4J29A

Crystal structure of engineered protein. northeast structural genomics consortium target or258.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
127
structure length
127
Chain Sequence
b'TVVIVVSRDERILEELLEVVLKSDPNVKTVRTDDKEKVKEEIEKARKQGRPIVIFIRGATEEVVRDIVEYAQKEGLRVLVIMVDQDQEELERIYEQLKKDGVDVRVTDNEDEAKKRLKELLEKVLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Engineered Protein OR258
publication title Crystal Structure of Engineered Protein OR258.
rcsb
source organism Synthetic construct
molecule tags Structural genomics, unknown function
total genus 48
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4j29A00
2LNDA 2L82A 4J29A 2LVBA 2LRHA 2LV8A 2MR6A 2LTAA 2N75A 2N3ZA 2LCIA 2LR0A 2MR5A 2L69A 2KPOA 5GAJA
chains in the Genus database with same CATH superfamily
2EV9A 2HTEA 3CYFA 4H6WA 2KHZA 5FTNA 5SYMA 3USES 2M1ZA 4PX3A 5AXBA 1KVTA 2A86A 3C5EA 4IHJB 1JWLA 4LNUB 4YRQA 1Z83A 1S1MA 4QBIA 4QSMA 1YB7A 3C48A 5LQJA 3K9WA 3NORA 4IFIA 4CV0A 3AETB 4MR8B 5K4AA 5LCXA 1UDXA 4XGRA 2XVXA 3DE5X 1T4DA 5DX8A 3KOYA 1ID8A 1ZLYA 4MRMA 4ETIA 1XTSA 4AIIA 5IWCA 1N1MA 5F7JA 4FNOA 2IX3A 4P2GA 3TX6A 1A5TA 2JFYA 3BT7A 3RFUA 4ZHQB 1US8B 1Y3IA 3JYLA 3L0BA 3R3SA 1LS1A 4JJIA 1RPZA 1IATA 3TRFA 3FTPA 4DA0A 3D31A 4CLXA 3DHWC 5KX5F 3IUJA 1H4TA 4HLNA 4GZLA 3VSAA 4LQDA 5BWNA 2OO5C 3BEDA 2JI8A 1C1YA 3FMIA 5EZSA 3SHVA 1UQUA 2C00A 4WBXC 4Z7JA 1AK2A 1MTOA 3BXGA 4EX6A 1GR1A 4PAWA 1Q0LA 4YRSA 2QLJA 4C0KA 1NVVQ 4XI9A 2GD0A 3L8MA 2BFOA 3M9LA 1JTFA 5IKOA 1FTNA 3VH2A 3K3PA 3TW6A 4YJGB 1CDZA 1YFZA 4IDBA 4F45A 3MINA 3J7TA 4W99A 4PX9A 4A6XA 1JAZA 3F7TA 5ITZB 3F5FA 3D02A 1MBZA 3QEMA 4KYIB 1CJUC 3L41A 4UXIA 2O54A 3G59A 3AUJB 5H81A 5HE8A 3RS4A 3JQEA 2R68A 4MQBA 1CUEA 2HLNA 2QD1A 1I36A 2RCNA 1PLLA 4WFIA 2PRIA 4M0MA 2V9ZA 2ZU6A 1JKFA 1DQPA 1VIDA 1XOIA 5GJWC 5I9NA 3IULA 1N7HA 2G5GX 2G1JA 4OF4A 3MGBA 3N07A 2KI5A 3H9JA 2CMFA 4XUCA 3IVCA 4NCJA 4DYHA 3K2BA 1Z13A 1NVGA 2A2ZA 2APJA 3V48A 4CTKA 1X1AA 3CUSA 5IZCA 4OAOA 5JSZB 4YB8A 3H04A 1NONA 1PGQA 3HRKA 4ND8B 4XLTA 3DBHA 2PUJA 3BBLA 2NTVA 3NBFA 4B2YA 4KRGA 1T9KA 4TKMA 2OBBA 1L5SA 2MR5A 2DFVA 1OGJA 2A1TS 1CVRA 1FLDA 3BKWA 2Z8ZA 3OZEA 1TQ8A 5HGXA 1N1DA 2PZKA 1I2ZA 4PCAA 1GO2A 3ADKA 3DUFA 5AVOA 2EF1A 3OA2A 4H59A 4Y6GB 4PO3X 1DKOA 1T3TA 2X8JB 3PFWO 4MCIA 4UM9D 4HX2A 3MYRA 2GPAA 3WA7A 3DHNA 1YJBA 3OJLA 4G0WA 3QXSA 2P90A 3LL7A 5FP0A 1TGYA 3CVJA 2FRVA 4JJZA 4ER7A 5B4TA 3MJCA 1Y7IA 1YVRA 3V80A 3T3NA 2QJWA 3KDSE 3LVBA 4I6JA 1RSZA 5FUYA 3W4KA 2VC2B 1V8PA 4RSMA 2OM2A 1IOWA 2VBIA 2LD4A 3JWJA 5MN5A 2JGKA 4O33A 3FNIA 2X6RA 5A0VA 3FPKA 1P2TA 1PNOA 1Y7PA 5T6BA 4BAUA 4RLHA 1FUYB 4DMGA 1FMTA 2Q3EA 1UWCA 1JJAA 1OKKD 1IXRC 2C9MA 3F9IA 2NSDA 4FNAA 4AMGA 2H6EA 5BYKA 4OSOA 2AN9A 1QH9A 2VHVA 2AT1A 3KBOA 3M1IA 3K9FC 1YL5A 1JF8A 2Y27A 3G0IA 2JFPA 3AZQA 4K9RA 1PI3A 4CCYB 1RLOA 2PGXA 4KZKA 5H80A 3DL2A 1H2ZA 3ROGA 4ENUA 1Z5VA 3AOEC 3FYCA 4NVRA 1UZNA 3CUWA 3N6XA 2D0OB 1ZNXA 2YZNA 3PXUA 4HD8A 2H0RA 2IYVA 3E53A 4PANA 1U8XX 2QMZA 3ZTTA 1N5MA 5J58A 1XTIA 3JQCA 4GMDA 2AFHB 3VO8A 2H4WA 2PS3A 2NQ8A 3P94A 1QGOA 4A8PA 3GBSA 4IUYA 2SKCA 2IEAA 1CP3A 1TMOA 3AONB 1E2IA 2B34A 3HSSA 5CDUA 1GZ3A 1XRSB 1V8OA 4MMZB 3HBLA 2E49A 3MN1A 1N6KA 5FBZA 3MGGA 3ZBPA 4UQLA 4ZDJA 2CMKA 3R7BA 1FXUA 2FSHA 1V7CA 1P75A 3WL6A 2IE8A 3IJRA 2I1WA 1MT3A 4ZO4A 2XTAA 1K66A 4A8HA 4EI9A 4JITA 2I5PO 3ZDZB 2E4VA 4DLLA 5F3DA 4GMGA 4Y9TA 5CNMA 5ALGA 4PWZA 3OIDA 1JQLB 1ZD8A 4O29A 1ULUA 4L0CA 4JUDX 1JQBA 2NVWA 4PCUA 3FNHA 3GRRA 4M0CA 3WWZA 1N7GA 5I7SA 1GSOA 5E6SB 5AM3A 5CBPA 2WIAA 3AR9A 2ERYA 2NZWA 3W8NA 1B8VA 4CLDA 1AO0A 4BO8A 3WQRA 4Z53A 1M6WA 1JJ7A 4XLZA 5K0FA 1K08A 4RV9A 3PU6A 2R4QA 1RACA 4D0NA 1JJVA 1XB2A 4CKEB 2JAUA 1XQYA 4I50F 2ZIFA 1ANKA 2EZTA 4G9GA 1CQIA 4O02B 2FQ1A 2BDTA 3TM4A 1JG6A 2EJWA 3ZDEA 1DBPA 2FZGA 1R66A 4XWAA 1WSBA 2I55A 1C9EA 4M7OA 1DP4A 1SVWA 4MVJF 4XIGS 1HTBA 4URZR 1NBIA 5DCWA 1Z3IX 4OHRA 3ZE7A 1NXTA 2VAPA 3LRPA 1FPMA 1R00A 3P4XA 2C9BA 2RHLA 1DAFA 3CVOA 3DTNA 1G66A 2X4DA 5FEUA 3SFTA 9LDBA 4MV5A 2BM8A 1E60A 4BASA 5JAZA 2WICA 1NQWA 3EEIA 2E37A 3AC0A 1N2SA 1TZKA 2WU0A 4QXPA 1K6JA 3JWPA 1FSPA 3PD0A 4D0LB 3RI3A 1VGVA 4NOLA 4XD2A 1FYWA 3TTUA 4B09A 1FFSA 2VQFB 1U9YA 1Z7YA 3KOWA 1P0FA 3KJFA 4UTZA 5IUNC 1BRTA 1ICIA 3KU1A 4YLEA 3KU4A 1JKIA 1QTNA 1Z0DA 2H4HA 4FLFA 3JTMA 3O4FA 5BRNA 4ACBA 3BJRA 4AN1A 1ZZEA 2AS0A 4B6EA 4KN9S 5DGDA 1FS5A 1NV9A 2FR0A 4XPIB 1TT5B 3IVRA 4OI1A 1C41A 1HDOA 2A0FA 3BK2A 3L07A 3OA0A 3P9YA 1NBMD 2C5BA 2IRWA 3FHCB 4LXTA 3EZ9A 4P8RA 4ZAYA 4YY3B 1A9SA 3AWIA 4K1LA 4U3JB 4ZGGA 4A03A 2Y2VA 2C77A 2HIAA 2XITA 2HJGA 2PQMA 4IXDA 4JSTA 4Y3UA 1QYIA 5SY4A 3OE4A 4A0GA 1XNGA 2G8LA 4B6GA 2JKVA 1RXWA 3FPFA 1RPAA 4D3YA 1N7IA 3SC6A 1EWQA 4YDRA 3U9TA 4RVGA 2W4IA 4E14A 1VLMA 2GK3A 1FMJA 3CCCA 4QJ3A 4UHFA 2RKWA 2CBZA 1BWPA 4BO0A 5IVKA 3OTGA 4BQPA 2AE2A 1NQXA 2CLSA 4X84A 5EHNA 5A4IS 1DOAA 4N7RA 1XD2A 3WBFA 4AY2A 2Q5CA 1GKIA 1Y7LA 4O0LA 1XMIA 2ENWA 5AO9A 3Q3EA 3EVAA 4B7XA 3I6ZA 5A5EA 1DIRA 3BB1A 1GNVA 2FG7C 1A7JA 4HTFB 2ZRPA 4JP8A 1KVQA 5EZ6B 5JNVA 3C3YA 1LBQA 3ACCA 2PFKA 3ZGVA 4FYWA 4HN4B 4LY9A 1CR2A 3GGSA 2D0DA 