3JWJA

Crystal structure analysis of the methyltransferase domain of bacterial-avhen1-cn
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
199
structure length
188
Chain Sequence
SLNQQRMNGVVAALKQSNARRVIDLGCGQGNLLKILLKDSFFEQITGVDVSYRSLEIAQERLDRLRLPRNQWERLQLIQGALTYQDKRFHGYDAATVIEVIEHLDLSRLGAFERVLFEFAQPKIVIVTTPNIEYNVKFAHRFEWTRSQFQNWANKITERFAYNVQFQPIGEADPEVGSPTQMAVFIHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Hen1
publication title Structural and biochemical insights into 2'-O-methylation at the 3'-terminal nucleotide of RNA by Hen1.
pubmed doi rcsb
source organism Anabaena variabilis
total genus 67
structure length 188
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08242 Methyltransf_12 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3jwjA00
1X1DA 2HV9A 3BXOA 1ZHFA 2B9EA 2AVDA 2G70A 5F2OA 2AZTA 4LWPA 3SSOA 1JQDA 4QDKA 5EVJA 5DM0A 5IKMA 4E2XA 2BZGA 1YFLA 2CL5A 5FHRA 3THSA 5JR3A 3LKDA 1R6AA 3EVDA 2C7OA 1AQIA 3HVHA 3GRZA 1P39A 4QVGA 5FULA 5EEHA 4R8SA 3OU2A 2JHCA 4ZTBA 1RI1A 1RJEA 3FUTA 1R18A 3M33A 3HVJA 2PGXA 3NWBA 5HFJA 5DSXA 2O07A 1JSZA 2ZZKA 3TM5A 5ICEA 5EQJB 1X1BA 3KQOA 3THRA 3UJDA 4C04A 5C9ZA 5JUWA 5LSAA 4MHTA 4GF5A 3G2OA 4P7KA 4ER7A 3OU7A 2EJTA 4FSXA 3GXOA 3P9CA 5LQJA 3P8ZA 3TR6A 3JWJA 5E2BA 5LQKA 3OCJA 1EIZA 2BM8A 2IFTA 3FTCA 4C05A 5LQAA 2P7IA 1AV6A 3HA3A 4YUWA 2IPXA 4OBXA 2PT9A 3ELUA 3G5TA 1DCTA 1KIAA 2WA2A 3KR0A 3G5LA 5U4XA 2OB1A 5GM2A 2ZIGA 1D2HA 3GU3A 3LCUA 4HH4A 4HRAA 4X1OA 2P7HA 1NV9A 1XCJA 3G2PA 3UJBA 3ER8A 5BW4A 1G8AA 1OR8A 2XYQA 1YFJA 2VDWA 3DTNA 4AX8A 2OZVA 3OPNA 3DH0A 2P41A 2ZVJA 2V7EA 5E8RA 4POOA 3KKZA 1VPTA 2IIPA 4RTJA 4X41A 3SSMA 1R00A 3UFBA 2NP6A 3SXJA 3CJQA 3A4TA 1WS6A 2OB2A 1XTPA 5GP1A 2ZSUA 4RTLA 4MQ4A 2EG5A 3WSTA 5CVJA 4O29A 4C06A 2C7PA 3C6MA 5GOZA 4FGZA 4E70A 5K0FA 2LD4A 3HCEA 3R9XB 2K4MA 2JHPA 2FK8A 1O9HA 5FWAA 2NP7A 2FPOA 1M6YA 3DP7A 3M6WA 3TOSA 3UJCA 2I62A 2QRVB 2XVAA 3LKZA 3ME5A 4KIGA 4PWYA 2GLUA 2YXLA 5CCXA 3I58A 3BWMA 4R6XA 1P1CA 5DTMA 5K8VA 4RTQA 2AN4A 3TKAA 5C0OE 5P8WA 3NDJA 1NT2A 5LQUA 3MERA 3DXXA 3FPHA 5EEGA 4RX1A 4A6EA 3BZBA 1IM8A 2PXAA 3AXSA 5E8JA 3AY0A 3P2EA 3JWHA 1I1NA 3C3PA 5ICGA 3KQPA 2R6ZA 5D1NA 1KP9A 3FUXA 2ZZNA 4PCAA 5C1IA 1DUSA 2PWYA 3ELDA 5DTQA 1SVUA 2FCAA 5FQNA 1KPHA 3EEOA 3NW9A 3SMQA 4OX9Y 1NBIA 2ZBQA 4PYJA 2NXEA 1RI5A 5DSTA 3ANXA 1TW3A 2F8LA 2XBMA 5IH3A 3HNRA 4X61A 2QRVA 4Y30A 4LECA 3PLAE 1L1EA 2PX8A 3A26A 4YV2A 2QM3A 3ID6C 4EKGA 4MTLA 5KVAA 1IXKA 2B2CA 3P9NA 5EOVA 3BT7A 2Z6QA 4PYLA 1YZ3A 3FUVA 3OZTA 1RJDA 4G56A 4XUEA 1N2XA 2O57A 2ERCA 3BKXA 5E1OA 1QZZA 2VS1A 3B89A 3KQYA 3KR2A 5EMLA 5EZQA 4BLWA 3KQVA 2N47A 5DT2A 4OQDA 5GWXA 4BLUA 1ZKDA 3UJ6A 3MTIA 4WXHA 2P3LA 5FHQA 4FT2A 2P1DA 3FUWA 3MCZA 3FUUA 4MWZA 4YMGA 2BH2A 1XDUA 3EVCA 4OA5A 5T6BA 2DPMA 2IDKA 2NYUA 1YF3A 5HZMA 5DM2A 3DOUA 1IY9A 3JWGA 3P9KA 5HEKA 4CXMA 4P7FA 3OU6A 5EC8A 1JQ3A 1KHHA 2PX5A 2WK1A 3A27A 3I9FA 3PX2A 3TQSA 3FPGA 1X1AA 1BHJA 5HOQA 3KPWA 1PJZA 3GRVA 4RVHA 2OYRA 3C6KA 3TFWA 4PIMA 3HCBA 1WXWA 1QANA 4ATNA 2FHPA 1QYRA 4R6WA 4HTFB 5E9JA 3M6UA 1NKVA 2NNWB 2YQZA 2P8JA 2ZWVA 3B3FA 4KW7A 5CUQA 5FA5A 1WG8A 1XJ5A 2R3SA 3T7RA 2O05A 1QAQA 2OKCA 2GAFA 2VDUE 3BGIA 3E23A 2A14A 3H2BA 2YR0A 3NJRA 4KDRA 2VZ9A 2OY0A 4PGHA 4R8RA 4GOLD 3GRYA 3NMUF 1RJGA 2UYQA 5B1SA 3R3HA 1O9GA 1G8SA 3P97A 4YUZA 3FYCA 2YXDA 2AN3A 1NW3A 2PBFA 3M6VA 3B3GA 2AVNA 3FRHA 5FTWA 2ESRA 3EVZA 3OZRA 1SG9A 1KPIA 4PCLA 3UJ9A 3V8VA 4CWAA 3MB5A 4ER0A 4DKJA 1EQAA 2PWPA 3LGAA 3LL7A 3DUWA 3G8BA 3GCZA 4P7JA 4Z2YA 4QPNA 3BUSA 1T43A 2C7RA 2C7QA 10MHA 1NV8A 5FCDA 2UZ4A 1M0EA 2Z6UA 3AXTA 2PSSA 1XXLA 3EVAA 3Q87B 4KWCA 1O54A 5DLYA 3FPFA 5E9WA 2HR1A 3RODA 1V39A 3IYLW 2PX4A 1ZQ9A 5FWDA 1HMYA 1L9KA 5H02A 5ICFA 4UOEA 1D2CA 4HTFA 5BW5A 1VBFA 4AZVA 4FZVA 2JJQA 1MHTA 5GINE 2KW5A 4RVDA 3OFJA 4E31A 3EGVA 3KR9A 4FP9A 3DULA 1ZG3A 3GO4A 3GWZA 4DF3A 4QDJA 3VSEA 5K03A 1VP3A 2H00A 3KQMA 3LBFA 3TLJA 4X63A 4E2WA 4YV0A 3PB3A 4RWZA 5LQNA 3R0QA 1BKYA 2IGTA 4RYLA 3UJAA 5HIKA 4OA8A 5GIPE 2PLWA 2PT6A 4DM3A 2YVLA 1X19A 4L7VA 5K0CA 1NW6A 2EFJA 2NXNA 2VDVE 3G2QA 2QE6A 3K0BA 5F2NA 5EKUA 4RTSA 1BC5A 2AOVA 3LCVB 3BWBA 4IV8A 1PRYA 3EEYA 1I9GA 4M38A 2ZIEA 1KPGA 1RI3A 3AWIA 4PYMA 2G1PA 5BXYA 2ZBPA 1INLA 2PXCA 4WVLA 3EMDA 3ELYA 3HEMA 3P2KA 5CM2Z 2V74B 5FA8A 4ER3A 4RV9A 3DXYA 3HCFA 2H11A 4E2ZA 3HA7A 3MAGA 1RI2A 4P7GA 5CVDA 5EIFA 3OFKA 4Y2HA 5M5BA 2ZCJA 1G6Q1 1BOOA 1QAOA 5T67A 4P58A 3DMGA 1YB2A 3RIEA 2AOUB 3VYWA 2XYRA 3TPZA 3HCAA 3KQSA 4PONA 2BR3A 4OQEA 5DWQA 4RTKA 3G2MA 4U7PB 4BY9E 4MIKA 3E05A 2ZTHA 3P2IA 2FRXA 3T0IA 2AOXA 1ORIA 4KVZA 2CMHA 2XYVA 3JWIA 3FPEA 3LX6A 5DXAA 3M4XA 2ZULA 4HGZA 3HTXA 3E7PA 4RSRA 3RW9A 1XDSA 4F86A 3ERCA 1I4WA 2IDJA 4PNEA 1SUSA 3GRRA 5K0BA 4JXJA 1R8YA 3I53A 3HA5A 1TPYA 3DLIA 1WZNA 5EHIA 3LDGA 3KPYA 4RVFA 2I9KA 2HTEA 3EGEA 2H1RA 4IV0A 3CKKA 4GOND 5EIWA 4BP1A 2PJDA 2AOUA 1JG3A 3I64A 3DR5A 5HILA 3CJTA 4PYNA 5K0NA 3NWEA 3SGLA 1N7JA 2PX2A 2HMYB 4DQ0A 3MQ2A 2PY6A 3PFGA 5EZSA 1FBNA 3LECA 3O7WA 4NECA 4OBWA 5CVEA 3VC2A 3MHTA 3PS9A 4RVGA 3UA4A 3HM2A 5FADA 3EPPA 2FYTA 3G8AA 3OZSA 1FP2A 1VL5A 1JSXA 2ZBRA 2AOWA 4C03A 