VZ3A 2EDAA 4F60A 1HDEA 2WG2A 1TCBA 1K5PA 4AO8A 1GKLA 2H7CA 2HA4A 4QA9A 2QR5A 1IVYA 5LKAA 4PSDA 1A88A 3A2NA 1N5MA 1CV2A 1DT5A 4Q3KA 1QE3A 2OQVA 3LS2A 4C4YA 4Y2SA 4IH4A 2D0DA 2XMRA 4ROTA 1WM1A 3ANTA 1T2NA 4J3JA 2G63A 1MN6A 3OC0A 1WPXA 5CT5A 1H2WA 4EY6A 4Q05A 5AM3A 4ZV7A 4FLMA 2R11A 2E3JA 2AJCA 1YR2A 4LXIA 4IH1A 3KWJA 2JEYA 3GBSA 1ODSA 4IQ4A 4UHHA 2DHDA 3M81A 1FFCA 3FYUB 3BDVA 3LIIA 1LLFA 3UMJA 5JARA 2WHRA 5LP1A 1XRNA 4GDMA 4BP9A 4HAIA 3CCCA 2Y6VA 1ZD5A 3GA7A 1DX6A 3AJAA 1EB9A 1X2EA 4U2EA 1RP1A 4UBKA 2PKYX 5K5EA 3FYUA 4J0CA 3BF7A 3G9ZA 4MQMA 5DYWA 4QLOA 3T4UA 4GLBA 1MAHA 2PSHA 3AIOA 5JAUA 4OB6A 1E5TA 1XZGA 4J03A 2G5PA 3TRDA 1NU6A 1QOZA 1YA8A 5CT6A 3QVMA 2JGMA 1EINA 2XQFA 2ZYRA 4OD0A 2J4FA 1LPBB 1CVLA 3E1GA 1CR6A 2XUAA 1BEEA 2C5GA 3IURA 3NUZA 4GWLA 5CXUA 5AOCA 5HFAA 3QITA 1DX4A 2I3DA 4AZ3A 4JH0A 4DMKA 2X5XA 5JALA 3IUQA 4NMWA 1OCEA 3DYVA 4BC0A 3WA7A 3WL5A 3GROA 3PUIA 4PV7A 2QXUA 3PE6A 3GZJA 3H1BA 3HJUA 2QT9A 3D0KA 3BXPA 2WQZA 3FYUC 3I6ZA 4Q1VA 4WJLA 2B20A 4N8DA 4LXHA 1L7QA 4X97A 5FXMA 4UBJA 1BCSA 3X3HA 2XLBA 2XE4A 1QFMA 2V96A 1WHTA 5C7YA 1HL7A 4Q34A 3ZLVA 3FCXA 1Q84A 1RYYA 3STYA 1XZDA 3F8SA 4B81A 2WFMA 3WA6A 1UK8A 2OXEA 1YCDA 1ORVA 4B9AA 5JASA 1XKLA 5ALKA 2WUDA 1C7JA 4BRSA 4B7ZA 4U2BA 1P0PA 4QEKA 1XRMA 2ONCA 1J07A 3DNMA 2OPHA 5A2GA 2W6CX 5IKXA 3PFBA 2WJ6A 4PSCA 3G9UA 3GUUA 1FFBA 4C87A 4X3CA 2PSJA 3HEAA 3WKAA 3WZMA 3IULA 1SCIA 2V98A 4BDSA 4H7KA 4Y2VA 5HQ3B 1SFRA 2IITA 4OYYA 3WIBA 5YASA 3I2JA 1SOMA 4GHWA 1XZHA 3WJ2A 1LBTA 1QONA 5JD4A 2DFPA 4J0IA 1AKNA 1TAHA 4NS4A 5HQ3A 1EDEA 2PX6A 4BATA 1SCKA 2JBWA 2RAUA 1JJFA 3I6MA 2XT0A 5LZ8A 3ESCA 2QXTA 5AK6A 1MT3A 3HLKA 2XUQA 4BAUA 5BV7A 2IX9A 5AHXA 5FV4A 1G42A 4DIUA 4L0CA 1MPXA 1Y37A 3VVMA 2QMQA 4EY8A 4WDRA 3CN7A 4G4IA 1MNQA 2GYVA 4DMFA 4UHBA 1WCYA 3EIOA 4ZREA 2NW6A 5LIPA 3O95A 4QNNA 3H17A 5C8VA 3ESBA 4OU4A 2AJ8A 2HA5A 1LPAB 1XRRA 5ALEA 2VA9A 1I6WA 2VT6A 5FDFA 5C8ZA 4YX9A 2CUTA 5K3CA 1Y7IA 2HADA 5LZ5A 2PSFA 1JJBA 5AI4A 1UKBA 4B9EA 1JMKC 4INZA 5DTJA 4H77A 2CZQA 3TGLA 4AZ0A 3VJLA 2XQIA 3WK8A 5KBYA 5ALJA 1VLQA 3O4GA 1QIMA 4X95A 1UWCA 4YPVA 1UK6A 4G4JA 4H7FA 5HK9A 4K6HA 1TCAA 3DQZA 3HC7A 1DU4A 5JIBA 4XVCA 3BJRA 3R3VA 4MEAA 3C45A 1ETHA 2XUDA 4X93A 1UOOA 4FFVA 5ALXA 5I9IA 3WKEA 1ZD3A 4KJXA 4BCCA 2VSQA 4Y2PA 2XUOA 1L7AA 1XQWA 4UHEA 4IO0A 4E46A 3JWEA 4DMHA 5SYNA 1HBJA 2OCIA 2ACKA 3STUA 4B83A 2XMGA 5LZ7A 3RK4A 1M33A 1RWQA 2EDCA 1GKKA 4BAZA 4WFJA 2XUFA 3A2LA 1BROA 3C6ZA 3OURA 2BFNA 3IUJA 1CEXA 4MJ3A 3V1LA 3W9BA 3HYSA 4GI1A 2WIGA 1JT2A 4EHBA 2HA2A 1IUPA 3SC2A 2I3ZA 3WKCA 1IUOA 2HFJA 5HCUA 4W1PA 5DNWA 3EBLA 1X2BA 4FBMA 1MTZA 1BE0A 4B82A 4BVKA 1EK1A 1XZFA 4PW0A 4AMZA 5CH5A 4H7HA 4CI9A 1ODTC 3FVRA 2JEZA 5JD5A 3K9BA 1ZIXA 2FJ0A 3R41A 2VTVA 4CCWA 2HRQA 3BL8A 3STWA 2GBIA 2XUHA 3ZV7A 4Q3OA 1ODCA 1YAHA 2OLEA 1JI3A 3FBWA 4KYVA 5JZBA 1W75A 4Y9SA 1DWQA 3Q8WA 3VKFA 1LPPA 3STVA 4L3WA 2PSEA 5A7HA 5IH7A 2CKMA 3C70A 3G7NA 1CUXA 5HF9A 2QJWA 3W06A 4UHFA 3G0DA 4TVKA 5AM0A 3VJMA 3O9MA 4BVJA 4OUKX 3ZLTA 4U2DA 1H2ZA 2OCGA 3K2IA 2ZVDA 3D4LA 4HXEB 3Q0TA 2WILA 1CUZA 3MUNA 3VISA 3H0CA 4Y2YA 1CIJA 4G1FA 3O4IA 5I8PA 1Z68A 5AOAA 1QIEA 4PF1A 1L7RA 4H18A 1ZGBA 5LYYA 4OYLA 2QRUA 5ALUA 4EY4A 3E0XA 4BZWA 5J3JA 3WWPA 4BTVA 2QKYA 2C0PA 5AKIA 3PDCA 4OSEA 3QMMA 4Y2RA 4UBLA 5FKJA 3RARA 4G9GA 1EA5A 4JYMA 1G66A 1N5RA 3ZI7A 5AK3A 2RIPA 5H3HA 3R3YA 4UPDA 4ZGBA 1ZI8A 2WLSA 1AUOA 1GPLA 2WUFA 1W4LA
chains in the Genus database with same CATH superfamily
3SIPA 1PJ4A 4YP7A 2GXQA 1R4ZA 4LVNA 1OYWA 4LOAA 3PD0A 1QH0A 4ARUA 4B6PA 1FBNA 1WMBA 2ZW9A 4EKYA 1A7UA 2ZWMA 1O77A 1EXVA 5SYAA 1SXJC 1U4SA 4JX8A 5B3JC 1GZHB 4HB0A 2XAAA 2FZKA 3B6MA 2AVDA 2FG5A 3DULA 3T12A 1YT5A 5HX7A 1VL6A 2A86A 2BMFA 2QNBA 2X8JB 5M7EA 1VJGA 1QYRA 1L7PA 2ASEA 3DAYA 5LYJF 2B37A 4KMMA 4KPEC 5ALDA 5E7JA 1K89A 2P62A 2YMLA 3PLRA 4JL6A 1O8CA 4N7BA 1ONNA 4TTPA 4JJFA 1PGNA 2GHQA 3D8HA 1ORWA 3KZKA 1RIIA 2GZSA 3LIPA 4H7EA 4O4IF 4X85A 3HQ4O 1Z6TA 4BFSA 1Q2UA 1E94E 4DSNA 3ETCA 3SXPA 4DC1A 3ZY6A 3X1KA 4ZV4A 3CC8A 5JCJD 4JDPA 4D9KA 3WRXC 3DMYA 5ER6A 4BX9A 1AOXA 2Q9CA 3IP5A 3MJCA 1NHGA 4PCLA 4HMPA 2QB5A 3PQ4A 