4J29A

Crystal structure of engineered protein. northeast structural genomics consortium target or258.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
127
structure length
127
Chain Sequence
TVVIVVSRDERILEELLEVVLKSDPNVKTVRTDDKEKVKEEIEKARKQGRPIVIFIRGATEEVVRDIVEYAQKEGLRVLVIMVDQDQEELERIYEQLKKDGVDVRVTDNEDEAKKRLKELLEKVLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Engineered Protein OR258
publication title Crystal Structure of Engineered Protein OR258.
rcsb
source organism Synthetic construct
total genus 48
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4j29A00
2KPOA 2LRHA 2L69A 2MR6A 2MR5A 2LCIA 2LTAA 2N75A 4J29A 5GAJA 2LR0A 2N3ZA 2L82A 2LVBA 2LNDA 2LV8A
chains in the Genus database with same CATH superfamily
4DSZA 4EG1A 2VT2A 3LZDA 1H2XA 5FRDA 4OB7A 2EP8A 1YAJA 3TLJA 3W5VA 3ROFA 2I2AA 3JZIA 2EG5A 1GNQA 1L5ZA 1A98A 4FFLA 3PKIA 1TM2A 3RT7A 3I9V6 3KQPA 3TX2A 2RGUA 3KALA 4XX0B 1K88A 2ABWA 1ZXLA 3BWBA 5E8RA 1RI4A 3R7DA 1XZCA 3ZIAA 2JATA 2X5KO 1MTOA 4A5OA 2ZI9A 5AI9A 2I9KA 2WIAA 1EP3B 1XSEA 1IJBA 1R0XA 4FC6A 4MP8A 1R4NA 3C70A 2BL4A 4JDPA 4Q48A 2PH1A 2DR0A 3H5AA 5ES3A 3NYQA 4R5MA 1E92A 1M2HA 4L57A 2CSUA 1MAAA 5E6SB 1ZVQA 1U2GA 4RCZA 3RJZA 3BZBA 1Q7RA 1ZITA 1UPAA 1PT9A 3DLCA 3L7YA 3M8KA 4IUBS 4AMYA 4DA0A 2JD0A 1WCWA 1ZVJA 3K16A 5JEEA 4M0CA 3D31A 2GD6A 2IDKA 3MERA 4X7RA 1T91A 3UNXA 2OORC 2Z9CA 2IYLD 1FQOA 2QBYB 4XR4A 2HH9A 3IVCA 3JWEA 4Y2PA 4YAKA 2AFIE 2A78A 3A8TA 1OWLA 3RHSA 3UWPA 5BVHA 3MGAA 4PZZA 5EZ6B 4X64B 2NZVG 1EDBA 4TTVA 2VDVE 3DE7X 2ATCA 2CUZA 1Z34A 1N7JA 4HF7A 3WFJA 1AXEA 1ZJ4A 2A5LA 3CCCA 1U65A 4LKRA 4AK9A 4NBLA 4O2RA 4OU5A 4UAVA 2CVPA 1NOIA 4C9BA 3W5SA 4BQEA 1E2PA 4E88A 3HBNA 3FNIA 4MKIA 1VGRA 3G2MA 2IHTA 2Q2NA 4B2PA 4G4SO 4JYBA 4YRNA 3QTTA 5E4YA 4JELA 2Y05A 1KIMA 2XDQB 3MM4A 1II9A 3FJOA 5JAZA 1I80A 2HZ7A 4HNHA 2R6AA 3DNMA 2O0MA 3EARA 3HBAA 5DNWA 1WP9A 4AJPA 4X65B 1JZTA 1NOKA 2CFTA 1O1YA 3RLIA 2AN1A 1IPEA 3CX6A 3ZZ1A 1I0ZA 1J1UA 1F0NA 4PGHA 3QV1A 5K4HA 2A14A 2MSWA 2SHKA 3TPZA 5JQWA 3IMCA 4GGPA 2FUEA 3EMKA 3FMPB 3KPJA 4QPCA 5EKDA 3F96A 3LECA 3EXG1 2QW8A 2OUIA 3P0FA 3Q2KA 5AVOA 4RPLA 1IHOA 3CVVA 4FCVA 5EIHA 1YL7A 3ITKA 2WJIA 2WR8A 4RK6A 1HE5A 3C1AA 4TN1A 1P44A 4MUJA 1C9EA 3KJXA 4NESA 2WHPA 4FHDA 4UDXX 1J06A 3UHFA 4GZ5A 2CBZA 1M2VB 3NUQA 5C18A 4OKNA 4TL8A 2BLLA 4WZBE 2SKCA 1NNI1 2ZE5A 2AVDA 5G0TA 2VYVD 5KQLA 4C6SA 4CLRB 4EEZA 2FN7A 3FUVA 3U1BA 3RG8A 1L7AA 1HOTA 2AEJA 4E12A 3G2IA 1UMBB 3G49A 2QJRA 3LY7A 1F2UA 2Q6TA 3LH5A 2WZBA 4L16A 3UTCA 3B78A 3DP7A 1IG0A 3PNVA 1PFYA 1U4OA 1UBRS 5DBEX 2DCMA 5IAKA 2WA2A 1FFAA 3C6MA 1EB8A 1DDIA 1XUOA 3EG9A 3HXLA 3TVTA 2D06A 4ND5A 1YQEA 3U4QA 1LQ2A 2Z0MA 3M2TA 3PIIA 1OH7A 1NVMB 5IM5A 1LTQA 2D6FA 4PS1A 3WGQA 3O8QB 1SXIA 5KPDA 4PC1A 1W44A 4FR2A 1P4SA 2GN2A 3KT6A 5K4GA 2A9QA 2ZSDA 4MUXA 3S6JA 2O1WA 4E4TA 3PDWA 4KWEA 1W46A 2NU6A 2P0YA 5CR9A 4K9DA 2FH5B 3VPSA 2XXAB 4X95A 2C2WA 4GS5A 5HKLA 2R62A 1B8NA 4I2VA 4CQJA 1DQYA 1ZO8A 2I03A 4XARA 1C2YA 3RU2A 4EG5A 2X2EA 3DFMA 2O8FB 4D82A 3D4BA 1U1FA 4LYDA 3TL6A 6ADHA 2XOKA 1W59A 3NBMA 4MVJP 4WBXC 3UUFA 2K5UA 1M34B 1VE9A 3C8MA 3JQFC 3MINA 3WWYA 5IDXA 2GHIA 2NPOA 5JWOA 5JC1A 3GXBA 3TTVA 2CD7A 3K0KA 4D4GA 3AY7A 2H2GA 3LQYA 4YJ3A 4ZMBA 621PA 4KXYA 4YAIA 3MYYA 1BYUA 2FG5A 1R8JA 2AQ8A 4BAZA 1PZNA 1MQ8B 3DUFA 3FPFA 4ZJZA 4P35A 1PT7A 1C14A 4R2XA 4G86A 3RVLA 4DZRA 3A6HA 5KEIA 3L9XA 1YKFA 2ZR8A 3A1VA 3RC9A 1DX9A 2IWHA 4TWJA 1N3IA 5AJWA 5J2TF 4KJZA 2G1AA 4MGZR 4Q05A 4GPEA 4C05A 2NQ8A 4C0BA 1G7CA 3G9UA 3CF4A 2GZHA 4Q4CA 1ZGBA 1Q3TA 1SKYB 5CFNA 1ZH8A 2Z5FA 1AKRA 3CVOA 4ETWA 3EZGA 5GJWC 4V0MA 1EINA 1WZCA 2QPAA 3DFUA 2B8JA 3LHDA 5ELLA 3WGOA 1JMVA 3ZY5A 2V96A 3FWZA 4NYJQ 3T4XA 4FXPA 4ZEOA 1YRWA 3BJMA 1IM2A 1J4AA 1M0WA 4GL2A 1BW9A 4ZVOA 3CCFA 1DDOA 3P8ZA 4TYPA 4ZEVA 3BTOA 4QTXA 1CF4A 1CK4A 2VBIA 3USES 3P9IA 1FZQA 3W8RA 5LOVA 4F2HA 1Q1EA 2XUAA 2IHVA 4O4LB 4CV2A 4UDNA 4DIDA 2ZDQA 1Y8QA 2F4NA 4UNNA 4MUMA 4W1SA 1Z0JA 4P83A 1BRMA 1E1NA 3RE1A 4G36A 2ZBEA 1TQ8A 2RHDA 2UYQA 1W4RA 4HLDA 3RTEA 3ZWVA 1GNRA 3B6KA 1YQ9A 3GFGA 3TZKA 2XEXA 3UH1A 3CEPB 5EP3A 2H2FA 4G9EA 2QTLA 1MDBA 1X6VA 2WVAA 5LA6B 1P8JA 2NPIA 3GA0A 2UU9B 3M6UA 4MO2A 1E4YA 3KAJA 4GUDA 4OA5A 1JBKA 2PDAA 3FBTA 1NF9A 2NUPB 2H2WA 3UMJA 1I6KA 5DX1A 1N2ZA 1YJQA 2D13A 2ZT6A 3OJ0A 4OYHA 2OZLA 4QFCA 4BRZA 5JBNA 2IJGX 3GJYA 1RM4A 4J1SA 1MVOA 1XTBA 1ISSA 2E6UX 3FCSB 3ABQB 3FZNA 2QTFA 3H0CA 4CMCA 5F1OA 3MWKA 4E94A 4UM7A 2QZPA 4MWGA 1C2TA 1EXWA 1XRSB 4NPAA 1EBFA 1NW5A 2IEBA 2Z09A 2QP3A 5EIOA 2C5SA 3RM3A 4BVEA 2AQHA 1TFRA 1V25A 2BGJA 3BA6A 1IWPB 5D3MA 3ZBUA 3I04A 2EJUA 4MAMA 2XUZA 3L5KA 2J3EA 2VHTA 2OCLA 3UMBA 1O8BA 1VKJA 3ENVA 1M6HA 3T5TA 3CX4A 4DUPA 4D9FA 5DM70 1W19A 3MQ4A 3JZFA 1IXZA 2VXYA 3WKEA 2WYWA 3LSYA 3M5CA 4XUDA 5A7FA 3BFKA 4URWR 5JNWA 1IC6A 1KYVA 3NWBA 2G71A 3L4SO 3O9MA 2XADA 3WISA 3FAZA 3ODGA 5LVAA 1NN5A 3CISA 1GZ3A 2D2XA 3K6SA 4RPJA 2ZYVX 4KSBA 4EFNA 4R2HA 4EDFA 1W36D 1SQ5A 2WM2A 4C0HA 3NIFB 4TL6A 3DLTA 5CXSA 2C7PA 4E30A 1XKQA 4V0LA 2HJRA 2RKBA 4LY3A 4FOTA 3GFBA 1YFJA 2LIPA 4NXMB 5C4GB 1E79A 1X87A 1HT1E 2KBFA 1PR9A 1XYGA 3WOVA 