5KQSA 4AUKA 4C08A 1YUBA 2BR4A 2GPYA 3P9IA 4GEKA 4E2YA 4HC4A 2B3TA 2YXEA 5EG5A 1AQJA 3FTFA 3V97A 3GNLA 3QOXA 4IWNA 2YX1A 9MHTA 3Q7EA 2OBFA 3T7SA 3UJ8A 4M36A 1FPQA 1WY7A 2VP3A 3LHDA 3PVCA 3UJ7A 2ADMA 2G72A 1JTFA 2P40A 3BKWA 4QQNA 3CVOA 4XUCA 5GM1A 2UYHA 3KQTA 2OO3A 5E1MA 2I7CA 3GDHA 3AJDA 3EVGA 3SR4A 3KPUA 2P3QA 5EGSA 1SQFA 4C07A 3SM3A 3DXZA 3SVZA 1SKMA 1HNNA 2OXTA 4XUDA 2O0LA 4DMGA 1XCLA 5ERGB 3A25A 1MJFA 3EGIA 4LG1A 4V0RA 1F3LA 3DMFA 5E1DA 1EJ0A 4YV1A 4GC5A 3P71T 5BP7A 5CD1A 1B42A 1TW2A 2GS9A 3ER9A 3LSTA 2YUIA 3KHKA 4E30A 3GJYA 4QTTB 3PFHA 5DM4A 1L3BA 2B78A 5CVUA 1H1DA 2PXXA 1JG2A 2EJUA 4PGGA 5CCBA 3D2LA 3TKYA 3KQQA 5DRTA 4DZRA 4RTOA 2IBTA 3KPJA 2Q41A 4R05A 3S68A 5K0JA 4EK9A 3KQWA 2I6GA 5HIJA 1R8XA 1VP9A 2JHAA 2P35A 3BGDA 3HVKA 3HVIA 4K6MA 1G38A 3OE4A 2DULA 4GQBA 3UWPA 2WA1A 3QOWA 2AOTA 1JTEA 4PIPA 5CVVA 1UIRA 3BGVA 1SUIA 5KQRA 1DL5A 1P1BA 1F38A 4X60A 2O06A 3BWCA 1NW7A 3EVBA 1VE3A 3FRIA 3NDIA 4XCXA 3PX3A 1NE2A 3A7DA 3DLCA 5EMJA 3CGGA 3IHTA 4EQZA 4FR0A 1FJXA 2ZZMA 3ORHA 3QV2A 2CMGA 3IEIA 1L3CA 1NW5A 2XVMA 1KYZA 4EVIA 1KR5A 2ZLBA 4DCGA 1JG1A 1JR4A 4H0NA 5F2KA 1UFKA 2E5WA 3GIWA 3F4KA 4PYKA 1Q0SA 2IH4A 4IKPA 3EVEA 4M37A 3TMAA 7MHTA 2G8NA 1G60A 3CC8A 1AF7A 4DCMA 2Y1XA 1N7IA 5E2AA 5D1HA 4RTMA 1WXXA 4GOOD 1XDZA 1SQGA 4EKIA 4FS8A 3M6XA 4V0QA 4U7TB 4YUVA 1L3IA 5DX0A 4RTRA 3T7TA 3LCCA 5FQOA 2PKWA 3FTDA 5EHGA 3DMHA 2ZWAA 1FP1D 2Y1WA 2CWWA 1QAMA 3KU1A 4YMHA 3L8DA 2ZW9A 4PINA 4AZWA 3UZUA 3NTVA 4KRGA 3UBTA 5DXJA 4CKEA 4BLVA 2FK7A 1RJFA 5K0GA 3PT9A 5KYGA 4BP3A 1VQ1A 4ER5A 5HIMA 5GIOE 3TM4A 5E1BA 3C3YA 3KR1A 4HG2A 1P91A 2IP2A 2ZIFA 4ISCA 3G88A 3X0DA 2P3OA 4F85A 3O4FA 2CKDA 3MCTA 4GOMD 3FZGA 4HGYA 5EKXA 4GBED 5K0LA 5MHTA 2HNKA 2NXCA 3HCDA 4LWOA 3B3JA 4QTUB 5DX8A 1M6EX 1XVAA 2HWKA 3FPJA 5K01A 5DPMA 3A7EA 2JH8A 4CKBA 4PYQA 2JH9A 3E8SA 2AR0A 2OPBA 4YUXA 4FSDA 1EJ6A 1UWVA 2B25A 2UYCA 1YZHA 3K6RA 2UYOA 2QYOA 4QPPA 5LQCA 4AZTA 2ONZA 3O31A 1U2ZA 3KPVA 2G71A 3BWYA 1JG4A 1D2GA 4C4AA 4E32A 4EMSA 4CKCA 2IH2A 1X1CA 3HCCA 3TRKA 5K05A 4B17A 4RTPA 4PYOA 2GB4A 1VLMA 3NVKI 1NW8A 2GA9A 1JQEA 2BR5A 5FUBA 3B7PA 3LDUA 5DTRA 4YUYA 3PTAA 5DM1A 4FT4A 3MTEA 4CTKA 1KXZA 3EMBA 3R6TA 5E9QA 5T64A 3I5UA 2PVCA 3SX0A 2Z6AA 4KIFA 3CBGA 3LDFA 5DX1A 4CTJA 3M70A 3R24A 4HSGA 3G89A 3C0KA 5DRYA 1RI4A 2ONYA 3ELWA 3GRUA 1VIDA 4DA4A 4QVKA 4KDCA 1KYWA 3LPMA 5LQRA 1G55A 2YTZA 3CCFA 4GUAA 3G7UA 3GGDA 2JG3A 2QY6A 4M7RA 2PV0A 4ER6A 3REOA 3SSNA 1Y8CA 4QQKA 1R74A 5G02A 2NXJA 3UA3A 2AN5A 3OE5A 4PYIA 3VC1A 5EPEA 2AS0A 2BM9A 3NVMB 5K09A 5EMKA 5HIIA 2AOTB 3EVFA 3FTEA 4A6DA 1Q0TA 2GH1A 5K0EA 5CIYA 3LBYA 3CJRA 3HP7A 5LR6A 1ZGAA 5EMMA 5ICCA 4RTNA 3MGGA 1EG2A 4AZSA 1ORHA 4GC9A 4F84A 3B5IA 2EX4A 2IH5A 3U81A 2IBSA 1NBHA 8MHTA 1EAMA 2ORED 3FYDA 3IV6A 4E33A 5KS2A 2ZFUA 1ZGJA 1Z3CA
chains in the Genus database with same CATH superfamily
4E6EA 3D6MA 2AVDA 3CVUA 5F2OA 1PTKA 4QDKA 1JN0A 3OCCA 1YE8A 2FEKA 3ZX5A 4OHCA 2ZE6A 4UM7A 1YQQA 4JX9A 2WI8A 1ZNQO 4L50A 1RTTA 2CXHA 5FOQA 4EHKA 1TVEA 4KFRA 4RMNA 1UPFA 3LI2A 2W4QA 2WYHA 5CB4B 3GRZA 3S8YA 1QO0A 3R5HA 3THXB 4JSYA 1RRPA 4ZCSA 1LNZA 3TRFA 1TKRA 3KOWA 4DDHA 3BE4A 3BQMB 1M1XB 4UAVA 5T57A 1DBRA 4L6CA 3W2GA 3H1GA 2ZRBA 4BQRA 2Q6TA 3QV1A 4GX2A 1FLNA 5ICEA 2NPOA 2ODBA 1RP1A 2WD8A 3GVHA 2NOAA 1M33A 4HFMA 1AN9A 3VJKA 2XNDD 3DLBA 3UAGA 2VK1A 1PTJA 2DWCA 1FX0B 2YDXA 1EIZA 3GT7A 3ZBTA 5CG1A 3FLMA 1BDIA 2JEOA 3WBJA 2NUPA 2O8FA 1SHUX 2JJ1A 1V6CA 1NRJB 2CXTA 2H1FA 2WPDD 5JS1A 1E6CA 5GM2A 2Y66A 3UHAA 4GMXA 3E03A 4JODA 2AI1A 1IWBB 1FC0A 3C3JA 3G82C 3AM5A 3VZCA 4CQMA 1G8AA 4MICA 4TTVA 4YJGA 2DRIA 1KBOA 3TZCA 4P33A 3P27A 5KVSA 1KI6B 1XFAA 3H0CA 4X6YA 2WJGA 2IHYA 1PT8A 2O3TA 2OBBA 3SXJA 1Y1SA 4AJ1A 4EKEA 3PQFA 2QN7A 4B8ZA 1GFIA 2YNMA 2ZS9A 4J7AA 5A3SA 5JJIA 3SLGA 4UBMA 1T9CA 3DFUA 1S96A 1FTNA 2ZJFA 4Q03A 2P91A 1DRKA 3R8CA 2QRUA 2ZRJA 2ZJ2A 3S28A 4Y2QA 1E62A 4DQXA 3M6WA 2NP7A 2Z4SA 5DVZA 3DHWC 4R71A 5JJLA 2VWHA 1G7TA 2NTEA 3ILXA 1E3DA 2YXLA 3A4NA 5J9FA 3I58A 5IXYA 4PLZA 3ONVA 2XKKA 1UM9A 4U0JA 3PQ8A 1ELOA 2RMKA 4ZV7A 2OC4A 3UB3A 1T8SA 4Q4DA 1SK8A 3SS7X 2YRXA 2BPOA 1W44A 1OE0A 1DAOA 4RY0A 4TVBA 4JYAB 3QX8A 4EEKA 1IM8A 2V1UA 2BE9A 4G9GA 3AY0A 4HWSA 4S1OA 5CITA 5CP8A 4I3FA 1FU4A 1I1NA 3QFRA 5JVDB 2BKEA 2C57A 3A9UA 4ETNA 1O4WA 1B8OA 4FDTA 3QKSA 3ONEA 3MPOA 1L7DA 2PJUA 3DDHA 2G5PA 1IVNA 4MQBA 1KPHA 1CT9A 1S3IA 3HR7A 2VJAA 3I0ZA 3NW9A 4XQ9A 2KPOA 4YJ3F 4QFDA 4F5WA 2ZS8A 3W8DA 1ZWLA 2HDOA 4U7WA 3RLIA 4AN1A 4KN8A 5KNDH 4R1PA 1Q1NA 3M3PA 4XIIA 3VU1A 3ZZNA 4IIHA 4EUNA 4EJMA 1K8XB 3EEBA 4DBLC 5LPNA 2QBYA 3WKEA 1BS1A 1JAHA 3DBLA 4EYSA 3KJFA 1Y3AA 2L82A 4BV2A 4ITRC 4JUDX 4PTYA 5KQMA 5CTJA 1E6KA 4XUEA 1E7SA 1T4GA 3GIDA 3ENZA 4PO9A 3JYLA 3ZHSA 5IH7A 4QAJA 4R2KA 1X86B 3N7AA 4PX3A 3KWLA 3L6UA 4IIJA 4MVJI 2HA3A 4KPFC 2ZRCA 1XHLA 1QB8A 2AG6A 4FM9A 2W2KB 1N2HA 2QF7A 1O96A 2ZJ0A 3QJ5A 4HDMA 4CIVA 4E11A 2OGUA 3PUZA 4CKZA 1BU5A 1CRQA 1K3UB 5TJHA 1W88B 2VQ6A 3WWEA 5G4KA 3SNHA 1NVFA 2I3BA 3KKKA 2PZGA 1GLNA 3ZWCA 4CXMA 2C42A 5ARDA 3DUFB 4D9FA 1GQSA 3IAS1 4RS4A 4EUKA 1CP3A 1WOYA 1SPXA 4G1VA 2GM9A 1E1NA 2XADA 5CLLA 4CM7A 3K1ZA 4D6PA 2D13A 4D96A 