3JWJA

Crystal structure analysis of the methyltransferase domain of bacterial-avhen1-cn
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
199
structure length
188
Chain Sequence
SLNQQRMNGVVAALKQSNARRVIDLGCGQGNLLKILLKDSFFEQITGVDVSYRSLEIAQERLDRLRLPRNQWERLQLIQGALTYQDKRFHGYDAATVIEVIEHLDLSRLGAFERVLFEFAQPKIVIVTTPNIEYNVKFAHRFEWTRSQFQNWANKITERFAYNVQFQPIGEADPEVGSPTQMAVFIHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hen1
publication title Structural and biochemical insights into 2'-O-methylation at the 3'-terminal nucleotide of RNA by Hen1.
pubmed doi rcsb
source organism Anabaena variabilis
molecule tags Transferase
total genus 67
structure length 188
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08242 Methyltransf_12 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3jwjA00
2IP2A 1G8AA 4QPPA 4E30A 3M6XA 4KW7A 4EQZA 5E8JA 4IV0A 2ZIEA 3GCZA 3NVMB 3G2QA 2P41A 4KIGA 3UJ7A 3VYWA 1KPGA 4ER5A 4MHTA 1KR5A 3Q87B 5HZMA 3TKYA 5HEKA 4LG1A 3BWYA 3FPJA 5B1SA 3UWPA 1JG1A 1WG8A 4MQ4A 1UWVA 5IKMA 4BY9E 5HILA 4C4AA 3FTFA 2YQZA 3OU2A 5C9ZA 4V0QA 2I6GA 3GIWA 3IHTA 2R3SA 3P2IA 3KQWA 5GM1A 4XUEA 4CXMA 3LGAA 3HM2A 2ZW9A 3ELUA 3BWCA 3FPHA 3MTIA 4WVLA 3GJYA 4RTMA 3ER8A 3MB5A 5KS2A 3DR5A 1P1CA 1KXZA 3NDJA 5DLYA 5DXAA 1O54A 5T67A 3CJQA 1L3BA 3KPWA 3T7SA 3PTAA 4C07A 4AUKA 7MHTA 1BHJA 3C6KA 3FUUA 3DULA 4IV8A 3D2LA 4YUVA 4QDKA 4RVGA 2OB1A 3E8SA 3G5TA 5CUQA 3M6WA 4RVHA 2PJDA 3RODA 8MHTA 4PIMA 3THSA 5ICFA 3LSTA 3I9FA 3BWBA 4R6WA 3PX3A 4FT4A 5FQNA 3TQSA 2QRVB 3TM5A 2P3QA 3TOSA 2GS9A 2UYOA 1UFKA 3P8ZA 4RYLA 2R6ZA 5CVJA 2Z6QA 2NP6A 4OBXA 4UOEA 1VIDA 3KPYA 4P58A 4QTTB 1XDZA 4C06A 5CVUA 1RI5A 3DXXA 3GO4A 4LWOA 4JXJA 5GIPE 1WXWA 4R05A 4QDJA 2H1RA 4CWAA 5DWQA 2WA2A 1KIAA 3AXSA 3TR6A 1NE2A 3SMQA 1DCTA 3DP7A 2OPBA 5DM4A 2BR5A 5DSXA 5FADA 3UJ8A 3P9NA 3LBFA 3UJCA 5LR6A 2BR4A 2PVCA 1IY9A 5FUBA 2B9EA 2AOUA 3LL7A 2NXJA 2OKCA 3HCFA 5JR3A 2C7PA 1JQ3A 3G89A 5LQKA 1Q0TA 3P2EA 3GRVA 3I5UA 4PCAA 3TPZA 4ER6A 4HC4A 3K6RA 1NW8A 2ZULA 3G8AA 4XUCA 4KDRA 1EG2A 1G60A 10MHA 1NV9A 4G56A 2JH8A 4BLUA 4EK9A 5LQRA 1I1NA 1NW5A 2H11A 1AQJA 1SG9A 3R6TA 1WZNA 3HCCA 2ZTHA 2ZFUA 4BLWA 1NBHA 2E5WA 3DMGA 1F3LA 2BZGA 2PXAA 4X63A 4F86A 2DPMA 1EAMA 3MCTA 4PIPA 4R8SA 5CIYA 4EVIA 5CCXA 1IXKA 2FPOA 5EKXA 1YUBA 4RTNA 2JJQA 3GXOA 2YTZA 3G2MA 5U4XA 1YF3A 3FYDA 3NMUF 2ZWVA 5KVAA 4E2ZA 1FP2A 5GINE 1NKVA 5DSTA 5EEHA 3OFJA 3SXJA 2B78A 4M36A 2HV9A 3M6UA 2GH1A 2I62A 4MWZA 3FUXA 2YXLA 4M38A 2Y1WA 2BH2A 2P35A 4HSGA 4YV1A 3HVJA 3P9IA 3G8BA 3GDHA 2O06A 1G38A 1VPTA 3AXTA 5DTRA 4HGYA 3MQ2A 4GOND 3NTVA 4P7JA 4V0RA 1XCLA 2HMYB 3KPJA 2CMGA 4Y30A 3EVBA 3QOWA 1VP3A 3KQOA 4M37A 5DM0A 5M5BA 3SM3A 3SSMA 3OU7A 2C7RA 2AOUB 3THRA 2PX2A 2IH2A 5F2NA 1TW3A 1RJFA 4FZVA 4KIFA 2HNKA 1RI4A 2UYHA 1QANA 3S68A 2C7QA 5KQRA 3EMDA 5K09A 1QZZA 3R9XB 5DX8A 5EZSA 4OBWA 5ICGA 5G02A 2CKDA 5K01A 3DOUA 3H2BA 5EIWA 4AZTA 3UA4A 3DLIA 4X41A 1V39A 4F85A 1QAOA 1R00A 2ZBPA 4U7PB 2AOTA 3KR2A 1T43A 2VDWA 2ORED 2Y1XA 1EQAA 4GC9A 5FA5A 4PNEA 3VC1A 3HVKA 2YX1A 4R6XA 3L8DA 1JQDA 3A27A 3VSEA 5HIKA 1G6Q1 2QE6A 4EKGA 2HTEA 2ZVJA 1BOOA 5E9WA 3BUSA 3KPVA 3EVEA 2IH5A 5HOQA 2PX5A 4RTKA 5K0JA 1L3CA 4HTFA 2UZ4A 1QYRA 1RI2A 3DXZA 3REOA 2XYRA 1B42A 3ANXA 3ID6C 4X60A 5K0CA 2ZCJA 3GU3A 2AZTA 2FK8A 2JHPA 4DCGA 4E32A 3JWHA 3G2OA 3UA3A 3RIEA 3BZBA 1O9HA 2YXDA 4KRGA 1TPYA 4RSRA 4KWCA 2B3TA 3BXOA 3P2KA 5DXJA 4ATNA 5T64A 3NW9A 5BP7A 5FWAA 4PINA 4RTJA 3CJTA 5DX0A 3F4KA 1BKYA 1SVUA 1X1BA 2GA9A 1WXXA 4HG2A 1RJGA 1PJZA 4FSDA 4C05A 2V7EA 2VP3A 3P9KA 3FTEA 3OFKA 4XCXA 5K0FA 4YV0A 3LBYA 2GLUA 3LCUA 2OZVA 3HA7A 4E2YA 3FPFA 4YUYA 4OA5A 3A25A 3ME5A 4C08A 1M6EX 2PKWA 3ELYA 3ELWA 3HVHA 4ER3A 3UZUA 5EHIA 3EMBA 3TLJA 3HTXA 2AOTB 3CJRA 3CKKA 1SQGA 5FWDA 2FK7A 2PT6A 4OQDA 1SUSA 3HCAA 4BP3A 4LECA 3TFWA 2NP7A 3UJAA 2HWKA 3NDIA 3C3YA 3VC2A 1O9GA 5CVVA 2I7CA 3B7PA 3FPEA 5EZQA 4QVKA 3BGVA 4AX8A 2O57A 5FULA 5EIFA 5E1OA 4ER7A 2IFTA 3KQVA 5DM1A 3ER9A 4FT2A 1N7JA 2JH9A 2WK1A 4P7GA 5FA8A 4HTFB 4X61A 1AV6A 3T7RA 1R6AA 5HFJA 3I58A 2CWWA 1H1DA 3KQMA 4GC5A 3EGEA 5D1NA 2P3LA 1FP1D 3M6VA 3LDUA 5E2BA 4A6EA 2Z6UA 1NW6A 2JHAA 4RVFA 3KR9A 5CD1A 2P7HA 2VZ9A 2AS0A 4PYKA 1ZHFA 1PRYA 2ADMA 3P9CA 5E9QA 3C3PA 4HH4A 5LQNA 4XUDA 3EGVA 5HIMA 1VQ1A 1XVAA 3PT9A 3HCEA 2BM8A 3JWIA 4KDCA 4PCLA 2PLWA 3KR0A 3OE4A 4A6DA 3ERCA 1JG4A 3DUWA 1DUSA 3OPNA 4PGHA 3CGGA 3GRYA 3Q7EA 3R24A 4OQEA 5DPMA 3EVCA 4BP1A 2XVMA 3GRUA 3KU1A 3LDFA 3KQSA 2CL5A 4E2XA 3PB3A 3KQQA 4RX1A 3SR4A 4PYLA 4DA4A 2EJUA 1D2CA 2V74B 1Z3CA 3LHDA 4RV9A 1VBFA 5EMLA 5HIIA 4C04A 3FRIA 3OZTA 1JQEA 3HP7A 1XJ5A 4CKEA 3EGIA 3AJDA 3NJRA 5K0EA 5EHGA 1X19A 4BLVA 2ZWAA 3EEYA 2QM3A 1BC5A 2G8NA 3E7PA 4RTLA 3G2PA 2UYCA 3MGGA 2P8JA 4GOOD 3BT7A 2ZZKA 3UJ6A 1XCJA 5EMMA 5K0NA 5FHQA 2LD4A 3A26A 3NWEA 5EKUA 3RW9A 1JG2A 1KHHA 5F2KA 2FHPA 3CBGA 1Y8CA 1QAQA 4C03A 1NT2A 3O7WA 2PXCA 3EVAA 3IEIA 4DM3A 3BGDA 3EVDA 3KKZA 3SVZA 5CM2Z 5E1DA 3QV2A 2AOXA 3LECA 3KR1A 4OA8A 4WXHA 4Z2YA 5BW4A 2N47A 2ZBQA 3PFGA 4E33A 3MTEA 1N7IA 4PONA 1R8YA 1VE3A 2OB2A 5GP1A 4YUWA 3M70A 5CCBA 1ZG3A 4P7FA 5MHTA 3DTNA 3SX0A 4DCMA 1X1DA 1TW2A 3FTDA 3K0BA 