4J29A

Crystal structure of engineered protein. northeast structural genomics consortium target or258.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
127
structure length
127
Chain Sequence
b'TVVIVVSRDERILEELLEVVLKSDPNVKTVRTDDKEKVKEEIEKARKQGRPIVIFIRGATEEVVRDIVEYAQKEGLRVLVIMVDQDQEELERIYEQLKKDGVDVRVTDNEDEAKKRLKELLEKVLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Engineered Protein OR258
molecule tags Structural genomics, unknown function
source organism Synthetic construct
publication title Crystal Structure of Engineered Protein OR258.
rcsb
total genus 48
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4j29A00
2LCIA 2MR5A 2LR0A 2L82A 2LVBA 2MR6A 2N3ZA 2KPOA 5GAJA 2LV8A 2LTAA 4J29A 2N75A 2LNDA 2LRHA 2L69A
chains in the Genus database with same CATH superfamily
4IHAA 1VBFA 3A6GA 1XTRA 3JRXA 3AUUA 3DNFA 1KEEB 3D1LA 4PE5B 4F12A 5K0SA 1UZUA 3RGWS 1RHKA 1LRKA 1PZGA 2FXVA 4FR2A 1HNWB 2KW5A 1PR5A 3KV3O 3STUA 3WGGA 3NEJA 1QANA 1TTHA 2Y6VA 3WBFA 2PKXA 2Y8EA 1W19A 1Y98A 1TUBB 1KF0A 2M6RA 4ZVRA 3RVMA 3SC6A 3VNSA 3VNBA 5DWQA 5B2EA 2DPHA 4R2MA 3CGGA 2JASA 1JJIA 5EE0A 4IDCA 1NIJA 3QKSA 4M9XA 1K7XB 2H2AA 3VUEA 1NATA 5JS7A 4L28A 4K6MA 2GJSA 3G85A 3IH5A 3QVWA 5CPFA 4LMPA 2VUUA 2P91A 1YGPA 4PU0A 821PA 3T1OA 5C3UA 2Y1EA 4WFKA 2AI3A 4M8LA 3ONEA 3QITA 4P3YA 3WGHA 4HWSA 1JWLA 5CVEA 4BPBA 5AESA 3BFKA 4JAVC 2V65A 2XSZA 4HAZA 4IMPA 4RZXA 1YFJA 1MKYA 1SH7A 3AW8A 3OUTA 2BZ0A 2Q6LA 4R6XA 4TXNA 4DR2B 1J4AA 1DX9A 5M2QA 4I6JA 1Q0UA 3IP7A 1M6VB 1EAYA 4E09A 4LJ6A 1NNI1 2X9VA 2ACEA 3PUYA 4NP6A 3T4PA 3ZY3A 2BBTA 1U8EA 2WILA 3PSHA 4U4AA 5BYBA 1IY0A 3CLUD 1TKBA 1CJUC 3HCWA 3QA9A 3HL0A 1Z37A 3BTUA 4BKMA 1T43A 5LXTF 4EH1A 2Y1GA 3OPYB 2C8VA 1AF7A 3TR0A 1P2GA 4NS1A 2GBFA 1JIXA 2BISA 3T3MB 2L82A 4ZU3A 1KMCA 3OD1A 3AETA 1V5EA 1XZBA 1AKMA 1JVNA 3H11B 3WNVA 3KXLA 1G9TA 3EMBA 3IKMB 3EHDA 4BE4A 4MVXA 5HILA 1EDOA 2W58A 3BERA 4MOWA 5IUKC 4WPGA 1WZEA 1ZAKA 1LBTA 3EXAA 4FS8A 1TO1E 4J8PA 1ZOSA 2DECA 4UARA 1YU9A 3U4GA 1TM7E 1QE0A 4NYMQ 1RC1A 1V96A 2E9SA 4JLWA 4QHYA 4YREA 1YL7A 2B8EA 2PSFA 4K9LA 4CMKA 5FA6A 4DQUA 1PGNA 1RM4A 2MINA 2CHFA 3LZCA 4JLJA 1A2OA 3EEQA 1P5HA 1OROA 4G2NA 1RJDA 4MUBA 4DLTA 3TX2A 4RTJA 5A3RA 4W4TA 1NQWA 5LZ8A 2GOYA 2GHQA 4YUXA 2BCJQ 2FA9A 4I8XA 3V55A 1U0BB 4MV6A 3THYA 1CDEA 1L8LA 4YJ3B 4IBOA 1ZOOA 2IP2A 3DCIA 3KSUA 4QE3A 5CB4F 1T9ZA 1RBQA 1NDHA 4GXTA 1UXKA 5BQXA 3E1KA 5KSYA 4RDXA 4O4LF 5HDQA 1Z74A 1ULHA 3HFSA 4DDVA 3O47A 4IG9A 2HRQA 5C34B 1VIYA 2ZIXB 1QZZA 3EDCA 4AO8A 4MV5A 2ES4A 5LQMA 1OC4A 3NVKI 5JY1A 1OYWA 1C9EA 3AVUA 2OVFA 3AB8A 1A8HA 4GD3Q 3JQ9A 1V5WA 4HKTA 4HFNA 3DL4A 4N6GA 1ZINA 2HF2A 1V1RB 2WR8A 1S8OA 1Z2AA 4EB6B 1IHUA 1YFKA 3W8FA 3KYCB 1BXZA 2R47A 2EKZA 4JVSB 3MGBA 1O97D 3ZHOA 1XTSA 1IQPA 1ESEA 4EW1A 3RJ9A 2GLUA 5AW3A 4RKWA 5E2AA 4D96A 3LIPA 4X61A 3R7DA 5K8JB 1FTSA 3DGFC 4ZO7A 3VO8A 2L42A 1T1EA 2QOEA 5DBGA 4BB9A 2QN8A 3I8SA 4DXDA 1MC8A 1MQAA 3SX4A 1Q22A 2AF4C 5LC1A 3USZA 3V4OA 3W7BA 2B9EA 4R2HA 1ARZA 4R2WA 4B47A 1CRPA 1RABA 3VR4A 2FPIB 4G0VA 1N2BA 3LM8A 1I94B 1OOEA 3X2EA 4A8JA 1ZCBA 5COBA 2HSZA 4AF8A 3OFNA 1H85A 5ES4B 5KYUB 2IV3A 3UEOA 1I7LA 1PZEA 4EFKA 3RT7A 1BA2A 4AK9A 3A4VA 3VU9B 2IIVA 3GAFA 1SU6A 4HLNA 4MSUA 1FJXA 3DVAA 3NHFA 1BGWA 1Q14A 1P2SA 4TWIA 4ABYA 3U4QA 4OIFA 1C9YA 2OL4A 3FNRA 4IEFB 5KTTA 1IHOA 1SPXA 4GT1A 4JOBA 2IH2A 2DB3A 2VDMB 4LV6A 4A8TA 2KPOA 1Z07A 4MGEA 4QHTA 3K8QA 4EK9A 5IZCC 3MTAA 1P60A 5K0FA 1VFNA 3S81A 1YR8A 2A1UB 2A14A 3IAM1 4PLPA 2GCNA 4QGHA 5ARBA 1NLUA 2OQ2A 4E7OA 4WWHA 3X1KA 5DEOA 3Q4GA 2UDPA 4HWKA 1TFRA 3PXEA 3SIWA 4AC9A 4ZZ3A 5DM4A 4YAOA 1X1SA 4C4PA 3FVTA 3BXPA 4ZDWA 3IQXA 2XXAB 3GGOA 3KWFA 3HKDB 2IBMA 4YAGA 1WXEA 4XD2A 1JDNA 5HK8A 5TQ0A 2NADA 3TLZA 4D8YA 1WZCA 2NM0A 1GUFA 3OE4A 5ER9A 4HC4A 2GCPA 4RH0A 5JNTA 5IC5A 2NSHA 2QGNA 2PRYA 3H5VA 4UULA 1SGWA 4AJ9A 4ZGBA 1VXRA 3OIUA 5FV4A 3VTZA 3OQIA 2IYOA 4MYDA 4QQ8A 2HIAA 5JTUA 4A26A 2Q7DA 1GUAA 1XIVA 5BY2A 1Z56C 3FHTA 4IDEA 1ZP6A 4G8CA 3RARA 2RKOA 1SG6A 1URPA 2FQYA 5ANRB 4JLBA 2QTAA 3FCSB 3UT5B 1NWCA 5HUQA 5KVVA 2VSQA 4UPVA 1H1LA 1L8OA 1XQ1A 1BDIA 2K6GA 2AF3C 5JNVA 2AW3A 4RHTA 1AE1A 5AW2A 2ZI9A 1Y1SA 2F3TA 2QG6A 3GJ3A 4U0KA 3GJ7A 5AR1A 3SSOA 3IEKA 1B8PA 3UXHA 1GYRA 3A6EA 1WF6A 2B4AA 2ZR7A 5IXSA 1KZ4A 3DZFA 2JLWA 2JLCA 1LDNA 2J9ZB 4OPMA 4KGZA 1RYZA 2P8SA 3OCVA 3A26A 4UEWA 3I9LA 3T7SA 1I5EA 1M6NA 2WPNA 1VYUA 4PPFA 2QBYB 5FPSA 2QKYA 1A2KC 2XMGA 2H0RA 1E0AA 2A7XA 4B17A 4E5SA 1RMQA 3NH9A 3MMXA 4BO9A 2YW9A 1U98A 3GFFA 3MJCA 1QFYA 1XNJA 2RGNA 1LU9A 3FYHA 4J9UE 3O8QB 4PCLA 1K7SN 1E4EA 1NJ8A 1IY1A 1XEWX 5TPZD 4C3VA 2QPTA 1PE0A 4FQ8A 5AVWA 2EWVA 2N1MA 1G5QA 3WGNA 3RYFB 3QXXA 4ASUA 2GLXA 3E9MA 3DZJA 2P35A 2B7CA 3FG9A 3R5HA 4MWTA 1YR9A 2DH5A 3Q2OA 4CLRB 2RGBA 3FSJX 1W36C 1F51E 1HDEA 2BY4A 1EUDA 1RXSA 1Y8RA 2ACKA 3GUZA 2X76A 1G8HA 3FBTA 3OFND 2Q07A 4X1YA 3HI6A 1HH4A 1Z6AA 3DOEA 3H5AA 4M37A 1HT3A 3OEEA 3E9YA 2JS7A 1GFSA 3I9V6 2XAUA 1JQJC 4K40A 1RPZA 1SVIA 4JVOA 4B7XA 4S05A 4QXPA 2GSDA 3UTCA 4AU1A 1R0SA 1TC1A 4MINA 1RVV1 2IL1A 1IZ9A 3TZEA 5F2KA 4A5SA 2I6GA 4D98A 1U2GA 3D6VA 2ZYAA 1CT9A 5KVAA 3LNTA 