3HJUA

Crystal structure of human monoglyceride lipase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
291
structure length
291
Chain Sequence
PRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Monoglyceride lipase
publication title Crystal Structure of the Human Monoacylglycerol Lipase, a Key Actor in Endocannabinoid Signaling
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 3.1.1.23: Acylglycerol lipase.
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hjuA00
5ALWA 3ZLVA 3STXA 5AM1A 2HA7A 4Y2QA 5IVIA 1F6WA 2I3DA 5AICA 2CMFA 2B4KA 3CCBA 1P0PA 3EIOA 4X85A 4BTVA 1E89A 1FJ2A 2WTMA 5YASA 1H2ZA 2XUJA 5ALKA 4G5XA 1JMYA 3WK4A 4M0FA 1Z68A 1NU8A 5K3CA 1GPKA 1UKBA 4X92A 2WUFA 3KDAA 4U2GA 2UZ0A 3WIBA 1GQSA 5AKYA 1MO2A 1XZGA 4M0MA 3GUUA 3HEAA 5K3AA 3SC2A 2WFMA 2PU5A 3RK4A 2XUGA 3QPDA 4UBNA 4FWBA 3T52A 1YR2A 4TGLA 2BGNA 3B12A 5ALTA 4H7KA 3OURA 1PFQA 1T4MA 1XQWA 4A5SA 1S8OA 1A7UA 3O95A 1LPNA 4UHCA 2OQIA 2JGEA 4QEKA 1LGYA 4G8BA 4RE5A 1LLFA 4B0OA 3C8HA 1BN7A 3TJMA 1W76A 3ANSA 1EB9A 3YASA 1KU0A 3T4UA 3LS2A 1Q84A 5AM0A 1ZIXA 1N5RA 2J3DA 3UMJA 4MEAA 2XMSA 2XQGA 2XQFA 1ETHA 1XQXA 5AI4A 1DX6A 1U2EA 4G9EA 4W1QA 1FFDA 3Q8WA 1CPYA 3KD2A 2GZSA 4X97A 1QIIA 4QNNA 5JAUA 3HRHA 5FV4A 2XUPA 1XZKA 3K2IA 2RIPA 3LCRA 1YCDA 2WIFA 4EY6A 5JD4A 3WI7A 2G63A 5EIAA 2Z3WA 4U2DA 3WL6A 2JGIA 4A16A 1VXOA 1LZKA 5ALMA 3UUFA 4WFJA 4PSDA 5HF5A 3HJUA 3G7NA 3V1MA 3WWDA 1XZBA 3N0TA 5AO9A 3JWEA 4HZGA 5HCUA 4UBKA 1SCIA 3AZOA 2OQVA 3G0BA 4CFSA 4MWSA 4CI9A 2WU4A 5A71A 2XB6A 5E4JA 3PFBA 2WJ4A 4D9JA 4FKBA 3BL8A 1Q0ZA 5CBKA 4G4IA 1UK7A 5DLPA 1QTRA 1DT3A 5BWBA 4FHZA 3L1JA 4HXFB 4ZI5A 5CW2A 2WM2A 2YXPX 3D2AA 4B7ZA 5A7FA 3GELA 1G42A 1MJ5A 4G1FA 3WWCA 1EDEA 3DKKA 1QO7A 2XDWA 5JZ9A 2PM8A 1JT2A 2D5LA 2PSHA 3U0VA 3WQHA 5A62A 5EI5A 5ALQA 1HKHA 1JJBA 2HM7A 2C0QA 2CB9A 3G9XA 3AUKA 1OCEA 2I78A 1VJ5A 2I03A 3IUNA 4W9RA 5DYTA 3FSGA 3F8SA 2ZSIA 1R9MA 2QXTA 4OU5A 1ZICA 4OD0A 5CRIA 1MT3A 4HS9A 1QGED 5AI5A 4P93A 5HZGA 2XE4A 2QXUA 4N8EA 1P0QA 2CKMA 2C5FA 4J0DA 5EHNA 3NWOA 4LHEA 3GFFA 2Q0XA 4AO6A 1H23A 2QMQA 3M3DA 5E4YA 1EI9A 3EF3A 4ARAA 1Y7HA 2ZVDA 2WIGA 4Y2YA 3FYUA 4GXNA 4J0IA 1EK2A 1MX9A 4BBZA 4UHHA 1AX9A 2WHRA 4QWMA 2XMGA 3TRDA 2Y2VA 3RARA 1HQDA 3JW8A 1AURA 4EA6A 4HAIA 2WU3A 4C01A 4NZZA 1QIFA 4IO0A 2W6CX 3L1IA 4X6XA 5AI6A 3W9UA 1CUEA 5EGNA 5CH5A 5DYWA 5CURA 1CUJA 4GEGA 2B20A 3DQZA 5EFZA 2XMCA 5ALHA 3IUMA 1QIHA 4LIPD 3DOHA 1QOZA 2P8SA 4BVKA 3I2IA 3FLAA 3H2JA 4FNGA 4NS4A 2PSFA 4YX9A 4Q3OA 3W04A 1EDDA 1QIMA 5FDFA 5FLKA 4PO3X 5FPQA 1IUOA 3R41A 1DX4A 1CUIA 1MNQA 3CXUA 1F8UA 1DTEA 4QWWA 3WL5A 5ALNA 3DNMA 5BV7A 5AI9A 2YH2A 1E8DA 3BE8A 1CUXA 1N8SA 4DGQA 5D3ZA 3I1IA 3G0IA 4QDTA 1XZLA 4AN0A 1MAHA 5D3KA 4H0CA 2VJDA 4UFNA 2AJDA 3BDIA 3DKRA 2BKLA 2O2IA 1IMJA 2PSJA 5T4FA 3DOIA 1DINA 2JF0A 2PPLA 3OPMA 2QT9A 3IUJA 1UOOA 4RNCA 5ESRA 2R11A 5JALA 5AK4A 2QOEA 5IVHA 4AQDA 4AX4A 1QONA 3DEAA 4H7JA 1HDEA 2RONA 3O9MA 3O0DA 5HQ3A 3D3NA 2XT0A 4X7BA 4MXDA 5DJ5A 2OPHA 1WOMA 3N2ZB 2BJHA 3K6KA 1R3DA 7YASA 4KR0A 3A2LA 3R3XA 1WB6A 2VJBA 4FNMA 3AILA 1CUAA 4TPKA 5CTAA 5LKAA 1E66A 3R3ZA 4DNOA 1CR6A 5ALXA 4Y7DA 4DYHA 2EDCA 2G4LA 2DHCA 1EB8A 4J3JA 5JAHA 3OOSA 4GW3A 2EDAA 5C8VA 1QLWA 4DIUA 3RM3A 1J1IA 1ZI6A 1XZJA 4J0JA 5ALLA 2DHDA 4HVTA 2FJPA 3BDVA 5DYYA 1XROA 3FSGD 1R88A 4OYYA 3WIOA 3WYDA 1W52X 4W1SA 1K5PA 1RWQA 2DQYA 3QZUA 1T2NA 3CCCA 1JU3A 4C4YA 4I19A 3KXPA 3IVMA 3BJMA 2X76A 2OAGA 5T4EA 3WK8A 4OB7A 2WIKA 1UWCA 3W06A 3TEJA 3LIPA 4UPDA 1HLGA 1ACLA 4W63A 3SX4A 1ZD3A 1AGYA 1LPPA 3AZPA 1THTA 3FYUB 1SC9A 3ZLTA 4QLAA 2Y2UA 5ALJA 5HFAA 4PW0A 3WL7A 2HA2A 5ALEA 4GI1A 4Q3LA 3FNBA 2OGSA 5AK3A 3VDXA 1XLUA 4Q34A 4W1RA 4IQ4A 3A2MA 1A88A 4UBOA 3A70A 4RPCA 5DTIA 1IZ7A 2CEKA 4B81A 2FX5A 3IA2A 2OGZA 1XZFA 1FFBA 2QM0A 3OM8A 2Z3ZA 2XUHA 4F60A 4E14A 5ALPA 5AOAA 4X95A 4QLOA 1E8NA 5HF6A 5A2GA 4X6UA 3WYNA 2B61A 4Y2PA 3E0XA 3EQ9A 1UKCA 3STVA 2VAXA 4E11A 5ALZA 4UHFA 5EIHA 1LPMA 1ZGCA 1DWPA 3ICVA 2V96A 4GWLA 1LNSA 5BOVA 3I6YA 5JZBA 2WG1A 3KWFA 4UUQA 4GHWA 3QITA 3PE6A 4XIIA 1C7IA 3R3UA 3DJYA 4XWGA 3ESDA 5K3FA 1LPOA 4G8CA 1ZJ5A 4KE6A 4WY5A 1UK8A 1NU6A 1N5MA 4BRZA 2XUQA 3C87A 4X93A 1L7AA 4BB0A 4N8DA 5SYNA 2O7RA 1X2BA 2QUBA 1CQZA 4P9NA 3PUHA 3WJ2A 1ZJ4A 4W1PA 4NVRA 4J0CA 1WPRA 4MJ3A 1CUBA 1AZWA 4EY7A 1YSCA 4WCVA 3VJMA 4RE6A 4Q05A 2J3QA 1K8QA 5HQ3B 1W4LA 4MQMA 4P08A 3QYJA 4BE4A 4DM7A 4ROTA 1DQZA 2AJCA 2AJBA 3STTA 1A8UA 1PJAA 1FFEA 3BIXA 4QA9A 5D7BA 1LPBB 5BWCA 1DWOA 3FAKA 4FLEA 3H2KA 4DNPA 3TGLA 2JEYA 1CVLA 1SFRA 2HU7A 3QVMA 3IIIA 4FFWA 1F0NA 1G4HA 3NUZA 1C4XA 3G9UA 2CBGA 4EZIA 1QIKA 5ALGA 3WKCA 1RYYA 3G9ZA 3HYSA 1BROA 4BAZA 2IIVA 4DSAA 1H2YA 3I2GA 4KE8A 4K6KA 4Y2RA 3D2CA 2OAEA 1U8EA 3QMMA 1TCAA 5AOCA 5EIEA 2ZYIA 3R0VA 4UBJA 4ZXFA 2EEPA 3I2HA 2BFNA 1WM1A 3DS8A 4OSEA 2JGFA 3IDAA 5AIAA 3S8YA 3QMVA 1U4NA 3STYA 4OCZA 3F9CA 4EB0A 3LIIA 2Y1KA 4H7IA 1O6GA 5AKLA 5CXUA 1J2EA 2GZRA 4C4XA 1IVYA 2VF2A 1GGVA 2YASA 3O4JA 2PUHA 5F4ZA 4H18A 2DR0A 3R40A 5CMLA 1I6WA 4B85A 4RGYA 1FFCA 1CUCA 5DNWA 2WILA 2PU7A 4FLMA 4K6GA 5AKKA 1IUNA 1WPXA 4H7EA 1B41A 2HA0A 4J0KA 