3H84A

Crystal structure of get3
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
346
structure length
326
Chain Sequence
VEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSRANNNGSDGQGDDLGSLLQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structures of yeast Get3 suggest a mechanism for tail-anchored protein membrane insertion.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords ATPase GET3
total genus 107
structure length 326
sequence length 346
chains with identical sequence B
ec nomenclature ec 3.6.3.16: Arsenite-transporting ATPase.
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3h84A00
3TVTA 3VMFA 2OAP1 2DBYA 3B82A 4TL6A 1XTQA 4GMXA 1K5GA 3Q85A 2VP6A 1FMLA 1NJGA 4PPGA 4Q01A 4Q9KA 3I5YA 2ZVPX 1U9IC 3NVAA 4QOSA 1Z6AA 4BLOA 5DI3A 5J4HA 1E2MA 2A78A 1E2JA 5JHGB 2XNSA 1UDWA 1VG9B 4JLKA 2ZXUA 5KSZA 2YWGA 2N46A 2R9VA 3VNUA 5EP1A 1JB1A 2W6JD 1E1RD 1KDTA 1XNJA 4MH0R 4BECA 3GQBA 3NBXX 3V4RA 3CIOA 4GMDA 1J90A 1CTQA 3GLFE 1E4VA 4M1YA 2F1JA 4LDJA 3W9YA 3SOPA 1S4QA 2IL1A 2D7DA 3CNLA 4I1OA 3X1XA 2PCLA 2CCKA 3PQCA 2QU8A 2OXRA 3IGFA 4A9AA 4DCSA 2XZOA 1U0HC 4JVNA 3TW4A 1OIWA 4DSOA 4CEJA 4LC1A 2J0UA 3TRFA 4WZAE 3RYTC 1D2EA 4A2PA 2AWOA 3Q5EA 3LV8A 4TL8A 1G19A 2ONJA 5JFGA 1UKZA 2ZPTX 4B6EA 2O8FA 4UXHA 4FN5A 1G6HA 5CYOA 4QFMA 1F2UA 2ZUDA 2H16A 1CS4C 1QG4A 4Q5IA 4LSGA 4D0LB 3K09C 4NCKA 4EIWA 4DZZA 4TLAA 2BCJQ 4D4LA 2W6IA 5FOUA 2ZJYA 5GADl 3L8ZA 2CJWA 4NONA 3LVRE 2VH5R 4Q9JA 2VQSA 5FR2A 1E2FA 3WXMA 1RJ9B 1CBUA 1LNZA 2D62A 2PJRA 3QBTA 1X8LA 5CJ2A 3SN6A 1RKBA 4JS0A 2GCPA 4OI4A 2BOVA 4URYR 5DIFA 4M1WA 2F43B 3QG1A 1WQ1R 1SKYE 1VYUA 1N6OA 4URXR 1XEWX 2C78A 3RRMA 3CRW1 2QI9C 2OBLA 3BBPA 1RRCA 3NEYA 1OB5A 3OE7D 2Z4RA 1AGRA 4JLOA 3B8HA 1XMVA 2C9CA 4A8JB 1NL3A 5E7MA 2EU8A 4TSFD 4P0TA 2ZYWX 1G8GA 4HI0E 2BDTA 1BH2A 1GZSA 5JJKA 1Z2CA 4G0NA 2ZSEA 3I92A 3LD9A 4TYQA 4TMZA 5TVKA 1EFCA 1F2TA 2DWQA 4NYMR 2FJUA 4CT4B 2V7QA 1GKYA 5KSPA 1DTSA 1KI1A 4Q4JA 3QF7A 2WM9B 3EX7C 1DO2A 2Q3HA 3K70C 2FU5C 5FFMA 5LPNA 4PAMA 1KI6A 3DM5A 5C2JB 3R9XA 1XEXB 4CYMA 2N1BA 3DOEA 4Q7JB 2JLXA 4HEJA 2QP4A 1PJRA 3A4MA 2QPTA 2FG5A 1XBTA 3MCAA 2O0HA 3BC1A 3B1VA 4JT2A 1KZGB 5SZJA 1Z2AA 2J46A 4Q03A 1W5TA 1SXJE 4WBSA 2E87A 5EE5B 5E3HA 4Q9IA 1GRNA 3K8YA 3QXJA 3K9GA 4D6PA 1OV4A 3FKQA 3AUYA 5EXTA 4C3ZA 3H0KA 1OW3B 1HV8A 1KNXA 2PJZA 2WOJA 3WMFA 5CLQA 4IXMA 1UEJA 4XTCS 4ESHA 1E79A 2RGNA 1LTQA 4CRWB 4DCUA 2BMFA 1GIAA 3H84A 4KV9A 4EQ6A 1P2UA 3M6AA 4JYCA 1RE0A 3TQFA 5JSZA 4HAWA 2QM7A 1MABA 2P65A 3AKDA 2H92A 3EASA 2JJ1A 2WWGA 1T0HB 2OCBA 1XFAA 4BZPA 3NH6A 3BB1A 1R5OA 5JSZB 2EFCB 2GBLA 3G5UA 2XTMA 3VHLB 3VR5A 4EQ6B 4G01B 4JSTA 4BFUA 2OLKA 4WZBE 1XEXA 1KI3A 5H1YA 2VF7A 2OT3B 4DLWA 4DRZA 5JRZA 3RSLA 5JS7A 2GXSA 2BCGY 3AKCA 3NBYC 4C4PA 4MQBA 4OI0A 1OYYA 1AN0A 3L0IB 4P31A 3KQNA 4XVQA 4C0KA 5EE3A 1L4UA 1Q1ZA 1RYFA 4KSBA 1XDBA 5L3SA 4F92B 2QGNA 4HAUA 2WVJA 4PPQA 4NYJQ 2ASEA 4IEEA 1ZIOA 2I3BA 3EC2A 2ZETA 2DHRA 4Q1AA 3H2YA 2GAOA 2ECKA 5CDFA 1N6KA 3W6OA 2J87A 2FSFA 3DVLA 1FUUA 3TBKA 2ZJ5A 3HR7A 2FMXA 3MMPA 621PA 1NLZA 3AVOA 3CRVA 3OEHA 1E1QA 2XXAA 1KI6B 3THXB 4ZKEA 3SBEA 1BOFA 3A4NA 4O2RA 3IHLA 2ZANA 2QTFA 4URVR 2CMKA 4PQYA 3BD9A 4GOXA 4JBWA 3ADCA 3GLGA 2AKAB 1LB1B 2PMDA 4LYAA 1RJ9A 2GESA 1X8KA 1YJ5A 5HE9A 3MG9A 4GPTA 2Q0HA 1N6LA 3AEZA 1TADA 3U3RA 3PENA 1CF4A 4MUBA 3RDPA 821PA 4UNQA 3SDZA 2QSYA 4POAA 2IYYA 2CDNA 1NP6A 4A8JA 3SQWA 2J5XA 1P5ZB 3PCRB 1G7RA 5FOVA 4CT5A 1F2UB 3LH5A 3L0OA 3QOFA 3NIBA 3QUSA 1GL6A 4HUQB 2ZI7A 1XMIA 4S35A 1W1WA 2ZRNA 2MSCB 3I1FA 1NN1A 3CWZA 4LI0A 5C1BA 1V5WA 221PA 1Z22A 5CM9C 4LJYA 2ZE7A 4M9ZA 2J0UB 3NTUA 4TYNA 4BRWA 1IJFA 3A37A 3AVTA 2ZRKA 4M1OA 2RB4A 1W2GA 1T3SA 3FB4A 1SQ5A 1T3LA 3IHWA 5EZ5A 3UK6A 1AQYA 1P75A 2WTUA 4TQUS 4LWZA 2QM8A 3WP0A 3A1UA 2W2XA 1TU3A 1GL7A 4BUJA 1WF3A 3BH7A 4FIDA 4N3NA 5KSOA 1P61B 1ZUHA 5JI3E 4B2PA 5CM8B 3KXLA 4TZ0A 3GEEA 2QEQA 3ZLJA 4HAXA 1JXMA 2WWHA 3A6PC 1U99A 3ADBA 4GBMA 1KI9A 4P3YA 3VR4A 1SKYB 3E5HA 4V0OA 4X8HA 2W2TA 2WPDD 3OEEA 3AVPA 3HPQA 2REOA 5BQ5A 1R5BA 1WCV1 2FFQA 2O8CB 1GDDA 4ZDIA 4FMDB 4DLZA 1QHHB 1R0WA 4FWIB 1LS1A 4QKQA 2ZUCA 1OE0A 1E9DA 2F9MA 1J7KA 1ZBDA 3CF2A 4QJ4A 3R9IA 1JAHA 1CJTC 3X1WA 5J40A 1DBSA 4LJ5A 2W83A 4URZR 2AKYA 1OHHA 4EPTA 2BBWA 5DO9A 1XZPA 2OO7A 1KMQA 5F2EA 3H86A 4A2WA 2IUSA 4EFLA 5EJEA 3SHFA 1QDEA 4XVUA 5M04A 3GLGE 3PEUA 5LDDC 3BOSA 3GJ4A 2J0VA 3KJHA 3D8BA 1JXOA 1AGPA 5HZKA 2ZM5A 4LBYA 4MKGA 3B1WA 4KBGA 1P73A 1CXZA 1E9RA 2C77A 4Q47A 1KI2A 5H70A 4TT3A 4ERNA 1EGAA 1SVOA 2BEJA 4BLTA 3U44B 1RYHA 1R8SA 2BV3A 4O3MA 4GOKA 4ASUD 4DCVA 1HQYE 5JCZA 4IJMA 4XJXA 4FMCF 2QMUA 1DADA 5KDDA 1E2KA 3I8SA 4HAVA 3GLHB 3JZAA 4IW3B 4MITA 1ZD8A 2OUKA 3WNCA 4DIEA 1XP8A 4UNRA 1U8AA 1W4CA 2PEZA 3B13B 3KTAB 1UKVY 4BASA 4DLVA 4IHQA 3C15C 2IXGA 2GJAA 4KXFB 1LF0A 1OFIA 4KODA 1O3YA 4B3FX 4KVGA 4PO8A 2CE2X 4IDHA 5JECA 1HT2E 1NMZA 4JVLA 5B2ZA 4DSTA 4YMUA 2CL7X 2IS6A 1G3IA 1OYWA 4JJZA 4CVNA 4RJLA 2AHOA 1Q22A 2KE5A 1IQPA 3NDPA 1AJEA 3KXIA 5FUYA 4PSAA 4Y0VA 1E94E 2ZU6A 4AD8A 4V0ME 3QSYA 4PHTA 2YYZA 3O47A 1W46A 3VU9B 4OL0A 4W5HA 3HYRA 3LLMA 4YDSA 3K0SA 