1FJ2A 1QWOA 1UM9B 3E2IA 3V48A 4AURA 4TKVA 4JUFA 3HN7A 2C0PA 4Z4QA 1VKOA 2FZEA 5D00A 4CE6A 1K8XB 4XJVA 5SYMA 1P7YA 4PN7A 4CR7A 2G04A 3I5YA 1WBDA 5EHQA 2JARA 2EBFX 1IOZA 3MBKA 3I2JA 8ABPA 2CWWA 4TWJA 1WKCA 4AJ4A 1NMZA 3ZCQA 5JSHA 4C2TA 4L0CA 3FTNA 4HQ0A 4M55A 2CDNA 1ST3A 4FYIA 2EW8A 3QHQA 2WRZA 4RK1A 5KTNA 4M8IA 1TF5A 4MQBA 4UCWA 3WMFA 1SHJA 3LF2A 3RBZA 2HH9A 1GZ7A 2GF2A 4QO8A 2ZDQA 4FHZA 3C1TA 3FA2A 1WBJB 2X5JO 4J43A 3BXGA 4XEHA 2BTQB 2ODBA 4MNTA 1T4GA 3EGCA 4OM7A 1SA0A 1E6LA 4UD6A 5DHAA 1RI5A 3FDZA 4BQIA 4GI2A 1KPGA 3BE8A 3I61A 4I4NA 2PNFA 4MUFA 1RQGA 3TQHA 1RYBA 1DJOA 3JASA 4RL6A 5AW7A 4DPKA 1V8OA 4D8VA 3EY4A 3RRXA 3TXAA 4XKJA 3TLBA 3UK2A 1J8VA 2HQSA 3FWZA 3EOAI 4LDNA 4EHBA 3NKFA 5DNYB 1SOWA 4PYKA 3GZNB 5JEEA 1X39A 3DV2A 1QSGA 3AI7A 3QENA 1BC5A 4QUDA 3SIPA 5E4FA 5K4GA 1G18A 1PWXA 2CKMA 1ZD9A 5CH3A 1U0RA 1Y9AA 3T1TA 4FD2A 1RHRA 3IGFA 3U5ZB 4FLMA 2JAXA 2IY9A 1JA1A 4L08A 1RFLA 1T3HA 2A33A 4BCDA 4OLAA 3O2SB 3QLUC 4ZYZA 5BRAA 5DYYA 1QC5A 5AKXA 1XWWA 5J4HA 3SZRA 1JFLA 4JI3B 4C05A 4DYVA 4EHIA 2D2IA 4HLCA 4MZDA 3BZUA 3OJFA 1HOXA 1R9JA 1DUIA 4L7QA 4LDQA 5HJ2A 4MH0R 3WV4A 4EQZA 4BY9E 4Q39A 2FW9A 2E6KA 1LNQA 4JVMA 3HGTA 1QE5A 3I2FA 2QJRA 1OHHA 3G2JA 3FF4A 4ZZ0A 1W4BA 1E9AA 1FQOA 1NBMA 3NOXA 2C54A 4A2WA 3GJ0A 2NO4A 1JEYB 2ZZMA 5IBCA 4FN4A 1PFKA 4MVJE 2ZI5A 2GXUA 4E46A 3DB2A 3LY5A 4JD5A 2PS9A 4WXHA 2VPZA 4XX1A 2XSZD 4UZFA 1WNTA 3QRWA 1Q3KA 4XFJA 5DYIA 5FA8A 4FDAA 4MV4A 3ADCA 5G1PA 3O83A 2OV1A 4CIAA 1JR6A 1VE7A 1PX0A 1G3RA 1MN6A 1CJTC 1ONBA 4LE2A 4PYNA 2A6PA 1RM5A 2GN6A 4IGFA 1GSIA 2V3CC 3EFOB 3ORQA 3BYZA 1FF9A 4K0RA 2WU1A 4PGMA 3I6IA 1DZIA 2C7GA 4RAQA 3MJRA 3D4LA 1GITA 1FDOA 1HLDA 2HQBA 3T0GA 3RTAA 1IUNA 1JHUA 1X1BA 2WNSA 5LZ7A 4ZK6A 3LQQA 2F8LA 1N33B 4DAOA 2QI9C 3P0FA 5IDQA 2OBXA 2PAAA 1O5TA 2UXCB 1T5HX 2BVNA 2HWKA 4RJJA 2ZPAA 1UBKS 1ZVMA 1N2OA 1Y5NA 3PGKA 4UUPA 1N2EA 4K6CA 3KU1A 2Q6OA 3FZYA 2XJ4A 2JCBA 3RSZA 2OFPA 3GWZA 2OAP1 4B3RB 1QV7A 2AQHA 1K8QA 2I2WA 1ND5A 4XIJA 3TJZA 1T4CB 1UKYA 5K9ZA 1J2TA 3I58A 2YZNA 1PL0A 4O8CA 4BZWA 4EW6A 1RIFA 3L79A 4FOTA 3S2UA 2L0XA 4ETIA 4MB0A 3R24A 4D5EA 2QP9X 3V8EA 4ARIA 4KODA 3GEEA 1X7WA 4BJ3A 4F2PA 4PG6A 4Q9DA 2BDTA 2WJ3A 1YZFA 3T0IA 4MYRA 4CM8B 4RDHA 4MYSA 4C04A 1YBVA 3RRYA 1FFCA 5FTWA 4OXYA 4WL0A 1I13A 2I6UA 1SKBA 2J30A 1J24A 3GK3A 1UPUA 3PRJA 2K7ZA 2ODQA 4JJGA 3L05A 5ALXA 4EG5A 2GPJA 2HMAA 2KM1A 5A4JA 4MDHA 1RFGE 3KR9A 4NV1A 1GPKA 1DAOA 1N0HA 4YCMA 3FBWA 1PGPA 4ZJPA 2JJQA 2G40A 3TL6A 1KHTA 3DLBA 4NESA 1VLQA 2VDLB 5HQJA 5B7PA 1I1HA 3LF1A 5JI3E 4DWJA 4Z53A 1CHDA 3DM9B 2O8NA 4FCCA 4KSYA 1M2OA 2YXDA 2PH3A 3JXEA 1U31A 1CR2A 2I8LA 2PBLA 4YP5A 4YMTA 2EG9A 4XM1A 1A71A 3ZV7A 1HTTA 4UUOA 4F2HA 5CDUA 7ABPA 3P9SA 4GL4A 3JASB 4G4JA 2AC4A 1BS2A 3QY9A 3VAYA 4G0XA 2PK3A 2Q6TA 4DCSA 2XYVA 1POWA 2P9EA 4IJ6A 4TGLA 1ZS9A 3L8MA 1MHPA 2PZBA 5EZSA 2WYHA 6YASA 2AVDA 4FJ2A 3S2FA 2CFIA 1V16B 3FCUB 4FJ0A 2I29A 4D6XA 2VDPB 2VPQA 1UAGA 2CHUA 1OXBB 3G9QA 3I6BA 2X6RA 3SQLA 4LDZA 1T1GA 3OOEA 1PR9A 3Q7SA 2GTPA 1ULTA 3QU4A 4YCNA 2PD3A 4BO3A 5EEHA 3BFJA 4ONEA 3RVOA 4Q03A 3AIKA 1Q91A 1T3GA 3FYUA 3IBTA 3PYLA 2OD2A 3LK6A 3U0BA 2F1IA 1KP9A 2V03A 1UBLS 4YEDA 2UUPA 5LMCA 3DPUA 1T0UA 1KYVA 4QT0A 4GKJB 3TQIA 3GEBA 3ZW9A 4M1MA 3RHSA 4BYMA 2P78A 3EZGA 2FJPA 1Z16A 3JQRA 1O7JA 2BAGA 3N8NA 4UHDA 5DVZA 3RSGA 4A9AA 3HKCA 1F14A 1XRLA 3KQOA 1KC1A 4WOJA 1YR6A 2RMKA 4ALLA 2VH5R 5JSKA 2OOKA 2OZKA 2R6DA 2VN8A 3HKDA 4N5IX 2P68A 4QXQA 4R31A 4CV3A 1XDBA 3OIYA 2DUUA 4ID9A 4O02B 1U6IA 3EB9A 1FNDA 3RS4A 3TTXA 4IHJA 3JYNA 1CPYA 3NHBA 1AA9A 5G0SA 2YWEA 3U9LA 1KEPA 2FK8A 3E15A 4JBXA 4TL8A 5IN4A 1SRRA 4HNQA 3PTAA 3W3ZB 3ECSA 3N7TA 4NX2A 1GUBA 1X7XB 2BFBB 5EJEA 2FSHA 2F9FA 4LTNA 5JPIA 1PQYA 2B98A 4W8GA 1K98A 5CW1A 2B5VA 3PC4A 5FR1A 1I33A 1RAHA 1Y0BA 5JCOA 5J4LA 3FDZB 3OMLA 5LYJF 5ETJA 3DVSX 4UM9B 1SA0B 5BNFA 5IFKA 3KC2A 5JXGA 2XCSB 3HVUA 3OMWA 5GJWC 4E4TA 2EFCB 4HGPA 1QFMA 1Y6RA 3F4LA 3GH3A 2D0DA 4TS4A 3SBXA 4E70A 1AV6A 2F6RA 2MYTA 3L7YA 4JWTA 1KU6A 2MR6A 4MK4A 4TRMA 3W2HA 2J3KA 4YLYA 1GNTA 3HWRA 3VVCA 2WU4A 1K66A 2LCFA 3FCOA 1NHGA 1M8GA 1WY5A 1HZZA 1OLSB 5BYKA 1H2HA 2RK6A 4QULA 1FZQA 5I7WA 2AZMA 1ZVJA 4K46A 4NHOA 1DKOA 3RTDA 4W99A 1KY4A 3F5DA 5A7FA 1QJ4A 3RREA 1E3LA 5AT1A 3MCTA 3NM4A 1F4LA 4OOEA 5TPZA 5LOVF 1GKIA 4JUDX 4Z0PA 1Z4IA 1CW2B 5KMGB 3A6FA 4JS0A 1MJFA 3FUTA 2FE4A 5B3AA 3GFSA 4AROA 5BP7A 4BC1A 1PQWA 1JLSA 1X70A 2VDUE 2WZCA 4X8OA 3U48A 5JH7A 1E2BA 3IR5A 1H5UA 1EDEA 3C3DA 3G5UA 2OO5C 4M2LA 1MC4A 2XDQA 3D0QA 4QTZA 3X43A 4CM9A 4D6YA 2P0YA 2ZSKA 2SKDA 3WK8A 1YVDA 4BBAA 1GRQA 1SBHA 4I7EA 4YONB 2OFXA 5AHWA 2XCIA 1SC6A 3L01A 4F1KA 2I9PA 7GPBA 4XGQA 3GLFB 5CP8A 1T0IA 4NCXA 3D3EA 1DHRA 4RXUA 3D9QX 3Q3VA 4FSHA 3RVPA 3TSCA 3ZJVA 2C82A 1KJNA 1OQAA 4XYEA 1TJNA 4GMHA 1ES9A 1D2RA 1O0SA 2BHTA 1VSVA 5EIFA 3STTA 4FKZA 5EJ2A 1RAIA 3HYTA 3OFSA 4HNRA 1L9XA 3PHCA 4LZAA 2NWQA 2OHOA 3KPUA 5THXA 1FLDA 3FHLA 2ZBFA 1E96A 2OORA 4BRUA 4C4YA 2GPNA 4GZLA 2QGFA 2FSIA 3RRMA 2ADOA 1FQKA 2Q41A 3GN2A 5F1OA 1CIVA 1OH8A 1GIAA 1MG0A 4WZ6A 2WM3A 5KVSA 1NVDA 1A5SB 1SQSA 4C3OB 5FUMA 1I3NA 4GNRA 4IS3A 5CA1B 1TD1A 1CUCA 