3UHOA 1ES9A 4GU5A 4J75A 1L7RA 4Q1FA 4PSUA 3WLQA 2X4LA 4ZDJA 2V7VA 5DNYB 4P3NA 1SUEA 2R8PA 3D1VA 4GPAA 4M1QA 3CUYA 4FNOA 4DCJA 5ALVA 4NF2A 3Q6NA 1FBTA 3U4MA 4IFBA 2WIJA 3AGQA 2UUOA 4L4SA 4FFSA 3JWHA 1VJDA 3V32A 3FSRA 5J4HA 1CUHA 2HA0A 2Q7XA 4CUJA 5CFQA 1CR0A 1Q0SA 4H3HB 4AIIA 2JLUA 2NN3C 1YS9A 4QUHA 3LRXA 1TLFA 3VR5D 7ABPA 5JS7A 4J4TA 1UMCB 3QUAA 1E5VA 4Z9YA 1R74A 3CTMA 4IUCS 4PZPA 2E1PA 5FF9A 1PLKA 2CXHA 5EWLB 5KHOC 4QT4A 3P0JA 2BCEA 5FTLA 1DWPA 1CF2O 2A0FA 2JBAB 5AVTA 1RLTA 1LI5A 5JOQA 1P4RA 1QAOA 1SC3A 4GM0A 1GLGA 2FZCA 1BXRB 4EHJA 4CI0B 2N75A 3IT2A 1SUAA 2CL7X 3N39C 1ZUIA 3M6FA 3HU5A 4V0QA 1NURA 3KJZA 4Y7DA 4YI5A 5J9FA 1WHSB 2FWJA 3UOAB 1P7ZA 4RQBA 1E98A 1ZOLA 2FJUA 1N6IA 1R37A 5ICEA 2AHRA 2CZGA 2VJBA 3MD9A 3KOWA 4COOA 4C3OB 1TPYA 3T94A 1YCGA 3WV5A 1FUKA 1PAUA 2KYRA 2W4IA 5L7TA 1GPYA 2FR8C 4WLEA 2H1RA 4N0QA 3F6RA 3R6LA 5DOVA 3DV2A 3U3MA 1DQSA 3CSSA 1JHVA 4ZTBA 1E9EA 5CAEA 3NG1A 4GWKA 4OLJA 2Q9BA 5IZCC 4BC1A 1US8B 1QHXA 4ARBA 5EJMA 5FUVA 4GPTA 5HIIA 2R7AA 1X80B 3MJVA 1TYDE 2OCBA 1G18A 3BH6A 1VFPA 1QGOA 3N6RA 4TZ0A 3RSFA 5B5SA 1UANA 1YNSA 4ZZ1A 1IONA 3JW8A 1T9GR 4K6CA 4MW6A 2V5VA 1P7YA 4DWVA 3GBPA 3CB4A 4N5NA 1QQ5A 1XLTA 3ROPA 3ZDZB 3STXA 1EE2A 1TUBA 1D2CA 4OXRA 1GZ6A 3WA6A 1BVUA 1KVRA 2C88A 4ZMRA 2GPYA 2VOJA 4V02A 5F2NA 2HA2A 4Q9LA 2DB3A 3URMA 2JDID 4RY9A 3ZYZA 1X1AA 3DZFA 3KKEA 2OCYC 4BFYA 2R96A 5DRYA 4BX2A 5A02A 1I94B 3Q0EA 4ER6A 3I3OA 4UE2A 4ONEA 3ERCA 2ISCA 3IKMB 5H80A 5DGTA 1K8RA 2ZB8A 5AJTA 5FUMA 4B46A 2RGNA 1I3KA 4FT2A 1QLHA 2Q28A 3BFXA 1MABB 4X41A 4A6XA 1ZD9A 1Z18A 1RS0A 1I1HA 2C4NA 3MCWA 1XMIA 1K8QA 4CKYA 2YQ5A 1I6WA 1LV8A 3MS7A 4LZNA 2ROQA 2GPTA 3TNLA 2EDCA 1H4TA 2VF8A 4MPJA 2IH4A 2IXEA 5DXFA 2ZPUA 4EPYA 2LR0A 1JIVA 5FFFA 4FMCB 4LV6A 1H9BA 2ZB7A 3L1VA 1XTVA 2HMYB 1MJNA 4LK3A 4UUOA 3GR6A 3L1IA 4CKEB 2NO0A 1J7KA 4K6MA 3TL3A 1BGXT 3G8DA 1NLYA 5L95A 2GB4A 3EFOB 4LYEA 5L4LA 2JZCA 4Z49A 5J2UB 3CUEF 3KUUA 4I08A 4OK5A 1OROA 3QWHA 1BQ4A 1MNQA 2QX7A 3LM8A 4OGLA 3IDQA 4UD6A 4L2IB 3R75A 3U16A 3TLKA 1FE8A 4KGDA 5BXYA 3CT4A 4P82A 2BOVA 4IIJA 5GP1A 4GD3Q 3ZBPA 3A9SA 4AF7A 2HJWA 4O63O 4KITB 2A9PA 4OXKA 1JRLA 4MUGA 5BRNA 2GCNA 5K51A 1CVRA 3DKVA 1H6AA 5HMMA 3EY9A 2V7WA 1CRQA 4R1QA 3H2JA 4IFEA 1JDZA 4C6TB 2Q99A 3FMGA 4Q9KA 5FBHA 1QHNA 3WGUA 1CFJA 2WTXA 2QAJA 2JAQA 2VUTA 3T9CA 2V3WA 3EVCA 2FJ0A 5CJPA 1Q19A 1YJ5A 3RGGA 2DH6A 3HWX1 1YE3A 4NAUA 4C5BA 4YUAA 1KJYA 3D0OA 1UBTS 1H1LA 4BDTA 4BB5A 4B31A 3D8NA 5AW4A 5IG2A 2EKPA 3AKZA 2JJ2D 5DNCA 3SZOA 3OIVA 4OQLA 1S3FA 2VTVA 2I3GA 1J1ZA 1CEXA 3TRIA 3L7AA 4EKDA 1KJJA 2QJOA 1R6AA 2GO1A 4IWYA 1OBFO 5JSZB 1R0BA 4XDYA 3R9WA 1NJGA 4ETIA 1OI3A 2ZJ2A 1IZ9A 1AS3A 2GBIA 2GBLC 2Q9UA 3BKXA 1E1CB 3KS9A 4Z99A 5EJ2A 1Y7HA 4O5OA 1KJWA 4KDRA 4ZVNA 4LXXA 2P4SA 5I7OA 3VGPA 4H9GA 3AR3A 1LLUA 1G8FA 2DP4E 4L6CA 4IV0A 2HF7A 1TAGA 4KN8A 2H9YA 3QVUA 4Y2XA 6YASA 5LUAA 4FWTA 4WSOA 4QAQA 4FZRA 3VPXA 4EGQA 4UHEA 2LXNA 1KY3A 1W0KD 3EVZA 3KTAA 4IP0A 4U7HA 2WPNA 2XVXA 2QG9A 3BXOA 2NOAA 4XM2A 3F5DA 3RIGA 1V1MA 3PJGA 3KCNA 1V41E 4CL2A 4KQCA 4MR7A 3U6BA 1GXSB 3QJYA 3VR6D 4W63A 4Q1AA 3U7GA 3R2JA 3PFCA 2YWBA 4UHKA 5KINB 3DWIA 3JRXA 3KELA 4BGVA 4K6GA 3AB8A 3GLHB 3JQ8A 4HPWA 4PV7A 4CDNA 5GZ3A 2B1JA 2H06A 5DISB 1FYDA 2C9DA 5C46F 4KE9A 5HIJA 3PUZA 4YQFA 1E6MA 1Y8RA 4ZZIA 2L69A 5B6JA 1BO6A 3F98A 4JAVC 1OA1A 2HU8A 1NU6A 1XU9A 2JD2A 2WOJA 1DC6A 4LZZA 3M9XA 3FB4A 4IZOA 5DTIA 3NALA 1DBRA 2IUFA 4TVBA 4YONB 1JG6A 2Q5QA 3QF7A 4X54A 2R3SA 2QAGA 2XE6A 3B8EA 4GR5A 4PG7A 4C0KA 5I9NA 4OD0A 5HCIA 5U1PA 3ZE8A 3CZAA 4AIRA 2H4XA 2BHNA 4B3CA 2VBFA 3K30A 5CH5A 3FJ1A 4FLMA 1AK9A 4P54A 2BEUA 4FMBB 1RZ3A 4OHRA 3K1ZA 2ADFA 1NHWA 1VE5A 7AT1A 1Z8HA 2J5XA 1VJRA 4LXTA 2I6UA 3GEEA 5AI6A 4YAGA 1A9XB 1C50A 1XTPA 2ZE6A 2WHYA 3D6JA 4DJDC 5JZVA 1CFZA 1EK6A 2WJ4A 4GKKB 4FPXA 3T7SA 4GSLA 5CVVA 3THXA 4KQ9A 4PQGA 3U44B 2QLJA 2FDXA 1ZISA 1VCHA 1KIFA 3WLLA 5A9SB 3WLMA 3AUTA 1PQPA 5E0OA 1JG3A 4PVDA 1HT2E 1N6HA 1IEVA 2XNJA 4YBZA 4FR5A 3NHMA 3U81A 1PWHA 4MS4B 3BX1A 1TAHA 1C7IA 1GRQA 1O9HA 3B85A 1DBIA 3HR4A 4Y2GA 2ZE8A 4XPIB 1TO2E 2ZK7A 3S0JA 4IR7A 3CE9A 3PEUA 4YAUA 3O84A 3OG9A 1EVIA 3ILYA 3WWZA 1G17A 1B93A 4UAJA 5BMVA 3E4CA 1QTNA 1FTWA 1OWNA 3UA4A 4NHEA 2A57A 2VRWA 4YJDA 3BB1A 3JQGA 5HQ3B 3BSFA 2YINC 1YIDA 1B8VA 2AIRA 1Z4QA 2X7XA 2NSYA 4GVPA 3CZ4A 1Z3IX 4JLSA 3RRBA 3ZZNA 3OQNA 3QSGA 3WXBA 4F8JA 4TYYA 4D56A 1WZEA 4OUDB 1T10A 4K26A 3JYHA 4FFRA 4HY3A 5ARBA 2WVJA 4DWWA 5JXHA 1EDOA 2R8BA 3E1KA 3UIEA 3ZQJA 4Q3KA 4EG4A 3KB8A 5J59A 4TQUS 1SQSA 2IPAB 5TPZA 1K4KA 3GYGA 4GWGA 4A03A 4HUJA 4PXSA 1N8TA 1YB2A 2C3UA 2RAVA 3I5XA 1YIOA 1DIRA 1Z4OA 1TK9A 1V16B 1WZIA 1W85B 5JS8A 2HTEA 2YC2C 4L08A 4L73A 1AUPA 1N5KA 4Y2UA 5TPWB 5E3HA 1WZ2A 1CUCA 4DXAA 2JIOA 2V74B 2OFPA 3AOEC 3KQWA 1IYZA 2HADA 5L40A 3B5IA 3DJFA 3IUQA 3IVXA 3ET5A 1V1JA 4POAA 2J9RA 3HADA 4NAVA 1D5CA 1A8IA 3LCVB 1E3JA 1MNAA 2WV7A 3EWIA 2VZ9A 1NUQA 3FR8A 4AKHA 3TLYA 3N8NA 4Z6KA 3HFSA 2YZMA 3Q4GA 1L7OA 5JASA 2OAP1 2WUDA 4IIFA 4RNDB 4C2UA 4J0KA 4EGFA 4BKRA 3UW1A 3ZHUA 4C20A 4R1LA 3ECSA 5HZGA 1Q44A 5JR3A 1VMAA 3SHWA 4XZ3A 3KWFA 3D6FA 4XIFA 4JSRA 3AETB 