5K3DA 3EVCA 3KL4A 3O4FA 4L27A 3BGSA 4PG6A 4G5SA 3TZCA 3TINA 4OUDA 5LQUA 5HCNA 2HNAA 3IT3A 4FN5A 4Z9AA 3B70A 4O1IA 4L5JA 3OZIA 4QYIA 1AZTA 1WLYA 1M66A 2IEAA 3WB9A 3I58A 2PX2A 1SU8A 1EK2A 4OGWA 5FHRA 3THOA 2XB4A 4ZFNA 4RJJA 1LD3A 1YU9A 2GEVA 4QU5A 1ZXBA 4E07A 3HVRA 1M74A 5FTKA 1V8OA 1FS4A 2DE0X 3TQHA 1EHCA 3ZWVA 4H59A 3TN7A 2CHUA 2JAUA 3N0WA 1JF8A 2AKYA 3AVQA 2RSLA 2O1WA 4UEJA 2CMKA 4LQLA 3OVMA 4YLEA 3SVZA 3TTVA 2BP7A 2PZ8A 2VJAA 1JALA 1Z8HA 3WX0A 3I5UA 3LCRA 3OLQA 1BC5A 4FK8A 4O8CA 2GD2A 4PQFA 4E1BA 2GXAA 3QU5A 4OP3A 2XVYA 1V71A 2H1LA 1N5OX 5AOVA 2QYSA 1SBTA 3EIEA 4I50F 3ZHZA 1APBA 2EF0A 2VWQA 4HJXA 3AF6A 2J30A 1P1FA 3MJSA 2EATA 3AI2A 1B43A 3PRYA 4N18A 1XZBA 2XNJA 4INJA 2JFBA 3N8GA 3U0BA 4ODIA 5A62A 3P5SA 4J1TC 5DNVA 3PJFA 1OASA 3UATA 3ML1A 1UXKA 3M9LA 4Z4GA 1JMYA 2Q0HA 1RC1A 4XGNA 1OB2A 3H9QA 3V8PA 3BXXA 2G72A 4WFQA 5HS6A 3TIFA 5HJ5A 2I7XA 2OGZA 2PMCA 2VPYA 3GOQA 3K5HA 5KQRA 2WU4A 2VG8A 1XMOB 4L9RA 3BH6A 4BKPA 3EZ9A 4D0LB 4E5DA 2WB2A 3VOTA 2JDID 2CNLA 4JJ8A 3DWEX 3LFUA 1H69A 4PZ9A 3K20A 5ALFA 4W82A 5FLKA 1JHVA 1LZKA 4L95C 3K9CA 4J0FA 1ZVMA 4LY0A 4QBFA 5L3SB 4FT4A 3TQSA 5IDVA 3IE1A 1IZ7A 4ONEA 1E5DA 1XIVA 2W2OA 2XJ9A 3GDOA 1X8LA 5K45A 4WECA 4IIVA 1DIHA 4JR0A 5H16A 4HAYA 4RTMA 4KVGA 1E8MA 1BWSA 2IA5A 4RESA 3QXSA 1EIZA 2YVQA 3AFOA 3QTBA 3V2IA 2E5FA 5TPZA 4B40A 5GZ1A 1E3QA 2VCHA 4EL5A 1RKBA 1YXMA 2XY4A 2NO4A 4TLEA 2FYTA 2GTIA 2EBUA 4ZO4A 1DFIA 6GPBA 1QM5A 2WKWA 1FP1D 2UZ1B 5JROA 3L6BA 2VXYA 3A1NA 2WV9A 1AGYA 1T3HA 3HI4A 4TTAA 3O8RA 5AVWA 1PX0A 2CNBA 4CQMB 4HVAA 3H5VA 2J0QA 4YY3B 3E4CA 1Z22A 2RGUA 1DMSA 1WZEA 3HJNA 3N58A 3Q3VA 5FUVA 1GVHA 4G1EB 1O89A 2RKOA 1JWBB 2BZSA 4XR4A 3TR5A 1R5BA 1N78A 4UCQA 4FSDA 1V2GA 2QRVB 4F0JA 4C7XA 3VMFA 3IOMA 2IJGX 3WL7A 5HKAA 1ZX1A 4IM7A 2MOKA 3NTOA 3PRJA 7ABPA 4IJUA 4ZT5A 2QMOA 3DZHA 4P3OA 2CL7X 2AQIA 2YOGA 1MC1A 1V6SA 5K51A 2UZ1A 3LECA 1PR3A 1RI1A 4G01B 5DDIP 1O0CA 3LDGA 4MWTA 2OZVA 4G89A 4JP8A 4OV6B 3FWKA 2E1RA 2QS9A 4OL9A 3ROMA 4CQMA 2QUAA 1T9ZA 1OJLA 1CT9A 5AKHA 4CDNA 1MHPA 4DM7A 1H3FA 4TWIA 3H2IA 1IBCA 4D9CA 1F12A 3LM8A 2QRVA 3Q8KA 4TZ6A 3A4YA 2HGZA 3PXUA 4B6RA 3HDHA 1II8B 4RZ3A 3OF5A 1P1RA 4W5HA 1AGNA 2H7VA 4ARVA 3UBTA 2ZS9A 5BMOA 1KSGA 4RVSA 5CMLA 5EJ7A 4YJ3F 3WLQA 1WLSA 3G0CA 5FF9A 3I1FA 4EKIA 2OR3A 4FMCF 2VCYA 3M7IA 5HVNA 2X3FA 4NVRA 1G60A 4O4HB 3BM5A 2CXTA 1FTGA 3SZUA 2VR1A 1BE6A 1E1RD 3CUKA 5DBGA 4MITA 4NF2A 4X0EA 3O6VA 3IL2A 1S2GA 3RV3A 2OT3B 3IQXA 3SLGA 3AVOA 4US0R 1NLMA 2IHBA 1GGVA 4JLAA 4TWJA 3M3DA 4DMCA 2PS9A 1IOVA 3CPJB 3PL1A 1A5AB 1Y7LA 1RBMA 3F6PA 3VXKA 4WESB 2FAXA 4D9EA 1W36B 4M0FA 1II8A 4K9DA 4ZVNA 3HY3A 3JQ6A 1EP1B 2CL6X 2IUYA 2P79A 3UA3A 3VR2D 1IXKA 4I5EA 2DJ5A 1WUIS 3UGKA 1XLWA 1P0CA 2FRDC 3EZ6A 3FJ1A 3SS9X 1LNQA 4FGJA 4CXMA 1DARA 4C6HA 3F4KA 2C96A 1KFBB 3O7WA 4TLAA 2OVFA 2H6EA 1UZNA 2VHEA 3FHLA 4O4HA 2W6ZA 3AFIA 3WQQA 3CXUA 3CTMA 2XCTB 2C0CA 4LZWA 1MX3A 4YQFA 5A7FA 3VI3B 4IYJA 5JOQA 2V7XA 4G5GA 1JG6A 2C4HA 1W2WB 4WXPA 2YJ4A 1KO8A 3MM4A 3PXBA 4PO8A 3SM9A 2LDXA 4WESA 1EH5A 1YAJA 2H1OA 4BS9A 4QE3A 2YYSA 3WGVA 2WHYA 5SYMA 1LFDB 1U8AA 1UEXC 4HGYA 5JJKA 1AA6A 2Y1GA 2UZIR 4EELA 3KB1A 4AKEA 4DUGA 3FTQA 4Z7JA 1X7XB 3DBVO 5A71A 1YS2X 1C7RA 5TMEA 1UJMA 1VXRA 1DZ3A 3G2PA 3JYOA 1EUCB 3KXLA 4Q7JB 4XPIB 2B7BA 3K8OE 2XBLA 1K0FA 1Y6ZA 3NNSA 4GBJA 3EMDA 4M60A 1QZXA 3ZCPA 1R2QA 2MWMA 3F74A 3K3PA 5JFTA 4NAHA 1MX9A 4L9AA 2A57A 2OHIA 4B5LA 4YRLA 2PBFA 1BD3A 1Q17A 3QA9A 1QVZA 1SHKA 1RCUA 2PFSA 4AF8A 1U5CA 4P9NA 4Q9HA 4C0QC 1KKUA 2FHPA 3X1DA 1NUHA 1BS1A 3N8IA 4FNMA 4ZCRA 2PZJA 2D2FA 1Y3DE 3I9LA 5FPHA 1K2VN 2ZITA 3G9TA 1QIKA 2M98A 4U7JA 1X7XA 1XSEA 2EL9A 4OL0A 2PZFA 4M3NA 4PVCA 5DLYA 2O20A 3O3OB 4J9UE 2CJPA 4O08A 1X15A 1XNQB 1TLTA 1EUCA 1PT8A 2IP1A 4XPIA 3RIGA 3SE7A 4Z9BA 3NKLA 1WW8A 1VGRA 1C14A 4XIFA 1JQDA 3PYMA 3KQTA 3OESA 4OQFA 4PSKA 5D5PA 2CD7A 3W05A 1KQPA 3M33A 2PT6A 4A0SA 2QJRA 1RAAA 1H8HA 2TS1A 4HNRA 4BMXA 1ORTA 2J9FB 4Q1BA 3W8FA 2ZIGA 2GLUA 3N2ZB 3VKWA 3ZLBA 5A3RA 3A06A 3BE5A 2PL5A 3DEFA 3HXOA 5DHTA 3CF4G 2J8ZA 2FV8A 1SBZA 2JFPA 2VAVA 2I6UA 1KF0A 4GXQA 1N6OA 3RTBA 4OSOA 1O5IA 2GEKA 1DT3A 4EI9A 3IDFA 3AWIA 