3JWJA

Crystal structure analysis of the methyltransferase domain of bacterial-avhen1-cn
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
199
structure length
188
Chain Sequence
b'SLNQQRMNGVVAALKQSNARRVIDLGCGQGNLLKILLKDSFFEQITGVDVSYRSLEIAQERLDRLRLPRNQWERLQLIQGALTYQDKRFHGYDAATVIEVIEHLDLSRLGAFERVLFEFAQPKIVIVTTPNIEYNVKFAHRFEWTRSQFQNWANKITERFAYNVQFQPIGEADPEVGSPTQMAVFIHR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hen1
publication title Structural and biochemical insights into 2'-O-methylation at the 3'-terminal nucleotide of RNA by Hen1.
pubmed doi rcsb
source organism Anabaena variabilis
molecule tags Transferase
total genus 67
structure length 188
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08242 Methyltransf_12 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3jwjA00
4IKPA 2PWPA 5F2NA 2B2CA 3AXTA 4QTTB 2AOTB 5LQUA 3BXOA 3HEMA 1I9GA 4BP1A 1NE2A 1YF3A 4XUDA 2BR3A 2Y1XA 3BZBA 1O9GA 2QY6A 2VDUE 5DXJA 3P8ZA 4WVLA 3UJ6A 3R3HA 3V97A 2ZTHA 3OZSA 4YV1A 3G2MA 3MCTA 3FTCA 3DMFA 3HCDA 1YFJA 4PIMA 3I53A 4Z2YA 4AZWA 5DM2A 3HTXA 5E9QA 2DPMA 2PXXA 2PT9A 4MTLA 1EG2A 3GO4A 1KIAA 2NXEA 2R3SA 3FPHA 2ZIFA 1TW2A 5KQSA 1P1BA 2OY0A 5EZSA 1NW8A 5H02A 2C7OA 3OE4A 2IH5A 2VDVE 4ER0A 1NW3A 4PYJA 5EIFA 2P3QA 4FSXA 3PVCA 2YVLA 5K0CA 1JG1A 2FYTA 3E23A 3KPUA 5EVJA 1U2ZA 4DF3A 1KP9A 4PIPA 2A14A 5U4XA 1UIRA 1SUSA 1G55A 3FPFA 4RTQA 3ME5A 3FRHA 3P71T 3LGAA 3BGVA 3DP7A 4ER5A 5LSAA 2NP6A 4DMGA 2IPXA 3KKZA 3HNRA 5EMKA 1BC5A 4YV0A 1JG3A 2ZWVA 2JH9A 3HCFA 4QVKA 5HIJA 2R6ZA 5ICCA 3FTFA 2C7PA 1RJEA 3UJDA 4RTJA 4LECA 1KPGA 3IYLW 2ZLBA 4IV8A 3UJ7A 5EQJB 5EKXA 5BW4A 4P58A 5DLYA 5T64A 2NYUA 2B3TA 4HGZA 4PNEA 3FTEA 2NXCA 2JG3A 3DR5A 4DQ0A 3EEYA 3A4TA 2YTZA 3DOUA 4EMSA 1X1DA 4AZSA 1KR5A 4RVHA 1WG8A 1N7JA 2IH2A 4E2YA 3LBFA 1IY9A 4YUWA 5K0LA 4RTOA 2UYOA 5HIMA 3U81A 3BGDA 5CVDA 1D2CA 4CKBA 2YXDA 4IWNA 1RJFA 1P91A 1SUIA 1M6EX 4HG2A 5CD1A 5DRYA 2G1PA 5EHIA 2FK8A 2P7IA 2UYHA 3HA7A 3CVOA 2PWYA 2PVCA 3CKKA 4KVZA 3R0QA 1JG4A 2P7HA 4OA8A 4RYLA 5EZQA 2JHCA 5BP7A 5IKMA 3ELUA 1UFKA 3A25A 3I58A 4QVGA 3AWIA 2O06A 4RTRA 3VYWA 2G8NA 3KQMA 3BUSA 4GQBA 1NV8A 4F84A 4GOMD 2ZIGA 3KQYA 4KIGA 4QPNA 1WXWA 4EVIA 5K0BA 2AOUB 5DTQA 5GIOE 1ZHFA 4FP9A 2HR1A 2UYCA 4YMHA 4RVFA 3FUWA 3E05A 3JWIA 3A27A 4FR0A 4CKCA 4EKGA 1ORIA 1H1DA 1HNNA 1R8XA 5F2KA 2AN3A 10MHA 3P9KA 1YZHA 4QTUB 4HTFB 1O54A 2EX4A 1DL5A 5FHRA 3K6RA 3HCBA 3DUWA 2JHPA 3A7DA 5CVVA 1XJ5A 3SSNA 3CJRA 4C08A 4C4AA 5ICEA 5HIIA 3HVKA 4HC4A 4CTJA 3T7TA 4M7RA 1KHHA 1VE3A 2CKDA 5EGSA 3FZGA 3LCCA 3OCJA 3KHKA 4RTNA 5HFJA 3WSTA 3M6UA 5E1OA 3NWBA 2CWWA 1BOOA 3GGDA 3PX2A 2WA1A 3EVDA 3EVCA 3GDHA 3M6VA 2VS1A 3C3PA 4ZTBA 3IHTA 3LHDA 4FZVA 1QYRA 3OU2A 3RIEA 5BXYA 1TW3A 4U7PB 2AN5A 1Y8CA 1Q0SA 2V7EA 3EVEA 3SXJA 3O4FA 2FPOA 2PX8A 5K0EA 1FPQA 5DX8A 3Q87B 4NECA 5CVJA 3VC1A 2AS0A 2AR0A 3VSEA 3PLAE 1XTPA 2IGTA 3HP7A 5E9JA 4CKEA 1YZ3A 5P8WA 3UFBA 3GRZA 5K0GA 3GCZA 5GINE 1JSZA 4QDJA 5DTRA 5E1BA 4DCMA 1JTEA 2PX5A 5LQNA 5K09A 1R6AA 1RI5A 1ZKDA 3HCAA 2BR5A 2AOTA 3MQ2A 1YFLA 3FRIA 5HILA 2VZ9A 3P9NA 4MQ4A 5HOQA 1ZQ9A 2P3OA 1R18A 3BGIA 3BWYA 4MIKA 3BKWA 3KPYA 1QZZA 4FT2A 3EVFA 2CMGA 3PT9A 4YMGA 2C7RA 4PGGA 1X1AA 1YB2A 3C6MA 4OBWA 2BM8A 1RI3A 4G56A 5CVEA 3HVJA 3PS9A 3TR6A 3TRKA 2FHPA 5DT2A 3M33A 3T7RA 1R8YA 3NVMB 3T7SA 3BWBA 2EJTA 2IBTA 2FCAA 1EJ0A 1SG9A 3Q7EA 2NNWB 4QQKA 4X63A 5HEKA 4PGHA 2O57A 4AX8A 4KIFA 1BKYA 4GOOD 9MHTA 3TM5A 3FUTA 2IH4A 1JSXA 3JWHA 3LCVB 3B3GA 3LX6A 3EMDA 3FPGA 3SSMA 1G8SA 2NXJA 4V0QA 1NKVA 2K4MA 3PFGA 4BY9E 2PSSA 3ELWA 2VDWA 3ELDA 3NMUF 4P7FA 3FTDA 2YXLA 2G70A 2IP2A 2IFTA 2Q41A 4RTLA 5DTMA 1XXLA 3K0BA 1QANA 5DRTA 3GRYA 3KR9A 4OA5A 3RODA 2IDJA 7MHTA 2AZTA 4RTKA 4FSDA 4DA4A 4C05A 3H2BA 1G60A 4HSGA 3DXXA 4RTPA 2O0LA 4LG1A 1RJGA 4QPPA 2XYRA 3IEIA 4OQEA 1AF7A 3MERA 4BP3A 3HCEA 4GC9A 4ER3A 3UZUA 4AUKA 3THSA 4KDRA 4DZRA 1I1NA 3M6WA 3TM4A 4DCGA 1VBFA 2QRVB 2F8LA 5EEHA 3LL7A 4LWPA 3V8VA 3GWZA 4RSRA 1MJFA 3P9IA 1RJDA 2QYOA 4R6WA 5G02A 5FA8A 1NBHA 1VL5A 3P97A 2PXAA 5JUWA 4M37A 2O05A 2ONYA 2ONZA 3TQSA 4C04A 4E2WA 5KQRA 1JQEA 2PGXA 3GRRA 2ZFUA 4E33A 2IBSA 2ZWAA 2OB2A 3C6KA 4PYIA 3R9XB 1PJZA 4PYOA 4V0RA 1AV6A 2BM9A 3KQQA 2OO3A 2GS9A 1VLMA 5FADA 3HVIA 2GB4A 3QV2A 3I9FA 4GOLD 5GWXA 5HZMA 3DMGA 5DSTA 3ER8A 4M36A 3UA3A 4A6DA 3LDGA 3DTNA 4QDKA 2NXNA 2NP7A 1R74A 2ZCJA 2G72A 3A7EA 2PX2A 1NW7A 4XCXA 5E8JA 3SSOA 2BH2A 3KPWA 2BZGA 5DM1A 2V74B 2P41A 3A26A 3VC2A 1WS6A 1IM8A 3M6XA 1JR4A 3LSTA 2LD4A 2ZBQA 2AOVA 2AOUA 3EVAA 3CCFA 3KQPA 3P2EA 1VQ1A 4HH4A 1HMYA 3GRVA 2ZZNA 4P7KA 3EEOA 3BWCA 2H11A 1FP2A 1WXXA 3B3JA 3L8DA 2EFJA 5DX0A 1I4WA 2UYQA 4DM3A 3MTIA 3PB3A 3E8SA 3NJRA 2B25A 3HA5A 5GP1A 3NDJA 1RI1A 1RI4A 1F38A 2XVMA 5KVAA 4HTFA 3P2KA 2HV9A 4X61A 3OFKA 3UJAA 3G89A 1F3LA 2O07A 4O29A 1NT2A 1RI2A 4YUZA 4CXMA 5IH3A 2CL5A 5C0OE 5LQRA 3GRUA 1XDZA 1XDUA 3DXYA 3OPNA 5DPMA 4F86A 2P8JA 4ER6A 1JG2A 3C3YA 2JHAA 3REOA 1G8AA 1V39A 3OE5A 2PV0A 4P7JA 4RWZA 4BLUA 4PINA 1P39A 2HTEA 3I64A 3KQVA 2H00A 2GA9A 3CGGA 3LCUA 3OU6A 5LR6A 3MGGA 2EG5A 3KQTA 4PONA 3GIWA 5DM4A 4AZVA 5CM2Z 3OFJA 4PYLA 5E9WA 2CMHA 3BT7A 2IIPA 4GC5A 