4R8RA 3MHTA 2ZZMA 4RVDA 4KVZA 3A4TA 3X0DA 3BKWA 3I64A 4GQBA 2PY6A 2IPXA 4L7VA 4ZTBA 2AN5A 1IM8A 1SQFA 2PV0A 1UIRA 1ZQ9A 1EIZA 5DT2A 3UJBA 4RTPA 5KQSA 3PS9A 1D2HA 3ORHA 1SKMA 3C0KA 3WSTA 2Z6AA 3V8VA 2ZLBA 3SSNA 5DTMA 2ZBRA 4AZSA 2YVLA 4OX9Y 3LPMA 3GWZA 1EJ6A 3T0IA 1P1BA 3EPPA 2NXEA 3EEOA 4YMHA 2F8LA 1XDSA 4PYNA 3OU6A 1OR8A 2VS1A 3A7DA 3B3FA 4Y2HA 3OCJA 5CVEA 1YFLA 2FRXA 1R18A 2PX8A 3G5LA 2H00A 4CKBA 3V97A 1AF7A 2DULA 5IH3A 5D1HA 3O31A 2EJTA 5E9JA 2QRVA 3DMFA 1KYWA 3HCDA 2NNWB 3T7TA 2VDUE 2AOWA 5H02A 2I9KA 4QQNA 4E70A 3E23A 3I53A 3CCFA 3NWBA 3EVFA 1WY7A 1MJFA 3EVGA 3HEMA 5BW5A 1JTEA 3KPUA 1FBNA 4F84A 2PGXA 5DTQA 4PYMA 4M7RA 4CKCA 1Q0SA 2AR0A 2P1DA 4DQ0A 3GRZA 2EX4A 2PXXA 2ZIGA 1JSXA 2G72A 3FUTA 1G8SA 4U7TB 1KYZA 3MCZA 1XTPA 1ZKDA 2BM9A 2FYTA 2G70A 2ZIFA 2FCAA 2PBFA 4GUAA 4LWPA 2QY6A 3B3JA 1RJEA 4PGGA 3A7EA 1RI1A 4QPNA 5FHRA 2PT9A 5LQUA 2QYOA 3JWGA 4FR0A 4B17A 2GB4A 2G1PA 9MHTA 3UFBA 3HNRA 3IYLW 5LQCA 1FPQA 1JSZA 4DF3A 1VP9A 4O29A 5P8WA 1DL5A 2P3OA 1RI3A 3G88A 4PWYA 2GPYA 5EEGA 3TRKA 4GOLD 5E8RA 2EFJA 3SGLA 3DH0A 1D2GA 1INLA 3FUWA 3OZSA 3P71T 3AY0A 1F38A 3PLAE 4CTJA 1I4WA 2ESRA 2IIPA 2YR0A 4AZVA 3GNLA 5EPEA 3CC8A 2WA1A 1NV8A 3BWMA 1NW7A 2ERCA 3DMHA 2B25A 2B2CA 2K4MA 3C6MA 3ELDA 1JG3A 4PYQA 4PYOA 2XYQA 2ONZA 3OE5A 3HCBA 1X1AA 4EMSA 3M33A 2IGTA 2ZZNA 2EG5A 3UJDA 1L1EA 3MERA 2HR1A 4FS8A 3HA3A 4ISCA 2VDVE 3LKDA 2P40A 3GGDA 4FSXA 4X1OA 2OXTA 4DKJA 4PYIA 5FQOA 3KQTA 4IKPA 1JTFA 4YUXA 1YZHA 5K05A 4QQKA 3R3HA 3FPGA 1R8XA 1NBIA 3LKZA 5EMJA 5C1IA 4NECA 1HNNA 1HMYA 3EVZA 5EVJA 2XBMA 3O4FA 2JG3A 3LCVB 5LQAA 3U81A 5K0BA 4RWZA 4P7KA 2YXEA 3CVOA 5DM2A 2UYQA 1P91A 2IBSA 3LCCA 1EJ0A 4IWNA 5LSAA 1ZGJA 2AOVA 2KW5A 3PFHA 5E2AA 1L9KA 2Q41A 3BGIA 5EQJB 3GRRA 5C0OE 1KPHA 4H0NA 3KQYA 5F2OA 4DMGA 4GOMD 3B5IA 5EMKA 4YUZA 3SSOA 1YFJA 1M0EA 1KPIA 2O05A 3DXYA 5EOVA 1ORHA 1I9GA 2PWPA 2XYVA 3B89A 3FTCA 3KQPA 3LX6A 3M4XA 4EKIA 3E05A 5K03A 2IBTA 2NXCA 3FUVA 2OYRA 4HRAA 3UBTA 2AVDA 2IDJA 1XXLA 4PYJA 5LQJA 2IH4A 5K0GA 2JHCA 3JWJA 3PX2A 4DZRA 4ER0A 1X1CA 1MHTA 2PSSA 1U2ZA 4E31A 4FGZA 5CVDA 1G55A 2PWYA 4QVGA 5K0LA 3UJ9A 2AN4A 2AN3A 2XVAA 5ICEA 4HGZA 3DLCA 2NXNA 1KP9A 1M6YA 1AQIA 1RJDA 1XDUA 3LDGA 3QOXA 3HVIA 4RTOA 2IDKA 1ORIA 3FYCA 3G7UA 4POOA 3NVKI 2A14A 2NYUA 1JR4A 1R74A 4QTUB 5GM2A 2OO3A 5E1MA 4RTQA 1ZGAA 1YB2A 3KHKA 5KYGA 4RTRA 5ICCA 3IV6A 5DRYA 3TMAA 1YZ3A 5K8VA 5GIOE 5ERGB 3MAGA 5GWXA 1SUIA 2G71A 2O0LA 3P97A 2OBFA 5GOZA 4CTKA 2PX4A 3B3GA 1L3IA 2ZSUA 4RTSA 2AVNA 4K6MA 1WS6A 2P7IA 2YUIA 4MTLA 2C7OA 3AWIA 3FRHA 5FTWA 3TKAA 4AZWA 5BXYA 5HIJA 2GAFA 4GEKA 2OY0A 5T6BA 4E2WA 4FP9A 2ONYA 4MIKA 3R0QA 2O07A 5JUWA 5EG5A 2BR3A 2CMHA 3FZGA 5EGSA 4GF5A 4YV2A 1N2XA 5DRTA 5DX1A 1QAMA 3TM4A 3BKXA 1FJXA 3OZRA 1NW3A 1P39A 5E1BA 4YMGA 1VL5A 1VLMA 5EC8A 5FCDA 4GBED 3PVCA 3HA5A
chains in the Genus database with same CATH superfamily
1G18A 1G5TA 3GC6A 4UXIA 3ETGA 4UTNA 2Z56A 3GH3A 1Q44A 3R9IA 3VZPA 3ZYZA 4U7GA 5K8TA 1WCV1 2HHLA 4KIGA 1NJ5A 3G2QA 1KYXA 4TV8F 2HI0A 1ZU4A 2DTEA 4QC2A 1DO0A 1GTJ1 3R6LA 3WHIA 4DHWA 2P9HA 3MJTA 3UWPA 3BQNB 1J90A 1D2EA 2A0YA 3C24A 2Q4OA 3ER6A 3F96A 4D0GA 2PUGA 4BNDB 2DBQA 4CN8A 3VAAA 4ALKA 4HUQA 2OMKA 4NBTA 1HDEA 4NH4A 3DQZA 3GN1A 3B2NA 4O4IA 2IODA 2VHQA 3HM2A 2FJPA 3BHIA 5JEDA 2O50A 2Q8PA 1MO2A 1O4WA 1GZ6A 4H7IA 3N6XA 1GG8A 1KXZA 1OX4B 1PWYE 4BEBA 4LBVA 3OLYA 3CJQA 4WV3A 5DN6D 5HF5A 2PHZA 3FMPB 5CA0A 3T4UA 1ZJ6A 2NSDA 2VJLA 4IV8A 2QVGA 1U31A 2H06A 2JIZD 3BYZA 3FF4A 1O94A 4JCOA 2BDUA 4EENA 2Y1LA 1FE8A 4G8DA 2XCSB 5DKFA 4DLAA 1KA9H 5GJVC 5JAUA 1GG2A 2CJYA 3QBVA 2AT1A 2E6UX 2CHUA 5THKA 1B6GA 4TVBA 2GO7A 1M2VA 4ZAVA 4N65A 3WMXA 3GEGA 2CD9A 3DXXA 3PUHA 3ANTA 2G17A 5ENZA 1DBPA 2EYQA 3BREA 4R05A 3D7RA 5DF1A 3EPRA 1Z5GA 3KTAA 4PGAA 5BSTA 1KAMA 5DYWA 2IYNA 3RROA 1OAOA 3MWLA 4PWZA 1LI7A 4IGEA 2ZIWB 2QROA 2W8BA 3X2SA 1GEEA 1HSOA 2C07A 1NQXA 1Z7WA 2IHVA 3BFXA 5EKSA 4CV3A 3WB0A 2XRZA 2B9EA 3OJOA 3LUFA 2NXJA 1E1CA 1UKCA 3A9CA 1W581 4QQRA 4ITVA 1VRWA 3QLUC 1EDDA 2JVIA 1USGA 2MSLA 3QU9A 2P6OA 1W9MA 5CR9A 3N7UA 3AGQA 3GT7A 4TTAA 1K6IA 4EW1A 2N1BA 2H59A 3W5AA 10MHA 4G56A 1RMYA 4M3NA 1LQ2A 4G4JA 4YJ3B 3M3DA 2D13A 3AR9A 5KVSA 3AF0A 3JQRA 3DUFB 5HMLA 2Q7DA 1QWSA 1QZTA 1F3LA 1XJWA 3CG0A 5HIAA 1EX1A 1XQ1A 2JBAB 5FNVA 4Y2QA 2CB9A 2G76A 4HUTA 5I9IA 1IXKA 2CNKA 4WECA 4EGQA 5CIYA 4JLDA 5KNCH 3ETHA 3LQ1A 1C8BA 3PTLA 4X66B 2A9PA 4BJ6A 3KZXA 5LQDA 1SZJG 3HJHA 2HA6A 5FBKA 2CLLB 4IQGA 5IN5A 4JLWA 1TK3A 4YECA 4YP0A 3QF4A 3RABA 3VOAA 1VHWA 2C7VA 3MXTA 1MIOA 2JLCA 1C9JA 3O8LA 4EHLA 1ADGA 1ZUHA 1A5BB 1D09A 4MWZA 2HJ9A 2ZB4A 3N8KA 4QEKA 4EPXA 1NOKA 2WUGA 4QTZA 2O06A 1T4BA 1G38A 1U81A 4GRDA 3U4GA 3B1ZA 5JVDF 3AL0C 4OFBA 5C52B 5CPFA 4UAJA 1A1SA 2NZ2A 1J99A 4XOUA 2QR5A 4MGEA 2IYOA 4NRDA 5AJXA 3HKBA 5FJJA 4PZYA 4EAQA 1L8XA 1W85A 3OEHA 4FIDA 3GGGA 3G49A 1CQPA 1B76A 3PFIA 1V5IA 5CITA 2FZKA 1E0DA 2X7HA 5T4FA 2RDMA 2VJAA 2Q21A 1K6EA 1E3MA 4UE6A 4HDSB 1O97D 3B53X 3ND8A 1Z62A 4TYQA 5DP2A 3TECE 2Z5VA 3MOGA 2R65A 2HNKA 3DS8A 1J8FA 4G26A 2QBYB 1M2GA 5B1EA 1JG7A 2YW2A 1H8EA 2ZJ6A 1XRLA 3D3QA 1M1YA 2ZSKA 1PL8A 3SYTA 2Y0PA 3WQQA 4M21A 1TF2A 1QRUA 