3Q2KA 4GXRA 4P0PB 1MXFA 2ZRHA 4ARZB 4EJ0A 1EXNA 1ACMA 1E77A 3A32A 4O29A 4G5FA 1Z7GA 3EMKA 4Q9AA 5B5SA 1WX1A 2VUIB 3NP7A 4NOKA 1CKEA 3H05A 1TEXA 1Q1QA 1OV4A 3IDQA 2NPOA 1QGZA 3NGLA 2QUHA 1JEEA 1QK3A 3GEEA 3UMCA 3WGHA 2B82A 2RC5A 5ADHA 4RACA 4F97A 1T25A 2PGLA 5DFAA 1MJ5A 2J9FA 3U4GA 1QGAA 1FNMA 1NLUA 2DVMA 2RHDA 4JIMA 1RADA 4KJZA 5FUYA 4G0QA 1XXHB 4QLBA 2I4TA 4I6GA 5TLSA 2F55A 3TH5A 3TFQA 4AJ9A 4NEHB 1TM4E 1PVDA 3O0DA 4PTLA 4C4PA 2A9QA 3AIMA 3CLVA 1M8PA 1LW7A 3H0KA 4D4IA 4ARZA 3E3LA 4PFJA 1FVXA 3FHCB 3WYDA 2XYRA 3DKRA 3EH1A 3S7ZA 2I4NA 4EB8A 4PZDA 2CVHA 3T5BA 3FTNA 3VNUA 1TUIA 1VE6A 1QX3A 1H2BA 4NCXA 1EFTA 2XADA 5C3UA 4IG4A 3ZE2B 1UEIA 5ALQA 3TB4A 2P27A 4AQ7A 2D1FA 2PIDA 8LDHA 1SVLA 3P5BA 3K73O 3RKRA 3KYIB 3X1YA 1XXHA 3SHVA 3ABSB 3T5TA 4A2CA 3GBPA 4RBNA 1YZQA 2G8LA 1JU9A 4P7BA 5HJEA 1A1SA 2V4ZA 2PV7A 3DOUA 1M0EA 5CNMA 3BPSA 1E2GA 4JODA 3K0SA 1YWGO 1KY3A 2NPIA 3FTEA 1NFFA 1X0VA 3AINA 1XXLA 3A9TA 1SUWA 4Z9YA 4IGIA 1N0IA 1Y6GA 2R3SA 3JVIA 2XYPA 3EFOB 3PD7A 1GITA 5DBHX 1ISPA 4I9FA 4BMZA 3GDFA 3OIVA 3JYNA 5EEGA 5BSFA 1PU2A 1X74A 4JFRA 3JQRA 1XDZA 2R87A 3OC6A 4C7KA 3DOCA 3WIVA 1LDGA 3G23A 5KNBH 2WI8A 3VR1A 1K5GA 5TR9A 1J2TA 5CR9A 3EZFA 2OESA 4BE7B 4OAOA 2B34A 1EFKA 1QYVA 1B8NA 4JQSA 4M22A 3KQLA 4BVAA 4FR0A 4Y7DA 4QRDA 3UPTA 4MDYA 4R0MA 1EDDA 1ISIA 4K6GA 4W9NA 1Y8CA 4Z7QB 2C2WA 3RC7A 4U9IS 3SFVA 2ADOA 3QXJA 1ZMBA 2PZGA 5HF5A 1QAMA 1KPGA 1ZQ9A 2GSWA 1FU7A 3DMNA 3EFOA 3SQOA 3VDRA 3VOAA 5JD6A 1M7HA 1U94A 1T3SA 3LC7O 1Q7TA 3GDGA 4FS3A 2NUPB 4M0MA 4DEYA 3FCUB 3A1EA 4X6XA 4TRNA 2FFQA 5CT8A 3GUZA 1VLZA 4ZK2A 3UPUA 3JQFA 1VQ1A 4RSMA 4UMDA 1GTMA 5AJXA 3V2HA 4ZWNA 1DAOA 1QG0A 3S5JA 2GZ1A 4CM5A 1EESA 3IP1A 1F0KA 3K0FB 3ZCXA 1E92A 3G0IA 3LPMA 3H2KA 4JB3A 3ZI4A 2F67A 4YYEA 2ATEA 2DFNA 1DAHA 5HF6A 2GGSA 3PC8C 4F7WA 4M0EA 2P9JA 2V3CC 4G5XA 1CDOA 1RCFA 3BFVA 3F2IA 1WF3A 1M34B 3LRXA 3IJRA 3O4JA 5ALSA 1K27A 2P1RA 4JT4A 3S4YA 1UK9A 2JAQA 3C5WP 4KIGA 4HDAA 2EFDB 1RI2A 1T26A 4Q66C 1V9SA 5BSTA 4JMPA 1WDTA 2Q1YA 3W9YA 5KVSA 2ZYVX 1JAXA 3L6DA 4PWYA 2ATIA 2NUPA 4F1KA 4NCHA 1DINA 1VP3A 1Z2CA 4Q6WA 3OZVA 5KQPA 4QNRA 4R68A 1Z8NA 1RWXA 1V16B 1XO1A 5EZQA 1M2FA 2G9VA 3CNHA 4CETA 3K0FA 3E35A 1FDRA 4U00A 4EMBA 3OOSA 3PKIA 2O07A 5KSOA 3CA8A 2HLNA 3IEVA 2J9ZB 2OBFA 1GPH1 3P32A 1L5FA 4JB0A 3BGOS 5AP9A 3ZWPA 4B6GA 1C7ZA 4XYEA 3NJ4A 3PDJA 4MUJA 1M34A 3IERA 2HHAA 3R0VA 3T4EA 3DF7A 1CJTC 1NP7A 4MUXA 2NZYA 1JLRA 3RG8A 3UY4A 4LI0A 5KKAA 4DLWA 1YFLA 3HWRA 2QVYX 3R4CA 5D3ZA 2INGX 1B0AA 2PNJA 1WB9A 2ZI7A 4QOSA 2BGIA 4TSRA 4KWCA 5TVGA 3HR8A 4CMIB 3UK6A 4JWKA 1RHQA 2XCIA 3Q1KA 4KO4S 2VH5R 2BFDB 4OMUA 1V16A 2NU6A 4WFIA 2Q5JA 4BVHA 5KREA 3IEPA 3WLJA 4D3SA 1SR8A 3K5IA 1XCBA 3WG9A 1KHHA 4DLAA 1Q91A 2YJ6A 1JWAB 5FP0A 5BORA 2A2ZA 3DCNA 3CT4A 5DX8A 5HUHA 2NX2A 3ELUA 3O2JA 3VPGA 4D42A 3D7SA 4NSNA 2XUJA 4KXMA 2JA2A 1SK9A 4TKZA 5FYQA 4JBYA 3MXTA 4F2GA 1D1PA 1LW6E 4B76A 5K3SA 3QSYA 4QHYA 3SHFA 3ZI0A 3ZHQA 3ZHOA 4MYRA 4PZAA 4LSWA 3I32A 3L1UA 1IXYA 5DN9A 3D4OA 1JJIA 5KB3A 4CMIA 4QGGA 5EJFA 4COKA 2J5XA 1Z62A 5KOJB 3QP9A 3ORRA 4JUBA 1ESDA 2BFDA 1MO3A 2XUGA 3IIMA 4YP5A 1AT1A 4D43A 2SKEA 3SBDA 1HDOA 1QGOA 4E32A 4DXAA 1BCRA 5BYAA 5F76A 2NMVA 1QQTA 1UC5B 2J6IA 3MOIA 1PFVA 2KYRA 3CEAA 1NXXA 4I8DA 1PD1A 2QLBA 1K7CA 1Z0DA 3NRJA 4H6PA 1JBQA 1XGKA 4YDSA 4DYHA 3DLTA 4U7FA 4EABA 3D2AA 2A9KA 5F7JA 5HFJA 3OD1A 2ZJ4A 5K3AA 1WPQA 2O2IA 5AW5A 3SQLA 3WO0A 2B61A 3U1VA 4A36A 4BWGA 3Q1LA 5CH3A 1G5FA 3II6X 3ZQKA 1XLTC 4EYSA 2VK1A 2EBFX 3FI9A 4ZDIA 1W48A 5IP5A 2QD1A 4UDOA 1EP3B 1YR1A 4YMLA 4NCKA 5KOJA 4ZQGA 1XFAA 2AQKA 2GPSA 2Q6LA 1NM5C 3MINB 3GPBA 4MTLA 4BQPA 3VUFA 3QBTA 2V7GA 4ZP1A 4N7JA 1W2GA 3BXFA 3JQGB 4ZXPA 3RU3A 3UG6A 3VU1A 4JXZA 2UZAA 3O8BA 3ZDXB 4LF5B 3ET4A 1JHRA 3A9UA 4GUDA 4OSPA 3P9KA 4H7JA 4LJ4A 1E2JA 3FPJA 3R44A 5B64A 4S0ZA 1BFDA 1NYQA 2A9VA 3MRSA 4AXBA 3O0TA 5IDQA 4E11A 3EXEB 3DL2A 4EUFA 4ITUA 4M2LA 4OHFA 1WQ1R 4M7RA 4DIOA 4KNVA 4R2XA 3AHEA 3L0BA 5BQFA 3G2NA 3KSBC 3VYVA 2RK6A 4B31A 2ILTA 2CLSA 1L5KA 5TPZD 2FZLA 1VBKA 5KJ1A 4I1PA 3ILVA 2H59A 1JBEA 1T29A 3MINA 1AGXA 2HWXA 4C9BA 3KYDB 2NLOA 1KJWA 4CQLA 3SLRA 4NOMA 