2HCJB 4Z8XA 1HH4A 2R6GA 1YR7A 4O2LA 1KYIA 3VAAA 4DC9A 2ODWA 2CVFA 4RD1A 1R0XA 3RANA 4ACBA 4CEHB 5JEEA 1RW4A 3B7GA 5FBRB 4B47A 5FTNA 2V3CC 1HT1E 3QXCA 3O8CA 1DAHA 1Z6YA 1OJLA 1UBCA 3AF0A 2G9NA 4ZCMA 2B21A 1XD8A 5CB8A 2FPLA 4QGAA 3IEUA 4E5UA 1IM2A 2OM2A 2ZYTX 2CHVA 2BM0A 2Q9CA 2YZ2A 4LZZA 2WSSA 4TSFA 4EJSB 1I2MA 3KFVA 4MRRA 2AX4A 4NYIQ 1YZQA 3U3KA 3GFPA 2WMOB 2CNWD 4FCWA 3FWYA 5AJYA 1Q44A 2JAQA 1NVXQ 1XPRA 1G9XA 4H1UA 1D2NA 3BFKA 1SVIA 2UZIR 1GFIA 4B2LA 1B0UA 2O8EA 2QZ4A 3NXSA 3TH5A 1VYVA 2FZ4A 4JL5A 2QBYA 6Q21A 2H7VA 4HLQB 3QKRA 1QHXA 1PUIA 1FFHA 3M4YA 3P27A 4F38A 1XTRA 4DT1B 2O8BB 3AH8A 1E2HA 2ZSAA 1IJEA 3SQXA 1G8HA 3ASZA 4QGHA 2JEOA 2IYLD 2ZJAA 4AWXA 1W2HA 2FE4A 3QNUA 2YC2C 4M4SA 3AF4A 3E1SA 5G40A 1W0KD 3B9PA 4LC0A 5SZIA 3CF0A 4UNPA 5JMTA 4MRPA 2D4HA 1E9AA 2IWRA 2VHTA 3PG5A 3B2EA 5CIWA 1D6JA 3MJRA 2VL7A 1AS3A 4KI0A 2Z0MA 5TV2A 2X19A 2FNAA 3BAFA 4L8GA 4IVRA 4BFVA 4OHVA 1J99A 4DLRA 1XCGB 3ZQJA 2Y8EA 4M1MA 1EG7A 1F6BA 2WAXA 3A1SA 4DUGD 4HDQB 3LA6A 1NVWQ 1RPZA 3V4FA 1IY2A 4DB4A 2H57A 3BS4A 4C2TA 4ZIRA 1KDRA 2AD1A 1QG2A 3FGNA 4LGMA 2QTVB 4D25A 2KBFA 4O0MA 2V1UA 3MWKA 4KVAA 2PCJA 2BM1A 3RC8A 4IEIA 3OZXA 1T8TA 2ZRHA 5D3QA 4A2QA 1KK3A 3FMPB 1IBRA 1VCNA 4NH0A 1DOAA 4AYXA 5EE1A 5GJBA 1IOZA 3QE0A 3UKDA 2NOAA 3RS2A 4GSYA 3VKGA 3ZIAA 2QL6A 4WOPA 2GF0A 4MYCA 1PZNA 5DHAA 2HUPA 3GJ6A 1XJQA 3VKHA 5JS8A 1NLFA 3LO5A 4A4DA 5H68A 1H8EA 1NBMA 4M22A 5G3ZA 1QVAA 1CP2A 5A5GA 1PLLA 1ZC3A 4PC6A 4Q00A 1KJYA 5JJLA 2J3EA 2VPPA 2GEUA 4M1TA 5D3MB 4JLMA 1ZUNB 3EG5A 5CK5A 1SVKA 2HCBA 2ZE6A 2CLDX 2NGRA 4Q9HA 1EFRA 4JKIA 4NHOA 3RLFA 3E2IA 5L3RA 1S1MA 1XU4A 5FBQB 1EXMA 1NI3A 1UM8A 2JLQA 2FH5B 4ABYA 1NLYA 3UMRA 1KK1A 1KO8A 1W47A 4ON9A 721PA 1T8UA 4ZV4A 5UKDA 1PVOA 3BJIC 4NCJA 3MWYW 4Q7KA 2JJ1D 2H8KA 1OH5A 1E0AA 3KKOA 3FOZA 2VSFA 1ZM7A 2BKUA 3F3YA 5FOSA 1KO5A 1N5JA 1KHTA 3PJRA 4PTLA 3WBJA 1KAGA 4PANA 1I2DA 3CLVA 4K81B 2PLFA 2RAPA 1W4BA 2GJKA 4A0FA 2ZRJA 2NO7A 3QXHA 2GZDA 2RHDA 3TE6A 4MKHA 2H17A 2OBNA 4HLCA 4IVQA 4M0LA 1HURA 1YZTA 4LHXA 1CR4A 5L3QB 1JPJA 4DLSA 1FNNA 1NG1A 1NN3A 2HF9A 1OXXK 4ZI3A 3GLFA 3TGPA 2VP0A 1NMYA 3S1AA 3LBIA 1QHHA 1CIPA 2GZAA 4G5OA 4MDEA 4KLZA 1XTIA 1M1YE 2F3RA 2IYZA 2ZRDA 2NTYC 5AR1A 3TR0A 4QHSA 3R8FA 1H65A 2O8CA 4Q1EA 4PQFA 3AGPA 1AZTA 3F5FA 3WRYC 2Z83A 2AK3A 4W9MC 1WE2A 4BFXA 1XTSA 2GK6A 4ZCIA 2XJ9A 3GLIB 2NZJA 2Q9BA 5BN5A 2NMVA 1P4SA 4I1UA 5DH9A 1D5CA 4B48A 2V8OA 1R0ZA 4QBHA 1ZD1A 2XB4A 3UPUA 3OFNA 1M7GA 4MA4A 1MOZA 4FINA 3G0HA 4D0NA 1Q1EA 1ZVQA 1FX0B 1EWQA 2B7BA 2JLUA 4B74A 1CRQA 2QE7A 1U98A 1ODFA 2FWRA 4ITRC 1Y3AA 3ZJYA 3UMSA 3N2EA 1SVSA 3GJ8A 1VMAA 2XJ4A 3NC1C 1ZNWA 2CCGA 1YKSA 3WYGA 2FV8A 5JBQA 1TU4A 1E69A 1S8FA 1U2RA 4FXPA 3W3AA 4LUCA 3X1YA 4XSGA 1N0UA 3EC1A 3CUEF 4AKIA 4KU4A 2F9LA 1XWIA 2G6BA 4DLTA 4TLCA 3N5CA 1LVGA 1XD2A 3LWNA 4II7A 4M9SA 4ARZB 5C4MA 2C9YA 3ASYA 5DN6D 2XOKA 1NY6A 3QPVA 2P67A 2HT6A 4HUQA 4JKYA 1IN5A 4KJZA 4V0NA 1Z0KA 1VG0B 1IHUA 2QENA 4TLEA 2P5SA 1L2TA 3IILA 1U9IA 4GFDA 5AJVB 2J7PA 4PC3A 4BLPA 2PBRA 5CITA 1LW7A 2EFDB 1TF2A 1VCOA 2Z4SA 1TEXA 4FMCB 1UAAA 4XIGS 5TY0A 3U6BA 1KSGA 3VFDA 2R8RA 1Q0UA 5DYGA 3GLGB 4DUGA 4E22A 4IVPA 1CLUA 1TQ2A 2WWFA 3ICQB 2ZS9A 2LCFA 3THXA 2G77B 3GD7A 2VO1A 4W5WA 2XXAB 4A0RA 4PO1A 4XD7A 4RFSA 5DHFA 1GKUB 1QHYA 2ZRMA 2QAGB 4KHZA 1JJVA 5HKKA 4X8MA 5GVSA 1W7AA 1TX4B 2TMKA 1SKQA 1Z07A 2WIAA 3BB4A 3QKTA 4LJAA 4Q4AA 5JWOA 2RGDA 3IQWA 3ZD6A 2IBMA 4PR0A 2C5LA 2D3WA 2PT7A 1YRBA 3AP2A 5KO2A 5L3SB 2HJGA 1OH7A 1I4TD 5P21A 4EFMA 2ZR0A 2V9PA 2A5FA 2J1LA 1G20E 2XITA 5EZ6B 3FHOA 1KY3A 2WJYA 4FCTA 1KK2A 1NKSA 1N25A 3VNVA 1UF9A 3ZVMA 2GWHA 1U8ZA 3K0FB 4YLGA 1E0KA 5LB2A 4P4TA 1NSTA 3SYKA 2ZAOA 1QHIA 1T91A 2ZITA 1J8YF 3OESA 4Q1BA 4B2IA 2VP4A 2C04A 1M34E 2DWPA 1KZ7B 1M7HA 4FMBB 3CO5A 4Z54A 1DAGA 2BMJA 1W0JD 1E0JA 3AV0B 2WWIA 4LHVA 3KKPA 4BQSA 2WKRA 1KY2A 2CNWA 4HATA 3THYB 2HYDA 2VP9A 4BZQA 1FL9A 4I4LA 4NZYA 5HKKD 4PPNA 3GMTA 2VP5A 1F3OA 4AI6A 2RGEA 4B3BA 3DKVA 4HSEA 4OQFA 5HCIA 1KSJA 3PITA 2R2AA 1T0JB 1W44A 3BFXA 4LV8B 4MRSA 2GNOA 4BLQA 1T3HA 3MRSA 4D82A 2QAGC 2O0KA 3QXSA 4Q7MB 3OAAD 5DE3A 4A0GA 1TTTA 2FDCA 2ZREA 1A1VA 4BEBA 3RSOA 4KAXA 3D6TB 3U7HB 1I4DD 2RGAA 1Y63A 2PX0A 4B75A 2QORA 2NO9A 4RZ2A 4S2EA 3L0SA 2HXSA 2Q9AA 4TTRA 1OLOA 1P9RA 2H1LA 4LBWA 3U61B 2BMDA 3QPWA 1FP6A 2DWOA 4WZ6A 4DCTA 1G1MA 3RRZA 2OSBA 1R4AA 4QJ3A 1XTKA 4D0GA 4Q4JB 4EUNA 2WJIA 3TSWA 1M8PA 3NEJA 1F2TB 5KPJA 4M53A 4HZUA 1R8QA 3A1TA 5IF9A 2AFHE 2G1JA 4YONB 1HYQA 5F3WB 3EZ9A 5B57C 2ZYUX 5FPYA 2GA8A 3KL4A 4F4CA 4EJSC 2QRNA 1Z08A 2QY9A 1UKEA 4C0HA 4NCIA 2QE7D 3TSZA 2ZEJA 5FPTA 4B6FA 1AS0A 1SZPA 3BGWA 1D9ZA 1P60A 5FUXA 2IWHA 4LX0A 1L4YA 1CU1A 1XTJA 3QKSB 1IONA 4V0KA 3EIEA 2QRZA 4IDOA 2P6NA 2PLRA 4RCZA 3E70C 3K0AA 1N6RA 2IYWA 2WIBA 3AVYA 1S3SA 3PFIA 2IA5A 1NVVR 1M74A 1ZIPA 4EPRA 4F7WA 4UJ5A 3NKVA 4HLDA 4RZ3A 2VSXA 4BE7B 2P3SA 1OIVA 4QBGB 1AIPA 2CJWB 2HV8A 2Z5FA 4B34A 4G5QA 2ZAMA 4OHXA 2MMCA 5AK0A 1E79D 1CRPA 4TTQA 1VCMA 4JL8A 2C9OA 3ADDA 3DM9B 2PH1A 3MLEA 4RD0A 1GL9B 1MKYA 1EWRA 2O8FB 2B8TA 2JGNA 2XSZA 1TF7A 4TTPA 3LQQA 4C7OB 2J7KA 2ZI3A 2QPAA 4TMKA 1OT3A 5AUOB 