2FMFA 2YHIA 3WGZA 3WKCA 4RMHA 1L4HA 4IKEA 4KXXA 1YR9A 4PSCA 3T7AA 3IPAA 2Z09A 1RABA 1WUIS 3SAJA 5B55A 4NU6A 4NYIQ 1NATA 4EI7A 4E32A 1OVMA 1UP7A 4I4LA 5I8PA 1TVMA 3ABQB 4FDVA 3V1MA 1V1RA 4G5YA 3M6LA 2Z3WA 2ZB2A 3IUMA 1O0SA 2DHCA 1CUAA 1L6RA 2VXCA 4I8IA 1KPIA 4PHHA 2G4VA 3S99A 1DXYA 3W2EA 3H5WA 4M0LA 2G67A 3CZPA 4HTAA 4JLVA 3QXCA 4E6EA 2H9AA 5JUWA 4REQB 1GU0A 4E5KA 2JJQA 3LUDA 3R8FA 2VJMB 1JYSA 4M89A 2M6LA 4FONA 4AS3A 1QQ7A 4TUYA 4BP1A 5JRZA 1TB4A 2GEBA 3OFKA 3PDIA 3PIRA 3GOHA 2QLTA 8GPBA 2PU7A 2R6ZA 2C95A 2GYUA 3AY3A 1ZRHA 3PKZA 2HK8A 4PLGA 4AG5A 4F2PA 1DC7A 2XKKA 1M1ZA 5K09A 2XB9A 3E3MA 4PLYA 2ID4A 2JAQA 3VU1A 4D6YA 4FGSA 4YBRA 6PFKA 1PJZA 4NCIA 3LHFA 3WLEA 4RZHA 4YGXB 4BMDA 3QSGA 3K71B 4QQRA 3QFHA 2WYIA 4G8DA 1DC6A 4WLVA 3DBRB 2QG9A 3F4BA 1F7VA 3WJ7A 4JLPA 1U11A 2I3GA 3A6KA 2PD3A 3OCUA 5AVXA 3GEEA 2OENG 4YUXA 1QNFA 3AL2A 4C0XA 1KQOA 1TMKA 1TRHA 3A1WA 1TCAA 3C3MA 1GNPA 4LE1A 3WIEA 3QTBA 5KYUA 1X94A 5TVKA 4O3MA 3UBTA 3FW1A 3HS3A 2GAIA 3IUPA 3THOA 4X1YB 2W98A 4N3BA 1GKUB 3F6PA 1GPUA 1MT0A 3KAJA 4GXTA 4RBNA 4XGKA 2ACEA 3ZLJA 2ZSUA 4X65B 2ADMA 2PU5A 4OKSA 4G1FA 1PK7A 1COWD 2XCUA 3JQAA 4G5RA 2G8NA 4MDYA 1ZUIA 4KQXA 2FZWA 3GBVA 1LI5A 3CNHA 1EJ6A 3TIGA 2OGUA 1DAPA 1TO6A 4HNAA 5AK4A 4B75A 4ZHSA 3CNLA 2F43A 4ZO6A 3PGXA 1FMLA 4JEHA 1V7QA 1M76A 3QU5A 4N12A 1KR2A 1YRBA 2NTYC 1G21A 1KO7A 1WZEA 2BKXA 4YC7A 5IT0A 4DSOA 3L6RA 1C8LA 1ADCA 1J1IA 2A9VA 1BJRE 5FWXA 4LGCA 1EFDN 1UKAA 3S7ZA 3A9SA 1DMSA 4AJKA 1FS4A 3ORSA 1HNZB 1KJZA 2X86A 4R9SA 4CGYA 2CE7A 2PJRA 3LWZA 3VJRA 1SQ5A 3SEFA 4F5DA 4GX2A 3AHHA 4QE3A 4FEGA 3R0JA 1I4TD 2JDID 3FMPB 4Q37A 2YFQA 3DCJA 5BVGB 1VHQA 3GLIE 2VJKA 4MVJI 2HMVA 2XGMA 1MX1A 4PZPA 1CUFA 3K6RA 4CIYA 2BFPA 2O8FB 3OE1A 4X85A 3WS7A 5CH8A 2IEGA 3R0XA 5ECWA 3IE0A 3RBXA 4ALLA 4I5GA 4B44A 4PZ0A 4BQEA 1FF9A 1ZINA 2HLDD 3ABZA 4NV0A 3ZS8A 5L6MB 2I4RA 1C3OB 1QVWA 1TFUA 3AF5A 2HREA 4GBMA 4A2CA 1XDSA 1ZU5A 1LBIA 1NI4A 1UPFA 2JIRA 2Q5QA 4DLRA 4DNFA 3GLVA 3OI7A 2GKOA 4X00A 3HBAA 5DJ5A 4G07A 5F12A 5IXJA 1NR7A 3K1AA 2Q7OE 1IC6A 4TTRA 3JR3A 4OK6A 5L7WA 1BDBA 2ZWIA 3HWRA 1E2HA 1UDWA 1X1RA 2AW3A 3RFXA 1B41A 3ERCA 4RC9A 4Z8YA 3KOXA 4BNFA 2ZYAA 3BIWA 4PQFA 4KAFA 4OHZA 3UK1A 1O54A 2D00A 3NEYA 1J2YA 4EVQA 3ZV7A 1TK2A 1SUFA 2XQVA 4A8JA 4QUBA 4UVEA 1G3UA 4BU1A 2BZ1A 5M29A 4LWPA 3CZRA 1V43A 4PNHA 1N2ZA 5I9MA 4RZ3A 4N0MA 4ZEOA 5B30A 1W5BA 4C0SA 1P4GA 5I6DA 3I9JA 4DQVA 2NSHA 2ZSHA 5JZBA 3R3JA 1LPOA 2FMKA 1KC1A 5JQWA 4JNKA 1NG9A 5I51A 2IXTA 4RPLA 2XJ4A 2RK6A 4Y6SA 1T2CA 3I73A 4KH0A 2FU5C 4PPGA 5G53C 4P80A 4Q66C 5DULA 3P2KA 3WVNA 1CUSA 2VKTA 5AW8A 2XB2A 1ESEA 1G98A 4L0QA 3A26A 2Q1YA 3RYHA 3ZY6A 3GPCA 1NN0A 2WYHA 3C5CA 2Z9DA 3OIFA 3QWAA 1ZMXA 4MLPA 2QK4A 3F98A 1WP9A 2QAGC 4RK5A 3V7WA 4CT5A 3PNKA 4OGWA 4EW1A 1L7DA 2ZTSA 2G6BA 4ZQEA 3UHFA 4F3NA 3OKFA 3E0QA 3P9PA 4GPD1 3JWEA 5LP6F 3FUWA 2NTJA 4E03A 1XKLA 4RIGA 2D0IA 4WT7A 1G6KA 2UUPA 1N2OA 1J8YF 1Z36A 4RXMA 3IQZA 3TSOA 2QXYA 4KGVA 4F71A 4UCXA 5I4IA 1X39A 1A4RA 1DELA 2FMXA 3AUYA 4NV1A 2ROQA 3FXAA 4DSNA 5TS3A 4IG9A 4UMEA 4LJ6A 2W2KB 3SF0A 3ID6C 1U0SY 1IL0A 3DS8A 4Q3NA 1E3IA 3FPSA 3Q4GA 4P4SA 4R1LA 4DNXA 5K8JB 3VX4A 1EK2A 2H7CA 3I2IA 4Q3BA 3C3CA 4DPKA 1ECGA 2CVHA 1DGQA 5BMOA 3AKYA 5ALJA 4ENWA 5A9SB 3P32A 2PMWB 4OHKA 2WTUA 2X8BA 1TJYA 3GROA 4QRDA 4UPVA 4E2YA 4EB6A 1CCWA 4B3TB 3LRXA 3K6KA 1FRZA 1HO3A 1A76A 1XZEA 3QELA 2JK1A 2DQ4A 5TNXA 3K30A 2ON6A 4WERA 3RQSA 3R5JA 2Q6TA 2N42A 1L4KA 1GG5A 3GDFA 3LDUA 2PKCA 4MKFA 2IODA 5BN5B 2GPBA 3NHJA 3BSFA 3FZNA 4RMGA 3TGWA 4ZRDA 5I3CA 1YMVA 2PNFA 2E7ZA 1TJPB 4TTSA 1GTMA 3RVLA 5BV1A 1UKZA 3BDIA 3CQ9A 4LHWA 3NC1C 2Y0DA 3FHOA 1QH8A 2PS0A 2VPWA 2XQJA 3BJZA 1UZAA 3INYA 3NTRA 4QYWA 1SIOA 3ZBTA 4IS2A 4YLYA 3TLCA 5FLKA 3ZWOA 1E0AA 1IHUA 4MLZA 3EXEB 4YJHB 2W22A 2ZAGA 5KCMA 2CZQA 3N8NA 1JXOA 3PRKE 3OQMA 5EP4A 1SCQA 2GHIA 2LZ0A 1Y3HA 5SYAA 2FDRA 1E2PA 1Z2NX 2FE4A 4I14A 1EU1A 2XADA 3WO0A 4C0LA 2WFLA 1YFKA 5JFOA 1SU4A 3IOYA 3EGIA 3MTGA 4A82A 1XKQA 1QGZA 1J2TA 3QY9A 4OHFA 3B7WA 4R2IA 2LUOA 1XHEA 1MO3A 1U6JA 2F90A 3ZLVA 4D5EA 1WF3A 1D4FA 4TZ6A 4GM4A 3LKZA 4HZUB 4DPMA 2QZPA 4D97A 3B6EA 1B0AA 4KQHA 4U2GA 3ZW8A 4R3NA 5BW4A 2H85A 4KHZA 4K0RA 4JC0A 3WFIA 2PE5A 2YFKA 4CF7A 2VTBA 3PWZA 1GR0A 3KSDO 4OQ4A 3TSCA 1N33B 4JJGA 4CIDA 2FPMA 1ZK0A 4H0FA 5I01A 1SUIA 5IH7A 1EBFA 2ZIUB 3UXYA 3CVVA 2VP4A 4LZPA 4CQJA 5JVDA 3NCTA 1O58A 1LS6A 2C20A 5JDIC 5I4CA 4HC4A 2PH3A 5LIRA 5LP6A 3VNAA 2DLCX 3VOBA 4TL9A 3O8CA 1PQUA 1V1RB 4ZT2A 4INPA 1KKUA 4MJXA 1VRWA 2BKAA 2Z2IA 2F8MA 3MT7A 3ZDRA 2P2NA 3D1JA 4Q6WA 5IDVA 2G7ZA 1JEQA 1A9YA 1YCGA 2O2DA 1BVRA 4EK9A 2JLSA 2UUAB 2X42A 1W0JD 2IA5A 3ROTA 4EZIA 1I6LA 1IULA 1MC4A 1RYDA 1N5JA 4MCAA 2G72A 1MRNA 4WN9A 3I42A 3OEWA 4Z4QA 2ZWPA 4LMRA 4Z3KA 5D3QA 3ANSA 1P9WA 1DKPA 4JEUA 3HVJA 3AUFA 3WL7A 1E4YA 4MUIA 4AIRA 4YRNA 5C1OA 3RRFA 4IRMA 1N2CE 3GLUA 1S1CA 2BMEA 3PBKA 4R1MA 4HVLA 1C7EA 3CLUD 4DBZA 2PZMA 5BY2A 3CTMA 2XV1A 1KF0A 3WRWA 5CB4A 2FPXA 2BHSA 5AM2A 4AAYA 2HGSA 4ZARA 1FDSA 1O97C 3GJ0A 3OM1A 3LQFA 4BVKA 5DTRA 1C9KA 3VHQA 4MO2A 5T4HA 3QPUA 1ZVQA 1LK7A 2P30A 3TKYA 2FUG6 3MWEB 1NMYA 3INNA 3R6WA 4W8OA 