4PIMA 3QPAA 3GDFA 4X95A 4ZREA 4B6GA 1Z62A 5J2UA 2P0AA 4J43A 5F35A 2VJDA 5JY1A 3RARA 4KW7A 4GM0A 1T2AA 4KQ6A 4RK7A 5AO9A 5BXQC 5CVTA 2WQ7A 1XYGA 1R12A 1ZN8A 2HLDA 4TKMA 3TLXA 1YBAA 4D02A 3HMKA 4NE7A 2E21A 3NVDA 4RAQA 1OLOA 4N12A 1F8XA 4FJ1A 2P4QA 4LZAA 2BFEB 3JY6A 4AYTA 1G18A 2HQSA 3RUCA 3Q3IA 1LFAA 2X6TA 3M7IA 4IOLA 5CXQA 3FBGA 3R7WA 1CZOA 1W7AA 5FTWA 3IHKA 1LPPA 3GYBA 2XBLA 4JN6B 1V7ZA 2G83A 2C7RA 2J5XA 4ECAA 1JWLA 4TTPA 1ECCA 2RC5A 1EI9A 1QM5A 3H97A 3MB8A 1U7DA 1VFNA 2QJOA 2R1TB 4Q1AA 3RODA 5JISA 1HBJA 1ZQ9A 1SBCA 1D2CA 4GPIB 3VR6A 1YS7A 4JBNA 1ZUWA 3N59A 3STYA 1JKJB 3EASA 3L1VA 3IJ5A 4J1TA 1TTTA 4OEHA 4FN4A 4FU0A 1XO1A 2E4UA 1PT9A 2X3FA 4M7PA 4RJKA 4CQLA 5K03A 1E3EA 2FP4A 3AW8A 2RJNA 3WVNA 3TOXA 1IB6A 2J7PA 2ZPTX 3KYBA 3A9VA 3ZHBA 1XVTA 3LFHA 2Y1CA 1X19A 2B69A 4OBEA 3KKEA 2IQ5A 1KRXA 2OV2A 4PS1A 2X0RA 2VHEA 2WWTA 1QONA 2G9QA 3E22B 5F2NA 1XZNA 4KVFA 2PU5A 3RK4A 5U1PA 1G3UA 2BFPA 3T7DA 4WKNA 3RQIA 4ZC8A 4ZO9A 2ZIEA 1LSOA 3GAAA 4FN5A 2OCYC 4FIDA 3W5UA 4KITB 1JHZA 1INLA 2ZBPA 3MWDB 3NIBA 4AJ4A 2VPXA 3AL0C 2AFHB 1BCSA 4TKZA 2A4MA 3JCZA 5LL6P 3MF4A 4NP6A 1PZNA 1ZJZA 1K75A 3L49A 4WEOA 1JKXA 1UC5B 3IURA 1BOOA 3VNBA 4H1WA 1PUJA 1R50A 2VAPA 1FRFS 3RSCA 1XZCA 3ETNA 4PE5B 1Q84A 1U1EA 1DG3A 4P98A 2D2IA 5AXBA 3RHSA 1G1MA 1C81A 5C7IO 4ND1A 1P74A 3E05A 2PKQP 1JIUA 1SUEA 3P2IA 1BFUA 2WB4A 4NJEB 5C5IA 3JQBA 4DVGA 3FPEA 3HVUA 1SHKA 1BS9A 1PUIA 2ORWA 1Z5UA 3MWKA 3H9JA 1LA2A 4DZTA 3Q6IA 3NS7A 1NOIA 2QUZA 4FFPA 4UHJA 3HNPA 3TLMA 2B4KA 4GVLA 2GX6A 3F67A 2OORC 4RD6A 5JLAA 3OP4A 1QP8A 4RZXA 4RVFA 3PDHA 4KXQA 3QPVA 1V43A 2VA8A 2XQJA 3EN0A 3H8WA 4GOND 3T0GA 3WZ2A 3G1WA 3O8OA 4H08A 1R6XA 4C5CA 4WAUA 3GJXC 1A27A 1I2ZA 2P2DA 1FW8A 2FZ4A 2XDQB 3UFXB 2CLDX 2PX2A 3E82A 4FHCA 1GILA 3PRJA 5KTTA 3BULA 5TQ2B 1JQJC 2ZSDA 4N40A 4C1BA 2Q2VA 1XEXB 1RYHA 5C1BA 1U8XX 4D4LA 3JQBC 4IDPA 4EHAA 4PVCA 2FR1A 2I7XA 5FADA 4MWGA 1H85A 3L92A 1XEWX 4KGXA 4BC1A 5H3HA 4UHHA 5KQSA 4DCUA 3QEMB 1RLIA 5EUCA 2IV7A 2CJFA 1LBQA 3D6VA 4GEGA 3L6OO 3ZWXA 3EMVA 4BE4A 3UMVA 4UNQA 2I0FA 3CKYA 4D9IA 4HPJB 2LDBA 5TPWB 3WB1A 3MT9A 3IOMA 3VPGA 5CFRA 3EVNA 4KQWA 3GGOA 4D8VA 2VBIA 3D3QA 5L3VA 2CLIB 3WKBA 5DNCA 1IY8A 5TR9A 3I1YA 1P6XA 2AWOA 2C0CA 1QE5A 3DONA 3NEPX 4UU8A 3SQOA 4OL9A 1KOGA 1T2NA 5EGSA 3UWDA 1DIHA 3S5UA 5A4JA 2X8WA 3AUFA 4YPVA 2JBHA 4C2BA 1KBZA 4ARBA 3IDOA 2VF8A 1Z5PA 1K1EA 2YY5A 3RYCA 3STHA 4DDUA 2EKLA 2C97A 2GBCA 3PPIA 3UMBA 3ANYB 4NK4A 1FTWA 3PR3A 5E1DA 8ABPA 2CL0X 1C7FA 2QS9A 2QV7A 2P9ZA 3LUDA 4AUEA 3UEOA 3BWDD 1QYDA 3JX9A 4ZYZA 4DCSA 5CD1A 1K89A 1PV4A 1RWWA 1HWYA 5LLTA 3GJYA 2NO6A 2ICAA 2FR0A 2ZK7A 2ZQ5A 3IL2A 4UEWA 4FDVA 4KCGA 2RGNC 5AM1A 4NCIA 1AGYA 1OMOA 4ZXFA 3OPXA 5B4VA 1HSZA 1L7BA 1W6RA 3C3CA 5E6RA 2IHTA 4K6KA 1JHRA 5LYJF 1X15A 3I9V1 3TOVA 4NMXB 5AI0A 5CLQA 2LBPA 4TMXA 4F5YA 1Y1PA 3N8NA 5K8UA 1U8ZA 3A14A 4RF5A 2ATEA 4BHTA 2WA1A 2HHJA 4Q3CA 1PQPA 4I50A 3P9QA 4YRDA 3SXUB 1BVRA 4LQ4A 4RZHA 1SEVA 5B3JC 5FWNA 4ZZ2A 3DSRA 3HO6A 4X60A 4ZDWA 5LMCA 3GVCA 3MTQA 1R6DA 2I4OA 3R7DA 4N3AA 3W6PA 5L3RA 4WEQA 1NXXA 5DF1A 1JKIA 1M8GA 1K7EB 2FMIA 1IEXA 1UPUA 2GN6A 3FWPA 3GLUA 2B8WA 3OA0A 4ZCPA 2B2XA 2YOHA 3CGGA 3LAWA 3P5BA 3H2JA 2TSYB 4JT9A 3QXSA 3V8RA 2J67A 2VJLA 3BIJA 3EF1A 3JALB 4UFPA 1GITA 2WB2A 4F9EA 5FUWA 1B8PA 4X1YA 1KR5A 2DHRA 1JG1A 3SS9X 1JNXX 3QZUA 4G8BA 3TNLA 3S2UA 4M0EA 2CEAA 4W7IA 3TMAA 1GTG1 4F11A 5AVZA 1E79A 4F4UA 2H0QA 1WVGA 1VCHA 3OEEA 4IVRA 1OZAA 1JHDA 4E88A 1ZCFA 1G16A 5AQ1A 5JCPA 3F6CA 2H4JA 3CSDA 4FZ3A 1MIOB 4H1TA 3HDVA 1FP6A 3V1MA 4OKIA 1G3QA 1LBSA 2ATVA 2WWGA 3MLBA 4B6EA 2R86A 3HFJA 5FYDA 3V4FA 4EO9A 4R8VA 3QF7A 4RKFA 4DR5B 1QC5B 4B2YA 3LQYA 2OENG 3M5PA 3OETA 4K8OA 4MJXA 5A9SA 3G0OA 3KDSE 2YJ3A 4X8HA 1WUHS 4N5NA 2WIBA 1OX5A 3P96A 4ZYVA 5ADWA 4QNMA 4ER5A 1LK0A 1V9LA 1JLMA 2D3TA 1UKZA 4S1WA 4YWJA 1W73A 5F23A 4W1RA 4WNAB 3T5MA 2QI9C 2Y2VA 3TWOA 4F85A 1HDRA 1ORVA 5JDIA 2BGKA 1GD1O 2D54A 2HPAA 4GBED 5C46F 1M6EX 3H18A 2BZ1A 2HWKA 3BXGA 3K53A 3EQZA 2BHLA 2JH9A 2AR0A 3WSWA 4Y18A 2GJSA 4M0PA 5CCDA 3UXMA 1C2TA 7ABPA 1RXWA 4GNRA 4NZ9A 3WJ1A 3NOOA 5C51B 1J2YA 1JG4A 1GPUA 1E2BA 2XNJA 3H75A 3OUTA 4R8MA 3ZLUA 5FIUA 4TVOA 16PKA 1D2MA 2F4VB 1C7RA 1FP7A 3V2HA 3PNOA 5JDIC 2RFLA 2PMKA 5DM1A 4UFNA 4I3HA 4KWEA 4R2MA 3A0UA 4U2KA 5E9QA 4YV7A 3GOQA 2PVCA 4HN9A 1X2BA 3GLRA 5DGCA 4F60A 2HA6A 3WRWA 4CTJA 3L7NA 3M70A 4DV1B 2ONYA 4R8LA 2V7PA 1KAEA 4NPAA 4RE6A 2X13A 5EE1A 1C3LA 1Y3CE 3ZR4B 2JJ8A 4CLOA 2J3KA 3U48A 1CQWA 4M7RA 4MRMB 4FD3A 1TKBA 2ID8A 2P9GA 4DGQA 4A36A 4MQEB 2VP9A 5C4MA 1EBUA 2NXJA 3NQ41 2AN5A 4MH0R 3VC1A 1WXDA 2FJUA 4CEHB 4PAOA 2LUOA 5EMKA 4ZTUB 4UAGA 3ASUA 3KUXA 1M76A 2B8NA 5FP0A 3TW0A 1Q0TA 4HYTA 4Q7LA 1Y1LA 3IEKA 5BV2P 4LOHA 3H8SA 3LFUA 1O97C 4AJEA 1USVA 3I6YA 3OF2A 3OM9A 5EJ9A 4UD6A 1UBKS 4KACA 2EX4A 1YZFA 2C04A 4XWAA 4DDWA 1CY7A 1ZSVA 2GF0A 3CGWA 3ESCA 1CKEA 1FUIA 1NMZA 5B55A 4M9QA 5HDQA 5GGYA 4XIFA 1TZMA 5CFZA 3A6PC 4R7TA 4CEJA 1E20A 3HBAA 3FHCB 1PYDA 1L0BA 1PVDA 2IPOA 2J0UA 1X1DA 2RGGA 3A4LA 4HB3A 3KOZA 2B9EA 2ZUSA 4TM7A 3RUPA 1UMDB 3K8OE 4JSTA 4P31A 4Q4AA 3RSGA 4JHXA 2IXTA 1OLSA 2XUPA 5DXFA 2CL5A 4QU9A 1JVSA 2GCEA 5FHRA 