3DULA 4MWZA 5F2OA 3SR4A 2ESRA 4OX9Y 4C07A 2FRXA 3LECA 1AQIA 3MTEA 5FA5A 2ORED 3NDIA 3RW9A 1N7IA 4AZTA 2XYQA 4E2ZA 2OBFA 4RVGA 1KPHA 2YUIA 5FQNA 4XUEA 5ICGA 1SQFA 3I5UA 3NWEA 1JQ3A 4GEKA 5D1NA 5EKUA 3SMQA 2ZZMA 3FYDA 3QOXA 3KR2A 5GM1A 2ZIEA 3EGIA 5DWQA 5K0JA 5GIPE 4FT4A 3KQSA 5K8VA 1JQDA 5E1MA 3DLCA 3OZTA 2OXTA 2C7QA 1Q0TA 5FWAA 3KR0A 1VP3A 3G7UA 2OB1A 3AJDA 4XUCA 2PXCA 5B1SA 3CBGA 5K05A 1XDSA 4RTMA 2GPYA 5M5BA 5KYGA 2EJUA 3HM2A 3EGEA 3GXOA 5K0NA 1INLA 5GOZA 5ICFA 4R8SA 2ZBRA 1EQAA 4WXHA 3BKXA 3B7PA 5FHQA 5CCBA 4PYNA 3M4XA 4K6MA 5E2BA 2Y1WA 3HCCA 3B89A 1L3CA 1EJ6A 1QAOA 2AOXA 3DXZA 2QM3A 4E2XA 4PYMA 4YUVA 1N2XA 1TPYA 5CUQA 3F4KA 3G88A 1EAMA 1PRYA 2JJQA 3ID6C 4C03A 1AQJA 3NVKI 2QE6A 5EHGA 2OZVA 2AOWA 1KXZA 3CC8A 1JTFA 3ERCA 2GLUA 2VP3A 3HVHA 1QAMA 2P1DA 3LKDA 3KU1A 1XVAA 4KW7A 4RX1A 2PX4A 3TKYA 5MHTA 2I7CA 2ZVJA 3M70A 3R24A 4P7GA 2IDKA 5EIWA 4LWOA 3G2OA 4C06A 4EKIA 4ISCA 1L3BA 2XBMA 3GJYA 3KQOA 2UZ4A 2KW5A 3AXSA 3FUUA 4E70A 2B78A 4DKJA 3EMBA 1SQGA 4GF5A 4JXJA 3TLJA 4BLVA 1QAQA 5CVUA 4CTKA 3UJ9A 3LBYA 5E2AA 1G38A 3SGLA 4X60A 1WY7A 1VPTA 3B3FA 2I9KA 2QRVA 4GOND 2XVAA 2WK1A 5FCDA 1L9KA 4PYKA 3FPJA 3HA3A 1X1CA 4M38A 4EK9A 1FP1D 5T6BA 2PKWA 3CJTA 3TKAA 3EVZA 1VIDA 2AN4A 4QQNA 3DH0A 1L3IA 2YQZA 2OKCA 1XCJA 3DMHA 3C0KA 2ADMA 2PLWA 3MCZA 5EMLA 4E32A 4PYQA 3ELYA 4RV9A 1BHJA 4R6XA 3GU3A 3MAGA 2ZW9A 2N47A 5EG5A 1SKMA 4POOA 5DX1A 3G2QA 1O9HA 5EC8A 3IV6A 3UJBA 4BLWA 3UBTA 3KPJA 2AVDA 5LQCA 4OBXA 4R8RA 3G8AA 3LPMA 3TMAA 3G5LA 3E7PA 5EOVA 1EIZA 5DXAA 2ZZKA 5K03A 4CWAA 2ZBPA 1IXKA 3UWPA 3T0IA 3FYCA 2ZULA 3SX0A 3MHTA 4YUYA 3PFHA 3B5IA 1WZNA 5E1DA 3R6TA 4YUXA 1D2HA 2PBFA 4PCAA 4ATNA 4E30A 5DM0A 5C9ZA 2H1RA 4EQZA 2WA2A 3UJCA 1DUSA 4KWCA 3JWJA 4RVDA 5LQAA 3NTVA 3G8BA 1SVUA 1KPIA 1X19A 3FPEA 1NBIA 4U7TB 3PX3A 1VP9A 3O7WA 4X1OA 5T67A 4Y30A 3LDUA 4GUAA 5GM2A 3LDFA 3S68A 5HIKA 2Z6AA 5JR3A 1Z3CA 1P1CA 2DULA 3THRA 2I62A 2P40A 5LQJA 1B42A 1R00A 4R05A 3P2IA 2HNKA 3JWGA 3G2PA 2Z6QA 4B17A 3G5TA 2ZSUA 1NV9A 1L1EA 2HMYB 5EMJA 2PJDA 2PY6A 5BW5A 4HRAA 3BWMA 4GBED 2FK7A 4F85A 5C1IA 4E31A 1XCLA 2ERCA 5K0FA 5DSXA 2OYRA 3SVZA 4RTSA 5EMMA 5FQOA 3UJ8A 3TFWA 4KRGA 3ORHA 2I6GA 3FUXA 5ERGB 5K01A 1NW5A 1DCTA 1X1BA 2XYVA 3MB5A 4OQDA 4PCLA 3TOSA 3PTAA 3CJQA 1M6YA 1OR8A 5LQKA 1T43A 2GH1A 2HWKA 3GNLA 4A6EA 1G6Q1 2P3LA 3P9CA 5FUBA 4IV0A 3X0DA 3OZRA 4L7VA 4PWYA 4Y2HA 5FTWA 2YXEA 1D2GA 3KR1A 1ZG3A 3UA4A 1ZGJA 2Z6UA 5CCXA 2AVNA 3KPVA 5E8RA 2E5WA 1FBNA 1KYZA 1UWVA 3EGVA 3EPPA 3EVGA 4KDCA 5CIYA 2JH8A 3NW9A 3TPZA 3KQWA 3FUVA 3QOWA 3ER9A 1M0EA 2P35A 4X41A 1ORHA 3D2LA 5FWDA 2GAFA 1MHTA 1YUBA 2YR0A 2PT6A 1KYWA 2B9EA 3OU7A 4FS8A 4FGZA 5KS2A 5FULA 5EEGA 4HGYA 4YV2A 4H0NA 5D1HA 2OPBA 2G71A 3SM3A 1FJXA 4MHTA 8MHTA 3DLIA 2YX1A 1ZGAA 4UOEA 3LKZA 1NW6A 2BR4A 3ANXA 5EPEA 3EVBA 4ER7A 3O31A 3AY0A
chains in the Genus database with same CATH superfamily
3HDVA 4FOOA 3PGJA 2ZXFA 5EWMB 5LD2B 4KMOA 3ZYZA 2WP8J 4OG2A 2QJOA 2R4TA 1UJBA 2GXSA 4WK4B 1H0SA 1PT6A 1LX6A 1M6HA 3ZG6A 4BP1A 2BR3A 2Y1XA 3W5IA 2VJQA 4L9AA 1NVDA 1O9GA 2A9JA 2NAPA 3VKFA 4FZ5A 1A72A 2XUZA 3RU2A 3GCGA 4JGGA 3TZHA 1XN4A 1GEGA 4IQ4A 1C8VB 2R8XA 1RRKA 2ZRHA 3BJZA 3A6FA 5HTOA 2VFAA 4Q02A 3WYCA 3KJNA 3TSOA 1U8YA 4M9XA 5T4FA 2I4OA 4Q47A 2WAYA 2GZ1A 4CKXA 4BO9A 3KSDO 2R3SA 3A3PA 1H6AA 4JLNA 5HKKD 1HFWA 4O5AA 2HA0A 2VI5A 3L0IB 1IOLA 2HHAA 1I6MA 4MEBA 4MKRA 4IDGA 4YRSA 2QVYX 3VPBA 4IIUA 4B9EA 2HWYA 4X8OA 4H08A 3ROZA 4AYWA 1XZCA 2JFNA 3HWRA 2VZEA 4ZK2A 2P3SA 5BSVA 1FS5A 4MS4A 4BEVA 3ZBTA 1XMVA 1ZUHA 4LY6A 3B5EA 4H4EA 5KYXB 1NL3A 5HOEA 4F4IA 3ICQB 2J3MA 3PSHA 2QD4A 3O6VA 4IMRA 2IITA 1I4EB 1SOAA 1UOEA 3KC2A 3VSBA 3ZZMA 5F23A 1PGPA 1PWEA 2R1TB 1N2IA 3LW7A 4LA4A 4S1PA 3DP7A 2CDNA 3QJGA 4OP1A 4XQCA 5LSAA 3CW9A 3HNRA 4IOKA 5FJJA 3SOPA 1OIXA 1J07A 1E7RA 1XA3A 2FWRA 4O1IA 4JOCA 4Y2YA 4ZODA 1K8YB 4E1VA 4GMKA 3D4PA 3DS8A 5LJIA 4S05A 1MC8A 2O20A 4AG6A 4B3TB 1M75A 1L4KA 1Z0FA 2WF5A 3HUFA 1Z34A 4NFLA 4V3BA 3QFSA 4LK3A 2VDQB 4A0SA 1ND5A 3ZKWB 5LXTA 1RXWA 1MEOA 1I0IA 3DDHA 3AESA 1F0YA 1JAZA 1WP9A 3JYNA 4MROA 2NVUB 4EATA 3T0GA 5ALPA 5ULLA 2KLHA 2W2MA 4Q1BA 3RJ5A 1FP4A 3IBCA 4LZWA 1YHZA 2RHBA 4EF4A 5HX7A 3B3AA 3BGDA 3GVCA 3IUNA 3S8MA 1D8TA 2E9SA 2HFKA 4N3GA 3ZWXA 4CKBA 1OTXA 4J90A 1M7GA 1GARA 5DRYA 3RJ9A 1S3GA 5AIAA 3MAJA 2ALJA 1QO0A 3GEEA 3NEJA 1Q2XA 2HUNA 2IHZA 4KQKA 3EOBI 1D04A 4JU9A 5F5LA 4A8JA 2BFMA 3Q2OA 4URHA 1IOVA 3DR3A 5IKMA 1CNMA 1D0VA 3RVRA 1K75A 2TSYB 2YC4C 2QW0X 3K70B 1I2DA 1GD1O 2XQFA 3ESDA 2O06A 4IXWA 1ZN7A 2G8NA 4MR7B 2ZIAA 4EL5A 2XUPA 1NV8A 5ER6A 1PDOA 2ZUDA 1IBMB 4UQLA 1Y1LA 5IARA 5C51B 3T3NA 1H85A 3HPRA 1L0BA 4ZYTA 5JXHA 3C2QA 4MO9A 3TDMA 3K0HA 4CKCB 5KTOA 3WOVA 4AJLA 2G09A 2H8KA 3KG2A 5ESDA 3MGKA 3ONWA 1E64A 1E18A 4M0PA 2IUTA 2IYYA 1R6UA 5GMOA 4D0GA 2DZDA 3NM5A 4J0KA 1T6YA 1QXSA 4W8OA 1W0JA 1ZONA 1MPTA 3RDPA 3GVPA 3F8TA 3HJBA 3COWA 4RQTA 1A8QA 1XALA 3BSSA 3OJXA 1EJ2A 1FQOA 3T1HB 1KQOA 5A4KA 1G8FA 2J3LA 2QENA 4NFHA 1Z33A 3ZU6A 3KZXA 4EB0A 1JBKA 4U7GA 3VPGA 3M6VA 1U7PA 1E2QA 2H54A 4PC6A 2OYCA 3VO8A 3TN7A 1IXSB 2ZBVA 2A5LA 3ISJA 2DR0A 1SIBE 3OOJA 1NVVQ 5JXGA 1XRNA 5CNJA 5C46F 3BD8A 1V4VA 