4GECA 1R5NA 5HCNA 3U56A 1L5LA 1E3WA 1I8TA 1OIVA 1ZX1A 4WUVA 5FUVA 3DMGA 5C9ZA 2I2FA 3WFJA 1IAQA 5FHRA 1HORA 2D5LA 2G63A 3IAHA 4WDRA 3RE1A 3D3QA 2TRSB 3TDMA 4EGAA 3R9WA 2PZEA 3ZW7A 1OH6A 2DPMA 3FOAA 4PCVA 1F7UA 1TO6A 3FVRA 2X2EA 3Q9SA 2H17A 1P0CA 2WI8A 4J2TA 2XB9A 3PNQA 3EIXA 4IH1A 3QVVA 2Z30A 4KSCA 5JJCA 4H7PA 5K3DA 1W96A 1J2RA 2DWOA 3UHPA 1VI2A 2GX6A 3DKPA 5FNVA 3H0CA 5TV2A 5C4MA 2XBMA 4NU8X 5L7WA 1EXVA 2PFSA 4EVIA 3ASVA 4S12A 3VTFA 4FWTA 2ZTUA 2PMFA 3MAJA 3BHMA 3PF8A 5SZHB 5BSHA 4L57A 5CG2A 3ZE6A 3VH1A 3TSWA 5IKEA 2CXSA 1XL1A 4G5RA 3NT4A 1VGVA 2WTXA 3EZ7A 1GTRA 1PU2A 3LAWA 5FIUA 3R3UA 3M81A 3OIVA 1XK6A 3E03A 3HA3A 3RK4A 3C6KA 1A1SA 3ZGYA 5BN1A 3DEKA 4JL5A 1P80A 3T7RA 4B3FX 1R5BA 1VCNA 3HCNA 3M3HA 1M0TA 2VDKB 3PUZA 3SKVA 4EKNB 1UC8A 1UWKA 2O2JA 1CS0B 3L4EA 2I62A 3M4NA 6ADHA 4PPYA 1JDJA 4YGXB 3CW9A 1O89A 4ND6A 1LSSA 1T2DA 1Z4PX 2FX5A 3AZQA 3IJPA 4JEMA 1CY6A 1NTRA 5AM4A 3ZVRA 4CCYA 4E5VA 1KJIA 1S4QA 3G2IA 3TWOA 1QONA 3G2MA 3UBMA 5KDLA 4EZIA 5LDHA 3WIEA 3P2YA 3ROFA 3RD5A 4B45A 2VT6A 4PHTA 1OFUA 1MO3A 5EE9A 4NZMA 2PKQP 4Z4CA 4L1KA 2EXXA 2JZOA 3VH4A 1IN7A 3MT9A 3PDJA 4IYRA 3JARB 3A37A 2Q1WA 1HQYE 4AS2A 5GZ1A 1XTJA 3F98A 2CV2A 1P9WA 1MZVA 3CUUA 3SE7A 4S3MA 5CX1B 2CJFA 4J3FA 4R8RA 1P75A 4HRVA 4YIKA 1LDMA 4JUIA 1TQ4A 3AX6A 3UAYA 3DC2A 3N2EA 1JEEA 4AY4A 4R0MA 4IFIA 1V9CA 3BJRA 1JJFA 3OTQA 4B46A 3GJQA 3SZ3A 1CSEE 3LUGA 3AR4A 3EQ8A 1PKXA 4D3XA 1ATZA 4CTOA 4JJKA 2AZTA 1ZI9A 3QE4A 3WOHA 3P9ZA 1NRXA 1UBHS 3KCQA 121PA 1J5PA 4I2VA 4OFZA 5FBKA 1QFZA 2HU7A 3QIVA 3H99A 4A6EA 4J6FA 2RAUA 4PBRA 4QJ4A 4V0OA 5DGHA 3DMFA 1ZGGA 3A1SA 3IAS6 3L3BA 1C30B 2QXUA 4RETA 1NF3A 3F6RA 4BN0A 3FTEA 1TF2A 3O5AA 4DR1B 3H0KA 1DG3A 3CLRC 4WKBA 1AXRA 1WXIA 4FW8A 4P4SA 4P3XA 3KQLA 2O1EA 1VGQA 4JBWA 2VOJA 3R8XA 3K2BA 4WK0B 4KR9A 4BNGA 3Q3CA 1YAHA 5HG0A 2CXTA 2G70A 5TMPA 1V39A 1G5PA 3H3JA 1BCSB 4D81A 4YCSA 3TCNA 3V34A 3EA0A 3BK2A 1NYQA 1WEHA 1G8KA 1JX6A 1MX3A 3OTHA 1A9XA 4JGGA 5JNWA 4GDFA 3GQVA 2YXNA 4I8DA 2WHQA 3L0PA 2WWVD 1XCOA 1J33A 2BDEA 2BEWA 4UQPA 4RJIA 3JQGA 4X6XA 5IVIA 1XMPA 5JDIC 1PFQA 1NKSA 4LGMA 4F7DA 1Y6GA 1HPLA 3KYIB 1JJBA 3G68A 6PFKA 5JLJA 3THOA 4KE8A 1SUCA 2H4XA 4G9GA 5FT9A 3H9JA 4ZV9A 1LRJA 4YRBA 1EEHA 1G98A 1OW3B 1MRZA 3K53A 1S7CA 5B3JA 3BXOA 4KQHA 5IAKA 3E53A 3COWA 3KOWA 3SGLA 4IH9A 5MGBA 4FMDF 5BVGA 3QVSA 2V7QA 4H6PA 5AOVA 1NNLA 1LZKA 2ODAA 3JQFA 1DC3A 4IR7A 1O08A 3PL5A 3NATA 3WGVA 3TR5A 5C0OE 4FFBB 3O93A 1PS9A 2F3RA 4CFYA 2IE8A 4ZEVA 4A0SA 1U6KA 2FEMA 1XA0A 1WUTA 8ADHA 1P4SA 4IXDA 4IO1A 3IR6A 2W0SA 3AJRA 4YI3A 4LZPA 5EZQA 4Z7NB 3NXSA 1Z12A 3ZNOA 2ACVA 3HXOA 4P9NA 4IJ5A 1W52X 3V4RA 2XNSA 4EHFA 1YQGA 3I39X 4HLDA 4ND2A 3CNOA 1UJ6A 1NYRA 1XZFA 1OV6A 1XTVA 5BOVA 5KYYB 2QVLA 3HNOA 4I9UA 4JLPA 4YT4A 1S1MA 4MW4A 4LS3A 1TIPA 3GGDA 1DDOA 4RYDA 5SZIA 1E4OA 2GEBA 1ADCA 2NTYC 2W2KB 4OU5A 1KIFA 1ESCA 5D1NA 3SN6A 2X6QA 4M6WB 4CG1A 1IIBA 3NTOA 3PWZA 4O33A 2QMQA 1FX1A 3UWDA 3K32A 1AVTA 3E2PA 4I9HA 5I4IA 5KKAA 2AJTA 1T6ZA 5A7HA 1H42A 3K15A 4G4SP 4XB6B 2BFPA 2ZR0A 2ZSIA 3PC8A 4L2IB 4QZVA 1ZR2A 5HM6A 3LZ6A 2PT5A 5KOIA 1LEHA 3V8NA 1T91A 4TKUA 1SG9A 3O1JC 1UJNA 3A4IA 4UQOA 5TPWA 4HB2A 4RTPA 1RQPA 2WU3A 5T4FA 3A3PA 1GNQA 3HJRA 2YY6A 2JFYA 4WW0A 8LDHA 4KDFA 1THMA 2QMUA 2RHMA 1YJQA 1I3KA 4B80A 1YUBA 3THXB 3D7MA 2CMHA 3BGWA 3ESAA 3BBPA 2JAWA 5KJFA 1U2ZA 3QKIA 3Q5EA 2MOKA 5CB4A 1C30A 3PEEA 2QF7A 1X42A 3FLAA 4LOIA 5D01A 4C2UA 1YRQA 2D5CA 2IDZA 4K3UA 3JZAA 4IV0A 2C03A 4LG1A 5ECYA 3TJMA 2OLEA 5ELLA 5BWBA 3K0FB 1NYLA 4Q9IA 3GVXA 1WZ2A 3DBRB 4K26A 1P2DA 3GBSA 2XVXA 1U5AA 3RUEA 2ZI7A 4QUBA 3X3HA 4N0MA 4PF1A 4FCWA 4QFMA 3WLKX 3ZH9B 4N9WA 3M5PA 1THGA 4O4LB 5KHAA 3T1QA 2O8VA 2PE5A 5JBIA 1RI1A 4NJOA 2JFUA 5HDBB 2H1CA 1V4VA 3GROA 1I2ZA 1KZGB 2FFJA 4WFIA 2ZPUA 3GAZA 3NBKA 1P8JA 1Z68A 2VP0A 5CJPA 1ZM4A 1IM5A 3SPXA 1P1BA 2ATIA 4OK5A 4B31A 2BR3A 4ENSA 4TMWA 3FCEA 1L5KA 3C14C 2AZXA 5JCPA 1QHXA 1G55A 2WUWE 3E9QA 3P2JA 5E6UA 1Q95A 2EEZA 3FCCA 5LR6A 4DKJA 3G49A 1S96A 5A7GA 5F5LA 1K08A 2V4UA 1OV4A 3KJZA 2O0MA 1NI3A 3II6X 2KMLA 5C8ZA 4DV0B 4BNNA 3EPKA 5F2EA 4K1XA 3PFBA 2FUG6 3EA5A 3OIGA 4NC9A 4XIIA 5T8KC 5LLTA 3DLPX 4LV8B 4KL8S 4R5HA 2IQIA 2JH8A 2OHIA 3GPDG 3OU6A 2RE8A 3NBZC 3HKEB 3RAFC 5DXJA 3JQ8B 1RKUA 3PGVA 4I4TB 2DWCA 1G64A 1GAWA 4J3NA 4X93A 4RTLA 3ANMA 3VR3A 1TMGE 5C4GB 1WWKA 2OK8A 1H8ED 3CKYA 2Q4TA 2VSNA 5IC6A 3W5HA 1SD5A 2NVUA 1S01A 5KBYA 4FP9A 2UU9B 2YCBA 1Q7CA 5MN5A 2FZCA 1IAVA 3ICCA 4LHVA 4ZVQA 4Z8XA 2F17A 3QPUA 1GAQA 1XQYA 1L4GA 1Z4MA 1T9GS 3ND5A 3I9V1 1JHQA 2YMLA 5FLEX 4JELA 2BZSA 2PT6A 3DT9A 3MBOA 3WBBA 2XVAA 2YZMA 3OF2A 4EENA 1NZDA 1C7RA 1TB4A 3PYXA 5TNXA 1CCWA 4D3FA 1P44A 2QXTA 4M49A 5TGTA 4ZCIA 4LJ5A 4KXUA 3J81k 3IP1A 1TUBA 3ND7A 3EF0A 4G0QA 4RHEA 1B0UA 1U4OA 1VPWA 3E22A 5C8VA 2YFKA 3Q7IA 1QU2A 3E1SA 3IOCA 5EIAA 4FDUA 4AKTA 4KB5A 4DIUA 3VJKA 5I4BA 1XHLA 4P0QB 4X7MA 5FNZA 5KTSA 3BD6A 5IAGA 4DNFA 2Z6UA 3OQBA 2RD2A 3OBIA 4DABA 1W35A 1Q92A 1X7XA 2BFBA 2YV3A 4JNKA 4KO2S 4PCAA 1A50B 3M4YA 5DXFA 5IJAA 4LSZA 5LUBA 1RWKA 2O14A 1OWOA 1UK8A 2H4FA 3Q41A 2OCAA 4Q9KA 3WZMA 5IT4A 5JAMA 4CMJA 1T9AA 4DA6A 3IS3A 4ZHQA 1RWBA 