1HYBA 4GIBA 1NXPA 1K8XB 4AZTA 2ZK7A 3CPEA 4LVUA 5DLEA 1J97A 5JQWA 1HA3A 1HDYA 2P27A 4UASA 4UTPA 1R00A 2VXOA 4LZLA 1ZJWA 2GCOB 4KBFA 4MDYA 1SCJA 2WF9A 4MW6A 2BY4A 3HJAA 4S0XA 5AO9A 5FFNA 1G21A 5A4AA 4YPFA 1FP4B 2XQJA 1CZKA 1KY4A 3GJ0A 2WWXA 3Q1LA 4MP6A 4OD0A 3UPUA 4BNFA 4EYKA 1RS0A 4J6EA 5EWJB 5FI1B 2VHXA 2QLMA 4RZIA 5IT0A 2J0EA 4BV2A 1YFKA 3R5KA 4MDHA 4L4XA 4EF6A 5EJ4A 2UZ4A 4C7OA 1TKAA 1KGDA 2XR1A 3GEEA 3H2SA 2PYZA 4EPRA 3EPHA 2DUUA 2Q3FA 3TBHA 3HUEA 3TI9A 4RH1A 3AFOA 3GU3A 1LNZA 2Z5FA 4N7BA 1JKIA 1Y42X 3G0IA 2EFCB 1U98A 2GZ2A 2V7BA 4JI2B 4FDMA 3I2HA 1EVKA 2FQXA 3QKRA 4M7PA 4JP2A 2NWQA 3P2KA 3Q7PA 3RYCB 3GMSA 1EP2B 5T64A 2FZ5A 2AFIA 2JD1A 1NF8A 5PGMA 4MV8A 4AQ7A 1DXHA 2QPOA 4ZPJA 2RBGA 4DXAA 1Y1PA 4RY8A 3BRWA 1P9LA 1WXGA 1ILWA 4NI5A 2JAHA 5HMMA 4HG2A 4G0ZA 5TQ2A 4YLEA 4MWGA 3LM8A 1CJKC 3QYJA 1Y9ZA 3LT0A 4ZAZA 3OHMA 1UBEA 3JZMA 2VHEA 4OHVA 4RS3A 3TG2A 1C1DA 1XYVA 1RZUA 3R0XA 1SOUA 2ZVQX 4HBZA 3T8YA 1AX9A 3DWEX 2J3EA 4YUYA 5AVXA 2CVOA 4LOLA 1GRCA 5E6RA 5B53A 1DEKA 5SY4A 3CUEF 5G4LA 4I1YA 5F78A 1GSHA 3CRMA 3HTXA 3IIJA 3CKKA 1MNAA 5KU1A 3H5NA 2C54A 1OFIA 1H5NA 3ZDCA 4TTRA 4ZD6A 4RK6A 1LRJA 5BQOA 3S2GA 2HPHA 4W63A 1CZNA 3KDAA 5CVVA 1E8NA 4ZYWA 3KAQA 4NMWA 4AG5A 3BTSA 4ER7A 5B30A 1Y7HA 1SH7A 4UEKA 2QM0A 4JLBA 121PA 4FGLA 4JB0A 1G7RA 1RYNA 3T7RA 1WKVA 2QRNA 3C5EA 3DEYX 2O7QA 3GUZA 4IX1A 3EDOA 2QX7A 1FLDA 3QX9A 2CL6X 2Z6UA 4GXRA 5K6AC 4AY6A 2JIOA 1VMEA 2RG7A 2B1JA 3R0VA 1E9CA 3N70A 3HB1A 1PRYA 3ZG6A 4EVSA 4AJLA 3F98A 5H83A 5LQNA 1GZ3A 2EBUA 1ZGZA 3JQGA 3VC3A 5BV7A 1QU2A 3FZEA 3JWIA 1RWOA 1NX6A 4PCLA 3QI7A 3OE4A 3FVQA 4D2IA 5IJ9B 4A36A 4K9OA 4WOCA 1DG3A 1ZMRA 3KWLA 3ASYA 3CGGA 4XIGS 1KK0A 1WO8A 2WWIA 1I3CA 4FEGA 4CMKA 1RXWA 2ODNA 1L5RA 3ZDBA 1KI6A 2R4TA 3NHRA 3O4RA 1P45A 3S6JA 4FGUA 1U7XA 3PDHA 2QRGA 3QFSA 3RVJA 3WR5A 2IVZA 4D9MA 1N5MA 4L72A 3A6EA 3DEKA 1SXJB 3ZQ4A 1B3RA 5I4KA 4IV5A 1T2UA 1XJ5A 4UQOA 5FWNA 1IN8A 1N6KA 3G59A 3IR7A 5K0EA 1JLLB 2WPNA 3TR0A 3GPDG 4WOPA 3RU9A 4KR9A 4K9MA 4P4LA 1NPYA 1P3JA 3N8HA 5IKXA 3KOXA 1FDOA 3Q11A 5EKUA 2HB6A 4G4SO 4BO1A 5BUCA 4BKMA 4QHSA 1NBEA 1Y8CA 3N2YA 4R0NA 3UCXA 4R16A 1S1MA 4KIUA 1DP4A 1HE3A 1D0VA 2H4YA 4YJHA 3RBAA 1ZN9A 3VVMA 2ODAA 1UXIA 3KUUA 1C3LA 3O8OB 2JGMA 3OPXA 2QD4A 4GW3A 3QLVA 1P7VA 2WJ6A 4H7FA 4BO5A 3IAUA 5F5LA 1C0KA 1DIOB 1T91A 4F4DA 1AXRA 1JG6A 3AIIA 3RC9A 2ZYGA 4UBNA 1SBNE 5SYNA 1G5FA 1M2NA 1LBSA 3PE4A 4HVTA 2OBBA 2IPXA 2I6QA 1GZ7A 2QMZA 3MS2A 4MW1A 4EABA 3PYXA 4B4WA 5IANA 2IU3A 4OOEA 3MAJA 3KFVA 2ZUFA 3PUYA 5BSWA 4JBXA 4OUDA 1D2HA 3DHNA 2HKIA 1SKMA 3H1EA 4G5SA 2SKDA 2OV1A 4DZTA 1I7PA 2HMSA 3W2GA 2ZBRA 1E58A 1PJBA 2HZ7A 3CLVA 3DNPA 4OX9Y 1JJIA 3E3NA 4P4GA 4S05A 4XB1A 3SKVA 2NMVA 4Q18A 5TQVA 4IIUA 1I3NA 4M0LA 5BY2A 3PDWA 4MKGA 4GXNA 2J59A 3QK7A 5KINB 2WWYA 4FEAA 4MRPA 2A84A 2P5YA 3M81A 4GBMA 4MUJA 4ZVTA 3W8EA 4CKEB 4BECA 4YX9A 1ZMBA 5KYXB 1XV5A 2YVQA 4WKGA 4P83A 4W6ZA 4QGAA 1TGYA 2QD1A 1YMQA 3T3EA 1I94B 4WJKB 3TAXA 1G8MA 4QNRA 2FUCA 4IF4A 4LSMA 2RCNA 1ZBDA 5IARA 3RUPA 4V02A 4TSFD 1WDWB 5DGDA 5I9BA 2DFTA 2REXB 3R5JA 4KXWA 2OM2A 3HSSA 4BU0A 1VSUA 2E5FA 3KPUA 1WMEA 5DTQA 1FXSA 1SU6A 4BCDA 4CKCA 2EX4A 3LQQA 3MA0A 3WY9A 5HW0A 3C3DA 2P4SA 4LGYA 5KX5B 2NZ8A 3H84A 2W6JA 3HRKA 2WHXA 3Q0IA 1U9JA 1YQ9A 3L8HA 5C2JB 5AM5A 4B6QA 2RH9B 2WI8A 3LAWA 1F5NA 3MD9A 1QK4A 2Z4TA 3DZCA 1O2DA 3HN6A 3MMZA 1Y1QA 3QLEA 2DC1A 2OHOA 1DRJA 4XJTA 4NMXB 4Y1EA 2Z1DA 4Q3EA 3RYIB 4O2AF 5CRIA 5IXYA 1RBYA 3AEYA 3UO8B 3PDUA 4QDOA 2LDXA 3CA8A 1FPQA 5DHUA 2Q1UA 4IOMA 4BFUA 4E5SA 3I6BA 5I7UA 3O0DA 4P81A 5F4BA 4JELA 4OHYA 3WV5A 1RACA 5FV7A 4PWYA 2Y1EA 1UAYA 3SS7X 1SXHA 3FUWA 1J0EA 2Z2ZA 4DBZA 1I7DA 1NVGA 4DRZA 2ESRA 2Z1NA 1JR3E 2Q3LA 3GNQA 5E3JA 5CB4F 1TZ2A 2E1RA 3U7GA 1QZUA 3DMHA 5F35A 1XN4A 2B2CA 2K4MA 3U4QA 1TM2A 1JEDA 4PVDA 1KIFA 1E0JA 1FRNA 1XTTA 2FR8C 3NYQA 3EBLA 3TZCA 5JWOA 1SG0A 4RHUA 5CVTA 5HM6A 2FFJA 4RGVA 1TUEA 5JBQA 2OXTA 3CZ9A 1K5DA 2B4RO 4EHDA 1K3UB 2WAOA 4LHZA 5DNVA 2PWAA 4YUXA 3CZ4A 3FPLA 3L43A 5KEIA 2PUTA 3G9QA 4U5XA 2AEMA 1KEEA 2H5EA 5EMJA 1W46A 4A7PA 1LZKA 1J7JA 1PUXA 1XMSA 2BFEB 5C1IA 3FDZA 4KMMA 4M1ZA 4LJYA 2JG3A 3OPYI 4X94A 2P6NA 2X0NA 1ML3A 1K5PA 3KCQA 4EQ6A 1OF1A 3ACCA 3KKOA 1P0PA 1S6YA 5FL7D 1ORDA 1N36B 1VJGA 4H59A 3RK0A 3TS1A 1S4QA 3PE6A 4M6WB 4FZ3A 5CM9C 1GNLA 3E0QA 3KEMA 4BGVA 5M7EA 1G3RA 1GL3A 1A9XA 2FZEA 6REQB 1YT5A 5EQJB 2NUAA 3H9EO 3VR6D 4AULA 2DT5A 4P3YA 3C3WA 1TMKA 1OFGA 4JOCA 4WESB 1M0EA 4RWEA 2CV0A 2AX3A 3CH4B 1II0A 1DHTA 1U2GC 1BNCA 1OFHA 1Z2OX 3REQA 9LDTA 3ESCA 2AX4A 2XYVA 1J20A 4MW9A 5MN4A 4P3PA 1IVSA 1L7AA 2VDNB 1RWKA 1QF6A 1VXOA 5ISMA 1FU4A 1L4HA 4HZUB 2IWRA 1TZKA 4PPQA 1EP1B 4BASA 4C7JA 1P4GA 2IH4A 1PL7A 2JHCA 1TUGA 2IEIA 4UUNA 3QMWA 2NO6A 1CUHA 3AO0B 3C8HA 3W0LB 1PX2A 2CCJA 3RD5A 2RCYA 1XLUA 1VIMA 3CMMA 3GBPA 2J9ZB 4EEKA 1Y3DE 2G1AA 4FKBA 4Z4FA 4ITRC 2QD3A 4TVKA 1RYEA 3BXXA 3U6KA 1DJPA 1KKLA 5H0IA 4HVAA 3WGIA 3L8FA 2GOYA 4FB4A 3BAZA 2QN8A 1MNQA 3BFPA 1XZNA 3B9BA 2ZSFA 1DSSG 3IAEA 3MINA 1NTOA 4X5OA 5A5GA 2LP4Y 3ZY5A 4GI1A 3QIVA 4NK5A 5IHXA 4D4IA 1DOHA 3MJHA 1GFSA 1X7XB 2FP4A 1VYTA 3R3YA 2LTAA 4WIAA 2X5XA 2C5GA 5IM4F 4OVKA 5C8XA 