4HJRA 2X42A 1V4BA 2BEVA 4ER0A 1DIHA 3PTLA 4JJIA 3THRA 1UWVA 1CEQA 1YHZA 1Z5PA 4B5KA 2CNDA 4KUGA 1ORRA 2PA3A 1I3LA 1FDUA 2QNIA 3EZYA 3LCUA 5IH3A 2ZPTX 3NGXA 3X1WA 1ZSVA 1YI8A 1YVEI 2EIHA 4G4IA 4PBSA 4QUKA 4CM8B 2VHQA 2CB0A 2DSNA 4BATA 1IN1A 3C39A 1I36A 4HXYA 3CKYA 3O3NB 3MT0A 2HTFA 4JJKA 3NLLA 3QBTA 2W58A 2G77B 4LCBA 4LQDA 1EUQA 1QG2A 4YASA 3RHTA 4D92A 3W6ZA 4I8XA 4UFNA 5ENZA 3KXLA 2R87A 4L0QA 2O8BA 1RJFA 2R5FA 1PV4A 3ZY6A 1D07A 5I8ZA 1PT6A 1T4CA 1RHKA 3KD3A 2A88A 4MV9A 3EWNA 2QWXA 4OJQA 1CW2B 3I2YX 2W6JD 3ECCA 4IJKA 2YCBA 3PYLA 4H59A 4KXMA 3D6NB 5DCYA 2HM7A 1J9GA 1K1EA 1AF7A 4ZARA 2NYRA 4PQFA 4XFDA 2YY5A 1E2EA 3DH0A 1FBNA 4IVRA 3DE5X 1QF9A 3OIWA 3IBSA 3AERB 1RWMA 4MQFA 1BEEA 1L3BA 1OI2A 2XTNA 3AR9A 3KEFA 4HHEA 3VMMA 1G64A 1EFVA 4MTCA 4C0LA 5IH7A 5KYUB 3VKUA 4F97A 2LVBA 2ZRHA 4YFVA 3UW3A 4NYMQ 2CYAA 4UCQA 5IT0A 3F6YA 4NICA 3RVPA 1JLMA 3VDQA 1LDGA 5F1PA 3I76A 1OBHA 5HE9A 4Z8XA 2P91A 3X1JA 3MMSA 4OB6A 2HA4A 3PC3A 1AZTA 4HCJA 5HZKA 2GZ1A 1C0KA 4GXTA 3QLVA 1VLHA 3CIFA 3OJEA 1SZJG 4C7BA 5ECWA 1XTQA 1R16A 1PV1A 4AB1A 3EDMA 1DOAA 1YQXA 5AESA 1IEXA 3ADBA 6REQA 1NVAA 2HLDA 1PQUA 1ZGZA 3BWCA 1E63A 3AB7A 3GBVA 4RZIA 4F8YA 1PP4A 2RDMA 3QQPA 4PIVA 4LHVA 5CA0F 3GUUA 2XMZA 5FULA 1V7ZA 1X7HA 3OD5A 4TV9A 4MV6A 3SVTA 2ANCA 1OT5A 2Y76A 3L7BA 2FP4A 1JHPA 1I5RA 3LUAA 4GX5A 4MV3A 4WHMA 1KR5A 3LI2A 3RYCA 2Y1DA 3QVGB 2OR3A 2FUG6 2XNCA 1ADYA 1YZ3A 2EYQA 1A8SA 1AE1A 4FNGA 4Q9DA 4BV2A 4XSGA 4EHDA 2WUFA 2UZAA 3HDVA 3QYPA 3T7AA 4XQCA 3S70A 2P3QA 3UMFA 4JLOA 3QXJA 1K97A 4Q66C 1HTWA 2X15A 3F2IA 4J07A 4JGGA 3T38A 4ZAZA 4B43A 1H3FA 1RQXA 4YUVA 3SZGA 2DFVA 1LPNA 4ACBA 3U4HA 4K9LA 4BJ6A 3MS4A 1W94A 4OHUA 5DYNA 2LE0A 5FHRA 5AVQA 2PJDA 2Q3MA 4PC2A 2XYQA 2QM3A 1O94C 3B3QA 5CDHA 3LP6A 1WMDA 4CF5A 3QVWA 2ODNA 3U3OA 3YASA 3FFXA 1V3QE 4B2IA 1O4WA 4EA8A 5KNCD 1PW5A 4QHSA 2B1QA 3ETDA 1NXSA 2TMKA 1O03A 4V2IA 1VTKA 1UQTA 2CJWB 5AW2A 1T2NA 2PZAA 2QXYA 1IRXA 2F00A 1G20A 2PD6A 4KVZA 2OWDA 1IFXA 2JJYA 3EVEA 5ALDA 3P9ZA 4YUWA 2X0JA 2GAJA 4MW7A 1R66A 1YR1A 4DIKA 2C77A 2HLNA 5C8VA 2GAOA 4AURA 1EEHA 4B81A 4AS1A 2ERYA 1GSOA 1DG1G 2EFYA 4NU8X 3E2MA 3OF2A 4G2TA 4FCTA 2V7TA 1OFGA 3H7IA 4KYVA 3JWGA 3IOCA 5IF3A 1SUDA 2GD2A 2J85A 2PQ0A 2ZYIA 4L50A 3KAPA 4WCFA 2VATA 2QQFA 3RSSA 2J08A 3ECAA 5F76A 3FNFA 3AI3A 5T4FA 5JJKA 3TDKA 1WG8A 2QEQA 3W77A 3ETCA 1C9KA 4MGHA 2WYOA 2FSVA 2O59A 2HIHA 1WULS 2REOA 2QRGA 1IQUA 4FD2A 2OO5C 4NI5A 5GOTA 1ISPA 4Q03A 1KRXA 5LKAA 4HDQB 4PINA 4U2KA 2HIAA 2IP2A 1J24A 3OO0A 1B00A 1XMSA 5G40A 1G0OA 4HLCA 4POOA 4N3CA 2IHUA 1XXHA 4PGMA 4A6EA 5IJ0B 4LJRA 1R64A 2B8TA 2J3IA 2R6R1 4NEHB 4QDJA 1G6KA 1SC6A 4R3NA 5BN3B 5KTRA 1ZEMA 3KKNA 2IA5A 2QL9A 1HXHA 1KL7A 2R79A 3NT5A 4RHCA 3N5CA 1RHQA 3JASA 3FGPA 3M6IA 2VK4A 4FBLA 3QBEA 8ADHA 3NM4A 4BO5A 2X0EA 5BW5A 4UARA 3SZRA 1F3LA 4CF7A 5CG1A 3V7WA 1WWKA 5CDYA 4RIHA 2A5JA 3RK0A 4PFQA 5ARDA 1YZVA 3OE4A 2HXGA 3LQ2A 3UQYS 1PVDA 1WW8A 5JAIA 2WFLA 3A2NA 3QEAZ 2R6ZA 4A92A 1T4BA 2O2XA 4E5DA 4RJ2A 3FCCA 4HDSB 1S2GA 2I6QA 4YFYA 2G6TA 4CG2A 3FZEA 1C9YA 3DZDA 5EKSA 2X86A 1W9MA 4HRAA 3CZQA 1ONSA 5IN4A 5JXJA 5BQ5A 1E7QA 5EJ6A 5ALGA 4UXIA 3NBYC 3L7OA 3G3EA 1T8TA 2P7HA 4HJXA 3L7KA 4MV8A 3SS9X 5HF5A 5HKBA 5K8IA 2V1UA 1DOHA 2PXAA 2XA1A 4PYMA 1L5QA 1KBZA 2WYHA 1FRNA 3CWZA 4ZXPA 4P81A 4TGLA 5A0TA 2Q9AA 1T2FA 1AKQA 2IZ1A 4INJA 3K9CA 1E2BA 2IYZA 4LSMA 4BECA 4CV3A 1B6RA 5FBKA 2XRFA 3LOPA 5L51A 3IEMA 1X1BA 1XNRB 1U9CA 1BC5A 3EULA 4A2WA 1L7QA 2PNFA 4N0DA 4GLBA 4W5NA 2PUBA 5JXIA 2VK1A 4DMLA 2A33A 1IHDA 2G4CA 4RHFA 2OC4A 1L9KA 3OZDA 2XBMA 1XJ5A 4QECA 4TLDA 1YJCA 4G5GA 3SS8A 3IESA 5KU1A 5CXQA 3A37A 4NG4A 1QE0A 2R4TA 2X3YA 3GH3A 1JZQA 5KNDD 3OOSA 4X1YA 4GOND 3KJEA 1UJ5A 1S89A 4IIDA 3UK1A 3BZWA 4OXIA 5EGNA 4E51A 2QAIA 3HJAA 4PX5A 2P5UA 1URPA 1A2KC 3HLTA 4OHPA 4EA7A 4WESA 4RF5A 1AG9A 1S2NA 3KCQA 4XX1A 4CEIA 4BP8A 1PR3A 2Q5OA 3PZRA 1F7UA 1HA3A 5CFOA 3ZW8A 1S4QA 1H4SA 2PRJA 3UT5A 5KX5B 1I30A 3DE4X 1U3VA 4KXNA 4Q02A 2X1LA 3R8XA 3SM3A 3HG7A 4E2ZA 3SF8A 4BZQA 5C5EA 4ZPJA 3E8SA 3H4VA 2VTKA 4KSCA 1OKKA 2JFVA 4NZOA 4JOBA 5JJIA 1U80A 4LZJA 4Q7KA 2KW5A 2PYZA 1ODSA 1AKEA 1NFRA 5CCBA 4OHWA 4QUIA 2Q50A 2G08A 5CDFE 2G09A 4JNKA 3UEOA 5ADVA 2VWQA 4RTOA 2PBFA 2ZUFA 2BHLA 4L78A 2OZVA 3RASA 4LFBB 1NY5A 5BV7A 2JZNA 4DDMA 1GTVA 2ZS9A 4MWSA 4YCAA 2FQWA 3WHPA 1ZHOA 1BTOA 3P9CA 3FNGA 1ZU4A 1IJEA 2RHHA 4TPKA 2OYSA 1GKUB 4XRRA 2XVMA 2YYZA 3OIYA 2SCUB 3CTPA 1I7PA 4JGBA 5B2ZA 3OBIA 3SLRA 3LPLA 2WTUA 1XZBA 5EXSA 4TOIA 5EN4A 4DC0A 5DBFA 5JCXA 4TSRA 3I62A 3ZUPA 4PSVA 3MCUA 1X7GA 4E33A 3QF4A 2PLNA 4KC0A 3ICEA 2MYPA 4NULA 1OFHA 4DLUA 4BVJA 3I6BA 4C07A 4JLWA 4OHCA 3R74A 2DQ4A 3MILA 2REQB 3DNFA 1ZJWA 1BDIA 3KWMA 4FYKA 3TQOA 4YQEA 1HO3A 2VWHA 2QGNA 3VZBA 3ZGVA 1JLKA 5ICSA 2JAUA 3P2IA 2BFNA 3EMVA 4U02A 3DMFA 4MYTA 1ISHA 3AU8A 4NENA 3C16C 3WAJA 3K5IA 1VE6A 4QJ3A 1D2EA 1I5EA 2X77A 4CG3A 1P7CA 1QDUA 5ITVA 4O4JB 4TLAA 3UPUA 4UMVA 4A1FA 4NCKA 4EB6B 1ZH6A 2FWMX 4PLFA 2QLTA 1J00A 2PVPA 2QRLA 1LVUA 1MKYA 1AUVA 4HGOA 5DM4A 1JYEA 1XZKA 2OM6A 4ND7A 2YUTA 3FYUB 3HP4A 4MA4A 4J0HA 3RIHA 4YCLA 2GN1A 5IEBA 3KT3A 2D2FA 3LBIA 1SPXA 