4CEJB 3LAWA 3TVDA 1MRNA 2QPOA 3LW8A 5GVRA 1KO7A 4R7ZA 3HYTA 2IYVA 1EFTA 3MGCA 3U60B 1W48A 2IHBA 3SYLA 3K70D 2E9SA 3C7KA 3KB2A 3CPJB 3LFUA 1NBME 2FOLA 3MSXA 4CF7A 4XD7D 2C99A 4DVGA 4RD4A 1RIFA 5TDHA 2KSQA 4DEXA 1IY0A 2RMKA 2DYKA 1KSFX 3DKPA 2VF8A 1P72A 4U00A 4UKDA 3RS5A 4HB3A 5EQTA 3TAUA 1UKYA 3O8BA 1YZNA 1IXZA 1J2JA 1E99A 5KUTA 1JEEA 5DI3B 1E2NA 1X3SA 1XCPA 2IYUA 2DFNA 1G8YA 2IEZA 1KTVA 4QBFA 5K8IA 3Q9LA 3KJIA 1MR3F 2FSIA 3P20A 3SZRA 4AC9A 4URUR 4CEIB 1PLJA 3GCGA 4HZUB 1MO3A 2HDNB 2V4ZA 4JLJA 4B3GA 3QEOA 1RVDA 1TNDA 1UADA 4PC2A 5FBWB 5F98A 1F60A 3CX7A 3DOFA 4DSNA 1SHKA 3V9PA 2CE7A 3VR6A 5AJXA 4LHYA 2ODBA 1BYIA 1SULA 1OFUX 2FSGA 2WZQA 3AGQA 2ANBA 4RD2A 2X2EA 4DDUA 1GP2A 1SXJB 4Q4HA 2AD5A 2OFXA 4KCGA 2NO1A 1II8B 4WAUA 4QJ5A 1FQKA 3AKEA 2D7CA 3QF4B 3UXMA 1ZM9A 1S0UA 2PZFA 3BERA 4A8JC 1MO4A 5BN3A 4GNKA 4Z1MA 2WJVA 2GAAA 1G3QA 3V00A 5G53C 3TIFA 1NVUQ 2IS4A 3FHTA 1CR0A 3CR7A 4G5RA 2O52A 3GJ7A 2ONKA 3ZVRA 1OF1A 3IO3A 4I99A 2OG2A 5EE0A 2G0NA 4C0SA 4IFBA 3LBHA 4I1VA 1KMHA 3IDQA 3P4XA 1T9HA 3PVSA 2OCAA 4Q18A 4B32A 3F8TA 1E9SA 4FWTA 3C14C 5J4YA 4QHYA 4UNNA 2IT1A 3N70A 5JI2E 1A5TA 1ZMXA 3FDIA 3CM0A 4NL4H 1GUAA 1XEWY 3UATA 3CRMA 3TAHA 3CW2A 2GRJA 1NRJB 1OIXA 1LFDB 5E4FA 3HR8A 3Q8XB 3SU8A 2JLWA 2XZLA 4M1SA 1SGWA 2XGJA 2ZRGA 2NPIA 1Z0IA 1DAKA 1XX6A 2XZPA 3VR2A 4B76A 3GJ5A 2ZJOA 2QQ0A 3OAAA 5TXGA 1ZCBA 1OHHD 1Z06A 4BFZA 2A7QA 1ZC4A 3CZQA 3L0PA 3C8UA 3CRQA 3KUCA 1HQCA 2R62A 5JJIA 2EWWA 2GVDC 3D3QA 1BS1A 2AR7A 3GEIA 1R6BX 5LD2B 2YOGA 5AJWA 4BGDA 2Q3MA 2QROA 4DHEA 2CHGA 2O5VA 5DLQC 3QEJA 1BKDR 2F6RA 4RKFA 3FKSA 4TL9A 2JLZA 4HYYA 3U3OA 5K8TA 1RRPA 4IOKA 1HTWA 3EPHA 2ZU0C 4DCNA 3QQ5A 5BYJA 3MWLA 1GWNA 1P3JA 2MMGA 1N5LA 2FZLA 3U4QB 1ZW6A 1Z8FA 5FUVA 1JR6A 2N42A 4P4SA 4LHZA 4IFEA 3IPYA 4L9SA 3B1ZA 4D4JA 1SXJC 1TMKA 1ZM4A 1DELA 1FW6A 5GJWC 5IK2A 4TMWA 5DI9A 2V6JA 4RZUA 2J0SA 3LNCA 2XX3A 3QBVA 2WWXA 2EYQA 3DHWC 4F93B 1Z0AA 3W6PA 3RS0A 4JZKA 5LD2C 1ZCAA 2F3TA 4M2LA 1W36C 1GKIA 2ZS8A 3K0CA 4Z51A 1N6IA 1XD2B 4ARZA 4QGGA 5CB6A 5CYPA 2D2EA 5KNCA 4H9GA 1IN7A 3GLHE 2QG6A 3C41J 1XD9A 121PA 4GZLA 2O0JA 1BMFA 1Z63A 3P32A 3B78A 2WBLC 3T1OA 2A5YB 4MYTA 4AURA 2OFOA 2ZE5A 4IOMA 1J70A 4A92A 3BWDD 1JQJC 1E2PA 4PHGA 2XB2A 4BZXA 2ORVA 4BFSA 1XZQA 1N6PA 4BRUA 1QRAA 2XEXA 5E7JA 3CX6A 4C0BA 3ZVNA 2JDIA 4NPHA 4NYIR 1EFRD 2GCOB 3QJYA 1JALA 4EFNA 3LRPA 4N1AA 1KKLA 2C2HA 2J7PD 1VPLA 4W7SA 1M6NA 5CLLA 3CF6R 3O8RA 4RZXA 1P6XA 2BBSA 1R10A 3RABA 4M1KA 3GLIA 1DG1G 4OHWA 2NO6A 4ESVA 1Z6TA 1W36D 2J45A 3RS4A 1H8ED 1NBMD 2BJWA 5DN6A 3CRRA 1ZINA 5DYIA 2LKCA 1YQTA 3T15A 1IXRC 1DAMA 3FMFA 3GJXC 1E9CA 3EXAA 4LYJA 5FI1B 3C16C 2O8DA 4XH9B 4MKIA 3THWB 5JEDA 2GF9A 2KI5A 4PX9A 1FOEB 5GJCA 3J81k 2VTKA 2ZRPA 2F1IA 4FD2A 4RCYA 3BFVA 4FMDF 4C30A 2EW1A 3KKNA 4LOAA 1OKKA 1YU9A 2I1QA 3VQTA 4RKEA 2BJVA 2WHXA 2QT1A 3X2SA 5EP4A 3P4YA 2CLSA 4LYHA 3AM1A 1JNYA 4AYWA 2WSMA 5DNYB 4LCBA 3ZS9A 4GI7A 1NJFA 2X8AA 3T12A 4US1R 4A82A 3GJ3A 3H1TA 1XXHB 4C0QC 1JR3E 2PEYA 2QMOA 4I1SA 1G291 1Z3IX 2AN9A 5FL7D 2OXCA 3AUXA 3SC3A 3TJZA 2HT1A 2WSSD 4D81A 2IYXA 4QC2A 1MT0A 5KSYA 5SZHB 1K5DA 1AK2A 2VBCA 5J5CA 2ODNA 1VCIA 1LF5A 4K46A 1SHZA 1ELOA 1JI0A 1A2KC 4Q9LA 4D4KA 4JIMA 4EPVA 4WXPA 2W00A 1G5RA 1TEVA 2ZJZA 2ATXA 1Z47A 2YKGA 1XB2A 5D3MA 2EQBA 1E0SA 3Q7PA 2BBTA 3A4LA 1QBKC 1OFHA 3EZ7A 4UQOA 4EAQA 3DEFA 1TPZA 4OHYA 1WDTA 1NNEA 4YQFA 4PC1A 4O25A 4U5XA 3UANA 4DLUA 1E9EA 1C9KA 3KDSE 1HY3A 2ORIA 3NC0C 3K9LA 3THWA 3BIFA 3FVQA 3IKJA 4TN1A 4CZ2A 1T4GA 1NG9A 4C2UA 4HB0A 3A58B 4JLNA 4N0DA 3CZPA 5B58C 2HEIA 5C46F 2GXUA 2BVNA 3NDBB 1U0JA 3CR8A 5BYKA 3IO5A 4GP7A 4Y0AA 5TARA 1K6MA 4R2IA 4OK6A 4K8OA 3NBZC 3ECCA 4HB2A 3AVXA 3TMKA 1G17A 3NWJA 2K5UA 3GEHA 2HLDA 2J41A 3K1JA 4ZIRB 1XEFA 3LW7A 4NCNA 4GZMA 4PZLA 3NBFA 1L7VC 3KKQA 3IIJA 5IDVA 1N5IA 3B9QA 3OHMA 2LKDA 1CKEA 1NIPA 3RC3A 2F55A 1OKKD 4XVRA 5KNDA 1E98A 1Z0DA 4MKFA 3FMIA 2C98A 4OJQA 3KQKA 1W4AA 2GDJA 2CBZA 1YZGA 4Q19A 3HP1A 5EE9A 3DO6A 4KFUA 3H4MA 3OIUA 3ZS8A 2GBLC 3MAAC 3CH4B 3A1WA 4A1FA 1US8A 3RNLA 2DB3A 1LS6A 4TLDA 1HE8B 4AG6A 2KJQA 5FTKA 5FPKA 2W2VA 4LV6A 1JPNA 3L82B 2ZJBA 2CK3D 3VX4A 1E96A 2GEDA 3HWSA 4AIIA 4UNSA 3VTKA 1VYTA 2ERXA 2RGNC 3Q5DA 4N0EA 1Z5ZA 1YR9A 2GILA 2JA1A 2ZSDA 4TWZA 1X8JA 2BMEA 2KBEA 1U94A 3WNDA 3DZDA 1N0VC 3UWKA 4HLUC 4P33A 1FQJA 1CJKC 1MV5A 2VLIA 4LBZA 5EXSA 3ZGXA 2JJ8A 5B30A 4V03A 5KDOA 1DAEA 2O8EB 4AK9A 4U02A 4MUAA 1Z6XA 2BHRA 3FYHA 3EW9A 4WVFA 4JJKA 4DLYA 4ZKDA 2YINC 4DLXA 1JBKA 3R7WA 1TAGA 1A82A 3FHCB 1E9BA 1Z83A 3AVVA 4NCHA 1G16A 1II0A 2ZIAA 1KK0A 2EFHB 3WHLA 2FGKA 2DPXA 4LYFA 3EWSA 5FL3A 5JLJA 3VKWA 4TYYA 4PSVA 5EP3A 1AS2A 1FTSA 5BN4A 3ZDQA 4JT4A 3RWMB 4QM6A 2FSHA 2RGCA 1P2SA 2ZVQX 4AKGA 1G3MA 2FEOA 5DGXA 2FEMA 1VIYA 4L16A 4RD6A 1YZKA 5CIQA 1EX6A 4L5BA 4P4SB 1H8HD 5J4VA 2VRWA 4M9QA 3IUYA 4ASUA 4MDFA 1NN0A 1HEIA 4IKEA 3LX5A 3I72A 1Z29A 4QGFA 3HPRA 2DR3A 2IW3A 2OE2A 3BH6A 2WMNB 4PPFA 4RD3A 2X1VA 3B1XA 1MO6A 1OFTA 4UXJA 3SBDA 2ZR9A 1G7SA 4Q1CA 1XF9A 4TL7A 5HE8A 3BORA 4G1UC 4JBYA 2PT5A 3K9HA 4NTZA 4QNRA 4V02A 4EPWA 1UBFA 4QNMA 5IT5A 2J0QA 3AQ4A 1OH6A 3ZZTA 3B60A 4PSKA 