1PJ8A 1QC5A 4EA7A 2JJ1A 3H2SA 3Q40A 4U2FA 2BJVA 4UBMA 4KQXA 3SYKA 1YVPA 3IDZA 2GZAA 1H42A 2WFLA 2AOXA 3AOGA 2B4KA 4GYJA 2A4MA 3KJNA 4PQGA 4P0QB 1XTUA 1TE2A 2VSNA 2AJBA 4NARA 5I3CA 5FPQA 3VC2A 5CLFA 3EXEA 2I9PA 5KYXB 4GNRA 3LLCA 4G8BA 1G0NA 2BDTA 5EFOA 3PBKA 4LISA 2GDZA 4Y2TA 3P8ZA 3R0QA 2CBGA 3X1XA 1OT5A 1XJ5A 4XVQA 4A2QA 2F43A 2FMTA 3G88A 2FZVA 3B48A 5ED0A 5TEWA 1PZGA 1TA0A 3PDIB 2OFXA 1XAIA 1PL7A 3IUBA 3HY6A 3PC4A 4KXNA 4B74A 3PHLA 4CM7A 2I80A 1GPMA 3HK2A 1Q7BA 3NWEA 4KXQA 1ZZGA 2OSVA 2D3WA 1J7JA 4UOZA 2JIDA 1SZPA 2C5EA 1WVMA 3W5HA 1RFLA 4FZ5A 4P4UA 2RKBA 1HRKA 3IUMA 4CQMD 3X1ZA 1UT5A 1SB9A 1OWOA 4P5EA 5KYXA 2V7WA 3NEPX 6PFKA 3LPNA 5J4YA 4LECA 4ZCPA 5TF0A 5HZGA 5SICE 4WLFA 4QYSA 4GDFA 4U1RA 1GOTA 4FB5A 4NYJQ 4BE4A 1GSIA 3AQ4A 3GFTA 3IDAA 4TLLB 2BGUA 3HU2A 3WLFA 1CUJA 1DAEA 2PKQP 4HT3B 3F7NA 3PDIA 5JW6A 1BU5A 1EHYA 3N2LA 4QPJC 5KSYA 1YFZA 5HSGA 2QTGA 2Z04A 3V7WA 4B6FA 3C24A 3SKYA 4OHKA 1RJ9B 1QGUB 2RGWA 2PTHA 1A8PA 4OFZA 1SOUA 3I9NA 4EPVA 2E4YA 1Z4IA 1CUCA 1X38A 5FEUA 3QMPA 4MDEA 1MOSA 2C0QA 2PAAA 3QJ5A 2IH5A 3ONNA 1CG6A 1COZA 3LUKA 4KGVA 3PXDA 1RI3A 3D5EA 1NRXA 1Y8ZA 2IHJA 1UZAA 2C04A 2W58A 5AVKA 1G6HA 1NJ1A 3IKJA 1QIDA 1M76A 2OG2A 3GZ4A 1C81A 1HLGA 1Y80A 4IO1A 1UAAA 4IGFA 1SD2A 1L8AA 2Q7DA 1PR5A 5TXGA 3CNNA 1EDOA 2YNMD 3ETLA 3FCSB 1PHPA 1Y9AA 1RJ9A 1QGUA 3KJFA 3P9CA 4H0CA 1TKBA 4PQYA 1XXHE 2ZJOA 2IYWA 1MAVA 2FZ4A 2QUBA 4NECA 2Q50A 3SBXA 3LNTA 3TLAA 2OSBA 2VL7A 3EXHB 1PNQA 3OT5A 2KM1A 4KRGA 2IZ1A 3GBVA 4B7CA 4Y3UA 5DNDA 5I7HA 2GH1A 4EUNA 2D1RA 1U2DA 3I9KA 3QU7A 4FILA 2D2IA 2PY6A 5KDDA 5FBVB 4FU0A 1W36D 4OHYA 1QTIA 1S3SA 2HRRA 3EW9A 5DWQA 2ZS8A 2QJOA 4QDJA 4NG5A 3UENA 1L5QA 1K6JA 4NZMA 4BB9A 4DUGD 2R79A 1V5WA 3QEAZ 4JGBA 4KO3S 2ZDHA 1GGJA 1YB1A 3LY8A 4TLMB 4BV3A 5KSZA 4DLNA 3L1JA 1ISFA 3QOXA 4GM4A 3WMFA 5CJJA 3LCVB 1GSAA 3P2IA 4H1HA 3STTA 2RHGB 1DGQA 1S3FA 1RPNA 2W2TA 1OGYA 2X9LA 3N3AC 3CF0A 3JZDA 4QUDA 4YI5A 5HMLA 5K0NA 1SPXA 3ZJYA 4HO1X 2C3PA 4MPJA 4P4TA 2E4ZA 3UHOA 2OC4A 3HCDA 1QF9A 1L7VC 3KR9A 4WLEA 1DBIA 4RHTA 1CFZA 1VL5A 2A94A 3MCVA 1HWYA 4KTVE 5ENZA 1C7QA 4MVXA 3NM6B 4O2AF 1YIDA 3WGJA 1KL7A 4C1BA 4DCJA 3KZOA 1NXPA 3KB6A 3LUAA 5EMHA 2B5WA 3IIIA 1G5HA 1VG9B 4ZI7F 5M04A 3HLTA 2E6UX 3O8DA 4QTZA 1DDGA 3PTLA 4JP1A 2BSXA 3ANSA 4H6WA 3SQMA 1S9DA 4X94A 2BM0A 3I0NA 4E4YA 4RJIA 5H81A 1QP4A 4K9NA 4FZJA 1NMSA 4IFTA 2ODAA 4OHZA 2R0QC 5D84A 1EK5A 5B4UA 3KAJA 1IWOA 5DLPA 5TJ9A 3U7JA 4E5YA 4EIWA 2O8DB 1BGWA 2JIQA 3TJMA 4EG4A 5JCPA 1JDJA 4K86A 1H8HD 2JI6A 4J0HA 4II3A 4M4SA 1ZSVA 1QR2A 2Q1SA 2G8NA 3AOEC 3QOWA 1CUHA 5FBWB 5LXTB 2H4XA 1XPOA 1TK9A 1ZVQA 3KV3O 3ZGNA 2HAEA 2I7VA 2I33A 3I62A 2P9GA 5DEIA 2GNOA 2VQ6A 2QD4A 2ZROA 3G2MA 2FF5A 4WHMA 5JJLA 1DUSA 3FNBA 1D07A 1WAMA 4BFWA 1BRTA 4O5AA 5HUQA 5I7RA 3GVHA 3H5WA 4LXGA 2PNFA 2JAWA 2RGEA 5DV9A 2XYQA 1QO9A 4L4SA 4REOA 5B1YA 3UT6A 3C7DB 3LPAA 2HIGA 4G26A 2GF9A 5U1PA 2R7MA 4M49A 5D7BA 4JYAB 1BQEA 4QL3A 4BO5A 3FPLA 2O8DA 4MCJA 2CNDA 1T4MA 1HM5A 1QIIA 1TM5E 3IESA 3BTSA 3C7TA 5AXAA 4DNPA 1AB6A 5LXTA 3DLCA 4X7PA 4D45A 2G1AA 4IUCS 4Y2XA 4ZU1X 2M6KA 3ESDA 4TMVA 4ETMA 3RFCA 4YAFA 1DAMA 4RTNA 1DLJA 3R6GA 5DHSA 1BGVA 5T7BA 2AZXA 3QFTA 3UH0A 2A0XA 4CZ2A 4B4VA 1LBHA 1JQBA 3OF3A 1JG3A 1LX6A 3GYGA 4URHA 4DIDA 5A6VA 8GPBA 1E2KA 5E95A 4KO1S 2VA8A 5AXDA 3CZRA 2GZ2A 2HF8A 1K63A 1LDBA 4AECA 3U44B 1PT6A 1HFWA 4IGEA 2OFOA 4B3MB 3H9BA 3QUBA 3OZFA 3CRQA 4O2RA 4XYLA 3DEZA 3D54D 1XU7A 4LQCA 1O6ZA 4OQQA 4S1TA 5PGMA 3T52A 4QUAA 1U3TA 2QX8A 3VO1A 2XSZA 1DHRA 4YO8A 4YUVA 3RVMA 4ZC8A 4ZHQB 1SELA 5AHOA 2VZ0A 1EDZA 1XL0A 1U8YA 3QE0A 1NF2A 4NV3A 4HX9A 4FSXA 4PLVA 3PB3A 2H5JA 4LIPD 5C34B 1IWPB 3AU9A 2P6OA 1CZKA 3TW8A 5KEIA 4IXTA 3NHBA 1XHEA 4FFLA 1YJ8A 1WF6A 1Y82A 2JVJA 1Q83A 3L0ZA 4YREA 2JAXA 3ANNA 1BYUA 2C3MA 5BSRA 2VYNA 2EBWA 1USWA 2P4QA 1KSJA 1OUMA 3GN1A 3GIWA 4JLBA 1CFJA 1TX4B 3HY4A 2GA9A 3BA6A 2FOXA 3FX2A 3RVLA 3U44A 2C7RA 5I51A 1KZ1A 2WFZA 1HY3A 3AP3A 1RCTE 2Q1WA 1TTPB 2QUJA 4C0AC 4GR9A 1TTTA 1E96A 1I3LA 3JQBA 4ZHQA 4WJZA 3ZJTA 3RJ9A 3KAPA 2VYCA 1QTRA 4RCZA 3GCGA 4ZJUA 1P81A 2IL1A 4LTDA 2IZOA 1EK0A 2O14A 3V1MA 1GPWB 2GK4A 4Q9DA 