2BR3A 3AHGA 3I6QA 2HQBA 5J43A 2GYYA 2J7KA 4DR2B 2BRUC 3SHTA 2HYDA 4HDKA 2RFLA 4QTYA 2FFBA 1G63A 2O7QA 1Z68A 5M3BA 1KJIA 1Q2UA 4OLAA 4KV7A 2K2WA 4WBNF 2WV9A 5GIPE 2FDCA 1V71A 3EIQA 4QOHA 2GZ2A 1QO7A 2FAXA 4FYIA 5HIAA 1U7UA 2MT9A 1QH9A 1XG5A 4BP3A 1OC4A 3ASVA 3OKAA 5ECGC 2H29A 2WIFA 4RJKA 1EZ4A 3KSZO 4U5XA 3D6MA 3OCJA 2BW0A 3QBJA 1EUDA 1WUHS 3AUUA 2XZPA 5HJEA 4BMCA 1QANA 3OUZA 4KOEC 2CVQA 4B33A 3V4PB 1XNQB 4PWZA 2OHVA 1SXJC 4IXDA 3RWMB 4BNMA 3FDXA 4MRAA 4BEJA 5HKAA 5JJCA 3BXPA 4N5MA 4J1NA 5C1OA 4R8MA 1HZJA 5P21A 4KVAA 5EHZA 3TI9A 3MUOA 1AIPA 3O2SB 1EWTA 2YYSA 3VR1A 2C2HA 2DTDA 3H6GA 3AFMA 3GLSA 3TBHA 5EEHA 1ZH0A 4EG8A 3A1SA 4D4KA 4QU0A 2JJ8A 2WWWA 1GGEA 3WK6A 3LSTA 3EDOA 2Z1NA 4WI1A 4ZVLA 1PJZA 1UIMA 1XELA 3I4CA 1ORDA 4MCAA 3FKQA 4IQ0A 1Z5VA 4DPLA 5JNLA 3X0DA 3UUGA 2OO7A 1GPAA 1I7NA 5IARA 1QGZA 2BE7A 5ELMA 4LFAB 1DAHA 3IPRA 4IHJB 5B7NA 4TXJA 2NVUA 1Q0LA 2XYHA 4OA8A 4UCXA 1CIPA 4YI3A 4KQ6A 4URYR 4HVTA 2HF8A 4XSVA 4IFTA 3UJ3X 2YMPA 1EVYA 4CIVA 3DFIA 4PZUA 4D41A 1J56A 1I2AA 2VK2A 5T7BA 2C1EA 2A9VA 2Q4EA 4Z2YA 3KZOA 5AM3A 3ZJYA 2OP0A 3EIXA 5G0VA 3DXZA 4Q39A 2ZTUA 1DRUA 1GNLA 1ST2A 2WWGA 4LRSB 4DGQA 2F48A 4Y3UA 4D5GA 2YQ4A 4PLVA 1SJ9A 1KZYC 1P9OA 1UFVA 2VSOA 1B4DA 4XOIA 3VQTA 4ZT2A 2PHZA 2J4FA 5AM2A 4XIYA 2H5LA 4Q4LA 3NDBB 1YA6A 3GLGB 2FSHA 5KSOA 1IEQA 5IT5A 4WWHA 1WQ3A 1V8FA 1V4NA 2YY7A 4FFBA 1Y9AA 1QRRA 1MO3A 2GERA 3CLKA 3HDJA 5FL7A 4XB1A 3THYB 2WJWA 5U4QA 2B21A 1HDEA 2D7CA 3BHMA 3WQSB 3E81A 4R7TA 4RKWA 3PYXA 1D4AA 3PVZA 4E6PA 2J41A 4QX6A 5J23A 1THTA 1QK3A 2PZKA 3OPXA 1SXJD 3V97A 3VNQA 5IX8A 3JAMA 1GCGA 1U90A 1UBFA 4ED9A 2DR2A 1NUUA 2HR1A 5MFZA 2ZJ4A 3DOUA 4TS1A 1U0NA 3WTCA 1OXXK 2NZWA 1W88B 3EZ9A 3TVDA 1JKXA 4ZOCA 1QVWA 4H18A 5L3QA 1E59A 2PLWA 3QU4A 4I8DA 1FFYA 5IYZF 1TE2A 2B7CA 2ZS8A 5A4IS 1W25A 4JXXA 4B6QA 1Z7BA 4NU5A 1UC9A 1M0EA 5BSMA 2I76A 4K46A 3IMGA 4GG1A 1N3LA 1YONA 3NV7A 3PVCA 4X3OA 3E5HA 4XYGA 5ERYA 1MRZA 5ICFA 2BSXA 2VUSA 5PNTA 2VP6A 1K66A 1GQSA 3AO0B 3FUUA 1NG9A 4GKJB 4YT4A 1CY8A 1E62A 4KP7A 5DULA 1BXGB 3DYVA 3K1YA 3H16A 3ITEA 4DDTA 1QH1A 4EJSC 2YIDA 2IX3A 1I4OA 1Z56C 1GQ2A 3VKGA 4AY4A 4BMPB 1RHUA 4OQPA 4RESA 4A0SA 1F0KA 2X8AA 3WIEA 3I9V1 1M10A 3RUAA 1M1YB 4MCHA 1H4QA 3SJBA 2JH8A 3OMXA 4KN5A 1ZEJA 3IUYA 3PJFA 3B3JA 1Y9JA 1ZA2A 4DV3B 3JQPA 4TXLA 2XNKA 3NXSA 3GLUA 3WYGA 3UWOA 1K0FA 3KJIA 1KZ6A 1GARA 3KWJA 4K28A 2Y2UA 5T64A 2G3YA 3LZCA 2Y9PB 4WY5A 1YRQA 1E5TA 2FUCA 1M54A 4RHTA 5DBIA 5HQJA 4KACA 2RJ3A 1RQRA 4QPJC 5LYJA 3ROMA 2WC1A 3STWA 4PYOA 1OAAA 3GRPA 2IY8A 2O2EA 4I4IA 4EO7A 1F3OA 3DEFA 3H05A 5FIUA 3FDJA 3GEIA 4OTZA 2VHXA 1GGKA 5KTNA 2C9MA 3CLTD 1QX4A 4RULA 5KKNB 4Y2RA 4GSKA 3GJQA 3LPDA 4N1AA 1XKLA 3AIIA 3A3NA 4Q4HA 5ECYA 5FPTA 3NANA 1P4AA 3RC3A 5DYWA 3GFSA 4JHXA 3ZXYA 2ZT7A 4HAXA 1G5IA 2H5EA 4B6OA 3AHDA 4B0OA 1G8KA 2F62A 4F0JA 3TLGB 1H9CA 3C1UA 3NJ8A 1YV9A 4QPZA 5KNDH 4OAQA 2Z6AA 2GFQA 2ZUBA 5LP6B 3WJ7A 5EXPA 1Z63A 1GSHA 2FEXA 4Q3CA 3F6PA 5FO1A 1I9CA 3HVKA 3WQBA 1E9DA 2LV8A 3AY6A 3AWIA 2HJ9A 1PR1A 5BXQC 4OL9A 1C7RA 4BNIA 1AF4A 2N3ZA 1O96A 2POCA 2DERA 5LM3A 3H5WA 3HM9A 4AULA 3JVUA 1T2UA 3CEMA 1L8LA 1H8HD 2X22A 2B20A 5F64A 2HPZA 3GDHA 2VQDA 3PFNA 1WO8A 3E35A 2MSEB 2PGXA 2JPDA 4L8WB 1DI0A 2YBEA 1DADA 1RRVA 1X7YB 3PUHA 1X7DA 3DZIA 3QBVA 3S28A 2R97A 2ZBQA 4OJKA 2F9MA 4K1LA 3WV4A 5F9FA 3QVLA 5ALHA 2ENWA 2X1MA 1L1QA 4NYJR 3TK1A 5BQPA 2GETA 2MINB 2VDMB 2VPPA 4RF4A 3GRUA 1FMTA 1L5VA 2I3BA 2QSZA 4AN0A 5DBGA 4H0CA 2ZKIA 4L7VA 3VBEA 3ZVLA 5KHLB 3R5KA 3TM5A 4ROSA 1I10A 1IMOA 4DJ5X 3E9YA 3TSOA 1TRKA 7REQB 4C4TA 3WZMA 4MJXA 2E5LB 5K2MA 3UK7A 4BNWA 4DY6A 2FWPA 1Z82A 4MEAA 4WJKB 1CB0A 1WB4A 3TUIC 3K2BA 3R23A 1JBQA 3ADCA 3AEXA 2BFAA 5KYWA 1AGXA 3LP8A 1BHO1 2MSDB 4RHYA 4FGWA 4KLAA 1RC8A 4UUMA 2GT1A 1E4EB 3RF6A 3A6ZA 4Z8YA 1ZIDA 3QKRB 4LYGA 2R47A 1P9WA 1P2FA 1T5BA 1NXXA 3BBPA 3NHJA 4O25A 4QSHA 1J2TA 4YV0A 4E7OA 4M0MA 3LHFA 3I73A 1UJCA 2W2VA 4MHOA 3FTFA 3HRHA 5C32A 4WACA 3UK6A 1ZNZA 2VJOA 4N4AA 3L6OO 3VU0A 3VTZA 4O4HF 3ESQA 3GOQA 4L4YA 3OBBA 1JFTA 1WPGA 1NF3A 2X2OA 3W2HA 5AK5A 4ZTUB 1JFRA 2YHIB 5LU8A 4UE3S 3N2KB 4WOPA 2V7UA 4BRUA 4CN9A 2X9GA 3FOFC 1XRLA 4IDHA 3C7AA 4D3XA 1H94A 1ZK3A 2G07A 5CLHA 3KQSA 2IDMA 5E6RA 4CFZA 1O5IA 3OPYA 4ZO8A 5HW0A 1EM8B 5FEUA 3SYLA 3ZI7A 3N7UA 3AESB 4AY5A 2BDUA 2I2DA 2MMGA 1EDEA 2ZPAA 1QRUA 1JKIA 4FWBA 1SVWA 2JF0A 4CI9A 3PXGA 2E4UA 1A9PA 3A6EA 4MR9B 5JE8A 1DCKA 3FSGD 1JR3E 2OBLA 2H4WA 1IUKA 3H75A 4IV8A 3FCXA 5BYJA 4B40A 4XRGA 4QL3A 2IE8A 3AI1A 4ZIRB 4NFSA 3Q85A 4TLLB 4CLDA 1WV1A 1YVRA 3KQHA 3QEJA 2R5WA 4TUYF 4R4JA 1OBVA 3EVTA 1F7VA 5H1YA 1OLOA 2IIBA 3CONA 1XKTA 1P5ZB 1RVDA 2HHLA 4YRQA 5FI5A 2QV0A 4KCGA 1J0AA 2G9RA 3R3XA 4ZPXA 1DRWA 1KO5A 2PT6A 2OESA 1C8LA 4Z4CA 1LS1A 1L4HA 3D59A 4DQLA 2XTJA 1P31A 2LTAA 3AZQA 1TD9A 3HVJA 2GLTA 4ZQIA 1ZBQA 2QU7A 1TZMA 4DLTA 4KB5A 1E5DA 1YRYE 1U0TA 2HV8A 3OA2A 4HX5A 1PZXA 4HX9A 2HC9A 4JBWA 4TWBA 4M1TA 3N2EA 2F1KA 3WLAA 5EQFA 2GN9A 3Q9LA 1PLJA 4GZ3A 1S5PA 2EFDB 3DEHA 1KVTA 4OK3A 4TM7A 4D3ZA 1EQ2A 1WBDA 4Q16A 5HKKA 2VDNB 4EQ6B 3U7HB 2PPLA 2IYQA 2RG7A 4HRYA 4LDJA 3WLIA 1YMQA 1RC0A 3NPAA 1G5HA 4LDQA 