5LZ7A 1QO9A 5AM2A 4C88A 1A8SA 3STUA 4ZGBA 1J06A 4KRYA 1AKNA 3AJAA 1AMNA 4WFKA 3BF7A 1WB5A 2PL5A 4MYSA 2LIPA 5HF8A 2XUAA 5CT5A 2VJCA 2PBLA 3ESBA 2QJRA 3DLTA 3H1AA 1LZLA 2DSNA 2WJ6A 4G8DA 1C7JA 4OU4A 1EVEA 1EDBA 2XUIA 1EH5A 2ZJFA 1JJFA 2DCMA 4KJXA 3I6MA 4BCBA 4L9AA 1ORWA 5LZ5A 5IVKA 1OXMA 1K6EA 1USWA 5EHZA 1MNAA 3M81A 1R9NA 4C89A 1XFDA 3ESAA 1NX9A 1CEXA 2H9YA 3I2JA 1JU4A 3FWHA 2E3JA 1BN6A 2J4FA 3IURA 5EHXA 4QDOA 4LYEA 5LP1A 3QPCA 1CV2A 5HK9A 4BAUA 5AJHA 2GBCA 2VSQA 1CUSA 1GKLA 4WFIA 4UBLA 5K3FB 4XVCA 3I1YA 2XMQA 3SK0A 2QTBA 4E15A 1CUFA 2HU8A 4Y2TA 3BF8A 4U2BA 4N8SA 1OILA 2HA4A 1EINA 3HXKA 2HFJA 3C45A 4OUKX 2BUCA 4H35A 3AINA 4WDQA 4ZV9A 2HHAA 1XKLA 3R3WA 1WCYA 5JIBA 5AM5A 3L1HA 5ALFA 4BC1A 4BRSA 4EBBA 3H0CA 3ICWA 1CUWA 3ED1A 3G8YA 3WMRA 2XMZA 1QIJA 2BCEA 4I4CA 2RHTA 2C5GA 3D0KA 5AKJA 1CUDA 4B82A 5LLSA 2Y6UA 5IKXA 3QM1A 4B0PA 3ZPXA 3G0DA 4CCYA 1HBJA 1UZAA 2Z8ZA 1XZAA 4BZWA 1MTZA 4JH0A 3JYHA 4G4JA 2H7YA 5AOBA 2DHEA 1VKHA 3WKAA 4EY8A 3C6YA 4UFPA 5E4TA 1EVQA 1MX1A 5ALUA 4QZVA 5AK6A 4BE9A 4ITVA 4J0GA 1XLVA 1TIBA 1GPNA 2XI4A 4P92A 3AZQA 1UOQA 3IBTA 4J7AA 4MQLA 3IB3A 3H2IA 2WKWA 3WK7A 1B6GA 4F0JA 4B9EA 4YASA 3NGMA 2GBFA 1M33A 5K3EA 3HACA 3V1NA 4LXIA 3G0CA 1ZI9A 1EX9A 3WWPA 2VA9A 2GBIA 1UT6A 2G5TA 4GDMA 2IITA 5IH7A 5JASA 1MU0A 1VA4A 4AMZA 4EY4A 3O4HA 4Y2XA 4BATA 4BTLA 2ES4A 3M82A 2J4CA 1J07A 5FRDA 3G9TA 4ZWNA 4BDTA 3VXKA 5KREA 4AB1A 5AKXA 4L3WA 3F96A 1ODCA 1GXSA 2QVBA 4H7DA 5AIBA 3VKFA 4CG2A 4TVKA 5AK5A 1GQRA 4BYMA 5K5EA 1UKAA 5AI8A 4K5QA 4C87A 5LZ9A 3H04A 2DQZA 4DNFA 5C81A 1P0IA 1YB7A 5D6OA 2XQIA 4LKOA 1XQYA 3H2HA 2WUDA 3W05A 4IHAA 5A6VA 1WHSA 4QDZA 2HU5A 4C4ZA 5CH8A 1QFMA 4DLNA 1CUUA 4H7FA 2C4HA 1VE7A 2C7BA 1CUHA 3V48A 3GZJA 3DCNA 3MUOA 4OPMA 5J3JA 3FYUC 1XRRA 4IH4A 1XZEA 2H7CA 3WWEA 2QZPA 4S0XA 3ZWQA 1E3QA 4QE3A 4ZREA 4X71A 4BCDA 1UK9A 5AM4A 3W9BA 1VXRA 3B5EA 3ILSA 4U2EA 2GYUA 2PSEA 1UFOA 3HABA 4MWTA 2OCKA 5AM3A 1AC5A 3X3HA 3EQ8A 2HFKA 3V1KA 3FLBA 3Q0TA 4BP9A 1VZ2A 2QJWA 5LYYA 3STWA 2VEOA 4BC0A 2XMBA 4BVJA 5I9IA 1GPLA 3HLKA 2YYSA 3IULA 2WFLA 3HSSA 4ZRDA 3BJRA 4IH9A 5C8XA 4XJVA 3WA6A 3AIKA 4CCWA 4B83A 2HRRA 3DDUA 4PSUA 2JGJA 1E5TA 1ZD4A 5KWIA 4KE7A 3O4GA 1TQHA 3AFIA 2VTVA 2ZJ7A 2JBWA 2GYWA 1CQWA 4AZ3A 2VJAA 5JD5A 3WKBA 3OTQA 4Y2JA 3QPAA 3I2FA 5DNVA 2RI6A 3HZOA 1QTIA 5JZSA 4PV7A 2XQKA 4CG1A 2C58A 3K9BA 2FUKA 1BCRA 4CCYB 3G0GA 1JFRA 3QMWA 2V9ZA 4FOLA 1ZD5A 1ODTC 4Y2UA 1Q83A 1QIEA 5AHXA 4UFOA 4FTWA 2OCLA 2HADA 2FJ0A 5ALSA 1TAHA 1L7QA 2X8BA 4UHBA 3ANTA 4Q82A 1XRNA 3WJ1A 1EXWA 2RAUA 3C5VA 5C7YA 5HK8A 2C0PA 5LIPA 2O2GA 1CUVA 1YB6A 5ISMA 1KEZA 1AQLA 4PNZA 2HL6A 4E46A 3LLCA 3I28A 3R3YA 5A7HA 3V1LA 2O7VA 1QE3A 4AXBA 5HFNA 1R4ZA 3WA7A 2HIHA 5T4HA 2OCGA 1XQVA 2PUJA 4EY5A 4KAAA 2VT7A 2CUTA 4Y2VA 3CN9A 1LBTA 5DTJA 3VVMA 4AO7A 3AIOA 4NMWA 1WHTA 2HRQA 3G02A 5CT6A 4EHBA 2NW6A 4MEBA 4Q1VA 1YS2X 5I8PA 4N5HX 2ZYRA 4B80A 1BCSA 4KE9A 3MVEA 4JNCA 2G5PA 4INZA 3EQ7A 3FCXA 2WUGA 1IZ8A 2XQJA 5AP9A 5H3HA 5LZ8A 3SWWA 1XZIA 5FOQA 1JI3A 1DWQA 1CUGA 5JYCA 4B6GA 2QKYA 3F67A 1GZ7A 2WHPA 4J03A 3IUQA 4U2CA 4OB6A 5ALOA 2V97A 3C43A 1AUOA 5FUMA 2ONCA 2WIJA 1UOPA 4LXGA 1MN6A 1FSSA 4V2IA 1ZIYA 1XZHA 5KWJA 2R8BA 1A8QA 3DYIA 3WK9A 1JMKC 2WHQA 4KACA 4ETWA 1DT5A 5CT4A 4M0EA 1O6FA 4H77A 5JADA 1SCQA 2JEZA 4FBMA 5I7UA 5JAPA 2HDWA 3PI6A 5CXXA 3C8DA 2H1IA 4PF1A 2ECFA 2Z8XA 4U2FA 3M83A 2VAVA 4GLBA 1VZ3A 1QFSA 2XMDA 4YPVA 1QZ3A 2ROQA 2WLSA 1ORVA 4X00A 1W75A 3D4LA 2VQ6A 1XRQA 4MYDA 3I2KA 1H2WA 5JD6A 3PF8A 4FMPA 2PX6A 1W1IA 5AKZA 5FPPA 5KBYA 3KWJA 2PVSA 2RGUA 3W2TA 2GYVA 4YK7A 3D7RA 2XLCA 3CN7A 1N1MA 1H22A 2W22A 2WFLB 3B3QA 3C6XA 3WWOA 5AI0A 3A6ZA 1YS1X 4BAGA 5LZ4A 5ALRA 2JIDA 2BUAA 3WL8A 3FVTA 4X94A 4JUIA 3O4IA 4DMKA 2WUEA 2XLBA 3DL7A 3A2NA 3ZI7A 2BUBA 1G5FA 3FYTA 5CH3A 2AJLI 4EUSA 1BEZA 3PF9A 3FCYA 5AKEA 1VLQA 3OC0A 4K2AA 1Y37A 2K2QB 4WJLA 3OG9A 2ORYA 3QBJA 3D59A 1CUZA 4AN1A 4DMCA 4K6HA 5K3DA 1Y7IA 5ALYA 2WJ3A 4BDSA 2XUDA 1LPSA 3O9VA 2PSDA 1QIDA 5C8ZA 3BXPA 5HKAA 1QJ4A 4IH1A 3C70A 1XZDA 5SYMA 4AO8A 2JGKA 3ESCA 1VA5A 2AXEA 3GBSA 5EHQA 3AIMA 3C6BA 4UBIA 4X91A 5JARA 1TK3A 5T4BA 3QH4A 1PV1A 1GT6A 1WB4A 1CLEA 5AKIA 3WK5A 4JEIA 4DNQA 1XZMA 3F98A 1SOMA 3WKEA 1LBSA 5IVDA 1RP1A 5FP0A 1H2XA 5CT8A 6YASA 4JYMA 2Z5GA 4X90A 4JYPA 4CIBA 1BU8A 4UHEA 2O2HA 2QUAA 2X5XA 3BIWA 4LYDA 4HRXA 2VT6A 1R50A 1XRLA 1JJIA 1MPXA 1EK1A 1BEEA 1P0MA 4O08A 3WZMA 4DMHA 2HA6A 2Y6VA 2XMRA 1CFJA 1U65A 3GA7A 5HF9A 4DTCA 3VISA 3R3VA 2PKYX 2WHPB 1G66A 1CIJA 4HXEB 1EHYA 2OCIA 1YA4A 4KRXA 4HXGA 4BZZA 2AJ8A 1HL7A 4BP8A 2QS9A 2HA5A 3MGAA 2JGMA 1HPLA 3BWXA 4KEAA 3ZV7A 2DFPA 2ACEA 2OGTA 3E4DA 3KSRA 1XRPA 4G4GA 3FBWA 4Q3KA 3VJKA 4DMFA 1R1DA 5ALIA 4C6HA 3V9AA 1TCCA 3EBLA 2ZJ6A 4QDXA 3C5WP 2B9VA 1DQYA 4KAFA 1UK6A 3WLAA 1ODSA 5FKJA 4LXHA 3DD5A 4F21A 5HKBA 5AKHA 4X3CA 2ZSHA 2I3ZA 4G9GA 2GBGA 1X70A 2ZYSA 3VJLA 5JATA 4WY8A 3H17A 2OG1A 4H7HA 1BE0A 5A7GA 1LPAB 5AH0A 1DU4A 1XRMA 1YAHA 4GECA 4F5ZA 4XX1A 4KAJA 2RHWA 1L7RA 3E1GA 3KOOA 2XUOA 1UXOA 3FLEA 1BRTA 3U1TA 4FLFA 4OB8A 2D0DA 3UUEA 4ARBA 2OLEA 4N5IX 4B84A 4Y9SA 3PICA 2QRUA 5JANA 