4R9UC 1Q7BA 4OU5A 5DNAA 3NBFA 5AKIA 2HCJB 2BT4A 4LY6A 1QYVA 1Q95A 2DAPA 2OBFA 3QG1A 2XF8A 2P5SA 4RVCA 3ZHYA 3T61A 4ECEA 1K92A 4QG7A 3CIFA 1MV8A 1B23P 2A5DA 1DKMA 1DTEA 4FGWA 2O8FA 1HQKA 1GEGA 5KTRA 1FMCA 3ZQ6A 2PE5A 3VYVA 1G17A 1XRRA 5A9SB 4RMJA 4XPIA 3UPTA 4CTNA 3H5LA 4OJYA 1JPUA 3E0XA 1SY7A 5DRTA 4ZCTA 4TS4A 3CY6A 4K40A 5JZBA 3EXIB 2HREA 2ABWA 3FYHA 2OHGA 1IJKA 1ZHHA 4QGHA 3RLFA 3T5GA 3SQDA 2YVAA 5LYJA 1FBTA 4LZZA 4OHBA 3KT8A 4UFPA 4UREA 1NA5A 4PZ9A 3E7XA 4C9BA 2E4UA 3ZDZB 4PQEA 5JPCA 4R2HA 2C4VA 2P2LA 2AG6A 4O2BB 2WLTA 3BN3A 3CPHA 3GAZA 1E6KA 2AJ8A 1OLXA 3D1JA 3ITNA 3LC7O 5LBIA 1SXQA 2BCJQ 2PNFA 3SNKA 4ON9A 3TQOA 3BQMB 1U3UA 2AHRA 3WB1A 3DONA 1POXA 3AONB 3OX4A 3RS8A 4DG5A 5F12A 1N2CB 2JJ2A 4JU9A 1DOAA 4V39A 3WMFA 3KKKA 3ZY6A 3ZXXA 1L4EA 4CXMA 4ENVA 2F43A 1Q1QA 1FOEB 1H2AS 2ZJ5A 3OP4A 3FPHA 1QP0A 1EVLA 3C6ZA 1W34A 3MWDA 3R3ZA 3E82A 4LZNA 4IAOA 4ZCLA 4A23A 2OSVA 2Z9CA 3K96A 5AIBA 1Q6YA 4JROA 2ZREA 4WHMA 3V42A 4LS3A 1C1XB 2C9BA 2Y2UA 5KHOC 3PUJA 1BHJA 4YO7A 3TRDA 2VIIA 1I4DD 3FJ1A 3W3AH 1NPTO 3C6QA 3CKYA 3G5AA 3MIIA 3DBRB 1SQSA 2LCQA 1XCPA 4DWWA 2SECE 1D1QA 2RAVA 2DWCA 1Y4DE 3LSTA 4Y9DA 3ZNPA 3ZXIA 1XVVA 1JHVA 4E5NA 3HCOA 1L5ZA 1G7CA 1XKQA 4JWTA 2H0AA 4B33A 4PN3A 3A9TA 4FFVA 3ZZMA 1TVCA 1X8JA 1RTTA 2ZQYA 4XCVA 1SVKA 3ESZA 5AW7A 2LWIA 1J8MF 1HL7A 1MVLA 2XMPA 3KJQA 4NKRA 4XZ3A 2IIVA 4HEQA 4C6HA 1QTIA 5I9NA 3LY9A 1MDBA 4XUGB 4GPEA 3AXSA 4D3DA 3TR6A 2O48X 3H6HA 2EQAA 5GMOA 1VXRA 3SF8A 1N92A 3UJCA 1P9WA 3G17A 4OM8A 3RC2A 3KEFA 4GOJA 3NO4A 5AHXA 3FOFC 3KZOA 4TL6A 4EOGA 2ZDGA 4HNAA 3EW7A 4ZYZA 1WY5A 3HPRA 5JV5A 1XG5A 2PKCA 4NOJA 3MF4A 5KNCD 2J6HA 4BNIA 1D07A 2G8LA 4N0MA 3DBVO 4DPMA 3OTIA 4MJXA 3CONA 4FCWA 4MW2A 4DMFA 3RFUA 2FQQA 5BN3B 3NBZC 5G0SA 4NU0A 3HDTA 1TK9A 1N7GA 2OCPA 4JBGA 5ALYA 2MIIA 4ZYVA 2QZ4A 4WUVA 4TMYA 5CLIA 4U0KA 2DPMA 4P54A 3FYUB 3VGPA 2ZSIA 4YJGA 5LCXA 1W4RA 3FZYA 3PXEA 2FX3A 4B5LA 3A14A 1YUBA 5GGYA 4DIMA 2JVJA 4HV4A 1IQPA 1BSVA 3FYDA 2I33A 3T3DA 4YXWA 1DCMA 4N0EA 4ZQBA 5HJ2A 1FRFS 2WUEA 2HA0A 1CB0A 2WZBA 1ZGCA 4G37A 1OLUA 4KLZA 3B8EA 3S2IA 5GZ1A 4M36A 3NKVA 5GY7A 1TJ5A 4L8GA 3F5QA 3I9NA 4OG2A 2SKEA 3B48A 3H4IA 5JHGB 2CNDA 1A0OA 4YJ2A 4Y18A 2VH5R 1P1KA 1GUYA 4V0MA 3GDHA 1IBMB 4PEVA 3K5WA 4OQPA 2C1ZA 2F59A 3LWBA 3TW8B 1UXOA 2R68A 4GOND 2YNMD 3DKPA 4D43A 3IH5A 4R2IA 2HMYB 3L1UA 2AA3A 1AB6A 4XFJA 2ATVA 2Q2WA 4P5PA 2WU8A 1FS5A 1JDBB 3GA5A 1TB4A 3JW8A 3OU7A 1AA9A 1CE8B 2GN0A 4G3XA 1SWWA 3R23A 4O63O 4WDRA 3TL6A 4UTVA 3ZVKA 2O6HA 4GAEA 3WIBA 5JH7A 4MRAA 1CUBA 3CRQA 1VE9A 3OP1A 4LNUA 1D2MA 4IZHA 4JT2A 1RI4A 3UG6A 4Z2AA 3U5ZB 3S68A 1XZBA 1EQUA 2CWDA 4XYGA 1UQUA 2G82A 2RG1A 1M0SA 2XMCA 3R5HA 3W2EA 5K09A 4FYKA 3OBIA 3ETEA 1P4SA 2PGAA 2V1XA 5LMNB 1V47A 4MW0A 3EQ7A 1UCFA 4ZANA 3BTVA 3I2IA 4LJ9A 4MVJA 2XXAA 1QAOA 4J1QA 4QOHA 4TMVA 1LW6E 1ULSA 1EQAA 4ZZIA 4GC9A 3V1MA 2W00A 3GLTA 1GL7A 4IH4A 4R6XA 3L8DA 3K71B 1GQ2A 2VDRB 4R01A 1ZXXA 1H2FA 1IAQA 2HTEA 4PZEA 4S3MA 1Z6TA 4AF8A 2WJZB 5KKAA 2QUAA 2XTZA 1B8PA 4MUIA 5BR1A 1SCKA 4N47A 3W8DA 3VISA 2NUBA 3V55A 2BEUA 3GLHE 2X15A 3J7TA 5FPSA 3LGXA 5I4IA 2QN1A 3H4TA 4V03A 3ABOB 3WLKX 3VTFA 5M34A 3AEKA 5K9ZA 2PKQO 4M22A 5FPPA 4F2GA 2IYVA 1DT5A 1LSUA 4EO7A 5AJYA 3L49A 4U2EA 1HBJA 3BXOA 3O38A 3MW8A 2VLIA 1IAVA 2CNNA 1DI0A 2FEPA 4DDHA 3VUFA 1E3JA 3UMCA 4DL9A 5KYUB 2JLXA 2VT6A 1Z6AA 3Q3IA 4TYYA 3HG7A 2VRNA 3KAJA 2VBFA 4ZI7A 4CFZA 1J22A 2HMAA 4IRUB 4QL3A 5FT9A 3B52X 1LPBB 4G5HA 4HDRB 2V7EA 4KU4A 5KTPA 1JA1A 1SIOA 2VNJA 4F4FA 5MFPA 2GBCA 1M7HA 3R5XA 2XNKA 3AVWA 2WWFA 3ENNA 3VKVA 1JU3A 1WXDA 3ME5A 5K8IA 5CX1B 3OT5A 1LQUA 1NVBA 4GKVA 4YP1A 3KT6A 4EG5A 3R9WA 1QM5A 1DUIA 1SG6A 2GM3A 2IEAA 2R8RA 2WABA 3KSZO 2EBFX 2VJPA 3HJGA 4DLKA 3JQPA 1XNHA 1E6WA 2I2DA 2IX9A 1B8VA 1RLOA 3F9IA 4ZT4A 5F33A 4A2PA 2CMDA 4GX2A 5E0OA 1R4MB 2O57A 1WD7A 2QT1A 2XUKA 4O6VA 3D81A 4ILKA 3ER9A 3UY4A 3OTWA 3FTQA 3JQBA 4PR3A 4MQUA 2RFLA 4D0RA 2NUPA 4LF7B 2XF2A 5E2BA 5AK4A 2IPLA 4IMJB 4Z0TA 4OAPA 5CD1A 1KZ9A 1H85A 1YS9A 4XX0A 1DLIA 2NV0A 4P0PB 2GJ8A 3JALB 2OP0A 3TEMA 3ZIAA 5JC8A 3WGJA 4Z4EA 1TAUA 5K3BA 1NFQA 3EGVA 5JPIA 4UUQA 2XT9A 1UZAA 1HFKA 5HZKA 1R0WA 2P77A 4IIHA 1Z6PA 2PGNA 4FHZA 3VKFA 1P2BA 1T9BA 1GAXA 4Q6WA 5AM2A 4F8EA 4Q01A 1XRSB 4OX9B 5K4AA 4X8MA 4MWSA 5JTTA 4AKGA 1YI0A 2NZXA 1QDLB 4MYDA 2PTHA 2VRCA 1QG4A 4OSPA 5EQTA 1LS6A 3GN2A 2Q5EA 4F72A 2JFBA 3U44A 2V5AA 3O47A 3HYTA 2XB8A 4FOOA 4C04A 3ASZA 4LJ5A 3BORA 4QNMA 3FFAA 2CW5A 1U6KA 3EHEA 4NJMA 1Y7LA 1WD5A 3KLOA 4IIJB 2WQ7A 1AKYA 1X1TA 3KKMA 1O95D 1A7UA 3NJRA 3ISTA 2VYVD 4QFCA 2JBWA 4LE1A 2X5JO 3FNGA 5EHGA 3DJFA 4F5WA 3EZXA 1V1MA 4CGYA 2OYSA 2XXBA 4KLAA 2P8JA 4FUTA 1A4IA 1U0LA 3IP8A 2F4NA 3CO0S 5H68A 3DMTA 3H83A 3LBHA 4AI6A 4LAFA 4FB5A 2M6KA 2CLMB 3GW8A 4YAFA 5TF4A 4PC3A 1NG9A 1T3TA 2Y66A 3MRVA 4RVNA 4EUSA 1KZ1A 2YYSA 3IT3A 6PFKA 4NAHA 2GCPA 4R1NA 4I1IA 3RR2A 3D8HA 3FBTA 1D2NA 1HXHA 2IHBA 2ZYAA 4X8OA 2HLNA 1D9XA 3FHLA 1L4KA 3DKIA 5COQA 4R8RA 5MN5A 4UW9A 3E6AA 1RQGA 4BWFB 3VR5H 3N2LA 1L5GB 3QEAZ 5DFAA 3DCNA 3NHZA 4ZTBA 4R69A 4EJFA 1K88A 4QOEA 1KDYA 4OHZA 2ZB8A 3HXTA 4OKSA 1N32B 1XTVA 3RG8A 1MOSA 1UBRS 2Y05A 5TX7A 4AO6A 3U3JA 