5CVUA 1T0JB 1WHTA 3ZX5A 4LBVA 1VSTA 4BO1A 1I7PA 1XJ0A 3FPBA 5DRTA 3ELBA 1JHXA 4LJRA 1R37A 4P08A 1LNZA 2IU6A 2ZRIA 1X8LA 2R79A 3O7MA 2FN7A 1M75A 4LWZA 4X97A 2ATXA 4GQBA 5L7YA 3C8DA 1J39A 1ZRMA 3T1YB 1L4EA 2NTEA 4QKQA 4KXYA 1IL0A 1U0NA 1U3TA 1NUTA 1U0OC 1YCGA 2A59A 3PJEA 5IH3A 3UXEA 5JALA 1XUOA 3ES9A 1UDWA 3QKWA 5F77A 3E9EA 2PXXA 2GEKA 4MICA 1JKXA 4KXQA 5C37A 1X6VA 2FB9A 1GV1A 1VMAA 2PFKA 5F1KA 3IO3A 3RIXA 3DMRA 5EKTA 1K1EA 4F6RA 3AXTA 4ZYYA 2C95A 2JKYA 4TKLA 3HHEA 1ZK4A 1I4OA 1F5NA 3ACCA 3TW0A 1ZISA 4G5SA 2FEXA 3FETA 3MYYA 5TS2A 4DOMA 4EPXA 3M3PA 2J7PD 2C9CA 4F04A 4DJFC 5KJCA 2RH4A 1OWLA 4EITA 4JOSA 5D84A 4XEUA 4F3YA 2LWIA 5JSUA 2HBZA 3V46A 2FPLA 2FZKA 3P0HA 2AJDA 2WIDA 4KQGA 3H9QA 2DUMA 3JTEA 2I6QA 2ZOSA 3QH4A 3UB3A 4JI8B 1RNLA 2YV2A 1E1CB 3QFFA 1JFSA 2I4IA 1H9CA 1U1FA 3MJFA 4KLCA 2X0IA 2XCLA 3V9AA 4YUWA 1A7AA 1LSJA 1UDCA 3KALA 1P5FA 3JSAA 1NBOA 1Q0HA 4FIZA 1V11B 3E9DA 1GA4A 3OPNA 5EXPA 2I2CA 1LWNA 5HQTA 1AV7A 2PQ0A 2A3RA 1GJRA 1M5UA 4OHKA 4E30A 3ZIUA 3CF2A 3AIMA 2X14A 3NKVA 4X71A 4URHA 3MBIA 5BN3A 1F38A 1J2YA 1F8XA 1ZXBA 2FCAA 3E81A 4R41A 4F2GA 4G1EB 4EY7A 1GNPA 5FI1B 1N2CB 4DJAA 3UMJA 2ZE7A 2HK9A 2WM8A 3SHTA 3IQZA 3R20A 3WLLA 5A9SA 1E6WA 3MVEA 3WKCA 1NOKA 1V95A 3JZDA 4F1JA 5BW6B 1ODTC 4X8LA 2R65A 2QRMA 2G3YA 2XMDA 3AVPA 3TXYA 1I36A 4YAFA 1BGXT 3GVIA 2XVZA 2EJWA 2Z3VA 3BTVA 4NDZA 3RVKA 2EGGA 3DLCA 3K6KA 1E6EA 4Q4HB 1FUYB 3KAJA 4AYTA 3BE6A 2B30A 3L6RA 1LQTA 3R0QA 3JW8A 4ZC1A 1JUDA 1KH3A 2BFNA 3OZCA 5H1YA 2Q3CA 2JLZA 2WIKA 1EDZA 2ZBVA 1MB9A 4LY9A 1RZRA 3V6LA 2FWBA 4DHEA 3FPSA 4BP8A 4J4TA 1QGOA 2WYUA 5FRDA 5J4KA 1J07A 5LWQA 4M98A 4M0MA 5LDDC 2XF8A 4Z4EA 3OTIA 4G0MA 2FCRA 1U2RA 2JI4A 2NUBA 3CUYA 3WB1A 4IIVA 4QELA 1R10A 5CMLA 3RNOA 4Y2YA 5HF9A 4DXAA 1PDWA 4HVAA 5IX8A 2AX4A 2AQIA 4AG3A 1E60A 3I64A 4PYLA 3BGSA 5A5VA 2EC5A 3FCXA 2WM2A 1HYHA 2ETVA 5IEJA 5IXJA 1QZ3A 2EZUA 2FUG1 1UP4A 1C0EA 2QN7A 2X9QA 1WP9A 4MQ5A 4ZAFA 5F33A 4NFSA 5CD1A 4DR3B 4PLFA 1N5LA 1QS0B 2EBHX 5C8XA 4OQXA 3W5CA 1JAHA 3NDJA 3O6VA 3VO9A 1XZKA 2B1GA 5K45A 3E8SA 2VK2A 4INZA 3SP1A 3ITKA 4Q4AB 1E7YA 3W2IA 1DKRA 1W88A 4MPJA 4X1OA 3WICA 1EQUA 5DV9A 4OG2A 1U65A 2R8EA 2QBYA 2A0WA 3VR5A 1KFBB 3QMPA 2QZSA 3RVDA 1KO1A 1NSYA 2E21A 4YIHA 3OIFA 4H7IA 2WYWA 4RKEA 2QRVB 5KINB 2K87A 2HA7A 3OP4A 3TSOA 5I7EA 3A0UA 4D3YA 1NG9A 3NDBB 1PTJC 4P58A 1B2RA 2BKXA 4GPAA 4PY2A 2WVHA 1TYAE 1L5NA 3TEJA 1T9CA 1CQIB 2I54A 4XW2A 3NC4A 1ZKDA 2R6R1 4YCJA 5A1TA 3WRXC 5DCUA 2A86A 3B6IA 1Y8QA 1HTWA 4EDFA 1AGNA 4RPCA 3L8GA 4U7TB 2JFGA 4I1UA 3K5WA 4NZPA 2XKKA 3OFJA 3IPCA 4W5TA 2RJOA 3RLIA 3LC2O 1YULA 1QQ7A 3LUKA 3NUQA 3O8OA 1FNCA 2ZRQA 2BEVA 4NMHA 2GD6A 4E11A 2QMHA 1MDFA 3V4ZA 1CY7A 3CX6A 3N8GA 1JPJA 2BE7A 1EIWA 5GJCA 4O2AB 4YUAA 5CDSA 2I8AA 2VG8A 1F4PA 5HMMA 4OJMX 1UQUA 1XTQA 3ZU4A 2JG3A 3DNMA 3D6HA 5IN5A 2Q5EA 4TT8A 3K0KA 3ZK9A 4EGSA 4LXQA 1Y8ZA 1QJCA 3N2KA 3V2HA 3WLEA 3LBHA 5K2OA 2JHAA 4HHEA 3S4YA 5AK6A 2BM0A 2IEAA 2R6AA 4BVEA 3I4LA 1EXNA 3NBQA 4C1BA 4FMCB 2ZCJA 4IOKA 1EE1A 2HTEA 5T5QA 2VYNA 2XNHA 2ZJFA 4L4SA 3L6BA 4FUTA 3AM3A 3KKOA 2AI2A 5CXSA 1D4OA 2HU2A 4WVLA 1FMFA 1A7JA 1AUPA 1ZNXA 2PFGA 2RHBA 3ETEA 4OB6A 2D1QA 1EBUA 3UOAB 1ZNWA 1YA4A 4IPTA 2FN4A 2VDVE 2O20A 4LUCA 1PD0A 1NN5A 5BMVF 2J5RA 3E7DA 3GLIA 1EUCA 3SXUB 2ARKA 2ZWMA 3M5WA 1OA1A 3JAMA 3NRJA 4KXWA 4P83A 5BRJA 2A0YA 1DAPA 1HFWA 4MW9A 3IPLA 2Z2JA 2BP7A 4RJ2A 3ROPA 2O9JA 2WUDA 7MDHA 4WLEA 5IC4A 2FG5A 3HXPA 2QD5A 4U7PB 4Z4HA 1WUYA 2O0HA 2QT1A 3WAGA 2AI1A 1XJWA 3X1JA 3ER9A 5JI2E 1TM3E 3A1DA 1XA4A 4ZDKA 1PFGA 3BICA 3W3AA 3RLFA 2VHUA 1KVTA 3HE3A 3SEZA 1IBLB 1M74A 3EZ9A 2G9QA 3L8EA 3LFTA 2XMZA 3ANNA 3BGVA 1D1QA 1B1CA 2KBFA 3HZZA 4CM5A 4F4HA 4R7GA 3FFBA 4BNMA 5AM1A 1E94E 3JAWB 1D0VA 1JDBB 3IT1A 1ZHFA 4ILKA 4RIFA 2IDKA 3BAFA 4R54A 1UDAA 1YQUA 2RJ3A 2UAGA 3Q8WA 4ZVLA 5LP6B 3OIDA 3QUBA 5A0TA 3MTIA 4LPSA 2BHLA 3BRWA 4OD0A 4B0OA 4E2WA 4YUYA 4D02A 4RULA 2OECA 2PH1A 1Q7GA 1T8PA 2OO3A 3B1XA 3QNUA 4R84A 3TQQA 4YX9A 5L51A 1TEZA 1Y37A 1M8FA 4QUAA 3ZLBA 1JEYA 4H1HA 3EYWA 2C5BA 4C7JA 4DWOA 3HH8A 3HP4A 3OP1A 1ZKMA 1RPAA 1QTNA 1Z0KA 5AKEA 5J4YA 3DSRA 1L3BA 1A82A 1Q77A 5EL0A 4MKIA 4FE3A 1EUYA 3DTNA 3ME5A 3RKRA 1O5IA 4MGHA 1AG9A 3FMVA 1UFQA 4KVGA 3V1MA 3OPYI 4DLSA 2GD0A 3IEPA 5D3ZA 5TXGA 5F7XA 2YQ5A 3LVBA 1YC5A 3D81A 4F11A 5LSAA 3ESQA 4NQZA 3E6AA 1WCYA 3UHAA 3UJPA 4II7A 3MB8A 2GCGA 4U00A 3ZHBA 3GELA 1KOLA 2Q2OA 3VC2A 3O8QA 3ECCA 2ZAGA 5ALDA 4MVYA 4OHZA 3AF1A 4XDZA 3R5XA 4HWOA 2Y2VA 3LOPA 1GOTA 3CH5A 3EGDB 1TT5A 1EM8A 4INJA 4ITUA 2WWWA 2QN2A 5CLJA 4AG5A 5EWLB 1UBMS 1DEOA 2O7VA 2BOVA 5A0FA 2I55A 2C92A 3LI2A 4OTZA 4ARVA 4DLXA 4G0OA 4JP8A 4ALMA 1W36B 4BGUA 2CMFA 5CURA 3QI2A 4LI0A 3NVMB 3A9WA 1NT2A 3MQ4A 4GZMA 3AC0A 3N2ZB 3MWJA 5BSGA 2GAJA 3WGTA 5JAZA 1WHSA 5ADUS 1PW7A 4G5OA 3CLKA 2XT6A 5DHSA 3HCFA 5EIOA 3SR3A 2BMDA 2XUIA 4IHKA 4RHUA 3O2JA 3CT4A 3OZGA 5D8DA 2HRZA 3T7KA 4OLFA 1BHQ1 3W6ZA 5KNDA 2YBDA 2ZQYA 4JYZA 1XKQA 4BVJA 4TL6A 2BEJA 4BBJA 2GJ4A 4I50B 5EHZA 1PV4A 4BLWA 5FYQA 3I92A 3IT0A 4NU0A 3PP8A 4Z86A 2BF4A 5ALOA 1Z33A 5FBRB 4O8ZA 3CZ4A 3X2FA 1WDMA 3ZR4B 5LYJA 3LHSA 1ONOA 4YR7A 3O92A 1KSHA 