3NOXA 1ACJA 2JGLA 2H7XA 2XUKA 2WQZA 3VVLA 2QR5A 4CIAA 1F0PA 1JKMA 2WTNA 2CZQA 2OXEA 2ACKA 4AMYA 1ZI8A 4FBLA 1ZGBA 1BS9A 1W6RA 4PSCA 3WZLA 4PQEA 2XUFA 2HA3A 5DWDA 1KU6A 1IUPA 1K63A 2IX9A 4BCCA 3DYVA 1EA5A 4AZ0A 5FXMA 1ZD2P 5ALDA 3H1BA 4OYLA 3F97A 4I3FA 1XZCA 4B9AA 3FOBA 3H19A 1E8MA 1TRHA 4FFVA 2WG2A 1TKRA 3E3AA 3WK6A 3DL4A 1QIGA 1XLWA 3HC7A 1VE6A 1GKKA 1X2EA 3GROA 3P2MA 1Q0RA 3PFCA 2V98A 3PDCA 3C6ZA 2WFZA 1ZOIA 4KYVA 2WG0A 5ALVA 3S2ZA 1K4YA 1TCBA 4QDUA 4L72A 4UHDA 3D5EA 2VATA 3RKSA 4UBMA 4WDRA 4CG3A 4Z49A 1YAJA 4Y2SA 3I6ZA 3HI4A 1MX5A 5DNUA 1SCKA 1VOTA 1XKTA 4BVLA 2WIDA 5LKRA 1THGA 3RLIA 1D07A 1CRLA 4J0HA 4HRYA 4L0CA 3ZLUA 1YA8A 4X6YA 5K3BA 1MAAA 1YASA 4A23A 4FDMA 5AKGA 1FFAA 5LZ2A 3MUNA 4DSZA 2WSLA 2ZYHA 4HTAA 2BAGA 5E2IA 4ZV7A 3FVRA 2BGRA 4GBGA 3H18A 1ISPA 1CUYA 3PUIA 2CJPA 3WKDA 5JAOA 3D2BA 3H2GA 5CT9A 3LP5A
chains in the Genus database with same CATH superfamily
2XHZA 4I4IA 1KQ3A 5ALWA 3GFRA 4G2NA 4DLBA 2YWFA 1Z6GA 4X1IB 2II6A 2D13A 2G25A 3OTGA 4W9MC 1L5LA 4O4IF 2I65A 2FR1A 4Y2QA 1H0SA 2G9QA 2HWKA 3AYXB 3N5KA 1G98A 2G0TA 1NMEA 3G68A 2V6MA 3Q7TA 2ENUA 2I3DA 2Z8YM 2A1UA 3PP8A 3C7AA 1NC3A 4JP8A 3G85A 5D8DA 3U7HB 4EI8A 4YRTA 3TI7A 2GUGA 1Y3DE 4M0LA 3DMPA 4IS3A 1DAPA 5B1HA 2I99A 4HEQA 2C8JA 2BRUA 3NALA 2HQRA 4BTVA 5AQ1A 5LXTB 2B4AA 1FJ2A 4BPRA 5BP7A 5YASA 4ISBA 1H2ZA 3RTGA 2R87A 4PZUA 4A2QA 5ALKA 5BNZA 1MB9A 2A0WA 4RF5A 3UH0A 1PWYE 5F21A 4NJMB 4AG3A 4U6SA 4LDAA 2D1TA 3ZQUA 1NU8A 3AF1A 5KTTA 4IJ6A 3GEEA 2ZB8A 1QH1B 5ADHA 1A1VA 2V8OA 3VVCA 4CIWA 4UEQA 2B4YA 3VR4A 4F71A 4CLHA 4KUHA 3FXAA 4X92A 1AVTA 1FS4A 3Q88A 5BT9A 2BY4A 3RYIB 3TLAA 3PUYA 4X44A 4Y1FA 1P5FA 1QGZA 2J9FB 3SR3A 5GZ3A 2NQTA 1D5CA 1V6AA 4KIJA 1SBZA 2O07A 3QKUA 1Z34A 3IQDB 2IHZA 4LOHA 5K0FA 1RXCA 1GQSA 1LK7A 1N57A 2K6GA 3TE6A 3K7EA 2O5EA 3R24A 1CP3A 3CLTC 2AW5A 3JTEA 4IIJF 2QR3A 1KEEA 2GO7A 3A1WA 5BWMA 4P33A 4UAJA 4Q16A 3FCSB 3M6UA 5TPZA 5F7ZA 5CLJA 1NUPA 1WPGA 3DAOA 3LTNC 4V02A 1RKUA 4W7SA 1J25A 1UJBA 2R6HA 2IZZA 3HRIA 2DR3A 1COZA 1I4DD 1UADA 1Z2EA 2VJYA 5AVTA 3SC2A 7GPBA 3TZ6A 3QNWA 1JEDA 3OKFA 4MVCA 2CNNA 1CZHA 3PIRA 1T3SA 1DRKA 2PUTA 3QPDA 3FB4A 1T13A 2MMGA 3NBFA 1UXJA 1G0NA 2R8YA 3N8HA 4J29A 2IHYA 3MEQA 4UE3S 1X9HA 1XB2A 3M6FA 4NABA 3T3GA 5TDHA 1QS0A 2BGNA 4TZ6A 1Y3IA 3ADDA 3FMIA 1HG0A 1EFRA 2O1XA 1KVTA 2C5AA 4H7KA 5KKNB 1PFQA 2HKIA 4GM0A 2HLHA 4Z9YA 1Q1QA 1QXSA 1XQWA 2WE8A 3ACCA 4JODA 3E9RA 4WZ6A 2B9EA 4A5SA 3CGGA 1F5NA 1SEVA 2Q6OA 3OFKA 3IJEB 5L4LA 1Z35A 3NV7A 5EQTA 5A6SB 4E1AA 1LPNA 3H3JA 3ONWA 1KI8A 4MAFA 2OQIA 2ECQA 1X1SA 4UHCA 3KETA 2UXCB 4KO8A 3K9FC 5LMUB 2P4SA 5KWEA 5P8WA 1I4WA 1YJQA 2RJ3A 2QI9F 1KYYA 2PV7A 4ESEA 4B3GA 5DE3A 4B0OA 4A1OA 2ZT6A 1NI3A 2QD2A 3C8HA 1AZLA 1BN7A 4JUDX 3UJAA 4BZPA 3L7LA 5LMNB 2ZQ5A 3UT5A 4DPMA 1KMCA 1E3DA 3RRBA 3OOWA 1UJ6A 4X61A 5HIMA 1EAYA 421PA 3WYCA 3NG1A 5IAGA 3N2IA 3T4UA 1TMOA 4B6OA 4GVLA 5FR2A 5AM0A 2P2YA 5E9WA 1N5RA 3GRRA 2NYUA 3QKSB 1CRPA 3HBNA 3ZXYA 1YR9A 5IW8A 3WC4A 2H8GA 4ZOCA 2OHIA 3G5LA 3WGKA 1EFTA 1R00A 4DMLA 4RVGA 1Z7GA 2J46A 4Z4IA 1HE1C 1ETHA 2HGSA 3HTXA 4OMFG 3KSDO 3L1VA 4XH9B 3QGMA 2AF3C 1S2DA 3EVNA 2P5UA 1ZH0A 3M2TA 4F1JA 5B3AA 1XBTA 3U4QA 1N2BA 1U7HA 2OAQ1 3ONNA 4DUGA 2Q0HA 1RTTA 5HX7A 4HDKB 2VJLA 5K8LA 4M1KA 3VV2A 1OWPA 2I33A 3DE3X 2GZSA 1NQUA 5CPBA 2CNBA 4QNNA 4UEWA 1CEYA 4CDMA 3M4YA 4LDRA 3AT1A 3VTZA 4RF3A 4QJ3A 1FC0A 2QQ5A 3GWZA 4L2IA 1XG5A 2XF8A 3BEDA 2C3MA 5AUPB 3F4LA 2CZCA 4PLTA 1MJGM 5IPFA 4XPZA 3PQFA 5M7EA 1JSXA 3LO8A 4GGMX 5EN4A 2NU9A 3UGQA 5CFZA 4B33A 2JNWA 2PRYA 2I2AA 1MVLA 4RESA 1W6UA 1T0BA 4R6XA 4IYRA 4UM7A 5TJ9A 2DHQA 5J2UB 2GEFA 3CB4A 3KZKA 5G0VA 2OBBA 3DE1X 4WFJA 3C3JA 2YXNA 2HQBA 4UPVA 1D9ZA 3GRCA 5PGMA 5I9NA 1VRWA 3GPDG 4G67A 4POOA 3N0TA 4EKGA 5AO9A 5K8IA 2P6RA 3AHCA 1L3CA 1LSJA 3IIKA 3JWEA 3DT6A 3JZDA 2JFGA 4IFBA 2Q45A 4JFAA 2D1YA 5HCUA 5KTPA 1CF4A 4M9SA 5K8JB 1YA6A 4BLUA 4GBJA 1EP2B 3KXIA 4JBHA 1B6RA 4UBKA 3THOA 1LC0A 3AZOA 1T3HA 3REQA 3P0IA 3CLUC 2A57A 2BFCB 4QUBA 2XGGA 1MQ9A 5A4KA 4QODA 4JB0A 4CUJA 3GRFA 4JI8B 2XE8A 2OVBA 4GUAA 2XDYA 4O3FA 5FYQA 2XB6A 4CI9A 1TK2A 5E4JA 1QF6A 1NI4B 5AXAA 4D0LB 2NVUB 3KELA 4LAFA 1W5TA 1E6WA 3B13B 3F5DA 4RHEA 1D7OA 3SHWA 3VPFA 3OP1A 4E94A 3Q5EA 2DRIA 3PC8C 4ZVQA 1U31A 2HAEA 1OTYA 1Q0ZA 4IG4A 5K6TA 1UK7A 1C1YA 1QTRA 2X2OA 3H5IA 3DTVA 3NLLA 4IDPA 3DHWC 1JR3D 4IIGA 4D3DA 4GR4A 1E2QA 3L5OA 4M0CA 1FNDA 4GOKA 1NM5C 3SJ7A 1DT3A 1Y5MA 2J9GA 3KLBA 1ADFA 4NJEA 3ISTA 1VJDA 3D3JA 4HN9A 3PJGA 4EUEA 1NXTA 1YRBA 3EZ7A 4P4LA 4QNRA 1KI4A 1ST2A 2P2ZA 1POXA 3HWSA 4JVSB 2KB0A 4RZXA 1EUYA 1N2HA 3WRXC 4YRKA 4KBYA 1GPUA 1CTQA 3GELA 2ZRKA 1JN0A 1J20A 4ILEA 2P5SA 4L27A 1Z5OA 2L42A 2Q6IA 3WWCA 1TECE 4QTTB 1R0RE 5LLDA 3EH2A 5A06A 4RH1A 5TV2A 1NC1A 3ANXA 3H2BA 1ISRA 1GPMA 3DKKA 3ZUPA 3L0YA 4YCBA 2OK8A 4RH0A 4ZAYA 1ZH6A 3QV1A 4O4JF 3QU5A 3DL0A 4LSMA 4DLYA 4GC5A 4OXQA 2D2FA 3PVZA 1QGAA 4ZYTA 2R6DA 3GRVA 3E05A 1NUQA 2GCOB 1KDZA 4BMPB 4URXR 4GMDA 5IJ9A 1CS4C 4BO1A 4E5MA 1JG6A 5C5EA 2V74B 3LQ1A 1HKHA 1IHDA 1XA3A 1EQ2A 1ZUD1 2VPPA 1G8MA 3BH7A 3G9XA 3GRZA 4GF5A 5AT1A 1OCEA 1YB5A 1CG6A 