4WA8A 4H7DA 5AKJA 3NKFA 5L3ZA 3M3HA 1N3IA 4DABA 1GFSA 1SUSA 1R18A 2EJUA 1W1IA 2EW2A 4YCJA 3WGZA 3AX6A 5C1BA 4BP3A 5JT1A 2WOJA 4ND4A 1PR0A 1TMGE 1R9NA 1Z0KA 2DC1A 3TQCA 3ZVKA 4S1PA 2WY2D 2H1WA 3VKUA 5CURA 4DDKA 2AKEA 2PBZA 2RGNC 2YV2A 2AZDA 1GTG1 1BDBA 1F9AA 4TYPA 3AVXA 4KR3A 1UAYA 3CJQA 1RP7A 3UMRA 1XAJA 5EIAA 3KNZA 4HMOA 3KG2A 5DMHA 5D8DA 2EARA 2J4CA 1H0KA 4GFDA 4I5DA 1UFKA 5F2NA 2QVLA 2C57A 3GL9A 4GL2A 2R60A 4IIEA 4IINA 3I23A 1G4UR 1KDTA 3OIUA 3DMPA 4F4JA 2C9ZA 3NP9A 4MUMA 4P32A 2OCAA 3JD2A 5DNCA 5LYJB 1ZJ4A 3K9FC 4KLAA 2IZ5A 3NNNA 3HFRA 4CGZA 3CNOA 4QJ3A 4D9FA 4D4KA 1CDDA 1GAQA 3EEIA 4MA4A 5LFAA 2YXLA 4Z8XA 3TUIC 5HW0A 4Q1EA 1F9EA 2GCIA 4MWSA 2BMJA 1N3YA 3VR5A 4XR9A 3W4JA 2X9VA 5I7OA 4FDAA 3OECA 1B6GA 1XDDA 1CS0A 3AM5A 2A84A 4YRFA 3S99A 3C8HA 5BUQA 1MEEA 3G8BA 1PFGA 2FX5A 2BMAA 1WDLA 2NXEA 4J6EA 1Z17A 4O33A 4RD3A 1K1EA 2QX9A 4XVUA 1ZH0A 4AZVA 1LC0A 1SB8A 1U7HA 1ZWLA 2O23A 5ELLA 1FDTA 2WAXA 3B3JA 4YNBA 1GJRA 1F60A 5TQVA 3GIDA 5C35A 2GHRA 2DR2A 1XZKA 4DKJA 2QOEA 2HEGA 3K6KA 2BHSA 1YS4A 2QRPA 2ZR8A 3EDCA 4IOKA 3O8CA 3E27A 1JMVA 3R3XA 4O2BF 1SU7A 3KTOA 4R5MA 1HE5A 3P9YA 3GPDG 3PKZA 4ZYXA 2C5LA 3FMVA 5JNTA 1PK9A 1QHGA 2V97A 3AIKA 1U9JA 1ZN2A 1HF3A 1TM7E 5AUOB 3CINA 1WV1A 3E70C 2JCYA 4S1WA 3PNBA 2O2DA 4QPPA 2J0VA 2R62A 4ON9A 3TECE 3D3KA 3ZDFA 4TLDA 2QLMA 4KCGA 5DWDA 4GC5A 4Q1DA 2QHXA 5KYUB 2ACWA 1QP0A 4I50B 3H1AA 3LDFA 5JE8A 1GTZA 3I64A 1CJSA 4OMFG 3SF0A 1BKDR 1LBIA 3M6LA 2IY8A 2Y6UA 3JRXA 5B55A 4IUYA 2A5LA 1FDWA 3DWGA 4MKIA 3BXEA 4QKQA 4DLKA 2VSXA 4X7BA 2P9HA 4N41A 3C16C 3KM0A 3U61B 3TEMA 5KO2A 2YZGA 2OK8A 2VDVE 5JNSA 5A4DA 4AVYA 2NO1A 3FCOA 1T8PA 1MG5A 3NNDA 4MUHA 5HMMA 4TKMA 1F48A 1ZMOA 4Z2YA 2JNWA 4YQZA 1EGAA 4PLHA 2I2AA 3A4NA 2FFJA 5AI6A 3CLHA 4EBBA 2C9MA 1H8EA 2ZJAA 4I50A 3HCWA 4YXFA 4OHCA 3IR5A 5DB4A 3CNQS 3VSAA 2A9FA 4J0JA 4JX9A 4EHJA 2AQ8A 4B6EA 3EMVA 4QSMA 3WWYA 1EE9A 2ZAMA 4DRXA 3JX9A 1T91A 4QTXA 4KRFA 5TGDA 1MR3F 3QW4B 2V45A 1Y1QA 1AQUA 3K2EA 3VSEA 3ZE8A 1Z38A 3L6EA 3W2TA 5JV5A 5LMZA 3AVVA 2ZB2A 1RXIA 1RHJA 1Z2AA 5KS2A 3QE9Y 4K28A 2VOEA 3AMVA 2NYVA 4QGSA 1AS3A 1VOTA 2P2NA 1PSDA 3JVUA 4EM6A 3ZJ5A 1RIFA 1LI4A 2Q5QA 1F4PA 1WXIA 4E0BA 3AR5A 4URFA 3BIFA 1SUBA 1O6GA 5DOZA 2WAAA 3OZBA 1J1IA 1NSYA 5EUBA 3VH2A 3DDWA 2QK4A 2ZE5A 3MMSA 1T6XA 4LF4B 4PLGA 2FK7A 3ESQA 4GBMA 1G16A 5E1BA 2FPXA 1EJ6A 1M1NB 1MHTA 3CZ9A 2AT1A 4CKBA 1RZVA 1SOVA 3CZCA 3P19A 2I7DA 3NHZA 3L7IA 4IX9A 5B58T 4IIUA 4GECA 1C41A 1EZZA 1RU3A 4G0XA 2GESA 4AURA 4U7WA 5GONB 3USES 4N3NA 2JJ1D 2BMEA 4ILEA 3U4IA 4JNKA 4KR0A 2PZKA 4L75A 3AR6A 2BW0A 3S7TA 2EF1A 2NACA 4OLFA 3VTZA 2MSDB 2J6CA 4K0RA 4P81A 1AMOA 2XDWA 2GK6A 1IHUA 1C0KA 3HB7A 1NIPA 2GZMA 1JIUA 1VCHA 4HZIA 4PTYA 2IP2A 4EUSA 3A1CA 2MYNA 1ZK0A 3HMQA 4NJMB 2PGOA 4CIVA 5GJCA 1EGMB 1JJVA 1OREA 4MP8A 1M1NA 1OA0A 4N01A 2QLFA 3A6FA 4BFXA 4BB0A 1NQUA 3GJ3A 1NY5A 1YKGA 2HM7A 5FUMA 5EXTA 4YJ3B 3MAJA 4RMJA 4CFSA 5GONA 4FMCB 1ZBDA 3C3DA 5DTMA 4HEA6 4YONB 2XWSA 4BO0A 3H75A 1ESZA 1NMEA 4U4AA 4B6JA 2WWWA 4FUQA 4KQ1A 5AK4A 1SCAA 1QPBA 1T43A 1NLFA 3ITNA 3UMGA 2RAPA 2R48A 5TGTA 4AG3A 2E4UA 2ZUSA 1U0NA 2XMCA 3MWFA 4IV0A 3KUDA 1X9IA 1QYXA 4NJMA 1G8PA 4ZZ1A 3UUFA 3N5KA 9GPBA 3LQKA 5LZ9A 1HTTA 3C43A 2W2MA 3MJEA 4UM7A 2C9CA 3N39C 2Z98A 3Q7SA 5C5CA 2X2PA 3PV0A 5TF4A 1Y81A 3W2EA 1JKMA 4M6WB 3HXLA 4MV6A 4NU8X 5K05A 1Z2OX 2FLWA 3GF4A 5G0TA 4YJ3A 4DCSA 7MHTA 2FWNA 4YP9A 1AXRA 2FP4B 5DLQC 3B89A 2FJUA 1KJYA 3SYLA 2E5WA 1AB5A 2CYBA 2AOWA 3OP4A 4RXUA 4UBIA 2BBWA 2LVBA 1MPTA 2YWGA 5CLGA 5AM4A 1NW7A 2RGBA 1H2FA 2YIJA 2ZI3A 1U9CA 3DZ8A 5CPFA 4DG8A 2AMVA 1DQYA 3KJEA 4BECA 5IM4A 1VKNA 3LX8A 4C4XA 1PWEA 1YCHA 1WSAA 2HSWA 4JI4B 2ZSFA 3IUSA 4LC9A 2J6BA 1QDEA 1XYVA 2V55B 1XNHA 1JLMA 1TVKB 2HXGA 5FI1B 2IXEA 3AEYA 2DR0A 4M6WA 4Z2AA 5C18A 5AW2A 1B6TA 1J39A 4C4OA 2VT7A 2ODWA 2ZT7A 3OE7A 4QT0A 2A0FA 2A7XA 3WLPA 2FP4A 3KUKA 4ZQCB 3MT7A 2MCFA 4AWBA 4DADA 2CFRA 1M6HA 2L0XA 4F72A 5B1DA 4CR8A 3K2QA 5LMCA 2ASVA 3LUPA 4LMRA 5IBRA 2AN1A 2Q0SA 5LQCA 3RU7A 2G7MC 4UQPA 2FZWA 2HSDA 2C2MA 2WHPB 3C8DA 4KODA 3Q5GA 4C2UA 2FGJA 4IXNA 4PYKA 3U7FB 5JSFA 5AK0A 3BAFA 1V6CA 1E6EA 1T1RA 2I0FA 