3VZSA 4Z7QB 5TMEA 3AUSA 5KSZA 2HEIA 1A27A 4LG1A 1AXRA 5DCLA 1WXEA 2W2TA 2ZS9A 3B2EA 5AIAA 4NULA 4WZBE 2JJ2D 2FHPA 2GBLA 3NRBA 4O4LF 4RPIA 4WBSA 4CODB 3O1LA 4ZZ1A 1M2OA 1ONBA 4DQKA 1WUHS 5E6UA 4P32A 1AZWA 3ESXA 1XZQA 2RG1A 3L1HA 5G0TA 3TRHA 2A57A 1FVOA 1EDDA 1LVGA 2QUAA 3KKEA 2C94A 2GAFA 3M5PA 1U0FA 1V0JA 3CUYA 1AX9A 3LMKA 4NONA 1WD5A 5CM9C 5HDQA 3HKEB 3U44B 3AJAA 5EP2A 4RQTA 5JI2E 4CEHA 4RY9A 2ZUWA 3IV7A 4Q00A 5AXDA 5FF9A 1T8YA 4TXLA 2FMIA 2GA8A 2P4QA 4F06A 1C4OA 3ZUGA 4LUCA 4GP6A 2PPVA 1P2GA 3N8KA 2QVBA 3HWWA 2GASA 1TO2E 1TC2A 3QLJA 1VMKA 4FX2A 4Q3OA 3U09A 1UWVA 2MSEB 2XYGA 1RCUA 4XIYA 2XMDA 2BGGA 2X41A 2H9IA 4ROSA 1ACLA 4O4JB 3TQIA 1W85A 4UTPA 2A7XA 3MTQA 1MENA 1X1DA 1TYZA 3ZZTA 4Y2HA 1MIOB 2EZUA 3HC7A 2ZDHA 4L08A 1ZNQO 2D5IA 3QLEA 4L2IB 4Y1RB 4YN3A 5JPDA 3JD2A 1KETA 1FY2A 2PH1A 2Q9CA 1NC3A 3D6MA 3VHLB 4K03A 4B6RA 3BRSA 2CBXA 2PANA 2C9ZA 4MVYA 1N1EA 2P40A 4KXLA 1Y82A 2CJWA 1RNLA 4LV6A 2B1IA 2Z83A 2I65A 4P7BA 4AJLA 5C5CA 3FDXA 3A6EA 4TRRA 3L0ZA 4G01B 3EW9A 3JQ8B 2IK8A 2NADA 2GZ2A 2VUSA 3E7PA 2JKYA 3K5WA 4P3NA 1XTTA 5H4HA 4RZIA 4PU0A 1C5KA 2NU7A 2K2WA 2XE8A 3D1LA 3HJCA 1ITZA 2YW2A 1CUHA 2PKXA 3CF6R 4D4KA 1K92A 5KDOA 2IZ0A 2D74A 1XC7A 2P0YA 4MA4A 2JVKA 2BFAA 2R1ZA 2C8LA 3DMRA 5LJLA 3AHCA 4YGYA 1WO8A 3LVFO 4DLVA 1DX9A 1T8PA 1FJHA 1TI7A 3ROPA 4BVAA 2O8CA 2ZBDA 4CEIB 1PIWA 1T9CA 4TTAA 2DB3A 1LY1A 4KQFA 5KYKA 4RPJA 2H29A 1ISGA 4LGYA 1UXKA 5JDCA 4CMEA 4ABTA 3WP1B 3DMPA 1HE2A 1QLJA 2GS9A 4COKA 5AVRA 4EGAA 4EFDA 1RKXA 1LJ8A 4CDNA 4DRYA 1AKVA 2OVBA 4EKEA 2R65A 2RSLA 3FLBA 4F21A 4U7HA 4US0R 1C8KA 4FDTA 2RMKA 3SZ3A 3H75A 3COZA 4QXOA 3MSXA 1HYQA 1A7AA 3X3HA 4EBFA 1ZOIA 2C1ZA 2VHQA 2W11A 1NSFA 1TZCA 1WV1A 2XEXA 5AVKA 3LVQE 5KVVA 1G20A 2JPDA 2XCLA 3GFVA 3I0MA 4KAAA 4L74A 2JH3A 1B6TA 3A1NA 4MVCA 5CXQA 1VE6A 3K1JA 4IEFB 3UJPA 4LXGA 4WCVA 5EEGA 1WHTA 4GG1A 4H6PA 2E4XA 1X7ZA 2HFJA 4MUGA 3KZKA 4DDUA 1ZI8A 2OCBA 1VIAA 3Q7IA 3EDYA 4JOBA 2EYUA 1IMOA 3PLNA 4DY6A 2AUTA 4FQ7A 4PHCA 1EUCA 4N8SA 3O3MB 5LNK1 4AG6A 4N41A 5KNDD 4FEEA 4AO6A 5BUSA 3WNQA 3I5AA 2I99A 3QBJA 4PHGA 5DASA 1V5WA 4ZREA 5SZKB 3VM6A 4BEBA 1KP3A 5JATA 2R5FA 2X3YA 5EKTA 1U2DA 2V9PA 3NOVA 4F04A 3L6CA 1NNI1 3QVKA 4JD5A 3B3JA 3HCPA 1EE9A 2O2SA 4I5IA 1M1NA 4TSFD 3URKA 4GMXA 2JAPA 5CVJA 4O8CA 3OCJA 3TIIA 1AGPA 3D3QA 4LWQA 4DYVA 1KDPA 1GGHA 4I6EA 3TTYA 3OZGA 1KMIY 3VOSA 4U7GA 1XTPA 3PGLA 3BWCA 6LDHA 3H3JA 2BUBA 4G1EB 4NBSA 4IDAA 4CUZA 3KPJA 4H7IA 1RRPA 1XRQA 1GUBA 5HIAA 4V24A 4CM4B 4UM8B 3DNFA 3OTIA 3U7QB 1BA2A 3FDFA 4JX8A 5J4YA 1OIWA 4B17A 3IE2A 3PUHA 1JDBC 1YNOA 1Y4ZA 2R1UA 3E70C 3G9XA 4ISBA 1T1RA 3LRTA 4KXYA 1OWPA 2ECFA 4MEBA 3WLHA 5K0NA 3KXIA 3WWCA 3ZEAA 4JEMA 1IY9A 1G63A 1M2VB 1Y1RA 2P2SA 2P4EA 5JV5A 3OZFA 2J48A 3DE6X 4RJLA 2J6CA 2G6TA 1IPHA 2ODNA 3IXLA 4YRAA 3NM5A 4BNGA 1IXYA 5DGCA 4DTIA 1QFYA 1LC0A 1YKGA 1GRQA 3QKSB 3RU2A 3GMDA 2BLLA 1RLIA 2CWWA 1D03A 3DOIA 4B74A 1NVBA 5IFLA 1EWTA 4RZUA 4ZPXA 3ZWAA 2PRZA 3L7KA 3NOQA 1D0IA 4D9GA 3GRAA 5MN6A 3FRHA 5CLIA 3IOEA 3R5HA 2DUUA 2FFJA 4XRGA 4DFDA 2AOUA 1UJ5A 1K27A 4PZAA 3KR0A 4M86A 1Y9AA 3E5HA 3UMJA 1JKXA 3MS4A 1G5IA 3SZMA 4C20A 1NL3A 3JD3A 4WGFA 1KRHA 3ELDA 3ETEA 4HPXB 1LWOA 1YULA 3TEJA 4GI7A 3RRJA 3LLCA 1P1CA 1QYWA 3Q9NA 2WI8A 2G08A 2QQGA 4IIGA 3QFCA 1BFDA 3M4ZA 3IT3A 4IGKA 2H59A 3SCZA 2BFBA 4Z1MA 2EQBA 2HA7A 2NVOA 2X6TA 4R40A 3TD6A 1DC5A 1W4RA 1A77A 4PGFA 1XEAA 1P62B 3RC7A 1OH5A 4CF3A 3NBKA 4QTXA 5EZYB 4L9SA 1AURA 3CX8A 2XXJA 1BIFA 1XRMA 1EESA 4YRIA 2QLMA 3U7JA 5BNWA 5KJFA 4JUAA 3HP7A 3EEQA 3UK2A 1SKYB 1TA4A 4RO0A 5ENDA 2GX6A 3CWQA 1TK9A 3O2NA 3C8DA 3O9VA 3L8FA 3TQTA 1TW2A 4YPFA 1EPUA 1P4SA 3R3WA 4QULA 1PJSA 5JVDB 1U0RA 2QMHA 5CG2A 4HNTA 2FR8C 3AF6A 1ISHA 2EFCB 1I7PA 1BMTA 3ADOA 1ONOA 2BY4A 4JR1A 1PDVA 1YBFA 4ZXPA 3DSRA 4KL8S 4B73A 2X23A 4DRZA 2AN4A 1MG0A 1AHPA 2PCLA 5E7MA 3NDJA 3FSJX 2ZIGA 4QVGA 4NAVA 4TWRA 3C0KA 1WX1A 1CNMA 2EX1A 4C43A 1GPJA 3DE3X 3RAFC 1E3JA 4RADA 2R86A 5K4GA 3ED1A 2K6GA 1XZMA 3GRUA 4WX2B 3KZ1E 1EGAA 3N2IA 3NALA 4MW0A 4CM7A 4FYIA 3B3AA 2CLOB 2YKGA 2P9JA 1DE0A 5IJAA 1W25A 4QQ8A 4J1TC 1W2GA 2WSSD 4I3FA 8ADHA 2Q62A 4J2OA 4G0VA 2GLUA 2WU8A 3U13A 4DNPA 3ASYA 4BBJA 1K75A 4YRCA 5K1ZA 4EF6A 4X6YA 5J1SB 2DUJA 4AY4A 1RAGA 1RIIA 1LH0A 2F9LA 4HDKA 4O4IF 1KEZA 4UVGA 1TZ2A 1TYDE 3DM5A 1PYGA 1NBWB 1R1DA 1ZH0A 2RHHA 2EEPA 1PJ8A 3UWKA 3K4HA 4ZZIA 3ULKA 2XVMA 4KJZA 5DNDA 3V8QA 1YOVB 3ANYB 1Z37A 1Z5GA 4GYKA 3KX2A 4A6PA 2JGRA 5B1EA 1RAIA 1YQUA 2D0PB 2YNMA 1FZQA 2NSYA 2NLOA 3F97A 4LFCB 3V1TC 3KWLA 2POCA 1MQAA 1MH1A 1KRXA 2G5PA 3IQEA 5IT9A 3HY4A 2I71A 1F4LA 1IVNA 2P2ZA 4EUNA 4GI3A 5JAQA 4ITVA 2JZCA 4G81A 4P93A 1S2MA 1QBKC 1CDEA 3AR8A 2AR7A 3IQIX 2XWQA 3HN2A 5CT4A 4WESA 5FUXA 3T9CA 3AG6A 2QZ4A 3LE8A 3LDGA 2HA4A 4BC1A 5CIYA 2ODWA 1NA5A 1MR3F 1JECA 3HM2A 3T7CA 3M82A 1EG7A 1JU4A 1QWSA 4JZYA 4NHEA 4OHPA 2B8JA 3GEHA 4D57A 5FA6A 4F96A 1U5BA 4LJAA 1QGUB 1ZJ4A 2IBMA 3C6YA 4Y2PA 5C34B 3QQ5A 3RG2A 4B48A 3Q8LA 1F0KA 3DDSA 3ORQA 3SZRA 1WQ1R 4IH1A 5HRCA 1YE5A 2FQXA 3GJ3A 2ZCJA 3KYJB 4F46A 4BLWA 1K3UB 4FYYA 2XWBF 1XWIA 4I4TB 2FPWA 4XR9A 2CV2A 2VJCA 4GYYA 2WUWE 1ZGAA 2NZUG 1HC7A 5CK4A 