1G2OA 4KIUA 4OBWA 5IX8A 2A1TR 2HJ9A 1P6QA 3A6GA 3EH1A 5DYTA 1D2CA 1IIBA 2J0UB 3QQPA 4QGAA 4YIKA 1DIRA 4BNUA 3FLMA 3AJ8A 3MT8A 3B9QA 2ZSIA 4XKJA 4D99A 3ZDFA 4KB5A 4AJHA 3DOFA 3GFGA 3VZCA 4OU5A 2X8JA 3VVBA 1AHNA 1IIRA 1MT3A 5JDIA 1AKWA 1JALA 3K72B 4MIOA 1OGYA 4NIMA 2P7HA 1GAXA 2GAFA 3EC7A 2QGFA 3L9XA 3V55A 5HZGA 4QOJA 2RC5A 4HTFA 2XE4A 4HO1X 1B76A 4ND2A 3ENVA 1BJTA 4HCJA 3SKVA 4RDXA 3F47A 5DP2A 1EHCA 1GZSA 2CKMA 4BO6A 3COPA 4DQKA 2ERXA 4RZSA 1TVKA 3PT9A 3KOZA 4UARA 1Z37A 3UUWA 1FQKA 3CISA 1HRKA 1WCIA 3DFUA 2KI5A 4J0DA 1UJ2A 5BRAA 4MUKA 3UA3A 2VQDA 1V48A 2A1UB 2QTTA 3A4MA 2ZROA 3NWOA 3FB1A 2Z57A 4IHKA 4FFBB 3U17A 3I45A 1KHHA 3K6JA 521PA 2EFCB 2Q1WA 4IRXA 3RHFA 2QMQA 4GYYA 4W4TA 3GWGA 4MULA 4IJWA 4QUAA 1WBDA 5JWHA 2O23A 5D01A 5LQKA 4NYIR 4O2AF 1SZJG 3HQ4O 3B3JA 4MSUA 2WIGA 4Q47A 2ICAA 4B7XA 1O0CA 2O50A 4QJIA 2F3PA 3FYUA 3Q9SA 4OH7A 4ARCA 1FU7A 3DZCA 1Z4QA 3KG2A 3V46A 1O87A 1FS6A 2P6OA 2PD6A 2V7PA 4MKHA 1CQXA 2TECE 3H6GA 3CWQA 4NFYA 3PGLA 5E95A 3UMFA 3FTEA 4R83A 3V1NA 4I14A 3LXMA 5GY7A 4BBZA 1AHHA 2WM8A 1FQWA 3ER6A 2UXDB 2AHRA 4QWMA 4LI3X 4OP2A 5JQGA 4N48A 1HQDA 1I94B 3JW8A 1FLVA 1M66A 1VECA 4HBGA 4MKIA 3W5AA 4OP1A 4K0KB 4MROA 4P0PB 1ZGHA 3LX5A 2YICA 2PR7A 1RKXA 3CNNA 3H9BA 4G09A 2QL9A 5HILA 1M6HA 1YHNA 2ZBVA 4OHOA 3ENQA 4NZZA 4N0EA 3RVSA 3A9UA 4TWZA 3AF5A 1ZH8A 3GGSA 1D1PA 4KO2S 4U8GA 3SF8A 1P2DA 2ZRBA 4H3VA 1QZZA 5CH5A 3SC2B 3KPJA 1RBYA 2CDRA 1HR0B 4FGJA 3BD9A 2EKPA 2L19A 2HYDA 1VJCA 3I23A 1P0FA 3QVUA 4OKIA 5EFZA 3GFVA 3B9PA 3MG9A 3OWOA 1NJ6A 1SKAA 1OX4A 1XEWY 4FEGA 3MD9A 1QS0B 1AO3A 4NU8X 1X77A 5CW2A 4DR3B 3ZGZA 1H2EA 4C4AA 3R9XA 2FN4A 3H4VA 1NJ5A 1U1GA 3Q8LA 1P3JA 4EL0A 1JHOA 3FLAA 3H2JA 3SEZA 1R5NA 2FMIA 1PN3A 2PSFA 1JVBA 3CBGA 4D4JA 5GQSA 4RW0A 4YX9A 2O3SA 3TM4A 3V2HA 5I7EA 1CY7A 2PH3A 4DV3B 1DDGA 5EIFA 4JT2A 1ZYUA 1QHNA 1G1MA 2QSZA 3VH4A 5SZKB 3AHJA 4TL8A 1FFYA 4PLYA 3RVOA 3AG6A 1HYBA 5SYAA 2P69A 1KC1A 5U4QA 2EFJA 5KNDA 1KORA 1Q0QA 2VJKA 4GZLA 3ZWKA 2H65A 2W9XA 3UT5B 1MNQA 4XRGA 5H16A 1LDBA 1HUQA 2O2CA 3PIIA 1SIWA 1KGSA 3BL5A 4Y6QA 2XX3A 2PUVA 4Q3AA 5L4NA 2ZIEA 3TRKA 2YH2A 3OKPA 5E9JA 1E8DA 1LF5A 4WEQA 3NM4A 3S0JA 4A2PA 5IMBA 4QG3A 2OT3B 5IK2A 3IQEA 1YR8A 2JD2A 1AF7A 1VBKA 3OIDA 3W5IA 4REQA 2UYOA 3KKOA 5HE9A 5B55A 1XJ5A 3TUIC 1XK6A 2YYAA 2WQ7A 3P2YA 3OHPA 5CB6A 3VTKA 2GVNA 2I7TA 2G88A 4P54A 1SUDA 4YQZA 1MIOA 3JYQA 4HDRA 4C0SA 3PD1A 4AN0A 2DPGA 3U4QB 2VJDA 1C0LA 1OROA 2AJDA 2Y93A 3B85A 5IS2A 3HY3A 4ERNA 1KI7A 5J5VA 4PGAA 1Z73A 2R4QA 3G2JA 3QNMA 2QVLA 5I45A 1FCJA 1A1SA 5GJVC 3Q8XB 3E2MA 4OGLA 4DUYB 1IMJA 4HP8A 3C2QA 4TUYF 2IOHA 4L2IB 3QLVA 2ZS7A 1ETUA 3H8WA 3FFAA 2W2LD 4KQXA 3LBFA 5T4FA 4Y2GA 3GLQA 2Q4BA 3B7PA 5DIFA 3RIXA 2GZ2A 2FCRA 2PPLA 1YC5A 1HTBA 3D6JA 4QO7A 3IUJA 4YRZA 5A5EA 1UOOA 2MSKA 2NU9B 4RIFA 4OL9A 2NU8A 2RAVA 3PPWA 2KPOA 2VSYA 5E0KB 1NDHA 2CHFA 3U3OA 1G8JA 2QMHA 3A26A 4MV4A 4D97A 4PC6A 4AQDA 3O8BA 5BUZA 2FN7A 5CFPA 4WHMA 1OWMA 2AG8A 2YVKA 3CYFA 1RM5A 3IAM1 3ASZA 4F2WA 5M04A 4V0KA 2DH6A 4CUZA 2HR1A 1FSGA 1HDEA 4EHJA 1O4VA 1BVHA 1PLJA 1ZH2A 2AUMA 2HXGA 2RONA 3O0DA 3QHQA 3RAPR 3C98A 1SWVA 3PUVA 3WMEA 3CMMA 1TTTA 5JH7A 5JO9A 4BLQA 1LQ2A 3E5MA 4OA8A 2XYVA 3ZK9A 2WMDA 4RELA 5G53C 1OWLA 4LMAA 5BSEA 1XWWA 2B1JA 1Y1TA 1N9ZA 2ECOA 2B7CA 2QVGA 3IP6A 1L3BA 4X1OA 1WIWA 3N2ZB 4DSUA 1R3DA 1MFZA 1U81A 4D6YA 3FPEA 1E6MA 4HDAA 1I2AA 4KR0A 1MDFA 1Q7EA 3A2LA 3JVUA 4PBRA 1WB6A 5EKXA 5EPOA 5GJWC 4ZI7F 4FNMA 1KYQA 3TIIA 2P78A 1I0IA 1Y1QA 4LY0A 2EC5A 1EWRA 4GP7A 3A1SA 4MLDA 4D1YA 1L8LA 2GJSA 1CUAA 1G60A 1NV9A 2ZSBA 3DTVB 4RCYA 2CEAA 3F6SA 2FRVA 3FNEA 1JJVA 4FOTA 4RGQA 3JSAA 2X8LA 4F46A 3KJHA 4TL9A 1TRKA 5CTAA 5AW5A 5LKAA 3O4RA 4K9KA 1HNWB 1CFZA 1JQJC 2Z95A 2IYUA 4FXOA 1NXVA 3GT4A 4L50A 4NJEB 4LKRA 4PAGA 4JI6B 4ZEWA 4DNOA 1NVMB 2APJA 4MQEB 4IIXA 4OHRA 4LRWA 3DW3X 2Q62A 5JO0A 4Y7DA 5GV7A 2B4QA 5LQCA 2G5GX 1M2HA 2CLHB 2OESA 3R0JA 2EDCA 1KJJA 2Z2YA 3RDPA 4BNXA 1SBQA 1V26A 2X7XA 3E7WA 1MX3A 2B8JA 2VG8A 2DHCA 3GEIA 3HZRA 1ZGZA 2G1UA 4H60A 4J3JA 4L1KA 4TWAA 1AMOA 3LYHA 4AP5A 4S1NA 3C3BA 3OOSA 4MW6A 1QH9A 3G5MA 4KRFA 2DKFA 2ZSJA 4GW3A 3FVVA 4N76A 5C8VA 1T4DA 1TJNA 1D2EA 1LUAA 1JIXA 1G3IA 5KSWB 4ARVA 4RLFA 2AVDA 2YWHA 4ON9A 5IJ9B 4O4LF 3TWOA 1QB8A 3L7DA 3DO5A 3OIFA 5EE9A 3IUBA 1ZI6A 3V4OA 1XZJA 4J0JA 5C53B 3RS8A 3I76A 3U13A 1DKQA 2P9BA 1DPFA 4KLRA 5HMLA 1DUSA 3AR5A 4YUWA 1XA0A 3H5RA 4HVTA 3DZDA 1M73E 3O8QA 4CT4B 4X0EA 3PRJA 3SYNA 1XROA 3IDQA 4J7CA 4TRRA 1R88A 1Z4MA 4NDAA 1XF9A 3DR5A 2H29A 1X1BA 1WPQA 4JKOA 2RGNA 2X8JB 3D0QA 1QK3A 3FPLA 3P9XA 4AY4A 4W1SA 1Z74A 3OBIA 3ICPA 4MAMA 2HOQA 1NXWA 3FA2A 4BZQA 1PFVA 4JBYA 4WFQA 5EEHA 3CCCA 3UATA 4C4YA 4EELA 3U1BA 2NIPA 3IEVA 3TQCA 2NXNA 5CYGA 1CS0A 3JQRA 4PVDA 1YI8A 2D1SA 1AB6A 5KINB 1UDCA 1TVKB 2CLOB 3WK8A 1N6PA 2RG7A 1EXMA 1TX4B 3WLIA 1P1JA 4FZJA 3N86A 2CUZA 3B6IA 2UV8A 1UWCA 3CE9A 3BXOA 1Y82A 2W2NA 4JMLA 4UE2A 3TEJA 4UPDA 1DELA 2PT9A 2YV3A 4F5YA 4FMBB 1ACLA 1W94A 1P44A 2VPWA 3OKCA 3RTEA 3PQ4A 2FY8A 4BQPA 4N9WA 3SX4A 3QA3E 1ZD3A 1J56A 3FH0A 1S8FA 1X8XA 4L5YA 2CHQA 5KNDH 3L8GA 1A2BA 5DM70 2RHOA 4RIIA 