2D5IA 1OXBB 1U28A 3LOUA 3IHLA 4H7KA 3CO5A 3ZCXA 4YPVA 4BBAA 4KHPB 2GH1A 2KPOA 4RA6A 3IUEA 1ETHA 4S3MA 5CT4A 4RU1A 1L7PA 3TAUA 1YXMA 2FE4A 2XB4A 1DC8A 3CLHA 4H17A 4JP3A 5CIYA 4G0PA 4BKPA 1M83A 2I62A 3OETA 3PGVA 1WCIA 3ESZA 1CWUA 5T4BA 3CO0S 5BNZA 3AF0A 3BRCA 1U7DA 2I4IA 3GMSA 4UMDA 1IN8A 1H1TA 2IZ5A 4P38A 4BVHA 5I7SA 4EY6A 1O9GA 2YXDA 1BCRB 4P1ZA 3FTPA 2YC4C 2CMFA 3HYTA 1D4ZA 4PTYA 1DG3A 2G88A 5EHQA 3DTYA 3QJ5A 3GA7A 1GM5A 3RFXA 1E96A 3UWKA 1NVBA 3W2FA 1R12A 4G4GA 3Q8MA 2V7QA 3B1XA 5JANA 4F2DA 1TKBA 2XGGA 3P2YA 1KTVA 4KN6A 3VO9A 3IIJA 3RTGA 3C48A 3SYKA 4R1NA 1JXMA 4Q7MB 3ZI4A 1N2OA 2HHAA 2ZYDA 1VRVA 1XP8A 3FG9A 4UVHA 3W5UA 3ZJTA 4MP6A 3IBYA 3O4RA 2G4VA 4DT1B 3GZ4A 3HC7A 4P8RA 3LO5A 3O3MB 5DIFA 2DAPA 3L93A 3WOHA 1KOLA 2CFSA 4EY4A 4YRMA 5A5FA 5BWLA 4FIZA 3FPKA 3AGPA 1K7YA 1VLMA 1HYQA 4W7SA 5ALNA 1DJLA 1F6DA 4TKLA 4DNFA 9GPBA 2CUNA 1FXWF 1WCXA 2RC5A 4NS4A 2ZR0A 1IJFA 1O4VA 2WIBA 2ZSUA 3M4XA 5BNIA 2IBTA 1S4MA 3MN1A 3CN7A 3EHEA 5BWCA 2GI4A 4N7RA 3L79A 3QX9A 5I01A 4B6RA 4DXDA 3E7PA 4KPYA 5TQJA 2O7SA 3UV7A 1JJBA 4G25A 1CUXA 4AD8A 1B3BA 4MW4A 1MV5A 2PJZA 4R8RA 3GP8A 3QMPA 1EFDN 4O2BB 2YVLA 4WZBA 4XJVA 1Z8DA 4FB4A 4KJXA 2AT1A 5DGIA 4CF4A 1FK8A 1UJ6A 4YVFA 2OPHA 3K1AB 2DHDA 2BFCB 2HCTA 3KPUA 3HA7A 1GYQA 1KHHA 1E0AA 1WQ4A 5L7YA 2O7RA 3QBDA 2FUKA 4LXYA 4I4CA 1ECCA 5DBOA 1XLWA 2A5FA 3K0CA 3QOFA 5BN4B 5JEDA 4TMYA 1DXYA 2AE2A 4NZMA 1SBTA 3SXUB 5LQAA 3OU2A 5IWCA 2CXXA 2G70A 1RKUA 3DXFA 2E5FA 3OQ1A 2P9JA 4RTJA 3RHZA 5IS2A 1N6NA 2IUSA 4YJ2F 2IS2A 3STUA 3ZDRA 1UPCA 4WIAA 2CLFB 1ZQ1A 2K4MA 3MLEA 4EABA 1F8UA 1U8XX 2ZBGA 4CDRA 2I22A 2R1VA 3EZ7A 5LC1A 5DOZA 1RPJA 4AKGA 1U63A 5TQ2B 4BE7B 1BDJA 1KMHA 1N0VC 2PX4A 1I2BA 5F7ZA 5TMDA 5JPIA 5FYQA 1HDGO 4GI3A 3CG4A 5LIPA 4UM9D 2DT5A 1E9RA 1UMKA 1ODIA 1SUCA 5DNUA 1M7HA 2A9RA 2HYIC 1R6VA 3A9UA 4G56A 4MYHA 1OGJA 2P9QA 5H3HA 3ZEAA 5B30A 1ST3A 1ZHHA 3EISA 4KO8A 2COEA 4N82A 4O2AB 3ZJ4A 3OEHD 1EUZA 2QTVB 1J39A 2B30A 1NXWA 3RU9A 3QVVA 4ZDKA 2N1MA 2DBYA 2QK4A 1REQB 3B1JA 3PFIA 4O4IB 1W5EA 1T5OA 3QXCA 5ES4B 4Z0PA 4MR8A 2KMLA 1AQUA 1E9VA 4MS3B 3RV3A 3GZTB 1V8OA 2D2VA 4EG3A 3J81A 2V4MA 1TUGA 3M6WA 5CPBA 4KRXA 1KMMA 3JY6A 1QGDA 1SELA 3GMIA 3GT3A 3I1YA 1M2EA 3MVEA 4G5XA 3VU8A 5TDHA 4NSNA 3G0GA 2OYCA 1CUSA 4FHEA 4JLBA 2DXIA 2QL5A 2B98A 5I48A 2CXPA 2XUOA 3QMWA 3WGNA 3WYNA 2CLSA 2PMBA 5HCUA 4BRWA 1EG7A 1YJAA 3CJRA 5BMOA 3J81k 2ZUTA 4LJ5A 4PNZA 1SZDA 2PWZA 2OD7A 3AL0C 2VYFA 3MRSA 1SD5A 4YCCA 1QG4A 2AI1A 3HB0A 2WSSD 1ZKDA 3L1JA 1DIGA 3UAYA 1OB5A 5B3LA 1UOQA 5AI0A 2I7VA 2OHOA 2RHRA 2VBCA 3GYBA 3I2FA 1FCJA 3ZQ4A 5AW0A 2YIMA 3NOVA 2QZ9A 1KYZA 1JHOA 3TQHA 1ECFA 2A5YB 4G0MA 1PLLA 4R9SA 5JMWA 2HRBA 1DKPA 4HNAB 1NFFA 1TYEB 2E4YA 5JD3A 4QGHA 1KC1A 2W7TA 4MOWA 4AUNA 3GJ8A 3EGDB 2ZIEA 3ISVA 1SG0A 4L5CA 1XCGB 4U8GA 4N6OA 1E3TA 2OUKA 3KQQA 3G23A 5AOCA 5M34A 2JLWA 4QEZA 3F4LA 1YFZA 1JMKC 1AHNA 1NXOA 1TD1A 2JFNA 3IQEA 5CEFA 3O8RA 4LE1A 2QSYA 4ABTA 5FWYB 1XVUA 5B3JC 1K6JA 2Q4BA 2PTHA 3BWEA 3GJXC 4DY4A 1IY0A 3WNZA 5LMCA 1K6MA 1DINA 3ZHTA 3D8BA 2XUFA 3MBOA 4WXPA 1K6XA 1Z5ZA 1NNLA 3E3NA 3IDZA 3RKRA 1Z5NA 1ZUD1 3OE7D 1ADJA 4PYKA 4MQEA 2Q6KA 3SMVA 1RKQA 1NKTA 2I4LA 2PCJA 3OTHA 4GI1A 4JVSB 2ZSIA 5FQOA 4EY7A 5KTTA 3W2IA 6PFKA 4B6EA 1LPPA 2ST1A 4TVOA 5EC8A 1PT5A 2X5NA 3BMQA 2JASA 3QXXA 1FP4A 1O95C 2AR7A 3IMKA 1KAHA 1G6Q1 5HDQA 1ZI8A 2OGWA 2XSZD 3KHTA 3DFZA 1IATA 4M99A 3R5FA 4PZDA 2A0KA 2R2GA 2ZJFA 3O4FA 4WPGA 3NBFA 4MIKA 4EQZA 4I4NA 3MC1A 1KXJA 3PCRB 4CETA 1AZSC 2W0SA 4O3FA 2FF7A 1MQ9A 3GFPA 4S1VA 4YRTA 5ALFA 2A0WA 3WG9A 4M76B 1OIVA 5LZ9A 2ZI5A 3DXXA 3DUWA 3FUTA 4E21A 2JA1A 1NNSA 3EN0A 1TK2A 2CCGA 2OCPA 2QTGA 3IIMA 4QJBA 3WMFA 1B74A 2FN8A 4W5QA 1OFTA 5A3SA 2Z6QA 3LF2A 3ZJVA 2G8NA 3PR2B 1FMFA 1I1OA 4EZEA 5BW4A 1UC4B 2ETXA 3OIUA 3REQB 1R18A 5KVAA 3J80A 3Q41A 3BTUA 3VR0A 1M2OB 2QN8A 3I05A 3T4PA 1E0JA 4DWOA 4CM4B 1XNJA 5ITZA 5K6AC 3K5PA 2L19A 3IXQA 1AA9A 1DXQA 1XEAA 5IKXA 3F3MA 3PPYA 3S1AA 5HJ7A 1PN3A 4EIWA 3DMRA 3LW7A 1U04A 2B69A 5HCNA 1FQKA 3OCUA 5J58A 2QPOA 4OLBA 5FTNA 2IYOA 4D9JA 4RGQA 1ZHFA 5CT5A 4LY6A 2CWWA 3RS0A 3JD3A 4QFMA 3COJA 5B1IA 4X44A 3VOAA 1GP2A 3T54A 4CE6A 4YNBA 1Z0AA 3LY8A 1SEVA 3P0IA 3HABA 4JOQA 4YH1A 4NBNA 1S8AA 3NAGA 3ND8A 4MPDA 2PANA 4KVFA 5FYDA 2H08A 1U2EA 3B12A 3E9NA 3MJ4A 2GSWA 3S2ZA 1DEXA 2C2XA 3QY0A 3MUEA 2FSUA 3ICOA 1JMYA 1SHTX 4F86A 4MKRA 1RJ9A 1T8YA 1QCZA 2H3EA 3EF0A 2WF7A 1Y4UA 2P5YA 3R5HA 4ID3A 3M1AA 4D80A 2D0IA 1GQRA 1V5IA 3BRSA 4MRSA 2UYHA 1O95D 3CBGA 1Y3HA 3VSAA 2A9FA 1L5NA 2MR6A 4BTVA 2MIIA 2FB9A 4LBWA 1E32A 5IVDA 1MU0A 3E3LA 3RF7A 3PXEA 1QGUA 2EGGA 1JFFB 1L7BA 2FR8A 4ND1A 1IRIA 4NYIQ 1NLFA 2Q27A 5BVGA 4XB2A 1UT8A 4G3XA 4NAHA 1F4VA 1Q0PA 4JYMA 3U7RA 1MC5A 5IZCA 3VZQA 1L4BA 4CMHA 1H2AS 2DHEA 2JHGA 3T3GA 2J3LA 1WRBA 1YJXA 2Z1MA 3PEFA 2W6MA 4XFKA 3UGQA 2HBRA 2BMEA 3KKKA 4B7CA 1DPGA 1KMQA 3IT0A 4PZEA 4RTQA 1V8DA 5HRUA 4KKVA 4P53A 3NTQA 1BNCA 1RHRA 1XEWX 3U5TA 2VQEB 4ZAYA 4G0WA 3FLBA 1Z8NA 2C5LA 3E5RA 4RGYA 4ZOLF 1KKUA 4F93B 1AN9A 3K0AB 4RDCA 1TF2A 2F8MA 3KJGA 3FNBA 2QTMA 5AUQA 1XCBA 3C97A 3QLJA 4MLCA 1PTJC 1Q0TA 4LEIA 5C8YA 3R7AA 4WW0A 