3EDQA 4B3GA 3K0FA 3LBAA 3ILVA 4PXAA 1QIIA 1GPLA 2PPLA 4W7IA 1NIPA 3HR7A 3SYLA 1Z0ZA 1MO4A 2JFOA 3W6UA 3IIIA 3CEAA 2ZWAA 3EG5A 3KLBA 4FSDA 3V8MA 4KAXA 3NPMA 1BJTA 1QF6A 2WT9A 4MCJA 3RWOA 4JQCA 1XU9A 4ZEOA 4GEGA 5FPHA 9GPBA 5IASA 3IALA 4G0PA 1T3SA 1OXMA 2JLAA 3HLYA 1QIHA 3W7AA 2C9BA 1N5JA 1QH1A 5LOVA 1JDPA 1H66A 2Z5FA 4C0QC 4D8XA 4IJWA 2W4IA 2E85A 5HRCA 2GETA 1I10A 2GPTA 3ZBUA 2VLBA 7ADHA 3VJRA 1GQOA 3R5TA 1H0KA 5IM5A 5IS2A 4IWYA 2E1PA 3CLUC 4A36A 1NUHA 1EUDB 3OUUA 3FDIA 1D6MA 2A88A 1EB8A 3KJNA 4HEA1 2ONZA 5H70A 1EP1B 4M6WA 2GN8A 2P1ZA 3EVCA 5K0LA 3CRRA 2NO6A 4JB3A 3W2TA 3E7WA 5FJIA 2BMEA 2NU8B 1R5JA 3IIKA 2BGJA 3ILYA 3K0CA 4JEHA 2J3LA 2J5QA 2GF9A 1FSZA 3PFCA 4TKUB 3UCFA 1SUDA 2HCJB 2AFHA 3C8MA 3GJXC 3T41A 2MDTA 1ZJYA 4OF4A 1ENYA 3ZZTA 3FMGA 2V1XA 2EP5A 2JZCA 4N5HX 3KOMA 5JZMA 4BQNA 1Z5NA 4LRWA 3JQDA 5I7HA 2SNIE 4IIXA 4N3NA 5E6RB 5DX0A 4CIBA 5K3BA 1FBTA 2Y67A 5IUNC 4HDNA 4YJHB 4JWKA 1UQTA 1ZG3A 1JIUA 4HLQB 1CUAA 3CR7A 4MWGA 1YZHA 5AW5A 2ZZKA 1Z5UA 4LZZA 4OM8A 3HN6A 3V3KA 4HRAA 4D80A 4FFBA 1YR1A 1N1EA 2NYVA 4F5DA 5LN1A 2FWJA 1A2BA 1OLOA 3MM4A 3MMPA 3IV9A 3PFWO 4P86A 3RIGA 3NNSA 3HYRA 5EZYB 2P67A 1LDEA 5ECDA 1CR6A 3ZD8A 3LVQE 1EXWA 3FZGA 2XQGA 5KKNB 1E3TA 5A5EA 1N75A 1F1BA 2QL6A 1JRLA 4V0MA 1SNYA 2WAYA 2QEQA 2IXTA 4JLMA 1JHRA 1YE3A 3L0ZA 1V2HE 1M2JA 2QTMA 3AR2A 1WSWA 3GIDA 4UBLA 1RQLA 3DULA 5I5GA 4E13A 2IHNA 1DCKA 3IV6A 4WBNB 2CLLB 3B20A 5DHQA 4B43A 4MIOA 3OPXA 2HHLA 4UATA 3KTAB 1FRVA 3DLHA 1EJ2A 1FL9A 3GQBB 3EIQA 2HA3A 2V7TA 4QDKA 3EPLA 1QQ5A 2A84A 4Z7OB 4JEIA 1H0RA 1LI7A 2R7AA 3QKTA 4EPVA 3W2EA 1UWVA 3A7DA 2G5GX 3HGQA 4RPGA 4WZAB 5FLYA 2FOXA 2PHZA 4X6UA 4B2IA 1LS6A 4TS9A 1WLYA 4Z6KA 1US8A 3LDAA 4DR5B 4P4NA 5CYGA 3AG5A 2FXIA 1U28C 1EFVB 2A5LA 1JDBC 1K8ZB 1XRSB 1L3CA 3R41A 3GF4A 3GC6A 3B3QA 5ECGC 3ZBPA 5CDYA 3PHBE 5I48A 3FAKA 3P9QA 4K3VA 1Y5RA 1WO8A 2WWRA 1SVUA 3RNLA 1X7ZA 2XVMA 2X9NA 3T4EA 1QO7A 1K7YA 3KZOA 1KJJA 4R2JA 4BNHA 3U4HA 2WOJA 1R0YA 3C15C 5A5FA 4CEIA 4L50A 3VPHA 2XYHA 3HG7A 4KFCA 1RE1A 1QB8A 5CLGA 2I0FA 2CT8A 1LQUA 4L95C 3R9KA 2JAUA 1V0JA 2I2AA 1KVQA 1KO7A 4MX8A 2Q5CA 1DAFA 3VYTB 4HMQA 1GPAA 2HSEA 4NBTA 5IJ9A 1AQIA 5F7ZA 2FPOA 3S2GA 3R9XA 1Q2UA 2V58A 2B7LA 3DHVA 3LX4A 1E1KA 3RQSA 4D8TA 2Q6IA 1P9RA 1O94D 1QAOA 5A4DA 2QU8A 4JJFA 3EARA 1E0KA 3O3CA 4AICA 3BREA 1WA5A 2A9QA 3C1OA 4R0NA 1WM1A 3MSXA 3MD9A 5I8WA 1PNTA 1TZJA 1XDUA 4HI0E 4MWSA 2P3QA 2QL7A 3FKQA 2F9LA 221PA 2G36A 4IIYA 3EBPA 4NKRA 3EWNA 4ZPXA 1KZ1A 4ZRMA 3WADA 3KZKA 2EJVA 3FWKA 1RP7A 4DBZA 4LCJA 4B3SB 2C78A 3ROTA 3ISJA 2GXQA 3AL3A 3IQDB 4NZZA 1MMFB 1PTKA 3AF6A 1T13A 4O1IA 5KTRA 3HZOA 2PZMA 1KDOA 1Q1EA 3DE2X 3PUWA 4HNHA 1T6BY 4ZV4A 2P4UA 2PA0A 2REOA 4DN6A 4O4HF 4NV3A 5LUAA 2E89A 2C57A 2X19A 4IVQA 4TQGA 5SYAA 5KPDA 3BWXA 3RYHA 1YZTA 5FA5A 4QWMA 1L4NA 3QMVA 4Y6PA 1W5BA 4YPVA 5BR8B 1YKFA 2QLLA 5A04A 2J46A 3K09A 1X1CA 1RLUA 5ALKA 3FSEA 3LUAA 2MSNA 2AJ8A 3HUUA 3AR5A 4G8JA 4D4GA 1K8RA 4DIDA 1YB6A 1PEDA 2G1UA 1QPBA 4NEGA 3TZBA 4PRZA 1JILA 1NFQA 1G5FA 3K1YA 4WJKB 3TO5A 1TE2A 1BDJA 4WAUA 1TXGA 1RJ9A 1IE3A 3AHEA 2JGDB 3MUFA 3M6LA 3W0LB 4P6VF 5JZSA 1NRJB 1C7QA 1MH1A 4B8ZA 2VQDA 4FX5A 1QVZA 4RZUA 4D9BA 1PR1A 3WWYA 5G4KA 4BQFA 4HQLA 4PPNA 4ZZ2A 2Q4OA 2G9VA 2TECE 4MWOA 4JJAA 4PX3A 4ETWA 3W5DA 1C9DB 2RGYA 2Z57A 4MEAA 4BL5A 2WVJA 2NTNA 1FSFA 3NHMA 3ESYA 1CLEA 3IBCA 4N7RA 3RASA 4FCVA 2QRKA 5SY9A 4QRHA 1DWUA 3ONVA 5EPOA 2C7BA 1T2AA 2JFWA 1KWKA 3PPXA 1NUSA 5KYTA 2R8OA 2GZ1A 1L4LA 1NASA 1XQXA 1I24A 1AHNA 5K0NA 4KFTA 1P5JA 2ID7A 3NS7A 4NNPA 2C8JA 2PEZA 3DOOA 3KSAC 3B1FA 3B9BA 1Y3FE 3O3OB 3OKCA 3TIGA 4P38A 1WVMA 5JDCA 1VI5A 3M5CA 4FNAA 5E1MA 1UIMA 3OJLA 4WA8A 1PL7A 2BPOA 3NWBA 1B93A 1ZGCA 5JSFA 2DHEA 4W9NA 1GV0A 1D2EA 3I1JA 4J90A 1NSTA 4ZCSA 1W44A 1JS1X 1Z6YA 3JR7A 5EWLA 2G4LA 1SUIA 3GFVA 2UZIR 4Q01A 1HLFA 4V38A 5TGDA 2VK8A 5BWOA 3A2KA 1T26A 2VCEA 1KK3A 3QJ5A 3QFTA 2QVYX 4UAVA 4W9NC 2D4AA 5ALEA 4OMDA 2ZJ5A 1LUAA 3VA7A 1VCHA 5EJ8A 3I76A 4I1VA 3C3CA 2ZWVA 3KOUA 3X44A 1LBIA 4AP9A 1ISPA 5KKCA 5A9TA 3Q12A 1DAHA 1Q1ZA 3V8RA 4B6FA 4WA7A 2FJUA 3IVXA 5GIPE 1F8UA 2WP0A 1LBEA 2CVQA 2FEKA 5BNIA 4LZNA 5MGNA 3FYUB 1Y7LA 2ZBDA 3HBLA 4ZXPA 2ZIEA 2YL2A 1VE9A 3TKAA 4GR4A 1C1XB 3UVEA 4G4IA 3VX3A 2Y4OA 2ZT7A 4BX0A 5CAEB 4YVFA 4IJVA 3I2KA 4Y2PA 4DLWA 5C31A 3FLMA 2UZ4A 3U62A 2QE6A 3J80A 3U61B 1DCTA 5KOHA 1EK6A 4X0EA 5ITVA 3MHTA 1JR4A 1MB2A 1KI1A 2Q9CA 4BE7B 3I5AA 3ZWPA 2NSJA 2DX7A 4FIDA 4H27A 4PHCA 5KVQA 3NHYA 4EAQA 1ZHOA 1IN8A 1DPGA 3MMZA 5DB4A 4PV7A 3RSFA 4UOEA 1BZYA 3OC0A 4XQ0A 3F71A 3PDIB 4RCVA 3C70A 3URMA 5ILQA 3RRJA 1E7SA 4LZJA 5KB3A 3WVNA 2M6LA 3QLJA 1W34A 1GAEO 4FK8A 2FKAA 1KFEB 2G9ZA 3OWHA 5E9QA 2PLAA 3R8FA 4A7PA 4M1TA 4OSEA 2KJQA 4L8FA 3FXAA 1G6HA 3QXCA 5JD4A 2FRDA 1NVBA 1C7ZA 1JSXA 3O4FA 4JQZA 4ND3A 3VAZA 2BEVB 3F5FA 3W9YA 4BFWA 2QPLA 4OGKA 2Y1WA 2SCUB 2A92A 4RZHA 3H5NA 3KT8A 3NHPA 1KKMA 3ZDYB 4KUGA 4BLUA 5HR5A 5KYKA 3Q0EA 4U8HA 2VHCA 3GLIB 1Y8QB 2IYAA 2ZM6B 3VOSA 1J9EA 1EFRA 1F3LA 4R8SA 2VFAA 3VDNB 2AJBA 4KW7A 5IABA 4N0PA 3PFGA 1U9JA 2F4VB 1M7HA 3SG0A 3BDIA 5KUTA 3ZZUA 4BNFA 3H2BA 3GLHB 3GMDA 4O2BB 5AHOA 3E7XA 4A4DA 