3W5BA 3HADA 2JIRA 4LE2A 5K3OA 3FYUB 3OOJA 4ARIA 2O8DA 4WPGA 2NUAA 1SULA 2LW7A 2WUWE 3BZUA 4O2BA 4YIHA 2ZBFA 3EZ6A 1AKUA 4FWTA 2CXPA 2X77A 5HFAA 3OAAD 1JXOA 2HJWA 3VV3A 1XPUA 1QJCA 3VO9A 4B43A 5JQGB 1ULHA 2DQ4A 2OGSA 3E18A 5AXBA 2UZAA 3EGOA 3X1YA 5GOTA 2AKEA 2J85A 1PT8A 1TL7C 3A2MA 2NUBA 1WW3A 3DAFA 4UBOA 1LRKA 3W5DA 1EBFA 1YRWA 4NYMR 4GRDA 4MX8A 4YAJA 2H0RA 3P5BA 2BEUB 2R2AA 3CE6A 4B44A 4HY3A 4S12A 1IZ7A 3CEMA 4MV6A 5EVCA 4CPDA 3A1FA 3GGDA 2C1ZA 5HDBB 3TEFA 2H18A 4B81A 1UC5B 3SF8B 1XZFA 2VDOB 3RC9A 1H2AS 2GNOA 3VYRB 5IYZA 4NEHB 1I6LA 3V32A 1VDZA 3WNBA 4PQGA 1ZM4A 1ORHA 3MGCA 3OM8A 4PPQA 5L53A 2C2XA 1MB2A 2Z3ZA 4EHFA 2QLLA 3QPWA 1AF4A 1Z8HA 3IKVA 1BJKA 1O97C 1OFUA 1LBIA 1OX4B 4AZVA 5AW0A 1YMVA 2ZM6B 5JNSA 2CT8A 1KK0A 3BK7A 2A5YB 3R9XB 1T15A 3NTLA 3GF4A 2VK4A 2WV7A 2VP9A 3Q7PA 4PAOA 1F0YA 1IRIA 3NJ4A 2CK3D 4QL3A 2YIVX 4J3NA 1XAJA 2XUZA 4I8DA 1U7DA 4WKBA 5DX1A 3WP0A 1K2WA 1WDLA 1C50A 1UFVA 3WO0A 2NO6A 3EQ9A 1UKCA 4Z8XA 4UU0A 1R10A 2BCGY 3LA6A 1VG1A 4C4TA 3G2LA 1RE1A 3LT5A 1YBFA 1EUZA 2Y3IA 1I4LD 4WUTA 4GWLA 3UC5A 1P29A 1NQOA 1LNSA 2GK6A 1QYVA 2HMYB 4XVRA 4ZYXA 3G5AA 8ADHA 2H07A 4DKXA 1RCTE 3FRHA 1GCOA 4XGKA 4XE5A 4EGJA 5B2FA 2Q3FA 1TA9A 3WXMA 3HEBA 5B4UA 3LVBA 1XHEA 2O2DA 3PE6A 3HO6A 3QUTA 1JG7A 5EZYA 2FG5A 2H8KA 2ZYWX 4ZYWA 3T1VA 1Q3TA 3O3MB 4M1OA 2C84A 1C1XB 2BW0A 1VPWA 4TL6A 5TQ0A 3AY7A 4KKXB 2DKOA 1X7WA 3OECA 2NG1A 1P33A 4PR0A 4XEHA 4XWGA 4RD3A 3N8IA 1Q19A 4XWTA 2QL5A 1U63A 3FZQA 1RQLA 3CLHA 3ROGA 3GGCA 2GLUA 4PLHA 2FN9A 4YH1A 2ZR8A 3U3KA 5LC1A 1ZJ5A 3VPAA 2J3EA 5K09A 1MIOB 4HDRB 3TJRA 2XWPA 1QKKA 4BN4A 4C1BA 4TQAA 1LJ8A 3ITKA 2DJ5A 3EAQA 1N5MA 3FR7A 3HWRA 4IL5A 3ZIAD 1O97D 1X9IA 1KS9A 1NLYA 2HDHA 1BVUA 1P2VA 1O1YA 2AKAB 2GILA 5SYNA 3RIEA 2ZCJA 2QIPA 5IXYA 1ZK2A 3DCYA 4K3VA 1U6KA 1I3MA 4OXXA 2ZITA 5I9TA 1Z4KA 4YPOA 3ZV5A 1QH0A 5DH9A 3KYBA 4R31A 2C7QA 2V54A 4TT3A 2QUBA 2QTRA 3WNVA 3PPIA 1M8GA 1CQZA 1VGRA 3RS9A 4HZIA 4XX0B 1Z0IA 2PR2A 3TCKA 4GP9A 3SPXA 2UVPA 4HWRA 1VMAA 3CEPB 3EPKA 3AMVA 4U7GA 2JRLA 5T6MA 4F04A 5H4HA 1Z5PA 1EWVA 1O5IA 2C03A 4QYTA 2V0CA 1PP4A 1YQGA 2YNMD 3TQHA 3VJMA 3LOQA 4MI6A 3ECCA 4UD6A 3W9SA 3DL2A 1NBAA 1J24A 2VN8A 1W4LA 3IALA 4P08A 4EG5A 2EF0A 3N74A 3GVHA 5JH7B 1DQPA 3KE9A 4G9BA 3DMDA 1Z06A 2AXNA 1DQZA 1S3GA 1XTZA 3O1JC 3WGQA 1G6Q1 2GAIA 4IMIB 3RVNA 2O2EA 3TEMA 3CWCA 3G1TA 1N6KA 4MUXA 5KYGA 5SY6A 3K9HA 2WWHA 3L49A 1B15A 3FOAA 3GN2A 3QFHA 1FFEA 2BSXA 3ROMA 3RYFA 3ADBA 2VWPA 3BIXA 4OG2A 5D7BA 3WO1A 3C74A 2Q07A 3IMCA 3OQ6A 5CPFA 2ZZMA 1DWOA 2QY6A 3EZ2A 4UM5A 2KLBA 2C3UA 2KE5A 3B6MA 4HVAA 2QX9A 4ANFA 3H2KA 4DLVA 2ZS8A 4DAEA 1T5LA 3PWKA 1A4IA 3QVMA 2R25B 5HKKD 4FEYA 2C99A 2F1HA 4CF4A 4CM9A 4LBYA 2V6FA 4WADA 4UDOA 2ZYTX 1JVSA 3GVPA 4V1CB 2HUNA 4Y6GB 2O4UX 4UUPA 1NUTA 4UCFA 3IOCA 1PNQA 2VDWA 3T94A 4PYOA 2BFEA 3EVZA 2AMVA 3ISVA 5DBHX 3FY4A 1DVRA 5EPEA 3TBKA 1OYWA 2HWYA 1RTKA 2JS7A 4DSTA 1QIKA 4NMXB 5ALGA 3WKCA 4C7JA 1FSFA 3RUCA 1BDMA 4O1HA 4I9FA 4F4HA 1KAQA 5HMMA 1N7HA 3J80A 3VMFA 3HJFA 2ONKA 2JH3A 3GDFA 3HYSA 4OFWA 1SOAA 5DGHA 1Y6JA 4GBED 2EZ8A 3WL5A 5JWOA 4D9GA 1E9RA 2B5VA 2WAAA 3NKFA 2HK7A 3OIGA 3CRQA 3I2GA 3JQ9A 4R71A 4Y2RA 1I30A 4UOQA 3D2CA 4Z8YA 3PDIA 5DNCA 1FNNA 3QMMA 2B36A 2VDQB 4OH1A 3R1IA 1TCAA 2B1GA 4QULA 5FHQA 2PBZA 4WXMA 5C8YF 1SC3A 3I12A 1TJ4A 2ZRDA 2ZVJA 3CTMA 3HG7A 5EQFA 2WSSD 4ZQEA 3QXJA 4DG9A 2XTJA 1YE8A 3BC1A 3RUEA 2ZIUB 4DT1A 3O8QB 1EJ6A 1RSZA 2Y4NA 4UBJA 2V9PA 3UXMA 4F5DA 3GNQA 1ZSNA 4ADSG 3RS7A 3I2HA 1GUBA 2CLSA 5DB4A 4QT0A 3EEIA 3QXXA 2ZSUA 3QU4A 2IXDA 3GLFA 1HDGO 2DBQA 4OXIA 3DS8A 4ZOLA 4ES6A 6ADHA 1R6AA 2NN3C 2JGFA 3C3MA 4OSEA 3IDAA 4Q6WA 1L5VA 1TCUA 1UZMA 5EJMA 1QB7A 3STYA 3LIIA 1M0EA 2Y1KA 3TL6A 4H7IA 2C8LA 4ZCTA 1LVGA 2CVZA 4IRUB 1CS0B 3ZWDA 2GZRA 4LJKA 3PQ3A 3K70C 2DFLA 4F3CA 3AGQA 1JHRA 4X66B 4KU4A 3JQGA 4Q21A 2YASA 3WTBA 4DUZB 2QJTA 5EJGA 1ABBA 4RY9A 2PUHA 4J6FA 1BA3A 2Q6TA 2JJMA 1EXDA 4CTOA 5LNK1 2QG6A 1HSZA 2DAPA 2VBGA 1Y3FE 2DR0A 2B7BA 4H18A 1I10A 3JPWA 4Q1FA 4HUTA 3TNFA 2YDYA 3DWIA 4MYTA 5CBPA 3P45A 3DDCA 5JNUA 2WAMA 3FW1A 3UW1A 1GGKA 1QG4A 3L2OB 1DC3A 4OVKA 1RWXA 2PU7A 1G63A 3F6CA 3VSBA 5JEDA 2XCLA 1WPXA 3TSCA 2O8DB 4TLMB 2YHBA 4H7EA 5G0TA 2EP5A 2NUAB 1K75A 3JYPA 1UINA 3B1FA 3A28A 4LI0A 4W5WA 1B41A 3OQJA 4Q3NA 4CKBA 2O54A 5LZ7A 3DV2A 4YV7A 1Z18A 4LTMA 3UAWA 2HBZA 1L1FA 3ZDCA 4Q1EA 1A8SA 3H1PA 3STUA 4EKIA 3B2NA 3PUKA 4KRYA 2GKSA 4RF2A 4CM7A 5DLDA 2R5NA 3QVXA 2PGIA 1D03A 1YJXA 3S2EA 3L6CA 1VDMA 1QO0A 2LIPA 2JGDA 1T5SA 2AS0A 3LUBA 3MCWA 5KSPA 1UF9A 2HD4A 4KVGA 4O4HF 3X44A 1QR6A 4BEWA 1ZRNA 1DKUA 2R1ZA 3E23A 1W581 1QP7A 1DB3A 5IUNC 5E2AA 3TD6A 4GBMA 1SVNA 4HAWA 1A9XA 1VP9A 3OTIA 4KODA 5IYZB 4DC9A 3U4GA 4OU4A 5TEWA 1QZXA 3VU1A 1MAWA 1NAIA 5IMSA 1J42A 4QPPA 3GEHA 3I73A 5IDQA 1PYDA 2A7QA 3NTXA 4RV4A 3WAGA 1VCMA 3N6VA 3IGFA 3H5TA 4EI9A 1E63A 5FBLB 5FOTA 4YJ3A 1KFBB 1PS0A 3KDPA 3I6MA 3LA8A 4XM2A 3RSFA 2QN6A 3OZUA 1R5BA 4L9AA 4Y6OA 1NN1A 2IHBA 3BXXA 1Q0HA 3N8GA 1XYYA 5LZ5A 2IXTA 3E8XA 2PKWA 3TTSA 1T2EA 1M76A 1OXMA 2XRYA 1NG9A 5DBGA 1USWA 2O52A 1T8UA 1MNAA 2RKWA 2GF9A 3IMKA 3M81A 