3H84A

Crystal structure of get3
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
346
structure length
326
Chain Sequence
VEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSRANNNGSDGQGDDLGSLLQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords ATPase GET3
publication title The crystal structures of yeast Get3 suggest a mechanism for tail-anchored protein membrane insertion.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 107
structure length 326
sequence length 346
chains with identical sequence B
ec nomenclature ec 3.6.3.16: Arsenite-transporting ATPase.
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3h84A00
1Z6XA 5CITA 2E9SA 1WE2A 4QBFA 3A8TA 4G0NA 5FOSA 2OBMA 4FINA 3ADKA 4UNSA 1TQ2A 2VF7A 5LD2B 1E9DA 1R6BX 1ZD9A 2YVUA 4LJYA 1SZPA 1T9HA 2AXNA 3QXSA 3BS4A 1QG4A 4MQBA 4M9XA 3T1QA 4B3XA 2DBYA 2ZQ5A 1II9A 2REOA 4MDFA 2GCNA 3QBTA 4LBYA 3PENA 3TQFA 2ZJYA 2Q3MA 1DO2A 4LBVA 1UBCA 3N2EA 3PEWA 2CCKA 1XTKA 1JR3D 4F92B 1OJLA 2RGEA 2W00A 4PSVA 2ZJ2A 2BJWA 4GPTA 4PXAA 1S8FA 4LJ7A 4KJZA 2J0SA 1IM2A 2NOAA 1G5TA 2HCJB 2EW1A 3GMTA 5EZ5A 1QBKC 4NCIA 3UG6A 4HUTA 1NVUQ 1D2MA 1KHTA 2GRJA 1UDWA 2GZHA 2JLQA 4TLCA 1XMVA 1M7GA 1II8A 1N6HA 4HUQB 5DYGA 1E2EA 1W36B 3GLIB 4PTLA 1ZD1A 4YMSA 5TMPA 5HE9A 1DOAA 2VH5R 1FFHA 3ICEA 5KDDA 3ZLJA 2D3WA 3B9PA 2KSQA 1FX0A 4BFSA 2ZEJA 2GXUA 1BYIA 1GTVA 3I1FA 4OK5A 4DB4A 3VU9B 1OIWA 4NCKA 2P0EA 2ZUDA 1NVXQ 4YMUA 3SHWA 1E1QA 4UNNA 1JR3E 3OE7A 2B7BA 3EX7C 2OXCA 3FKQA 2EWWA 3OIYA 3VNUA 1XFAA 4V0MA 2VO1A 4LBZA 5FR2A 5AUOB 1IN4A 2QZ4A 1GG2A 1U8YA 1ZU4A 1CR2A 4UNQA 3WHKA 5JRZA 1XCPA 2FSHA 2HLDD 2JLVA 1GITA 1VCMA 4B2PA 4DLRA 5FTJA 4URVR 4LI0A 5AJZA 2EFDB 3B13B 2EFCB 1E3MA 5AWFC 4MRNA 3K70D 1FMLA 1Z8FA 1N6KA 2GAAA 2GJ9A 4HAWA 4HLQB 2IS2A 1NVWQ 1RYHA 3ZH9B 2B8TA 3LQRA 1H65A 