3EDOA 4ZVKA 2GVDC 2VEDA 5KYWB 4DA4A 3HRIA 1OZAA 1OU0A 2EBWA 4TS3A 3GRPA 5FBHA 2PZAA 4HADA 4ISCA 1H2EA 2EV9A 2WUVA 1JU4A 4DJDC 1FFXA 2J6BA 1CRLA 3QE2A 3SJAA 1IZYA 1EHIA 2ZIVB 3UIEA 4O1HA 2WUFA 4BO2A 1O95D 2DFVA 2KE5A 4E51A 4FWIB 4ICIA 3PR1A 3CF4G 4M1KA 4DKXA 2Y71A 1DBIA 2HI0A 3QNWA 1GTL1 4TYMA 4ER6A 3GBVA 5E3JA 2MWMA 2QRLA 3D6MA 1GNSA 4M7PA 3DV0B 1O9GA 3T06B 4NH0A 5DXAA 1E7WA 3ZC3A 4DCGA 1WR8A 2C2OA 3QV2A 5BPHA 1QHHB 3NEYA 3R5SA 3N58A 3H3FA 1P0MA 1W87A 5FTMA 3P9YA 3BD8A 4DY6A 1NJ1A 2QR2A 2QYTA 3QYFA 1E64A 1R4MB 4L51A 5FOWA 4M1OA 1PVOA 3TPFA 5LQCA 2GPWA 5AOBA 1WXGA 4YRIA 3N2YA 2VT2A 3HKCB 3V8QA 3L7IA 1Q21A 2WIBA 3KFVA 3GXOA 1SCKA 4LKRA 4MQFB 2ECPA 1AN9A 4MV9A 3FGPA 4Y2SA 4WESA 3PFKA 4IICA 5K0JA 1UWCA 5KJ1A 1N0UA 3R3VA 4LOLA 1Y5LA 4E14A 1E7MA 4HZUB 4YMWA 4DDWA 3ZDXB 2VAVA 3QF4B 4L8GA 2NQ8A 5JSZA 2CCKA 2JFBA 1M5RA 3LXUX 4PZLA 4YLEA 1HF3A 2OXIA 2XWQA 1V7QA 5A06A 3ZCRA 1P0IA 2QQ5A 4K9SA 4UVDA 5K4AA 2ZR8A 3ZOKA 1R0KA 1SJ9A 2FUKA 1ZLYA 3E7PA 2NUPA 3K16A 2Y1LA 1L5VA 4UBMA 4WCFA 3QFCA 5LBTA 1RZUA 3ROMA 1OAOA 3QF4A 1D2CA 2D2EA 4KQXA 3NUZA 4FMPA 1VMDA 2O2EA 1X92A 2ZB7A 3MCWA 1G17A 4KQKA 4X91A 2PR2A 3SU8A 3TZ6A 1DIBA 3BSSA 1GZ3A 2L17A 4WACA 1GKYA 1CY8A 4PX2A 4YT5A 5INTA 3F3MA 2BF7A 1EX9A 3AEKA 3FPFA 2GHIA 2QUHA 3EVFA 2B20A 4K9KA 3IP3A 4W5JA 4YJKA 3MRTA 4DQXA 1P8AA 4X62B 5IJWA 3BD7A 4W9MC 1D6SA 4RX1A 2DERA 3OM0A 4NDAA 1QG0A 3NUGA 4X20B 2RONA 1NN1A 3OX3A 1LTHR 1TA4A 5J2TB 1XKLA 3QWFA 2CXXA 2EJCA 2R1VA 3QZUA 4EIWA 1CNEA 2C4WA 1X1RA 1XCBA 1GPNA 4BVHA 1NMQA 1AB5A 1QQ6A 3AKEA 4TSFA 4UHBA 1D2GA 3WDMA 3GEHA 3OTOB 3D4IA 3K8ZA 3C3AA 3GLIE 3AILA 4HL6A 4YAIA 5JC8A 1NI5A 1J8YF 1QRAA 5AXBA 3GP5A 3ER6A 3OC6A 4URWR 2CL6X 3P9RA 1WDTA 3OJXA 3MSCA 4R0VA 1CUEA 3ZQ4A 4P5PA 2J31A 1GDTA 2AN9A 4KR7A 1UBTS 4ZT5A 2P9JA 1XKXA 2IEYA 3CCBA 3AR7A 4YALA 1QGED 3I9KA 3TTWA 4UM9D 3AOGA 4AZSA 1GPJA 1O8BA 4KQEA 1TGYA 2V4MA 3GAAA 3KE8A 4RIHA 1PVVA 1S8AA 5EIXA 5CFRA 2G4CA 2Z4RA 1RLMA 5FBWB 2R85A 4DV7B 3OVMA 2XITA 4DJJA 2VRBA 4ZT4A 3VV2A 3ITEA 3KKPA 3U3ZA 1JR3D 4MKGA 4R9SA 4WASA 1X1TA 5AWFC 5JYBA 2MCFA 2W42A 3D5QA 4E4RA 1BJRE 3BWBA 4R9VA 3SVLA 3D02A 4OHCA 5HW0A 2ZIWB 2OXCA 2NXJA 4QEZA 2L2QA 3NXKA 4WCFC 4Z9AA 3HKBB 1UAAA 3BF7A 1JAIA 2JDIA 1WPRA 4X1IB 3MLBA 1E92A 3V2GA 5JS8A 4ZQBA 2Q21A 2X5KO 1P19A 4ZO9A 2GBCA 4CIDA 4YT2A 4CL2A 1IBMB 3EJWA 2QM8A 5I9BA 3KOZA 1Q83A 3FYTA 3FJ1A 3V00A 3GFGA 4R83A 3MS4A 3GA5A 1VG0B 4QG3A 3V4SA 3JVVA 1JAZA 2DY0A 3I12A 2BSXA 4NCBA 2FW1A 1I9GA 3NASA 2JI7A 2I66A 3K9BA 1QHFA 1SWWA 1JV2B 2AHOA 2D13A 4IF4A 3H1PA 4KWTA 4MQ6A 3HC7A 4U7FA 2AR9A 1QYCA 4D7AA 3MWFA 3PQ8A 3LA8A 4HR7A 2P9QA 4WXMA 5B37A 4I0WB 4EARA 4LXYA 1UC4B 5IZ4A 1QYRA 1UINA 1MGOA 1MPXA 4KWCA 5A02A 1MU0A 1Y1QA 4FQ7A 3NMUF 5A4MS 5B1EA 2V6BA 2Q2QA 5DCWA 2B4RO 3LPMA 2QV0A 3OZSA 2AMLA 4U7HA 4IO0A 4DCJA 3TBFA 2QLMA 2EF0A 3ONWA 2O0JA 1GGHA 4BO5A 5IJZA 3NTXA 4K1LA 4A73A 4JJEA 2IXDA 2UYYA 4QWWA 5JAOA 4W5NA 1FBNA 2OYCA 2P65A 4NENA 1MABA 1P0QA 1L8QA 1ZSVA 5HGJA 3VVLA 2ZJ1A 3JS5A 1COZA 1NW6A 4A16A 2P2YA 3KDSE 4HQRA 5IARA 3Q87B 1L7BA 4PO1A 3T3HA 2V45A 1GR0A 4OB7A 2V6GA 1QIGA 5L95A 3DZBA 5F21A 1JWBB 5KSPA 1KNXA 1U0HC 4GPZA 1U3UA 4IINA 1NPTO 1ISSA 4HQ6A 4CDMA 2Y9MB 3V1UA 3MZ0A 5KCMA 2H5EA 4B6PA 3FI9A 1PN3A 2AOWA 1I32A 1S3IA 4EF4A 2G8LA 5DCYA 5IAEA 4CMCA 4Y1EA 1RCFA 1L7DA 2YWFA 5HJ7A 2TSYB 3WGIA 4IYJA 3PA8A 4ZREA 3R3WA 4LYEA 5EINA 3C3EA 4LJ7A 3WJ7A 3ASYA 1K86A 3HTXA 1EINA 5A3QA 3B1ZA 1RKBA 2BN4A 1I80A 1SOMA 2I6TA 4K5QA 1RACA 1CNFA 1YJ5A 2IF0A 3R6GA 1NOJA 1CUSA 2VBIA 3CW8X 3NVAA 3PRKE 4GHWA 4RZQA 2J4DA 3PXXA 3WYGA 3CLHA 3BDVA 3I2GA 5ALZA 1VI6A 4AX4A 4RD1A 1Z4QA 1KKUA 3GQBA 3WL7A 5SICE 1OLXA 1QGUA 3BC1A 1V5IA 1WIWA 4V0KA 1XALA 1Z26A 3ROZA 3RODA 5KHOC 4MXDA 1IVNA 1S9HA 4F6LA 2Q3JA 3HADA 2QRGA 4OHRA 5KWIA 3NYQA 2VTBB 2YWHA 1YA8A 2CNDA 2PT9A 3PNYA 1T8RA 1ZJZA 3MRVA 4KKXB 4RGQA 3ZDQA 4DNXA 1KAEA 1FQJA 4MYUA 1MOSA 2X0KA 3F6SA 5DNDA 5TC4A 2CXUA 2BI7A 1XJ5A 2ORWA 4HAXA 2OV8A 3QU2A 3B7WA 1HL3A 3MCVA 5JZVA 4A1OA 2W6ID 3IPXA 4R6WA 1G5TA 3NKLA 2AHRA 4FEAA 1XC7A 3AY0A 1Y34E 3BFVA 1JXOA 2IYZA 2LR0A 4RVOA 1ODFA 2IIQA 3DT6A 4XWTA 3PQDA 4Q0MA 3DKVA 3ZIDA 2XY4A 4KTTE 2C83A 5EZ5A 3C7TA 3IEXA 1GY8A 4WGFA 3B9PA 2JFHA 3CQ9A 3DEHA 4XLTA 4WK2B 3U19A 1ZIOA 3IOMA 3P27A 4AN1A 4EHAA 4HNTA 3W79A 5HZGA 5EY5B 3EXG1 4RY0A 5JXWA 1F8GA 2CNOA 1W36D 4I55A 3MC1A 4Y0NA 3FRHA 2G07A 1R3UA 3EMDA 3GV0A 1NULA 4EOGA 2Z8ZA 1TX4B 3NBAA 1MNQA 3ZBTA 5B1SA 1EK0A 2DU8A 3R9IA 4UC0A 4XVHA 4CQMB 3DEJA 2YUIA 2CMDA 4KVFA 4PNPA 3OF5A 5DLYA 4L9AA 3JWIA 4HO1X 2NU8A 1KORA 2Z9CA 3RFXA 2EW1A 1PFVA 2EZTA 3LUPA 4IDAA 2RHHA 4LRUA 3VVMA 2XD9A 4EMBA 5T3UA 3VYSB 2FPRA 4JKYA 1QKKA 4IH4A 1A4IA 1NVKA 1ZD3A 2DR3A 1RWQA 1YT5A 1PJCA 2VSFA 2JJ2A 3PPIA 4MR9A 2PZJA 4MV0A 3VHLB 3Q7TA 4P7JA 1ZI8A 2WD7A 3GIWA 1W29A 3DP7A 4EHHA 3DTVA 4Q1EA 3QX9A 4CLRA 2Q9BA 4CMIB 2R96A 2FRDC 1N2XA 1G5HA 4C4OA 3ORSA 1U0TA 4EFNA 1WUIS 4EF5A 1EFDN 5E4JA 3KHSA 2NSLA 2WUEA 1TPYA 2ODPA 4QU0A 5AHRA 3ZU6A 5F78A 1YZYA 4DDTA 5B4TA 3DTVB 4G1CA 1D1SA 4UMFA 3BTSA 4OK3A 2PKYX 1YNOA 4OQEA 4LJ4A 4RIGA 5CCEA 1NAIA 4YJ3F 5K6TA 2PD4A 3P9PA 3FNEA 