4YMLA 1DBVO 2NXEA 3BS4A 2LCQA 3E7FA 3BHJA 1QPZA 3KV1A 3CLSC 3AJEA 3Q10A 1ZR2A 4C89A 4XM0A 3KYJB 4KWTA 3CV3A 5D3MA 1WF3A 1AXEA 3ADCA 2JDIA 2VP4A 4JEMA 1HZZC 1VKZA 1UBCA 5EC8A 1JU4A 1UQRA 1CY2A 4X54A 5F5XA 1B3BA 1C81A 4I9NA 1BN6A 3HGTA 3F78A 2IXGA 2C3PA 3IURA 2DUJA 2WSYB 4IXWA 5LP1A 3PTZA 3EAGA 3QPCA 3KU4A 1Z3IX 4JOBA 3P32A 4N6OA 3ZK8A 4FN5A 2OORC 2IXAA 3R7DA 4YT8A 3O6VA 4BAUA 4DAOA 3G7UA 5ITZA 1NZDA 2GN1A 5EZYB 3GYGA 2D1QA 2RHRA 2GBCA 4M55A 2REQA 1P61B 3EFEA 5TQ0B 4RVCA 1NOKA 3K1AA 1X7WB 3L6BA 5FUBA 3BA1A 4ZVUA 1I8TA 2EHJA 2ZCUA 1N6OA 5GOZA 2HRBA 4XVCA 2FZEA 2XMQA 1O94D 3SK0A 1WETA 1JIUA 5KI6A 4B8YA 1Z16A 4ZYUA 1A77A 4J91A 4DIUA 4OM8A 2VT3A 1CLUA 4Y2TA 1O03A 2ZPAA 3PNSA 1LLCA 1TUIA 2P6NA 4H7PA 3RH0A 2XZOA 1M5TA 1BFKA 5THQA 3A9WA 5CVTA 2JFZA 2A86A 3RJMA 1QAOA 3R23A 2HFJA 3S2GA 1P8AA 1G9XA 1PZMA 5HIKA 1XMOB 3IAUA 4KXNA 4N0DA 5K4GA 4PZ9A 3RS3A 3BCHA 1E3LA 5B7QA 3KR9A 2BUCA 2RBKA 2EERA 2FOIA 3AINA 2VH2A 3LHKA 3Q1KA 2G28A 4PEVA 4WDQA 3EOBI 2VHUA 3C5CA 4F2GA 2XKKA 3LFHA 3SU8A 1OI3A 3T3HA 5HOQA 4R8SA 1IXSB 1SB8A 2FEOA 2EWMA 4F6CA 2C59A 2UVPB 3Q41A 5FUWA 2WSMA 1WCYA 3NBMA 4HWPA 3OP4A 4YNBA 4PG4A 2FW6A 1RVV1 5AD1A 3DBOB 3GPCA 3I5AA 1WXEA 5AM5A 2QVXX 7MDHA 1O5TA 3G5UA 4BFWA 1U1DA 1U3TA 4KW7A 3LWZA 4LX8A 3FWKA 4C2BA 4PO1A 1DG1G 2CZGA 2YW2A 5KQLA 1TYZA 5IT0A 3NX4A 3QUAA 3VNBA 3VOTA 1DEXA 3TAXA 3RFUA 2BCEA 3EHEA 3EUAA 4I4CA 5DNDA 2RHTA 3IFSA 4XR9A 1I1HA 3PLNA 1Q0LA 3AL3A 4G0VA 1RRGA 5IKXA 3KHKA 2VJQA 3ZPXA 2IU3A 2IYTA 4E21A 5CNKA 3L1KA 5AVYA 2IZ7A 4UNIA 2AI3A 3RYFB 3H3FA 3UMRA 1UZAA 1ZVVA 1BFDA 2GT1A 3TK1A 3VO8A 3ZS8A 5KYXA 3BBPA 1ZHOA 4G4JA 3QLTA 2EWVA 1ZM3A 1RXSA 2H7YA 2QF7A 3IJRA 1MVNA 3OC6A 4QGGA 4EA7A 1N78A 3AUSA 3VU9A 4NENA 1VKHA 4R3WA 2QLNA 4EY8A 4DCTA 2AX3A 5E4TA 3QHPA 4ALNA 5KYUA 1T2CA 1A8PA 3OZWA 3OFSA 3ZXSA 4QZVA 1OB5A 1E7WA 4GI3A 1GNRA 3DWGA 4BE9A 3TSOA 3KQPA 3HVIA 4GLLA 1T1IA 4K26A 2PY6A 1UOQA 3IBTA 3SEFA 3D1JA 4ZAWA 3SQMA 1RCUA 1QFXA 2IPAB 3KKLA 2C5HA 2BFEB 3H2IA 3RRFA 2DETA 1CRQA 3WK7A 3TDMA 2CJFA 3KFVA 4A6XA 1ZMTA 2OV1A 4ZTZB 1D2HA 3UOWA 2NO4A 3L84A 2QAJA 2POCA 4NU5A 4E03A 2B0JA 2AZXA 3OTWA 2DWCA 4EKEA 3DOCA 5B30A 3UN1A 5LPNA 2PLRA 2UKDA 3KVOA 4KN8A 4BFXA 5K3EA 4H0FA 2QMOA 2QI9C 2SKDA 4LGCA 4M21A 2DR2A 1DIOB 2J9XB 3G0CA 5HFJA 1ZI9A 1EJ2A 3PNPA 4OHUA 1DUVG 4TSFA 3LMKA 5J40A 1H8HD 5HG0A 3K71B 5E7IA 2RI1A 1BGXT 1UT6A 5DM2A 4ZYZA 3PUZA 3PDIB 2W6JA 4MYCA 5G1PA 2J3HA 3ZDRA 2BZ1A 2PKQO 3CNBA 3EXIA 3GFTA 4A7PA 2LPMA 4IGKA 5DIZA 4DWOA 1PSDA 2IA5A 1AKRA 5JASA 3AEKA 5LYJA 2COUA 2FEWB 1VA4A 1LKZA 4YMWA 4DT1B 1XZNA 4EY4A 4X8LA 4B40A 1E0JA 1ADJA 2I80A 3B6KA 1WF6A 2IDMA 4BATA 2Z08A 3TQSA 4BU1A 1L5QA 1B42A 2O3QA 1LTQA 2ES4A 2YV5A 3M82A 3LQ2A 4HAZA 4MB6A 3VHLB 3GLFB 5FRDA 4IYJA 3G9TA 4ZOLB 5IBRA 1SH7A 3GEBA 5HBGA 4L5AA 5BN3A 5B1DA 2VPYA 3G9QA 1X19A 4WK6A 5AKXA 1TE2A 1HI9A 3D6HA 4XARA 2XKBA 3LXRA 4WA8A 4DMRA 3W4KA 4HYQA 2CNDA 1H05A 3IELA 1J4AA 4H7DA 5AIBA 4EGFA 3EDOA 3KSZO 4PGGA 3BGWA 2C5BA 2WF5A 1WDMA 3JQGB 4HQ6A 2ZIFA 4IXDA 3VKFA 4JP5A 1GFZA 1GGEA 3S1AB 5K5EA 4GRIA 3VH1A 4AURA 5KNCH 3LUGA 3VYVA 3GCZA 1GILA 3IP3A 2XB4A 2O7NA 1IM2A 2FLVA 1RQGA 2PWYA 3GEDA 1U80A 1NY5A 3MAAC 1ENYA 1RJEA 1Y6RA 3G49A 2CXXA 5CBPB 2ZIXA 3DUFA 5AUNB 1GAJA 3H04A 1XDDA 2A14A 2J5KA 4JLMA 4WJKB 1NIPA 3WGTA 5C7LO 2HGZA 1XQYA 3MB8A 3PHIA 3RGGA 4PY2A 4FYVA 4EBFA 4ZJZA 1ZN8A 4B6JA 1PS9A 2GEVA 3ABRB 2HWXA 1DQRA 5J4HA 1Z0FA 1K6XA 2KMLA 1QDLB 1BHQ1 2VNJA 3MLBA 4IIFA 1WHSA 4YP1A 3VPHA 4B6QA 3S8MA 4CKBB 1OQAA 5JC1A 2YN0A 3T9DA 4C4ZA 4D57A 5CH8A 5BVHB 3W6NA 2UUAB 4WVFA 3AETA 1LSUA 3DSRA 1ENOA 4FVTA 2J32A 3GFBA 4MWBA 1YL6A 2QT1A 3ADKA 3IVRA 3MBOA 3E82A 1J0EA 4ARUA 4GYWA 4B87A 1E2NA 4NCNA 1VQ1A 4Z86A 3GD7A 2JGDB 1JKXA 1M67A 4NRDA 3GRYA 3IKJA 1K4KA 1KNXA 3V48A 5IEJA 3P2OA 2VNKA 3DCNA 1E2MA 1A4UA 2C4MA 3LJKA 2N1MA 3LYAA 4OPMA 5TC4A 5J3JA 1A9XB 4KR2A 1XRRA 4JXZA 2UUOA 3NIDB 4IH4A 2H7CA 3DE2X 5ETJA 3T1HB 2A0YA 3R4CA 1ZVMA 3UJBA 3FD8A 1C0IA 2CCKA 3GRUA 4CEJA 2JGAA 5JY1A 3VNUA 5FA5A 4G24A 3TIXB 3N2GB 1ZLYA 5JC8A 4HQ0A 3HYRA 1DTSA 2IZOA 4YJ3B 2AE2A 4RVHA 3TO5A 1M2OA 1UK9A 3BVPA 1UBUS 3BSYA 5AM4A 1S8NA 1TMYA 4UUBA 1JHXA 3MTGA 3CVVA 2LCFA 5K0CA 2P41A 4EKYA 4P4NA 4L5CA 2A2ZA 4B3MB 3HKDA 2GN9A 5E6RB 3K0KA 4U2EA 1V5EA 1C4OA 2PSEA 4MVJE 4NYMQ 1YGPA 1QVRA 3HABA 1K66A 3TSAA 4YMHA 1C9JA 1LRJA 2I4NA 3WYAA 1KJQA 5D3MB 1XMPA 1WA5A 2OXRA 3EQ8A 3O82A 4HYEA 4U7PB 3V1KA 1YI1A 4FYPA 5LDGA 1V7CA 1H1DA 2WZQA 4GXQA 3OTOB 2J67A 8AT1A 3DHEA 3Q0TA 3LFTA 1OWOA 5DHAA 3DZIA 5K0TA 3EWSA 2H11A 1YE3A 2Z2ZA 5KCZA 1W2GA 3PFIA 4MVJA 2JCBA 5FBQB 4CM5A 4YDSA 721PA 2VQSA 1APBA 4DEVA 3GOQA 5ITZB 4OXKA 4II7A 3CKLA 1ZAKA 4IEEA 5HRAA 5TF4A 4MUFA 4QXRA 1XL1A 2H4JA 4EYEA 1NP3A 2X23A 2I8AA 3ETCA 3ETJA 3RTAA 3A4YA 4QG7A 1MP0A 2REQB 2XYGA 2DBZA 2RK6A 1E7YA 1F4VA 3K1AB 1BRMA 2VDPB 2XSZD 2YYSA 3IULA 1WY7A 4TS3A 4IHQA 1JR3E 3RSHA 2IDKA 3RU9A 4QXMA 3WY9A 4DKJA 2OCPA 4XOIA 2XAAA 3VPDA 3F4BA 2P75A 3NBUA 1RJWA 4TMVA 1VCHA 3OPXA 2ZVPX 4EYQA 1C0EA 3JQPA 5M34A 3H9JA 2YWGA 4YV1A 3C0KA 1LJUA 1JHZA 4W5RA 3P4YA 3C97A 3TDKA 2FH5B 1IG0A 4D0RA 