3M1IA 3QY0A 3X1ZA 1LY1A 4RFVA 4OHZA 4IDNA 3B6EA 2P2LA 1VIAA 3TQCA 2ZRBA 1VG1A 1KMHB 3KQLA 1Q21A 2D2FA 2WICA 2P6RA 2CHQA 4B43A 4RSGA 2OCPA 1PV4A 4IOLA 3QI2A 2D06A 3BXZA 4KFSA 4LJ7A 3LBNA 4QBIA 3WBKA 3A36A 3EAQA 4GP6A 4DB2A 3Q72A 3W3ZB 1AKYA 1DVRA 1XJ0A 3ONWA 4NKRA 4WXRA 1G4AE 2F7SA 5K8LA 3LLUA 2R65A 1GAJA 3IBGA 3KTAA 3B85A 1WBBA 3FPAA 3LXXA 1NY5A 4B3DA 3QF4A 4PXAA 2R6AA 2YOFA 2CLCX 1QVRA 1XMSA 1GOTA 1CJUC 4M21A 4NBSA 5CK4A 3BB3A 4Q4HB 1SXJA 2BEKA 1ESNA 4IXNA 3OEHD 2OBMA 3WNBA 2JLSA 2G88A 2FGJA 3EA5A 1IN6A 2FPMA 3KFXA 2XOKD 4AYTA 1E32A 1GNPA 2OILA 1TF5A 4LV5B 3GLIE 3I5XA 1EESA 5C4GB 2YHSA 4ZDWA 2MSEB 4JLVA 2VA8A 3CNOA 4PFSA 2UKDA 4R71A 1GNQA 2FPKA 2VHUA 1AM4D 2ZUBA 3AF3A 2QAJA 3JZMA 1KI8A 4TYPA 2WWYA 4CEIA 4DKXA 4DWJA 1P7CA 4U7DA 5HTKA 4XSHA 1K8RA 5B64A 1QZXA 1TQ4A 5HR5A 2EFGA 4OJKA 1KI4A 3OIYA 4KSCA 2RGXA 2IYSA 4LJ4A 5E7IA 1II8A 1R2QA 1KSHA 2FA9A 2VHQA 2IX3A 4TQAA 3EIHA 1GSIA 2WJGA 3KJGA 4PQRA 1DARA 4IDQA 2XTNA 3OE7A 3THOA 5JRJA 4D26A 2MSDB 4LK2A 5BWMA 1G41A 1KDOA 4MRVA 2R44A 2ZRIA 5BW8A 3SNHA 4FW9A 4CW7A 4L15A 4Q02A 5JHHB 1G6OA 3TW8B 2IYQA 5L3VA 2V6IA 3C4JA 1E2QA 1X86B 1OB2A 4LPSA 3ETLA 2VYFA 3KQUA 1RRGA 2DY1A 4FCVA 1W49A 2ZRLA 4B71A 3KJEA 2E1RA 4NMMA 1ESMA 4JMPA 2CEAA 2F1HA 5FTJA 4TT3D 3W34A 5G3YA 4C7OA 1YZLA 1C4OA 4OK5A 4DDVA 2REBA 5LBIA 4Z8YA 2CXXA 3BE4A 1OPXA 2W6JA 1R7RA 1G8PA 3D31A 3CWQA 1E2IA 3WMEA 4PAQA 1JJ7A 3QIAA 5L8VA 2B7CA 2HYIC 1T5LA 1FZQA 1S9DA 3HDTA 4XOIA 4HDCA 4CGZA 3UIEA 5E95A 3N2IA 3ZZUA 1GRRA 4TLBA 4I81A 2QNRA 4LPKA 3VR3A 3TKLA 4MYUA 5HPYB 1OSNA 1WBDA 4XWKA 1KJZA 2AK2A 3SJAA 1Z0JA 5KOYA 4JSYA 2G1KA 3KXKA 4QHTA 2P5TB 1NMXA 4B35A 2IEYA 3VX3A 2ZI4A 1F48A 3AKYA 1E3MA 1JECA 3CKLA 1HE1C 3WHKA 2X77A 2F1RA 1WRBA 2GHIA 3L2OB 2IYTA 4HB4A 4Q7LA 4YXWD 4G3XA 2HXYA 4JVSB 2QA5A 2RHMA 1E1RA 3MUFA 3SJCA 4QRHA 3AP1A 2GEVA 2A9KA 1Q3TA 3C5HA 1NSFA 4OBEA 2GJSA 2GJ9A 5IK2D 2ZJ8A 1DE0A 4NYMQ 2QP3A 2QN6A 2RCNA 3OIVA 2ZROA 4US0R 3A8TA 4F4IA 2QTHA 1V43A 4OQNA 4KYIB 3K0AB 1G18A 4M8NE 5FPSA 1KDPA 4DJTA 3QKSA 1N0WA 2OZEA 2I4IA 3MFYA 2GJ8A 5K8UA 4YC7A 3PXGA 4BLRA 4C0AC 1YR6A 2V7QD 4JL6A 4MGYR 4BWYA 4ZO4A 3U6KA 5HCNA 1KOFA 1TQDA 4P32A 2Q21A 1GM5A 2JLVA 3MD0A 4JLBA 2GTPA 3HU2A 2WKQA 3SR0A 3UMFA 2ZS7A 1P2TA 2EFEB 3PUWA 5JCPA 3TR5A 521PA 3EZ6A 1IN8A 2YC4C 4E09A 5FOWA 3W6NA 1FUKA 1CR2A 4F91B 4BEJA 2IS2A 5KNBA 3WRXC 2C96A 5GJVC 4YMTA 1DAFA 1P9WA 1YVDA 3ZZ0A 3P26A 1UBGA 3CBQA 3AVUA 2A5JA 5JWRA 4G5GA 1W0JA 4HDOB 4AKHA 4YMVA 1JQLB 2A5GA 4L9WA 3THYA 3RRNA 5F9FA 2XSZD 5AJZA 4BFWA 2A30A 1FPMA 4ACAA 2GETA 2OCYC 3QKUA 3BH0A 1T5IA 1W0KA 3FFAA 1KAOA 1OXSC 3PUVA 2DCUA 1W4RA 4W5JA 1ZD9A 3GP8A 2Q3FA 1MABB 3AF2A 5FUWA 3VR1A 2Z43A 4G5SA 1JEDA 2CL6X 3I32A 421PA 1GG2A 1TQ6A 2D74A 4YXWA 1OXVA 3K0FA 3NG1A 1G3RA 2R6DA 1NN5A 4F4JA 1XJCA 2V54A 4BFTA 1Q57A 4DDWA 2YOHA 2IC5A 2L0XA 2XTZA 3I8XA 2GCNA 3DMDA 3K9NA 1X6VA 1JR3D 5G41A 4WW0A 1U0LA 4D2IA 5JZVA 4ZCLA 1EFUA 3TUJC 2J59A 3KZ1E 2QSZA 3IIKA 3TSOA 2ZRFA 1RC8A 1O87A 4HAYA 5J47A 4PHFA 3X1DA 1M7BA 1ZYUA 4DSUA 1VECA 1N6NA 4YDHB 3IPXA 1DG3A 4Q4LA 2ZRCA 1KNQA 4WA7A 1UFQA 4NP6A 4IOJA 1LV7A 2WPDA 3OEED 4Q48A 4DEYA 4RFSB 2C95A 3P1JA 3LQRA 1KJWA 5KTYA 4LJ8A 2GXAA 2HJVA 1DEKA 3PR1A 3DPUA 2ZI9A 5CJPA 1NVVQ 2EWVA 1VHLA 4DIDA 4US2R 1DAIA 1L8QA 2FN4A 2ZTSA 2IK8A 4OQXA 3U7FB 4XWOA 1DO0A 1EFHA 2HF8A 2XNDA 3DL0A 1XPOA 5ELXA 2WJHA 4GOJA 5AUPB 4GRAA 1CR1A 4WIAA 2I1VB 3EA0A 4Q4AB 2J9RA 3CONA 3I73A 1W36B 4UJ3A 1GTVA 3HU3A 2B6HA 1KKMA 2IF0A 2QAGA 5LB4A 1VG8A 5BXQC 1WA5A 2A2ZA 3R7WB 1II9A 4A36A 2P0EA 1YHNA 1BIFA 2LWIA 2ZRAA 1COWA 1UEIA 3EWAA 3HU1A 4KO8A 2F43A 3W5IA 1KGDA 2BBOA 4LBVA 4NDZA 3I62A 4D4MA 4UXIA 2QQEA 1ZRHA 3FFBA 3RHFA 4E07A 2YNMA 4J0QA 2VHJA 4M9XA 1D8TA 4Z1MD 4MGZR 1M2OB 1UJ2A 2EVWX 1D9XA 1ZNYA 3KX2A 5FPHA 2OEPA 3Q3JB 2ZSFA 1N3BA 3EARA 1A7JA 3R20A 5EUMA 1P9NA 1ZNXA 3SFVA 1MRSA 1CJMA 3RS3A 3CB4A 2VEDA 5FTLA 5IHPA 4C0JA 5F9HA 3SFZA 2PZEA 3K0CC 3AF1A 3K09A 5FBVB 2R6FA 3QENA 1RZ3A 1S1CA 2CCJA 1X1SA 3AP3A 4DXAA 1US8B 3BK7A 3WYFA 2FFBA 3PIRA 3T5DA 3TLXA 3IEVA 4JBXA 3UG6A 2G0TA 1G21E 1QF9A 2JCSA 2VIIA 4HUTA 1WXQA 5SZKB 2H5EA 1YE8A 1ZU5A 2CVHA 2NQ2C 2W58A 3UWOA 2XAUA 3ZD7A 1ZUIA 2DFTA 4CDGA 5C18A 3GFTA 1E4YA 3RAPR 4XWAA 3KQHA 4HLUA 1EX7A 2RGBA 5FBLB 5L3QA 5FH9A 5DSZA 5IRCD 4EPXA 1FX0A 5A4JA 3LDAA 1A4RA 1TUEA 2GVZC 3B5JA 3K0EA 3TK1A 4B3XA 3CPEA 1I4LD 1G8FA 1P2VA 4JLDA 1QHSA 2IUTA 2VSOA 4LRWA 3ICEA 4Q1FA 2G3YA 1XMJA 3TNFA 3ADKA 3OIWA 1BO6A 1GRQA 2FF7A 5FL7A 4OQLA 2WKPA 4OK3A 3KKMA 5JWHA 4TMTA 2YWEA 4GDFA 2SHKA 3PEYA 1MO5A 2JIZA 2JLRA 3MJHA 3SJBA 4GL2A 2V55B 4AG5A 1NF3A 1XPUA 2NO0A 3FTQA 5KDLA 2IF2A 3S1AB 3R8CA 3GLFB 2ZJ2A 4RVCA 5TB5A 2QMEA 4KBFA 5KU1A 4RY2A 1MH1A 2X2FA 3K70B 1S3GA 2ATVA 4L4UA 3W8RA 3PUZA 2ZI5A 4Q66C 1U8YA 3EIQA 2KWIA 4A0HA 1BYUA 3O8DA 4X8LA 1AZSC 1Q1BA 4QG7A 1ONBA 3SS8A 3L8YA 3TUZC 1OH8A 1GNRA 2QMHA 3EZFA 1N6HA 5HZHA 3SHWA 1GVNB 1FNMA 3SI7A 3NHBA 3U3MA 1E9FA 3ZIAD 3U7EB 3AB3A 1F5NA 1TL7C 2ZSBA 3W8NA 4JYBA 4FI3C 5KYKA 2B92A 2RKOA 3W90A 5AUNB 4V0MA 3C5CA 4QM7A 3RS7A 3KB1A 4KFRA 4PZZA 3JVUA 3ND8A 1XXHA 4JLAA 1NKTA 4TMVA 2ANCA 4EDHA 2QUZA 