5IF3A 2AG1A 2ZRGA 3RUIA 3FNFA 4RCVA 1G59A 3ST7A 3M7IA 2ONYA 2SKDA 2ORIA 2FHSA 3RG8A 4MH0R 2WILA 1U9IA 2HWYA 3GFOA 2FA9A 2GPWA 4ZCIA 2V7QA 4EZBA 1YRLA 3C3AA 4LKOA 1FTQA 4TLCA 2JIQA 4TTPA 2Q99A 3T5CA 3VKHA 1NF8A 4N54A 2VP6A 1EHYA 3AF3A 3QVGA 1PL7A 4AURA 1A1VA 3KOMA 1FW6A 4GX5A 1BXRA 4R2WA 2Q2WA 2KW5A 2ID8A 4TXJA 2AXPA 2VAVA 4WADA 1XF9A 2RDMA 1SN7A 2BRUA 4W8GA 5JZ9A 1E2BA 2GO7A 1SELA 2YJNA 3ELWA 4F8JA 1ZY2A 4V0QA 3K73O 2EGHA 4L02A 5B3JC 2WVGA 2ZRMA 1V8ZA 2H1CA 3KFLA 3NJRA 3CUEF 3NWEA 2NTEA 5L9AA 2W6ID 2X1HA 4DIKA 1UXIA 1A72A 2V6BA 1PX2A 1ILEA 2NYRA 4O4HA 4P7GA 3ZH9B 1C80A 4KLZA 4GLOA 1DFIA 1YBAA 1D07A 3SKYA 4BKUA 4MIYA 3KLOA 4TVSA 3O8NA 4PC1A 4YJ2B 2QM8A 4PFKA 2OV8A 1ESCA 1L5YA 2YFYA 2AR0A 1CEXA 2XA2A 4OGLA 5CT8A 3GJXC 4HF7A 4C9BA 1PL6A 3OQHA 4LS3A 4ROTA 4YUAA 4OXNA 3PHHA 3VZDA 1FMCA 1RLJA 3HEAA 4U7JA 2HU7A 3OZSA 3PNYA 5K2MA 2QL9A 3L7JA 3OAAA 1M9NA 1MJ5A 4WZZA 3ZVMA 3MJFA 3U80A 3N2GA 5TT1A 5ECGC 2NU9B 1PJRA 2EFDB 3KQNA 4UOEA 3DKVA 1FFDA 4KWIA 2QSYA 1UM9A 5HDBB 5CDFA 1GLNA 1IN5A 3KO8A 4HWSA 4EJ6A 4TS1A 4ZWNA 4RLFA 5C53B 1BEUB 3CBGA 1H8ED 3WWPA 5IX8A 4G3XA 1SA0B 3IP9A 4LF6B 1SMKA 1TVCA 1UBOS 2ZZKA 3G85A 3M8KA 1SIBE 2ZLBA 3FMGA 3WSVA 1GQ2A 5CYGA 4GPEA 4Q1CA 4EDFA 3ZHOA 3TF5A 4RVFA 1XFAA 1OZGA 4EBBA 1TM5E 3ZCUA 3AKEA 3DMHA 2RJ3A 5GY7A 4BUJA 1Z2DA 4BP9A 2E87A 5JSFA 2EDAA 3TRJA 5J2TA 1X80B 2C5FA 2ZSEA 1IY2A 3I37X 521PA 3MD9A 1KSGA 1U2QA 1BMDA 5DSXA 3TOSA 5C8VA 3U4MA 2DBQA 2O23A 1MA3A 1U9ZA 1FEZA 1VDZA 2O7SA 3AM4A 1K8RA 3C70A 3OJXA 1Y6FA 1Y6JA 4DAEA 8LDHA 4W1PA 1PJ2A 3TZKA 2OORC 1SXJA 2HHLA 2HPAA 3IQGX 5COAA 3WRYC 1DRUA 4TMZA 3HB5X 3OP1A 3ZYCA 5KJ6A 4YRFA 5HK8A 5IVHA 3HYSA 4TYYA 1YR2A 1LZLA 4LHSA 1UMDA 4JCOA 5DLYA 5CH3A 2JATA 5DLDA 3R7FA 2DY1A 3WKAA 2WFAA 2W4QA 3U9SA 1ZWKA 2FV8A 3AEUA 1R6XA 3UCXA 1RXYA 1K9VF 1POWA 2PMFA 3H6KA 3RCBA 1G7CA 1K7CA 2XCOA 1PZNA 3T12A 3KQTA 1CW2B 1QCCA 1BE1A 4TV9F 1OAKA 5DNYB 5A4DA 3BCSA 1DHTA 1KHHA 3FUUA 1KYQA 3UT5A 3X1DA 2QTNA 3KNZA 3SX0A 4PY2A 3IEVA 4UHCA 3PGVA 4F6RB 1GDTA 2QRVA 1JIQA 1ZXBA 5AOAA 4CF5A 4RGQA 3MTDA 4AN0A 4DQ0A 4ZC8A 3U7IA 1ETHA 1MB9A 4J16A 5FA5A 3WIBA 5AM0A 4L5IA 2VSYA 1AUXA 2HU5A 4NRDA 4FGUA 4HZIA 1D8AA 3PHCA 3MHPA 1VIYA 5AESA 3K2EA 2X8AA 2OESA 3C1TA 4EO4A 3AL0C 2BMFA 1FZTA 5HX7A 4BNDB 1XZFA 2W8ZA 3U5ZB 1BAPA 3WK5A 4NK5A 5ICGA 1V26A 5FPTA 5BOSB 3L01A 3E81A 4BQIA 3UGTA 2C98A 4GMFA 2OHXA 1S01A 1ZCFA 3S2UA 4M1TA 5JYDA 5DGTA 4Z9BA 4UNSA 5LVAA 2FMTA 1JLSA 4TV9B 1N8KA 4O1HA 2MYNA 2O9JA 2Y0PA 4A2QA 5JQGF 5IEBA 1N6IA 4QU5A 3RFCA 5AQEA 4D9HA 3E1SA 1ZBQA 3OVMA 5A3SA 3W2TA 1MCZA 2X0IA 4HLCA 4UEJA 3ONDA 1FTWA 3ILHA 5EE3A 3ZWXA 5FLXA 3EA4A 3U7GA 2FFBA 3TZCA 3ZR4B 3EEYA 2BE9A 1H3NA 1UKVY 3EEOA 4JBNA 4W5QA 4MROA 5AJHA 1L3IA 4O1MA 4QXMA 2CXSA 1T2AA 5JCPA 2YOGA 2ZRCA 4JB2A 2ZWOA 3G6WA 2NACA 2BMDA 4DNOA 2C3UA 1QIHA 3EE6A 1WVGA 3AF0A 3ZHXA 1MW8X 2OZEA 1LF0A 1DCTA 3HNRA 4NPHA 1GUYA 3C7AA 5EXXA 3ZU3A 2XYHA 4J90A 4KGXA 2YXLA 1SY7A 4FYPA 4MO9A 2HBQA 3AI2A 2P9QA 4GOKA 3E8SA 1BTOA 4MS3B 3VNSA 4Q7KA 2I1LA 3A1FA 2LCFA 3LGSA 1XZAA 5BPFA 1MX3A 1KI7A 1UCFA 4L8YA 1Y98A 2RGUA 4TV8F 1IJFA 2FGJA 4W5JA 5EVJA 3LUBA 2XYVA 1GV0A 1F1JA 3B1YA 4B0PA 1HUQA 4JQCA 4KV7A 6CHYA 2RAUA 4L3VA 5I7HA 3H84A 1APBA 2MTBA 4YUWA 2D8MA 3NS7A 4GVLA 4N49A 1Z63A 4A7PA 5K6AC 1OX5A 1U04A 3EDRA 3EVBA 4FDMA 5DLEA 3GY0A 5CVEA 3IX7A 2YCBA 2XGSA 3OOSA 1G21E 2OV2A 4A0HA 1ICEA 1U5BB 3UCEA 1ZEJA 3FCYA 3EPPA 4ZI5A 3QEJA 1FDWA 1KZ4A 1GXSB 1XZHA 1WEHA 2F8SA 4CV2A 4AZVA 1XZNA 3VR1A 3WL4A 3L6DA 4ZOLA 3H7AA 2I8AA 3UEOA 3S29A 3D43A 2Q49A 1A8QA 3QVTA 5FNVB 1Q3TA 3W6OA 5EN4A 2ZWAA 1Z5NA 1BQ4A 4AW9A 2NM0A 2HRQA 2YN2A 3OC0A 4U6QA 3WAGA 4MQEA 1HI9A 3D2CA 2ZT5A 1FDUA 3E22B 4WLUA 4D0GA 5I7VA 3DO8A 4RJIA 4KR6A 1G3QA 1C2TA 1CJTC 1EGVB 1ZHHA 3NBUA 2XNDA 4KLNA 2DMRA 1ZITA 2ZIWB 7REQB 2B4AA 2M6SA 3LGXA 5U4QA 1L5WA 5C35A 2V5UA 5C32A 1FDTA 3O0DA 4H6VA 4IPTA 1CZLA 1OX4B 1WU7A 2QZJA 2JGEA 1G1AA 1GV1A 1SCNE 2YXDA 3L4KA 1Y1QA 3DAOA 3NNDA 3UW3A 1QGYA 3B1WA 4EHFA 1JHRA 1QOZA 5ALSA 2YQ4A 3CPJB 4D0RA 4EG8A 5L4SA 1KRWA 4HSEA 2ATIA 1I7SB 2L42A 4MWBA 3WRXA 1ZA1A 1P4JA 3P9NA 3PYMA 4IFTA 4BJ5A 1GTZA 4XM1A 2ZRBA 4J0EA 4FYHA 4ZVOA 1VB3A 2CLHB 3T3MB 1G41A 2AL7A 3VPCA 1VG0B 3BD9A 2O1SA 3F6EX 1JZQA 2VBGA 4MUBA 5DWVA 4WACA 3W5HA 4JT4A 1BVYF 1FW8A 3LXXA 3ZLUA 3DL4A 3QU7A 1H2RS 4LZWA 4IV8A 3VSCA 3FDZA 3AW9A 1H23A 2ZB7A 3NIGB 5IRCD 4MYDA 4F4HA 4NCBA 2CXNA 3R3ZA 4CCSA 1P9OA 1OY1A 1YRAA 4WI1A 4KOEC 4DJDC 3IEKA 5AVZA 1CK4A 3DL7A 1FJ2A 1MOQA 1A9ZA 5ENVA 4F5EA 2BI4A 3RS0A 1FX0A 3QV1A 4R68A 1YFLA 5BVHB 1BXZA 4MJ7A 1WCYA 3EW7A 5CLHA 4WJLA 1QO9A 1P1FA 1OHHA 2MSKA 2JLBA 2MU1A 2V0GA 1NQ5A 1E9EA 1ZHOA 5JZOA 2IKQA 4QUAA 1DKQA 4OMCA 3W6UA 2B5OA 1KHTA 3R77A 1D6MA 3WQBA 3F2VA 1YGYA 4BKRA 1Y1KE 4XUDA 2B20A 3HJAA 4GAEA 4G4SP 4HQ0A 5DDIP 1W5SA 1C0PA 1M73E 2IYRA 4MKHA 4CKZA 2ZPTX 1SXHA 3F3KA 1F1BA 1HE5A 4Q5IA 2IH2A 3RVQA 4X93A 4ZT6A 2XB6A 5HIKA 2IVZA 4WJZA 5E1MA 5GVSA 3AYZB 1U2ZA 3FF4A 3ZTWA 1RVDA 3QENA 3AR7A 1K8QA 3CBQA 4HWKA 1VFPA 2NV6A 1ZXLA 2P9BA 3H3XA 4ARVA 3V42A 2R8ZA 1NASA 4DCCA 3FYUB 5DBHX 3K5PA 4KVGA 1U6IA 2WIJA 4Y67A 1WULS 5EERA 