2FPOA 1U5CA 3OPYA 3W5AA 2Z2JA 3DW1X 1DX9A 2PKQO 4XKJA 5PNTA 1A8IA 5KNCD 2PZEA 5E9JA 5WRFA 2L42A 1N7GA 3GRZA 3G17A 4TS4A 1H3FA 3C7DB 2MR6A 4FFBA 4RESA 1GGHA 4MW4A 3VUFA 4H2DA 3I9NA 5ALRA 1J00A 2PX5A 3C4VA 2ZUSA 3CLHA 3MWLA 5DTRA 2GF9A 2QRQA 2B0JA 2PK3A 3VISA 2C0QA 4UJ5A 2H7CA 4XB1A 2BGKA 2OZEA 1BX1A 2QN3A 3D8TA 5BPHA 3BGSA 3BTOA 2CJYA 5IDVA 3PPXA 4D0SA 1X7YB 3KYDB 4PLHA 1UQUA 4WZBB 3B70A 3BJMA 3P1JA 1GGKA 1T8PA 1TO2E 1YJBA 3MFQA 2VK2A 4KWTA 4QNRA 4CBVA 3WAJA 1RLTA 5KTTA 2P75A 1NHWA 3MRXA 4LOAA 3VPSA 4BFLA 5ERXA 3ICEA 3T7SA 5HUHA 4MW0A 4K6FA 4QQKA 1UPFA 5GGXA 2I6XA 2VLBA 2Y1GA 3TAXA 3HR8A 2R7KA 1P9NA 1F2DA 5KU7A 1PK9A 2SBTA 2G80A 4C4OA 3FJYA 2NXJA 3F90A 5A7GA 3RRJA 4IIBA 4PLWA 2YXLA 3V8MA 5JD4A 3G85A 4HYYA 5KNDA 3OBIA 4X6YA 2PAAA 3NHFA 4RTLA 2P69A 2B4QA 1YUMA 2X6RA 3K0BA 2PH3A 2M6KA 1CUHA 3W1EA 1U7DA 4G2TA 2TMKA 3PITA 4JEMA 5KB3A 3GRYA 1K2WA 2ADFA 1SD5A 4FSDA 4LMAA 3WGYA 1K27A 1TA9A 4AKHA 1KJJA 2IIQA 4J91A 3R0IA 1M54A 3KFLA 1UZNA 1N8KA 3WSWA 3AUXA 3AVUA 1YGPA 1GKIA 1IBCA 3IEIA 1PV4A 2FN8A 1ZNWA 3KD2A 1D2MA 2AFHE 1Z6YA 2F55A 3ZE0B 1NF2A 4OHBA 1DFHA 4OUDB 1ZVQA 2QUZA 3GLIE 3Q9SA 1YBFA 3R20A 3W3AA 5A1TA 5K99A 2KX7A 4R1UA 2Q4DA 4NCAA 2WV7A 4N5DA 4KQGA 2A58A 1L7VC 5JSZA 1CQJA 4DAOA 2IODA 3H8WA 5BSRA 3ROQA 1CY0A 1RJDA 3WNZA 1TI7A 4FINA 5G02A 5IC6A 2PUVA 3CN9A 3ZK7A 5IW8A 5CX1A 2W6PA 4NCBA 3IQHX 2IC5A 1RZUA 2PG3A 4DTIA 5BSEA 2I34A 1TMGE 1IMJA 4KUEA 1QQ7A 2QU8A 4YR7A 2ZFUA 5IJWA 2O8FB 4TROA 1N2HA 3RKRA 3V4FA 2PL3A 3VPAA 1RACA 3D4OA 1TQ6A 3JVUA 4OQQA 1NQOA 3KO8A 5T5QA 2Q7XA 3IIKA 5LP6C 3N07A 3PNQA 1TJPB 3T4XA 2BGMA 5SZIA 1R64A 1W2HA 4GI3A 2ZCJA 3NETA 3B1YA 3PDIA 4QU5A 4OQMA 2PUDA 2PUJA 4DCJA 2BHLA 1GUBA 3PQ5A 4G8DA 1MW9X 4U3JB 5CR9A 1FFGA 5E8JA 3VR4A 2EFGA 3W2HA 2KYRA 1CBUA 2O3TA 2QD2A 5DM1A 4E08A 1Z4NA 3OA0A 5CDHA 1XMJA 2H0QA 3UICA 2RB5A 3AONB 3QHPA 1NSFA 4B3BA 1E8MA 1D8AA 3PFCA 3Q10A 3QEOA 4HH4A 3HU1A 5EA2A 3SQMA 3WYDA 1HOTA 1XVUA 3R3JA 4ZEXA 4MS1A 5MN4A 2VJYA 2X14A 2PHZA 4HAUA 2H1CA 1QSGA 5D85A 4AY5A 4C4SA 4WCFC 3HBJA 3FTQA 1I36A 4IZHA 2Z56A 1KMHA 1LLDA 2DKNA 4IDDA 1Y7IA 1OXTA 4CU2A 5JBNA 4HQLA 5K3OA 1A71A 1ZITA 2DC1A 1PX0A 4H7EA 3QKUA 2J6IA 3RVBA 5AD1A 1ZCFA 3CS3A 1HK7A 3KS9A 3SQNA 5IH3A 1GZUA 5BUQA 1FRNA 4BQEA 1VECA 3DMDA 1EVJA 3CM0A 3S70A 4W5NA 1EFDN 1U9YA 1I7PA 4PBTA 2EOAA 2QJFA 4LYJA 2J5XA 3VTZA 1KYVA 1ZNQO 4WJZA 3TQOA 4HKTA 2KB0A 4HUJA 3RS5A 2QUJA 3I64A 3OU6A 1Z38A 1N6OA 3GCDA 3KSRA 1J97A 3KXIA 4Q1DA 2X4IA 3GR6A 1K1EA 3BFVA 2GKOA 1OXMA 3N0WA 4DV5B 1VPVA 5BVHB 4F3NA 1HDGO 2WKRA 2PRSA 1H3NA 1PJLA 1RBQA 3AJEA 3QKRA 2ZU0C 4NCKA 1OZGA 4UBKA 2WFMA 5EVCA 5AW7A 4GAEA 1GV1A 3N8NA 1YRYE 3WVNA 2DBYA 1VKZA 3LRTA 2FRXA 2VSFA 4AAYA 5A6SB 1KQNA 4JQSA 2C5FA 4E2ZA 1KPHA 1EGMB 1BXGA 5BRJA 2Q5EA 1S6YA 3DHVA 3TI9A 2D4AA 4K6OA 1D4AA 4LF9B 3I2GA 2R96A 2EBUA 1BA3A 5GIPE 3T5TA 2QMEA 2OZLB 4MKZA 1G21A 2C84A 5JQWA 3VOAA 4YYZA 5HS4A 1ZOSA 4PN3A 3GA0A 3MMXA 4U9IS 3IT0A 1E9BA 3O3OB 2XCTB 4W1PA 4EL0A 4YCMA 1UBSB 3C1UA 3ICVA 1IY0A 5ECWA 5BPFA 2EIXA 3M2PA 4RF4A 1L5MA 1IULA 4GZ6A 1ZJZA 2C2OA 4AZ0A 3LUBA 4B8ZA 4H17A 3HS3A 3REQA 1E2FA 3DVRX 3M4XA 5E2BA 4AY3A 5DKFA 4DWWA 1ITZA 2JIDA 3EXAA 1OQAA 2FKAA 4QDZA 3IS3A 4P92A 4M1EA 4QWWA 1T1IA 5FOXA 4E11A 5CEFA 1VYHA 1TPYA 1S2LA 5JDIA 3A05A 4YC7A 3SBDA 3CX7A 3QVJA 4JMPA 2FRDC 4OL0A 1T5SA 3TQHA 4GXTA 4OLHA 3R24A 4AU1A 4RGQA 4EG8A 4L8LA 2P4QA 2QT1A 3KV1A 3UGQA 2ZXEA 2ZVDA 3AKYA 4PLZA 4TV9B 3G2OA 2UVPA 3RS3A 2B8WA 5A3QA 1TM5E 1XJ0A 1E5QA 4J1TC 4KIJA 3MMSA 3BL8A 3AHEA 1RXEA 2EW1A 5CVUA 3AEXA 3RS4A 3M5WA 2WU3A 1XQVA 3TQQA 3ZE8A 2A92A 3WGGA 1LFDB 4X20A 4MI9A 5I4CA 4JK3A 5JAIA 2CHQA 1IM2A 1FMCA 3VZSA 2EJBA 3L46A 1N2GA 3QPBA 1C7EA 1FP1D 3TKAA 4IPTA 1YXMA 2AFHB 1XF9A 1TM1E 2YRWA 1GTJ1 4YT2A 3IQXA 2WOOA 2VUSA 1JNXX 1MOQA 1L7BA 4X84A 3WE7A 2G07A 3ETGA 2Q46A 5EXEA 5HQ3B 1JDTA 3MAGA 3AP1A 4ODIA 4OYHA 4PU0A 4MGYR 1A9XB 2X23A 4JUFA 1O87A 4EDHA 5ESWA 1R6XA 2JJ2D 1R0SA 1EM6A 1MIOA 5TQ0A 3BICA 1O8BA 1A76A 1H2BA 3G8AA 4R8RA 4CMAA 2P79A 4JH0A 2BEWA 3ISTA 1KQFA 2PEZA 2B8TA 1KBQA 3T0IA 1ZJJA 4CXMA 1XROA 3T1NA 3TNDA 1RE0A 1MCZA 5DN6D 4EG4A 1GV0A 1SFRA 1VA5A 5E1DA 2MSKA 2YJ6A 3NYQA 4ROSA 1GN8A 2WHXA 5LDHA 1B6GA 2JBWA 2Z58A 3CUEF 5HHTA 3JX9A 5FRDA 4TRMA 1JEDA 3TTTA 1M1YE 4BFCA 4FIZA 2D06A 4JOQA 1AN0A 1WQ4A 2H9YA 2C5AA 2K5UA 3MFYA 4U1RA 5CURA 5K4HA 5T67A 5AVVA 1MN6A 4G4JA 2WYUA 3FWKA 1QGOA 3RPEA 6REQB 3ZK9A 2V65A 2Z6AA 4M8IA 2M1XA 2V7QD 5FWYA 1Z2AA 2AJLI 1R00A 5J3JA 2WSSA 1G1AA 1T5TA 1AMOA 2K2QB 3QKSA 2J9FA 2PSEA 2R751 1RQ2A 3G5TA 3LD9A 1UMCA 5ADUS 4EPXA 4IINA 4YRDA 2WWHA 4HT3B 3DD1A 3BMNA 1DAFA 2VDJA 1CLEA 1WABA 3BCUA 4R8KA 5CDFA 3S2UA 4Z49A 5AUOB 2CL0X 3U16A 4ZEMA 1JYEA 5EJEA 4O3MA 4QPJC 3MK31 1WXGA 1OAOC 1PD0A 4DABA 2G7ZA 2OG2A 1T1GA 4YRTA 4B2IA 4BNTA 3WR5A 2YDXA 5EJ7A 2JBHA 3IEMA 4CN9A 2GK6A 1V1RA 4UOZA 5TIIA 1KJIA 1VL6A 4D44A 1ZD4A 3GNLA 1QC5A 5FUBA 1EK0A 3P9CA 3X0DA 3VA7A 3V7YA 4I99A 3L0ZA 4Y2HA 3S2GA 5KUTA 1FMFA 4OQXA 3E53A 2HSGA 1ZG3A 3N3AC 4KQMA 3P94A 4BFYA 5H4HA 3QW4B 3UYKA 3U40A 3N76A 2VAXA 3VJLA 1ZUNB 3WXMA 3H4MA 1XL0A 4HDKA 4I8XA 3WNBA 1FC0A 2OBNA 5JAOA 1N5OX 1T2AA 4N0EA 3H2IA 