4EY5A 4XX1A 5DHPA 3WNCA 2JFGA 3BOSA 2V7VA 3LNTA 4L8FA 4Q9HA 1VBKA 4L5IA 2WF9A 3SZOA 4UU7A 3IAAA 2JLBA 3V4ZA 3O26A 2YZGA 3MHPA 5AXAA 2LZ0A 3O5AA 4LJKA 1MKYA 4I4IA 4PAQA 5THXA 3SF8A 1JAIA 2H51A 4QOGA 4CKEB 1TE2A 5IU6A 5HRAA 3CZMA 1REQB 1RWXA 3KTFA 4NLLA 4Y2UA 3J81A 2OM6A 3O0TA 4R2XA 1RPZA 3HI4A 1E6WA 1RZ3A 2F6RA 3KQOA 1FCJA 3LD9A 1AHPA 4OQXA 1D4FA 4DAOA 1UBSB 4Z54A 1XRJA 3PV0A 5EIHA 5C7LO 4ZGGA 2I8LA 1VJ0A 4K1XA 2GTHA 4BGUA 3Q3GE 2BZSA 3LPCA 4KX3A 3CTPA 1J1IA 3REFA 2WMDA 1US8B 2BDUA 3CMCO 5K3AA 1JIIA 2OV3A 1TD1A 1QH0A 1E2KA 3NCTA 1CBUA 5DNDA 1X1TA 3FSGD 1JJBA 3LQ4A 2Q8NA 1JBKA 1NV9A 1PI3A 3DCYA 4E0BA 4FHEA 2ZG6A 2B9VA 4NENB 121PA 1II8B 4U8HA 3B1WA 2EV9A 1U3WA 2R6R1 2QMOA 1W75A 4RTJA 2X4LA 2QE7A 4ZO7A 5KJ1A 3WBBA 1C1XB 3ND6A 4KMMA 5FLKA 5DM70 3FR7A 3MMNA 2C9YA 3NKLA 5GVRA 4RK1A 2OB2A 1J2TA 3H04A 1RKUA 2V4MA 1BXRA 3LXUX 5HRUA 2J31A 3FCCA 1N7HA 1MC5A 2VQSA 3QW2A 4O29A 4BFCA 1W1IA 5HMMA 2LRHA 3OFNA 1HQCA 4DN6A 2VG8A 1IATA 4V2UA 2B61A 2ZRLA 4IDAA 2QRJA 2JA2A 5IVDA 4KK4A 3VQTA 3QX3A 4LZZA 2QRVB 1E2JA 1Z0UA 2AEEA 1PFWA 2VBFA 1W5FA 4U2GA 1PNVA 4R6XA 1Y80A 1TM1E 2NZVG 3EZ6A 3SKVA 2CV0A 3E84A 1NT2A 5HKKD 1ISMA 2XLCA 2ZRKA 1UH5A 1MABB 3SHVA 4OGLA 3NTRA 2ZVQX 1WCYA 1HT3A 2W6PA 3FY4A 5CX1A 3VU8A 3BFJA 3IIIA 4RFVA 3ZQUA 3ZDZB 3TEFA 1CQPA 2PL1A 1C1DB 5CYPA 1FYFA 2CXUA 4WKPA 4PS0A 3AQIA 4XTRA 5FQNA 1U2DC 4ZHQB 2FEOA 1EE2A 1OXKB 2XZTA 4JL8A 4TYQA 3NDBB 2H59A 3R9XA 1E3SA 3NT2A 4EQZA 3H5IA 4LFBB 4EY4A 3SF0A 4Z53A 2OP0A 4HDCA 2H5JA 1L7AA 4O4IF 5C3UA 1GPNA 5TQJA 3PSHA 3ABRB 4EKGA 4GMHA 3W9YA 3R9IA 1HSOA 2Z6VA 3QENA 3SU8A 5EJ6A 2IY9A 1M6NA 4L5JA 4JYBA 1A5SB 1QH1B 1QFXA 2H54A 4DADA 1EHCA 2G1AA 1EXWA 1LW6E 3QY0A 3MILA 3JARB 1OXTA 2D2XA 4TUYB 5FHQA 1FMCA 2I3DA 3EBLA 3FUUA 3KEQA 3NUQA 1N5MA 2X5KO 2C5HA 2XTMA 3UYLA 4EHJA 1YVEI 3BJEA 2A67A 2Y6UA 1GT91 1QMGA 3N6XA 1WHSA 2JIZA 1DXHA 1PX2A 5HEKA 4YRJA 5J23A 4JROA 4EHDA 3P20A 5I9NA 3TQSA 1XCOA 2RHDA 3NKVA 3ETHA 4CL2A 4OUDB 3AIOA 1E2EA 3CMMA 3KPWA 1PJZA 3KAQA 1H2YA 3EDRA 3H1FA 4JGGA 2ZANA 1H3FA 4ATNA 3UHJA 1YRBA 3L7YA 3I1IA 3M9XA 3E5MA 4E13A 1P4SA 2FGJA 4N49A 1T8UA 4REQB 5DH9A 1NZFA 3OQHA 2RHLA 3A1UA 1WG8A 3PWTA 3GJRA 2OKCA 4FMCB 3FVTA 3DE1X 1R0SA 1U3GA 4Y8VA 2JGAA 1U0LA 5CDTA 3GYGA 5A0FA 2VTDA 4C4ZA 1R9MA 2EBUA 2GGSA 3VISA 1CUDA 1SG6A 4S3MA 1BW9B 3L7OA 1XWFA 1LLUA 3WQQA 2ZRMA 5D86A 4NCXA 1F48A 3M6VA 1ITZA 1VLZA 1SA0B 2MU1A 3VOBA 4B76A 4DSZA 1JR3A 1QV9A 3AYZB 3HRHA 1LS1A 2BFFA 3DKKA 3UOAB 4CMCA 1SG9A 1KPIA 3OOEA 2Z9BA 4I8DA 1E0SA 5THKA 3VDRA 3RC8A 3U17A 1RPJA 4PV7A 1NAIA 1DS6A 2V4ZA 1TZBA 1J2EA 1NV8A 3NRBA 3NEJA 5K6AA 1ILEA 3V32A 2X7JA 3CA8A 1O54A 2FUEA 2GEVA 2NQ2C 3OKFA 1FFBA 4TKVA 3ZE9A 2A86A 3GD7A 2GD2A 2Q50A 4YI3A 4V3CA 4DYVA 4U7DA 4HTFA 3WGJA 2H2GA 4DLTA 1T9HA 2DWUA 3HRIA 1WPXA 4KQIA 3DNFA 3LBFA 4N6OA 4X92A 4XQEA 5CK4A 3RU9A 4CNBA 4HYQA 1UBGA 3WFIA 2CNNA 5AICA 2A0FA 2JIMA 2O7SA 3IAHA 3PQ4A 3A4YA 2PMDA 5F1YA 4KN9S 4BEBA 4DM3A 1LRJA 4EX7A 2ZIVB 4TSFD 4JLKA 1KO4A 2I6FA 2VDVE 4HLCA 2HFJA 3B20A 3K0BA 3LCRA 3FR8A 2DF8A 3O3OB 4FCVA 5IP5A 1BC5A 3HY3A 3LCVB 1PZFA 5T4EA 3VM6A 3HACA 2G1PA 2P9BA 3F7MA 4IJMA 3TBKA 2ZJAA 4HGPA 3S2ZA 3O84A 1TM2A 3I1FA 4XB1A 4RV9A 3BD7A 4ZEWA 1ICIA 3FWYA 3OLZA 3HA7A 3ZZMA 1DBQA 3O91A 2XEDA 4E5VA 4I6EA 1QJ4A 3DMTA 3K0AB 3MELA 2JFHA 5T67A 1L7NA 3S27A 1R0CA 3CPJB 1JYEA 1NQTA 2YVAA 1EVIA 3VUEA 4IGKA 1KYYA 4G63A 4LN1A 2R7LA 4K40A 4U7PB 3CLRD 1TYEB 4C6RA 3E1KA 1GU7A 1EB9A 2FRXA 2AYZA 1ORIA 4JUAA 3W5DA 1DAKA 1NMYA 5BRNA 2J3HA 3V4PB 1LTQA 1F5SA 3VJMA 1NHGA 4CL0A 3GJQA 4O2LA 2PDAA 4YRCA 5BOVA 2NZ8A 2PYDA 2C8JA 3TI9A 4OHYA 1T3GA 3UAVA 1KMHA 2NV2B 5DBOA 5ADVA 1NM5C 3A4MA 1R6TA 4JQCA 3UJPA 4HAXA 4CM9A 4E15A 1KRWA 1XHFA 3DLIA 1M8JA 4KMRA 3LDGA 4E5NA 3UWMA 3IX7A 4KRYA 1BDHA 2YZMA 4TWIA 4EVQA 4Z0NA 4AVYA 5TQ0A 2E4ZA 1AO3A 3KT3A 1A8IA 2JARA 5MN6A 1V71A 3DAOA 3U2QA 3D3EA 4JJ6A 2FR8A 5LIRA 2XOEA 1KK0A 3C41J 3RVPA 3JQCA 4MVJD 3UCXA 3HB9A 1M54A 2H57A 3W04A 2P5YA 1YDFA 4X6UA 3DL0A 2QUHA 3N28A 1SBNE 4FR5A 2QBYB 1VYUA 3PPXA 5CA0B 3G8AA 5TVKA 1V48A 1M1YB 8AT1A 2ZBRA 3NHZA 1V3VA 1RHUA 1VGQA 2QTVB 1GL3A 4M6WA 4MQ6A 4JXZA 1FUKA 5JFTA 1POXA 1TC2A 1VJ5A 2EIHA 3MUEA 5LXTF 2I34A 4JX8A 3ASZA 1AY0A 1OTHA 1Q1EA 3PR1A 2G0NA 4QU0A 4L8YA 2ZDHA 2G9UA 1E1QA 2FR8C 4YLGA 2R79A 4I55F 2Q9BA 5A03A 1Z83A 3EWNA 3DT6A 1JBQA 1RC0A 3GLFE 2EKPA 2UVPA 4PO8A 3WGVA 1K5GA 4KQHA 5J5VA 4YRZA 4HWTA 2H4HA 5FL3A 3HN2A 1RZVA 3DMPA 3NUZA 5ELMA 1I5RA 1Z7WA 3AHEA 4CF5A 4DRYA 1U80A 3ENQA 3SVZA 2FPKA 3COVA 3AHDA 1OBVA 3H2GA 3EULA 3A6FA 3K15A 4PFQA 4YLEA 5JRDS 3RVDA 3CO0S 3WMWA 2JJ1D 4FGKA 5TMEA 4LG1A 1XPJA 3WYBA 4G1BA 4B8WA 3OY2A 2TECE 4EW2A 1ZGGA 3ZW7A 3LVRE 3RWOA 2BI8A 2B94A 2ZJ3A 4LQDA 3N5CA 2W2XA 1PJ8A 1PR4A 4DA9A 4WK4B 2R8BA 1X80B 3PGXA 3B1ZA 5DM4A 5DYIA 2PJZA 4DM4A 1PS9A 2RI1A 3DGEC 1WLYA 2ZBFA 1XFDA 5G0SA 2KB0A 1P4HA 3F9CA 3L0OA 4WKCA 5EZYA 1ZOPA 3OOHA 4YJ2F 3IBGA 1HNZB 1CUGA 2QTCA 3GEMA 2LNDA 4TSRA 2D1FA 3RFXA 1O4VA 2XIQA 1K2WA 2YNMD 3RC7A 3TGLA 3JAWA 2SKDA 1Y5RA 3ZWOA 1G5TA 1OHHA 4H7PA 2W00A 1P2UA 2CV2A 1OWMA 3C4VA 1OI3A 3FFTA 1JU4A 2IW3A 1UIRA 1W46A 5CM9C 1Z18A 1TMGE 1UK7A 1O5IA 