2C1XA 4JP1A 5AK0A 4FPXA 2NU9A 4YRDA 5EA2A 5EN4A 3UUFA 4HVLA 3RSZA 4QREA 3TTXA 2ECOA 2JAQA 4ZP1A 1D6MA 1YVRA 4ZCQA 4PQRA 2R96A 1S3GA 1QQ7A 5F52A 4JC8A 4M99A 1Z2CA 1KJ9A 2OC4A 4HOYA 3BF8A 3ZD9A 5C4IA 3IQXA 5AI9A 5ER6A 4Z4CA 3UJNA 1DJQA 3AFHA 1G4HA 1OZ0A 2J3DA 1DX6A 4WBNA 5FF9A 3TCKA 1G20B 1YFLA 5LB4A 3KLPX 1E1RA 1B43A 5HE8A 4O4JF 4QOFA 3BVPA 3DZ8A 4JENA 4G1MB 4W99A 3WYBA 3CISA 4BVLA 2I9KA 3K9WA 3WQHA 4NR0A 4R98A 4EJ2A 5DV9A 1KYIA 5HQ3B 5FLXA 3E23A 1Q92A 4BFVA 1SD2A 1T5LA 3K94A 4F96A 1WY7A 4Q3KA 1GTZA 1Z4OA 4DB4A 4WXEA 1W0KD 4ARCA 1YDEA 3QPVA 4U7FA 1ZR2A 2CXXA 2ID8A 2ZIGA 3PGJA 4AP6A 2B0JA 1Q3TA 2EKQA 2FMHA 3TQQA 3HXPA 4FX5A 5JO0A 4UZFA 4YV7A 3NM6B 4IYJA 5DYTA 2FYTA 2IU6A 2JASA 1ADCA 1TADA 5EY5B 4N0QA 1TCCA 2FUEA 1GKIA 4CM7A 5EKDA 3MTAA 4FR0A 2OBLA 3DL4A 1H6AA 3M6IA 4IJ5A 2XLCA 9MHTA 4UUOA 4YCMA 3HNRA 1G98A 4LE0A 3VX4A 4DUPA 1J24A 2A0XA 1PQ4A 2QW0X 1E2EA 3THYB 1TLFA 3I01M 5FR1A 5B2EA 4BFXA 4PHHA 1NXSA 3SHFA 5LDDC 3JYPA 2EFJA 3TXYA 4QBTA 3SGLA 1M34A 4DYHA 2N46A 4V0LA 4IQ0A 3FB1A 3CLSC 3K0FB 4WI1A 2OWDA 5EJ2A 3T7AA 4P34A 5JNVA 4I1PA 2Z9DA 2XVZA 3UF0A 1F2TA 3LT4A 4LBYA 5IBPA 1I1OA 4W5OA 3OTHA 2VCEA 2IEBA 1LBHA 1QDEA 1F4VA 4GZ3A 1IK4A 4IHJB 3AINA 3AUSA 2B7CA 2PUWA 4YQYA 3MOSA 4R2KA 4DMRA 1BVHA 2OXFA 3HO8A 1HKUA 1YMVA 2A7XA 3ST7A 3G2NA 4RY0A 2AMFA 1CP2A 4N7JA 4W5WA 4X1OA 4J7AA 5EQDA 5A7HA 4DABA 1JIIA 1BAPA 1VBMA 4O2RA 3AM3A 4BBJA 5LNK6 3KQUA 4IDNA 2WU1A 1J1UA 3IDZA 2E4AA 1CUIA 4QQKA 1A7JA 1P80A 2J67A 4RK4A 1R8XA 1MPXA 3ROZA 1X1SA 4RBNA 1RM4A 4DVJA 3QTTA 3W4KA 1JL3A 2IF0A 2XX3A 2O3QA 2H07A 3IP3A 2FPSA 3LC1O 3EMVA 1HE8B 3V34A 3G2KA 1VLJA 3SYMA 5K0BA 3ZVLA 1V3TA 1Y5IA 2IHNA 2Q3MA 3HZRA 3A11A 3ZJ4A 4FI3C 5DI3A 4TXLA 3LCCA 1SC3A 4CL8A 3R40A 3UCEA 3K9HA 3VFDA 1G2PA 3ABSB 4TUYB 5E2AA 1IHDA 3PC3A 4IX9A 1L5WA 4MW7A 1QVRA 3KYCA 2IXGA 1SCQA 2GEBA 2VDLB 5DW3A 3WTBA 2E7ZA 1W9HA 2PRJA 3IVGA 3GHYA 3KAPA 3LYAA 4JXKA 1VCOA 3A6DA 2EXXA 2VF8A 1EVJA 4P98A 3ZE6A 5KOHB 3GLIA 3T9CA 2RC5A 1FW8A 3O8BA 4GXTA 3FTCA 4EHHA 4UARA 3Q7RA 2RK4A 4AMGA 4OXNA 2O1SA 1I2MA 2V7QD 3L6DA 4GLFA 4M0FA 1TJ3A 2GRJA 2B99A 2VLBA 3OF3A 4QUGA 4BAGA 2AQIA 3ESRA 3NWOA 3M6AA 4YPOA 3D7SA 2FXVA 3OQ6A 1QC5A 1WMFA 2WYUA 3BMQB 1C9NA 4FGZA 1NIPA 3INNA 4MVYA 4D9JA 4Y2GA 4IJ6A 3UW3A 4FVTA 1UT8A 2FUG1 2RH4A 3UMRA 3NTXA 1AHPA 1IG3A 3GJSA 3KX2A 2VF4X 3AF1A 2X14A 5HWSA 2BSAA 2I65A 1B1CA 1F8UA 1PG2A 3MSCA 1ND5A 1G7SA 1X3SA 3EGXB 1EFRD 5E7JA 5A3SA 4DADA 1MZPA 1CUDA 1EE9A 1FSGA 1WU7A 2E89A 3FMOB 3G9XA 1RJDA 4NE2A 4CKWA 3AY7A 3LE8A 3AESA 4B75A 3UAYA 2OT3B 2FQWA 4K86A 4Y8VA 5B12A 4CI0B 2BZSA 4JGBA 5GM2A 1R74A 1ORRA 4AWBA 5BR7A 1MORA 4NXMB 1C8LA 3GK3A 3MOIA 3H1BA 1LUAA 4TX1A 5ICCA 1GTSA 5DRYA 3D6AA 3TMAA 5FOQA 3UQYS 2QVXX 4W6QA 5K8VA 2WM9B 2YICA 2G4VA 4GYWA 1JEOA 1MHPA 2FFRA 1UMKA 1WDTA 3HR7A 4R84A 3CNEA 3PR1A 4JKYA 2GN2A 4HNTA 1G6OA 5CK5A 3X43A 2QP9X 1T1JA 1Q84A 2V6BA 3LVBA 3C2QA 1XD2B 4NYMR 3WWCA 4QM6A 1UDRA 1LVHA 2GAFA 4GEKA 2R8XA 4BYGA 1B14A 5LQMA 3SLRA 3PP8A 4MIKA 1U3GA 5BSHA 1WHSB 2QG9A 1RLMA 1N8NA 3LPNA 3I76A 2ZT6A 5KOJA 1ODLA 3RK1A 3P20A 4CMCA 1NKTA 3BKXA 3FVRA 1T2CA 2GM5A 4K9PA 2YJ5A 5CW2A 1VLMA 1VLZA 3AM5A 3ZTTA 1N6PA 3OFSA 4F97A 3HA5A 4N9QA 2NU8A 1BD4A 1FFAA 1J0AA 2Y1FA 2GJ4A 4JZKA 2F1KA 5F51A 3OUUA 1ONOA 1B6SA 3RU2A 3I83A 4D92A 1MC8A 3M34A 1SMKA 3OZEA 2PKYX 5F2NA 1YJAA 3M1LA 5JAMA 4HLUA 4KYUA 4RL4A 3RVLA 1KEEB 2YYYA 3PEFA 4NABA 4ARUA 5FLYA 1HLGA 4BO2A 1F06A 4L50A 2WG1A 4RZ3A 1FB5A 3IMCA 4CBVA 3RSLA 3C98A 1XEAA 2DP4E 4DIFA 3ETDA 2LXNA 3H8WA 3IP7A 2JCSA 3OQBA 4NBNA 4UPVA 4EBBA 5AUNB 3S8EA 2Z30A 1W88A 1SURA 4D79A 1IUNA 1QX3A 4JXZA 3MMPA 1SXJE 3GJYA 1R5JA 1TEHA 4QYSA 1U0TA 3OCZA 4C0WA 3AM4A 3LX4A 1P1CA 4DQXA 4KQXA 4J7CA 4H7EA 1H3NA 1YRLA 3A4YA 1R50A 2BP7A 2XRMA 2EX0A 4GNRA 2WU3A 2IY8A 5T8KA 3T9BA 5H4HA 3RODA 7MDHA 1DGQA 4UMFA 5IDWA 1AF4A 1AMOA 3THSA 4JWKA 1RLJA 3KU4A 4YMIA 2E85A 2UYGA 1Q20A 1VRCA 3BPSA 4IEEA 5TNXA 3RADC 2QYHA 2GD0A 3W1WA 3W4IA 2D5AA 5CD9A 3KPYA 1N77A 3L6OO 4OF4A 3FPCA 3GT0A 3AZPA 1E6EA 4OPMA 4F9TA 1ZH8A 1JFFB 1WXWA 2W8ZA 3SEZA 3VZDA 1EG7A 4QDJA 5ELLA 1PNRA 3V3TA 4CT5A 2DWUA 1CDOA 2Y1GA 4AJ1A 1NE2A 3E3AA 3GEHA 2GI4A 4A8JC 1ZIOA 1OBOA 1P6XA 4FQ7A 2Y77A 4A5OA 1J21A 3B8HA 3NBXX 4ZO8A 4MQEB 3T38A 3CUSA 3VPDA 2J9FB 3VU3A 2X2EA 2XQGA 3FKSD 3AUFA 2IOFA 3DOEA 2CLKB 3QUAA 2VNAA 1KVSA 1RAAA 2HBYA 3HB7A 1RC1A 2IE0A 3ITKA 4HD8A 5BSFA 3AETB 2HK7A 3H87A 1F2VA 2AE2A 5KNDH 5AW1A 2JIDA 1IZ7A 3FJOA 4FFBB 2ZI5A 4NOLA 5BV8A 5SYAA 3U6BA 1CW2B 1NBHA 3B85A 2VJNA 1JQBA 3DM5A 3F74A 4CT0A 1Q0PA 2XB4A 3ED5A 2RHCA 4OFXA 4NV0A 4B3TB 2YHBA 3E15A 4DJFC 1U1DA 1Q19A 2I6SA 2FWRA 5J2TF 5MFZA 5CCXA 2IHUA 2IRWA 3GLVA 4N8SA 1YD7A 5LZ8A 1L8OA 4WZ6A 1KP2A 2CZCA 2EF0A 4HH3C 2UZAA 4FD2A 3U7JA 2IYUA 4BVJA 5BR4A 3L02A 5KQLA 3CN9A 2H7XA 3OX2A 4RHYA 4ZOQI 1BZYA 4MWDA 1W4AA 4A8HA 4G9EA 3SOZA 5DYNA 2I3AA 2YHSA 3NC1C 2WY2D 3LG2A 4XDYA 3MS7A 3AVPA 5JAIA 1AUOA 4P2BA 2DX7A 4Y30A 5A2GA 1D1PA 1SUWA 1WQ1R 4L4ZA 2GDJA 3SKXA 3WNBA 3NT2A 1CV2A 3UKJA 4RFVA 5L6LB 4CMIA 1KH3A 4FYIA 5EP1A 3QX8A 4KACA 4NPCA 4ETWA 3SZGA 4RQBA 4AY5A 1KYYA 1PT9A 2VJYA 4WGGA 3VZSA 2EIXA 3FF1A 5D86A 1CUCA 5NLLA 