1E2LA 2OFWA 4E03A 2JDID 2YWFA 1N2CE 4R2HA 1W5SA 2QGZA 5FOTA 1KO1A 1PUJA 4TZ6A 3NHAA 1C1YA 1OXTA 3FMOB 4IRUB 1A2BA 2G83A 1UBEA 3ND9A 4LJ9A 3R9WA 3LXRA 4OKSA 1YR8A 3LY5A 4YMWA 4LY6A 2BIFA 3RWOA 3F0TA 3SEAA 1Q3HA 3PEWA 4B3CA 2QT0A 5EXPA 3PV0A 2OESA 1KO4A 1G5TA 1CJVC 1U90A 2JJ2A 2FFAA 2O8DB 3ZQ6A 3EPLA 2AWNA 1AQUA 2NIPA 1J8MF 3A1VA 3CX8A 3DZ8A 4Q1DA 4XTRA 5EUQB 4AKEA 4ZDKA 1IAQA 2ZR7A 2UZ3A 4MRNA 4B33A 1G3UA 2GXQA 2PX3A 1WP9A 3U5ZB 3QG5A 3UG7A 1YZUA 4B73A 3IIMA 1X1RA 2C8VA 4V0LA 4URWR 5DISB 3WYAA 2IHYA 2V1XA 2Z6VA 1SVMA 2ZE8A 2ZI6A 1SVLA 2GCOA 3WP1B 1IY1A 1B23P 1E2EA 1XCMA 1ZM2A 3Q7QA 1T6NA 1UDXA 4BFYA 5TMPA 2WV9A 2AXPA 3QXXA 5EXXA 4ZI2A 2EYUA 1H8HA 4MYHA 2W0SA 4HAZA 1ZJ6A 5A0FA 1Z6GA 1VTKA 2ODEA 3QKRB 3D7MA 1Q12A 4KFTA 4NU0A 1FP7A 3FKSD 4EKDA 3ZH9B 2XNDD 8OHMA 4R9UC 4KLNA 4AY2A 1PLKA 2CL0X 4A15A 3FE2A 4OI1A 3T1TA 5CDFE 3WMGA 2DFLA 3U2QA 3JVVA 1YRAA 3BRWD 4DDTA 2AXNA 5H8WA 2WAYA 4ZPXA 1KI7A 3VHXA 1JR3A 4PHHA 2A3RA 3KUDA 1G5PA 3RRYA 1DPFA 1NIJA 1G7TA 4EJSA 2AL7A 3QPUA 3REGA 3DDCA 1WB9A 4DT1A 2JLYA 4P4UA 1IN4A 4OI2A 2O8BA 1S2MA 1ANKA 1RRFA 1WMSA 1Z28A 3HJNA 5KPDA 3T06B 5AUQA 2QBYB 2WOOA 2PMKA 4OQMA 1N5KA 4Q21A 2FFHA 3RVBA 3SYNA 1AA9A 3B1YA 3U4QA 1Q20A 2OV2A 2PZGA 2IXEA 4JVMA 3T61A 4A6PA 2RH5A 4A6XA 4CEHA 1E1QD 2IXFA 1VHTA 2JASA 2OLJA 1R0YA 2OAQ1 2GZHA 1ZP6A 3AVQA 3PUXA 1ZU4A 3I61A 1JAIA 2ORWA 4BLSA 1KIMA 3EPKA 1SVWA 1XXHE 2BWJA 2H18A 5FTMA 3REFA 4TMXA 2W6ID 3G82C 4CIDA 1G4UR 5FI0B 2P6UA 1E6CA 2B8WA 2ZQ5A 3VU9A 4YMSA 3SE0A 2NZ8A 3EZ2A 4TQ9A 4B44A 2AFIE 2JIZD 2YV5A 4X8OA 1ETUA 1RFLA 2ZYVX 3M0EA 2ERYA 2YVUA 3LX8A 1DS6A 4JLPA 2OHFA 2PL3A 3T34A 3AVWA 4D80A 4LHWA 3IBYA 3GFOA 1BMFD 1VDZA 2C03A 3CPHA 1QHNA 5AWFC 1Q1QA 3OF5A 3T35A 5J4KA 1ZAKA 2IYRA 4BPBA 3LVQE 4NE2A 2WWWA 3PUYA 3CH5A 3L43A 4IDPA 3WY9A 2CK3A 2GKSA 1G64A 4MGIR 4PC7A 1IXSB 4ILEA 1VKJA 2BC9A 3PEVA 1FTNA 2KB0A 2VP2A 3ZVLA 5J4LA 2Q6TA 1CULC 3T1VA 1E2GA 1QHGA 4DBLC 4ZDJA 3GLHA 3QVUA 3T1QA 2DFKB 1FMJA 4PAOA 3I4LA 2NPFA 5KHOC 3K53A 2GK7A 4PZYA 2QP9X 4C9BA 1G7CA 3QVVA 4EPYA 2JATA 3MWJA 5EP2A 2WJJA 5FR1A 1SXJD 4H1VA 2IS1A 2BKEA 2A5DA 4GT1A 4R98A 1AKEA 3IQXA 3T5GA 3U44A 2YJTD 1E2DA 2RGGA 1D2MA 3ZYCA 1HUQA 2FX3A 3GJ0A 1P62B 2R6CA 1GITA 3OFND 4HZIA 1HA3A 4KITB 4C0LA 4PO9A 3DMNA 4TYWA 3NH9A 1ZM3A 5ANRB 4LJ6A 4OYHA 2YWHA 4MGKR 4QL3A 2VHCA 4QXAA 1GILA 2REXB 4KYUA 2JJ2D 3U3JA 1XRJA 3CNNA 1UPTA 1OXUA 1S9HA 1EK0A 3U7GA 1Z0FA 1U81A 1R5NA 2IUUA 3SJZA 1ZNZA 5FOXA 3GPLA 1S96A 1COWD 1TUIA 2W0MA 3I3SR 4NYJR 3W5JA 3EPJA 2HLDD 2NG1A 2UVQA 1CEEA 3TUIC
chains in the Genus database with same CATH superfamily
3TVTA 3A1EA 3PPXA 2OAP1 1JE0A 4WLNA 1JDNA 1EDBA 4JZYA 1QIJA 4GHWA 3UUGA 4S2UA 4FKMA 2ONCA 3G9QA 2V3WA 4EGSA 3H6GA 4JXJA 4GC5A 4L50A 3ZK7A 4L3OA 5G0VA 3D02A 3LQ1A 4PPGA 3D6UA 2X8WA 2IHUA 1PHRA 1DT3A 3HB4X 4NSNA 4QOSA 4QYXA 2QN2A 4HN9A 4TM7A 2HU2A 2G5PA 4RGBA 5FJJA 3LT0A 1YZYA 5LQSA 3W4KA 1WPQA 2RGRA 2A78A 5JHGB 3TLZA 2XNSA 1IAVA 3VNUA 4EJ6A 5KSZA 4X6LA 2N46A 2PANA 3G5MA 1PNOA 1JB1A 1ZR4A 1E1RD 3TJRA 4JBNA 1MA3A 5HJ7A 4DMKA 1R6TA 3H87A 4BECA 3GQBA 2EC5A 3BTVA 4RQUA 4NPAA 3RYCB 2D1YA 4ZJZA 4M1YA 3QRWA 2PUHA 1F0NA 2HA5A 5JSHA 2ZUEA 1S4QA 2I62A 4MR7B 4R8SA 4RC9A 4MAAA 3PQDA 4LXUA 4QUEA 3L18A 3LC7O 4I1OA 1WNFA 2AI1A 3DBLB 4XFJA 4BDSA 4F4UA 1NQXA 1XRPA 1LNQA 4XASA 5LOVA 1TAQA 4YAEA 3RCBA 2VTBB 2Q4BA 2QU8A 3WQHA 3LI2A 2ZWPA 4F6RA 4E15A 1MG0A 2NV6A 4DCSA 3HO1A 3PHCA 1VSTA 3C1TA 2IH5A 2CMGA 1E1DA 1OIWA 3PLAE 1IJKA 1Q0TA 4MVJM 3S70A 2WYIA 3I0NA 4GMKA 4L08A 4A2PA 3SVTA 3Q5EA 1OX6A 4JFRA 3T7KA 5A4KA 4FNAA 1UKZA 1PZFA 3AX6A 3DFIA 4FZ5A 2XZDA 4HQNA 2O8FA 2OBXA 2Y4OA 3LPAA 3NALA 2EG9A 1H94A 1B16A 4Q5IA 5DMHA 1IRXA 2QTZA 4NCKA 1ZMTA 3C8MA 4KR3A 4ZMBA 1JHZA 3D3JA 2JCVA 3OCCA 4BV9A 2W6IA 1CB7A 2QZPA 1MX9A 5FOUA 3JYHA 4BN5A 3IHTA 1LBEA 2II6A 1L7XA 2Q3BA 3ZJUA 3JQGB 2J6BA 2VH5R 4N5NA 3FDXA 4K6KA 1X92A 1ZA1A 2P35A 4L5AA 4E5DA 2PLNA 5T41A 3RU9A 1X8LA 4M6WB 1QCYA 2BI7A 4URYR 1IZZA 3GY0A 2PJUA 4G81A 4LN1A 4WNIA 1OC2A 2AW5A 3PYXA 5AJTA 2CMDA 1JZSA 2F43B 4PCLA 3CLUD 3PUIA 1CDDA 1NOKA 3K4PA 4QXMA 5EWMA 1VYUA 3M9LA 1XEWX 2HTEA 1E8DA 1V9LA 2JIPA 2C78A 3F2VA 3E22A 1DG9A 1VIMA 1E61A 3CLRC 3RRMA 4LQCA 4E88A 1TK2A 2HV9A 3MXOA 4ZEXA 3BBPA 4BP1A 4BNKA 1U8EA 3OE7D 3ZBPA 5BT8A 3FDZA 2W4MA 4Y2GA 1K3TA 1QB8A 3OM1A 3REQA 3L41A 1NL3A 4REOA 5E7MA 2NXJA 3D3WA 2AEJA 4P0TA 2PBLA 2ZYWX 4P86A 5FORA 3L4EA 1HDXA 4WBNA 4V0RA 5GMOA 1QZ3A 1FIUA 2HF7A 2ZSEA 3G68A 1EFCA 2WR8A 4NYMR 1FDRA 2C5AA 4Y1RB 2FJUA 1N5MA 4RTNA 2VDWA 1CJSA 4FZ3A 4D4HA 1A71A 1UL1X 3WLTA 3JQBA 4CKWB 3EX7C 3N1UA 1DCKA 5LIRA 1H2FA 1HBJA 2P5UA 4YN3A 5FFMA 2PKQP 3OETA 3DHNA 3OJWA 3HVRA 1WPGA 3K70C 3R9XA 4H2DA 5IAKA 1RC1A 2RHTA 1EHYA 2BHNA 3TBHA 3INRA 5J43A 2XCSB 1ENZA 1SQ6A 1YJCA 4WNCA 1A8HA 3GT3A 1Y9JA 4QXRA 2OQRA 1XBTA 4CQMD 3MCAA 2XA2A 3ZWDA 2BFOA 3LXMA 3VTAA 4I1PA 1GVHA 4G63A 4X1YB 4FONA 4X44A 2J46A 1QCZA 3LY7A 4MMYB 1ZR2A 2QTWB 4WBSA 2E87A 1DTEA 1NQAO 2CBXA 3DCYA 1I33A 4Q9IA 4ZOLF 4ALLA 1H0HA 4D6PA 3G13A 4YUXA 4Y98A 5EXTA 1JEYA 4QWMA 4MPJA 3WB0A 3ZI0A 1OU4A 1VP9A 4O1HA 1Z5OA 4MV4A 4U6NA 1EG2A 