3OOJA 4W6QA 5LFAA 3DMRA 3C3MA 3NDPA 2Q99A 1IUPA 1G2PA 1X92A 3LSYA 4GMKA 3NDIA 4CVNA 1RDFA 4DQUA 4UUBA 2W48A 1DNPA 1KU0A 1YULA 2N1BA 2X6RA 3U4IA 4G4SO 4K03A 4TS9A 1R8JA 5EPOA 5GV8A 5LA6B 3A1DA 3BL8A 4Y6OA 1FJXA 4N82A 4I8XA 3GPDG 1W76A 3G5MA 3GNTA 4EBBA 3QFFA 3TLBA 3VR2A 1JR4A 1I2MA 4KRFA 2AI3A 2JAUA 5SZIA 3NAQA 2Y9PB 3ZNQA 2XMQA 4BU1A 3AP3A 3BIXA 1GFSA 3W9UA 2Y1XA 2DFVA 1PJ3A 4E14A 3NAZA 5IJ9B 2HSWA 1Y9AA 3HN7A 4FDLA 4CR7A 1E92A 4ED9A 3GRCA 3DBVO 1F51E 3CW8X 3MWJA 4PLTA 5BOSA 1YFZA 1QLWA 1YQXA 2R85A 1C7EA 4GZMA 1T4CA 3LCCA 2XUIA 1N78A 5FQOA 4DE5A 3BTOA 2CMDA 3PITA 4MQLA 4WXYB 1DTSA 4NU6A 5CGZA 5ADUS 4C4XA 4QDXA 3FZYA 3EOBI 2PRKA 3BF7A 1G5RA 4GI1A 4RC9A 2ETXA 4KRGA 5KJ6A 5IAEA 2PS9A 2Z1DA 1GZUA 3I2GA 2YS6A 1FDUA 5B7PA 2XY4A 2BGLA 1R27A 1VQ1A 3H1BA 5F2EA 5C8ZA 5HW0A 2P2LA 4KQXA 5FH9A 3C7CB 4A73A 4NCAA 2REOA 3TLGB 4ZZ0A 2IYTA 2P3OA 4EFMA 1Y3DE 1D1QA 2I6QA 4HGYA 1U6KA 3RNLA 4LWOA 4QTUB 4Y0NA 5C31A 2ENUA 4GBGA 4BNFA 3E6AA 1D2EA 5A9RA 1PWHA 1ADFA 4HEA1 4BEWA 1M8KA 2HA0A 3K0FA 2OXFA 3OJLA 4TTQA 2NSYA 2IXBA 4UHKA 3R5TA 5DN9A 5HVNA 2P9EA 1MC8A 3K6RA 1F8UA 4GE0A 2AFIA 3GMTA 1YSCA 2Q5LA 1U0OC 3CH5A 4WHMA 5KYUA 3W1VA 4F12A 5C8XA 1KWKA 2I99A 1RBYA 1ULSA 3G5AA 4E32A 421PA 5BRJA 1A9SA 2B98A 5FL7A 3AVTA 3WL3A 4FLEA 2CLMB 3EK2A 3DOJA 2QP3A 3COYA 1Z4OA 4HAUA 4LZOA 5LJIA 5H9WA 5JAZA 2BR5A 4YRKA 3LDUA 2HLDD 3UMCA 3W5IA 1ZD2P 4WECA 1R0WA 1W5SA 1UJCA 4IO0A 4M0FA 2P4HX 4RIGA 5AYVA 1KSGA 5CBKA 4A0RA 1CUWA 3LDFA 4PEVA 2WJYA 2QAGA 4Q66C 3AG6A 4MV9A 1VYHA 2XGOA 3J81k 1JHPA 1A76A 3TAUA 4EG4A 3K5WA 4HB0A 1Z34A 2YTZA 3HKCA 5BQ3A 3ICQB 3KT6A 3LK7A 4U6SA 3KSAC 2JG3A 3C8ZA 1ABBA 4WOJA 2C2XA 3TMKA 3NLLA 4F72A 3UHOA 2RHTA 2INGX 5BY2A 1BO6A 3L8FA 3T5BA 1SU6A 2FVYA 2QRKA 3O2SB 3GRFA 4GS5A 4I7EA 4PG7A 5BMVA 2ZQZA 3D8UA 1L5NA 2QOEA 3WLIA 2IQIA 1E6EA 5I4KA 4LQLA 1Z2NX 4RY9A 3LBYA 3L1IA 3UOWA 2MINB 3TSWA 2W8ZA 1G0NA 1UXHA 2BFCB 2CXPA 2Y67A 1E5XA 4RPGA 3I05A 2PGNA 1EG2A 4KU4A 1LRLA 2JAWA 4Z86A 5DBGA 2HHHB 4YXWD 3HB5X 4D4IA 3FX2A 2YOGA 3CEAA 3Q1LA 3FOEC 3OI7A 4FXPA 4HJRA 3CKMA 4MR9B 1JHVA 4Z7OB 3P0EA 3EPLA 3HKDB 1K92A 5AJHA 4H2DA 4DCNA 5COQA 5H70A 4EI9A 2JZCA 1Z0DA 3ASVA 4AB1A 2DE0X 4C0LA 5TGTA 3C6YA 1Q12A 2AZTA 4LWPA 4UULA 4ZYYA 3I3SR 1GKLA 1LLCA 5DM0A 1LH0A 1QFSA 3LUJA 1QZXA 1PL6A 3V8BA 1GPMA 4BBZA 2DHEA 2WYVA 5A7HA 4PC3A 1TLLA 5C2JB 3LKDA 3AJEA 4BNXA 5EE5B 2XIJA 5B4UA 4DILA 4RH3A 3SZUA 2E85A 2PCLA 3NRCA 5LZ7A 1JGTA 4K5QA 2G9RA 2Z4TA 4Z0PA 1Y6QA 1GT6A 4KK3A 3EXHC 2AWNA 4ZRDA 4BMOB 2BHNA 5LOVF 1F06A 1HEYA 1UPXA 2FPWA 4O4JB 3AJRA 2PGXA 3EQ2A 2GI4A 2B8JA 1T9AA 1HMPA 2J5QA 4QTXA 2H1LA 5P21A 1JSZA 3LGSA 2F3SA 3LUPA 1CETA 1Y9JA 4TT3D 3KJXA 4D43A 1JSRA 3FNBA 5FI0B 1V37A 2F1KA 4M8IA 5LXTB 4ONEA 5A4KA 1IZ0A 3DTYA 3WO0A 3EIQA 2QU7A 1O03A 3GXOA 4QYMA 4DARA 5JSFA 1M72A 5BUZA 2AW3A 3OCJA 2DBZA 4I55B 2KS6A 3OBBA 4YRTA 3SQXA 2DT5A 5AVXA 2P2YA 3OZEA 4X7BA 4XXHA 3LXMA 1XZFA 2Q28A 3PPWA 3DL2A 2CKMA 5KX5F 1R3DA 1QPZA 1Z6GA 1DHRA 1JYFA 3U3ZA 1XCJA 4WERA 3N2KB 3VKVA 4JB2A 5BN4A 4FNGA 1Y8RB 5JECA 4A23A 3CRRA 4LXTA 1E9SA 4PSAA 4MVJH 5DMXA 2HSJA 4GKKB 1VPTA 2GN2A 4HUQB 1KTIA 1EFAA 1YMUA 4FBGA 3IP5A 5FR1A 2NZYA 1CD5A 4RJIA 5JEDA 3C7KA 1LPNA 3FW1A 2CZGA 4QEDA 3WOHA 2AJBA 1GL9B 4D6YA 5TSDA 3DM9B 2VTBB 3QVGA 4BNGA 4HQFA 2PGIA 1E2PA 3R7FA 7MDHA 2UXBB 5IC5A 3EIHA 3OIWA 4FGZA 5BYAA 4FEEA 1K08A 3JZDA 3LPNA 1NE7A 4B7UA 2DWQA 3PQCA 3UPUA 2A94A 1YGPA 2FPOA 2HMTA 2KHZA 2O9JA 1GPH1 4LPKA 4Y2YA 4AO7A 4DMLA 1TD9A 1JA1A 1JW9B 3L1KA 2DKNA 1E7RA 5IAJA 3ZD6A 1RXEA 3I2HA 2X14A 4H31A 4HAIA 5KYVA 2YS7A 3E3NA 5ALPA 4AZ0A 3AVWA 3VPHA 2AG0A 2JPDA 4LS3A 1DXOA 2FN7A 2J3DA 4FINA 4LYFA 2X42A 3W6UA 5CDYA 4N6NA 1VJRA 3C3DA 4HYYA 4CLHA 4FJ0A 1CLUA 5CLHA 1PK8A 2E3JA 1RMQA 1CY2A 1DC8A 4NICA 4XYEA 2QTWB 2XB8A 1BCRA 4C21A 1X7YB 3Q6MA 5BNZA 4J7CA 4QPCA 4YR7A 2X9QA 4NZYA 2FWJA 2C7BA 3EGXA 2Z2YA 4LOKA 2XSZA 1BTOA 2QX8A 1ACMA 1XF9A 3HHEA 4BRSA 4YFVA 1T6ZA 2NXEA 2O3JA 2XQKA 1EZ4A 3NTLA 3QPUA 3SYNA 2BYTA 1WDMA 4LZJA 1KARA 4BWFB 1QFYA 4ZCMA 3GA0A 2HIAA 1DQRA 4WDQA 4MP3A 5HQ3A 1A9PA 5LVAA 1LDYA 3MWEA 2F8TA 4YV2A 2K87A 3I83A 3O03A 2H2IA 4G1EB 2PD3A 3N39C 4A8PA 2QMZA 5KVAA 4LUCA 3OCZA 4PYLA 4G07A 1KHTA 1NJ5A 4KHZA 3C98A 3DHNA 4DCTA 4YT4A 5JJKA 4BKUA 3MBOA 4BLWA 3VU3A 4EF4A 1J0CA 4EMBA 1AKNA 3KETA 4B83A 2XMGA 4DJTA 3JVDA 4WDRA 5BT8A 2PQ2A 4Q16A 3AINA 3JQFA 1GHTA 5KBYA 2O3QA 2RAPA 1JXAA 2WWHA 2P1DA 2Q2OA 3I4CA 3K96A 4DCJA 2XF2A 3M3HA 3ORQA 1KFCB 2VLBA 3EVCA 3JYOA 4CIAA 1G3MA 1WSDA 5BN1A 3P5SA 1KO5A 2FW0A 1C41A 5AW8A 4G5HA 1KYQA 3C24A 4BO6A 2KWIA 2VJMA 3BL6A 3GUUA 3T34A 3OMWA 4U7GA 3TF5A 2CT8A 1S4QA 5LYYA 1JWAB 1U1FA 3EQ9A 1IXRC 2A78A 5LZ9A 1LF0A 2VPWA 4CMEC 1BRMA 4EUSA 5GJBA 5I4BA 1TO1E 4Z9FA 3F49S 3W6OA 1BH2A 3IP1A 3DFKA 3AF5A 3FMGA 3SI7A 1D1PA 3LCMA 1KZ7B 4R6WA 3R2JA 1EUCA 3OEED 4PN3A 2RK3A 2O23A 4JS0A 1F7UA 2HDNB 2JIQA 1FLVA 4S0ZA 4ZT6A 2HCJB 4I46A 1OGIA 4OF4A 1EINA 2XF8A 2CZCA 4B35A 1RHKA 1SCQA 2SCUB 5IAKA 3BXZA 3WISA 1IMJA 4PCVA 3R3HA 5EWJA 2Y1DA 3JYHA 2VDOB 4C87A 3DMYA 4L0MA 2CNKA 3KQLA 1KEPA 2GZSA 2CFCA 5ERGB 1MHPA 1A69A 4BN4A 3M6MD 4PCLA 3RAJA 3GQVA 2WM3A 4PRLA 4U02A 3KB2A 