3TWOA 2A1IA 3S2SA 3V7YA 3PGA1 3TRJA 3I4LA 5KQRA 4F2HA 2XZLA 4JNCA 4GM4A 3V4SA 2BBOA 4XX1A 3LLUA 1DKUA 4F3RA 5F1YA 1SUPA 1M8FA 2CFRA 2V3WA 1KOJA 3A2KA 1UJNA 4CLOA 2IX3A 1TEVA 4HFMA 2B21A 5JVDA 1YBHA 1QH0A 1T43A 2DR3A 2O2CA 3FNIA 4MWEA 4CDRA 1BEUB 4DQDA 4R2MA 2QYTA 2VDMB 4XDHA 2A67A 2HRRA 1FW6A 3HKEA 2YX1A 1B6RA 1Y1TA 1YR2A 3BXHA 3WE7A 1DFHA 3O1LA 2ZVJA 1OT5A 3WLTA 4GP7A 3A6JA 3KUKA 3V4VB 1QGYA 4IJMA 4UM8B 1XCBA 4HZGA 5F9MA 1Z0UA 4OJKA 1QE3A 3EXG1 4JVSB 2G36A 2PO7A 5CVCA 1DO8A 2CLHB 4MQFB 3A10A 1ACJA 1W52X 4FINA 4NYIR 1E20A 1USUA 3DW1X 2Y9MB 3CZMA 3HFGA 3HP1A 3QNUA 5ALNA 2PRSA 3WL6A 1UBGA 4B73A 3DV9A 2I7XA 3L7NA 1M2OA 1RE1A 2B6HA 1O8CA 4HFJA 4Q7MB 4ZZ3A 3NHBA 3WGGA 5T41A 3CURA 4KWCA 1VPLA 1XQYA 3CLRD 4KPGA 1JFSA 3YASA 4RAQA 4D8YA 3PQDA 1QGOA 5J2UF 2IYFA 1RNLA 3JQAA 3OO1A 4KYVA 2ID4A 1ENYA 3OY2A 3INGA 4M1EA 4MUFA 2H7CA 5B1HA 2XUDA 4Q19A 3C5CA 5GPBA 3VV3A 1J4AA 4BX2A 1CZRA 1PL0A 1GPAA 1W96A 2Q9CA 4A10A 5C8ZA 1MJNA 4YQFA 2PS1A 4E4RA 1BYUA 4I6EA 2DHDA 1Y4SA 3GIDA 3A1EA 4M9UA 2YXBA 4TT8A 4YGXB 1T8YA 3FY4A 3UWMA 4JI0B 2WM3A 4XH9B 3TLZA 3O75A 4CQNA 2IZ1A 1Q0QA 3NNDA 1BS9A 2EAUA 3IUYA 1NWHA 2XHZA 3CH5A 4FZ5A 4JA2A 4I9NA 3FOBA 4B09A 1ABFA 3UFXA 3HE3A 3L0PA 1W87A 4BVKA 1J2UA 2AOTB 2BFWA 3AP1A 3KJHA 4KXXA 3CUYA 1SUSA 1FTGA 3QJ5A 3LU1A 4LQCA 5F98A 2MDTA 4JVNA 1WBJB 3C3YA 1N6IA 4IDOA 4N6OA 3VDQA 2KQUA 4IILA 3KSBC 3EUWA 3PZBA 3QBDA 5EZQA 3FMGA 5CW1A 5FULA 4HX2A 1XEXA 1WEHA 4HT3B 1ULUA 1IXSB 4A16A 2Q99A 2VAPA 3TGWA 3WGHA 1CR4A 1HDRA 3W5UA 1N5IA 2CWWA 1H0RA 4JVLA 1BE0A 4QYXA 4B7UA 1SCIA 3ZHCA 2JIMA 3R6WA 4UDYX 3WMRA 1RQNA 4P4NA 2HMUA 2HRZA 3IMEA 5ALHA 1KGSA 1J0CA 2IPNA 1PZNA 1W4BA 3K35A 4MCJA 2J3JA 4LYJA 4HUQB 4C6SA 4D98A 1VPEA 3HKCA 4OXXA 1VQ1A 3PT9A 4KV7A 1NX9A 4NNJA 1Q11A 1VSBA 2RKBA 2LBPA 5JS6A 1L6RA 4OI0A 5CYGA 1V11B 4F4JA 3QUSA 4LF8B 2CVQA 2FF7A 1FXUA 3Q7EA 1A8UA 1EWVA 2XVMA 2EP5A 4PZUA 4AS2A 4Q4AA 1E3SA 3BWEA 4E2XA 4HAVA 3FCOA 4JFAA 3LUHA 5KJ6A 1LRKA 3HDJA 4ZHSA 1RBMA 4CEIB 4R83A 3NRJA 2NAPA 5IJ0A 2CF5A 2IW3A 3PKIA 4KQWA 3BCUA 4MV0A 2IS4A 1ZA1A 4UXJA 2XLBA 2OLKA 3W5IA 1H9CA 1WU8A 1JDTA 1R2QA 3OD1A 3PKZA 4XEUA 4QAQA 2P9EA 4DNQA 2ZWAA 5DK6A 1FDTA 4G5FA 1ADYA 1K3TA 1M2VB 1YZUA 2EHDA 2P9ZA 1FDSA 4FN5A 5T6MA 3WRYA 4C29A 4E51A 4KR7A 1E92A 1OTXA 2P68A 2ZI9A 1GGNA 4TKZA 5EZ5A 3SLKA 1R4NA 1T6ZA 1YK0A 1Z0SA 5D2CA 5K0NA 3K9GA 4QT0A 1KEWA 3KTAB 3VR5D 4ZHQA 1D6SA 1ISHA 4MR7A 4C03A 2W8BB 3BSSA 3CTPA 1Q14A 4P22A 1XO1A 3QNWA 3CEMA 4YLGA 5D3MA 4D46A 1W49A 2GCNA 4WXPA 3KR1A 1KR2A 3QWFA 1C7IA 1ZOPA 1N2CE 5F7OA 3EPLA 2I7VA 4BTLA 3W8NA 4CLHA 2C82A 1BVRA 1FTYA 1GU1A 2YY7A 3Q3HA 2Q6TA 3IS3A 3KSRA 1KSGA 4TLMB 4ZRMA 5EXDA 5TS3A 3OJLA 3FNEA 1EDZA 4IKOA 3UMGA 3X0DA 2Q3JA 1LQTA 3A3NA 2I2WA 2NYRA 2A58A 5E4TA 3KETA 4PBSA 4GSLA 3E1KA 4RLQA 2AXEA 3KYDA 1SUEA 2LKDA 4NZYA 5KYNA 4DV2B 3OKPA 3OQOA 2Q3EA 4PXSA 1EK5A 1EUDB 3U0BA 4QGGA 4ECAA 5C7IO 5CDYA 4AZSA 1WB5A 2JK1A 4W82A 2YVLA 1L5YA 5H16A 3Q3JB 1AE1A 2AG0A 5KJEA 3H5VA 3RIHA 2C77A 4C1BA 1C3OB 4QDTA 3RKUA 3RUAA 1P1BA 4RMGA 3NAQA 1JEEA 1EI9A 1L5OA 1Z4NA 1PS0A 3A1NA 4HFRA 1ZINA 2I1VB 2VS1A 4JGGA 1A4XA 4LJSA 4MQ5A 4O0LA 1SKQA 3WK4A 2V58A 1NVXQ 1V3UA 2PX8A 5IT4A 1Z68A 1X7DA 2DKFA 4B2LA 4CIYA 1D4OA 3W5CA 3INRA 2FPLA 1KRHA 3NHLA 4GUDA 4D97A 3FVWA 3SSAA 2RHDA 2Z9BA 3HCDA 4HB2A 1BVYF 5CAEB 3HKBB 1DOZA 3PNKA 1MF7A 3NWBA 3RVQA 4UHEA 1Q22A 3EVGA 3LRXA 4J91A 3AHIA 1AKUA 1Z5VA 1XA0A 3THWA 1IWBB 2R1TA 2WSSD 3F67A 4EA8A 2NLOA 2H4JA 4QGFA 1ZCZA 5C3MA 1GPJA 1YH3A 3FUTA 2ZDQA 1VBKA 4BB5A 2IYYA 2VJBA 1CPYA 1M1YB 4GLJA 4LDZA 2I22A 4PGGA 5KBYA 3GDWA 3SKYA 1SXJC 3TDKA 2IXDA 1H22A 3L93A 4LK2A 4NQZA 3K0EA 3HLKA 4KKXB 2Z43A 1H65A 4WQMA 1DQSA 2ACVA 3DOJA 3GT4A 4KX5A 4C2BA 1R27A 4YR9A 5JFTA 1NC1A 5GVRA 1YV9A 3D8BA 4MIYA 4QYIB 1NYRA 5JDCC 3TLGB 3KXDA 4TKUB 1RKVA 1M3SA 1ESDA 4NF2A 2BFOA 2NOAA 4OEHA 2JLYA 5DM60 4OMUA 1SBYA 3N07A 4TOIA 4FOSA 4EHAA 3IUSA 1VIYA 4WDQA 4FQ8A 1JDZA 1XZFA 1H23A 4EHBA 4PQFA 5EE5B 2QQ0A 1ZK0A 4PLCA 4NE7A 1MR3F 3WC4A 1AHHA 1YO6A 1FRQA 1YQTA 1V8DA 2VHYA 3BSFA 4OREX 4RCZA 3L5KA 1TMYA 2HA4A 2Q7XA 1RLUA 2QRKA 3KWMA 3KZKA 4MW4A 2OUIA 1X1AA 3EFOB 1OTYA 2OORC 4XM1A 3DEAA 2ZZNA 4YAKA 2ZE8A 2HR1A 4BLPA 4RK7A 1G9SA 1RKQA 2UV8A 4FS8A 5IJAA 1FQWA 4FSXA 2JL1A 2W6JD 4BZPA 4RS4A 3LHKA 1Y6GA 3GG9A 3R6DA 1G4UR 2XNCA 4PYIA 3LPLA 1XI2A 5JCOA 3KQTA 5HTOA 5JZVA 4D9BA 1MB4A 2DCMA 3R3HA 4YJFA 1BW9A 1VHQA 2PKEA 4FYYA 4N5HX 4DIEA 2WINI 3SR0A 4Y2UA 3GOQA 1FYEA 4RABA 4I2VA 3EVZA 3DBLA 4L16A 5EVJA 3AFIA 4BEJA 2RAFA 1N2OA 1OC2A 5J63A 1R6XA 1D2AA 1QGUA 2PH5A 3NIDB 3AHHA 3C97A 1E4VA 3QXSA 4G84A 3UGQA 4CLRB 3ZI7A 2CXQA 1GGHA 5E6RB 2QZJA 3CQ9A 4KUHA 4RADA 5FDFA 3AF6A 3RK4A 3KQYA 3PXCX 2ZUSA 4WCFB 4AZ0B 3SQLA 3FCCA 3WTCA 1NDQA 4PX3A 1PJSA 1P2VA 2XQFA 4EG3A 3IUJA 2DRIA 1R8QA 2XB9A 4EKNB 3STVA 3WVNA 5J4KA 3ZCVA 1RMQA 1ISMA 2NXCA 1GVHA 4DZRA 1L4LA 3JWJA 3RGGA 5JRZA 3RJ5A 3U09A 2GK3A 2B4KA 2HSZA 3TOZA 4YMUA 3GGPA 1UJ5A 2GZMA 3OT1A 3Q5GA 1RJ9A 3L4BC 1JBQA 4OHFA 5AVTA 3RSQA 3W1EA 5TJHA 1YZNA 4AXXA 4CW7A 2E87A 3DV0A 1GV0A 3KOUA 1N2IA 1ML4A 4JB2A 3FOWA 2GBLC 3EOZA 3UANA 1TJPB 3CPSA 4K81B 4Y2RA 3ADCA 3EQ8A 4ZT2A 