6ADHA 2ZREA 4MWCA 4NBUA 2RGWA 3FVTA 5FYQA 4IYRA 5C3MA 1JEYB 4AKHA 4YDHB 2CBGA 1SIUA 1AZTA 2H57A 1X8KA 4TKVA 3Q3CA 1E2NA 4EY4A 2CW5A 5L3SA 2O5EA 5KOJA 3EIEA 5KYXB 4OXYA 4WK6A 2ZYDA 1VC2A 3G0CA 3SU8A 1VL2A 1JAXA 1HSOA 2JGFA 2Q4BA 3TMYA 4BEJA 4ZI2A 2ZJ1A 3PNPA 4Z0TA 3N2LA 4C2BA 4LOAA 1X19A 1NIPA 5CFZA 2FAXA 3H1FA 4Q4HB 2VJPA 2IHBA 2XUHA 3HACA 2IJGX 3ZQJA 3G49A 4L57A 4EB0A 3SVTA 2FWBA 1CR0A 3AT1A 4QPZA 5KWEA 1TCVA 4QOEA 3MMZA 5DNEA 5EXPA 2XTNA 2XXAA 1T0JB 3RLIA 3P0IA 3E7FA 2HOQA 3BJEA 4TLAA 5HXAA 3UOAB 2L17A 1GUAA 4RF5A 5D2CA 2XEDA 5H16A 1X0XA 4F3KA 5F5NA 4AMVA 2WWRA 2OB1A 4Q9DA 4MUNA 4U02A 4FJ0A 5JMWA 2O7VA 1F6BA 4JLOA 3EXFB 4JJ7A 3R9IA 1CB0A 1NM5C 2V4MA 3A4NA 4KO8A 1A1SA 4QOSA 2MCFA 5ARDA 3UC5A 3GLRA 4ZYUA 5H4GA 2XGOA 2JF0A 1DXQA 2I76A 1YBVA 3C3DA 1IVYA 1YTLA 2WZDA 3GCGA 3OE7A 4KGDA 4Y7DA 2YWBA 1N32B 1J49A 1E2FA 2DFTA 4B8ZA 5C51B 1GGFA 3RIEA 3GCWA 2IOFA 5HQ3A 3TB4A 3IP1A 4UCQA 3D3WB 3SSMA 1SBIA 2VWGA 1ZL2A 3FJOA 5E3HA 3GLQA 4YP1A 4R2XA 4L28A 4S1TA 3BGVA 1WUTA 1S3SA 1E4EB 5FBWB 2YMPA 5CA0F 5BWOA 5KMGB 5JOQA 4K3UA 1GT6A 4OSEA 3OPNA 4IOMA 5KKAA 5L3ZA 1BG6A 2B98A 2WU3A 3THYB 2Z30A 4NMHA 3KQSA 2HSGA 3C7CB 3VU9A 3DMNA 4PHTA 3MWDB 2EKQA 3ACDA 3OQIA 2BGJA 2FPPB 3D81A 5CLLA 2ZPAA 4WZBB 3RC9A 4B6SA 1RP1A 1AB6A 2F1OA 2DG2A 2BEWB 1FTSA 3B51X 3DO5A 3UJBA 1Z74A 3T9BA 3S81A 4L4SA 1T4CA 4GP7A 1TAQA 4R9VA 2I4TA 5JSKA 1X3LA 3PPYA 4C21A 5JYCA 3L92A 4ZQBA 5DN9A 4BWVA 3OQ6A 3DXYA 2UDPA 3EK2A 5GGXA 3G2PA 1XSEA 2IXBA 4ANFA 4RYLA 4D42A 2ZJOA 3BWXA 3ZI4A 3E03A 1Q7CA 5FPHA 4LMBA 1A4XA 2ZJAA 4I1SA 1PBNA 4KK4A 3W6NA 1G16A 4PC3A 3DKPA 3GB9A 4GM1A 4CQMB 2D7CA 4LXQA 1SC4A 4JGBA 1UPTA 2Q4RA 3G8DA 1D2NA 2WHPB 4JGIA 3QF4B 3UA4A 4ESEA 3SYLA 1GUFA 3IP3A 3KSRA 2GD2A 1L1FA 2I7CA 3CH5A 1U65A 1IRXA 3LQYA 1GTL1 3LFHA 3JQAD 4RZXA 4Z99A 1W4CA 4RA9B 4K0KB 1J39A 4TPKA 4X0EA 3Q7SA 5T8KC 2LCIA 3AP1A 1A2QA 3PJEA 4K28A 4I5FA 4R8LA 3ILXA 4NPAA 4U9IS 5LM3A 4H7JA 1FS6A 3EGDA 4DN6A 5TY0A 1OLUB 2J85A 3KHUA 4O5AA 1EM8A 1NQVA 1XRNA 2NPOA 1WSWA 2RGNA 1NHGA 5IYZB 5D5QA 2UVPB 1WPQA 1QPBA 2X5JO 3PHLA 3KLMX 2A84A 5HQTA 1JDZA 5LYJF 1E0SA 1ECJA 1ST3A 1RQNA 3EHDA 4CCAA 4N76A 5LD2B 1HFJA 1B0PA 4OBXA 2XHZA 4XOUA 4AU1A 3WRYA 4CN8A 1C0IA 5HBRA 4H3HB 2BJHA 1C9NA 4EIWA 4GFDA 4MW9A 2Z1DA 4JLSA 5A1TA 1QTRA 3SKXA 3OD1A 3PLRA 4QNMA 3MMXA 2P6RA 2AKAB 2GGSA 3K53A 1UF9A 4BKPA 1KMQA 1O8CA 1UJCA 1XL1A 2E1PA 3WOVA 3UUWA 3QRWA 1X7YA 2AIRA 1WETA 4CIVA 3NWOA 1DG9A 1II8A 3OOEA 4NP6A 4P84A 5IBPA 3BWEA 5EEHA 3DDNA 3AFIA 3MBOA 1I32A 5E9WA 3UAYA 5F23A 5CJ2A 2CN1A 5K0SA 4DIEA 1BXGA 2DOKA 4B47A 4E30A 2R8OA 1IBCA 3DC7A 3O8OB 1W2WB 2PL9A 4XYBA 1OZHA 3QUAA 1KE1A 4RANA 4AO8A 1XRPA 3JZMA 4EKIA 4QOJA 1OH7A 2ARKA 3DP9A 1YQEA 3H11B 1NXPA 1PVDA 4HDNA 3NPMA 2P1RA 1JQDA 3KKZA 2K87A 5ALTA 4HV4A 4AT1A 5JNSA 2C2YA 4W9NA 1J56A 4UDYX 1MF7A 3CPHA 1GU7A 2DCUA 5UKDA 2O1XA 4WKPA 1YZKA 2Z3VA 1XLTC 5K51A 3UAZA 1S8FA 4RWEA 4XYGA 5FPPA 1YE3A 3WAKA 2VF8A 4G41A 4AKEA 4S05A 2AWOA 3PNMA 4QYSA 4DSAA 1N77A 4FXOA 1TVKB 1CUUA 2FSVC 2GF0A 1K3TA 3LKVA 1Y8AA 3FZQA 3GBPA 2PFGA 2XZLA 1IK4A 5IBCA 1DOZA 1JI0A 3R3HA 2JGNA 1W5AA 4RU1A 3H2IA 1R0ZA 3KT3A 5JTUA 3CO5A 3ITNA 3W4JA 5HZMA 3Q7RA 3DKIA 4GBJA 1KYYA 2Z2JA 2ZI9A 3IV6A 1R37A 3OTQA 1WE2A 3PNOA 5M3BA 1RQGA 4OO3A 4ARSA 2QMOA 1LDMA 3AJRA 4UUAA 3AZPA 2ZYRA 2Z57A 1DV2A 4LBZA 5ENZA 4N40A 2Q21A 1IN6A 2YV2A 2HI0A 3FR7A 3S1AB 4OH7A 4YFYA 1M7GA 1ULSA 3ZQUA 5JALA 4EJFA 3ASZA 2YVQA 3A58B 1G20E 3FAKA 4DA7A 2VXBA 2ERXA 1E0DA 2GT1A 3CJRA 3GOQA 2PXCA 1JFFA 3CPSA 4RENA 5L45A 3CVWA 2Q9AA 1PFQA 3RANA 3W8FA 4IW3B 3USCS 3C14C 6Q21A 4MKXA 5BSFA 3ZZMA 2ATCA 1V5IA 4WCFC 2O0LA 3O91A 1PW5A 2B5WA 2IUSA 1GT91 2QOEA 1HG1A 2GKSA 3FY4A 1XCLA 4L78A 4GKKB 5FFFA 3E9EA 3TNJA 3GT3A 2C0PA 4EHKA 2RKOA 1XELA 1XVAA 1ZC3A 2ACKA 2ZIAA 3TQQA 5IN4A 1SC3A 1PZXA 3A1UA 4RPGA 1E5VA 4JH0A 5LA6B 1Z17A 3U1VA 2PMCA 3K0FB 5LQMA 1KTVA 3VHXB 1XMPA 3AY0A 5KSYA 1YUMA 4OB6A 2ZIZA 4OVKA 4C6RA 3D5TA 3IYLW 2WWWA 4LMAA 4HDAA 3C1UA 4M7WA 4KR0A 4RHXA 1TQHA 2DRIA 2FOLA 3RIMA 2O1EA 4GICA 1LPNA 1U9CA 4N7JA 2JH9A 4ND4A 3WICA 1HE1C 3TTWA 3SNKA 3WE7A 3IAFA 2ZRHA 5F64A 1H6DA 1GY8A 5C1DA 1ZMOA 1OJ7A 2NG1A 4B43A 1B7GO 4BLRA 2H1RA 5DHFA 1BDHA 1J09A 2C2KA 3EOAI 3OEHD 4O0MA 5B3AA 1VKZA 3FDJA 1ZM4A 4WY5A 4UCFA 4MDFA 3T5GA 2CHVA 1PFGA 5FTWA 5A7HA 3GJ8A 2P5UA 4NYMR 1FVFA 1BYUA 1J99A 3LI2A 1AS3A 1XKXA 2G25A 2YRWA 3PXBA 3ESCA 4ZVSA 5MHTA 1M1YB 2HEGA 3EA5A 2CDNA 3HCRA 2Q6VA 3N8HA 4JJ4A 2ISQA 3IAHA 1JILA 4OYHA 1V8FA 1SB9A 5E38A 1OTYA 1S3GA 1YI0A 3L5OA 4HMPA 4TMTA 4WLOA 5ARCA 3TAHA 4V1CA 3I9V1 4BVFA 1BNCA 2C1EA 3ME5A 4R2HA 5T64A 5J4LA 3SI7A 3KK0A 2W6NA 2EBHX 2YWDA 1R6VA 2ZJ3A 3JRWA 3WOHA 1WV0A 2GJSA 5DIZA 3RJZA 4EITA 1F60A 5MFPA 4G0XA 1CUIA 3K4QA 1F4PA 2ZUCA 1DT5A 2JIMA 1BMFA 4UVHA 3KYBA 3GRPA 4RKQA 4OJTA 3OIWA 2IHZA 2W0MA 3R7WA 1ISRA 4OFXA 3K5HA 1XLVA 1YZFA 2B0JA 3BHMA 3L7MA 3WHIA 3B20A 4RNDB 4FW8A 4J07A 1UKBA 3RF6A 1JALA 4HQFA 4KKXB 3TWOA 1CXZA 4I55B 2MYUA 4YAEA 1E8NA 2FUNB 1LNSA 3KEFA 1O95A 3KQOA 4CLRA 3QX8A 2WD7A 4DDWA 1GA1A 1XTQA 2R8RA 1DTEA 4M49A 1J21A 1DNPA 2WAOA 1J23A 2YICA 3T3EA 1Z0SA 2YS6A 2QR3A 