1FSSA 1GT6A 4IP0A 1S8OA 2D54A 2FN8A 2H54A 1AKUA 1NW8A 1IZ9A 1XYGA 2X42A 2ZJ1A 2ZRIA 3MELA 2NZWA 1S02A 1BD4A 1X1QA 1LQTA 5EJIA 2HTFA 3GW8A 1K8ZB 3EWNA 4HN4B 3UT5B 3IIKA 1C5KA 2JAHA 4XASA 3MQ2A 1F1JA 3C6KA 4IFIA 3ICVA 4ZVVA 5E2BA 4MV0A 4MZDA 1NRJB 4HC4A 3O1HB 3DHWC 3RNLA 4C0XA 1FUUA 3RS8A 3SEZA 5CLIA 4Y0NA 5E9WA 2J5QA 3B6KA 4GZ3A 1PDVA 2WHPA 4LE2A 2O3TA 2O5VA 2PRZA 4YA6A 5EWLA 3EFBA 4FD3A 5I9BA 4U39A 2B8NA 1ENPA 1MABA 5CTJA 2DLDA 2FOIA 3G2IA 5H68A 3UAZA 3X1WA 4C07A 4YASA 5T5QA 1UBFA 2AWNA 2R2GA 4K0KB 1D6SA 4LDQA 2OHHA 4YBZA 2YS7A 2JAOA 2JLXA 1E1DA 1ZLXA 4JR2A 1G8AA 1FNDA 4JC4A 2OHGA 3UT5A 5CFLA 3OPMA 4ZIRB 1E5VA 3KJQA 4E5VA 1A2BA 2YFYA 1AV6A 1OI4A 4PG5A 3QYFA 1P0FA 1PSWA 3DFUA 4KRXA 1IEWA 2OO5C 2BHTA 1MLDA 3B1ZA 1H5UA 2J9XB 5AM1A 2VPXA 2JFHA 2XTMA 4M9QA 5AVTA 1T9DA 1Z2EA 5J58A 2XRZA 4E5PA 2FLKA 2FWIA 4L50A 3W78A 1Y1TA 1EM6A 1NBHA 2XRMA 3FMPB 3P2OA 1QIJA 5KJFA 2AYZA 1X0XA 1SU4A 4PGMA 1RYZA 4CJXA 1DC8A 4EA8A 3AJ9A 5IN5A 2IBTA 4LV5B 4CLEA 3P2KA 1G0OA 3OZUA 4I55B 3NRBA 3NTUA 3PI7A 5F33A 2ZRDA 5HDBB 4DMRA 2ZDGA 3A2MA 3F9CA 3DWIA 1T2FA 5C1PA 2RH4A 1DKNA 1USIA 5ELMA 1ZITA 4ZIRA 1E2DA 2NZVG 4PQEA 4W6ZA 3TXYA 1SQ6A 2BRUA 1R3DA 4U7GA 2X1LA 5AHKA 1X19A 2CNOA 3CB4A 5EJ2A 1PNTA 2JFYA 2RGRA 1NN5A 3DOHA 2EP5A 3PQ8A 3OQMA 1C1DB 2ON6A 1M1YB 1FA9A 1NKVA 2ZRGA 1FP4B 1O57A 4W5QA 1RE0A 3L92A 2CUNA 2QP3A 2BUBA 2ZB3A 3WB1A 4GI7A 4ETWA 5LKRA 1NPYA 3ZWWA 5B3KA 4TN1A 1YVUA 3CT6A 1R6TA 1KYTA 2AMLA 4IICA 2DETA 2R8YA 4I55A 2GZHA 1FW8A 4FOTA 3O47A 4EF6A 4FB4A 5BUCA 3SEFA 3B20A 4BLUA 4BRZA 3AK4A 4MP6A 5JANA 2EKZA 2X1VA 3IBFA 2HSJA 5IXSA 1PZHA 1XV5A 1ZR2A 5BN5B 3F5DA 2XJ4A 3LVRE 4G4GA 4OAPA 5E9JA 1B8OA 1M7BA 2WP8J 2YHAA 4UZFA 3ETNA 5K0CA 3WAGA 3F3YA 3SK0A 1BDMA 1MOQA 5H02A 1RQRA 1C1DA 3B2EA 2XSZD 2CLIB 1M1YA 1ORDA 1TD9A 4JZKA 3T3PB 1Q16A 2Q29A 1FP4A 1RMYA 4HKTA 1CY8A 4BQEA 3E18A 1YB2A 1YD7A 3BWMA 1GUFA 5AHWA 5ITVA 1KMIY 3O38A 4MAFA 2IP4A 4NDAA 3T1QA 4D9BA 1GPJA 3ZV4A 4ASUA 5LPNA 2VBFA 3CJTA 2X6TA 3C5CA 4R8LA 5T8KA 4F5EA 4J1QA 3V34A 3ZK7A 3PEUA 3IPRA 1MO2A 1OH7A 3TNLA 1IYZA 3R1IA 4PHGA 1D5WA 5E3JA 4FFPA 3K70B 3NAGA 3JQEA 2VYND 3E4DA 1H2XA 1TC1A 3R6LA 3H4TA 3FPBA 3U9TA 3SFZA 5BN5A 2FQWA 3BD8A 2DQ4A 2C03A 4JHLA 2P9YA 5DTQA 5CD9A 3ZDAA 1YOVA 3UB4A 3I72A 4R9NA 1XTBA 4J9VA 4CMBA 3EN0A 4B3DA 1PQWA 1ZSYA 3JW8A 2NSYA 1KXZA 2XMSA 3ZLUA 4A0GA 2Z6VA 5CNKA 4DRXB 1Q95A 2HX1A 4ENPA 4NE9A 4D0NA 3R9WA 3COWA 1ECCA 1F0NA 4IXMA 1G8FA 1NQ5A 2VH2A 1DBWA 3H18A 3PFFA 3S5UA 3D6TB 3ND7A 3LCUA 2JFNA 1C3EA 3CNEA 5B58C 2WSBA 2V65A 1JECA 4ZGGA 3TEFA 2W6NA 1EDBA 4LSGA 3CGWA 1N2OA 3K5WA 5I47A 1E8DA 3BQNB 2C4WA 4LOLA 1B7GO 1GSOA 1PJQA 4AJ4A 2A3RA 1R64A 1U0BB 2D5LA 3PYLA 1IC6A 1E6UA 4XD7A 4I4TB 3FYCA 4FC7A 4HDMB 3VZBA 3W1VA 1IQRA 4BE9A 2BMDA 2BD0A 1GN9A 2FSPA 2HU5A 1VZ3A 2EDAA 4JLOA 1HDEA 4ZANA 5JSKA 2F8SA 1ZCJA 4ZVKA 4BTEA 5F1PA 3F1LA 2YJGA 3TTWA 2XB9A 4UASA 5JCOC 4HN2A 5DBIA 4CUZA 3NWJA 1SBIA 1VC2A 4GH5A 3SXJA 1NVKA 1Z74A 2H7CA 2P9EA 2HBQA 5FQNA 5IFLA 1PF7E 4Q93A 4AKIA 5M2QA 5IAAA 4FR2A 4AS2A 4YR7A 4TV9B 3CG4A 4DMUB 3ZY3A 3GVPA 1E9BA 4HWPA 1PLKA 1ST3A 2CJFA 3CLTD 4LC1A 2GA8A 4PSDA 1T1IA 2QU7A 2J5RA 1DT5A 4ITRC 3DV0B 4B4WA 4DG5A 3RHTA 1TIKA 3OZTA 4JVLA 3VR5D 3CWQA 2AQHA 4I4TA 2BDEA 4RZHA 5C1OA 2ERYA 4HDMA 1PGOA 1PKXA 5TEVA 4A8HA 4XARA 4E13A 4MGZR 3BXGA 2XMRA 4ZOEA 5A1TA 1J24A 2IF0A 1YC2A 3M6VA 3OZXA 4P4NA 4EENA 2VHWA 2Z43A 4IAOA 3GI1A 2HMYB 2YWDA 1O4VA 4Y1RB 3RS4A 4N4AA 3W5UA 4Q05A 4TV9A 1FTNA 3IJ5A 1BDHA 1XCOA 4H1WA 2R65A 4OJQA 2PGDA 1N2ZA 1QLHA 3ZC3A 4EX7A 3BZWA 1IIRA 3K53A 5FBZA 3DV0A 1RD4A 4I99A 3TXAA 2O8BB 2Q28A 3OEYA 3RBAA 1IQPA 1JILA 4E4RA 1UP6A 3MCZA 1AHPA 4UHHA 4LMAA 2H4YA 1P29A 2DRIA 1ZN7A 2DHDA 1WU7A 2G04A 1F2TA 3B9QA 2OKCA 3O84A 4JBIA 3BDVA 1J9EA 3TZ6A 3KV1A 3UMJA 4ND2A 4HLQB 4LFCB 4P3KA 1P3JA 2WHRA 3HS3A 1J5XA 1Y98A 1XTRA 1GNTA 2C2YA 1ZL2A 3H0EA 3KHSA 4Y1RA 4EG3A 4JYZA 4DR3B 4FGSA 1ZW6A 3CE6A 2QYHA 3NWPA 5DNEA 3UAYA 4MR8B 1KFEB 2VBGA 3N28A 2I8LA 2R4QA 4RPKA 4BP9A 1QWOA 3MS2A 5IBPA 2Y6VA 1WCXA 3A4VA 5EEHA 1ZD5A 3A9WA 1H5NA 3EULA 2O8BA 4UJ5A 2D5AA 4FYVA 4ZOLA 3MHTA 4B33A 1IDN1 1IPFA 1G21B 