4A8JC 4YP1A 4IXMA 1GFSA 3EHDA 1JEYB 1P2GA 2IQIA 1E79A 3JRNA 4CRWB 4EPWA 4EQ6A 4JYCA 1A9SA 1RE0A 1OXBB 3TR6A 3W6ZA 2PFKA 3CX4A 3N6XA 5CT5A 1MABA 3I37X 1RM5A 1U7ZA 3ZHVA 1UUFA 3LE8A 3BMNB 1NRXA 3EASA 1B0ZA 3OFJA 4JGGA 3B3QA 3D7KA 3AFHA 3EJWA 4YFYA 4RK0A 3EUEA 3TOSA 4U4AA 3C3KA 1R5OA 1BA2A 2FUG6 4G0MA 1XOIA 3L8CA 3PPYA 2OCKA 3VHLB 3EMVA 4ZN6A 1KAHA 3JZIA 4XSVA 5JVDF 3R6WA 4JP2A 4OXQA 4KPGA 4GR9A 3CZ9A 3UCEA 1OLUA 1DX9A 1G8MA 2DJIA 2OT3B 4DLWA 4DRZA 2Q4DA 5CIYA 2DC1A 4UTVA 5JZMA 4YCLA 5JS7A 2OD2A 1YSCA 2I6UA 1OYYA 1RYMA 3L0IB 4Y1RA 5DM4A 3JQAA 3TRJA 2BDEA 4AMYA 5CCXA 1Q1ZA 1RYFA 1QGED 4KSBA 1WLSA 5I7RA 2Z2KA 4F92B 2LD4A 4AIRA 5KWEA 4TTJA 3F73A 4IEEA 3F74A 4ILEA 1A0OA 2I3BA 4Q1AA 1DBPA 4YBRA 3H2YA 5KTTA 1RR6A 3TTUA 4YCBA 4FDUA 4KN9S 5CDFA 2OAGA 3DLBA 3IT3A 5TS3A 1QJ4A 2IYFA 2RC6A 4IXWA 1FUUA 3DQQA 3QW4B 3LCVB 3TBKA 2HSGA 3HR7A 2XCTB 1K06A 2ASVA 3MMPA 4DPLA 4DR4B 1DLIA 3GT7A 3DO5A 3IUNA 5ETJA 1OVMA 2B1QA 3O74A 4I4IA 1EYZA 2C97A 4UEKA 3SBEA 2JAHA 4RTPA 2ZANA 4NDNE 2FLWA 2QTFA 2VF2A 4LRQA 2OC9A 3UT0A 2CMKA 4ZHQF 3ADCA 4ZTZB 5IVIA 1X8KA 5K05A 3MG9A 4V3CA 3HDYA 1P80A 2RFLA 2XODA 821PA 4MV1A 3BQ9A 3ANNA 3D3WB 4G2TA 3LGSA 1UP4A 2IYYA 5NULA 3CE9A 3HO8A 5ALDA 3T7JA 3WO0A 2D00A 3ANLA 4A8JA 1J2TA 1P5ZB 1VRVA 2HRCA 3PCRB 3PFGA 1FYVA 4CTJA 2ZZNA 3I9V6 4IGIA 3PRKE 1F2UB 2X76A 4HGQA 1H2BA 3N39C 1GL6A 3N0RA 3NIBA 3ZQUA 2C9DA 3SKXA 1C3OA 5GWXA 5CG2A 1V5WA 3I3OA 4KBYA 3UGJA 2GCEA 3MT9A 4DV5B 4GD3Q 1OAOA 4LJYA 3RSQA 1DDOA 3NTUA 1GO2A 1XJ5A 4QD3A 3AVTA 3NOXA 4M1OA 2YNMC 1SBHA 2UYGA 3L0BA 3FB4A 2X0IA 2LE0A 1FFXB 1TD1A 3UAZA 1JPUA 2H0QA 5JXHA 3WI7A 2PGAA 3OX1A 1SD5A 2IHJA 3IOCA 3JWHA 5GONA 2MYNA 1IIBA 1T3LA 3IHWA 5COAA 2BGIA 1YVRA 4FEAA 1P75A 3OPYI 2J67A 3B3JA 1YT5A 3SBOA 2QM8A 3TNJA 2Q5QA 1ZESA 2W2XA 3EXHB 4Q34A 4BUJA 1WF3A 1PSDA 1ZUHA 5JI3E 4TZ0A 1DL5A 3EAGA 3Q6MA 1BDBA 2QEQA 3ZLJA 1NBHA 2MYTA 4DNOA 4GQBA 2YIVX 3VOSA 3A6PC 1EPUA 2W6NA 4ZO6A 1YKFA 2Z1NA 3WB1A 3ADBA 1KI9A 2FOIA 1OILA 2DGDA 5BN5B 3ROEA 3SYTA 4B6RA 4B3IA 1P2DA 3B5EA 3BUSA 3E5HA 1FNDA 1L4EA 5K7SA 5DLYA 4RSHA 3WSVA 1DZ3A 2IOYA 2REOA 5IJ0A 3E5NA 3NEAA 4FP9A 2FFQA 3DXFA 4JH0A 1O0BA 2WSBA 3I5UA 2VTBA 3IPRA 4XX1A 3ZZNA 4FUTA 3OOHA 3UJ6A 4KO4S 4MQ4A 1IK6A 4QKQA 5B6JA 5C3MA 1ZBDA 4HAOA 4QUHA 1L5RA 3R9IA 3NJRA 2NLOA 1JR4A 5HJ2A 4BWGA 1DBSA 4D3DA 2WIFA 3QM1A 3JVEA 1NASA 1U0BB 4MB2A 4WLFA 4URZR 2AKYA 3DDWA 2X5KO 3I0ZA 3ZW9A 1JVBA 1OHHA 1QU3A 5JNSA 4IVNA 1BWQA 3WLKX 3ZEIA 3AM3A 2O5CA 2GYYA 3FPSA 2FMKA 3KZNA 1ZGJA 5F2EA 3H86A 1I6KA 5E1BA 3DD5A 4A2WA 4F8EA 1GTG1 1OASA 4R6XA 5FJIA 4MYSA 3BOSA 4L27A 1HNNA 2J0VA 2O1WA 1U4OA 1CY7A 5HZKA 3V55A 4P92A 4MKGA 3B1WA 4MO2A 1FP4B 2O3UA 2PO5A 4G8CA 4LI3X 5EJ6A 4QOJA 3S6JA 1SKBA 4WGGA 3IALA 3VNQA 4RK7A 1EGAA 1ND5A 4QODA 4F84A 1R8SA 3CEJA 1A96A 3RKSA 4F5YA 1BDIA 3EUWA 4Y2TA 1PJBA 3EY9A 2PVSA 2CXUA 4RQTA 3HL4A 2W7TA 2PHZA 2ARKA 1SXIA 4C6TA 3MIIA 4OOEA 4TKVB 4ZVQA 3IOMA 3PQ5A 2B36A 4R2JA 4UHBA 1ODCA 3BJMA 1LV8A 1HM5A 2J07A 2OCLA 4EHIA 4B31A 3ETNA 3GV0A 3H3FA 1S8OA 3HQ4O 4C3OB 4PXYA 3EOAI 3TVYA 4GX0A 3LKDA 3UMJA 2XDQB 1I10A 8ABPA 1RJWA 5FWNA 2H4FA 4EA6A 5F12A 4MICA 1PJAA 2GJAA 3QHAA 1I6MA 3QLTA 3BL6A 3HP7A 3VDRA 3DFMA 2C8JA 1HE4A 1ZIXA 3GUHA 1OFIA 3EXEB 3K3PA 5P8WA 5JECA 2X7JA 4KVGA 1N3LA 3NHJA 4TXLA 4WY5A 1Z68A 3KP1A 2H7XA 1NMZA 2YRFA 4LNUA 1RHRA 1WW8A 3WJ2A 2IS6A 2YQZA 2VUTA 1SUAA 5IXJA 1WHTB 2C5EA 2QTMA 3PLRA 2VS1A 2AHOA 1Q22A 3IP9A 2BFAA 1JHRA 4JU8A 4NPCA 1TKBA 1H9BA 1HLGA 1I32A 2WILA 3ISJA 3ZTYA 5L40A 1P7VA 1E0DA 2ZAYA 4F21A 2VEOA 1ESDA 3PHHA 3SAJA 3VU9B 4UMDA 3DUFB 4AJ4A 4JI6B 3LLMA 4MS1A 1X94A 1CLEA 3C3EA 4EW1A 2LPMA 1L4LA 1HH4A 2R6GA 4AKTA 3UUEA 2B5WA 1TZBA 2R7LA 4UTPA 1L5WA 1RWBA 3PI7A 5A5DA 5KVAA 4IX1A 2R5FA 2KMLA 3ESRA 2XZTA 3I1JA 1R0XA 2P27A 1RW4A 3O4RA 4B8WA 1TFRA 3R5XA 5FBRB 4B47A 1Z45A 1HT1E 1FY2A 4BNLA 1TCAA 2QZJA 1Z6YA 2E4ZA 4E6PA 1QFXA 1UBCA 1QIGA 3AF0A 3FNHA 3HCPA 3PDIA 4N7RA 4Y9SA 3W5HA 4BLWA 2I0FA 4OUKX 5FLEX 1G66A 3E7WA 4MV5A 4MVWA 4O4HA 2PWBA 4E5UA 1QV6A 3BT7A 3QBEA 2OXEA 3HBFA 1C7JA 2YZ2A 3OQIA 4LZZA 5BN4B 3VHRA 3PE6A 1V2GA 5IMBA 4EAQA 3RFVA 4EB0A 5HW0A 2F4VB 4EMTA 1G20A 1P1FA 4R3UC 1I2MA 5C0OE 4N48A 3O2NA 4MRRA 4CUJA 4HZGA 4IFTA 1U11A 4QZVA 1JSLA 4MJ3A 3I9V1 1A88A 2UU9B 3RKUA 5I7FA 4FOLA 2WMOB 2CNWD 3IP8A 2FWMX 3PF8A 1IB0A 4Q3NA 5L51A 5AJYA 1Q44A 2JAQA 4P80A 1NVXQ 1P2FA 2A0KA 3V8EA 3KYBA 5A3SA 1XPRA 3LDUA 1WCIA 1AURA 3URMA 3COPA 4YJ3A 3BWBA 4HN4B 4B2LA 3IOEA 4DJ5X 1B0UA 2WT8A 2GCIA 1NOJA 2EKLA 2XTAA 1Z25A 1CZLA 3NHYA 3R2JA 3FBGA 1K8ZB 3QKRA 4MVJG 4E21A 4KWEA 4ZZ3A 2ZB8A 3VAZA 1BRTA 5KKCA 4FWBA 4D8YA 1P18A 1E2HA 1G8HA 3ASZA 2E5LB 4QGHA 4XPIA 2JEOA 2GZMA 2Q5LA 2VAVA 4R9NA 3VH3A 5CDUA 1E3LA 3EPPA 2I55A 4M7OA 2QXTA 4BWFB 4E33A 5JADA 4YJ2A 4M4SA 4PVDA 3AF4A 1DLJA 2QWXA 3QIVA 4GRIA 2EG5A 4DLBA 5G40A 2FP4B 1W0KD 2O57A 4M49A 4LC0A 3CF0A 3QA3E 2B2NA 2WYOA 2PKEA 4MKZA 2FZCA 3ZHBA 3C3PA 3ZK9A 2IOHA 3LVFO 5JZSA 1LCIA 4OLJA 1DXOA 3LT1A 3BBLA 4ZCSA 2IWRA 1LI7A 2G5GX 1D6JA 1OZAA 3MJRA 3IV9A 4N82A 2JFUA 1I7LA 2ZOSA 1OJ7A 1VRWA 3DHEA 3GT4A 4L8GA 4Q37A 5LLDA 1R4ZA 4LMRA 