1P5JA 4UVEA 3B6EA 3D2LA 4CMEA 2GJ9A 4ZO4A 1JMKC 3F96A 3PKIA 4AUMA 2Q3BA 2ROQA 1QU2A 2CL7X 4JP8A 5KS2A 1TIBA 3WYNA 4MWTA 3GGPA 3KVVA 2LCQA 1ZY2A 4G5FA 4PSAA 4A0QA 3E4DA 1L7NA 2V1XA 2B82A 4HMQA 4OBBA 3LLSA 3LKZA 2GUGA 2QN9A 3V1LA 3AK4A 1PGOA 3UJ6A 1FFDA 1KEEA 1VSUA 4M46A 2AJTA 1PQUA 2QD3A 4HFJA 2ZI3A 2B2CA 1E0DA 3H5NA 5LQUA 2PMEA 2I4LA 2KM1A 1DTWB 2V3CC 2F8SA 3HDGA 3LY7A 3MINB 4KE9A 4YP6A 3ZXSA 5A4DA 3N7AA 2WAMA 5K1ZA 4CN8A 2VDUE 4B1FA 4WVLA 2O8DB 3V97A 4ZQFA 1SC6A 1U5BB 2GO1A 1W25A 3NORA 2ZJ8A 4YHHB 2GETA 3KOMA 1QHEA 1FOEB 4WK0B 3ZWVA 4Q24A 3RGGA 3LPCA 3V4LA 3V6MA 4AP6A 4DS3A 3IOEA 4FOSA 1RHQA 2RJOA 1LZLA 2DPYA 4CMHA 5AQ1A 2NSLA 2QG4A 1RP7A 3GGGA 3GO4A 2NXEA 3NGXA 4L72A 1KRWA 3CX3A 4U00A 4IIXA 2AG8A 4C3OB 3MJFA 5I9SA 3T8YA 3CE6A 1RVDA 1LPBB 3DJFA 3ZH9B 1K4KA 2D1SA 4NICA 4LQ4A 4CEIB 2ZEJA 4ZGGA 1PX2A 3L2OB 2Q1YA 2P3QA 1E1CA 4PYJA 2V9ZA 3NIFB 2D0IA 3U3JA 2L19A 4C2BA 2FYTA 3FSEA 3PHBE 1IJFA 1NVFA 1G4HA 3ZTYA 5G40A 1QVVA 1QOQB 2B4YA 5IK2A 3PKZA 4FYVA 1DWQA 3OECA 2O3QA 1C14A 3S81A 1ZMRA 4IDBA 4XQEA 5REQB 1WF3A 1KEEB 3KB6A 4NCXA 4ZOAA 1N2OA 1WLYA 1JG3A 2Q4RA 4RK6A 1OCEA 3Q7PA 1I7NA 3I3SR 2H2IA 4FCVA 1V47A 2H4JA 5ALLA 1L8XA 1OZ0A 1Z7GA 2W6ID 1IU9A 4E13A 3MZ0A 3C7CB 3UG6A 5IAAA 3O0DA 2HQRA 4HZGA 5CTAA 1U2TA 3W9YA 5CT6A 1NDHA 4GD3Q 2RMKA 5E3JA 3L4KA 4TTSA 3FTEA 1J1ZA 1RSZA 3IRUA 1FLDA 2JPDA 1E9DA 4M8NE 4P8RA 2H65A 2WF6A 3RBVA 2AW5A 4RVCA 2X0RA 5H1YA 1G20E 4S1TA 4E2YA 2GYVA 4KYVA 2PZKA 2JLYA 1KORA 4B43A 5DGCA 1NY6A 1YOBA 3N8KA 1TUIA 4B6RA 3NNDA 3VYUB 2IIBA 3EY4A 5G4LA 3O8NA 3L4SO 1E58A 1N77A 4L5YA 2O8EB 1MT0A 1DARA 1G42A 3KV3O 4LC1A 2ZI4A 3AUUA 3HKDA 1JG4A 5ALSA 4FD2A 4INJA 4BZQA 5TPZA 3MQ4A 2QSYA 2RKOA 3KDAA 5AHKA 4D9JA 3UMJA 4BXOB 3MILA 4UZFA 1RYHA 4XIGS 2I7TA 4D9NA 4EMTA 4W5RA 3FPKA 2BOVA 4EVIA 1RQLA 2VWPA 2W58A 3OT1B 3ULKA 4K87A 4L5JA 2GEVA 4BVAA 3T9BA 5B1IA 3PFFA 4CKCA 4V38A 3DEYX 1AKEA 3DZIA 3C5VA 3RFVA 3PNPA 4U7DA 3JWPA 4HAVA 1VLZA 5DP1A 3I2JA 3SC2B 1O54A 3UCEA 4MS3A 3V9PA 5FHRA 2P9TA 5AUNB 5L3VA 3QITA 4EW1A 4DV0B 4Q9JA 4TKUB 4JB3A 5IVKA 3JAWA 4MRMB 1M34A 4RHFA 4DNFA 1DDGA 4A91A 5EGSA 1C7FA 3DBRB 4O4IF 1XJQA 4NONA 5DTEA 4RVOA 1IDN1 4X7RA 1NZFA 1R1DA 4R1PA 4HPXB 1ECPA 2JJ8A 3JQFC 4G0OA 1UBUS 4C29A 2R6R1 3VH4A 2G1UA 1F9EA 4X64B 3N9IA 2W6MA 2JA1A 3CWZA 3O4RA 1JAIA 2OUKA 1T0BA 1UBRS 3SXJA 5G0VA 2JGRA 5KHOC 4NECA 4F56A 5FUYA 3NHRA 4RJLA 1NF8A 2BFEB 3CUWA 3LOPA 3K05A 1PWXA 4HXGA 3NKVA 4O08A 5EINA 4CYMA 4EECA 5FEMA 4RJKA 5K0GA 3GLGB 1KNXA 1T8UA 3N8GA 4ZCMA 4B6PA 3RASA 4JBYA 1EUYA 4OI0A 1EWVA 4OJNA 3B1FA 1ZKDA 2XH8A 4HAYA 2AMJA 3FMGA 5BQPA 1JF8A 4HXFB 1ZQ9A 3V8NA 1CTQA 3BKWA 3HSSA 3UKJA 1ZRSA 4KV9A 5T41A 3WK9A 4HDNB 2FEMA 2NVWA 5CPFA 3ZV5A 1B8NA 3IO5A 3ENVA 2WU4A 3TRKA 4TS9A 4ND8B 1CV2A 3S1LA 2QTCA 1G8JA 3ND5A 2E87A 1B2LA 1QGYA 1I0ZA 2E4YA 3DD5A 4GPEA 4R7GA 3N05A 3HABA 1GTMA 3DVQX 1PW7A 2YICA 4KXVA 3RHTA 1U0OC 2XB2A 2GM4A 3VOSA 2QLBA 1T0PA 1U4OA 2B21A 2HCBA 3DZCA 4ZVLA 3TBKA 3RAEC 4KVGA 3FNIA 2NYVA 5GONF 4YR9A 2Z5VA 2PRIA 3AHHA 4Y6QA 4C6RA 4H9GA 1FNCA 3HE3A 1GQSA 1UBHS 2YV5A 3Q41A 3RFTA 4KZKA 4M21A 2Y0EA 3SICE 3ASZA 1CUGA 3AR7A 2QLJA 3D6HA 3WL6A 4QKQA 4OA5A 4KQXA 5HKLA 2NXWA 4PC3A 5KVVA 2WLSA 2W2NA 4N3AA 2O59A 1HOXA 4H7DA 1GTSA 2RK4A 3DXXA 5GOTA 5D8DA 4BFVA 4GKJB 1LBEA 1VG1A 2V97A 1Y6RA 2FLWA 1AF4A 1FEZA 1DWUA 1ONSA 4M0CA 4UM7A 1JZTA 1MF7A 5IDQA 4NAVA 4ER3A 1ZW6A 3P9YA 1L7DA 1L5KA 3BMCB 2RBEA 4G5HA 5COBA 4OUDA 3ODPA 4JASB 3WNQA 2VSQA 2PMKA 2F8LA 5A0TA 1N1GA 3QE9Y 2DUMA 5BW6B 4HSEA 2A67A 3TUJC 4ZZ0A 4RSRA 2FRVA 4GQAA 1Z3IX 1ES9A 5EIOA 5FDFA 1P61B 4ZRDA 1MJFA 2C07A 2C2BA 3DMTA 2C2KA 4BJHB 1M1NA 1UDBA 3JZIA 1Z8NA 3JASB 2WAAA 4KQIA 1Q84A 3FIJA 1W49A 4FJ0A 3IFSA 3OZUA 4DC9A 4ZICA 3GRRA 4HN9A 4ZJUA 4K9NA 2ZWAA 2ZAGA 3ND8A 4PYIA 3R9XB 2PX6A 2FFQA 3WO0A 3ZU2A 5KU1A 3KQQA 2VQ6A 1BCSA 4G1CA 4Z0TA 2RHLA 3IUYA 4NZ9A 2H48A 2C57A 4OGFA 5HZMA 3L8GA 4DAEA 1V7QA 3PI7A 1LB1B 4DM7A 4EI8A 2O2HA 1FSSA 2XCQA 2R6DA 4QDKA 3EJWA 3HV0A 3IP5A 4WQMA 3AJ8A 4JXZA 4C3ZA 2ZB2A 4NYMR 4TN1A 5E6SA 2WF8A 2XMBA 3UAGA 4JROA 3SSOA 4TPKA 5AW1A 2B4KA 2KS6A 1S01A 3JARB 3V33A 2V7GA 4XM0A 4C0LA 1GTZA 2LD4A 3MGCA 1ZXBA 3PUWA 4FLFA 5IJ0A 1MLDA 4TTRA 2BF4A 3BB3A 1KU0A 2FMXA 4R71A 4AKIA 3B3JA 3KTAB 5JYBA 1J20A 5CXSA 1R88A 4Y6RA 1U1FA 1JAHA 2G08A 3JVVA 3MTIA 2QE7D 1PZHA 2GD6A 1GCOA 5F5NA 1E4OA 3IDOA 3AOGA 4E15A 3BA1A 3N2EA 1XU7A 1ONBA 1UXGA 4ZDWA 1QYCA 1ID8A 1ZNYA 5HR5A 2O07A 1OTYA 4MVXA 2C1EA 3V4OA 2I0FA 3MLBA 1W1IA 3NBZC 1CIVA 4B4WA 3QFTA 4ADSG 5C7OO 5HJEA 2GXAA 3FMVA 3KYCB 4AF6A 2BGWA 3JQ7A 1IK6A 4KGDA 4JBXA 1ZJ4A 1I30A 4MVJD 5JVDA 2PQMA 4HGQA 1VJ0A 3SIPA 2C3OA 4N47A 2GK7A 1GLNA 3JPYA 1SUFA 1D3AA 3I72A 4G09A 4IIDA 3CVXA 3CGGA 1RD4A 3V1KA 2YFQA 1ZIXA 3G0DA 1KO8A 3SEZA 3ZDFA 4ZGWA 2EG5A 3GIWA 4A5SA 1UPBA 3E5MA 5KQLA 1MEEA 4Y0VA 5LLSA 1HX7A 1X2BA 3OIGA 1IRIA 2RHJA 4GP7A 4KOAA 5F2OA 3SR3A 4F4DA 3EPJA 1UQTA 4C07A 3V34A 2KE5A 4Z7JA 1ZN8A 3HUEA 5JSQA 1M2JA 2BDUA 4E3ZA 2ECQA 1R0CA 2EKZA 3BIFA 5F4BA 3ZWYA 5JNUA 2BIFA 3UMYA 3K20A 3EULA 4RMIA 4IIGA 2VQDA 3A1FA 5CJPA 4ARAA 3THYB 5EE0A 3E8MA 3R5JA 1T9HA 4B73A 2UUCB 5D86A 5ED0A 4M88A 4DA8A 