2I8CA 4OFBA 2QB5A 4QVGA 4CFSA 3RRZA 1IHDA 5AXAA 3K1AB 4JLDA 3WJAA 5LYJB 3MQ2A 4G41A 3W4KA 4GWKA 1DBQA 3D5EA 4Y1RB 4GBGA 4C2AA 1M76A 5L3ZA 1W73A 2BYTA 3QFHA 2O7NA 2J9FA 2VIIA 2QUZA 2CHEA 4JP1A 1F2TB 3FR8A 4WZAA 3OE1A 1IUKA 1ZCZA 4DGQA 2ZSEA 3BN3A 4EB3A 5JZBA 3OPQA 4YAWA 4M7OA 4Q4CA 2FSVA 1FZTA 4MVJM 3DBLB 3GFQA 5BWMA 5H3HA 3LUHA 4PPQA 3HMQA 3G0HA 3UMRA 3EXIB 2W43A 2XEDA 1Z0SA 4F5EA 3NWEA 4QOIA 1E9DA 1X94A 1JHMA 3EH1A 2G06A 3GH1A 4LXUA 5FOVA 1OLUB 1DAMA 3TVDA 4FM9A 3FB1A 3NOVA 2FN3A 3ILHA 4OXQA 2ZRPA 4LVCA 3RUIA 1YMQA 3U4IA 5LBIA 1N2GA 3UW1A 4YB8A 4F91B 2YWDA 1IRXA 3HFGA 3FKJA 3PX3A 4KK3A 1WJGA 4BB5A 3J7TA 3DO6A 3RS3A 3EZYA 1T5DX 3K0AA 2ZJ0A 2EJBA 3KQQA 2C97A 4YROA 4HNAB 1OBCA 3F1KA 1N5OX 4QQFA 3CIOA 4CLOB 3OI7A 4BZPA 1G16A 4N03A 2GYWA 2IBTA 2VBFA 4ON9A 3HVJA 3T3IA 3OLVA 5IPFA 2BFFB 2PZGA 1Y4ZA 1U90A 3U3XA 1V4BA 2QIPA 3N8DA 1V48A 2J6IA 4QUHA 3DXZA 3G5AA 3DVRX 2JCYA 1HYBA 1TU3A 3WP0A 4ZCQA 2YVUA 1ZCAA 4Z3KA 2X42A 3BAZA 3UUGA 1NQVA 1HKUA 1BA3A 3NGLA 3U7GA 2WOOA 5DCLA 1E1YA 2OWEA 1YUMA 2OHJA 2V9ZA 2VRCD 3UW3A 1EH5A 1R27A 2DY1A 3LP6A 2WE8A 5ALFA 4ME6A 3JD1A 1G21B 2ZS8A 2FPIA 1C3VA 2GA8A 4D4KA 1JEJA 1SULA 2HZ7A 2ZRDA 2FYTA 3DQZA 2BFOA 3FIUA 5J3JA 3Q8MA 4RAOA 3PNOA 4JZKA 2FQ1A 4N6NA 3WAKA 4HV4A 3A1EA 1YVUA 4EBFA 2X8BA 5AP9A 2BKLA 1Z4JA 2EHDA 2P0AA 5AOAA 4DSZA 1GZ5A 1C7EA 2NSDA 3WGYA 2A9KA 4L5AA 2CFTA 2HJVA 1IWPB 4NSNA 5G4KB 1FUEA 5B1DA 1UMBA 3T7CA 3RJ5A 1DKNA 1U02A 2DZDA 1FYEA 3AP1A 1SKQA 3HJTA 4BBPA 1OVMA 3PNPA 3M9XA 3PZRA 1U8YA 4IIUA 2UUAB 2D1FA 2YZKA 4D9MA 3OCUA 3AH8A 2D6FA 4F5YA 3OCCA 5JE8A 4OKSA 4LRQA 2IITA 1EUCB 2O06A 1ESMA 4ECAA 5ICEA 2GTIA 3ROQA 3H97A 1C1DA 4G84A 4PZCA 3WNCA 5ED4A 5BW4A 5CT8A 3C6BA 3DHEA 1NXOA 3L1IA 3M34A 4G5HA 3WGZA 3FCAA 3B78A 2PD6A 1D9ZA 1VE5A 5JYDA 2GWHA 2LP4Y 4QBFA 1XFAA 1QE3A 2RG1A 2VZ0A 2QT9A 4HK4A 3UFXA 4B1FA 4V1CI 1X7YA 2IVZA 1TCAA 3C48A 3H0EA 2W6CX 2WAOA 4RV4A 3MXOA 5TEWA 1L5HA 1U7TA 2CD7A 3COPA 2VP3A 3DOHA 3G6WA 3NC0C 5CJ2A 3T5PA 4ALNA 3LUFA 1I14A 4UBIA 2GVZC 3MWDB 5G3YA 4PCUA 1DB3A 5GY7A 1JLHA 4R16A 2XE8A 5CDFA 3RJTA 4TRNA 3UG7A 1XROA 5DI3A 4P1ZA 3MERA 3ML1A 1TKRA 1WDKA 4U8GA 2IXGA 5J43A 1SUWA 3BM5A 3W78A 4HH3C 1OGJA 2UUBB 1TU0A 4FNOA 4M1WA 1CEYA 1XLTA 2QD1A 1TKCA 2QA5A 4PHHA 3TQSA 1DEKA 1PGOA 1Z2DA 4EI7A 1FYFA 1CFJA 3BKWA 1W6UA 3NR2A 3GGCA 4BEJA 1JYSA 1HQDA 4LISA 3E5MA 3A9VA 2ZYSA 4OHPA 4NARA 4BKUA 1JQKA 4RLFA 1GADO 1ATIA 1QIJA 2DFPA 2W2QA 4NDNE 721PA 3I37X 1UH5A 2OCBA 2Q2WA 1AN0A 4TV9F 3DL2A 1WY7A 1K5DA 3B36A 1EVKA 4MRPA 1DJLA 2C9MA 1E79A 1T25A 4K9QA 3SOPA 5IH7A 4K86A 2I1VB 3ENZA 3UAZA 4XFKA 4RD4A 1NQUA 3SZLA 3ZOZA 1SUSA 2AFVA 2BGLA 3EF1A 3FZQA 4M36A 4XDGA 1JXQA 3KHUA 4CKYA 3Q5GA 2FZVA 1LF5A 1PR4A 1Z29A 4DSOA 1OKKA 3OQHA 4H08A 4I36A 4BO8A 5JSZB 5FPKA 3N0XA 5B57C 1VBKA 1FXUA 3AB3A 4C07A 4RA6A 3OQ6A 4OFWA 2OK7A 1LY1A 1N0WA 1E9BA 3AOEC 5PGMA 4EBBA 3P9KA 1O87A 1UBRS 5C7LO 2PX0A 2WK1A 1NLFA 2VJCA 3BVPA 3CH7A 3M7IA 3ZLVA 3K73O 3SK0A 4HNVA 3AHGA 3GMTA 2R1ZA 4GYJA 2EJTA 4DS3A 3T8YA 1DAEA 3VKHA 2FSPA 4QIHA 4HX9A 1TJYA 1G1MA 2P2NA 3OLWA 3PICA 4Z4GA 5GONF 4R7ZA 4HUQA 1YS1X 3D43A 1XDZA 3MWEA 4TX1A 2IPMA 2ORYA 4CDGA 3TFWA 1THZA 1NP3A 4GX1A 4J4BA 3VKVA 2BV3A 3ROGA 2XQIA 2EFGA 3ZWQA 1E5QA 2PJZA 2O1XA 3GGSA 3L8CA 1SELA 3LWNA 4OXRA 1MV5A 4X3PA 3V1TC 1SOAA 3VHRA 1IN4A 2OM2A 3NTLA 1FTYA 1JLLA 4QJ5A 3W3AD 3WNDA 4E07A 3KWLA 3P9IA 4KAAA 1HE4A 4B0PA 1E5VA 1TLFA 4LBWA 4C5AA 5C2JB 1RJGA 2HA2A 4RM3A 3OLQA 3T54A 5ITWA 2VJQA 1UKAA 3R0JA 3VO2A 3S2ZA 3I5UA 3I04A 3L4BA 3V2UA 1V1MA 3DEIA 5CB0A 1TMOA 1G20E 5L3SB 1YTLA 4YN3A 2CEKA 1TKAA 3L1KA 3WE7A 4AIIA 1FFWA 1YZUA 1AGYA 3I09A 4QOJA 1MIOB 3U09A 1NVAA 1FY2A 4N7JA 4DAEA 3FE2A 3LT4A 4ZJZA 3R74A 3MNFA 4QATA 5LYYA 2XUFA 3OQ1A 2QWXA 3U1VA 5BWCA 3VJLA 5FD8A 4UFNA 2RGGA 3A9UA 2H31A 5D7BA 4JI6B 3EEFA 4XUDA 4AXBA 4E7PA 2OZVA 1YMUA 1YONA 2OO7A 3GO4A 1XRQA 3ZNNA 1HT1E 1MW9X 4RSRA 4UBKA 4X9XA 3HXTA 4I1YA 1ID1A 3L7DA 5ADVA 4D25A 2RHGB 1R16A 4PZ0A 4AP5A 5EE1A 2XODA 2O8EB 5J1SB 1FFYA 4R98A 1EHYA 3DV0A 4DSAA 4ZEWA 1N7IA 2J3MA 1XQ9A 3GRFA 3HB9A 1TO2E 2GA9A 3PEVA 4PLYA 4X1KB 3IR7A 4F2WA 5JH7B 3OT4A 2ZVPX 3HU2A 1CLUA 4K8OA 2WT4A 3IKLA 3QBVA 4O4HA 3RV4A 1WMFA 3WXMA 1GZDA 1KSFX 1PJ3A 2FQQA 4L16A 2YFHA 2JJ8A 3AEQA 1L1RA 4Q7JB 3EPHA 1KP2A 3QU9A 1UXOA 4CKWA 5K0GA 4U9IS 2UUCB 3C41J 2ETXA 3X1WA 1MO2A 1XP8A 3FUUA 3GPBA 3H2ZA 4MP6A 1EP2B 1M2FA 4BWFB 2XUGA 1L4UA 1WXFA 3SEQA 4ZO6A 5EKDA 1XYVA 2ZJ6A 3DDSA 3ABRB 1R6XA 2KLBA 3OEYA 4KN5A 1ZN2A 2A5FA 1CYDA 3CRZA 4ER0A 1P7ZA 3RVRA 4YLGA 3QUQA 2ECFA 4C29A 1JBQA 1G9SA 1W59A 3L43A 3MWKA 5ESDA 3V5NA 2P6RA 3IOYA 3PQ6A 1Z36A 4RYLA 4D2IA 3DJFA 4INOA 2ZRLA 3VC7A 3CV3A 2P8JA 3VKUA 1TA9A 1GDHA 1Z2CA 1FX0B 4EY4A 3MF4A 3TOXA 1QKJA 4CUZA 3JR3A 4B3IA 3HY6A 5HTKA 3U7EB 1XZNA 2APJA 1G41A 1WCV1 2AX3A 4AS3A 2UZ1B 4W6ZA 1LJLA 1KJ8A 3WZLA 2XZTA 3EPPA 2P9FA 3CUKA 4A10A 5JEDA 3P20A 5E3IA 5A5GA 1KERA 1ZNZA 1C0KA 4UBJA 4MR8B 4IL5A 5HF8A 5FKJA 5E2IA 3N87A 4BXOB 4CG3A 5K2MA 4BQEA 1D6JA 5AJTA 4XR4A 1VPDA 3WYEA 3I1YA 3RKUA 2IYVA 4DMFA 3W1WA 2UZ1A 2VS1A 5JWOA 3OU7A 4G85A 4EA8A 5GVSA 2QRPA 1R3DA 4ERNA 2DQYA 4OAPA 1PGQA 