5AMXA 2HHCA 3RHSA 4EFMA 2HTFA 1ECGA 3VZQA 1I7SB 4M98A 2XRFA 4QFBA 3B1XA 3WA6A 4DN6A 4E5DA 5FFNA 4RLQA 1FVHA 3P9YA 3IO3A 6NULA 5G41A 4YAWA 1RHKA 5CDSA 3A9SA 1KY3A 4IUDS 3HJCA 1ZWKA 1W93A 3EN0A 4MB0A 5FLYA 4B2IA 4KZKA 3K8YA 5CB8A 1Z2NX 3HA3A 3IESA 3ZHUA 4Z2AA 3O4GA 4XGRA 1TQHA 3K9WA 5H8WA 2COEA 2VTVA 2C78A 2HV9A 2QD4A 3SBEA 1N5JA 1NW5A 3PX2A 4IHJF 2YCBA 4BKPA 2JKYA 4Y1RA 4AW9A 3QSYA 2WJPA 3IEIA 1R8YA 2KYRA 1QV7A 1BOFA 4ZAZA 3RAFC 1Y6FA 4P35A 2OM6A 2XKAA 5EP2A 3SIPA 2IOFK 1L6IA 2C7GA 3CUUA 3C5EA 2X9VA 2G06A 3DZHA 4Y2JA 1TA4A 3HSYA 3OD5A 5KYVA 2E82A 3I2FA 4M1WA 1NR5A 1LNZA 2A6PA 3JQCA 3G2NA 3BILA 3OQIA 4ITUA 4JT9A 2QQFA 3SQLA 1GR0A 3L0IB 3RS4A 2NTYC 2O0KA 4CIDA 2UZ4A 3K9BA 1T4BA 4L02A 4FXPA 2BFAA 4LUCA 1L5FA 1VL1A 3C41J 4TXJA 1K3TA 1MQSA 4PBSA 3G0GA 2ZRGA 5A3VA 1U3VA 4KO3S 5K6RA 1KFKB 1VSTA 5AVXA 1ZD5A 3AY6A 3TECE 4LCBA 5EGSA 2FQXA 3HA7A 2LXNA 2PMFA 3L8EA 4MV7A 4XAQA 5A3SA 2OXTA 2PE5A 1BVYF 3PC8A 4Y1EA 1OBOA 1DXHA 1XMJA 5L7WA 2FHSA 5JRZA 5DM1A 5F5NA 1SN7A 1PEYA 4P22A 4NENB 4FTWA 4IMJB 2ZUUA 3OWXA 2IY7A 1TAHA 3AP3A 3GCWA 2BN4A 1Y80A 4GR9A 4AJ2A 1DP4A 3ANTA 1NM5A 2H9IA 4YMUA 3CZ4A 3THRA 2PLNA 1I3CA 4DWVA 4KFCA 4XFDA 2HSWA 2C7RA 3GFSA 3WRXA 4ZEVA 2JK0A 1IN1A 1IWOA 3RRJA 3VHRA 1A5ZA 2VHJA 4IZIA 2IYOA 3NW9A 4UNQA 5HE8A 3K8ZA 3P9NA 4ZTUB 5LIPA 3PQDA 4R41A 5JZVA 4D0GA 3A3OA 5E9QA 4E4TA 5ISMA 3V4VB 4RTSA 4QUDA 4MYHA 1TLLA 3ZW7A 4E1VA 2G6TA 4ER5A 2W2VA 2FOLA 3V4RA 3HNPA 3FTDA 2KHZA 4RM2A 4EA8A 2HL6A 4E46A 5HVNA 1NAHA 5K05A 3H87A 1JLHA 1KP9A 4P3PA 4RO0A 3V1LA 2O7VA 2ZDQA 1E61A 2PKQP 2PWPA 4Z7NB 1I3NA 4CFYA 2DSTA 2I2FA 2YIJA 1QCDA 5HFNA 1MF7A 4AZTA 3L0SA 2W00A 3EXIB 3N7UA 3ZCTA 2P4QA 2FWNA 3A6JA 2OCGA 2X8AA 3QJGA 4B3CA 2AFHE 2VT7A 3AEKB 1IOZA 1XTPA 1PTJC 1Y9EA 4XIFA 5KJ1A 5LYJB 4S04A 3T5CA 3HBLA 3JWIA 1U0FA 3I9FA 1WAMA 3WGUA 4KPUA 5ER9A 3DEFA 2E4UA 1X1CA 1LS6A 3DVLA 3VVMA 3OT4A 1CT9A 3BRCA 1Z5NA 3OMWA 1UDBA 3PDWA 4AO7A 4NH0A 3KEQA 3TBHA 2AFHA 1ZC3A 1V4VA 1Z8NA 2DGDA 4LY3A 3R8XA 3F8TA 4PC3A 3X1XA 3G02A 4EQ6A 5BN3B 2YKGA 4NOKA 4KR6A 1K27A 2E85A 3AKZA 1YS2X 5EMHA 5A3JA 5I8PA 2DB3A 4L8YA 1HY3A 1BCSA 2Q7XA 3GJ5A 2R6R1 3LKDA 3TS1A 1RD4A 1FJXA 4EX7A 4YAUA 1ODFA 2QD1A 3L7IA 1RU3A 4O63O 1PHRA 3MVEA 2CFIA 4L15A 4UW9A 5FPYA 5BSWA 2CBXA 3OZGA 3ICOA 3BAFA 1E3TA 1DFGA 5EJ6A 2PRZA 2ZI6A 4L8LA 1RI1A 2EQ5A 3HJHA 1OIVA 2Q5CA 4HADA 3OT5A 4RPHA 4G65A 3PX7A 2XQJA 5AP9A 2AFRA 3RIHA 1Q57A 3PHLA 4JLWA 2V7QD 5JZMA 4NG4A 2ZIXB 3DUFB 4C0BA 2RJOA 1OU4A 2CFCA 4AWXA 5IC4A 4KXXA 2PG3A 4JZKA 1CUGA 1TTQB 2CB0A 3SLKA 2OILA 3ZHRA 4H0NA 4UQOA 3W7AA 5JG7A 5JFGA 2WHPA 4H08A 4KX3A 2FLWA 4KSBA 5ALOA 2XD4A 3EX7C 1YQDA 1PSWA 2HSDA 2V97A 3F5SA 3MRVA 4XYLA 5CDUA 3C43A 1I14A 1AUOA 1II8A 2WM9B 3TKLA 3UV7A 2HMSA 4CQLA 4D4IA 4ENTA 3TVTA 5K2OA 2WIJA 2VHYA 3EFOA 4C0XA 2QUZA 4NEQA 2PL9A 5C2JB 1OW3B 3JSXA 4GZ6A 2FETA 3K4QA 3TBFA 3C4VA 2YQ5A 1TO2E 2NTNA 1X7GA 3Q87B 3U56A 1U5AA 2B6NA 4QASA 4WTOA 1LDGA 2AMLA 3RJTA 1LX6A 2OBMA 1YB4A 3PRKE 5CG2A 5KWJA 1E4OA 1JDVA 5BY2A 3RI3A 1DT5A 1K8ZB 2RH8A 1M6NA 1UQUA 3OWHA 4NY1A 4QHSA 5FL7D 4CEJB 3WL3A 1LVUA 4PYRA 1GDHA 3TQTA 2DXIA 1FTSA 3AC0A 1RRPA 3LXXA 1P5HA 4LE1A 4Q6BA 4YLYA 4PM4A 1E2KA 1E0KA 5IU6A 1XQ9A 3G2OA 1M2OB 2JEZA 5JAPA 1ZXLA 2HDWA 3A04A 3PNLA 1T9GS 3PYLA 1XVLA 4HRVA 5EXSA 5CXXA 3GC6A 2B4TO 2H1IA 1VL5A 3HKDB 4L74A 2Z8XA 4PF1A 4LHSA 2VAVA 1TF2A 1DADA 2WTEA 4B2PA 5KHOC 1YHYA 2XNKA 2XMDA 3GZTB 4YPVA 4RIHA 5CLFA 4Q9HA 2IHNA 1KYZA 1XC7A 2ROQA 1XZ8A 3COJA 1OF1A 3KEMA 3LDGA 2E4ZA 1PFWA 4QFDA 5F7JA 3EQ6A 2BJWA 3C1OA 3NKLA 3JYNA 4D56A 2BGJA 4NPAA 4QATA 3BTSA 3HVHA 2A9VA 2IU6A 2I6XA 3EODA 3M9LA 4YJFA 1FEZA 3NHPA 1ZJZA 2AWNA 5AVWA 1H94A 4NI5A 3WV4A 2W90A 3HU1A 1XEWX 4LV6A 2FE4A 4LF5B 3IDSA 4FMPA 3CJTA 2DLDA 2G09A 3DAYA 3ILHA 3U9SA 1W1IA 5FPPA 5LQUA 1ZJYA 3KWMA 3WLKX 2EYUA 1N7GA 2PVSA 3KWJA 5H7XA 3W7BA 5JCJD 1AKTA 3AR9A 1PNOA 3M6LA 5DEIA 5LQAA 4G36A 2IY9A 4YECA 3D7RA 3T1TA 4BMCA 3CN7A 1X94A 4JP1A 2WYWA 4A15A 3KBBA 5TS2A 4TYWA 4F4FA 4CLRA 1NHWA 3W6UA 1KQNA 4XQEA 4L9SA 3B3QA 3TZKA 1CJTC 3ZU6A 3W5SA 5AI0A 5A9TA 1PIWA 1PQ4A 4CU2A 4MPJA 4L7QA 1CY4A 4HNAA 5KAPA 3X1JA 1W5FA 4OUDA 4O5OA 5KVQA 2PH5A 4A8PA 3VO2A 1U6IA 3D81A 3V6MA 1IATA 3NRBA 4QBGB 4X94A 1GTJ1 1HG1A 1PQUA 3P27A 5H1YA 4BPBA 4L5JA 1SMKA 3Q3VA 3VRHA 2XLBA 3A2NA 4Q4AA 4DEYA 1KO5A 3GGOA 5E9AA 4A8HA 4J07A 1V35A 2I2WA 2Q99A 3E5NA 1T8RA 1Q16A 1GADO 1KDYA 5IM4F 3E3OA 1F60A 4JLPA 2AJTA 4ZOBA 2OLKA 3W2FA 5IT9A 5G40A 2VFAA 2WHEA 3BMQA 4EUSA 2BGWA 3K8QA 2Z43A 1BEZA 3PF9A 3ORRA 2UZIR 3AERA 4CF7A 3A6PC 4GL2A 4BOYA 4Y1RB 1F4LA 3BULA 5DKFA 1N92A 4Z9FA 4DJAA 4N49A 3TD2A 3QKTA 4WJLA 1V8FA 2CL7X 2PD3A 5J1SB 2D0IA 4RQUA 3R7FA 3L7YA 4UUOA 2ZUVA 1P1HA 3ILXA 4MHOA 2X0RA 2CF6A 2QX4A 1Q77A 2AN4A 3ZTYA 3OQIB 2JLVA 4MV0A 2F17A 3S40A 1AGPA 1SUFA 3FCOA 1K3FA 2TYSB 3AM4A 3GGJA 1T1SA 2GNPA 1DAHA 1XJWA 2GR9A 2PIDA 3N3BC 2J9ZB 4AN1A 1ZBDA 1E0DA 4RPKA 5CK4A 5DULA 3UCXA 4EKNB 4KI0A 4K6HA 5IDYA 4XYBA 1YVDA 3UANA 5LD2C 4E5KA 2ZAOA 4F6RA 3NOQA 3M1LA 3GJYA 2XUDA 1LPSA 1WDKA 5IHXA 3VC2A 4WASA 5C9ZA 2XOKA 2JZOA 1QIDA 1UQTA 3QE3A 3PS9A 