1CS4C 4Z2YA 2A0YA 3QPWA 1XZIA 1A8SA 1BN6A 1T43A 1M0EA 5FCDA 4J1NA 3PGA1 2VT3A 3EVAA 5DYNA 4MXDA 1KIFA 2PGLA 1QKKA 4BGIA 4N39A 4UATA 1B73A 1XQ6A 3HZHA 3PWZA 4DXAA 4FLMA 3ILHA 1NBEA 4IIDA 4POAA 5ANRB 4FP9A 3VYTB 4EL0A 5B1EA 5JAPA 4E7PA 2QIPA 1WOMA 1X7XA 4E2WA 1UMBB 1C3OB 4D4MA 5HIKA 3TIFA 1CF4A 3GFGA 4J6FA 1YK0A 2QSUA 1QX4A 2UZ1A 3IFSA 4R1UA 1KDZA 3PE4A 1J9GA 3I2YX 2OKGA 4CIWA 5HMLA 3MUOA 3USES 3WGUA 5DNYB 4BO0A 4W9MC 2XVXA 3OTIA 1NVAA 1R0BA 2B4RO 3CLTC 1DAIA 1ESMA 2WG1A 4YP1A 5HSGA 1XZPA 3JRNA 3IAS6 1CUCA 1EGVB 3T95A 1B6TA 3B3QA 5JWHA 4JKOA 4KPUA 1ES9A 4BBAA 4BXOB 1MMFB 2BSQA 1DAGA 1B1CA 1O97D 2P2GA 2WWVD 1PNQA 5CLFA 2HPVA 3PCXA 1EVQA 3I5AA 2Q3EA 3DMNA 2QTMA 1FDOA 2W58A 3AX6A 3FM9A 3QKIA 3NNSA 2GKGA 3D4NA 3HCAA 1SXGA 1G7RA 3A6LA 3GLHA 3Q10A 5IVIA 3IT0A 4BNDB 4FFNA 4EM6A 1TEXA 1Y7HA 4XJTA 4RTKA 1XQ9A 2JLYA 4M1WA 1XBTA 2RGAA 3JATB 3MLAA 3JVUA 1RXVA 3K2QA 2P11A 3EXIA 4UCQA 2GZ2A 5G0WA 5ES4B 5U4QA 1N9GB 3IOEA 3V55A 2G77B 4HN4B 1S3SA 1UODA 2AYXA 5GJVC 3RW9A 4C4OA 3K9GA 3GCGA 3FB4A 5LOVB 3BD9A 4LGVA 1FVOA 1GUZA 2P2SA 3HA5A 1TPYA 3VR6H 3DLHA 4IZIA 1RYNA 1YB7A 4TLBA 4CYMA 1IJBA 4OXKA 2BEWA 2R47A 1XAGA 4MDHA 2PJDA 4KFUA 1P7VA 2RK4A 3CJTA 4KDEA 3CYFA 3NWEA 4IEEA 4Y1RB 5ABPA 4C5AA 3OZFA 1N32B 4X20A 1RWMA 3MQ2A 3LF1A 5TLSA 4RLQA 3OIUA 5DHSA 2O8EB 1G20B 1KEVA 1UT6A 3SJBA 1IPHA 1QB7A 2X40A 1G4HA 3EPPA 3MUFA 5A3RA 3R09A 4NARA 1VL5A 4G0YA 4LDRA 3RG2A 5E6UA 4AUKA 1NJ6A 1EFLA 1Z45A 2V5AA 3IMCA 1FX1A 1RIIA 4KQCA 4YP0A 5CLGA 2Y77A 1H2BA 1QHFA 3L8EA 4J1QA 1TCVA 5AQEA 1IN4A 3A6DA 1RM0A 2R68A 2RHWA 1C4XA 3V97A 1H4SA 2QT9A 4AJ9A 1Y5MA 3ZK7A 4RA6A 1PJLA 2VP3A 2OFOA 2C3UA 2JGIA 3SHTA 1C5KA 1LZKA 2Q29A 2J85A 4LXXA 3JQ8A 4XUCA 2J30A 3L0SA 2OO3A 5FXMA 4KR9A 4Z9YA 3JQ9C 1JLHA 1C7JA 5CAEB 3A06A 5G53C 1NN3A 1QTNA 1SQFA 4KXLA 2GCOB 3PNPA 1A9ZA 3SM3A 2WW8A 4RH1A 4IWXA 4WOPA 3MGKA 1IQUA 3BXXA 3QFTA 4OFXA 2RHCA 4QXRA 4D8TA 3FWHA 4EMTA 4H4DA 4Y1FA 3RAGA 4V0RA 1TIPA 5G2OA 3C4QA 4M9UA 3QVKA 4ZVOA 1FNCA 2ZT5A 1YR7A 3AKCA 3OFVA 1J2UA 4W5HA 4E03A 5IK2A 2R9VA 5BP7A 5FB3A 1E4EA 5KWEA 2C9CA 2YUIA 2WYWA 2X8BA 3NBQA 2GNOA 3PFHA 2B78A 2GK6A 3GZJA 4NFHA 4RKWA 4KPEC 2QE7D 4TLDA 4IXWA 3D2LA 3D5QA 3LQ2A 4HWOA 1E2MA 5D3MB 3T5CA 3PVSA 1GGJA 2WG2A 3IPRA 4FOTA 4KV7A 4OQQA 4QX6A 5FOUA 1GAWA 2I6GA 4FYPA 1D0VA 2QX7A 3QMPA 4K6MA 1P1FA 1BEUB 3C7TA 2ZKIA 3G79A 3OFND 4LDZA 4DV6B 5TX7A 3SDZA 1OBOA 3RFUA 5B3LA 2XGMA 2N75A 3A3YA 3IPLA 4U2FA 4A2PA 1BROA 1FFDA 2R8OA 5I7OA 4XM1A 4BNUA 1OJ7A 3T3GA 4ZJYA 1KY5A 1N6RA 5DHRA 4CM6A 3F7TA 4BCBA 2CJPA 1XZJA 3F47A 4PAMA 3IODA 1GPKA 5KOHB 4U7HA 2VP4A 3X2SA 2ZYSA 2BD0A 4U7FA 2DPGA 1EK0A 1L3CA 2HBYA 4FYMA 4RIHA 4HNSA 4Q7KA 3LGXA 5CLJA 1U2TA 1KMIY 1A98A 1QJCA 2Q9UA 5BVHB 4EHFA 1J0EA 2R66A 4LVCA 1BWPA 4KGZA 4QYIA 4MCIA 1Z4JA 3I9JA 3UV3A 3UWOA 4F6RA 4Z49A 2PFKA 5CT4A 2ONJA 3QLUA 5E7MA 3H1PA 3RIXA 3TLEA 3U09A 4TQ9A 1NTOA 2Q0HA 3QE3A 4NBWA 3ZY3A 2QG4A 3F90A 3M1IA 1Z12A 4YUVA 1QFJA 4C3UA 4EABA 1ZX1A 2XMZA 6REQB 4BMPB 3O4RA 3F5DA 1EGAA 2OQRA 1YQTA 3L5OA 5LZ5A 1E2UA 1ECLA 3T8YA 1GTJ1 4D5EA 4G09A 2PEYA 4Z4CA 2QGFA 5IT4A 4G97A 1RHRA 2JLAA 4RORA 1UBLS 4MPPA 2IZ7A 3PNQA 1N5JA 3HG7A 3CIOA 3PT9A 4YMIA 3VVLA 3T94A 4IDHA 1PW7A 5E1BA 5KTSA 4X3PA 2FG7C 1K6EA 1UMCB 1PKEA 2KSQA 4V3BA 2IEGA 1DRUA 2YRFA 1Z6QA 1EUZA 3G88A 4MVXA 4WACA 3R44A 4L4RA 4GXQA 3VR4A 5DI9A 4BCDA 4YCNA 2VJNA 5DWDA 3INNA 1SCAA 3B3JA 3QVLA 5L40A 1Z5WA 1KERA 1SU4A 1V45E 3H1EA 5A5DA 4O3MA 2IZ6A 3SYMA 2CHVA 4KYVA 4L4ZA 1HTWA 2HK9A 3E1SA 4MKXA 3F6PA 4BNZA 2YC4C 4FNOA 3CRQA 4D0RA 1TRKA 2J9XB 2QQ5A 3PE6A 4G8DA 5GZ1A 2QVZX 2GJAA 4W5TA 3KPVA 4BFWA 4CETA 4X3OA 3SE0A 2WWFA 1X1CA 2ZUUA 2Q3JA 2I8CA 3RTDA 2FWPA 2PXHA 1KJNA 4D5GA 4EG5A 4ZGWA 5JWRA 3GB9A 3WY9A 3I32A 1SU8A 1Y8AA 4PQFA 3R0XA 4OHOA 4KG7A 1JR2A 3GHYA 4JYZA 3OZGA 1BS2A 4LPSA 2GN4A 4BZXA 5JQWA 3QFHA 3R6TA 4DV5B 3FMOB 2QUJA 3I5UA 5B2FA 1DXQA 1SKBA 2C96A 5LZ4A 1NRIA 2RJ3A 3M5DA 3GVXA 1FY2A 2G3YA 1LX7A 2NT4A 4OYLA 4R0VA 3V4SA 1K0UA 5B3KA 3ELWA 5B58T 4P5DA 1E5QA 1KYWA 2HXGA 1K3TA 5TGDA 1NLZA 3GLIE 3WB0A 3V5NA 1S1MA 4HLDA 5CVCA 1NF3A 1EVLA 4LI0A 3ZGNA 1WXHA 2ES4A 1MAWA 1DGQA 2ZWMA 1FVFA 2CLFB 3Q0TA 4L3WA 3REOA 3F9IA 5EKTA 4K2HA 5G02A 4J9VA 4QECA 2IPLA 2REBA 2HFKA 1MPTA 3VO9A 5EPEA 3OJFA 1UAAA 3S1SA 5DLDA 1BJTA 4ARVA 1CUHA 1HH4A 4V38A 3I6IA 1B26A 2ZATA 1U99A 3R5SA 3U1TA 2EWVA 1H2HA 3RUDA 2D1TA 4LGCA 1RPNA 1ZD5A 3HV0A 5REQB 3BWVA 4ITUA 1URPA 3KWJA 5F5LA 2IEYA 2FPXA 4L27A 5MGBA 4OJQA 3WYFA 4CQJA 3OH8A 4C2UA 2C61A 3RUIA 5CBPB 1ZBDA 3T0FA 2O8BB 2G70A 2BVNA 3SE7A 4NX2A 2A5DA 1W0JD 4NMMA 5I9MA 2O50A 1V8PA 1OAAA 1J6UA 2G80A 2HRZA 4LKRA 4LF9B 2C31A 4DWOA 3IQIX 4MR8B 1M5UA 2G25A 2VHZA 4ZODA 1Y7PA 2BWJA 3EVDA 1KZHA 4C0SA 1Y4UA 5J2TA 4YAKA 8LDHA 2C7OA 4AP5A 1Q16A 5AI5A 1CC1S 3NJ8A 4L2IA 1VL1A 4G89A 4PZPA 1AGXA 2NU9B 4O2BA 1JIKA 2B6NA 5K8CA 4FFBB 1RI1A 2B1QA 2XITA 4HXEB 1KEUA 3QVTA 1M1NA 4EAAA 5HCUA 5AW6A 2AQKA 5J43A 3DAFA 4NV3A 2OFFA 2FFAA 4H3SA 1L4LA 1XD2A 4Y6LA 1PJAA 2OLJA 2F2TA 4B7XA 3M5CA 1J39A 3GBSA 2HZ7A 1UKEA 4M0DA 4PRYA 1A2BA 2HCRA 1EDZA 1E5VA 4QFBA 4F97A 1GG2A 4GYKA 5CT6A 1RYYA 3CISA 4UBNA 3JWJA 4D9BA 1CEXA 