1TDJA 3AFHA 4IUBS 3HSKA 3NHZA 1K8XB 5FWAA 1IDOA 2OO5A 3IMCA 1VP3A 3KKPA 3G7UA 5C18A 3AJDA 1FYWA 1T8TA 2ADOA 4B40A 1F06A 2PGLA 4NMXB 3WQQA 1PBTA 2HC9A 2R8RA 1UBOS 3EWSA 2XNJA 1NXVA 3O03A 4OU5A 4UAVA 5K0NA 3LPNA 4IUCS 5GOZA 3A9UA 4LJYA 3BKXA 1BU8A 2RGGA 1AUVA 1YT5A 9ATCA 5AJZA 2IX9A 3RS0A 3IAM6 2XUFA 3S4YA 3STUA 5ES4B 1P77A 1Q1AA 1QG2A 2AOXA 1ZOLA 1JQLB 4O1HA 3AIOA 2GPWA 3QJYA 1W36B 2XGMA 4IAOA 1UBKS 4KN6A 4C0BA 1BVYF 1KIMA 2VP3A 5E1MA 3A1DA 3FNEA 3LKDA 1I4LD 1MRSA 2V54A 1YE8A 4M8LA 3UK0A 1DT3A 4XI9A 5EJAA 3WGTA 3ZOKA 821PA 1SQ0A 2YZ2A 1T8RA 4TM7A 3B36A 1JXMA 5E0KB 4BNYA 3RBXA 3RHFA 2N0SA 3P0FA 4YJ3A 3FUUA 3QFFA 4IIFA 4ZD6A 4CTKA 4QGBA 3NTOA 2I9KA 5DNAA 2QRVA 3T54A 2WK1A 5JO0A 4H7KA 1ZWKA 1EDBA 1E7MA 3G0BA 3VKGA 4M38A 5D5HA 3CJTA 4KMMA 1VMAA 1LGYA 1P1FA 4G8CA 5F98A 1A8PA 2ZYUX 3HYSA 1AQNA 2H7VA 2ZWMA 1VGVA 4H6XA 4PYQA 4NIMA 4BIMA 4DLZA 1N32B 3QU9A 4M0UA 3FI9A 2X7JA 2XV1A 1P2TA 5ALJA 4HWOA 2GK3A 4K9RA 5IC5A 1ESCA 2VPQA 4QYXA 3D5TA 5D87A 2COUA 3H16A 1RQRA 3OKFA 1WW8A 5LQCA 1HQDA 1IWPB 2FMFA 4C1NA 3QMPA 4LX8A 3LY8A 5B5SA 4IG9A 2YYSA 3C8DA 1EIZA 4TTQA 3IOBA 2JIRA 3P5SA 3SX0A 3BDAA 1FSPA 2I6QA 4NG5A 1E8DA 3UUWA 4ZO8A 1P73A 3CZ9A 4DADA 4QTYA 4HI0E 2HJGA 3OVMA 3RABA 3GPIA 1FU4A 2BHNA 3LRPA 4UBNA 2QQFA 2NSJA 3N7UA 1VCIA 2RGYA 2SCUB 2WA2A 4RXMA 1JP7A 2C95A 1UBMS 4UVIA 4PAQA 5JXWA 3ACBA 3T1YB 4CIBA 1P29A 3H11B 1IL0A 1PYOA 3GYGA 1F8GA 1DHRA 1NBIA 2GDZA 3CSDA 1M5UA 3SC3A 5JJLA 5JQGB 5KYWB 4GUAA 4EUHA 3OT4A 5BWLA 1C1DB 4HQKA 1P1CA 3NX4A 1DNPA 3SWWA 1RABA 2VVTA 1JQKA 1ADFA 3GJ6A 3ITEA 4JU8A 1C4XA 4Y9TA 2RHDA 2WIFA 4I50A 5FWXB 8GPBA 4GYWA 1L1EA 1WXFA 4OHCA 4UM9B 4BX0A 2ZUEA 4PSKA 1P9OA 3BWMA 4GBED 5EWJB 4JL8A 2ERYA 3GDGA 1KI1A 2A5GA 1RZRA 5FYDA 5K0FA 3SF8A 6GPBA 4WN3A 4WXPA 2BEKA 2PMWB 1X1SA 1G64A 2H1IA 3AEKB 2WI8A 3GJQA 4NK4A 2KBEA 5HK9A 4RD6A 2C7VA 2ZPUA 2D5IA 3HDQA 3IP1A 4P33A 3SZMA 4EHHA 4WBNB 4R9RA 1Z75A 1X7XB 4DV6B 2EJCA 2DWOA 1DIAA 1XD2A 3RHSA 2HHHB 1NMSA 1TLFA 3C8UA 3W5UA 4CLXA 2CCJA 1XPUA 4CL8A 3DGEC 4G9BA 1GN9A 1ZKMA 2AVNA 2PUCA 4NL4H 3KWFA 4CQMD 2NPOA 5SICE 3SQLA 3K96A 1LNSA 3JVEA 2NZ8A 3K9CA 4QATA 2H2HA 2BFBB 3FUVA 5J4KA 1VFPA 1ZM9A 4AG5A 3ACCA 4ZT3A 2XNSA 1HYGA 4KO4S 1B6SA 2EFYA 1Y4AE 4HF7A 4N8DA 3TQFA 4RE5A 5LNK6 1RFLA 2C3MA 1R3DA 1TM4E 1JJFA 3STYA 2AQ8A 5AR1A 3RVSA 2PPLA 5BV1A 2X1HA 4TV8F 5DNCA 3DEKA 2IS4A 3W5SA 2FUG1 3K6KA 1T8YA 4AG3A 1JEOA 4IP0A 1QH8B 4MTLA 2EBWA 1MORA 1YDEA 1O6ZA 1N2SA 3AY0A 3E70C 3OZEA 4M1ZA 4ZVTA 2IYXA 5HQJA 5F2NA 4IH1A 1DLJA 1OSNA 3WGJA 1VHTA 1AZLA 1US8A 1M6NA 4JLPA 2Q0SA 3VU1A 4EGFA 1NOJA 1Q5PA 3GD7A 2C4TA 2HWUA 1FW8A 2C96A 1FJGB 2PZGA 1YJCA 2XE8A 3ER6A 3IP7A 2VXBA 1KAQA 3N86A 3OCZA 5E0OA 5HS6A 1WU8A 4AWAA 5K0ZA 5CA1F 1HRDA 2HK9A 4OB6A 1MO6A 3HYRA 4S0ZA 1QDEA 4UE2A 3HBMA 5KWJA 3LOUA 5JYEA 2OV6A 3M0EA 1O03A 3JRWA 5JMPA 1FVXA 3DZGA 1SIUA 4JZYA 4ZVVA 4CPDA 2DR2A 1CULC 5TQ2B 5EMNA 2JFVA 1ORRA 3OLYA 3NUGA 4DLAA 1XMQB 3ROMA 5CA0B 2B2XA 3V2HA 5H02A 1IVNA 4RMNA 5TMEA 1HR0B 4L73A 5ENVA 3PNVA 3O2SB 2BGLA 2GF2A 3Q7QA 3F5SA 3G8DA 5FP0A 3SC6A 2PCLA 4ZZ3A 5IAEA 5FOTA 4JC4A 3ZJVA 1V11A 4QARA 1Y7PA 5KCZA 5BO5A 4CHGA 4EX7A 4FPXA 5IH7A 1M2GA 1I94B 3EQ2A 4LDNA 3DXFA 3JZDA 3FHLA 1YR8A 4ER5A 3F3KA 4D9EA 3VC3A 3L5KA 3LBIA 1A2QA 1K97A 1LD3A 2XB4A 1QGZA 2BM1A 1T4GA 5J59A 1D2EA 5M34A 3IELA 3T7IA 1KVQA 1W30A 4GOJA 1GRQA 1XTSA 3THOA 4BQNA 4QHYA 3AUTA 3WADA 4EGCB 4ZN6A 2DGDA 1SBIA 2WHQA 1KWGA 4JLSA 4Q48A 2CSXA 3LC0A 1TRHA 3Q85A 3KBOA 3SS9X 4ND5A 5F7XA 4J4HA 3ZS9A 5T8KC 4DMMA 1P2BA 4S12A 5CBPA 2A86A 5A03A 3EEYA 1NG1A 3SIRA 3CT4A 3Q5GA 1TOAA 1BYIA 4ZT6A 3GN1A 2R00C 2HBRA 3WWEA 5BVGB 1J1IA 1DUVG 1WJGA 2H9IA 3L77A 1DX4A 2IY8A 4Z6KA 5JZ9A 2XX3A 4MJ3A 4GI2A 4ZZ1A 2GJAA 2H1LA 1A5AB 4BVKA 3WGVA 3SAJA 4A92A 2OWEA 5EHIA 2A6PA 1LSJA 2WHEA 3CHYA 1HLGA 3QNUA 1CEQA 2MWMA 4GGPA 4O4LA 4YWHA 3FLEA 1DG1G 1G3RA 4QYSA 4EHLA 4WK2B 1YZTA 3GARA 3ZWOA 4BECA 3FZEA 5SYAA 4YAWA 1K9SA 4CF6A 3AZOA 3I58A 1N2CB 3U4QB 3P9XA 3WWOA 1OKKA 3VNVA 3SYRA 5B3LA 4FZ3A 2DPGA 5GIOE 4BHTA 3TOZA 4NHOA 3BL5A 1UUFA 2DY0A 2PGIA 4LBYA 1EPUA 1JHMA 1GAQA 2VF2A 2HR1A 1L5WA 1RVV1 4BNDA 3GJ4A 4E5NA 2WTAA 2ORWA 4HMOA 4RFSB 1G18A 2Y71A 1CEYA 1CF9A 1PGJA 4MKGA 3KQUA 4XX0A 4Y98A 2WWWA 3TLAA 4AL4A 2E4UA 4BGUA 4ZHSA 3UAOA 5EHXA 3AHDA 2JJYA 3RCBA 3VPFA 4JBLA 4EB6B 5IX8A 5JI3E 2WR8A 4M7RA 5FTMA 5JW6A 2QD5A 4CCSA 3SN6A 2E6UX 2PFSA 1QFYA 2VTEA 2CWWA 2WKSA 3GGDA 5ILQA 3W6NA 3GDHA 4C89A 4ZTBA 4H18A 2FZVA 4P31A 3NONA 2KBFA 2JJ1A 4PFQA 2RD2A 1BQEA 1EFAA 1J9ZA 4B75A 1LI7A 3B6IA 3E0QA 1S2NA 1R50A 2XXBA 3ISVA 3K4PA 1ZM7A 5LL6P 1FMTA 3CW2A 2QX9A 3QOFA 4EG5A 3Q87B 3I4CA 5NLLA 1EDDA 2CZCA 3KLPX 4X8MA 5L6LB 3BREA 1V9LA 5EKDA 1YZ3A 2AD1A 3F3MA 3T95A 4DNOA 1MUUA 2BFFB 1OWNA 4HNSA 4F91B 2GHQA 1Y33E 2QNBA 3NC0C 3NBUA 4Z4GA 3QYPA 1SU8A 4YI3A 1GR1A 4MUIA 2IU3A 5JAUA 3HB5X 2NPFA 5LU8A 3ESAA 1NC3A 1GKYA 4RENA 5HILA 2FSHA 1T2DA 4MQ4A 1Y3AA 2MIIA 2ZVPX 2EZUA 4EAQA 1YIAA 3NNSA 2QXYA 1ODCA 3O21A 1QV9A 1ISPA 3KPYA 4HDRA 1WZ2A 2IJGX 1ILWA 4LE1A 5L4LA 4J3NA 3V3KA 4BFWA 4PHTA 1QKJA 2VT7A 1EM8B 2ES4A 4X3OA 1OIVA 1SC1A 2WILA 3F4LA 4H4CA 5J1SB 2EJTA 5IMBA 1H66A 4COOA 