4EMUA 4M9ZA 5KTSA 5JJLA 5GMOA 3K0BA 5IZ4A 3CX7A 4JP2A 3S99A 1SA0B 4B4UA 4ZOBA 5K6RA 4S35A 5E9QA 3NHBA 5SZKB 4F5WA 4QWWA 2B94A 2GKGA 5SZJA 4PZYA 4AY2A 2D1YA 4ZEMA 2R44A 3IB3A 4I1IA 2VHEA 4A1OA 4HAYA 4UNQA 4RFLA 2C5GA 2I4TA 1T36A 2WICA 2EU8A 2OOKA 4WN3A 1MMFB 3AVWA 5LBUA 1W75A 3GPBA 4HDNA 1J42A 2Y0BA 5HX7A 5DN6A 1KZ1A 4NOLA 5LBTA 1HDXA 1W36B 2FKNA 4PGFA 2JGDB 3TL2A 1P4JA 3VZPA 2OQ2A 4NYMR 2YIJA 2WAAA 1AOXA 1R50A 3QE2A 4ND4A 4GMHA 3NBKA 1C0LA 4PZ0A 4LGVA 3P71T 4B9EA 5C80A 1WVGA 7ADHA 3KT0A 4XTRA 3SP1A 1CBUA 2ZIUB 4FXOA 3AM3A 2HSEA 4ZT6A 5K0CA 4PX3A 1HDOA 3T1QA 1QONA 3N0RA 3OHPA 5KI6A 3RS9A 3I4FA 3NHZA 5I9MA 3JPWA 2IOQA 1J8QA 3EBLA 1IZ8A 3HLKA 4EY5A 4DILA 4Q3EA 3LYAA 3U4CA 1BQ3A 1OD6A 3ZXUB 1LTKA 4HX2A 1QB7A 1T13A 4DWJA 2C5AA 3FFWA 4AP9A 4I4LA 2PR7A 3HACA 4X94A 1G3QA 5EKUA 1RRKA 4DNPA 3UQZA 5GTDA 4IOKA 1LU9A 3I53A 4LNAA 1NXPA 2C61A 1H65A 2R6JA 1JHAA 2AFHA 3CH6A 2X8JB 3KQNA 1AUXA 4BBJA 5CM9C 4MB2A 5LSAA 4I3FA 5JISA 1RBZA 3E3AA 1N6RA 4RH3A 2YS7A 1D1PA 1QIMA 2VXCA 1HG1A 2FLKA 2ZJ6A 1TGVA 5GQSA 4RDXA 4N9WA 2NTJA 2FSSA 3OQIA 4EJFA 1P2DA 2GBLA 2I5PO 4M88A 5KOIA 3OLQA 4RVUA 3WAGA 3AHJA 3B7PA 3CZCA 5KTOA 4P58A 2VDLB 3E1GA 4JR0A 3TLXA 5EMKA 2QMUA 1XB2A 3QW2A 3HYCA 4Y9DA 1XALA 2HDWA 4EARA 4WKNA 4RS4A 2Z3ZA 1XZGA 2CNNA 3IQIX 5AW6A 4DSAA 1TO6A 3MCVA 4ZC8A 3E2PA 3EPRA 4OY3A 3U7QB 1UPFA 1PGOA 4J0EA 2X9LA 3HSKA 2VP3A 1Z4LA 4I1RA 5DP2A 2YDYA 1HOXA 4QHYA 1I3OA 3G1TA 4JFRA 5JQGA 1K08A 1ZPDA 5LFAA 4QGSA 1X19A 3B89A 2PTGA 4ZU3A 4OI4A 3S2SA 3W9UA 3L6DA 1ZICA 1DCMA 2H6EA 2OG1A 2PX6A 1UFRA 1ILEA 3VZSA 2YR0A 3PPXA 3KE9A 3QFSA 4M7RA 4QDKA 1Y98A 1YVDA 4ZVTA 3RQIA 3CVWA 5FX2A 4FHZA 4HN9A 3H84A 4PN3A 4BKUA 3D0QA 4RSHA 1HKHA 4YRZA 1J97A 2WWXA 4E5MA 1GAQA 1UCFA 1ZOPA 2GCIA 4G84A 4RA9B 3DWFA 4TYMA 1JH8A 1D2MA 1HYEA 1XX6A 4YRJA 5A4JA 2D1FA 4B4DA 5C5DA 1KFKB 2P1ZA 4LQLA 1QZTA 1YZQA 3RYTC 4WK0B 2L2QA 3PLAE 1FF9A 2PZLA 3D3WA 3FRHA 1PRYA 2O8DA 2X0FA 1XAJA 1QP4A 4JI0B 5BSTA 1L7MA 1RLJA 2A1TS 5KDLA 3EA4A 2PO5A 5GONF 1TYZA 1XTIA 1I3NA 2AJDA 2AUTA 1NASA 3PNSA 1KI2A 2OENG 4PPFA 1AO3A 1LPMA 1DEKA 1DJPA 5I7VA 1MT3A 2HSZA 1E20A 5FQNA 4RMHA 1SU4A 1ZD8A 5ALSA 1NIPA 3GWGA 4EHFA 5FBWB 5B2FA 5KYYA 3WYFA 4RWZA 3AEUB 4ZK2A 2B6HA 1IDOA 4ZVKA 4MQ6A 3ETGA 4JR1A 3MGBA 4D4LA 2ZFUA 5EJFA 2IY9A 3N8HA 3EC2A 2VJMA 4I50F 4DCVA 4FFDA 5H81A 4IZIA 4WV3A 1L0BA 2FUG1 3U6KA 4UZEA 4RDHA 3RU3A 4NHOA 1LSUA 2ZJOA 4W1PA 2NZUG 1H1DA 1NI4B 4R9NA 3S27A 2Q4DA 3GNQA 1Q20A 3WMRA 3FCOA 5DLPA 1ZONA 4X90A 4OHFA 4LE2A 2R00C 1VYTA 4ESVA 4Y8VA 5KKCA 4CDGA 4EGAA 3KLOA 3IR6A 3QENA 2WQ6A 3GDGA 1Q7GA 1NVFA 1QVRA 1PGNA 3KBBA 4FOOA 4DBLC 1NHGA 2XJ9A 2ZIXA 3F8WA 4LMPA 3R8CA 1WBJB 3ZW9A 4ECEA 3U7FB 1M72A 1MW9X 3GPDG 2IBSA 2JIZD 1F38A 1FMLA 2VCEA 1W4LA 1LPSA 1H5NA 2J07A 5JPDA 2WAXA 1N25A 2EJCA 2DTXA 4NV0A 1WXEA 2EZ8A 1QGED 2E82A 1KEUA 3HDTA 4QIHA 1E3SA 4QDOA 4XM0A 4HD8A 4B3MB 5BQOA 3DMGA 4DMKA 3PHHA 2YZ2A 3O7WA 3S2FA 2BFDB 4JC4A 1QR6A 2HA3A 3IV7A 4E08A 3C3KA 4HLQB 4I9UA 1OJLA 3HWRA 3M82A 1P3Y1 2O5CA 3H87A 4OOFA 1OWMA 1YC5A 4LJ9A 3N3BC 1R3UA 4TRJA 2FFQA 4EFLA 2BFOA 3ED5A 1ZLXA 3LA6A 2NXEA 1K5PA 2JA2A 2HDOA 1Y4SA 3T7KA 3N0TA 1R0RE 1GGMA 3ND7A 3GLVA 2WU0A 5EMJA 4L0MA 2VHYA 4M6WB 1N33B 3GCDA 1WAMA 3OP4A 1RPNA 3Q15C 4IIYA 5IVKA 3UK0A 4UHJA 1GA6A 4B74A 2LNDA 3KZMA 2P9BA 4D9CA 3KOMA 1A8HA 2XD9A 1KZ4A 2VAVA 4NS1A 5JNTA 1G3UA 2GDZA 4PBTA 4MV5A 3ICWA 2H2AA 2DHCA 4C5AA 1N34B 1LNQA 3EK2A 2Q3CA 3QRWA 2Q3JA 3F9IA 4WVLA 4BNTA 1VL8A 2B8NA 1I7DA 3KLBA 1MPXA 4Y2HA 3V46A 3W4KA 4E2XA 3CQ9A 3LXXA 3S44A 4HVLA 2P2DA 3O03A 4CM3A 3JYPA 3ZE0B 4DJAA 1CUJA 1BOOA 1X1QA 5FBZA 4ESEA 2OVBA 2AOUA 3KR1A 3THWB 3RS8A 3GGOA 1OWPA 1YKSA 3LHSA 4KDEA 3NKLA 1USIA 1ZR4A 3HCBA 4RQUA 4NBWA 3GDWA 4W6ZA 4EG0A 1DTEA 1S2LA 2HPHA 2NZ8A 3QX7A 1WP4A 2UZ1B 1BMFA 3TLBA 1DHRA 2E2WA 2WJHA 1KFJB 4D9EA 4IJQA 2PZJA 3AHIA 2AC2A 2XKBA 3H86A 5LIRA 1UF9A 3M70A 3OZ7A 2PR2A 4PAMA 4GPBA 4C2TA 3KOUA 3HUFA 2Q6IA 3NHSA 2R8OA 5CB0A 1C9DB 4TL7A 1KI9A 5JUWA 5L45A 5J2TB 3E05A 4U5QA 1NRJB 2BISA 4MRMA 5FOWA 3DD5A 1CJBA 1A4RA 1R6BX 4LNUB 1QHHA 5IAGA 3LQ4A 2C20A 1U6KA 1O97C 4H1TA 3V33A 4UUPA 4CEJB 1GPMA 4PYQA 5CIWA 5G0UA 1Z6TA 1YZYA 3IUJA 3LLSA 1DAIA 2C1ZA 4P33A 2C7BA 4TX1A 3BILA 2Y1LA 3LRTA 4J6FA 2JLVA 3BWDD 1RM5A 2H48A 4OAOA 3QVTA 5DW0A 3VU3A 1S8FA 4ZYXA 2QZ4A 5ALEA 3HJTA 4HS4A 3OOYA 5CX4A 1IE3A 1ML4A 1V5GA 2YVQA 5AHRA 5TX7A 3T61A 1TVEA 2GYWA 3OLCX 1ULUA 4Y98A 3KYCA 5EZYB 1BH2A 5HM6A 2WU4A 5BPFA 3CNLA 4EG7A 5LNK6 1JHUA 4N5IX 5B55A 4ZZ3A 1CRPA 1WXFA 2I29A 1Z6ZA 2OZPA 4AUKA 1O6FA 2XCTB 3GNLA 3UJ7A 3VPDA 1OPRA 1MO5A 1NRXA 1Q1ZA 1CRZA 1PS8A 3JV7A 4PRLA 2Q6VA 3FOAA 1XJQA 1VRWA 4XGKA 4LRQA 1W5FA 2WWIA 4YP7A 1U2SA 5KUTA 4ZI7A 1P18A 2CHUA 2BFFB 4R69A 4F21A 2VG8A 4HAOA 4L74A 5HK9A 1DIOB 2YWGA 2R7KA 4ZAGA 4PHTA 3L8GA 4BJ1A 4LYHA 2VXOA 4RZXA 3ND6A 4FGZA 2JG3A 3HRIA 2JHAA 3LC1O 1RJGA 2DQZA 3H1EA 2NUAB 2WF9A 3WZ2A 2ZYUX 3RC8A 2XA2A 4CCSA 3EOBI 1DO2A 1ND5A 3BB4A 4GMKA 4AJEA 2Z8YM 2DBQA 1MRSA 3KZKA 3QM1A 3ZV5A 1SVMA 1B8PA 2H92A 2VUHB 3PX3A 3V48A 4B44A 5JMTA 5K5EA 1I51A 2IOFA 5ALYA 5M29A 3WBJA 1TO1E 4X61A 1ABFA 2H9AA 2Q5IA 5BV2P 