2WKPA 4IHQA 4BHTA 3VYSB 1LV8A 3U9LA 2OG1A 5IJ0A 4Q1AA 3MQFA 2JFXA 3CEMA 1HDYA 3ZJTA 4NQRA 4HPJB 5A0FA 1H9BA 2YWCA 4FZVA 1A98A 4DJFC 4PW0A 4FFDA 3ESRA 3M1LA 1RZRA 4R9NA 4NZOA 4DB4A 3L8CA 1JRLA 3ABIA 3GGPA 1ZH4A 2VL7A 3KETA 5EOVA 2PGIA 2RHMA 1U2GC 4X9XA 1M34B 3RHZA 2AEMA 1JIXA 1NP3A 3C5WP 4Y6RA 3IBTA 5DX1A 4X44A 2JVIA 3IAXA 1QM5A 4P86A 4ND3A 4UULA 1V6SA 1O94A 3IKMB 3KAQA 1RBZA 5CW1A 1MO2A 4PC7A 1JBKA 5LIPA 1NSTA 2XIQA 1U02A 2FK7A 4HUQA 4ZVMA 2JJ8A 2GZ3A 3FZGA 4O3FA 2WJ4A 1DBWA 1N0HA 3D64A 1Z9BA 2Q5EA 1CQZA 1I30A 4YP5A 2DHEA 1ZKDA 2WSYB 1H2HA 4PQGA 1CY6A 2BT4A 2HK7A 2YTZA 3CF4G 4M0FA 1NYRA 1KVUA 2C9CA 2X8WA 4NWIA 3ZXIA 5I7WA 1ZOOA 4GH5A 2ZAYA 4OATA 5LQUA 3L1KA 3LOQA 3ANLA 4JKOA 2H52A 1GILA 5AW2A 1YIAA 3A1TA 3DAYA 5KYVA 7YASA 2D7DA 3GZTB 2PX2A 1OI4A 1RQ2A 1ZMBA 3CH6A 1B43A 1NNSA 3W06A 3T1HB 2X0DA 3QVXA 2E48A 4G1MB 2CNOA 2IYQA 4N3CA 1BCSA 1XDUA 2VDRB 5CAEA 1SOUA 3PNBA 5CYPA 2I9KA 3KYCB 3BFPA 1EFCA 1G1MA 3NBYC 2B9EA 3I04A 3PPVA 4HAXA 3V8BA 4D8XA 3MWFA 5A02A 2QRQA 3SC4A 5DBFA 3PFHA 3WLSA 3K9LA 4E3WA 1JYEA 3DTVA 1LCIA 1JJIA 3RREA 3NEJA 1HXHA 1PTKA 1RJEA 2DBYA 3GUZA 5KVCA 2H2DA 4HLQB 4MP8A 3RSOA 4JVSB 2C4WA 5G1OA 2AN5A 3D8SA 3M6UA 1PJQA 3LC1O 2PZ8A 3DC2A 3RJ5A 3WP0A 2QD5A 4BMSA 1UC5B 4PG5A 3ZV5A 2AEJA 2G9RA 4DDKA 2VJLA 4MNTA 3H5AA 3UMSA 3A1CA 3OKCA 5KOYA 3D7LA 4Q9HA 3NNNA 4L22A 1RM5A 3H9EO 1ECFA 5EXSA 3UATA 3UTDA 3HBMA 3OY2A 2W2LD 2ZT8A 3QYJA 4I5DA 3ROXA 2IQ5A 4V0RA 1VZ3A 3AFOA 3W8EA 3DF9A 3GVIA 1CJVC 1Z4NA 4FMCB 4UNIA 5JMTA 5KWVA 2GZAA 2JFVA 2JBAA 3HNPA 4MULA 3LPLA 1G7RA 4JA0A 3GYGA 1PV4A 1GITA 1QVVA 2ZBGA 3M5DA 4XJTA 4ACAA 2ZJ8A 1UJ2A 1X70A 1T43A 3IOCA 3TRDA 5ILQA 1NU8A 3B70A 5DYGA 1FNNA 1CUCA 3VOTA 1XCOA 1VHLA 4MK4A 5DFAA 5DNAA 3G5TA 4RHUA 1W5EA 5EMMA 2I8LA 3PQ7A 1NBHA 4WXMA 5ALWA 3SVLA 3GL9A 2EQAA 1HWYA 1QQ6A 3U4IA 1K8ZB 1D2GA 1ZD9A 2I34A 2J0VA 3HHEA 2VDMB 4HEJA 4N5NA 4ZXFA 1DZIA 4EY8A 3L9XA 3Q72A 3HJNA 3PGA1 4QUKA 5ED0A 1NDHA 3ZW9A 1JX6A 1RXSA 1VMIA 3R41A 1E3WB 4NCKA 4H0CA 3UK7A 2ZSFA 5HZGA 3HCFA 2O19A 2WJGA 5EJMA 5DM0A 1Q5PA 2R5NA 3DOUA 4OQYA 1DX4A 4U2FA 1QGDA 3UWOA 3L7CA 1PCXA 3BPSA 2DR0A 1MPTA 2NGRA 3A10A 3IBCA 3SBXA 2PSJA 4CKXA 2H7YA 4PZDA 3NV9A 3AVTA 3R4VA 4MDHA 5EGSA 1QFSA 1YB5A 2OYSA 3KUUA 4DWJA 1FQOA 4LN1A 2A5GA 2J0SA 1AKUA 2WQ7A 4ZV7A 2OD2A 3K5IA 5JI3E 3NEAA 4KV9A 2OVFA 5K03A 3KD3A 3MTIA 4X95A 4HH0A 1BA3A 3UPDA 4AFNA 2O8DB 5CNIA 5IZCC 1W52X 1D5CA 2CL7X 1YK0A 2OHIA 2QPTA 3FR8A 4IQ0A 4J0KA 3A27A 4LX8A 5E7QA 5C0OE 5KWIA 3SZLA 3PJRA 2VNKA 2CSUA 1BQEA 4KWEA 4UNNA 2EKPA 3OQPA 4C6HA 2HCRA 1HLPA 1H4VB 1WDWB 3KTAA 5CPFA 1DJPA 5JS6A 1U8TA 3HA2A 2ZVPX 2OXFA 4TQ9A 2PXHA 1RWPA 2QAGA 4BBAA 4EA6A 2OY0A 2R1VB 4FT4A 2H92A 2V98A 1TF2A 2FW9A 3G88A 2QUHA 2XYRA 1TTQB 5AI5A 5D01A 2WZQA 2XDQA 3B1KA 4GC9A 1U0EA 3E0XA 2BI8A 2BFFA 4Q6BA 2N1MA 2IVFA 3TXAA 3ZYZA 4XJXA 5AMXA 2E6KA 1V1MA 1NLMA 1CC1S 1W9MA 1Z47A 2AOWA 1PV1A 3W34A 2REBA 3EUFA 3D4PA 4JC5A 3ZE8A 1EFRA 4F11A 3P27A 1E32A 1RYYA 2GYYA 4WXHA 1AHIA 2QG6A 3SPXA 3I9MA 1UKCA 1TKCA 5J5AA 1EZ4A 3CXRA 5KQSA 1GZUA 4JAVC 3KQVA 2ZEJA 5NLLA 5FIUA 1U0LA 3W78A 4J0FA 1E3MA 3E9MA 3FTFA 4KPUB 1CZRA 3EASA 4O2BA 3R5SA 221PA 3T34A 1NOJA 1SXJE 1Y8QB 4TUYF 2R3SA 1E96A 1TECE 1VRCA 2A4KA 2IU3A 5BPHA 1ZEMA 4QBKA 1Z7BA 1N2HA 6AT1A 1MKYA 5BQXA 1U28A 2DLDA 1YCDA 2ONKA 1ULBA 1EP9A 2HWXA 4V03A 3TSWA 4YXWD 4WZAB 3NPAA 4EYSA 2PRKA 3D8BA 2BN4A 2JK0A 3EIWA 4RVDA 3V1NA 3TLXA 4YT4A 1C1XA 2UZIR 3BGDA 3EG5A 1NTOA 3KM0A 3UAGA 2BH9A 1NP6A 2YC2C 3V8PA 4X6UA 3PUIA 5DTMA 2VZ8A 1YTUA 2BTOA 2ZYVX 1YS7A 4RGVA 1A4UA 1DADA 3NYWA 1YUNA 3GX1A 5K3FB 1KNXA 3B7PA 4AROA 4DIMA 5DNCA 5HGJA 3OO0A 5HUHA 3KQUA 4EY3A 4LV8B 2VRBA 4Z1MD 1X7XA 2Y67A 1O6FA 1W47A 3OZUA 2NU8B 3HM9A 3THXB 4JJ8A 3WIDA 4N5HX 2X9NA 1RXEA 4B5KA 3OIVA 3QVVA 4D43A 2D4AA 3ZBUA 1Q1ZA 2GPJA 3V3TA 1QQBA 5J4KA 1UK7A 3W3AA 2EAUA 3BIFA 3HVHA 3LK6A 3O90A 2OZLA 2XRMA 4JFRA 4WY2A 5ES3A 3JCZA 1KDVA 2O1WA 1ONPA 4QFMA 2JLRA 3TQRA 2FPIB 3PIDA 2EKZA 4M9UA 1NDQA 4MEJA 3C3WA 1GL6A 4F4IA 5L3QB 2ZUEA 1MB4A 2FUEA 4H0NA 4HI0E 1TYEB 2DLNA 4IGFA 2ZTLA 3T9AA 3TDMA 3MIIA 4DLYA 3LSYA 3MELA 4JBYA 4XUGB 1IQPA 2F3PA 1RI5A 4D2IA 1FYFA 2Q4TA 4L5BA 2RI1A 1NVUQ 3WLQA 2DERA 3TI9A 4URXR 1TZJA 4IIYA 4I3HA 2Q07A 2QTAA 5EJ6A 3H18A 5GV7A 3TOVA 2WWXA 3CVYA 2EIXA 3K70D 1IN7A 1RP7A 3FBGA 1O5TA 1OXXK 1P1IA 1R50A 1U1EA 1V5EA 4REMA 3RROA 3ZD6A 2NO1A 3G0BA 4PF1A 1VPEA 4AS2A 3GNLA 3WIVA 5EHIA 1BS1A 2VUUA 5EUQB 1UANA 3DOJA 1GGJA 4MB2A 2BM0A 3K92A 4Z4EA 1ENOA 1I3CA 1EGMB 4F86A 4MGHA 3GRVA 3LUAA 4GZMA 3WL3A 5JANA 2FUCA 4N82A 4RW0A 3LCJA 1TUBA 2P8SA 4GOMD 5B3LA 1PJCA 2WWYA 3TTTA 2HQOA 4MRVA 4OHWA 1P6QA 3VHRA 3GI1A 4Q3EA 1I3LA 1H93A 4AXBA 4BFCA 4EUEA 3ELUA 5I4BA 5DCYA 4LHXA 3KYDB 3W8DA 5HEKA 4X90A 2Z1NA 4IWNA 2FDXA 1ZZGA 1DEHA 2RGDA 1CUWA 4QDZA 2GHRA 4JB0A 1QHEA 2GF9A 2ONCA 1R5OA 1CY2A 3E9NA 3MTEA 2AQKA 4Z2AA 4WSOA 2QR5A 1RQXA 5EJIA 4N3AA 1Z0UA 4URVR 1OPXA 5IWAB 2XVYA 2PYZA 1GDHA 3V6MA 2WW8A 5JJLA 3GH1A 2OCYC 1N0WA 1EWVA 3HUTA 3M83A 4TGLA 4K9KA 2WSIA 5KO2A 4U9UA 3ZHBA 1GNTA 2D1YA 3PEFA 2NMVA 4AECA 3AERB 4GGMX 3NW9A 1SRQA 2FOXA 4XX0B 1UFOA 1Z0ZA 3JARA 