1ZU4A 1SVMA 1RKXA 5TF0A 3VC3A 3BMCA 2O8CA 1QVAA 2R6JA 1PLKA 2Z2IA 1GZVA 1SN7A 2RH9B 2ZIAA 4BDTA 4Q6BA 1Z8DA 2PIDA 4MHOA 3A6HA 4L78A 4B9AA 1RQ7A 2J41A 4YMIA 2XNDA 2SHKA 3LDFA 3CO5A 3S5JA 3HJHA 3CVVA 1YJ8A 5C7YA 2TYSB 5EXSA 3KQSA 1WETA 2YWJA 1HE1C 3TOCA 5HHTA 2ZSAA 1H4TA 1ONSA 2OHFA 3HDJA 1X7HA 1LDBA 4MV3A 2MSCB 1NUQA 4HYYA 2OSVA 3RTEA 4OQDA 4JYCA 4UBOA 4KE9A 2AT1A 4E94A 4IZIA 1QRTA 4A6XA 2NO7A 3ZHVA 1DHTA 1DFHA 1R2QA 1VCIA 1ZK3A 1Z47A 2I4LA 4ISBA 5C1BA 1QGDA 4MS1B 2X0JA 3EVAA 1REQA 1U5CA 2Q28A 3L46A 3O4JA 4PQRA 3NAZA 3OT1A 4KJZA 4LC0A 3TQCA 1ZITA 2HTFA 621PA 1L5YA 2DWUA 1PL8A 2NU6B 1LI5A 2XA1A 1XHEA 3DOCA 3HUTA 2Y77A 1F20A 3DEYX 3PDUA 4JP5A 4DV3B 1RRFA 1L4YA 1YQXA 2ZSHA 3CIFA 1DC7A 3H04A 1XZPA 4RPIA 5AVQA 4KEAA 3ZNPA 1P17A 4N01A 3I23A 2WWTA 1K5GA 3TAXA 1KVRA 5KTPA 4HWTA 2J0QA 3O0TA 3PQFA 1BKYA 2GNOA 5CXXA 4NZYA 3ESCA 4X24A 4H6WA 3VZQA 4KPEC 2HBQA 3ZYZA 1H3NA 5DN9A 1HYQA 3VNVA 1VKRA 3BPSA 4LAFA 3K7EA 2P75A 4RK7A 1Z2EA 1DV1A 1OILA 1BXRA 3LC7O 2QM3A 2ISCA 2C4NA 3K4PA 2CXQA 4OQQA 5EP3A 1Z0FA 2ZG6A 4BHTA 3T52A 1G8AA 2D2VA 3CX8A 4MPTA 2JJMA 2ZTLA 4KO3S 1H22A 1Z34A 3DOJA 2H85A 2P2LA 3H4VA 1V1MB 1GP2A 1XRMA 4AI6A 3B6MA 3RGGA 2OGUA 1WDLA 1A8UA 1P3DA 1PJQA 2W6JD 3OEHD 2CKDA 3VBEA 5IW8A 4ZYWA 3OD5A 1KYXA 2WAAA 3MWDA 5EXTA 2QPOA 1V7ZA 1JZTA 1WG8A 1WL8A 2FFQA 1WULS 4TTQA 4NZ9A 4PRYA 4WZBE 1K92A 1MENA 2DQKA 3GW8A 1GL7A 1X2EA 1KK2A 5EGNA 3BS4A 2YV4A 4XWYA 3TLJA 2CJPA 2GN1A 1NC3A 3EK2A 4HVLA 3WMWA 4WMLA 2VP9A 1N2IA 4YQEA 4CN9A 3NEAA 5FCDA 2YC2C 3SF0A 2ERCA 4IQGA 2FR8C 3RYHB 4TWRA 1RHMA 4OSOA 4MCAA 4MW7A 1ZIDA 3MGGA 4DLUA 1VHDA 4FQ5A 3V7NA 3WLRA 1GTJ1 1A0OA 2R6CA 16PKA 1KXJA 1P0PA 3V1LA 1EAMA 5DN6A 3SLGA 4ZYVA 1BTOA 1SHTX 2RI0A 4BUJA 4UNPA 4DSUA 2WB2A 2BKEA 1ZNYA 4MQEB 2RKBA 4WZBA 1PSDA 5HKKA 2E5LB 2XZDA 1ZUWA 4YP1A 1NKTA 3E82A 3AJEA 1F1JA 2AEMA 1QIDA 1UMBB 2DT8A 4QEKA 4D1YA 1M1YB 4G9BA 1SBIA 4ZRDA 5DX1A 5TPWB 3RM3A 1CUGA 4BJ6A 3TQTA 4BQRA 4UJ5A 5EXXA 4EECA 1J8DA 4L7VA 2QUBA 2FPWA 4CKXA 3ZI7A 3CPEA 4TYPA 4TQUS 1VE6A 1AHPA 1DJQA 1SUFA 2QTNA 2BEUA 2OEPA 3L2OB 3KYDA 3G0BA 4NVRA 2BGRA 1YBAA 2QR5A 1Z75A 2AV6A 2ZVQX 3X1DA 3L06A 2O2XA 2C0CA 3JWPA 5JPDA 4XSHA 5JAUA 2BI8A 2IEIA 2FU5C 5DHFA 4XYBA 1IBCA 4RLSA 1OFUX 3U31A 1I9CA 3ITDA 4AY6A 4UTXA 5BN4B 2IYUA 5BSEA 1V5FA 3CF4A 4U7GA 1WB6A 1ZJ4A 2BEKA 3WLAA 1ZK1A 3EQ7A 4P0TA 5FXMA 3TBKA 3I3SR 2E4YA 1H2BA 3IOBA 4MJ3A 3QEMA 3DS8A 2J08A 3HXMA 4B5LA 2ZUBA 3CURA 3PNLA 4Q1BA 4YXWD 4AN0A 1W46A 2RK4A 3DUFB 4KOEC 2DBYA 5K3OA 3BHNA 4RPLA 2FUEA 3ZNQA 1PP4A 3HS3A 1IVYA 1MLDA 1US8B 2XGMA 3IESA 3MJDA 3R0IA 3ZQ6A 4CKCB 5LQDA 5MFZA 1BJKA 1IOLA 2HLPA 3INRA 1GZUA 2H5LA 5K3FA 1QH0A 3JQ8A 2IKSA 3G2PA 3HKEA 5F3DA 3W9UA 2IA5A 3DBVO 5BXYA 5DTQA 3ZU5A 2O2HA 1BAPA 3RUHA 3UFXB 4AF6A 1LZLA 4YQFA 1QQAA 1CU1A 1JG1A 2QTRA 3W9BA 3HY3A 3ZKAA 3LECA 3PC2A 3TFOA 1K6EA 3F6YA 3NHAA 5NLLA 3S1AB 2B4TO 1OYOA 1Y6QA 1E0SA 2WSMA 4NOKA 3AM5A 3WWPA 3PFHA 4WN3A 1KDYA 1QYWA 4D4HA 5EUBA 3K5PA 3R6LA 1X2BA 2CGEA 1ZBQA 2Z8XA 1IK4A 3HU5A 3STYA 4K9RA 3DG9A 3F97A 3ED5A 5J40A 3ONDA 1LBSA 1P62B 3FHJA 3H86A 1UMKA 2DTEA 1N57A 5G0UA 3OAAA 5H81A 3M2TA 4DILA 5IVKA 3W5VA 4LEIA 1PK7A 1HE5A 4W1PA 2AL7A 4ATNA 2INGX 1JR3E 4BLVA 4BV3A 2DWPA 1K7CA 1HXHA 1GSAA 1KYYA 2I33A 2B21A 3V2IA 1NFFA 1GLGA 4MLPA 4FC7A 4MYTA 5FLXA 2VH2A 1GKKA 9MHTA 1IQUA 1NE2A 4WE3A 1TRKA 2UXDB 1USKA 2XTMA 4KVZA 4CW7A 2WDPA 5E6RA 3RVLA 3NDIA 2QTVA 4QRIA 2WG1A 2BFAA 3KETA 4MV7A 4CIVA 1JSLA 1V25A 2VEOA 2NVBA 1HE8B 3JV7A 3OKPA 3GEMA 1I30A 3P94A 2Z1MA 2CB0A 4P22A 3NHJA 5F3RA 5H80A 5T3YA 5EEGA 3Q8KA 3TF5A 2BFDA 3C74A 3HSKA 3JQAD 4HDMB 2DC1A 3TSYA 2XRFA 4J3JA 4Y2QA 1BVYF 3LQRA 4PC7A 1VB3A 3DNPA 2YZGA 1N6LA 1QAQA 2X7XA 2QLTA 3I6ZA 1O6FA 2R84A 1DJPA 1PBNA 3I6QA 3R4CA 5CT6A 1KIMA 2A9JA 2P6OA 1U9ZA 4EY8A 1A3CA 1PQPA 3JVEA 4NJMB 2JI6A 2VWHA 3O9VA 2FDXA 1IYZA 2IYNA 4WN9A 4C78A 3LX5A 2NP7A 4UFOA 3AHIA 2CNLA 2EBUA 5A6VA 1T6XA 3GYGA 4ITVA 2JZNA 1QH8A 1U3VA 4DUGA 2POQX 3IMFA 1R6VA 2BW0A 2PA3A 3FKSA 1HDOA 1T1SA 2RHRA 2VP4A 4OJQA 1RPTA 5AI8A 3WBJA 1A9OA 2J85A 5IEBA 3HBNA 3HJFA 5D2CA 1PV1A 1RAAA 1RYHA 4I66A 4Z99A 5CXQA 4DPLA 3I05A 1EUQA 2B1JA 3GZTB 4NNJA 2YDYA 1J8FA 2BFDB 3IP5A 3IL2A 3SMQA 3DE0X 3UUWA 4O63O 3W04A 1Y33E 2A4MA 1YB4A 4EATA 3EBOA 1MPTA 2HR1A 1USWA 4S1PA 4EA6A 3TW8A 4CM7A 2PRIA 3RFTA 4BJ1A 4V0ME 1LLDA 1XO1A 2FZWA 2IGTA 3GA0A 1T2EA 4TLBA 4LV5B 4WCDA 4QUIA 3DE4X 4OJKA 3ZI0A 5ITZB 5DGXA 1KXZA 4DUYB 4JMPA 1X3LA 2F64A 5ES3A 2XUZA 4B48A 3THSA 3E5NA 1GT6A 2JIZA 4CTJA 4D92A 1GRNA 3TSAA 2Q3HA 3UMVA 2FEAA 5CNKA 2GKGA 1XZGA 2J9FB 1KR2A 3OG9A 3TB4A 5HS4A 3R77A 2WICA 3SKYA 1M34E 5E7QA 3D0KA 3RC1A 1H2FA 1UJCA 1I7QB 3ZKWA 2EX4A 3WYBA 5WRFA 2XAAA 1J00A 2RHLA 2P2DA 4WOCA 2VTBA 1MB4A 2CFSA 4K6KA 1VPVA 1DI0A 2IUSA 2V7QD 3A9TA 3WK9A 4QJ3A 5BW5A 521PA 1W25A 3L1VA 1EWQA 1IWBB 1SUAA 4GKAA 1N8KA 1JI0A 1UXJA 5BSTA 1BDHA 4DLBA 2PMWB 1YJBA 4BNLA 2YMMA 4WZZA 3GHHA 3AUXA 3AOEA 2WEKA 4YDRA 3EWIA 4JI2B 2CHVA 3G6KA 2ECQA 3REFA 2MIIA 1AQYA 2V54A 5EERA 1JDVA 2WFAA 5D5HA 5COAA 3EGXA 5G3ZA 3VZPA 1J42A 1P6XA 3GG2A 3L0CA 1K75A 2Q5OA 2WFMA 3AGQA 1TYZA 4HXYA 4Y6OA 2M1XA