2YY5A 2IOFA 4Q4HB 3WMFA 3TGLA 1LTKA 5HYVA 5DCUA 2FUCA 5K5EA 1BXRB 3B3GA 4JC0A 5I48A 1QRDA 4D25A 1OLUB 3K6JA 4A27A 1JLLA 4V0QA 2WB2A 1NKVA 4LMRA 1C3VA 4ACAA 1IG3A 2XVXA 2W70A 1OAAA 4Q3NA 4DR7B 2HA5A 3JQDA 3MJVA 4I1VA 4OGLA 4Z9XA 1V5GA 3UT5A 1W4ZA 4G0NA 4U2GA 3AR8A 3CQ9A 1RQNA 2DH5A 1S7CA 2CNWA 4D5GA 4OV6B 2AFIB 1LH0A 2ZQ5A 4G81A 2SKEA 3FDZB 4U2EA 3SDSA 3GLHB 4B3SB 3HWSA 3NJ4A 1A5SB 4FGWA 3HLKA 3FYUB 4HSGA 1GZVA 3EFHA 2KQUA 2O0LA 2A30A 4H7FA 1FFCA 4LG1A 1QR6A 2JEYA 1PUXA 4S3MA 1P0IA 4F8YA 2FW6A 1YCFA 3KJQA 1U28C 4JQZA 1QVZA 2E4AA 4P54A 3A1WA 3U31A 1H8HA 2B6HA 2FQYA 2KI5A 4DZRA 3T35A 3UG7A 2ZM6B 4G5QA 3FKSA 3SLRA 3SBEA 4EUNA 3T5PA 4MJXA 4F2HA 3RSSA 3CCBA 2RBKA 3EXFB 1T9GS 4ZJPA 1PEDA 3QFRA 4PSVA 2W2KB 5L4NA 1TEVA 4LHYA 2ZUWA 2Y0CA 3B6JA 4Q1EA 4R7TA 2J9RA 3VBEA 3GH3A 1BW9A 2DWCA 1RKVA 4JENA 4L76A 1MIHA 1I80A 2YWFA 3K6SA 3TIVA 5LVAA 4D43A 2IP1A 4P0PB 1ACJA 1J0AA 3KJGA 1SVKA 5ENZA 1TKAA 3K0FA 1AV6A 3L7OA 2JARA 2IZ1A 3MJEA 4K6KA 2WSSD 5CB4B 4CI0B 3G8YA 3PJFA 2DM6A 3T06B 2QTLA 2RGNA 3PGLA 3NEPX 4GOLD 4MYDA 2OCXA 2F3SA 3VNBA 2GYYA 1ECFA 2QIPA 4L9RA 4BTVA 2QMOA 4YQZA 3PC4A 3U3KA 3GBSA 4CMIB 4J4TA 4K46A 4RFVA 2DFNA 1L4YA 2BH2A 1P0CA 1EP1B 2QTRA 3C74A 3FBWA 1Q7TA 1WS6A 1D7AA 2PGDA 4O2AF 4EG1A 4IDQA 1AC5A 3ANSA 5CFNA 5FA6A 4F92B 1DDOA 4OQYA 3IRVA 3MPOA 3TKLA 4EA6A 4CKWA 4G36A 1L5YA 4E88A 1PR2A 1Y3FE 2O1WA 3FWYA 1XMXA 3F9IA 3MBIA 3E8SA 3PL5A 1LQUA 1XR3A 3FCOA 2OCDA 1PFVA 1CQWA 4RK7A 3C4JA 4M22A 4XOIA 4XR4A 4GVPA 1K7CA 4YJDA 3RYHA 1USWA 3UXYA 1ZISA 5BSUA 2H07A 4ENSA 5JISA 4YROA 2VDMB 4WIAA 5U1PA 3UMBA 1TU4A 1RMQA 3MNFA 2DXIA 2A3RA 3OCCA 3OPNA 4G4SP 5DPMA 2RK3A 5CA1A 5I7SA 3OHSX 4ZAFA 5ALWA 1JRLA 2BRUA 3F5DA 4N0QA 1RMYA 3T5GA 3WGIA 1CRWG 1V39A 2J87A 3ND7A 1YWGO 2DPHA 2LNDA 2VBCA 5EYPA 1O77A 1O58A 5B53A 4ZCLA 3VR6A 4D6XA 4BQQA 3AFIA 4ECEA 1BD3A 2WKPA 4LZAA 3TTXA 1M2OA 2ZGVA 2QI9F 3DO8A 5DM4A 3FHCB 4WACA 1KY5A 1JKMA 1EB8A 2XWPA 3OC6A 3ZWMA 2B83A 4BTEA 3CBQA 3MJTA 5IDWA 1VE9A 5AK5A 2JDID 4FMDB 1X15A 3Q3EA 5E4FA 5FNVB 5KVSA 3HJTA 1JR2A 1YE3A 2F8MA 4RA6A 4ZCRA 3NDIA 1SWVA 2EGHA 2IV7A 4J7XA 3E22B 2PWAA 2FPLA 3AIIA 4JLDA 4ICIA 4KR0A 3W8NA 1N5KA 3I5UA 3CVWA 4GEKA 3FCSB 2RB4A 2BTQB 3OX2A 2ZZMA 4WASA 2N9UA 4F6CA 3DBOB 5AM0A 5HZKA 4B31A 5K0JA 2HRBA 3C14C 3ETCA 3ZQ4A 4Q19A 5KNBA 1G6KA 1WVIA 3H8SA 4L57A 5CLQA 4ZVMA 3SR0A 4LHXA 3MSCA 2FX2A 4KX3A 2CUZA 1T5OA 3CBGA 3IMFA 2AC4A 1U3VA 2PM8A 2XMCA 3LCJA 4OK5A 3EGEA 1XRJA 3MT9A 2HBQA 2QZPA 3L06A 4MVJE 5A7FA 4O3FA 4MEAA 2HL6A 1H6CA 1YVRA 2QDKA 4N3NA 3S5UA 2R7LA 1S1MA 4RKWA 1QZUA 3EBPA 3GP3A 2ZI6A 3I01M 3JSXA 3EZFA 2J67A 3RV4A 1HQCA 5DYTA 3K8ZA 5DXFA 5JH7F 2ASEA 4ZDJA 1DRKA 2PKEA 5M2QA 2IUEA 2J07A 1ZXLA 4PLFA 2JH3A 3GFTA 4R3UC 1XELA 2Y3IA 3L07A 1GFIA 2JJQA 1E1DA 2PJZA 2Z5FA 5J63A 3RC3A 4LRYA 1R4NA 3NVKI 4PXSA 5EWLB 4PO9A 1Z6TA 4QD3A 5FPKA 4L3OA 2V9CA 1E2BA 1XQ6A 4QSHA 4P08A 2GBCA 1RLMA 2CJWA 3OC0A 3PENA 4MV8A 4R54A 4LJKA 4LWOA 5K3BA 3NBFA 3YASA 1FUEA 3AXSA 3RK4A 2ILTA 2B78A 2FZWA 3K92A 5J43A 2ZRPA 3DDSA 1SQGA 4GF5A 1LDMA 1S3IA 3LS2A 5H68A 1Z26A 2A35A 3SHFA 4ESEA 5E2AA 4ZALA 2DPLA 2NZWA 2Q5OA 3JATA 1YR6A 4OHUA 1E6WA 2G17A 1QIEA 1F4VA 3SY8A 3EA5A 4WCDA 1F5NA 3GEHA 1L8AA 4RDHA 4U6NA 3TLEA 3IUPA 2W2QA 3PLRA 3CF6R 3HP1A 3PQ4A 3EGDB 3SHTA 3ELYA 1UDAA 1YQWA 4MA4A 1NYLA 5CB6A 2F00A 2WSLA 4QOFA 1ODFA 1U7UA 5GVSA 1Z6ZA 2PZAA 2RI1A 3QXXA 4KQ6A 3EAGA 5EIHA 3ESBA 5KOYA 2NWQA 3H0KA 5TPZD 3HRHA 5A5DA 2XHEA 4R2MA 3AFNA 1A4XA 1E3DA 2ZIVB 4H4DA 4F5DA 2R9VA 5MN6A 4JI7B 1Z0UA 4D9GA 3WMWA 5DIFA 5JRZA 2D3WA 3TG8A 1G3MA 3E9MA 4FZJA 5A02A 1H42A 2OV1A 2ZIZA 1YR2A 4DGQA 1CUAA 4HZUA 3WQSB 1BJTA 3K9NA 1RYFA 1BEEA 4UU1A 4FGSA 1JYSA 4MCHA 1SQ6A 2J45A 3QXJA 5DM0A 1W35A 4DSNA 4YMLA 2CVPA 1W8DA 4FQ8A 1G3UA 2X5JO 1RADA 4QICA 3WZLA 1BVRA 1YE5A 1LEHA 3F6YA 3HYTA 3FPEA 5T3YA 3O75A 1EK5A 3I09A 4HWTA 4M7WA 1LVHA 3OCYA 4ENRA 4Y2SA 4LJ8A 3WKEA 4AMYA 5ARBA 4MDYA 1OB2A 1JYFA 1X9GA 2EFCB 2X2OA 4PR3A 3JAKB 5F78A 1LWNA 4ZAWA 4BP9A 2DSTA 1OHHA 3N2GB 4C87A 2OHVA 4DVGA 1GPAA 2BCEA 1K7YA 1L4UA 1XCLA 4C7BA 3SU8A 4OB7A 1K86A 4Z1OA 1NWHA 2O2XA 3VV2A 2BGIA 1Y4SA 2YMQA 3PEEA 4BMCA 4G25A 1A2OA 1HYEA 3QX7A 5ERGB 4CM1A 3RUAA 1X1BA 3GLFE 3TQTA 3KYJB 1MAUA 1L9XA 3RJMA 4AJKA 4QGGA 2QRMA 1K7XB 4NHEA 4X7PA 5ALDA 3T9EA 2HWKA 5KINB 1CZUA 4IIJB 4RA9B 3QEKA 2L17A 1QE5A 2ZB4A 5FTWA 3OCXA 1KY2A 3ZBUA 1AA6A 2ZE7A 3TW0A 3LUJA 1WUHS 3VDRA 3BE4A 4IH4A 4L5AA 3AR9A 3MJSA 4RANA 3W8EA 4CIVA 5F1PA 5CB0A 1O2DA 1ZCZA 3EPPA 4BO4A 4OHMA 2DUWA 5JNTA 4ZI7B 2V4UA 5MGNA 4BVBA 3QUQA 2B30A 1SMKA 4NMHA 2PBZA 3FWPA 3TQCA 2GAFA 2O1EA 4MMZB 4C6HA 2PT6A 1CY8A 1N92A 5H82A 2P91A 3KEMA 1QOZA 2PGAA 3JV7A 4M6WB 4OLFA 1X0VA 4OHPA 4RF3A 4NDNE 2ATXA 2AW3A 2BTOA 2FWAA 1K6MA 4ZHQF 1FJXA 2XDQA 4XGRA 5TF4A 5TMDA 2EV9A 4LBWA 2YFHA 1F4PA 1NRXA 4JYZA 4ECAA 1BROA 2FFJA 3O31A 1UAGA 1FNNA 1W87A 1NQAO 5ERYA 3LRXA 3DKKA 2O2CA 3BXOA 4RKRA 1NBWB 2RE8A 2MYPA 1FTSA 2EQAA 2ZBFA 4OK6A 1JI3A 2OV4A 4YVFA 3NM6B 4X92A 3S2ZA 2F64A 1DLIA 2J0UB 1CE8B 1SO8A 3VZDA 3OLWA 1NN1A 4XWOA 1WMAA 2RFLA 4J6FA 4ZVOA 3R7WB 3HJHA 1GVNB 2V7VA 3EZLA 2I3AA 3O4GA 3SJBA 1T3LA 3EXHA 3RC2A 2G9NA 2X2FA 