1O97D 3RC2A 5IC4A 3E18A 3PDIA 1EUCA 1YQWA 2VSXA 3E82A 3OHMA 3NNNA 4N9QA 3SZ3A 3WMXA 1JB1A 2JFUA 5KVQA 3HCAA 4MIEA 4B76A 1QNLA 3FDFA 5CB6A 4GP9A 9MHTA 1BX0A 4UBOA 4MQBA 2NWQA 5LCXA 1RCTE 1WUKS 4NBKA 4PFKA 4EO4A 3LTNC 2OQRA 3ZHYA 3A27A 4DRZA 3LG2A 4JYCA 2J9ZB 1QM5A 1IHUA 1KU0A 1O94A 3DTTA 3HKEB 4NOJA 2YWXA 1GFWA 4X71A 3KQVA 3MQFA 4Z1MA 1FTGA 2LZ0A 5FJIA 1D04A 4V03A 3BRWD 1U0FA 5DRTA 3BMCA 1XA3A 2PMEA 1WVMA 2X19A 3F46A 4GICA 2VL7A 4C4ZA 1EHYA 1LGYA 2B92A 2OV8A 4KIWA 1SKYE 5K6TA 5BN5B 4FBGA 3BG5A 1GA4A 3OEWA 3V8QA 3CRNA 4LGYA 3WYBA 4OYLA 1O87A 3E58A 3OEED 5EP2A 4CF6A 4DAOA 4IIXA 3AJRA 3HCCA 3IURA 1Z22A 1UIRA 3ER8A 1CVLA 3JALB 2CBGA 3KZCA 4RABA 3UAZA 4I6JA 1RW4A 4Q93A 3L40A 5JWHA 4OKSA 3T1OA 5J1SB 1IN4A 3ZHRA 3ZIDA 4G6ZA 2P9FA 2AOTA 3A4VA 1ZN7A 4YO7A 1IN6A 1FS5A 1JQ5A 4X8OA 1TKRA 4ZHQF 2ZB4A 1BFUA 1A3CA 2J9GA 3IE0A 3SDBA 1HDIA 4B35A 2ZUEA 2J0EA 4H77A 5AFSA 4I3GA 5JW6A 1V1RB 3KBOA 2PT5A 2HREA 4WZAA 4BMZA 2ISSD 3CWCA 3G85A 1U0RA 4DUGA 2FCRA 3FPHA 2HKIA 3ND5A 4IG4A 5T6BA 3GNSA 1C7QA 4HQ6A 5I9LA 3BTSA 2NU7B 1QQ7A 3CLUD 3E9QA 1EIWA 1Y5RA 3A28A 4F6LA 3AEKA 1LZLA 3LW8A 1QYRA 4CU5A 4FDTA 3BZUA 2E7ZA 2Y1FA 5AVKA 3BCUA 1JXAA 3MJHA 5LXTF 5SY4A 1E1KA 1RZUA 2FWIA 4L27A 3NI2A 4IVQA 5TMEA 3BFJA 3TR5A 3JX9A 3RRMA 3BJEA 3GH1A 1EYZA 2M6LA 1U6JA 4W5OA 4EO9A 4W9MC 4PYLA 2ISQA 3N2YA 4NJMB 3RG2A 2RGWA 1EK1A 5DHSA 5KJEA 4E5NA 1GD1O 2ZXEA 2OPBA 4PZAA 5D7NA 2VNHA 4RE5A 1A7JA 2EYUA 2OGZA 4HQFA 5EZSA 5K8LA 1ZM4A 3RC1A 4DLNA 1IUNA 1N0WA 4M86A 2E4ZA 1KI1A 3GXOA 3M1YA 4FZJA 1NYQA 721PA 4IPTA 2O19A 3IMFA 5DSTA 2ZP1A 2R1TB 4G97A 5AVVA 3QELA 2FZWA 2PUFA 3V5NA 2ZUDA 3PGXA 3EQ7A 3EPKA 2A84A 1OH5A 3EE6A 4N0MA 1R88A 2XDYA 1UXKA 2HA7A 2C54A 2WKRA 3D8UA 1P9LA 3V2UA 2ZVJA 4Y6GB 1ZJJA 2EP5A 2C9BA 2WMYA 4GE3A 3O1IC 2CLKB 4A2PA 1N2BA 2CXRA 3MLBA 2CLDX 1USKA 5K0JA 2QUIA 3PRKE 1JAZA 3IKTA 1E6EA 2VP4A 4O0LA 3UJ8A 2ODQA 4KH1A 3T5AA 1G2IA 2C7QA 2PKYX 2Q7DA 5TVKA 4LWPA 3SBXA 3TGWA 3SWWA 3B82A 3EZ6A 4BLPA 1J8YF 1OHHD 1RM0A 1Y4AE 2KE5A 3NHLA 3F3SA 3DL7A 2QZZA 4G5YA 4QATA 1XZEA 2OY0A 4YMVA 5AVYA 5EWMA 1I2ZA 3NDIA 4ZO7A 1P8AA 2VSYA 2A1UB 3AB3A 1O6ZA 5DM60 4LY9A 4CEHA 4PWYA 4IKOA 4XYLA 2VUUA 2VUIB 3KDAA 2G9UA 2P5SA 2NM0A 4K0RA 2DSTA 1R7RA 2FPUA 3ESAA 4OHVA 4E5SA 3QTBA 2IHJA 1E6WA 1VJCA 4ZCIA 1CIVA 4ZICA 4DV2B 4ECAA 2Q3DA 5HRAA 3SC2A 1S7GA 1R0SA 2FMHA 3AFHA 2IYUA 5KC8A 1CQZA 1U7OA 1KE2A 1X7WB 4H0NA 2YWRA 5BQFA 3A4YA 1KK0A 2O50A 5FA5A 4C78A 2GEUA 2IYNA 1IBCA 3BMXA 2Y3IA 4INAA 3HN6A 2PGOA 1GWNA 1UP4A 3H2KA 3IPYA 4ESOA 4EY8A 1K0UA 2C1XA 1P3DA 4RS3A 2IPXA 1ZUNB 3FDIA 1NVUQ 1F48A 3PQCA 2XWSA 1DAPA 3LUJA 3Q6IA 2NT4A 2PRKA 3QFTA 3RW9A 5CJJA 3L3BA 4IDFA 4HUQA 3VOBA 4ZGBA 1PCXA 3PR1A 3GJ7A 1T15A 4IIBA 4NU6A 4EJ2A 4MDEA 3V9PA 2NO1A 4EHLA 2F3SA 3BULA 2UV8A 3ELYA 1V35A 2FN4A 2SICE 1KJZA 3ZXIA 1M3SA 4OP1A 5KVSA 2X2FA 2CLIB 4LCEA 5KOYA 4HH4A 4Z4QA 1TB4A 1FFXB 3W06A 4BVAA 3V2GA 3WRXC 5CDFA 2X76A 4NNOA 3QVSA 4ZCTA 2HBQA 1USWA 2L18A 1R10A 4IMIB 4ZEXA 2XRMA 2P11A 2Q1XA 2YCLA 3UBMA 3QZUA 3G6WA 5G3ZA 1PJBA 1IBKB 4N3NA 3VNAA 1XIVA 1NQVA 2ZEJA 3MTJA 3NDRA 1QP0A 2LD4A 3W0LB 1NGSA 4C89A 5BOVA 1TZ2A 3EXG2 5ESDA 1FFCA 2OCKA 4G0XA 4R5HA 3X2EA 2ACEA 3ZTYA 5GOZA 3L0OA 1LCIA 4WEOA 2VP5A 2BCJQ 4MPRA 4W82A 4MQFB 1FPMA 1MR3F 1N2JA 1NPDA 5IP5A 5SYMA 2BAGA 2FSIA 2H1WA 3T0FA 2HQRA 4R8VA 1C3XA 4M9UA 1O0SA 4C22A 2J59A 2W48A 2JGRA 1NXQA 2Q4OA 3KEQA 3RR2A 4EUSA 2CXOA 1QCYA 1ESMA 2WILA 4UHBA 1MG5A 5EHXA 4LOJA 5KJ6A 4UNPA 1GZDA 2FG6C 4IIUA 4QFBA 2JCVA 2XXBA 4QQKA 3VX4A 4HT3B 4L5BA 1Z8FA 2QX9A 2XCOA 4XI9A 2WM3A 2ZR9A 4LRYA 3KLMX 4ZT4A 1VA5A 1MOQA 3K0SA 2XPCA 2NU8A 1E7YA 1JI3A 4M7WA 1LDYA 2GXUA 5CA0A 2C9ZA 3W3AH 3O3CA 4ND6A 1OILA 5CP8A 5TARA 1X7XB 1AV6A 3PUWA 4BO7A 1WA5A 2W9XA 2HB6A 1RSZA 2Y8EA 4AG5A 2BRUA 2PU5A 1FU4A 4CM5A 1BS2A 4LZOA 4HMPA 1NSYA 3OZIA 3DSRA 2NTYC 1C9MA 3AFNA 3REOA 2I6FA 4BV3A 5MN4A 4FZ5A 5HTKA 5I47A 2IXAA 2HBZA 4NDAA 5SYNA 2JCBA 3LNCA 4BBPA 2FETA 2W6OA 2Z2ZA 2PMDA 1NU8A 1D8AA 1QQ6A 1T2AA 1THMA 3WI7A 1OLSA 1QYVA 2C4UA 4NH4A 3G0BA 2OV4A 4QDXA 1P4HA 1W5BA 2GK3A 3C3DA 1QHFA 4CHGA 4M1MA 3AKCA 1VSTA 5EA2A 4UTPA 1NLUA 1T8RA 3DTVD 4IY1A 4AROA 1NBME 4Q1BA 1RI3A 5T6MA 4HAIA 4IDOA 4AY3A 1OZFA 5FOSA 4W7HA 5AKZA 4B75A 4BUCA 1OGIA 2QKYA 4ENWA 3ZXSA 1DKOA 4LG1A 4Q4AB 4QXPA 2ODTX 4KMSA 3THSA 2P1DA 2YY6A 2CN1A 3I61A 1VPLA 2CKDA 3EOZA 1N9GA 1U5BA 2IODA 4CQNA 3MWDA 5E1DA 2J0SA 4G07A 1RFGE 2B5OA 3D8SA 3UO8B 2J8ZA 4MRNA 3ZUGA 4F4HA 5BYAA 1TTTA 4E5UA 1HNZB 3R5TA 2MDTA 2NGRA 2VSNA 3NASA 1F8YA 1J9ZA 4PLYA 4L8FA 2COKA 2G04A 3LHIA 2R8EA 1CU1A 2BKUA 3WLKX 5BR7A 1E3WB 1HDCA 1ZVKA 1IY1A 5AKEA 3V1LA 1FYEA 4GNKA 4C03A 2ZQ5A 3RAEC 3QYFA 1X8JA 4L85A 2CXUA 2YJ5A 1D0VA 1UDRA 3IAFA 1P45A 1W0JD 3MXTA 3RS3A 1T4MA 1T0JB 3LUPA 1OW3B 3EXHB 1RXCA 4EKEA 4NJEA 4Z0HO 4BVBA 5LMZA 3RWBA 2PY6A 1VHWA 2Z8YA 2BGNA 2IEZA 3E1SA 1SUWA 3Q2OA 4BLUA 5C3MA 3AEZA 5A7HA 2ZM5A 1XTUA 2AE1A 5DK4A 3CEHA 3G1UA 2R751 1LW7A 4TMXA 5CB4A 3A58B 5CA1A 4CUZA 5I7UA 3OZCA 2NV6A 1UODA 1EGHA 3OZUA 2WKPA 5KNLA 2GHQA 3HVHA 4ZN6A 4RH1A 3I2KA 5CDUA 5GJBA 4GF5A 2BFMA 2IEDA 1AS0A 1C0EA 1Z88A 3ENKA 2PEZA 