5K8CA 4BQPA 2ST1A 1XLUA 2Y8EA 3DE0X 1R00A 3ZQJA 1QOZA 5A0VA 1EG7A 1KGSA 4BCDA 1F6BA 1B1AA 4LGYA 5JQGB 3EGXA 2JHGA 5F1PA 1Y1PA 2A9QA 4JHXA 1LD3A 3D4OA 3LA6A 2OBYA 2OFFA 1NVWQ 1Q1GA 3V8PA 1DUSA 2G07A 3V4FA 4E5NA 4ZI5A 3D6HA 3LKZA 1P3DA 4UHEA 5F52A 4NU6A 1PR6A 3ZV6A 4C2TA 1RKVA 3S5JA 3DNMA 4P34A 3B7WA 2HIHA 2KBFA 2VPWA 4J7XA 3R5FA 5DNCA 1Z4PX 4KVAA 2UZ0A 1VLZA 3TAXA 3QHPA 1KPHA 2PMFA 4EG7A 3IBCA 3RC8A 4IEIA 4OSEA 2X1HA 3I45A 3LBFA 4ZDWA 1L1FA 3EXG2 3P97A 4O2AA 1KK3A 4NFSA 4YALA 3HBJA 4XVHA 1IOZA 3M2PA 5KBYA 2H06A 3JD1A 1SELA 1T0PA 3RS2A 2ZBGA 3ZIAA 1OBVA 2C7BA 2CLOB 3OZFA 4UDOA 3ZU6A 2IHTA 4WNAB 4KPEC 5DHAA 2VAPA 5EYPA 3GJ6A 3NDRA 3UTDA 1XJQA 4YQEA 1NLFA 3ETHA 5HDBB 2ZBUA 3LO5A 2EEZA 4A4DA 1W29A 1Y1QA 3EQ7A 2ROQA 4KOAA 4M22A 5KOHB 3CW9A 3FRJA 6PFKA 3D4IA 1CP2A 4FYVA 2HF2A 3QFCA 5A5GA 2FCAA 3ZE6A 4Q00A 1KJYA 1M33A 1ISSA 1ENOA 1XDSA 4P3KA 5D3MB 3ZWQA 4JLMA 4CM7A 5CK5A 1ONOA 3RK1A 1SVKA 2HCBA 2OVFA 2CLDX 2NGRA 3HKDA 3MFQA 1IOWA 4NWIA 3T5PA 4JKIA 1T9AA 2FX5A 3E2IA 1E7QA 1E66A 3ADOA 2JHFA 5AHXA 2WFAA 4FBLA 1VPVA 3RARA 1CUBA 3VU3A 1ULAA 4U9IS 5B1EA 5I47A 5KB3A 3HB9A 2IYPA 1Z8DA 1DOZA 1W47A 4ON9A 4RJTA 3PI6A 3IE1A 1UPBA 2SICE 4I9UA 3BJIC 3DMTA 4JI1B 2JJ1D 4M0CA 4XUDA 1AKUA 1E0AA 1J33A 2RAVA 3C2QA 3IMCA 3KKOA 4G0ZA 4HJRA 4NV3A 5A4MS 3C7DB 2UZAA 4AP5A 3W2FA 5C1OA 3L1VA 1MC5A 1OYOA 1KHTA 1XRLA 1RWQA 4QYIB 2A84A 5JPIA 2WTAA 3GCDA 1XZJA 4RMHA 4KIWA 4C88A 4LF9B 2GJKA 2XTJA 4A0FA 4XX0B 1H9CA 2NO7A 5D01A 3LNTA 4PICA 3SGLA 4BBZA 3GWZA 4EMUA 1X77A 3V33A 4HLCA 4QEKA 4AJHA 4L95C 1ZD5A 1YOBA 2ZATA 3VOBA 1PD1A 3OJFA 4LHXA 1CR4A 4D9FA 3O8NA 1E6LA 4RESA 2QRLA 3MWDB 4DMRA 1OXXK 4HSGA 4UW9A 4D4GA 1NMYA 1ICIA 1C0IA 2XNKA 4TOIA 1UM9B 4YJDA 1O6GA 5FWDA 3EEOA 4A0SA 4FHGA 2IYZA 2NTYC 2O8CA 4OJNA 4QHSA 2OCXA 5DGDA 3M6LA 3U0BA 4ZAZA 2CHUA 2NU6B 3F49S 3N8IA 3UTCA 5IJ0B 4AJEA 1MV8A 2P9CA 2ZYRA 3USZA 2GK6A 4B81A 4PO3X 2Z09A 1BU8A 1Y7IA 4JEMA 4RA6A 2Q28A 4ZARA 5BN5A 1S89A 1J97A 1U8UA 4D8UA 1AX9A 4WJLA 1P4SA 2GLUA 4I1UA 4EG1A 4AZVA 4ENWA 3VV2A 2XB4A 3GVHA 5H5JA 1SZCA 4BVLA 4MA4A 5IVDA 1MOZA 1QGUA 4BMNA 3PL1A 1W59A 5DGHA 1WMEA 1Q1EA 1ZVQA 4D0NA 2GEJA 1M2EA 3S7TA 2P90A 2B6NA 1A5ZA 2JLUA 2DT8A 4FLMA 2QE7A 3E9MA 5FEMA 2XUDA 3HFRA 2FWRA 3P9ZA 1V1MB 4R4JA 1V45E 2GN6A 4B9EA 1X9GA 3IAEA 1RU3A 3IESA 5CAEA 1JAYA 1WSAA 4GQAA 5HUQA 4AQYB 2XYHA 3GJ8A 2XJ4A 1ZNWA 1UT8A 2CB9A 3QWHA 4D0RA 3WYGA 2OGZA 5JBQA 4MCHA 3KT3A 3QTLA 1GV1A 1TU4A 3R3SA 4HK4A 1S8FA 5DXAA 4LUCA 2QF7A 1R3UA 3X1YA 1CX9B 1OYVA 3EC1A 3CUEF 5D5PA 1N8KA 1I7DA 2R6HA 2ZTHA 1FDVA 1OBFO 1LVGA 3OU6A 1FW8A 4M9SA 3DAYA 1J0XO 4UZFA 1V6SA 5DN6D 1GQQA 1LPMA 1GCIA 1VL2A 2C7GA 4HUQA 1JFFB 3FZYA 5H3HA 1Z82A 2B35A 2WWRA 2HCRA 2XCIA 3UFBA 3ZWYA 1QTRA 5IBCA 4MINA 4TKZA 1L4HA 2CFIA 2V65A 2X2OA 1RNLA 5E3JA 5JVDB 1IHUA 3W34A 3ZVKA 2RCYA 2VPIA 3B1FA 4BLPA 2GJ4A 4J7UA 1VJRA 3VSAA 1TF2A 2O3QA 3FVRA 1TEXA 2QZ9A 3KBBA 4F2WA 4U8GA 2NT4A 3VFDA 4GBJA 4IVPA 1IL0A 1QVWA 3ELDA 3FYUA 2OQ2A 3S27A 1TQ2A 1USWA 2WWFA 1Y7TA 4MQEB 3IPCA 1F3LA 4MMXB 5G2OA 1ORIA 1Z4OA 3L7IA 3RSGA 1NUAA 2XXAB 4A0RA 2P6MA 3TX2A 3ER9A 4COOA 2RHCA 4RFSA 4P54A 1UK8A 2YIMA 1L4NA 3PJFA 2ZRMA 1OAOC 2QAGB 2YS6A 4KHZA 2JLCA 4MOWA 4F4HA 5IABA 3GW8A 1FXWF 5HKKA 5JS1A 4BAZA 3D0KA 5E8JA 2W37A 3IV6A 1Z07A 2WIAA 2OXIA 3QKTA 4IZIA 4B84A 5JWOA 2QVGA 3IQWA 1P29A 3ZD6A 4LVCA 2IBMA 3EVGA 4RZHA 3HZOA 3ENWA 3TOCA 3HZRA 4E5KA 1YRBA 3AP2A 3U4AA 5C1DA 1D1QA 1OH7A 4C89A 5P21A 3SX0A 5HS6A 4EFMA 2Q4TA 2V9PA 1J2UA 4KV7A 4RFLA 5K0ZA 4MIYA 3AEKB 1GZDA 4PG4A 5IXYA 4JQYA 1KY3A 2WJYA 2CXHA 3DONA 2G7MC 3LYHA 1N25A 4JYPA 4G5HA 1VHJA 1UF9A 2PU7A 1YUNA 3C97A 3DV2A 3OZVA 1U8ZA 3F78A 2VJMB 3GEMA 3OMXA 4TSRA 5BUQA 2AR9A 5AVJA 3V4LA 5LB2A 2H9YA 2A92A 3QY9A 3SYKA 3E5RA 4HFJA 1EWVA 1T91A 2ZITA 3OESA 3SKYA 4B2IA 4ZEVA 2VP4A 4MNTA 4PW0A 4ND3A 1M34E 1TO1E 2NVUA 3Q9SA 4QYTA 4KQ6A 1ABFA 4WEOA 1KZ7B 1M7HA 4WFIA 5CNKA 1WV0A 2FZWA 3OKPA 4CQLA 2C4TA 1M76A 3HXKA 1UDAA 4FSDA 5KQMA 4LHVA 4R1NA 4UPDA 2AUTA 3FAZA 4YPFA 2P9QA 2CNWA 1K7FB 2PWZA 3FZEA 3M70A 1L7OA 2HYDA 1VRCA 1F4LA 3WGLA 4BXOA 4UVGA 5HKKD 2P78A 4W4TA 3N6VA 4AJPA 1Z0SA 3ZHQA 1KDYA 2RGEA 1QFMA 3WADA 2WPNA 1ZGBA 1KSJA 1UMKA 1KP9A 1W44A 5C7YA 1BZYA 3BFXA 3RJZA 2VDQB 2ZYIA 5TGZA 1EJ0A 1U0EA 5T57A 4EGQA 3QLVC 2NTNA 3EOBI 3G23A 1HT3A 3MRSA 2QAGC 1J21A 1ZJJA 3C3AA 2R8XA 5EHIA 3VC7A 4AMZA 3QE9Y 4CM4A 2ZREA 4YR9A 2AMJA 4O08A 2XWPA 1V16B 2GO1A 2XVMA 9MHTA 1JLLA 5JYEA 3UW1A 5ALJA 3WK6A 4J2TA 4B75A 1U3DA 2HM7A 2BKVA 2OZVA 1CY1A 5CYFA 2XYRA 3NV7A 1G8AA 3U61B 2J48A 3W04A 1KOLA 4BO7A 1SOMA 4WZ6A 5LNK6 4ISCA 2AOVA 2FSSA 3RRZA 3WNVA 3HM9A 3HKEB 1BQEA 4LDNA 3K0BA 1RLIA 1BGXT 2C59A 2IKSA 2YV4A 2AI2A 2D6FA 5FX2A 3N8HA 3RYIA 4OX9B 1IIRA 3NTQA 5EEHA 4ZK6A 5KPJA 3KJZA 2CKDA 2YJ3A 2IEDA 4WKBA 4HZUA 1AKWA 3JAKB 4FYIA 1K63A 1NPYA 3GDHA 1E3DA 5ALUA 3UC9A 5LJLA 3A1TA 4V0QA 2G1JA 4UD6A 4YONB 3RU7A 3LECA 4KPFC 5CBPA 3Q7EA 4LXHA 1OR8A 1CYDA 1GUBA 3TCXB 3KSRA 5D6NA 5EMHA 4F4CA 4AG3A 1OI3A 2QY9A 3ZHOA 4C0HA 1XZAA 3NQ41 2NT3A 3P19A 4K3VA 4ZAVA 4DN6A 1CUYA 2ZEJA 4LJRA 4B3RB 4DARA 1SA0B 4M1QA 3COJA 1M2FA 3PQ2A 1P60A 