2I6SA 3ET4A 3WYBA 4WA8A 2V03A 1UCFA 3EX7C 4PF1A 3DLTA 3A4YA 3SS7X 4E7PA 4DLWA 2C20A 1IZYA 2AKEA 1PR4A 2ZQYA 3I6IA 4ROTA 4YP1A 1DELA 3H5OA 4KUGA 1K3UB 2QTGA 4IIVA 4RHYA 1P0FA 3CY6A 3OWXA 4GRIA 1XRMA 1A9YA 1WDWB 3EMKA 3G79A 4LXXA 4M1SA 2PL1A 4JI1B 3ZHVA 5B30A 2UUAB 4A82A 3EVNA 2GCOA 1KP9A 4I08A 4U2FA 3WAGA 2QTBA 5AW6A 4PIPA 3GZJA 1ACMA 4WOJA 1M67A 2HPHA 4XGQA 5FNZA 3ORSA 4Q03A 4YB8A 1NIPA 4JBHA 3FRHA 1V35A 5FEUA 2IVFA 1TRKA 1EFHA 1HDXA 2PLRA 3IOCA 2BHSA 4MRRA 4AZ3B 3AR4A 1HZZC 2XWJI 1SIOA 3GNTA 3VTKA 1GPLA 1T3SA 1Z22A 3B9PA 3QENA 4G0WA 2I55A 2FDRA 1TT7A 2ZREA 2MINB 3ETLA 4CMEC 5IBRA 4B7AA 1PR1A 3F6CA 4LGMA 3IAUA 3AUSA 3E58A 3N0RA 4R81A 4NU6A 4XDHA 3UJDA 1U2QA 2UAGA 2GCPA 2MU1A 1TU3A 3D0KA 3HO6A 5EQJB 1CUWA 5EKXA 5I5EA 5DLYA 2RHGB 4HUQB 4KMRA 4JITA 3SZRA 3M6FA 3S7TA 2BHTA 1A3CA 1MB0A 4RGVA 1PR3A 4RK0A 3W4KA 1UMDB 4MPDA 2FPXA 1SRRA 4EMSA 2SKCA 4KTVE 5IHXA 4YRMA 2IHUA 1N7JA 3PEYA 1FMLA 1H2WA 2OCBA 3ZXIA 4HMPA 4MGZR 4DEYA 3Q40A 5HZHA 3W8FA 2RARA 4E51A 1RM5A 4X6UA 5KAPA 1G0NA 2Z09A 3NBXX 1O57A 5IJ9A 2G1PA 2HRZA 1JHZA 3V4PB 2D6FA 2C2HA 2G67A 2DHCA 2R8YA 1DFIA 1MOZA 3S27A 2XOKD 3NNNA 2W9XA 4LJ6A 3RYTC 1S4QA 2AI1A 4JBWA 5CM9C 3O26A 1N2CA 1Z2EA 4OYLA 2CK3D 2DYKA 2OG1A 2YFKA 4URWR 2H3HA 4GIBA 1EHIA 5FUVA 3Q3HA 3TRHA 3ZDRA 1EKXA 4DIUA 5TEVA 2XZLA 1GQFA 1R0ZA 3AHFA 3BQMB 3KVRA 2AYZA 2PKQP 2XIJA 3LC1O 2YYZA 4IDPA 3LWZA 3ZI0A 3F2IA 4EFKA 5HM8A 1Y1SA 3NATA 4RIHA 4Q4AB 3W77A 2WF9A 4RVFA 1YR9A 1NN3A 1FJ2A 2GTHA 1MX5A 1V5WA 3I0MA 3CFYA 3VJMA 4C0HA 4MSUA 4TLEA 4ZXFA 3C1TA 4HXEB 2BFOA 2E37A 2JD1A 5B1HA 2AN3A 2W48A 4NENB 3LCRA 1IY8A 2YHBA 5JH7A 1GPH1 3I04M 4GWLA 1JEJA 3BIJA 3RSGA 1O3YA 4Y1FA 2Q4TA 4F97A 4WA7A 5KWVA 1DUIA 4RF5A 1GUFA 4GI7A 1GYQA 1Q92A 3M6IA 4LY3A 1UMBB 3ICPA 2R5FA 2RHMA 5FD8A 1NX9A 3DTVA 5TB5A 4COKA 4Z1MD 3N5CA 2EKLA 5IMSA 4HN4B 4FHCA 4QL3A 2HK7A 4A1OA 2NU9A 1S2GA 4C4PA 4CV1A 1NKSA 1TW3A 4ON9A 4AIRA 4LXUA 1AHNA 1K63A 1Y8CA 3GJ0A 3IUEA 4GT1A 2A5DA 5ECYA 4UPDA 3WBKA 1NU8A 5B36A 3ZI7A 1FPQA 3R9IA 2YHIA 3GA7A 4KQ1A 3DW3X 5AXBA 1NI5A 3ZCXA 4EKDA 5IKEA 5K8UA 4UMFA 2FV8A 2EZTA 4QBTA 5BN3B 2GPSA 4HFMA 1LNZA 5P8WA 4BNZA 4DJJA 2OENG 1UDCA 1T36B 2FEWB 3PEVA 3B2QA 3UK6A 3PUYA 3WIDA 4KUHA 6ABPA 3GLFA 3D8UA 4DUYB 1ADGA 3I45A 4JGIA 4DBVO 2I2DA 3EPKA 3FWHA 3EGXA 4W9RA 5CDGA 1YVUA 1XAIA 3P9NA 3B13B 1U2RA 1HTTA 1KVTA 4LRQA 3TMKA 4UUNA 2ZTUA 3B2EA 1UP4A 2WJGA 3C98A 3C16C 3DHWC 3ZGYA 1F60A 5HXAA 2ONCA 1F2TB 1AUOA 1BRMA 4L22A 1TQ2A 3O84A 4AN0A 4TKVB 5CVEA 4ZQCB 4PXYA 2A5YB 2VSXA 1TK2A 4PO1A 1R9MA 1FTYA 4Q1AA 3N58A 3LX4A 5EIBD 3K2EA 4LCJA 5CDSA 1QNFA 1JH8A 1S8AA 1OE0A 1Z4MA 2YRXA 1WZEA 3M9WA 5DE3A 3TXYA 2VJDA 3N2LA 1GPWB 4GOOD 4IIYA 2VJNA 2YJ3A 4RV5A 1KFEB 4RH3A 5D51S 3R7BA 2WJAA 5D3ZA 4WW0A 3MRVA 1Z0JA 4YMIA 2JRCA 3BC1A 2LKCA 4GNKA 4DSOA 3PEFA 4CIWA 4K3VA 2X8JA 1N2JA 1POWA 2W22A 1D03A 1NVTA 3LQFA 4HQ6A 4MB0A 3VO2A 5K6AA 4AY2A 2FFHA 3WLKX 2GN1A 4QRDA 1B6RA 5CMLA 1TF2A 1IWBB 1DXQA 4KYTA 1V43A 4CF4A 1TAQA 1ULUA 5C8ZA 3W5CA 4QXAA 3L0BA 1VL8A 2CNLA 3KWJA 4RDIA 3ZGOA 3PUXA 2G77B 3Q7SA 1N5RA 4FEGA 3WGMA 5KSWB 4ND2A 4G0ZA 1LLUA 4CDRA 3AF2A 3GB9A 1G60A 2AUTA 1P8AA 3HO8A 4RGBA 1XC7A 5JAHA 2AHRA 3TF5A 4AY4A 5A9SB 4WDRA 2E4VA 5EUCA 3C45A 3WLTA 3B82A 4O2RA 4X71A 2AWOA 2AJ8A 2W2XA 1UP7A 2HF8A 1M1XB 2GQ0A 4K9MA 3P9QA 4P36A 5AW2A 1PNRA 1KR2A 3C3BA 4IJMA 1H4TA 2VUIB 2GI4A 4DCGA 3HHPA 5EY5B 4LYFA 4ZP1A 3G5AA 3RTCA 4AS2A 4YMVA 1Z0DA 3GWZA 4WZAE 3EXFA 4UU8A 4ZT7A 1GHTA 2W2KA 2J6BA 2F1RA 2QPAA 3ELBA 3V1MA 3LUAA 2ZR0A 3VJRA 1C3OB 2Q2OA 3F74A 3P97A 1ZR2A 2WTNA 3B8EA 3TW4A 3WNCA 3SZGA 3D31A 3U3ZA 3WLRA 3DSRA 1JQEA 3QNWA 4LKRA 1J6UA 1TTPB 2YVAA 3UJHA 1WUJS 4MWDA 3U2QA 2OUIA 2O8NA 4CLRB 1JFFA 2A0WA 2ANBA 2OO3A 2GS9A 3I39X 2OD9A 3FNQA 3DE1X 4KPEC 1E6EA 1TYCA 4BEBA 3LDGA 5AICA 2A0XA 1B1AA 3AILA 1W2GA 2AG1A 3A2NA 3AQ4A 5COAA 5KWIA 1RZRD 1XZLA 3A7EA 3JQ6A 2NUTA 4MKFA 4D81A 4IQFA 2B4AA 4KXXA 2P41A 3G9UA 3PHCA 1Z36A 3TUZC 5KOHA 4JI3B 1SHUX 1PNOA 4BNKA 1XCBA 1OZHA 1GPKA 1GDDA 1L5VA 1QHGA 1W5EA 2D5CA 2O52A 5LLTA 4L0DA 3AEYA 3D5EA 3QLUC 2X15A 1CNEA 2QUHA 4F6RA 1VXOA 3DE5X 3DPSA 5HBGA 1Q1BA 3GLVA 1CWUA 4QUHA 5AOVA 4X5OA 3KKLA 1H6BA 5M29A 5HWSA 1E98A 1NRWA 4HHEA 2HV9A 1WD5A 3VHRA 1S02A 3WQHA 1WSAA 2JCSA 2OBLA 2YFYA 1W85A 1O6BA 4WOPA 3R2JA 1T9ZA 3MGBA 2VQSA 1WNFA 3CO5A 3CR3C 3OCVA 5E38A 2IIVA 4DNXA 2MTBA 4O0LA 4A0GA 4GYKA 3D8RA 1L5SA 2OWDA 4FSHA 1RAGA 1SCQA 3AGQA 2JHAA 3NRBA 1N6RA 3GEIA 4ZMBA 4IZ6A 4N9WA 1GT6A 1H23A 2V6FA 3LSYA 4UTOA 4X1YA 5JU6A 2GA9A 4Y1RB 3IKVA 5EQTA 2XJ9A 1YR3A 1LPNA 1U9IC 2A4KA 5C1BA 1DGQA 4L85A 3VR5H 4CM4B 3BE5A 1YQEA 4DMLA 3LQYA 1MVOA 4H1TA 4I55A 1NUHA 4FE4A 2X3UA 4TXMA 1E0AA 1BD4A 2L82A 3BX1A 4C3UA 5J2UA 1AQIA 3DE7X 2Y99A 5FA5A 2O50A 2WFZA 3DKPA 3FF4A 2OBFA 1RAAA 2O7VA 1MAWA 2DJ5A 3H1TA 3KBBA 1HT3A 3KUUA 2QMUA 3SMQA 5M7EA 3OIYA 3N70A 4KSCA 2Y6UA 4CETA 3DLCA 1BGXT 2DHRA 3OZTA 5LA6B 3WSVA 5LB2A 3EEIA 1PJ8A 4EZEA 1HETA 2OVFA 3Q2IA 4YBRA 1NSYA 1SVOA 1VPEA 2PZJA 3V6LA 5AO9A 4D2IA 2ZYGA 3IULA 3QMVA 2BJVA 4CCYB 4EMBA 3TQIA 1IUPA 2VNAA 2OM6A 4OQPA 3WY9A 5A71A 5JYDA 1P7VA 1O96B 2I66A 3HDTA 4FCCA 3QKTA 3LMKA 4GP6A 5HDBB 