3HBJA 5JE8A 2H2FA 4RELA 4CJXA 1C30A 3GXBA 2EX0A 2JEZA 1LSSA 3RSSA 3L4SO 3MTJA 3ND6A 3DDCA 1KP2A 2HJHA 2GYWA 2EJUA 4ZGWA 3R0ZA 4U7FA 3BYZA 5CT9A 3FWHA 5AK3A 5L3RA 3RE1A 3E27A 1KOFA 1S89A 1SCJA 1RWWA 2R2GA 3COVA 1A8HA 1LLDA 2D7JA 4MR9B 4F12A 1VPLA 5C9ZA 2FPOA 1PSZA 5F51A 3FCUB 5G3YA 1JMVA 5FX2A 2NUPB 2ZB4A 4NBTA 5DYNA 4C6TB 1FJXA 2JCGA 4DMMA 2AXNA 2HH9A 4YUVA 3CF4A 1F0YA 2Q5LA 1BJTA 1EXMA 4IDGA 1LSOA 3HYCA 4UBNA 3HA7A 4DC9A 3GJRA 2EP5A 1GZHB 4RD4A 4EO7A 2A0KA 4QJIA 2V7QD 3HBFA 5HUJA 4S0ZA 2FPGB 1VTKA 1YCHA 2HU2A 3I5UA 4K8OA 1JNXX 2ZANA 4Y2XA 5L51A 2JZOA 2VATA 3RKUA 4NABA 4BRSA 1U8CB 3N8IA 3S2YA 3FNRA 1C3JA 1RKUA 1UH5A 5CPBA 4N0DA 2XCTB 4YJ3B 1SKMA 1A8IA 1N5IA 3PQDA 5IKPA 1JP7A 1XYYA 1WAMA 1BSVA 2XODA 3PCRB 4IDDA 4WNAB 1NHWA 5J47A 4RHTA 3G23A 4Y2RA 4DRXB 2X0RA 1UDBA 1UBCA 1XCBA 5EHZA 4F1WA 2ZU0C 1J07A 1HGXA 3FGOA 4EPXA 3PXGA 4DGSA 4QO8A 2NV2B 1ZNZA 3ESYA 3DVQX 3PUZA 4JI1B 3GDGA 2C78A 4YHBA 4RJJA 1GPDG 1KEWA 2O3UA 1O5OA 3JVUA 1SQ0A 2JGJA 3CSSA 3P2JA 4KYVA 4CQNA 4Y2SA 4M76B 2R6CA 2ZJ6A 4NMLA 4QARA 5C37A 2VK4A 3H2HA 4D9FA 5C8ZA 3CHYA 4Q0MA 5LXTA 2FMUA 4MQFA 3CR3C 3EG9B 5CM2Z 2RGYA 3F7OA 1E4VA 4C6SA 1M33A 3FGNA 3LIPA 1O3YA 1OTXA 2X9LA 1UK8A 3HCAA 3HSYA 3I2KA 3NBQA 1DEKA 3ANMA 5EUMA 4YYEA 4AJ1A 3OAAD 3HXMA 1OI2A 2A5FA 1Q1GA 2VNAA 2NX2A 5CT6A 5H0IA 1QH1B 3V2UA 4YV0A 3EUAA 3WGQA 3TGLA 1RZVA 4LYAA 1I1NA 4ZANA 1DQZA 3VO1A 3OT1B 1G4UR 4R3UC 2MINB 5DW0A 3VFDA 4JOQA 3UYKA 3IAAA 4KQGA 4M0KA 2V1UA 1HNNA 2Q4OA 3NHKA 1G0OA 1DX6A 1P29A 4KU4A 1F14A 5FI3A 2XF8A 5ECYA 1UXHA 5SYNA 4E70A 2VRNA 3IR5A 1BKYA 4G5QA 2UYGA 4KNVA 4MW5A 4PS1A 2FQYA 3ZDYB 4X7RA 1ZOPA 4MWSA 4PRZA 3ACBA 4BECA 1T0PA 1JQ3A 2XMBA 1DIBA 3DPUA 2NU6B 3NAMA 4MX8A 4PYLA 4RJKA 1NE2A 1KK1A 1PTJA 4R6XA 4EELA 3VPHA 4RD6A 3H97A 5B2FA 2R00A 3TZBA 3MLEA 3HTXA 2F64A 5KJCA 4P1ZA 1TM4E 3CLKA 1IZ8A 2QORA 4MV8A 3W3AH 3A32A 4E15A 5HVNA 3AKCA 3JATA 4J75A 4AZSA 3L7DA 2AMFA 2J9FB 4N6OA 3VSDA 5BR4A 2DYKA 2ZPUA 3O92A 1U1FA 1M2KA 3DBLB 4O2BB 1F2TB 5SZIA 4KPFC 4FBLA 3TLMA 5ISMA 1QRUA 1KI9A 4OB7A 5A5VA 2WF8A 2QBYA 1HDXA 1AO3A 1KFBB 1XU9A 3ITDA 4FJ2A 3AR5A 3IPRA 3HVUA 1KYWA 1O89A 4CTOA 1QIJA 4G0MA 4NS4A 3CX4A 5FKJA 4TTIA 3TIVA 1AE1A 4YAWA 3X1YA 3R7NA 3CXUA 5G0WA 3VKVA 4KKVA 3V4ZA 2FFRA 1IPFA 2Y1CA 3GA0A 1CUDA 2RHJA 3F73A 4AJ2A 1XA4A 4GT1A 2OAGA 5JWOA 2OBNA 4B7CA 2SICE 3FSGA 4YQEA 2XT9A 3NCHA 2VUIB 2CXPA 1QPGA 1WBDA 2VH1A 4FEYA 4PFSA 5E3IA 4BVBA 2WUVA 4AWBA 2HSJA 2D4HA 3K0BA 3PR1A 3TQFA 1KERA 3G8YA 3VQTA 1TPZA 1WHSA 5GQSA 5C4MA 1JDNA 3GHYA 4IIJA 5CRIA 1L5LA 2EHDA 2SCUA 2PUVA 1JA0A 4R1SA 2IDJA 2GNPA 2PK3A 4KVFA 2P0EA 4JCCA 4KN6A 4K9NA 4KUEA 4ZN6A 4KR7A 3T9EA 2Q3LA 1VXOA 4HH4A 3IP8A 1TTPB 3M0EA 4RPHA 1QIDA 4ZU3A 1PT9A 4P31A 4RD3A 5L95A 3ROQA 3PC8A 4QBHA 3R74A 1WOMA 4F4CA 2VYQA 3ZHRA 2DWQA 2OAP1 3HKBB 5GIPE 4QTUB 4YHHB 1SWWA 5AVUA 4CLEA 1LK5A 2PKYX 4MGIR 2UVQA 2GEFA 3ZNOA 3FNEA 5PGMA 2IE0A 5B53A 1GHTA 2FWMX 1F48A 4J03A 1ZI6A 4N18A 3RWOA 3COWA 4JP5A 4H4CA 4CVNA 4XDHA 4OMDA 1R64A 1LJUA 4ICIA 1C7IA 1Z39A 2FX3A 2J5KA 2QMUA 1FNDA 4DIBA 3M3DA 3REQB 3X1WA 3DT6A 1ZVKA 3R9KA 3CZQA 2F1IA 3NHAA 1IDOA 2GDJA 3Q41A 3B89A 3GFTA 3NTXA 4LC1A 3Q3VA 3EIXA 2ZWMA 3JQFA 3RK0A 1QH0A 1TTHA 5ADWA 4HEA6 1VI2A 2JHGA 3QBTA 1IY1A 4OHUA 3MFYA 4DLWA 3ENVA 1NBOA 5K45A 1Q77A 5U9CA 2Z95A 1MH9A 2JD0A 2BD0A 1KK0A 1KP9A 1ZBDA 4UZEA 2WPDA 1AXEA 4BB0A 5A4FS 4EVIA 1Y8RB 3T7DA 1ZMTA 2CJPA 2PUTA 2G83A 1UXGA 3EFHA 1S8AA 2FN8A 1QO0A 2QY9A 4HYEA 3P52A 1GZ5A 2YJTD 3QPDA 1PT8A 4HGNA 3I28A 4RY0A 4XFKA 3FVVA 3A11A 2WTNA 3UOWA 4UTXA 4YMSA 1H2YA 5AI6A 2P69A 4Y0VA 3ZY2A 4KQMA 2FSGA 2ZYSA 3KZXA 4K2HA 4EA8A 1QIKA 2Y68A 3AU9A 4RIHA 3RT1A 3MGAA 2BZSA 2XBUA 1SEVA 4HBZA 5JH7A 2CHUA 5JEDA 3T9DA 3QVJA 3WGIA 2QL5A 3KXPA 5BURA 1PGOA 1Z6AA 3CLRC 1YKSA 3N2KA 5LP6C 5F35A 4OBWA 3A6FA 2FR8A 5D86A 3UFXB 2FN3A 4IVNA 3RYIB 5JJIA 1G5PA 3IDSA 1HSZA 2NXJA 4CQLB 3CR7A 1XDDA 2SHKA 2EFEB 5HKOA 1RWKA 3L7YA 4RORA 1WCXA 1DAGA 1KDZA 4PZUA 5DHQA 1S2NA 5LOVA 4D1YA 1YT5A 1P0PA 2PWPA 1S4MA 5A4JA 5LMUB 4WFQA 1Z5WA 5B37A 1LDNA 2JHPA 1L7MA 3BCHA 3ISVA 4F6CA 1AGRA 5JJCA 5KZMB 4G1UC 1EAMA 4KNYA 4OQNA 1RPTA 1YZGA 1NZJA 2QYSA 3R20A 621PA 3C7KA 1GTSA 2PWZA 2FLKA 4YI5A 2J0UA 3E23A 4BFLA 1QZUA 1RXIA 4TOIA 3BTOA 4AJPA 2OOKA 1DL5A 3K16A 4RFSA 3PIIA 3PB3A 1R9MA 4MUEA 4YO8A 2CFTA 2P67A 1NMQA 4F93B 3C3PA 3GJ7A 3BGWA 2IS4A 3RO7A 1E6UA 1JUDA 1YDHA 2BFEA 2XVAA 2M98A 4RHFA 2XNDD 3TFOA 1AQJA 1GPWB 3MRVA 3IIJA 1FUKA 2O8EB 2Q5HA 4QU8A 3C6XA 5FADA 3M4NA 1F7UA 3QA3E 2PBFA 4Q3DA 2E1RA 1QG4A 1C0KA 4M46A 3IUNA 5KTPA 2HHHB 2ZCVA 3BX1A 4MB6A 4OLBA 2RBKA 4KYUA 4V0KA 3VMFA 2I87A 3D8TA 4CM8A 1CJKC 1GRRA 3OESA 3DLBA 1KK2A 3HYNA 1C3EA 4LSZA 4AD8A 1L4BA 3G8AA 1RBYA 2R6JA 4KE8A 3SYNA 4MI6A 3PSAA 5FR1A 1JFLA 1CJCA 3MJSA 4HVAA 1QYXA 1V1JA 1AA6A 1MO4A 2XSZA 4HDRB 1CNFA 1CX9B 1S4QA 3W8RA 2YXBA 4O2AA 3LT0A 3O75A 3AEYA 3TVDA 2PUCA 4ZAGA 3CNQS 3N0TA 5ABPA 3W2IA 1BWSA 2XKJE 4GNRA 1M2WA 4FOOA 1J1ZA 2X5NA 4G2NA 1H6CA 3OLXA 4O59O 5DMHA 4FS8A 4L73A 1LDEA 4ASUD 4H16A 4NOMA 4E5SA 2VR1A 5EJ8A 1DIHA 4DNQA 1U2RA 5F7OA 3DV0B 1CJBA 5BNZA 1BX3A 1Q0UA 3X2FA 5JCOC 4M0EA 4LTMA 