5FUXA 2IWHA 4YJ3F 1XTJA 2GEKA 3QKSB 1IONA 3EIEA 5CX4A 3N0VA 3ROZA 2QRZA 2WG2A 4Q7EA 1YRYE 1AO3A 1QYCA 2VF5X 2O07A 2D0IA 1N6RA 2WIBA 3AVYA 2PE5A 2B4QA 2I71A 2WE8A 3TPFA 1G4HA 4K2HA 2NNLD 5FB3A 4D6XA 2IA5A 1U80A 5AHOA 2BPOA 1M74A 4CWAA 3OWHA 3EGEA 2XGGA 3IA7A 3VR4D 2VSXA 4INOA 3RSCA 1I1OA 1AIPA 1UAGA 1DQRA 1WABA 2Z5FA 4DNXA 1Y1KE 4G5QA 3H4TA 2RBEA 2OHHA 2ZAMA 2ZKIA 2MMCA 1E79D 5T8KA 2GPJA 2ID4A 5IVPA 3SZ3A 1JE1A 1VCMA 4IL5A 1CFJA 4FFSA 3MLEA 2VA9A 3HCEA 3M9WA 1V5GA 3FTFA 4MS3B 3DBOB 3WJ7A 1GTL1 4BTVA 2XMRA 4RTOA 2Y1LA 5JYCA 1GZ7A 1Y7LA 3I05A 2HLHA 4I55A 4CMBA 1Q0PA 5B55A 2J85A 1XQXA 2YXBA 3K6SB 1MRNA 5GVRA 1YS9A 1PNVA 3AJ9A 3VNBA 2IYVA 3LO8A 1EFTA 3P9XA 5MGNA 2PZJA 2IHBA 2GLTA 2I33A 4X90A 5IKEA 3FTDA 3K70D 4ZVVA 3C7KA 3WYNA 3KB2A 4BBPA 1TMGE 2EBUA 3IAM6 3CPJB 3IVXA 4QT4A 3LFUA 1AU9A 2FOLA 4BNMA 2I65A 2CVPA 4H6XA 2X5NA 1ZUD1 3NHSA 1F2DA 4CF7A 1Y7PA 5DM0A 3NBQA 2F8MA 3FPEA 2KSQA 1IY0A 1ULTA 4QPZA 5DIZA 2RMKA 3FHJA 3G5AA 3RK4A 3VSEA 4C01A 3VYWA 3A1DA 1T36A 3EGDB 3A2NA 3H5VA 5ICCA 3SM3A 5DTRA 4D99A 1RJDA 1EHCA 1J9ZA 3HYCA 3ZDZB 1KC1A 1IXZA 3FCAA 1FVXA 2FX2A 3P4UA 1E99A 1ZOOA 2FJ0A 2O2HA 5HIJA 3WWYA 1XCPA 2DTEA 3DGEC 4IDGA 4L72A 2XE7A 3D2CA 4NJOA 4UHKA 3Q9LA 3VVLA 3R6TA 4DZRA 3UJCA 1E5TA 1MR3F 1R4MA 2FSIA 3EFOA 3FSGA 3P20A 4YECA 4FX5A 4URUR 4RHTA 5F73A 3OY7A 4ZGWA 1DHRA 1Y4ZA 2HXGA 3GCGA 4HNGA 4KMRA 5FDFA 4YRBA 4B3GA 1MO3A 2O48X 1SCBA 1F06A 2HMAA 3MGAA 1TNDA 4LMPA 4PZ0A 2PXCA 5K0TA 3DOFA 3TPZA 2EEPA 2I5PO 1SUFA 4K2AA 2JVJA 2J9XB 4B4WA 4BEVA 5PGMA 1OFUX 3CZCA 1D8AA 3P0RA 1NPTO 4OHCA 3RUPA 4RHXA 1ULHA 2FWIA 1SXJB 2GTIA 2AD5A 1WMAA 1UMDA 1II8B 4WAUA 1ULSA 3ADPA 4QJ5A 3LOUA 3KU4A 2D7CA 4XYMA 1QS0A 3AYZB 5I7AA 3WDLA 4BVEA 4J2HA 1D03A 1YL7A 3HC7A 1ZM9A 3F47A 4HWSA 4PYNA 1E60A 2HNBA 4YT8A 4US2R 1FEZA 3BERA 5BN3A 3OZDA 2G67A 2QMQA 1V8BA 1TLFA 4OSOA 5GM1A 2JK1A 3S2ZA 3U39A 4ADSG 1NVUQ 2IS4A 3K2IA 4C2BA 5IAEA 1PR3A 3CR7A 2VYND 5IJAA 3TQTA 3GJ7A 2ONKA 4Z0TA 5DXJA 1OF1A 4I99A 4KKXB 4QUAA 1YFJA 2FW8A 1BX0A 1H4VB 4C0SA 4IFBA 1WW3A 2IH2A 3WL7A 2HQOA 4NJEA 2Q3LA 3O84A 2Z8YM 4QOEA 2I9PA 1EIWA 1XWFA 4C20A 2AG8A 1UQRA 3C14C 3NYWA 4AJKA 3QU4A 2PKWA 3M6FA 5JI2E 5EJ7A 3D8UA 5A4DA 3QEKA 1A5TA 4S05A 1BFDA 1F1JA 1M6VB 2LNDA 2CY0A 3EF3A 4J49A 1X7WA 4J1QA 2FVXA 3CM0A 2JHCA 4YUVA 3RUAA 4EGAA 1GUAA 2R7KA 1E89A 4F4DA 5TPWB 3TAHA 2GRJA 2IIQA 5IP5A 1L5HA 2GNAA 2B3DA 4OIFA 5E4FA 3SU8A 2H3EA 2HLPA 3VVMA 2IHNA 2XZLA 3CJRA 4M1SA 1N0HA 1SGWA 5IN5A 2D5BA 1Z0IA 3VR2A 4B76A 4LW8A 1DKUA 3KFLA 4WKOA 1E20A 4OB6A 3GRUA 4NAVA 4XWWA 1OHHD 4G09A 1SHJA 3GUUA 1PL0A 3TTVA 3BRSA 2BFFB 1YGYA 1A7AA 5A5VA 4BFZA 1PFVA 4ZEWA 1ZC4A 4MUGA 3WWZA 3G02A 1EDZA 3L0PA 3F8SA 6AT1A 3HO6A 3ILVA 3NGLA 2BMVA 3GAMA 4XQ0A 3SEZA 4MI9A 5SYNA 3VPCA 1QH1B 1XZDA 4XGQA 1BS1A 3CU5A 5CVVA 1JVNA 3WGHA 2BLNA 4DTIA 3OZCA 1ZVVA 2YOGA 3OZRA 1ODTC 5AHWA 3HKBB 1L4KA 10MHA 3WKBA 1J00A 1L4GA 4LG1A 4YLYA 1YBFA 3EHEA 4IHAA 3W5UA 2F6RA 4RKFA 2JGEA 5EEGA 4KX5A 1O94A 2O6LA 4YO7A 1DBRA 3U3OA 5K8TA 2OAEA 1UDBA 5LSAA 4YP9A 2ZU0C 2HOQA 4CMEA 4Y30A 1ONPA 2RK6A 3O3CA 1YUMA 2A9FA 1AZLA 1ADGA 3EVTA 4JBGA 1ZLYA 1PWEA 3FLAA 3ZDCA 1SCUB 4JENA 4PTYA 3DEHA 4IFEA 4DOMA 3B1ZA 1C8KA 2HW8A 1SXJC 1VXRA 3MPOA 1DELA 1RHMA 1RJGA 1Q0LA 3GPBA 3O90A 4J76A 4Q3EA 4U2KA 5CVCA 1FFCA 2A35A 4KE9A 4RVNA 2I7VA 4TMWA 5DI9A 4R2WA 5BUSA 1FFYA 1QYWA 1JDTA 1UBTS 3LIIA 4RZUA 5CVDA 4I4TB 5C80A 2J0SA 2OV3A 5EKXA 3WMWA 5JVDA 3QBVA 2WWXA 2EYQA 3DMFA 1CUZA 3MT8A 4TLMB 4F93B 4R7GA 4UU1A 2JHPA 1M2JA 5ILQA 5LD2C 5CW2A 5T8KC 3PIDA 2F3TA 3KJFA 5JD3A 3RQSA 4CETA 3VDXA 1NSYA 1T9ZA 4FHEA 3TKAA 4ZVKA 4ARZA 4QGGA 2WSIA 1MA0A 2DRIA 4E2ZA 1IN7A 1FJ2A 2AJLI 2CEKA 2QG6A 2QZZA 2VHXA 2X86A 4YQZA 1UBOS 3TE7A 121PA 4FFBB 4GZLA 1EB9A 2QE6A 4X64B 3H3JA 1HK7A 3P32A 4CM8B 2WBLC 3KYJB 4MYTA 3IAUA 4UOQA 3AMVA 2GPBA 3EXIA 2OFOA 2YUIA 1CUSA 5CAEB 4IOMA 3FM9A 3MJFA 3FYTA 4CF5A 2DBQA 3QVMA 1J2YA 1IZ7A 4PHGA 4TS1A 3NO4A 4MP8A 4AF6A 3ZWXA 4BRUA 5B3LA 5E7JA 4AN4A 1LC3A 1RAGA 1UFRA 4NPHA 1AUPA 3OFKA 4IKPA 2H1VA 3QJYA 4EFNA 3C98A 3EPLA 3EMDA 1SPXA 3KRTA 4H6WA 4RTLA 1KKLA 2C2HA 3AQIA 1CG6A 3FH0A 4W7SA 3O3NB 4A0QA 3O8RA 5B4TA 3FLBA 1YA8A 3GLIA 2F8SA 1SPBS 2NO6A 3A4IA 3B6IA 4ESVA 1Z6TA 1A9YA 4BLUA 1NBMD 2BJWA 1NJSA 3P2IA 3R4VA 4I4NA 1GUZA 1O9GA 1PHPA 1Q1AA 4OOFA 5DN6A 2HRDA 4CQMB 1YQTA 3SLKA 1DAMA 1A9QA 2AZXA 3ZCPA 2VBGA 3P9CA 5ERXA 2CGEA 3U7RA 4XIYA 5CD1A 2O8DA 1GCOA 4QRIA 3VUEA 3Q7RA 3CUUA 1LPNA 1VYHA 2GUWA 4W8OA 3V8QA 3DW3X 4ZP1A 4RPKA 1FOEB 5GJCA 5EL0A 2VTKA 3ZDEA 5K5EA 2G4LA 3BFVA 4IPTA 3I2FA 3JQAD 5ED4A 1OKKA 4G84A 3JYOA 3COSA 4R51A 4RKEA 3VQTA 2VK8A 2Z3ZA 3JD4A 2OXTA 1SR8A 3TIXB 4WEQA 5I9MA 5EP4A 4N5MA 2CLSA 1XRNA 3IL2A 5JSYA 1QRSA 3AM1A 4AYWA 3EH2A 3F4KA 2PUCA 1YCDA 4LCBA 1GT91 2G28A 3K05A 4GI7A 4QECA 1X7DA 1P8AA 3E9DA 4OF4A 1U28A 1TEZA 5FCDA 1N1GA 2QMOA 3E61A 4B6GA 1CEQA 1X9IA 1Z3IX 5CB8A 2BFDA 3AUXA 3MGGA 3TJZA 3ID6C 1SRRA 2ZXFA 3DBRB 3NAZA 1EQUA 4HQKA 4QC2A 2HL6A 3LM8A 5TMEA 4YQYA 4KQWA 5A5EA 4JSRA 1A8QA 1IZ9A 3AEUA 5J5CA 3ROTA 4QFBA 1SBZA 2IHZA 1U5BA 1A2KC 2F8TA 4FGJA 2WB2A 5BPHA 3UA4A 1G5RA 1TEVA<