4LJRA 2JKYA 2ZSEA 1HDOA 3MAAC 1RIIA 5FOVA 1NJ2A 3L7AA 4FMBB 1AGPA 4U2KA 1E3WA 1U0JA 3NUQA 3MBOA 1JR3D 3U3MA 1ZD2P 2GCGA 2PXHA 4EI9A 5FPHA 3NO4A 3IR6A 1MJHA 1Y5NA 1P72A 1JTFA 1EP3B 3CC8A 3IODA 4U39A 3C85A 3QU4A 4RX1A 1ZYUA 1J24A 1YD7A 1YJAA 1K92A 4J0JA 3FVVA 2ZAIA 3RFUA 2Q21A 4NV0A 4E5YA 4RJ2A 1FQKA 4YPOA 3RARA 4II3A 4EKIA 3TGPA 2HU7A 2WNIA 4HRVA 3GEPA 2WP0A 5CYPA 4ABYA 4QDXA 5EJ9A 3K94A 4JLMA 4XWYA 4FNOA 4OCZA 4QUKA 3MCAA 1EZZA 3LK6A 1II0A 4FGUA 2CDBA 4KPUA 3E9DA 2J3EA 1XMOB 2GKSA 1U0RA 4PYKA 3F9RA 1N6IA 2G4CA 2P4SA 4MV5A 2A1TS 2HEIA 1B76A 5T6BA 3RU7A 3K7EA 2Q99A 1KMIY 2BJWA 2QUAA 1UT5A 1A9PA 1JDBC 2WD9A 2WTBA 3EVZA 3KSMA 4M1KA 4CJXA 3WLMA 3GWGA 4BX3A 3N28A 1K5HA 1Q21A 4CR8A 5ESRA 3O8CA 2GM3A 3HQ4O 3VBCA 1D09A 3OZAA 3PCXA 4M8KA 1NOIA 5MDHA 4JI5B 2VKQA 3JQGA 1KOJA 4ZV4A 1SBCA 3NKFA 4BLWA 1M8PA 1RHRA 1A5ZA 4O2BB 1C80A 4XYMA 1PW5A 4WNYA 3THWB 2GK4A 4Q5IA 4X1IB 1XNJA 2R1VB 3HKBA 2F1IA 1JLKA 4XPZA 4BJ3A 1OKKD 5K03A 1NLMA 1A9QA 3UWPA 1UM9A 5M3BA 2JCGA 3QVMA 2BMDA 1RWVA 1WMDA 1IPHA 3KL2A 2G88A 2CLDX 5BORA 3PGKA 4KTTE 4PO3X 5IHPA 1E9RA 1KDPA 2QVLA 1A4RA 1E3TA 1HFKA 2P2YA 4HEA6 4RJJA 5BR1A 4LCEA 3DO6A 1W29A 5B1DA 5LOVF 3EQ8A 2ZIWB 3ZD8A 2ORIA 3NTVA 5F64A 1XHFA 1JVBA 4XAQA 4JI2B 1O95A 1NLYA 2AKAB 4RXTA 2IP4A 2HF9A 1QO7A 2EZ4A 3B51X 3KTFA 3MM4A 5JNLA 1JPVA 3ZV7A 1LDNA 3NEAA 4PPYA 5IF9A 2I62A 2Y4NA 3K1AA 5B3JA 3QXGA 4Q7EA 2VJKA 3ZY4A 1QFXA 4QDUA 1DV2A 2QSJA 4UE3S 3A4LA 4EHIA 1XZDA 2FPIB 5BW5A 2AE2A 3O38A 5EIBC 1XNQB 1DJOA 1KL7A 2GPNA 4NCJA 3W5VA 2ERCA 4R0VA 4U0KA 3JD3A 1Z5UA 1TAHA 4IXMA 5EIXA 1JIXA 3TFWA 4A4DA 4M89A 2WWTA 4TMFA 2WU1A 5EP3A 3V2GA 2X8BA 2XA9A 3TR0A 1Y7TA 1Z0IA 3HXTA 1XZAA 2J4FA 3PTAA 4QQ8A 4MUHA 1NYRA 3NHJA 13PKA 1E66A 2PA3A 3L02A 1C8BA 3OESA 3QUAA 5L3ZA 2NG1A 2IUSA 1VI2A 4DV3B 4OP3A 5JCJD 1VFNA 3KR1A 2B7LA 5CXXA 1MENA 4LRWA 3E9CA 5FOUA 3DKVA 4NKRA 2H51A 2W6JA 3FFWA 3KPVA 2O5RA 3OE7A 1KMQA 3HLTA 3T6KA 5CIYA 1JAYA 4YDHB 1OFTA 2XMRA 4XDYA 2JFXA 3TCKA 1PJCA 4X41A 4Y2VA 1WIWA 4N3BA 3ROGA 3WKCA 1OWLA 4ME6A 1RIFA 2YRFA 4URVR 4ZT2A 1YBHA 3AR5A 3OD5A 4PQFA 1BKDR 4HY3A 4DPKA 3TLBA 4YRBA 1P81A 1GKUB 4BAUA 1QE0A 1KI6B 4MITA 2G0TA 4F2PA 5KYNA 1CETA 1I3NA 4LWQA 3FMFA 2HK8A 1EXMA 1NBMD 1LQTA 5BQFA 2ZANA 4JMLA 5F1YA 3DWEX 5CFLA 2BGRA 2FEKA 1U7HA 3AETA 1PG2A 3B7GA 1YBVA 4FILA 3I2HA 2O4UX 1OBCA 4UEOA 1IHXA 1YZQA 3BSWA 4ILKA 4Q93A 2QY6A 2R0QC 5FWNA 2HM7A 5AVRA 2X0KA 3PC8C 1Q16A 4CCAA 2PZLA 3HZHA 4Q4JB 3K4HA 2HSWA 3JQAA 2RDMA 3C7TA 4RGYA 5DEOA 3T7KA 1YFJA 4PIMA 5HJ5A 1RLUA 1R8SA 1Z2DA 1Z12A 4AZWA 7ABPA 1W4AA 3IDZA 3OAAA 1Y4DE 4JEHA 2DQ4A 3V5NA 3WJ2A 5G3ZA 5D3MB 3T7CA 3WP0A 4E5DA 3CG4A 1YS2X 2G9VA 4UCFA 3VXKA 3WC4A 4JJ6A 1FU7A 1UWKA 3CF4A 4I9FA 1D6JA 3GY0A 3X2FA 3O8QA 3H2KA 4EPVA 1KWKA 3C97A 3KELA 1FY2A 2PGJA 4G23A 3ONFA 3OTIA 4NZZA 3OIVA 5C8YB 2P62A 4OX9B 2D7JA 1J1UA 1T1SA 3X1WA 3LUCA 4XM1A 1LSSA 4RPGA 4GLFA 1G17A 1L5GB 4Z7NB 3L84A 3ZLJA 2NZ2A 2IXDA 1Q83A 1MJ5A 1SH7A 1T8WA 3LY9A 3SJZA 2VJLA 3H9QA 2XVYA 5AI5A 1UJ6A 3TIFA 2XE7A 4DEXA 5J4VA 2VHUA 3TE6A 2V0CA 2HEGA 2NO4A 4YJGB 2CXUA 3WYFA 4C7KA 4Z54A 3GPLA 1MD9A 4MUYA 2C7PA 3RH0A 2A3NA 3LJKA 4IMJB 4PZYA 4MW5A 4PBRA 4LV8B 4DUGD 5FL7A 3KEQA 2B8NA 4HGZA 2KPOA 4FYIA 4PNEA 3EH2A 4DQKA 3DCJA 2XDWA 1TTHA 4IX9A 3PQ6A 4F4JA 3S8YA 3C3JA 3PA8A 3KKKA 4LXHA 4RTOA 4D96A 1AGYA 1IJKA 1ONPA 5HIMA 3OIUA 4MAAA 5ALEA 1JW9B 3U4CA 1FSGA 4WAUA 2B6NA 4AXXA 5JYCA 4MQEA 4F3CA 1QHFA 2LRHA 1KQ3A 3PJGA 3WB2A 5JMTA 1PV2A 1QKKA 2EFEB 5CIWA 2QUBA 4NOJA 3CW8X 2WTEA 3CVOA 1FFWA 2M32A 3SJUA 5TLSA 4WT7A 4UXHA 3ZHCA 4L6IA 3A2KA 1FLNA 1Y3DE 2JHCA 3EZGA 5BP7A 2QAGA 2BJHA 1C5KA 1B3RA 4BL5A 2FZGA 3UOAB 4R4JA 5CH5A 4UATA 3FD8A 4CLHA 1XYGA 2ZQZA 3UATA 3ZWAA 1PS9A 1MC1A 2EBHX 3KQYA 1TKCA 1JQAA 4HX9A 4RZXA 2HLDD 2J9YB 1RCUA 5FX2A 2Q5JA 1DAKA 3A6LA 3D0QA 3I8OA 3E05A 3JWIA 3NALA 2NPIA 4FR0A 1SHTX 1R0KA 3TW8A 3WK6A 1R0LA 3WKAA 5KSYA 1TTTA 1JSCA 1O08A 4UU0A 1JLSA 3K0CC 4YRKA 5HQTA 2WVJA 4F5ZA 1HDIA 1ZN2A 4P3NA 4HV4A 1TECE 4ZVKA 2C29D 1E5VA 2EX4A 3PR2B 1H2YA 5H0IA 4EA7A 1DAGA 7AT1A 2OFOA 3GL9A 2C3YA 3TNFA 5HUJA 3H6KA 4M9QA 3B38A 3WGUA 4CTJA 4EA8A 1S2DA 3GRCA 4PO8A 2OT3B 5EIAA 1E61A 4I5DA 1OGJA 1NQWA 5I8WA 1CPYA 4J6EA 4WV3A 1Z18A 5GAJA 1SHLA 3KIPA 1FDRA 4JGBA 4YP0A 1P4RA 2QV0A 4A6PA 2FSVC 4ILEA 2FZCA 3TW6A 5CXUA 3A70A 4P82A 4RH1A 2AR0A 4MVWA 1MQSA 1XTPA 2QNIA 3DMYA 2VUUA 4CKEA 1B93A 5JLAA 3UFBA 3V4SA 1YIOA 5E7MA 3LA6A 4H7JA 2FF5A 3D6AA 3W4IA 3KT0A 5KYKA 4GR5A 3HR4A 2HMUA 2P8SA 2WFLA 1NW9B 4RQUA 2GILA 2SHKA 3IIEA 1C3LA 2P9ZA 1A7AA 5AW8A 1BDJA 1G9SA 1RFGE 1V16A 1WCIA 3NIGB 1I7QB 2PX3A 4HEHA 4D97A 4DDHA 4GG1A 5MFPA 3V4VB 3JZMA 1N2EA 4TZTA 4YMGA 2C4WA 1AHPA 1BFKA 3OUTA 2F1OA 2I54A 5KC9A 1LPMA 2O6LA 2CCGA 3TR6A 1EG7A 2HD4A 2NO6A 1DRVA 4PG6A 3M33A 2W8ZA 5DT2A 3WGKA 3WGQA 1EESA 1C4KA 1SG9A 3B6KA 5HEKA 2J7KA 3AL2A 1ZHHA 2ISSD 4UCWA 2WVHA 1HNXB 3N75A 4ZKDA 5JEDA 2DQZA 4N7BA 4KB5A 3SSMA 4GW3A 2DT5A 2Z4RA 3WRXC 3I73A 2Q7DA 4OHKA 2XQIA 2VDWA 1TM2A 4QFDA 2VC2B 1L7QA 2WIGA 3BXXA 4ASUA 4ES6A 4G0UA 5ALKA 4M86A 1I24A 1JDPA 2EDAA 4HJXA 5LOVA 4CKYA 1U80A 3SEAA 1YDMA 3AR2A 3IAS6 4D9MA 3KR9A 4MUBA 4Q1CA 3K31A