1L6IA 4GQAA 4OQYA 3REOA 3VHXA 2V54A 2AX3A 3UUGA 1SHUX 1II0A 3U17A 3G9ZA 4QU8A 2Z9CA 2EIXA 2FX2A 3NYWA 1PQ4A 1MB4A 4C78A 2PSHA 3HV0A 1CZLA 1HMYA 4LDRA 1HO3A 3P0IA 3DPUA 2G5PA 4R1MA 2D1SA 3DZKA 5HBGA 1QOZA 2CHQA 4PN3A 1N2CB 7YASA 3OHMA 1H8ED 1JLSA 1I3KA 1OFIA 1EINA 2XQFA 4MR8A 5FUQA 5JI2E 1NVFA 2F7SA 1QG6A 4KVFA 2UVDA 4EATA 2OHVA 4KQGA 3E1GA 3TNJA 5COAA 4LZJA 5IJ9B 4KN9S 4ALNA 1HSZA 2J9GA 3TLXA 1HE8B 2KMLA 1R0SA 1W1WA 2C5GA 3DAFA 4TX1A 2JH3A 1G21A 1VHQA 4TRJA 5AOCA 4WN9B 2CFIA 3ZZNA 4WWHA 1VCIA 2ZSKA 2O3SA 1NAIA 2BMWA 3LDHA 3AHIA 2QTCA 3VNBA 3X2FA 4N82A 3NRCA 1G3QA 4YMVA 2FDCA 3WLTA 1JE0A 5GJBA 2BLLA 2ID4A 2VF5X 1WULS 2Q41A 4BY9E 2DGDA 4M8SA 1N2CA 2CL5A 3KPYA 4QUKA 3W4KA 3N6VA 4HAZA 3OWOA 1KAHA 3FA2A 4N3CA 4BWYA 1P2GA 2P6PA 3GVXA 1RT9A 2R84A 5EIBC 1B16A 4NNOA 5IJ9A 1O58A 4XCQA 1FFSA 3C5EA 4NMWA 3T9BA 3T94A 4X9XA 4EJSC 1T36B 1TDJA 3H8SA 3FUUA 4DB2A 2BKXA 4DLRA 2IYNA 1KVTA 3T7IA 3GROA 4DCUA 2CLDX 3BHMA 2CUKA 3W6UA 4QPZA 1IBRA 1ZIOA 3UW1A 2G36A 5LUBA 3TD6A 3H1BA 2SBTA 1YJQA 2AG5A 1RHRA 3BULA 3PGXA 4WN9A 3SE0A 1CULC 2X6QA 2PKXA 3TK1A 3DOEA 4QHSA 4TMXA 3I6ZA 1O5OA 3W0LB 4H27A 1VKZA 3FOFC 1E2QA 1Y8AA 2UXBB 2CKDA 3G5UA 3FAZA 5BWLA 2B1QA 2JHGA 3NDIA 4LXHA 4YAKA 5EXXA 2CDBA 3LO5A 4H3HB 1SIOA 5I5GA 1NNLA 3B8EA 1C29B 2WWFA 4R4JA 1LV7A 2IUFA 2Y99A 4O5OA 3K16A 2I99A 5EZ6B 2XLBA 3PLNA 3BMNA 4YT5A 1T36A 3W6ZA 2GPNA 4Y98A 1GGFA 4A9AA 1EWKA 1K9VF 5IW8A 3C48A 3B5JA 4KMSA 1ZGAA 1TLLA 2PGNA 3N0XA 4M8NE 5C7YA 3HU3A 3NJRA 3GEPA 5JMOA 1RXUA 1GGKA 3CH4B 3IT1A 4Z4EA 4EARA 3L0OA 3FNHA 4P54A 3KLNA 4DHEA 4RM2A 4D0GA 1SHZA 3GFQA 4WK2B 3ZTWA 3STYA 1WVGA 5M29A 3JQ9C 1XZDA 4LF6B 3JWJA 3AB8A 4DV7B 3RWMB 1X92A 4DSUA 2D59A 1FFHA 3U6BA 2AW5A 1UK8A 3R77A 2Z83A 1EEXB 4M9ZA 3RS2A 4L5CA 1UZUA 4DM3A 4LZZA 2EX4A 3R5HA 4R7GA 2VTDA 3O93A 3QJGA 2J46A 1XKLA 3D3QA 5HTKA 4ZEVA 4UE3S 3NDBB 5ALKA 1L5NA 5BNIA 3BJEA 1N92A 3I9OA 4MGEA 3GG9A 4BRSA 4B7ZA 2OCPA 2ZTUA 1XTQA 1JRLA 5JDIA 3U7RA 4UD6A 5EYPA 2GNPA 2AFVA 4MI1A 4NBLA 2H85A 1I32A 1P5HA 2NTJA 3CJRA 7GPBA 2OPHA 2IYTA 3LY9A 2IPXA 4C7VA 3WFIA 3A7DA 1BGXT 3PFBA 2WJ6A 4C05A 3G9UA 1FFBA 4C87A 3PEEA 3OY2A 4QASA 1JVBA 4OXIA 2DH5A 3CVXA 2IODA 1OPXA 3QWFA 4MQBA 2WEKA 1EM8B 2BEJA 2AMYA 4B4KA 1FFYA 4MW1A 1POXA 3NYRA 3NHKA 3IULA 5DO9A 1SHTX 4IJVA 1UBMS 3SHWA 1HEUA 4UAJA 2OCBA 4ZCIA 3A9SA 4Z0PA 2V98A 4IJQA 4H7KA 2ZIAA 5FBHA 3S3TA 3DXYA 3PQDA 4JKIA 2WR8A 1UBOS 1M1YE 4XQ9A 3OE7D 2K6GA 1J0BA 1JFLA 3JQCA 4LTNA 4XIYA 5CIWA 1QWSA 3G7SA 4KUHA 4PG7A 1GQFA 1KEVA 4JT8A 4LJ8A 1WBDA 3Q7EA 5BXQC 1UJ4A 1PL0A 3FPHA 3I2JA 4DC9A 5LP6C 4WPGA 3D0OA 4XYGA 1UPUA 2W83A 2Y9MB 3QA3E 4KN5A 3TDNA 1RQPA 1EM8A 1PHRA 4NYIR 1UFRA 2HSZA 4RX1A 1LBTA 1QONA 2Y1LA 2YWHA 3HBJA 3KUCA 2G76A 5TPWA 1ZPDA 1SIUA 3HUEA 3DZJA 1TQ2A 5JDCC 2DFPA 4J0IA 5G4LA 4YMGA 2XWQA 1R6UA 4LBZA 2Q4OA 4RF2A 2W4QA 4ND7A 3V80A 1TEHA 2REBA 2HCRA 1CQJB 3LBHA 3ZNOA 3LOQA 3A9RA 1XEAA 3TXXA 1SCKA 3T99A 2FEXA 4URZR 1I13A 2BKAA 2HJGA 3IHWA 1N4DA 2BFEB 2OXRA 3MT0A 1D03A 3ISVA 3NBQA 4CTJA 5IAOA 4OI0A 4ZYLA 2QQ5A 3VX3A 2Q4DA 3HI6A 2IEZA 5AK6A 4B3FX 4KDEA 1G7CA 2QQFA 3A6LA 1GQQA 4G81A 1VG0B 3OAAA 2UDPA 2IX9A 5AHXA 4BYGA 4M1TA 4J2OA 4ES6A 1G1MA 2G1PA 3QE2A 3CVOA 3TOXA 3TW0A 3QHPA 1L4EA 3A11A 3DDHA 2DFKB 2NUTA 5CVVA 5JAQA 2R7KA 2XWPA 1FDIA 4MJ7A 4WKGA 2YWFA 2QMQA 1PL8A 2P9CA 2PLNA 1W1UA 1KTVA 1D0IA 3LUGA 1CQJA 5IM5A 1YZGA 4HWGA 4KYIB 4DLYA 2I54A 1TNDA 4UHBA 2X1MA 1SOAA 2JIRA 3VTAA 1UDRA 3CY6A 1XMPA 4JQYA 2BFEA 1C50A 1WBJB 4M0DA 2AHOA 3PVZA 1NUQA 4IOJA 3TE6A 5LIPA 3AUFA 4FN4A 1IXZA 1EZ1A 4OMCA 3LC2O 4XEUA 5CA1F 1KY2A 3RT7A 3KT8A 4QNNA 3ACBA 3VDMA 5FAKA 3H17A 3L3BA 1QYWA 1YGYA 2EQBA 3OMWA 2GZ3A 3RFUA 1ZY2A 4JOCA 3E2IA 4OU4A 4C22A 3NT5A 1J25A 1P4RA 2O52A 3O3MB 1UANA 2WV7A 3BHJA 3QVTA 1DIAA 1U2TA 1WV0A 2CLFB 1ZEMA 2GN9A 3WS7A 4AU1A 2FFAA 2BKEA 3FBTA 5T3UA 1XRRA 2VPZA 1C30B 2VA9A 2Y05A 4OHBA 3BA1A 1CEQA 4RGVA 4WXMA 5BOSB 4QNMA 2BSQA 1YK1A 2QTAA 3NFYA 1Z4JA 2QQGA 4FE4A 3LC1O 2MSEB 4IHJF 2CUTA 4YX9A 5K3CA 1Y7IA 4ERXA 1OC2A 1RXCA 5EWLB 4JLJA 3OEEA 4Y6LA 1JJBA 1UAGA 3KCNA 3NHYA 1UKBA 4TKUB 4IDCA 3QFRA 2CCKA 4R54A 4YRPA 3SYMA 3ZWOA 