1SVOA 3GD7A 4BRWA 2CBZA 4AD8A 4A0RA 2MSEB 2ZS7A 3TGPA 5C46F 1T91A 2D7CA 4RKEA 2C04A 2O8FB 1GAJA 2O8DB 4JVSB 4V0NA 6Q21A 4MGKR 2GWHA 1T0JB 4MGYR 3X1XA 3Q8XB 4C7OA 2IYXA 1G3MA 3KKNA 3HU1A 4P4SA 1VMAA 1G5RA 2DWPA 1KAGA 1NMXA 4DJTA 3VHXA 1SXJE 5FL7D 1NKSA 4EDHA 3VFDA 4OQNA 1R4AA 1IN6A 1E1QD 3TW8B 2GDJA 2C9YA 3OE7D 4TMTA 1XCMA 3SYNA 3L0OA 3SR0A 1KY3A 1E9CA 1VG0B 4GP6A 1ZU5A 2O0HA 1N6PA 1KYIA 3VTKA 3AKCA 2FDCA 5JI3E 1YJ5A 4PAMA 3GLGB 2OBLA 4M9QA 1RE0A 2C77A 5CJ2A 5EXSA 1ESMA 3I73A 4OQXA 4TZ6A 1KMHA 4IRUB 2JCSA 3U61B 4C0SA 1R0WA 3B82A 1UADA 2OCAA 3LNCA 3Q9LA 3QENA 4RD6A 3BC1A 5CJPA 4ARZB 4A8JA 3FHCB 3AP2A 3NBYC 4I1UA 4BRUA 2AFIE 5EE0A 3FB4A 3A1TA 4Z51A 1E96A 4HAUA 3OIVA 1ZNYA 1FP6A 1YVDA 2GJAA 3K0EA 4BUJA 1G8FA 2ORWA 5KUTA 4Q4AB 1F2UA 5GADl 3CRW1 2OAQ1 1GL6A 1ZMXA 4FMCF 1A2KC 2ORIA 2F1HA 3KL4A 4RSGA 2OT3B 1RC8A 2CVFA 1G3IA 4N3NA 2WBLC 1GNQA 3AUXA 2MMGA 2JJ2A 2F43B 1E79A 4QNRA 4N0EA 3I5YA 1Q1QA 1L4YA 2QSZA 2ZI6A 5L3SB 3AKDA 4A92A 1YR7A 2YV5A 3IBYA 2XAUA 1EFRA 3EC2A 4UXJA 2PMKA 2X77A 1E2PA 1OKKA 2ZAOA 1N0UA 3K09A 3H86A 3FPAA 4KI0A 5EXTA 3CR8A 1W4AA 1ZM9A 5KDLA 2GAOA 1R2QA 2AKAB 5EZ6B 1N6RA 3U3JA 1OXTA 3I62A 2CXXA 2AFHE 2WJGA 4ZDKA 2ZE5A 3C15C 4WAUA 3B1XA 4NYIQ 2BWJA 4RD0A 1TADA 2AX4A 1GOTA 2E87A 4DCUA 1ZUIA 1SGWA 1ZUNB 1VPLA 3DKPA 4HDQB 4AWXA 1KDTA 5CB8A 4V02A 1K8RA 1XEWY 4XD7A 2ZITA 4PFSA 1VYVA 4BFTA 1XMJA 3RYTC 2FU5C 4LHYA 4TSFA 5AJYA 3RDPA 4B76A 3A36A 2R2AA 2YOHA 2ZJBA 2QBYB 3BWDD 2JJ2D 4M9SA 1E2NA 1E79D 1XU4A 1FMJA 5FTNA 5FPYA 2BDTA 4ESVA 3Q5DA 4LDJA 1XPOA 2QROA 4EPWA 1NG1A 3EIHA 3LVQE 5KNDA 4TT3A 1EFRD 5BYKA 1OIXA 2P5TB 2YWGA 1KI9A 3NH6A 3CWZA 1U8ZA 3KJEA 3BB4A 4GBMA 4Z8XA 1DARA 5DO9A 1OKKD 1SVLA 1W5SA 1XXHE 2GF0A 3K0CA 2ZRLA 4D26A 1S3SA 1COWA 4LPSA 4JKIA 3PQCA 2AN9A 4PAQA 3RRMA 1EFCA 2GESA 3GLFB 3AVPA 1NVVR 