1P1RA 3C1AA 1BXKA 4WUTA 2PH3A 4TZ6A 3VRHA 2A14A 3FIJA 1ZJ4A 2J41A 3NJ4A 2P5TB 1YS7A 2WIGA 4NBWA 1L5FA 2BI7A 2I4OA 2OFPA 1MTOA 4G8JA 4INZA 2P9YA 3RS9A 4R7TA 1T9KA 2QQEA 1R4ZA 2X9NA 1N3IA 1TNDA 2O0LA 5GWXA 5H3LA 3SBXA 3CNOA 3COYA 3B3GA 3NUGA 1KDPA 4TS3A 2QX8A 1QIFA 1A5ZA 2PUVA 2V6JA 5JMPA 4DJ5X 3FI0A 3AR7A 3N3AC 4FCCA 2X13A 2AUMA 4B7AA 5BXYA 4BDSA 3PHJA 4BMCA 3LZDA 2J4FA 3T9AA 3RQIA 4C0LA 4KFSA 4WY5A 1AQNA 4D3SA 1AZWA 1VB3A 3RUFA 3ESYA 3PQ7A 4GF5A 2KM1A 2IT1A 4GYJA 3SEQA 2WF8A 4HQ6A 1NLMA 1JRLA 2QN6A 4GICA 3VNUA 1OT3A 2YRXA 4EX7A 3EUAA 4CE6A 2CZQA 1BMDA 2VJMA 4EPTA 2QP4A 4FJ2A 5IM4A 4TXJA 2JCYA 1G8AA 1L2TA 3FCYA 4JA0A 4DR3B 4AAYA 1OTHA 1NJ6A 3DAPA 2WC1A 1GDTA 2GK6A 2P41A 4IM7A 3TSAA 1D1SA 2HXGA 3Q87B 4PG4A 4N39A 2EKBA 4XQEA 5EGNA 5B1SA 2AR9A 2CK3A 2I3DA 1A76A 2VHWA 3PC2A 4JQSA 4J0FA 5FNZA 2ANBA 4J1TA 4KE8A 1T1IA 1WXFA 3RC1A 1EGHA 1QHEA 2F1RA 1Z25A 3U3XA 3EDRA 1QIHA 1E3DA 1MW9X 3G9TA 4NE9A 2I6GA 2GCIA 1G8GA 3GIWA 4IDAA 3A06A 4XWTA 3CM0A 2R3SA 3P2IA 5FD8A 1K2WA 1WBDA 4OUDB 4AG6A 3V3KA 3JQ9A 2RIPA 3TNYA 5TGZA 3U3DA 3PDIB 3EF1A 4I7EA 4P3NA 1N5LA 3UOGA 3WI7A 1YI1A 1Z36A 5ADWA 2QMYA 2O1XA 1TMOA 1FP6A 4FYJA 4B80A 1L3BA 3AVUA 4IVQA 2XSZA 4YUVA 1K97A 1OX5A 2W2XA 2XADA 1TD9A 3D2LA 1JHUA 3E8SA 5B36A 3U0VA 5I5GA 4DA0A 3ADBA 2GF9A 4GH5A 2Q50A 4BWYA 1J9EA 1QRDA 4MVJM 2Y0BA 3OUTA 4MZXA 1AZTA 3ZQJA 2XE6A 2KLBA 4ENSA 1U5BB 2GS9A 4INJA 3P8ZA 2GASA 2B4QA 3UOWA 4RD0A 1R0XA 1UJCA 1Z16A 2CFTA 3DLPX 2JAXA 4GMHA 2ENUA 3RBZA 1M0TA 2ID9A 4BV9A 3T3NA 1XZGA 2PMKA 2GXSA 2GYVA 3GZNB 4V3BA 5A9TA 1W73A 1JHMA 2Y1OA 2JZCA 3OHSX 4TQ9A 2EQ5A 5E0KB 5JCJA 1ZAYA 1KI1A 2GESA 1YKFA 5G1NA 1FFXB 3N59A 4I55B 3UJ8A 2JJ2D 4LMAA 5FWXA 2X6QA 1T5DX 3AUAA 3G0GA 2VL7A 5BR8B 3TNLA 2WOOA 3UH1A 3VZQA 1QV7A 2D4HA 4IFBA 3H0KA 5LZ5A 2CBXA 3DKKA 3LW8A 3A32A 2KX7A 2D1SA 3GMDA 4UMEA 4XUCA 2A9RA 5PNTA 2H9YA 3OM0A 3M5WA 2YYZA 2I6TA 1N6LA 5HUQA 1SG9A 2QLBA 2Q1YA 1MBZA 5ALMA 5EIHA 3UENA 3PUXA 2KE5A 4ZO7A 4BO6A 4P5EA 2YIMA 1ODCA 3NTOA 3PQ8A 4W9NC 1G20E 5AKJA 4EG7A 9GPBA 3THXB 4R8MA 1TEZA 1CF4A 1EX7A 3W5DA 4EMTA 3WDLA 1MO5A 2JJQA 2G1JA 4GEGA 1IY1A 2WKWA 4LCEA 2IKQA 2PJZA 1FP2A 1KK2A 2B2XA 2D2FA 2D00A 2Z3VA 2WIBA 4UE3S 4BNKA 3KFXA 1UFRA 2O5RA 2HV9A 2JRLA 2BEWA 4BGUA 1OXUA 1Y3BE 1ZAKA 3FBWA 4ENTA 1F60A 3FUXA 1R10A 4HNSA 4M38A 4S2UA 1GGMA 1UFOA 1E79D 2FW8A 4L95C 5GGXA 4GMFA 4N76A 4L9WA 1OIWA 1OI7A 5A6SB 3TLKA 4DV4B 1NN1A 1QV9A 1WCYA 1JB1A 3NTVA 2PANA 1ZONA 4IXTA 4C1NA 2VPQA 4MRMB 4L4YA 4CQMA 2ZS7A 4XM0A 1U0NA 2O4CA 3QOWA 1YS1X 5LUAA 2YIVX 3Q5DA 2Q4BA 3WB9A 3CUKA 4I4TB 5B2ZA 2QZZA 1X92A 2WG0A 3VUEA 3JWPA 1XL0A 1H1LA 4IHAA 1E4OA 5DH9A 2IH2A 2QN7A 3SF0A 1DAHA 1QHHA 2F67A 2NO9A 3HH8A 4V24A 3VVLA 4HY3A 5BVHB 2QGZA 3PPYA 1XRQA 1A9XB 1GLVA 2WILA 2C2XA 1Y4AE 2NUAB 1FYVA 1G63A 2AFHB 2EG9A 1UBHS 2QTCA 4KSCA 3SXUB 1I0ZA 5ICGA 4MS4A 5K20A 1Z0AA 4PCVA 4QDZA 4URYR 1DJOA 1RXYA 2A92A 2F3PA 2V6GA 1WVIA 3E9RA 4JS0A 3CF4G 3C1OA 4N6GA 3X1KA 1MU0A 1YL7A 2GPWA 2ZUEA 1OYYA 4IICA 1WMSA 2QF7A 2IYAA 4JQCA 1XAHA 1SGWA 3H8JA 3OQHA 4OHXA 2C20A 4HN2A 5BQ5A 3B7GA 4IDHA 3IEUA 1CUXA 2PN1A 4WEOA 5TPWB 1I5EA 2QRJA 5D6OA 3TXAA 2FEXA 3R76A 3HZOA 2ONJA 1YBMA 2PBRA 4MWBA 2PKXA 4Y6SA 3D59A 2PX5A 2Y1KA 2YHUA 3U1BA 3LZ6A 4FW8A 4JLMA 1RI2A 1ZIPA 1G6KA 1V71A 1C81A 4UMVA 3ID6C 1T3HA 2V6IA 4YAGA 3MINB 3CEHA 4AJ4A 3PLNA 1BMFA 2C5LA 4U6NA 3IQHX 4RZSA 1ZY2A 5ETJA 2CD7A 4BHTA 1P1JA 1Z6YA 3ZE2B 3Q7SA 2ACEA 2JNWA 2KHZA 4OXYA 5J1TB 2FP4B 1L5NA 2W42A 1GA1A 1GD1O 3N8DA 3VDNB 2PLAA 1FSFA 1GLGA 2A0FA 3O84A 3FYUC 2PYIA 2WFZA 3GQBA 5C1DA 2Q6LA 5AH0A 1SVUA 3O82A 3RJTA 5CGQB 1ZD4A 1KEKA 2PO5A 3DE3X 3PNQA 3D3KA 3QPUA 1IFXA 4CG3A 4EVQA 3S44A 1KRWA 2PMDA 2RHJA 2UUCB 2I4TA 2JANA 1SUAA 3K4HA 4NBSA 2GTPA 3LCUA 1BQEA 1LS1A 3D3WA 1ZUNA 1UMCA 4CM8B 3OEYA 3A25A 3KIPA 3FLMA 1T35A 4C08A 4GLBA 1DMSA 1Y7TA 2PNJA 3NH6A 2DFDA 4XB2A 3HMKA 5EHIA 2GYYA 4BB0A 4LECA 4H77A 3K0KA 3L6CA 2GR9A 1O9GA 4ZAGA 5IZCC 2GJSA 3NI2A 5LYJB 1CQWA 1LPAB 4YRPA 2ZI4A 3ANSA 4K03A 3LOQA 4AX8A 4MICA 4RPKA 5E1OA 2O8EB 4RVOA 3DVLA 5JSKA 1N7JA 4Q15A 4X6YA 3U37A 2WWRA 3ISVA 3FA2A 1CQXA 2QRZA 1A27A 4BNTA 4C0AC 1V37A 5HM8A 1XTRA 4KREA 4YCAA 1I80A 3TLBA 4YHHB 3AW8A 3AHFA 3EDMA 4Q1EA 1ATZA 5KYVA 5T7BA 1REQB 4FMBB 4XWOA 1AZLA 1P77A 4GX0A 4NICA 3ZH2A 2O5CA 3HGMA 1E9RA 4FMCF 2IZ0A 3I04A 4YALA 2BM8A 4CU2A 3WWOA 2F43B 4JUBA 1XHEA 4TVSA 1QLHA 3MWDB 3DUWA 1YHNA 2F7SA 3A1WA 1GT6A 2EEZA 3NC0C 1W6UA 2YWBA 3HZHA 4FGJA 4B40A 5HBRA 1YQXA 2G1KA 3QWBA 3LOPA 1TO6A 4P86A 4F06A 4XDZA 1JZQA 3PC8A 1UDCA 2VYQA 2VPZA 2PM8A 2HDWA 5EWLA 2BPOA 4DA4A 2BC9A 2HLDD 4NZMA 3D6JA 4YEDA 3C87A 5EJMA 1VBFA 5EMLA 3G9ZA 2WFLB 3C7AA 3QGMA 3GGSA 2E2WA 2VK4A 1KK1A 3JS5A 2P0AA 2F17A 4J07A 5JXJA 1X19A 2CXSA 5DWVA 1TPZA 2F8MA 1AV7A 5A02A 1BC5A 2UDPA 3EDCA 1WULS 2LVBA 4N8EA 3TJRA 1JMVA 4E5UA 3VPBA 3GQVA 4XWWA 1U2DA 3LCJA 4MQLA 4G85A 4HKTA 1TAGA 1DWOA 1RM0A 1M5UA 1NQAO 4J49A 1K98A 2I1WA 4QBKA 2GM9A 3ZIAD 4HNHA 1K5HA 2JLAA 1Y5RA 4KR0A 1E3TA 2W98A 3V1KA 4H6PA 4JJIA 3Q12A 5EP3A 1LB1B 1YUMA 2WE8A 2B5VA 4ZK2A 2LCIA 4PONA 5BMVA 2BGUA 3AKDA 1NI4A 4CLEA 4GSKA 3IEXA 2ATCA 2GSWA 5I6DA 4MIOA 4CG1A 5BNTA 