3O9ZA 4I4TB 4RH0A 4YCDA 3K2EA 3HA3A 1MLDA 4IGIA 1SUCA 1HYQA 1QRAA 3P32A 5EN4A 3G2KA 4IDNA 2JGJA 1JQKA 1VFPA 2GD0A 2QP4A 2MWMA 2P68A 4ZAFA 1OFTA 1Z28A 1EP1B 4C7MA 2DKFA 1GSHA 4CL8A 2ADFA 1LPSA 2ADOA 2HI0A 2ZREA 2PTHA 3WWZA 4BPBA 3OPNA 4CGZA 1FFHA 2VJKA 1A5TA 1J25A 1ZM7A 1R6UA 3GFBA 5HFNA 1NP7A 1ZNXA 5AW4A 2BMVA 1GTRA 3QQ5A 2C2OA 2GKSA 1Z82A 3LNCA 3VO1A 5AI4A 1MFPA 3OCYA 1NYQA 1TJPB 3VGPA 1D2AA 4AKTA 3PFNA 4HCJA 5CXUA 3DB2A 4WZAB 1NU6A 5CFPA 8ADHA 4QVIA 2ET6A 1V11B 3JZFA 2C7PA 2EVWX 3LQQA 1Q2UA 4XGKA 1G8HA 1G42A 2H4YA 2HF9A 5K3FA 4BDSA 2XD4A 3GLQA 2VZLA 4ZOLA 4D56A 5C80A 2EYQA 3DZHA 3M0EA 1E1QD 4LAFA 4RNDB 2QR3A 1SKQA 3TOSA 1A4UA 2JCVA 3UJCA 4IM7A 1J1ZA 1IUKA 1FPMA 4WI1A 5PNTA 4UKDA 2KQUA 4AFNA 4JKYA 2AXNA 3C3EA 4QUIA 1P4GA 4JVNA 2O8VA 4FFSA 3B6KA 1I3MA 1II9A 2RGYA 5ES3A 5IMBA 1I4TD 2H5LA 2VAMA 1GGVA 1KI6A 1Q74A 4G41A 4M1TA 1AUOA 3U3MA 1KP9A 3OX1A 3G5UA 2BCEA 1XQWA 3WLOA 2HO5A 3ROEA 2FCAA 3JTEA 4WOBA 4MKZA 4NSNA 5CFOA 3SMQA 4WY2A 4WESB 4G5YA 1Z5ZA 2XXAB 4X6LA 3EPKA 2L19A 4MVWA 4EPVA 5KHAA 2QVGA 3AESB 4Q3AA 1IBKB 4Y3UA 4ZALA 2F9FA 1YMVA 2H1IA 5GQSA 4RF4A 3LXXA 3E7WA 1E99A 1AT1A 4R3UC 2H2HA 4GQIA 4W8GA 1WPRA 2DXIA 1PGNA 2A0WA 3GUYA 4I1PA 1V4VA 4O4HF 3HGTA 3FUVA 2PNJA 1RJDA 4LYYA 4HNRA 2BFMA 3KUUA 3IQEA 1ZDMA 5EMLA 1QO9A 1TYBE 4BUJA 5L51A 3RYFB 3LWDA 1DBWA 4TV9F 3PDUA 1WMSA 2H4ZA 3DYIA 1UKBA 3R40A 1E60A 3AUTA 1RYFA 1DTEA 2A92A 2QR5A 4ON9A 4MDEA 3A2KA 4WKOA 3HB4X 2C4TA 4O2RA 5ARBA 2P5TB 3ESRA 1XDUA 3IQFA 5C8YF 4Y67A 1XAJA 1DUVG 1WJGA 5IXJA 1Z0KA 5DM2A 1S1CA 1IY9A 3DL4A 4I1YA 3TIIA 3TQQA 4MWSA 1QDLB 2YJZA 1BGWA 4RDHA 1N2CE 3F6YA 3D0KA 4PFJA 1VCOA 4Q02A 4KYIB 1GZ4A 4L4YA 4OHWA 2XCIA 1SRRA 2WBLC 4NJOA 4AMUA 3VR2D 4CW7A 4NCNA 1ZCJA 1HT2E 2FU5C 2Y1EA 2RHJA 3W5VA 5ALLA 5MF6A 2NUAB 4M54A 3M6UA 3I2FA 2WINI 2P8JA 5JS2A 1XVLA 1G5IA 1MU0A 1NVEA 1FSZA 3T7RA 2GAFA 1GDHA 1PFGA 4AF8A 1JB9A 2QYSA 2QPOA 5K7SA 3CVYA 3D4LA 1RADA 1ODLA 4PHFA 1E6UA 1PG5A 2W2KA 3CE9A 2Q49A 1G8SA 3FXAA 4MVJG 4PSUA 1UBCA 1A72A 1ZISA 2RGUA 2WIDA 2CLSA 3RRMA 3ZIDA 3B3GA 3S29A 3OTOB 3ROTA 2LIPA 3NM4A 3O4VA 3OX2A 3PFKA 1DCFA 2IIQA 1HYGA 3QJGA 3GPLA 2CJWB 5JYBA 4G4SP 4GNKA 5HBGA 2C29D 5FPYA 1DZIA 2IXAA 5KYYB 3W79A 4JOCA 3JQAB 2Z6UA 3AXTA 1BWRA 1XLTC 2CVQA 1EJ2A 3QIVA 1AURA 2WKPA 3HWRA 3DAHA 4OXNA 1VG0B 4PXYA 1G6HA 3MBKA 4MP8A 1NPTO 4BNVA 1OVMA 1ZRSA 1JEYA 4R2JA 2JF0A 5BW5A 2QQFA 1E69A 3G8YA 2RGXA 3KCNA 1IEWA 4MRRA 3EGVA 1Z26A 5KO2A 1E8MA 1AD2A 5DGXA 5TRTA 1KMQA 4XJXA 2O5RA 1U90A 4MKHA 3TFOA 3PWSA 1BKYA 2Q4OA 3CCCA 1M6VA 4HNGA 3W2EA 1B0PA 4GX1A 2PQMA 2ARKA 4G85A 4BUZA 3OIGA 2F17A 1DPGA 4TQAA 2PGAA 2A8YA 3WK5A 3QTBA 1F2UA 1M10A 3EZNA 2O7VA 1YNSA 4LCEA 1QGYA 3U0VA 2B1RA 2AUNA 2BMEA 2ZI7A 1PRYA 2AMVA 3EHEA 3HJAA 5CH5A 4N7BA 3TOZA 5HGXA 1ZINA 5EFZA 5JQGA 1D6SA 3EZGA 4LBYA 4W5OA 1S01A 5TC4A 4YJFB 2ZUBA 3STVA 1JUDA 2ZTSA 3EWIA 2CHGA 4G3XA 1QIGA 4JR2A 5AOAA 4E2ZA 2NZ2A 3WB9A 5M5BA 3WLLA 4F3KA 2G7ZA 1EVYA 3RIEA 2Q3HA 2E5LB 2JGEA 1H2AS 5CX4A 2H2AA 1KH2A 1NVWQ 3KOXA 4PO1A 1SXJA 4NPCA 3OJEA 3K4PA 2HUNA 4M53A 5FNZA 4JGBA 5DHFA 5I45A 2PA0A 1CYDA 4KVZA 4YDQA 1MVLA 3E22A 4K28A 2H08A 5AUOB 1GEEA 3FA2A 3LX6A 1F9EA 3SBDA 4AZ3A 1QPBA 5E95A 4HI0E 3LIPA 3BEDA 5F7XA 1YONA 1PZXA 2OZEA 4CKYA 2Z98A 2WHEA 1R66A 1R8YA 3NONA 4RFSA 4RD4A 2X4DA 3VX3A 1NC1A 3KDPA 1H42A 1R6BX 4NFYA 3E9NA 4Z4HA 3L79A 3TE7A 3ZWMA 3KIPA 3LT2A 2XNHA 3T1OA 3PRKE 1IUOA 3A1CA 3I6QA 3W77A 1VL0A 2WZDA 3V00A 3DTVB 5IZCC 2XGGA 1SXJC 3KZMA 3OM1A 1T91A 2YWRA 4G5GA 4MI1A 1XQYA 3GEBA 4TGLA 4I66A 2PZAA 4WH0A 5KTRA 1K98A 5K9ZA 3TXYA 1Z0ZA 3JRWA 3KYJB 2PKXA 1OV4A 1Q83A 3UKJA 3L4KA 4UQPA 2C84A 3RUAA 4D82A 3KOUA 4G8CA 4RVGA 4WN9A 4AJPA 4D9GA 3HM2A 4F2WA 4NJEA 2WKQA 2AOWA 2OZKA 1N9KA 3NI2A 4TL8A 2QG9A 4JP5A 1MJGM 3K5IA 5JG7A 5I7EA 4ZKEA 4C2TA 1HDGO 4E2YA 1X9GA 2J33A 3GK3A 5ED0A 4L0CA 4K26A 1RSZA 1WV0A 5FAXA 1A9XB 2O7QA 4E21A 1RE0A 2O8DA 3F8SA 4GECA 1VBMA 3RVMA 2SBTA 4QYWA 5AW5A 4EKYA 1ZPDA 5BR1A 3FHJA 1TTQB 1CY6A 1JHAA 5EQTA 3BICA 3UJ8A 3EJ6A 1OKKD 1S2MA 4MV7A 2P9TA 1FS5A 1C8BA 2EATA 1GQQA 1U7UA 1V6AA 1L5GB 3L0ZA 4ZEMA 4TTIA 4BX9A 1C9DB 1SKYE 1W8DA 2Q4DA 2FQ1A 4MPDA 2K2QB 4NF2A 5TQ2A 4F4CA 3R3WA 3QJYA 4MWEA 1DRWA 3T9AA 1Y82A 4PHGA 3C3WA 1U0TA 4U2EA 4B6RA 2YJNA 3AHGA 4BIIA 1Q20A 5AK3A 1C30A 1XCLA 4NTZA 4AL4A 2CXSA 1MJFA 4G4JA 3ML1A 3RAEC 1U3DA 2A9RA 3U3RA 1G8YA 3QUBA 4EI7A 5JYCA 1BEZA 1I4EB 1U1IA 2AZ4A 1A5BB 5F77A 4MRPA 5GONB 4BRUA 4DG9A 4KR7A 4YCBA 4JJ8A 3KHKA 3H8VA 1CNMA 3LUKA 3UCFA 2AK2A 1C0KA 3BBLA 4QEZA 3KXLA 4BE7B 5JHHB 5LP6B 3KOOA 3OEYA 3DBHB 3IE0A 3G2HA 1N2BA 3X1XA 1ZA1A 2YYSA 3KQQA 4V0SA 5CXXA 2AC2A 1YOBA 3TAHA 4RBNA 4CMJA 2QZPA 2G1KA 1YR8A 4Q4LA 3U9TA 2V7BA 4CE6A 4Z6KA 2QN6A 2GPNA 1FTSA 4G9EA 3HU2A 3OE4A 1ZOLA 3U3JA 2YN4A 2C4HA 4MVJM 3RABA 4YCLA 1CRZA 5JJBA 3O8RA 3H11A 3U7EB 2XTZA 1X7ZA 4NU0A 5KQRA 4ARSA 5ER6A 1ONNA 5K3BA 1TAQA 2O06A 5JSYA 3N5KA 3KV1A 4O4HB 1NW7A 3BA1A 3M6FA 3FRIA 1B8VA 2X86A 1WTCA 3P1JA 1ILWA 2EW8A 2PMBA 2R7NA 3B82A 2CLHB 3E53A 4RQUA 2HWWA 2R5NA 4CG1A 4DBLE 1NI4B 3UTDA 1PK7A 1GNSA 5EYPA 3WFZA 2AYYA 4A2QA 3SKYA 2MYPA 4ND4A 3W9SA 3H5TA 1YZGA 5H0IA 5ECDA 3TDMA 