4E09A 1E2MA 2IEYA 3QI2A 3MFYA 3NEYA 3NDPA 3TSOA 1E0KA 5L3QA 2EYQA 2PX0A 5EXXA 3HR8A 3MMPA 1US8B 1XTQA 3DO6A 5KNBA 3MLEA 1N6NA 3RS5A 4GSYA 1VECA 2QT0A 1R7RA 4AYTA 2J41A 3KXLA 4EFLA 1VHLA 4A2QA 5LB4A 1IJFA 2H16A 4JSYA 1CKEA 4JLVA 2WOOA 4XD7D 2FV8A 1LTQA 4GOXA 1EFHA 2YWFA 1F2TA 1Z28A 2OCPA 2FSGA 4PAOA 1T3HA 2QTVB 3HU3A 2ONKA 4TSFD 1NJFA 1NY6A 5JHHB 4W9MC 4TLEA 3KZ1E 4LJ9A 1JNYA 2X8AA 4Q4LA 1W44A 1XB2A 3X1DA 1AZTA 1CJUC 3F5FA 4TYPA 1G8HA 3OEHA 3PFIA 4L4UA 2UZ3A 4TT3D 1AS3A 4TLBA 5KO2A 3U4QA 1FQJA 3TVDA 1Z0DA 3SS8A 3L82B 2QT1A 3AVVA 1AGRA 5JBQA 1CR1A 1COWD 5FTLA 2R6DA 3SQXA 1UKEA 1TMKA 4K46A 5HR5A 4UNRA 4A15A 5ANRB 3FFAA 5UKDA 1OFIA 3IILA 2A5DA 3U2QA 4LJAA 4D82A 4WW0A 3A1WA 4LJ4A 1G17A 2O8BB 3EZ9A 3SE0A 4PQFA 4W5JA 1OW3B 2A5JA 4AYWA 3TUZC 2JLZA 2Q9AA 4DLZA 1I4TD 1E2LA 1OYWA 1IY2A 2PLRA 2HJGA 3AGPA 3FTQA 2QMUA 3LDAA 3N5CA 4RD2A 1KI2A 1N5IA 3WY9A 1E0AA 1AA9A 2ZANA 4NMMA 4A0GA 3SYLA 3U44A 4GDFA 1X8JA 2ZSBA 3RANA 5AJWA 1CIPA 2BEKA 3THWA 5JJKA 3T12A 2A5FA 2C5LA 2ODNA 1BO6A 1VYUA 1LVGA 4OBEA 1NJGA 1UKZA 4B32A 1AKYA 2IL1A 1QHNA 4F4CA 3QPUA 4KFTA 1CRQA 1G9XA 1Q0UA 1GIAA 4X8HA 3QKSB 2IUUA 3RRZA 2J7KA 2R6CA 3SC3A 1KI8A 4M1OA 2BC9A 1FP7A 5AUNB 3EIQA 2IYSA 4V0LA 3WNDA 2RGNA 5C1BA 2H18A 2IS1A 2RGAA 4GL2A 2EYUA 3ND9A 4DDWA 2VSOA 4NTZA 5IF9A 3RAPR 4I1VA 5SZHB 4NP6A 2C96A 5AUPB 5DLQC 3UMRA 3U3MA 4EQ6A 1II0A 5K8IA 4RD3A 1NN1A 4ITRC 3ZS9A 4IOJA 3ZZTA 4LY6A 5JSZA 1Z2CA 2RAPA 2VQSA 3KB2A 1O87A 5CLQA 3U6BA 2BMEA 3L0IB 4Z8YA 5F2EA 2O8CB 2OAP1 3DMDA 3GLHE 4QL3A 2FPLA 2JLUA 4A0FA 1JJVA 3A4MA 2L0XA 3NXSA 2IYTA 2CL0X 3C16C 4MUBA 3GEEA 3LXRA 1HQYE 1BKDR 3EZ6A 3TUIC 4JSTA 4M9ZA 3NEJA 3P1JA 5JI2E 2ASEA 2GXSA 2XTMA 5B57C 3WBKA 4B6FA 5G3YA 1Z47A 3CR7A 3SNHA 4QGHA 2WJVA 3VNVA 1XX6A 1OH5A 2H1LA 1UF9A 4H1VA 4IDNA 4C2UA 3ETLA 1NN0A 1L4UA 4NYJQ 