2VRCD 4UNIA 2NUTB 2J3LA 4PC6A 2H5LA 1ZWKA 4AJEA 1EXNA 5FUWA 3K2QA 3KQNA 1SXIA 4RLSA 1IZZA 4JLUA 5E2IA 4YJGB 1YR3A 1V7QA 2GHRA 2C58A 4ME6A 3SQNA 2GN8A 1KVRA 3RUEA 1P3DA 2FPGA 4G23A 1JPNA 3VZBA 3WLAA 3N0TA 2QY9A 4LOAA 4BNWA 1M6HA 4CMEC 4R5HA 4EITA 2XUZA 3CWZA 3LPMA 3T0IA 1V16B 1UBUS 1USWA 3ESQA 4DM7A 5K3SA 2V7TA 1Z4LA 1OLUB 2BFPA 1GTL1 3QBEA 4G89A 4IR7A 3F73A 2VH2A 4CDNA 4JI8B 1DFGA 4NCIA 4B3HA 3GEMA 3F5FA 3LUPA 4ZJZA 1JEQA 2ZDHA 3V1YA 4ZQEA 1AF7A 2OV4A 5IH3A 1I7LA 4LJLA 2PA0A 2HCBA 3AQ4A 3CF6R 4H7PA 5KAPA 5CFPA 1GZUA 2MSCB 3ZV4A 2HY7A 2HQ1A 2W11A 1WCWA 3BJRA 3GY0A 1Y1KE 4X1YA 5CXSA 5TVGA 5K5EA 4O3MA 4JHLA 4BXOA 1U7DA 4E70A 4DR1B 4DYVA 1JAHA 3OTGA 2WF5A 3F8TA 2WAXA 3CFYA 1UBNA 2AWOA 1RKBA 4YXFA 3A8TA 3K1YA 1UDBA 1GCAA 2WSIA 2IEYA 5GV7A 3RC8A 2PL5A 2H85A 5JH7B 1K1EA 2ZBDA 3E2MA 5BNZA 4UD2A 4QU9A 3L4KA 4C43A 3CT6A 1O77A 3C3BA 1HDGO 5EHNA 2ZBVA 3O4IA 3EODA 3PHIA 1N2ZA 2LUOA 2PT9A 4TTQA 4ZOAA 5JYEA 3AL2A 3CINA 4GI5A 5EIOA 1LDEA 4D45A 4Z7JA 2GPSA 1OUMA 1T1EA 4O4JA 1CS4C 1L7OA 2ZIZA 1NR1A 4ZOLF 3G02A 4OY3A 5DEIA 4B6FA 1E64A 1CSEE 1US8A 4M0MA 3WZMA 3HYRA 1U99A 4H3KB 4P36A 4DTIA 5FTMA 3DYBA 1XFDA 2H17A 3HR4A 1M54A 4IIGA 3IO5A 4H6WA 2FG5A 4QUEA 3SDSA 1GKUB 3EXAA 1Z0KA 4JHXA 1F38A 1YMUA 3R41A 4EFMA 4CTJA 2YR0A 3A1DA 4CM9D 1OXVA 1MRZA 3EAGA 3ZS8A 2YNMC 2BGKA 3B1WA 3GLSA 3AHEA 2ZXEA 4RHXA 1HI9A 1X77A 1J2YA 4YMLA 3CNNA 3LP5A 4UBLA 4PYOA 3VPCA 3JD3A 2PDAA 3V32A 1PSDA 1R9NA 2BBSA 5AKGA 2RJ3A 2CLEB 3BGSA 3V8RA 3AEKB 3UJDA 4LY9A 4Q3AA 3B6IA 4HYQA 3RYTC 3RTBA 3CZCA 1DRKA 4KI0A 3GGDA 3ZWPA 1RHJA 1RBZA 1K8YB 1SUBA 5LOVF 3ZLJA 4E14A 1C9DB 3IQGX 5K05A 1ND6A 2YH2A 1FUIA 3SVTA 1ZRSA 1YKSA 2ETVA 4PQYA 4C22A 1BCRA 1JBKA 2BWJA 5AI0A 4EEXA 2WTXA 2P9GA 2HMTA 4MKXA 2ZYTX 2QAIA 5JAHA 1IVNA 2CEAA 2OZLA 5F1OA 2O6LA 2VJQA 3E3OA 3C3KA 1AIPA 5AKHA 1FUKA 2WHEA 3TOCA 4IWNA 4ZO4A 1ZGJA 1KTVA 2AOVA 1IBLB 5DISB 1P31A 2PMWB 3QELB 2B1GA 5JBIA 2W48A 2WPDA 2ZJZA 3NETA 5EHZA 3MUOA 4HMPA 3VYUB 3S27A 3NPAA 3FDIA 2ACKA 1ONBA 2E4XA 2ST1A 3OEEA 4B6EA 5EZYB 1ZNQO 4HB0A 4A8PA 1NHGA 2FEOA 5M29A 4YRAA 4N9WA 5JQGF 1JVNA 2FSVC 5CBKA 1ID8A 3KHTA 5LQJA 1XA4A 1X80A 4RYDA 3UMJA 4BMNA 5BN5B 1E0SA 4DUYB 1RQPA 1YU9A 2FKAA 5L8VA 5DMXA 4QT4A 2O8BA 5ARBA 4NV3A 5JFGA 1T5IA 1MAHA 1TO1E 5HFAA 4KPUA 4CNBA 3ZWOA 3EFHA 2GBFA 5IW8A 1CJBA 3D9QX 4OP1A 5CFRA 1KAGA 3WBJA 3GYGA 2J9RA 1S2GA 3P9PA 3Q3CA 1JMKC 1JWBB 4NFLA 2XCLA 5EIAA 3TZKA 2B8TA 4ZVLA 2XAAA 2HYDA 4NH0A 5JPDA 3PXAA 1J0BA 4FIZA 1I14A 2AKYA 5B3KA 4FXOA 1VL8A 2WDZA 3QOXA 4R68A 2REQB 2ZANA 4I50F 4C5AA 3G7UA 4X65B 2BFDB 1GU7A 1KS2A 2NYUA 3OKFA 5KQPA 1VHDA 1DEAA 3QVSA 2L0XA 3CX7A 3JR7A 4ND8A 4PLWA 2YV2A 1FNSA 2OPHA 3L3BA 3IV6A 1NJ2A 1WXQA 3ROTA 3J81A 3K09A 5GIOE 4QAJA 2XDYA 3QX3A 4WNIA 3BCRA 2OQRA 4H3VA 2Y4OA 3EXEB 4RH0A 4U02A 1L4NA 2QL7A 1AQLA 3KKQA 3E3LA 4IH9A 4Q1DA 1L3IA 4QVGA 3U31A 1HOXA 1MOZA 4NJMB 1KFKB 4DJEC 2YBEA 1E9DA 4DR4B 3BCSA 4LDPA 3FHCB 4QVIA 2PQ2A 1L1FA 3RI3A 5T6BA 1V1MB 4E2WA 2FRVA 2JCBA 3OBBA 3RSFA 1WNTA 1ZL2A 4BKRA 3FGNA 3KJGA 4AKIA 1O08A 4BYMA 3ICOA 2L18A 2BJWA 3M9WA 3PWKA 4BRZA 2F8SA 1T3GA 1MXHA 1PYOA 3DW3X 1L5SA 1I13A 2W2MA 4BO4A 1Z4IA 2DSTA 2OOKA 4NL4H 5AKZA 1NGSA 2CCGA 1UT6A 3KLMX 5DBGA 4OH1A 3CRW1 1IIBA 2XVXA 3U7IA 3GCZA 4R2LA 1BWPA 2XWPA 2JLBA 4YBRA 3E9MA 5F7JA 2Q46A 3TQHA 1ZGGA 1Y3HA 1S01A 2X8JA 4L15A 4P08A 2R5FA 3OZDA 1JHQA 4JI7B 1VB5A 3R9KA 2OZEA 2VWPA 2K2WA 3AW9A 5LC1A 1X7HA 1AGRA 4RDIA 1TLTA 4XIFA 2VDPB 1OZAA 1X9IA 3JASB 3KZ1E 3MGKA 1GXSB 4MKHA 5ALQA 1GZ5A 2BI4A 2ECFA 4XLLA 2ZW9A 2CJWB 2ZWIA 4G86A 2M6LA 4JBHA 2ZB3A 3RSGA 1JT9A 4D8TA 5JY1A 1O95C 3WYDA 2IVFA 1QJCA 5KS2A 1W36C 1VIAA 3L01A 1OGJA 2C8KA 4MVJI 4N01A 5JD6A 4WBNB 5TQ0B 1NZFA 1FFEA 4LBZA 5A03A 4LF4B 4X90A 3C43A 4R6WA 4ZKDA 2IS2A 3PX3A 5F5NA 2BGGA 5EAIA 3G6WA 1IJFA 1NXTA 2IQ5A 1A4RA 5B3JA 1E1YA 1T2NA 1HFWA 1UFKA 2EOAA 1ID1A 5JS7A 5BRJA 2WUDA 3AI1A 2ATEA 2QUBA 3IX7A 4P58A 2BGWA 4EPWA 3TZQA 1UJ2A 2WNIA 4LWOA 3HC7A 4TTTS 2P67A 3HCWA 5B7PA 5JCZA 5FPYA 2IHJA 2XCRB 3T7CA 4IEFB 2G63A 2H1RA 1CY4A 3L8CA 4DGSA 1DCTA 2IKSA 4G0MA 4RPIA 2B36A 3KVOA 3O74A 4RA9A 4Y2JA 2VZ0A 4KBYA 4COKA 2ZTSA 16PKA 4K9NA 4PAGA 5EJAA 1JQ3A 1AB5A 2VATA 3LUCA 4ZCPA 3WYAA 3PCXA 1B2LA 3TPZA 1HZZA 1X94A 4BV3A 3ZGZA 1P9OA 1Y63A 2IXTA 1YUNA 3P0RA 2RAPA 3UK1A 2JH8A 3K2BA 1AXEA 1RLTA 2GERA 3JQQA 3LRPA 4L8FA 2J3HA 4LNHA 5K51A 3EFEA 3ROXA 2XT0A 5JD5A 4L5CA 4XQ0A 4F3KA 4KR2A 2O19A 1ANKA 1PJRA 2D0PB 4L22A 4LDAA 1U28A 3ORQA 4WE3A 5JATA 1KS9A 3P9RA 1Y8QA 4R8SA 5HVNA 2XMDA 1ZX1A 4KVGA 2H16A 1KQ3A 5EKXA 1U63A 1JWAB 4GBJA 1ISIA 3BMOB 2CSUA 5LXTF 3U9SA 5CAEA 1GJRA 5A7FA 1F2TB 1YF3A 2OGWA 4Q66C 2G3YA 1TYCA 3DCJA 2CSXA 3BB4A 1HEIA 3X1DA 4WA7A 1OBVA 4L02A 1DNPA 2B78A 1L1RA 1Z4KA 1WB9A 2RGNA 3Q8WA 1AKQA 1I4LD 3QKIA 4EZBA 1EWQA 2EEPA 3KUCA 3GJXC 3OIFA 4XGKA 3L7DA 3B1YA 3QOFA 3MHPA 2OR3A 3MMSA 1JJVA 2JD0A 1DTWB 1CY1A 4ILEA 4N18A 1UT5A 1YB7A 3DWIA 1M1YE 5ALRA 2ODPA 1VKRA 1J06A 3AI2A 4BJHB 3USES 2VQSA 4G63A 5DM0A 2VF7A 2AHOA 2MSDB 3EFBA 3U17A 5B3AA 3VHRA 3TL3A 1BS1A 1F9EA 1KETA 1PW7A 2EZ4A 3WMGA 4XRGA 5AMXA 3N39C 1K7SN 4HDOB 4DMKA 1QH8A 3KEQA 4ZYUA 1A7KA 1CETA 1JI3