3VTZA 2JCYA 3OPYB 3I2KA 3ITEA 3KSMA 2DJIA 1JALA 4WMLA 4XYBA 3GIWA 4CKWB 2PUFA 1IZ7A 4DNQA 1J06A 3IHLA 1C7ZA 4YJ3A 1RXYA 4FOSA 5C8YB 2LCIA 3K7EA 2Y1OA 4V1CB 1IBSA 4IHJB 2XSZD 4KO3S 1NQ5A 1TLTA 3F5QA 4J4TA 4RTMA 3QWBA 2B1IA 4EYEA 2IUUA 1BWSA 5CRIA 1AKRA 4BVKA 5K2OA 4FS8A 1KE1A 1ZN9A 1K97A 3AJ8A 3HDQA 2BONA 3SXUA 3T7TA 2MR5A 1YNOA 3KLOA 4A91A 2YYYA 1OA1A 1ZZGA 4GO1A 2F4NA 2YJ5A 4ND3A 3FRJA 3DMHA 3K32A 3OPMA 5ALOA 4BOYA 3IS3A 1MO4A 2FZEA 4EA8A 3HP1A 2QWXA 2Y2UA 3SX4A 1B16A 2HJGA 1HLGA 3D81A 3KL4A 5DWVA 5LBIA 1RIFA 5JASA 3C43A 1NJ8A 2OAQ1 4OHMA 3L4BC 3U6KA 3V1UA 1X13A 2R1ZA 2BV3A 1PFKA 5C4GB 4DY6A 1AN0A 3O8QA 4UUMA 5A4AA 3PDJA 1NUUA 4JLJA 3EARA 3IB3A 2WSBA 1X70A 4R0NA 2XMPA 5K01A 1CR4A 2Q4EA 4FNMA 3K2IA 3JQ7B 1YCDA 3Q40A 1QZTA 5LQMA 2NTVA 3THWA 1EJ6A 3L8MA 3UC9A 1P8JA 4BL5A 1SCKA 2Q4TA 4DSTA 1C4WA 1F0NA 3UJHA 5EERA 3NGLA 2OAP1 1JJAA 1F3OA 1E2QA 2XWQA 1U2ZA 2I4RA 2BUCA 3AEZA 1W5TA 3R4CA 4HH0A 1VLJA 1VHQA 4K2AA 4JI7B 2UUPA 5E3IA 5BVGB 2BI7A 4J0CA 4PSCA 1Y63A 4D80A 2IE8A 3OJWA 4I4CA 4EG1A 3L7BA 4ND7A 3VAAA 3ULKA 3TLZA 1QFZA 2FCRA 1ZITA 3PYLA 3H5WA 2Z58A 1I0ZA 1O87A 2GHQA 2WVGA 1BMDA 5KDLA 2W42A 1R0YA 3NEAA 4F06A 3LV8A 4MYSA 4HSGA 2WM8A 4CF6A 3C0KA 4DL9A 1IH8A 1RI4A 4II3A 1I2CA 1Q3KA 2D0PB 2V6JA 3ZCTA 1FTGA 3KM0A 2D2EA 4UW9A 3OIFA 4NMLA 4OHZA 5K99A 5KVCA 2XDWA 4H3KB 4YCAA 5IJ0A 2YV2A 2H2DA 2FQWA 2QEQA 4JCCA 4JUIA 3QK7A 1CEEA 3B1FA 3RF6A 4A7PA 4QQKA 2R8PA 4KWIA 2D5AA 2ID4A 3HBFA 4QM6A 5F73A 1CF9A 2MYUA 3NVMB 4EQ6A 1ZKMA 4V2IA 5SY4A 3OE7A 4LHWA 1CRPA 4B7ZA 3GNQA 4BO2A 1Z5GA 1RYDA 3B53X 4CF7A 3NHSA 1WA5A 2AB0A 3L7AA 1I2BA 4QSMA 4EYGA 1VCMA 5ALUA 3N2EA 1F2TA 3DCIA 4KLZA 1D6MA 5EP3A 4GC9A 2ANBA 4UBJA 1LKZA 2AIRA 3VSDA 1L4HA 1NXWA 3NM6B 4NATA 4GX0A 2QL6A 4NNOA 3LK6A 1ZGZA 3GGJA 2R6JA 1VMDA 2IHVA 1ECBA 1OFGA 2WJ3A 4OY3A 1ZGJA 3TCNA 3X2EA 4MHOA 2CLEB 4HSEA 2HV9A 2VR1A 2ZJ1A 4MRMA 3RS9A 4E5MA 3MWFA 2OYSA 1NYRA 2RHGB 1DU4A 3K9QO 1DZ3A 1V2GA 4MQEA 3FYUA 4NH4A 3FCYA 3RIMA 3BXHA 4DB2A 1ESZA 5E6SB 3QYFA 1V1MA 4DT1B 4X1KA 1YUNA 2FMFA 3THSA 1Z17A 4D3YA 1TF7A 1WVMA 1Z74A 4BTLA 3HJFA 1BXGB 3A36A 2VPZA 3BN3A 3C70A 3L0YA 1A8UA 4HBZA 4UZSA 4B32A 2J9GA 3Q6NA 1A82A 4QO7A 4ZTBA 1IDOA 4BMSA 3EXEA 1CJTC 1DFIA 5IPFA 3QA3E 3RQSA 2J9RA 3IIMA 4YTEA 2GESA 4BFVA 4AROA 2RKBA 5J3JA 4PSDA 3SHFA 4P3OA 1FS4A 3VU0A 1NUSA 1UEIA 1XDBA 4RLHA 4QGSA 1IE3A 1YJXA 3Q1KA 5ALRA 3H0KA 3EDMA 5FYQA 2YMPA 4WCFA 3L7JA 1EP2B 1WSWA 1USIA 3INGA 4MWDA 4TXHA 3T15A 4HQOA 3FTCA 5GMOA 2WIFA 2IZ5A 4DR3B 5FUQA 1PL8A 1P7ZA 2GQ0A 3NTQA 4OBXA 2FEAA 3TR0A 3TZKA 4L16A 4CT0A 4P0PB 3LUCA 2FSPA 5CR9A 1HTBA 2SKCA 2JIBA 3N7UA 2VRNA 3TTWA 4HH4A 3I76A 1C4KA 4DLZA 2HNBA 1V1RB 3ADOA 1ZVJA 3L8CA 1C1YA 1X8LA 3ROXA 5BV0A 5A2QA 1GGFA 1RHMA 3QF4A 1OR8A 2AFVA 2HSGA 4WFIA 4RHEA 2OZVA 4WV3A 3DH0A 1SCBA 1TZCA 2A7QA 4HMOA 1ESNA 4RL6A 2QRMA 3ZE2B 1R00A 5TDHA 3ZY6A 4QQFA 2NVUB 2C98A 4IMRA 2BHRA 4GL4A 1WS6A 4HH3C 5ALGA 4JB8A 3ROFA 3U7QB 4CLRB 2QN3A 4NOMA 4YS6A 4MW0A 4YRRA 4KQ2A 4J4BA 3WSTA 1SHZA 2G9VA 1GKKA 2NO5A 5AXCA 1WETA 1CYEA 1G2IA 2HWXA 3NB0A 2Q1YA 4XASA 1VM6A 4I1SA 4MROA 1OX4B 4MS4B 1DAHA 1M6YA 3D3KA 3S2SA 3WLAA 4N3BA 3VSBA 5DBIA 1GIAA 3B1JA 3VXKA 1DBIA 1M1ZA 1MA3A 2OLEA 1WHTA 2FSFA 4OFBA 1EBBA 1MX5A 1WQ4A 3AGQA 5AHOA 3U4GA 4A2CA 5LP6C 4MUMA 4AS3A 4NDNE 2Y92A 2Q21A 3NBXX 5P8WA 5AI8A 3BK7A 1AKTA 4Y6SA 3DHVA 5B1IA 3HZRA 3MERA 4I9GA 2DBRA 3ZU2A 5LQDA 3MGBA 4QTZA 3GNSA 1WQ3A 3QA9A 1N36B 4B3GA 3L06A 2WV9A 4G84A 5B7QA 4Q4CA 2RARA 2B83A 2WD7A 1BMFA 3KCQA 5CNMA 4HVAA 2IV2X 4F8JA 2BOVA 4AT1A 1UXKA 3C5WP 3HL0A 3ICWA 1XTKA 1GV0A 1ZM9A 2PWYA 5DGIA 4N4AA 3QNWA 2II6A 5DTQA 3OZIA 1H22A 4L9SA 4ZYXA 5JH7B 1KNQA 1N6LA 1NBIA 2E49A 2PLAA 3PG5A 2F8LA 3EZLA 3TGPA 2OR3A 2QRVA 2QTAA 1N0HA 5C7OO 2R1VA 5FEUA 5LYJA 3OQMA 5I7FA 2HSEA 3DEYX 4QUHA 3CV3A 1FYWA 3QIAA 1GFZA 3QLVC 1XXHA 1M2GA 4HGNA 2CFSA 4JEUA 3SX2A 1YZ3A 1PQ4A 3ZUPA 2DLNA 1UBRS 3D5EA 3H3FA 3L1JA 3L6CA 5JSUA 4KREA 1VKRA 4XKJA 3B89A 4B3TB 3PQDA 3H4MA 1NXTA 3GQBA 5KDDA 4ARAA 5HE9A 3WMRA 2WUGA 4LJ9A 3IAM1 2JGDB 3F7NA 4NEHB 1ZKDA 4B0PA 4C6HA 2DEUA 1EWTA 2BFOA 3UT6A 5M2QA 4OI2A 2DFPA 2RAUA 1UKVY 3BB1A 4INJA 4U9HS 2VYFA 4YMGA 1IWPB 3TI7A 1CQJB 1T5OA 1RP7A 3D9QX 5JC8A 1KZGB 3ZDEA 2NTJA 3RRJA 1SBYA 3AKYA 1Q1AA 4UJ3A 4NHEA 1JQ3A 2FPIB 2WK1A 3I5MA 1Q92A 4Q1DA 2D3WA 3VR5D 1JU3A 5FTNA 3PXAA 4WBNB 3A04A 3OTWA 1P7PA 1M0SA 2BFDB 3DV0A 3KXIA 1WXIA 2QA5A 4H15A 3R3SA 3B1XA 1EK5A 5KKAA 3TFWA 3WLPA 4PF1A 3NAGA 1Z35A 1QYCA 4B45A 3FOCA 4MV5A 4Y2RA 1N2OA 2YZKA 1OWLA 1TQ4A 1U9ZA 1SC3A 3B7WA 3G23A 3SHWA 2WIKA 4FQ5A 2O5EA 2OAEA 1WR8A 4IF4A 3RRFA 3THYB 3EQ8A 2CDRA 4DNXA 1JS1X 3OA2A 4NVRA 4XSGA 1X42A 2QORA 5H3CA 4IRXA 3VOTA 4B3FX 4HMPA 1RYMA 3LW8A 3DW3X 3D0RA 3V1YA 1NI5A 4HDSA 4YMSA 5A0TA 2IOQA 3AM3A 1Y9DA 2DVMA 3FRHA 5LD2C 3CLSD 3HUTA 4JC0A 3OZRA 4RCYA 5M29A 2NSHA 4HPWA 2HGZA 1SKUA 1KVTA 1ZZEA 1D8TA 1E89A 3H42B 4KMOA 4KQMA 4R0MA 1XEWY 3FPSA 4GPZA 4PQRA 4UEJA 5D5QA 3C45A 1FZTA 4KKVA 3EG5A 3AFHA 1NUPA 2J6IA 5DNAA 5J59A 5F1PA 1H6CA 3VR4D 3OLYA 1ABEA 1QXSA 2NUBA 1BWQA 1RACA 2FQXA 3CM0A 3HQ4O 4OGFA 4DCVA 1YOVB 3DBIA 4AG6A 1GPLA 3WIDA 5J4KA 4YWHA 4XLZA 3OZVA