3MCAA 4XQEA 1HNNA 5ICMA 2RGYA 4J1TC 1XROA 1B1CA 1ZH4A 4ACAA 5ENDA 4YRSA 3I9KA 1SVUA 3AINA 2HXYA 1WD7A 3BICA 1C3LA 1NPTO 1P77A 1TIPA 4OMFG 1E9BA 5KREA 3PEVA 2LBPA 3GLHE 3MJFA 3X1MA 4JC8A 4ZI7F 1LNSA 3EGIA 3OTQA 3MD0A 1BS1A 1FEZA 1XLVA 1KETA 2QL7A 3D1JA 2A7QA 1ESZA 5D86A 5CNIA 3K8OE 3KYIB 2C29D 3ILHA 5AKGA 4ENSA 1KDZA 3M7IA 4C0QC 3P27A 4X6LA 4L9WA 5L53A 1SKQA 4CR6A 4CTKA 2I34A 2I65A 2YZNA 1COWD 3LVBA 3IODA 2NV2B 4Q15A 3FYDA 2IOHA 4FS3A 4I9FA 4HGNA 3N2GB 1KR2A 2C2GA 1YZFA 1A8UA 3QA3E 2WTNA 3W34A 2R7NA 1FVFA 4S12A 3JU3A 4W1RA 2DWCA 3JQAB 3WMWA 4O2LA 3MWJA 1A2BA 1T9BA 1TT5B 3CRZA 3SDZA 4KQFA 3SQDA 2BTEA 4GH5A 1TJPB 2C7GA 3AX6A 3DOIA 3CGGA 1QQTA 1Q0ZA 2RI6A 3SBEA 1MX1A 2O0LA 3F5FA 4HH0A 3QKSB 3RGWS 2YWFA 4FMPA 2TRSB 3OQBA 4NZ9A 4K6KA 3O74A 2YZKA 4GX1A 4OPMA 4G8BA 4MUKA 4YDHB 1XRNA 3VHXA 5JDCC 1FS4A 4KBFA 2H85A 1CR6A 2HT6A 4MVJE 1KE1A 4U4AA 5LQMA 1QYDA 2DLCX 1EP9A 4KE7A 3NIWA 5JD6A 1K98A 2CHEA 3AHEA 4YMGA 1A9QA 4Y1RA 3IELA 4GIBA 3RFTA 3V80A 4KZKA 2JH3A 3GC6A 1QBKC 1E9AA 1E89A 2GWRA 4JBXA 4V24A 2YJZA 4CQLA 3BL5A 3R76A 4EENA 1I1NA 3BSYA 4MS1A 5JVDF 2JB9A 2B3DA 3A3PA 3JAKB 4RF3A 3QEMA 3JD1A 3BSWA 4FYWA 3B1ZA 4PQEA 5KIAA 2DOKA 1PX0A 1JIUA 1LK5A 1H0KA 4BV9A 4FONA 1PR5A 4Q1EA 4P3OA 1NOJA 3CH5A 4O33A 4EHBA 1CUUA 1NVTA 1XD9A 4OH1A 4KV9A 1B76A 1YR7A 3R7WB 5BORA 2RSLA 1QTIA 2NAPA 1QKKA 1VCNA 3CT6A 4IKEA 4QBTA 4WDRA 3V34A 5BO5A 1E7RA 3EZFA 1UBNA 5IABA 4IF4A 4WBSA 3T5CA 4QYIA 3UT5B 5EJGA 4JVMA 4F6RA 3GVIA 4Y6OA 5DYIA 5C34B 2BKEA 3SF8B 4YLGA 2FFRA 3VMFA 2FFJA 3A7EA 2XE7A 1E58A 4K3UA 4UHFA 4WNAA 5GV8A 2A9OA 1TF5A 3HJRA 5D85A 5FCDA 3ZBTA 3FKJA 3IAEA 2JHFA 4HNQA 3PC7A 3LBHA 1DRKA 1OYVA 2FPSA 4FDAA 4UEJA 5AVUA 1KSHA 2I2CA 3R3YA 1ECGA 5CM8B 4KQKA 4D8XA 3ZWMA 3FGNA 4EMSA 3O75A 3KVNA 1X74A 3WVNA 3BDAA 2C4WA 4JGIA 3EDRA 2XMQA 4CTNA 3MRVA 2J5KA 1I32A 1CS0B 3OA0A 1R0WA 4HWTA 2ZZKA 1RWKA 3VPCA 1L8AA 2J46A 2PSDA 1ZH2A 3ZE1B 1Y33E 3NORA 5TQ0A 3A2MA 4BFVA 5JAPA 5ERXA 1VE3A 5IKEA 3L4BC 5FWAA 2BEKA 2A94A 1YA8A 2HSWA 3INGA 1N1DA 1C8KA 1HFKA 3FRJA 2RARA 2XUKA 5AICA 3PGLA 4E31A 3A2LA 2BN4A 1HZZC 3IA7A 3SYRA 1LY1A 3EEIA 3QXGA 2I1WA 2VYND 2GN8A 3TW0A 4LIPD 1L1FA 4DSUA 2HX1A 3HA2A 4KQEA 2B99A 2I3ZA 1TIBA 2Z3VA 3OUUA 3OLWA 3PYMA 4NNJA 4S0ZA 3NHAA 5JYCA 5AVXA 1POWA 1PF7E 3PE3A 4IJ6A 4J7XA 5EXXA 4YXWD 5I7HA 4G63A 4J16A 1CUFA 2OBYA 3LXUX 3ZWWA 3V3TA 1YZUA 1PTKA 5ALPA 2ZAIA 4D81A 1T5LA 3W5AA 2XQGA 3OJLA 1MG0A 1YIAA 4TVKA 1X9HA 4MWBA 2HU5A 3QE0A 1EXDA 1SXJB 2VXBA 2XD4A 3PHBE 2O2GA 4KI0A 5DZSA 3VPAA 4WXRA 3P9YA 1TZCA 3R0VA 4M89A 5F33A 3OQOA 4BHTA 1N2GA 3QWBA 1H5QA 4W8OA 5T3UA 3K71B 2RGEA 3PC8A 1RLIA 1QZUA 1IXSB 4C4OA 3ELWA 3H2IA 3CMCO 4PZLA 1F2TA 4OUKX 1OAKA 1WU7A 5J4YA 2AD5A 1UOPA 1VBFA 3A05A 5CW2A 2P9ZA 2J87A 3JARB 4Q82A 1RYFA 4OM8A 3DKKA 2GS9A 1P7PA 3N59A 3TQTA 2CJPA 3WGKA 4A91A 3PICA 3DBIA 3BXGA 3N9IA 4FSHA 2OXTA 1V6AA 4UVGA 5C3UA 1TM4E 3DG9A 3IS3A 2ATIA 4YP0A 1E6CA 1FA9A 2CMGA 2PYDA 1V7PC 1KK2A 1Y34E 2D8MA 2AK3A 2DCUA 4N54A 4RHEA 1YOVA 1JUDA 2ZYTX 4Z0NA 4CQMD 1YB7A 2ECPA 4ENQA 5DBHX 3UXHA 5B7GA 2WIKA 2VZLA 1QAMA 4A6DA 4CM1A 3GK3A 5GZ1A 2HFKA 4BP9A 2EJTA 2BE9A 3A7DA 1Q7EA 1CP3A 3L77A 4TV8B 4UFOA 2MJLA 1ULAA 4H6XA 4EKYA 1GAEO 3VVLA 1CQXA 2XH8A 1LSOA 3WWPA 2QNRA 5TT1A 1KIAA 1SHZA 2A92A 4GLOA 4TTRA 5HS6A 2O8NA 1N4AA 1FP6A 5BOSB 3MB8A 2YJTD 4GOKA 4RFSB 1NAHA 4LZPA 5A9RA 1G4UR 5CXUA 3OCXA 4JQOA 3KAKA 4LZWA 1VBKA 1X0VA 3NWEA 2PD3A 5EYPA 3ZY3A 1E6LA 3PNBA 3U40A 1GV0A 3QITA 3CH4B 3MWEB 3IPAA 4QVGA 3GWZA 2HD4A 4Y1EA 5FDFA 4DV5B 3I6IA 3BK1A 4NQZA 3ZZMA 2ZULA 1H4VB 2EARA 4MICA 5LQUA 4B4WA 2QRVB 2H8GA 1LC3A 3ZWBA 2AVNA 4BLRA 4G81A 4DQUA 1EVKA 2G72A 2J5BA 5L3VA 2RCYA 3OLZA 4V39A 4MNTA 3B38A 3EQ2A 3U4DA 4ZRMA 3W5HA 2IK8A 2FPLA 4IDDA 5JADA 4X6XA 3AVUA 1NM5C 2I7DA 2INGX 3CS3A 3D2AA 1RWPA 2FFHA 3FPLA 2NT3A 4XH9B 3EPHA 2O2CA 3P97A 3HZZA 3QYJA 5FI1B 2NZXA 3VH2A 4K9PA 1XN1A 1PV2A 2BGRA 2C04A 4TXMA 3BD7A 1NDQA 1BU8A 1J23A 5B53A 1AA6A 1B0PA 2F64A 2GOYA 2HK9A 2UYOA 3I5AA 1NQXA 2P77A 2J1LA 3O1JC 3RAPR 3W1VA 1T9DA 4F1WA 4OX9Y 4EFDA 3CLRC 1DXHA 2W2OA 4F5DA 1JIXA 3QI2A 4HDRB 4V2UA 3OM0A 1Z08A 4U2GA 1DMRA 1JI0A 2L0XA 4BO9A 5AVWA 3OKFA 3F1LA 3MSCA 4M22A 1ABEA 1D2RA 3FTCA 1NZJA 4RZ3A 4EJSB 4IHKA 3MIZA 4LJKA 1T9KA 4G1VA 1YBMA 4HLNA 4HEA1 3RD5A 1MO2A 4JUDX 1GTL1 1PSZA 2PWBA 1QE3A 3H83A 2N42A 1BKYA 2V9PA 3P2OA 3ELDA 3X3HA 2DF8A 2IHKA 5K3OA 3UAVA 4AX4A 3BM5A 1JDUA 4MQ4A 1CDDA 1PEKE 1SCAA 2X8LA 3AZOA 3OX1A 3ZKWA 2XAAA 4YDSA 3ZY2A 3GFTA 3AHHA 3OOWA 4CTJA 5KYXA 3STTA 4AY6A 1POXA 2NIPA 4NCJA 1M76A 2N0SA 2X9VA 5AK6A 3GLFE 4LF5B 1Z4JA 1P81A 1SRRA 2FX5A 4KW7A 4L51A 3I9JA 4NYIR 1JEYA 3B1WA 1YL6A 3MOIA 4TYQA 3O73A 2IYAA 1N5IA 1PHRA 3BK2A 3LV8A 4BUJA 2PT7A 2DWQA 1ZL0A 4CLOA 1ORWA 2JGEA 1ZWLA 4XVHA 3LC2O 3DEYX 1KDRA 2JAPA 1Q7CA 3SHVA 1JA9A 3QYAA 4LOAA 5E6UB 2AMFA 4EYGA 4QZVA 3VKVA 3GAFA 5A5DA 1Y80A 2Q29A 2PQMA 1F8XA 3RSHA 1KI8A 2OG2A 1RXEA 1M5RA 2GZSA 2BMFA 3LQ1A 4JOSA 1RWVA 2D1TA 1JKJA 4YAOA 3C41J 5DX8A 3ZWYA 2JCYA 1RQ2A 1K7XB 4A16A 3N2LA 2Y93A 4J49A 1YJBA 1MIOB 2PKEA 2EBUA 1X1TA 2MU1A 1N2CB 5FV7A 3VBCA 4II7A 1M7GA 1DQNA 2MCFA