4KN5A 4R84A 5DHFA 1KOLA 1DZ3A 5AVSA 5JV5A 1J2JA 1N1DA 1T43A 2X2EA 4IH1A 2R1UA 3SC4A 4ND7A 1NN3A 3DE7X 1U1EA 2DT5A 2EQAA 2PL3A 1V3VA 3IYLW 6REQB 2CKDA 2ODPA 2WWXA 1VTKA 4RC9A 3GJ0A 2V6JA 3GUCA 2P4HX 1CY8A 4KXVA 4E5UA 1Z6AA 4NAHA 3TR6A 3IOEA 1QZTA 3TRIA 4Z51A 1XTJA 3GBSA 3CF0A 4JITA 2O5CA 5EHQA 3QW4B 1QU2A 3SF0A 3E53A 3C6BA 3U3XA 5HUHA 1OI7A 5JARA 1TK3A 5T4BA 4JUBA 3O9ZA 2GHIA 2GEBA 5KPJA 2BGIA 2I1LA 2OZVA 2IYVA 3N8KA 4FQ5A 5ILGA 2Q7DA 1PV1A 2FMTA 1ZKMA 3AFGA 3THYA 4OJNA 1JQ5A 1KSHA 1OC4A 3C24A 4NXNB 3AVUA 4ODIA 3VTFA 2GSWA 1LB1B 3CUEF 1HH4A 3IMGA 5K4AA 3WK5A 3MCAA 4C0KA 1FMTA 1WP9A 3NHRA 4BBJA 1DI0A 1YNOA 1LVHA 1KQGA 1N3LA 1XKXA 1QG0A 1XRJA 2G8NA 3M89A 1S8AA 4RD0A 1SOMA 2FMFA 2HJRA 3K9NA 5D1NA 2G83A 4D25A 3EUFA 3ABOB 4KPUB 2FP3A 2QTFA 1A9QA 1OZFA 2GQ0A 3N87A 4ZVRA 5HRCA 2VDVE 1R15A 4INPA 5CT8A 3ZWVA 2DFVA 1U5BB 4QUJA 2AFHB 1W49A 4IEFB 1G2IA 3AK4A 4X90A 4EQ6B 2G08A 4UHEA 4CG0A 3GA5A 1XA4A 1RXEA 1HRDA 4WOJA 2VC2B 3VR5D 1Q6ZA 5G1NA 1WZUA 4QBIA 2Y1OA 3KXKA 2BHSA 2Q1TA 1BCSB 2AN5A 2NZXA 2P2NA 3MTEA 4HRXA 4CETA 1WVMA 4WQMA 1C1DA 3ETNA 3IAAA 1QTQA 1REQA 4LY9A 3T4XA 3P4UA 4JBLA 3V34A 2DT8A 3RYHA 1O89A 4MCIA 2ILVA 1QVZA 3C8ZA 2BE9A 5BMVA 4KAXA 1L3IA 4C7MA 5C1DA 4K2HA 1I7QB 4EO9A 5H82A 4X3OA 3DDSA 3SGLA 2AG1A 3AVQA 1C7ZA 4MUIA 4PE5B 3OQMA 1MB0A 2FZ5A 2PS0A 3JZFA 3L93A 2OHXA 1US8B 2PRSA 1PFUA 2Y6VA 2XMRA 1OIWA 5JMOA 1X3LA 1FNMA 2CK3A 3DD1A 4FFMA 3FNHA 3PFNA 3PJFA 2C9CA 1CFJA 1Y1SA 1ZGJA 4ZCIA 5FNVF 4JCCA 2WHPB 2PGDA 2CSUA 3MK31 4A2WA 1R12A 3ZEIA 4HXEB 2FZKA 3LBNA 3PWSA 1R64A 1VJ1A 2WUVA 2IS1A 4RMNA 2XT6A 4XTCS 1WZCA 4NBLA 1JRLA 2OCIA 3NC1C 3HB4X 1XZQA 1YA4A 4KBGA 1II8B 4TSKA 1GRVA 5EJFA 4CRWB 1Z8FA 2YWXA 1V3UA 3R3SA 2GN8A 4CQLB 1HL7A 3W5HA 1BU5A 2BSQA 3MMNA 2Y0DA 2QS9A 1E20A 4DDUA 2GN4A 3ZKAA 3EFOB 3NR2A 1FBNA 3UKOA 4DUPA 3FM9A 3IQZA 4KREA 1OH5A 3CRMA 4KEAA 4TXNA 1XVTA 3M6MD 1WMFA 4O2RA 1L5NA 3OZIA 5BYJA 2NVOA 2OGTA 3E4DA 1SO8A 1AS0A 3KSRA 3ZQ4A 2PT7A 4LVOA 5EESA 2E4XA 2VPIA 4JJZA 4LWPA 3VJKA 2JI6A 1NT4A 4DMFA 4I3HA 3CNLA 5L51A 3EAFA 4NYJR 4U6QA 5IEBA 3UT0A 4BO4A 3ROKA 3ZQJA 3FI9A 3NETA 4C6HA 2OM2A 4L3OA 3V9AA 1CCWA 1PVOA 1N9KA 4O59O 2AQKA 3ZIAA 3EVEA 1T24A 4RY2A 3RG8A 3RKUA 4JROA 2GAAA 4M36A 4UHKA 3V8PA 2AF4C 2YJ5A 3E7PA 1ZNXA 2W43A 4OX9B 1UK6A 4YUAA 1XL0A 2CYCA 1X7XA 3SJUA 4DREA 2GX6A 1EESA 4PX2A 1CZUA 3GLVA 3BE5A 1NQWA 2GJ9A 3LLSA 5DASA 5THKA 4QUEA 5HKBA 3IJ5A 1IE3A 3BGSA 4YO8A 2OA0A 3U16A 3D4OA 1ES9A 2OCDA 3NZEA 2QTNA 4X3CA 2ONJA 3WLPA 4O5AA 2J5RA 4DW8A 2QE7D 4JVMA 2RGXA 1X70A 2M6RA 4FFPA 3K0HA 1JS1X 4WY8A 2IP2A 1U8ZA 3IHWA 3N75A 1FLAA 3SVZA 1WCXA 3B1KA 5CK5A 4D9MA 3VKVA 4XD2A 1NL3A 1I3OA 5AH0A 4F4CA 2VDMB 4BUCA 4RTPA 4YJFB 2GUWA 5BV1A 1YAHA 1RYFA 1YRLA 3PUWA 4WLEA 5FOXA 3UAXA 1E59A 1GZ5A 3GZ4A 3I64A 1DIBA 4KAJA 2OO5C 4YRBA 1RYEA 2YYYA 4RHFA 3TYXA 1KARA 3D6VA 2NP6A 4JQSA 4N18A 5C5DA 1ZXBA 2EP8A 1KIMA 1F14A 1XMSA 2RCYA 3IUSA 4FLFA 4RMIA 4OB8A 4MICA 4BJ5A 5D86A 2GI4A 2ZTUA 3G2MA 4MKFA 4B47A 4UNRA 2HBRA 3OQOA 2GXAA 1THMA 1V8ZA 2FVXA 2Q2QA 4C76A 1C3OA 2JZNA 1T6BY 3Q85A 5IF3A 1Q1EA 2QRJA 2Z56A 3PVSA 4OJYA 2CF5A 1QQ6A 4BIIA 5TQVA 4BX9A 4CLRB 4N5IX 2PQ2A 1R0XA 3CU5A 4NK4A 4OM7A 4B35A 5EJEA 1FX0A 1EX7A 3IRVA 5FL3A 3GCGA 2B98A 4P4UA 3ITDA 4RBNA 2IBTA 3BRQA 3NOXA 2ZEJA 4L5IA 4OIFA 2A59A 4HNAB 3W3AA 3BTUA 4AN4A 4OUDB 5FBWB 2XUKA 2FMUA 2WQZA 4KXMA 2VTEA 1GL3A 1VIVA 1Z0JA 2IQIA 3DFIA 3VPGA 1H0RA 2HCTA 3R44A 5EIOA 1WKBA 1JKMA 5H81A 2H2HA 3IT2A 4EUHA 1W4BA 4NU0A 3UPTA 2UYQA 1O0BA 3AL0C 4D79A 4CTKA 3HK2A 3E5HA 5G0WA 1FFHA 1RQXA 3B6JA 3R8FA 4AMYA 1N36B 3O83A 3A4VA 4FBLA 4AYXA 4F4IA 4ZALA 4Q9DA 4ZYYA 1CDEA 5C31A 2MR6A 4R05A 4DLUA 1NW8A 3BMQB 2IYEA 3MINA 2G9RA 4C06A 1QHHA 3AERB 3LX4A 5P21A 3NMUF 4WK0B 5CHEA 3EZFA 3E03A 5LN1A 5AVJA 1KU6A 4EB6A 4AULA 2V5AA 5B12A 2VRCA 1EYZA 4DV1B 3WGGA 3BG5A 1BNCA 3H83A 4HFJA 4PXAA 1JHMA 4V1CI 5D00A 1ARZA 4OJKA 1D4FA 4D81A 4J2TA 3O2SB 4RJTA 4YP7A 3TKYA 3TZCA 2ZQYA 1VLHA 3VKHA 1ZD2P 4JL6A 4MO9A 5EKTA 1QHYA 1GGHA 3BD8A 4IDEA 4QUIA 4FW9A 1EE2A 4ZT2A 5L4SA 3U9LA 1PRYA 1NW4A 3ABSB 2I2CA 2W2MA 2DY0A 3H19A 3SFVA 2VYND 4FFVA 3GPLA 5T3UA 4YCSA 2FG7C 1Z4NA 4ZU1X 4F6RB 3VYUB 4MQBA 3E3AA 1GU1A 1TKAA 1T0JB 1QGYA 1GDDA 3R4VA 1XLWA 2PRJA 3GROA 3UB4A 4JX8A 4RTJA 1MD9A 4L07A 2YVUA 4Y9DA 1Q0RA 3S7TA 3JY6A 3GMDA 3V97A 4D5EA 2V98A 1JWLA 3Q11A 1L8OA 1EKXA 1TM7E 2DBVO 4IIVA 1JBEA 4MW0A 3SG0A 4WECA 1XCLA 2EJUA 5E6UA 3RFFA 1U1CA 1C7RA 4QXPA 3A4LA 3KKEA 1TCBA 1UJ4A 3AFHA 5JI2E 2XIJA 4QDUA 4R81A 4C7VA 1RLMA 3EEFA 5L6LB 4DR1B 2WYHA 3DUWA 1IDOA 2Y1WA 2GYYA 3AV3A 3WIDA 1P4HA 4CHGA 1JE1A 1SKUA 2MSWA 3MM4A 4JGIA 3BXZA 4X5OA 4YCDA 4MCAA 4N47A 4B6SA 5JXHA 1XK7A 5JROA 3KLOA 3THYB 2FQQA 1E92A 3T9AA 1UT8A 3N2NA 3NC0C 1EBUA 2C2GA 2GM9A 4A73A 5I4BA 1RXYA 1E2BA 3LVRE 2HK8A 4L28A 4X7RA 3ZV3A 1LH0A 3I3SR 3HI4A 4EH1A 2YHIB 1MX5A 2J3IA 5SZHB 4WE3A 2ZRMA 4UOEA 4ZZ3A 1EFUA 4FB4A 2WU8A 2DWOA 1PWEA 4TXLA 1W4RA 1VRVA 3KHTA 4OREX 4X20A 4G5GA 4W99A 1L5HA 3T1OA 3W3ZB 4ALKA 2BIFA 5FNZA 3CEHA 3LKZA 4NV1A 4BO9A 4J0HA 4HRYA 3T99A 4Q39A 5IXSA 1YA8A 3MJCA 1KRWA 2GZAA 3Q3JB