4HATA 2H1WA 1S8OA 1ZUHA 4NFHA 3TCNA 1M6HA 5A71A 1UJMA 1OHHD 3PFBA 4AMUA 2IUEA 1Z3CA 4CF6A 4X3OA 4WMLA 4GX0A 3V46A 3IQHX 4BOYA 1OT3A 2IW3A 3PRHA 1PJ4A 1T2EA 3L46A 4MJ3A 5FQOA 5IXYA 3R3YA 1BH6A 4A26A 3BORA 3F6RA 4M22A 4XQGA 5E8JA 2GQ0A 3BWYA 1OLXA 3B52X 3EXHA 1GG2A 4DR2B 3HXTA 1T25A 3BA6A 2ZKLA 3U4HA 4ECEA 3E58A 1AA9A 1P2VA 1PR1A 3GU3A 3O8QB 2V96A 3ICOA 1NBAA 4PM4A 4M6WB 4RSGA 3U3ZA 4EW6A 3ETGA 1NJ5A 4Y98A 4FFWA 1ZUNB 1KBZA 4X62B 2PT6A 3RS9A 1UQTA 2P9TA 3A6HA 2P41A 3DTYA 4XGQA 1BGWA 2QRKA 4BNJA 3QIAA 2I22A 1SC6A 3IEXA 4LXHA 2Z58A 4Z0HO 3FOEC 5CIQA 5CFNA 2QDKA 1WQ3A 4R8KA 2LV8A 1NZFA 4H6XA 4IVQA 4XSHA 1UC4B 2IGTA 3ZUPA 3G9TA 1RXVA 3KQMA 2UU9B 1EAYA 1FSZA 1ZN7A 2XR1A 5EMLA 821PA 1JFTA 1TW3A 1GQRA 2L0XA 5IUKC 1Z4QA 1L1QA 2UZ1A 1GCIA 1NJ1A 3ND8A 3K1YA 3SJUA 5HE9A 3WWDA 5KYWA 1S2OA 2NZXA 1L0BA 1YONA 1XLWA 2HHJA 2ZCUA 4NF2A 4A0QA 1EFVB 3GK3A 5KVSA 3OHSX 3EH2A 3QITA 3S2GA 1E94E 2WT9A 3C3EA 2XB4A 5K05A 2FX5A 3LNCA 3T4EA 1B26A 5JD6A 3H6GA 2WTMA 4XE5A 2JG3A 1V47A 3QHQA 1REQA 3F9CA 3F6CA 4XVHA 2O59A 1SVSA 3LZDA 3ZD8A 3GNTA 3WISA 3MTAA 5D3MA 1RJ9B 3RS8A 4JI2B 6REQB 1AC5A 1R6DA 2Y1KA 1CT9A 2RGAA 3SR3A 3RARA 2HNKA 4TTTS 1TA9A 4RTOA 3FPGA 3D8HA 1VGQA 4FHDA 3C98A 2GD6A 3GLGB 1WEKA 5CTJA 3P9CA 1KPHA 3TCKA 4R5HA 4M38A 5EQDA 1V2HE 5FWYA 4B1FA 5AJZA 2IXAA 5ITSA 3RFTA 2E5FA 3R3VA 1HYBA 2O0MA 3MMSA 3Q3GE 3FG9A 4B3CA 2OC4A 4BY9E 2IHNA 3PTLA 4N6NA 1OB5A 3DE2X 1G64A 5AUQA 5DWDA 1XVTA 3EXIA 4OHVA 5CX1A 5TE9A 1XKTA 3P2IA 5M5BA 1JDBB 4B85A 2GBCA 3HU3A 5ESRA 4PPYA 1F8UA 4E88A 4NBNA 3SJAA 1IQRA 1XCGB 1QCZA 3BXFA 4NIMA 2E5LB 2OORA 1RD4A 2ESRA 5HIIA 3R0VA 2HQ1A 3FRJA 3RD5A 4D3DA 4Q7QA 4ZYLA 4LFAB 2JLWA 1Z2AA 3J81A 2EDCA 1YH3A 1TVEA 1F5SA 4NBRA 1L5HA 5BSWA 1R12A 4NFYA 3DDWA 3PJDA 4EI2A 3CMCO 4UE3S 3TBFA 4ZIRB 3D6AA 2Y1EA 2JARA 1FA9A 3EMKA 4IOLA 2X58A 4BO5A 4E1AA 2PNJA 4L4YA 3RC1A 4DLXA 2WJJA 2G80A 2UUOA 4UHDA 5TF0A 1YV9A 2R47A 3CGWA 3ONVA 3DGEC 3PQ3A 1M1UA 2Z5VA 5JCJA 1L8QA 4ZOQI 4R51A 3RVJA 2HIMA 3D4BA 2B82A 2MSWA 3RUFA 3K70B 2RBEA 4IHAA 4K9QA 2H2AA 1RCTE 2ZRJA 3IC5A 1DKNA 3SE7A 3TW8B 3CG4A 1NT2A 3ENWA 2ZJ4A 2F1JA 2G17A 4R1NA 4BB6A 3HH8A 4V2IA 2EBWA 2RHWA 1LC3A 2B30A 3RKSA 1JLLA 2O6LA 4G09A 5JAUA 2YYSA 4JASB 3H05A 5AR1A 1CSEE 4X3CA 4JYZA 2NUAA 1T8SA 3I6BA 4G84A 1JDJA 1BX0A 4OMFG 5AKGA 1YQGA 3KWJA 4AKIA 3FMVA 2D54A 2LKDA 4UEOA 1VHDA 4KOAA 2V45A 1YL7A 4K6GA 5C7LO 3DFMA 4L4ZA 2XZPA 1SHKA 2H63A 1ZVVA 1W46A 1EVIA 2BM1A 2BVNA 2ZVQX 4V0MA 4W82A 4YRPA 3WK4A 1NVEA 3NM4A 3VTAA 3QXGA 4CIWA 5JS7A 1IPEA 3VO9A 5J2UA 3I9KA 3ZV6A 3PFKA 3CFYA 3T3OA 3NO4A 1L7AA 5JPIA 4J7UA 4YAOA 5F78A 1XHLA 3I1IA 3F49S 3E3AA 5H8WA 4EEXA 1LVHA 1RZUA 2WABA 2XQGA 3GEMA 3GCZA 1H69A 1IBMB 1O87A 1TF7A 4BC0A 3UUEA 1L5VA 5A62A 4TVBA 1J0AA 4C03A 2A9JA 4YR9A 1QV6A 4B9EA 4UD6A 3L3BA 3RS5A 5F5XA 3ZDAA 1YJ5A 1F2UA 2VA9A 2IXEA 1WW2A 3VR3A 2IS2A 1WL8A 1QLHA 2Z04A 4IMPA 3NHZA 4H7DA 1VLVA 2W90A 2GK6A 4Z9XA 1OFUX 1GSHA 1D2CA 2Q50A 3JQ9A 4K1XA 4BLOA 2ERCA 4QUIA 1YGPA 3N39C 1QE5A 2OGTA 4M8SA 4RA6B 5FL7A 5IDWA 3MT0A 2BFCB 2IZ1A 4RGYA 4JA2A 3QLUA 4O4HF 4PGAA 2QRHA 4B3FX 4XQCA 4FOLA 4YYZA 2C2ZA 3A0UA 4CE6A 5JEEA 1P77A 1I4EB 1E4OA 4M53A 4ZD6A 1IJEA 1M0EA 2F48A 2X0KA 4Q03A 2PVSA 1SBZA 3EY4A 2X1LA 2Y92A 5JWHA 1CS0B 2XOKA 5DNVA 3SBDA 4R05A 4HXYA 1WDTA 3C8MA 4I1OA 4QFBA 4KIFA 1CP2A 1QANA 2X15A 3K0AB 3QPAA 2B0CA 1UFKA 4TVOA 5F21A 1YB4A 4EQ6B 4WASA 5FOQA 5DTJA 3GDOA 4L95C 4DBLE 5DYTA 3JAWB 1ES9A 3TPZA 1U7DA 4ZO7A 1IUNA 1YO6A 4DV2B 5HIJA 1RC1A 3O03A 2Z98A 4BP3A 1PJBA 2KBEA 2R5WA 3ORHA 4KN8A 4EFLA 1V7ZA 3DNPA 1UPBA 4QGHA 4RUKA 4C87A 5REQB 3KJEA 2NSJA 3OBIA 1Q7TA 1M3SA 3A2LA 4I0WB 4Q93A 2GRAA 3V2HA 3NBMA 3OMWA 4QATA 1VG1A 2QUKA 3MCUA 4DMCA 3VPXA 3ABOB 1NE7A 2IWHA 4HVTA 3E9YA 3HFSA 3NYRA 1TU0A 2CB9A 1NFRA 2EBFX 2H0QA 2P5YA 3F78A 2O8VA 4JUBA 5HBGA 5T57A 1QF7A 4ARIA 4O25A 3DCIA 3SZUA 5ELXA 2GHQA 2PZJA 1TE2A 4JSRA 4X1KA 1YB6A 3I53A 2WF7A 3GIWA 4X7PA 5J2TF 5I9TA 4J3NA 1I3MA 1AU9A 1R4MB 4IJ6A 3QKWA 9LDTA 1L5OA 1SGWA 1SB8A 2QQ0A 3DB1A 1GU1A 1KZ7B 2AJLI 1V9LA 2WM3A 3P9RA 2GNOA 1ZIOA 1HORA 4BYGA 1WUJS 1XA0A 5TQ0B 3A6PC 3LD9A 4D3ZA 1G7SA 1PGNA 3C8UA 3THWB 3R1IA 1XXHA 2X9QA 1NNUA 2I4OA 4YALA 4ZO8A 1YFJA 5H82A 1HDRA 3KQWA 4Q4AA 4NY1A 3N87A 2JD1A 4OH1A 3LU1A 1EX9A 2VDPB 1N5OX 2RC6A 2X22A 3KR9A 2ZUTA 4IRXA 1QHHB 1JPUA 3HZRA 2HDNB 4Z3DA 4JELA 2ZRFA 2CYCA 1T9HA 2XD9A 3M4JA 5HQJA 2A5JA 3SHQA 3NHPA 1E1CB 3DXZA 4HP8A 3OZBA 5E9QA 1R6TA 5EIBD 2J31A 3I4LA 2G1KA 2QL6A 5C81A 1THMA 2DC1A 1MHTA 3P0JA 5K99A 5DX0A 4FR5A 3RM3A 1A5AB 1KZ9A 1E2DA 3ZG6A 1YU6A 2DEUA 4IDQA 3UMVA 2C8VA 2D5BA 1TEHA 4QBTA 2WP8J 3RHSA 4L75A 3VPSA 5BNTA 3T7TA 2V4UA 4TQUS 2HYIC 1G8PA 3HUUA 4LY6A 3FOZA 1MDBA 1SOWA 3K0SA 1L4NA 1ONSA 1OWOA 3PYLA 2WIFA 4LV5B 5MDHA 2YWHA 3U60B 3KAPA 1YHZA 3G2KA 3CRRA 3RVBA 1N9KA 2NXEA 4MCJA 4C08A 3GJ5A 3H17A 3Q11A 3T94A 5BWBA 5K8CA 4XZ3A 2HRBA 2X4GA 4BGUA 4HDCA 2R8EA 1XX6A 3O95A 1KKMA 1G42A 5HPYB 5EYPB 2YV4A 1FTGA 4G0ZA 3CRZA 3O7WA 5A6VA 4CKCA 4OU4A 3E2MA 4IVPA 2CT8A 4EPRA 4LJ5A 4AUKA 3HFJA 1BW9A 5BN4A 3R40A 2HHAA 2RHOA 4ZVRA 1JZTA 1A50B 2J5RA 2ZATA 4JLKA 1TEXA 2VAXA 3B9PA