2IEBA 3JQ8B 1F5SA 3HSKA 4NK4A 2CLOB 1NSFA 1DO0A 1Q7CA 1OBOA 1VBFA 2ONYA 3C3EA 4H77A 2GPWA 4IFBA 3SSMA 3QVOA 2EJVA 1IPHA 3K4HA 3GGJA 4JJEA 1Q0LA 5IF3A 2FKAA 3WLSA 2JLVA 4HEA1 2H48A 2OHOA 1C30A 1TZBA 3TD9A 1R5JA 2AUNA 2ZBFA 3IH5A 4E2WA 3LQRA 3RU2A 3EC1A 1RWWA 1BKYA 1VLQA 3FHJA 2WM8A 4OVKA 4Q18A 3WQBA 4I08A 2O6LA 3AW9A 1TVMA 3O4GA 1AGRA 1GV0A 2KLBA 1QIMA 2FPIB 2DPLA 3E7PA 1RBYA 2O2XA 3EHEA 1EBUA 3AFMA 3P97A 4PCUA 4X95A 4YECA 3B1WA 4YTEA 1QOPB 3K71B 3BCUA 4TKUA 1HYGA 2WIBA 5FLXA 2PUVA 4PIPA 2CLLB 4G4JA 1T2DA 1E1NA 5HK9A 3UOWA 5B57C 3HC7A 1OX5A 1DU4A 5BRNA 4YCSA 2Z08A 4WX2B 3HO1A 1FTQA 1PYOA 1XD9A 4E2ZA 3NT2A 1OLXB 3Q6NA 3TZHA 2BM9A 1W0CA 1U8CB 2DUMA 2IYXA 4C0WA 2HBYA 2LRHA 3AEUB 4GOXA 4CT5A 4ASUD 4L4XA 1ETHA 1O96A 4MWCA 1TD1A 2PZLA 3MTJA 4KR6A 2HCBA 3HB5X 4D7AA 4NE7A 1LS1A 5FTNA 3G7UA 1K2WA 1DAKA 4ZOBA 1VL8A 3SS7X 1E1CB 2FPIA 3SBOA 5ITWA 3INGA 5KNLA 1FRVA 2JLUA 4FFVA 3UOGA 2VO1A 4OGFA 2G0AA 1ZD3A 1P6QA 4Q9JA 2NSLA 3KVOA 2PGJA 3AVTA 5E3IA 1RPJA 4K9PA 3EZ7A 2DTEA 2V0CA 1B2LA 1OVGA 1VIYA 3I12A 4BLTA 4Q9IA 2QMEA 1IY8A 1PWYE 4YO7A 3VR5H 1XZPA 2GM3A 2G9NA 5E9QA 2PVPA 5KU7A 1I1HA 2XUOA 3EPRA 4J76A 1XQWA 1HE1C 3LRTA 1LSUA 4GZLA 5AFSA 3LTEA 4OP1A 3AEUA 1Z16A 1SKAA 1EFRA 2IKQA 2IYAA 1V3QE 1XBTA 4MV7A 5FFFA 4HFNA 3AF5A 1CP2A 1G21E 2D4AA 2OXFA 3IV9A 5CCDA 4R8RA 2IPOA 2IHUA 2HY7A 3QW2A 3WDKA 3K70D 2WA1A 3TZKA 3HZZA 1TUEA 2EZTA 5DXFA 2HLPA 4JBXA 4O4JF 2C1XA 2KBFA 3COPA 3KKQA 1WY7A 4YRIA 2FSVC 5LZ7A 2I7CA 1THMA 4D99A 3SC2B 2R6AA 1SVIA 3TZQA 2WT9A 5C1DA 2DT5A 1N2CE 2V6GA 4XD7D 5HE9A 1P72A 1PR1A 2R4UA 2VYFA 3ZWDA 1E6LA 3NHPA 4Z0NA 4WFJA 4BAZA 3SJZA 2I1WA 2O3UA 2PJDA 2GBLA 4NQZA 3HCPA 1I2DA 4BL5A 3SDSA 3IT2A 4TYQA 1U3VA 3GRCA 4JCOA 1FUIA 1CEXA 4JUFA 3CX7A 4BKQA 4LJKA 4OHRA 1CIPA 1MQ9A 3HYSA 2JLRA 1T0JB 1XUOA 3A7EA 3M5PA 3AUTA 1G6Q1 3LT5A 1U1IA 4KFRA 1EFHA 3ZCQA 3M6XA 2WIGA 1JT2A 3RU9A 3FH0A 4CTOA 2VDUE 3GK3A 3AF0A 3RNOA 5IABA 2PEZA 1V9CA 4PINA 1V8FA 3P9ZA 5MN4A 1JAIA 2G08A 4O2BB 3SC2A 3WKCA 5HZKA 2QI9F 3LHFA 4PTZA 1DRUA 3Q9SA 4ISBA 2RG1A 3FDZB 4K05A 5EP1A 4RM3A 5SZKB 1WJGA 5HCUA 3EQ6A 1E3IA 1L8OA 4Q12A 3WXBA 4RIIA 4FBMA 3X44A 1NVEA 4D3FA 1KQGA 2DBQA 3FNFA 1RZRA 2G70A 1BE0A 1MC4A 1ZNXA 2HQ1A 2QGZA 2UUOA 1NW3A 2WFAA 1WZIA 3KQOA 4GGOA 4P53A 2IPNA 4IJWA 3TYXA 3C1UA 1OLOA 4NHEA 4OFBA 2RJ3A 2FSUA 1QH8B 2I2CA 1Q0SA 2NIPA 1SUPA 2OB2A 4NLLA 4PW0A 3IQFA 4FMDF 4OA8A 5CH5A 1U0GA 2I65A 1JA0A 2ZB4A 3KTDA 5DASA 4NIMA 3AL3A 4PLTA 3EA5A 4HH3C 1ODTC 3FVRA 4MUAA 1TZCA 4O2BA 1L5YA 1SVNA 3D4BA 3KSDO 3MMNA 1O8BA 5D5HA 2O48X 4A26A 2ENWA 3B3GA 5DM2A 3ROQA 3CZQA 5JD5A 3I42A 1HZZC 3FDZA 5A4MS 3KOYA 5CYPA 3MGCA 3O3NB 2LZ0A 3R41A 4B6OA 5EESA 5LUAA 1O3YA 1U28C 1HE3A 4NH4A 1OC4A 5ERGB 3KRTA 3IKTA 1FX1A 3STWA 2GBIA 1JA1A 2IYZA 3PVSA 2XUHA 3L05A 2QLNA 4G0PA 3FPGA 1QH8A 1X1CA 1Z45A 4V0MA 3U5TA 1TJYA 3KOXA 1L5RA 4MVJF 1B6RA 3F6YA 1AQNA 1PR4A 1T1EA 5G0UA 4NX2A 4HGQA 1QANA 3UHJA 2FN3A 3G79A 4WZ6A 3L9WA 1GEEA 5DI9A 3CZAA 2PS0A 4JKOA 4KDCA 4LWOA 4OBBA 5FB3A 1K7YA 1XMXA 1W19A 2DH6A 3CUSA 5LQMA 1N9GB 2TSYB 4KYVA 5JZBA 4KXLA 5ELXA 1A9QA 3AJEA 5G40A 3VSCA 1E62A 2VP4A 3Q8WA 3VYWA 3K6SA 1LPPA 2HWYA 1E1KA 1VIAA 1R8YA 1W29A 2IXFA 4RY0A 5E7MA 4P35A 4DJDC 5JH7B 2P69A 3SYRA 1OYVA 4NPAA 1I2MA 4CUJA 2MDTA 2IHTA 4BN5A 4BMVA 4YV1A 2YVUA 1F3OA 3HGTA 2ORIA 3RRNA 2PUBA 4CFYA 3OJXA 1GPDG 1LVGA 4QUHA 1WP9A 3OKAA 3RSZA 1N1EA 3KQSA 2CKMA 3TL3A 3L84A 4KV7A 1S1CA 1U9IC 4OXKA 4CL3A 1UJ2A 4JOBA 5DCUA 4RV9A 3G7NA 1W4AA 5HF9A 1FNSA 1NJ2A 3MC1A 3FFWA 1UH5A 1N9GA 4M9XA 1DJLA 5DLDA 3U56A 3UWDA 1GGHA 2J07A 1VMKA 1NWCA 2D5BA 3OBBA 4QPCA 3VJMA 4BVJA 5M34A 4RHYA 4IIBA 2GXSA 4EBFA 4QXQA 1H4VB 5AUPB 5K0ZA 1AIPA 3ZLTA 2CNNA 3QKUA 4PN7A 5JH7A 5K6RA 3UICA 2ZOSA 2EWVA 2XYVA 1WZ2A 2DERA 1ONOA 4HUQB 4A4DA 1CUZA 1J8FA 4RLSA 4ZVQA 1FP2A 1JYSA 1QTQA 3T95A 4ESEA 3CW2A 1J97A 9ABPA 1FVHA 3PHHA 5I8PA 3AM4A 1J2YA 4N0MA 3VGPA 2BVNA 1BHQ1 3NBZC 2P9BA 2OTCA 1QIEA 1ZN8A 1O08A 4PF1A 3RADC 3M4JA 2HPVA 4U63A 2A88A 2DR3A 3HJCA 3HVHA 3N2IA 2D13A 1T9CA 4ZJYA 4AY2A 3V8QA 2FWAA 4ZD6A 3MTAA 1H4TA 3GQBB 1VL1A 5LYYA 4C7JA 4QPNA 3LXRA 4BZWA 821PA 5J3JA 3T1TA 2QN8A