1KZGB 3A6PC 3K0AB 1Z22A 2YC2C 3WP0A 3C5HA 4BLPA 1KNQA 4QBIA 4B74A 2D2FA 3KQHA 2VP0A 2JJ8A 1W2GA 3P4YA 3CM0A 5EP4A 3CB4A 4G5GA 4Q00A 2QPTA 5JRJA 2C99A 3MWYW 1QHXA 1R10A 2QMOA 1Z5ZA 5K8UA 3CIOA 1MV5A 3KQUA 2RMKA 3GJXC 1YZKA 3IDQA 4QM7A 1OB5A 3S1AB 2WKRA 3ZD6A 3TSZA 4GP7A 3G0HA 3GFOA 1MABB 5FBWB 5KPJA 2WWGA 1BIFA 1WB9A 2DYKA 5G53C 4NE2A 5GJVC 2KI5A 4XOIA 3BIFA 3QPWA 1ELOA 2G77B 5DSZA 1P7CA 2QAGC 3FHOA 4FWIB 5EP2A 4DLTA 4BFVA 2W6JA 4QOSA 1CJVC 1Q20A 1W1WA 2JEOA 2IW3A 1U0JA 1KDOA 1IN5A 3EPJA 1NNEA 2GXAA 2WWHA 1E4VA 1G3UA 4Q18A 2DHRA 2IC5A 1LW7A 2QP9X 3Q5EA 4CVNA 4DZZA 2ZRNA 1DTSA 5EE5B 1U0HC 4DHEA 2GK7A 1TAGA 3V4FA 1KI1A 3IEUA 2PCLA 4CZ2A 4M21A 2IS4A 3CUEF 1YE8A 1G4AE 2C95A 4IXMA 4CT5A 2ZJ8A 2GVZC 2IT1A 3O47A 2AHOA 1G7CA 3PEVA 3B85A 3CO5A 4R9UC 2WWFA 4M22A 3FHTA 4L5BA 4M2LA 4NCNA 1PVOA 4TTPA 5BQ5A 5BN3A 3MWLA 5FBQB 1Q1BA 3BK7A 1N3BA 2FZLA 3LY5A 2QUZA 4EKDA 3G5UA 3NH9A 2P3SA 1QZXA 2DCUA 4DCNA 3KJGA 2ZRKA 3DEFA 2XB4A 5F3WB 2J0UA 2YC4C 421PA 4D0NA 3VHLB 3B60A 3VMFA 3CONA 2P67A 2W6JD 3A4LA 3C14C 1U98A 4B48A 1NRJB 3WXMA 1UBGA 2WJYA 4GOJA 3ZZUA 1E0SA 2IXEA 1ZAKA 1F60A 2BBSA 3BBPA 4PHTA 1G16A 4M8NE 2CLDX 4DKXA 1CULC 1OFTA 2EU8A 4RD1A 5CK4A 3R7WA 3VR2A 4Z54A 4A1FA 1PLLA 4MYUA 1EFTA 2KB0A 3N2IA 3UIEA 5DI3B 4TMWA 2ZRFA 1M7BA 3RWOA 4FN5A 3B7GA 2H8KA 3CX7A 2HYIC 1Z0IA 2ANBA 1VCOA 3BB3A 3NG1A 2B6HA 4IKEA 1T3LA 5AJXA 3WYGA 4CF7A 2DB3A 3IEVA 4OHYA 1D2NA 1WQ1R 4L9WA 4LBWA 4XTCS 3K9LA 3QF4B 5IHPA 3QKTA 1DAMA 1FOEB 4EJSC 1U8AA 4LV6A 2BIFA 3EZ7A 2ZU6A 2AWOA 4PO9A 5L8VA 4KU4A 4CEHA 1OH6A 1J8MF 4RCZA 2F1RA 2Z5FA 2IXGA 1KY2A 2PMDA 3MJHA 1OH8A 1U9IA 2FFBA 1Q3HA 2WV9A 4Q9HA 3QF7A 1HT2E 1JPNA 1FTSA 1G20E 3TNFA 1RIFA 2I3BA 2Q9CA 2CDNA 1TF5A 1A2BA 4URWR 2X2FA 2BVNA 3E1SA 3TMKA 3B1VA 4IJMA 1AK2A 3NTUA 4F4JA 2ZI4A 4I99A 3LV8A 4QHTA 1W2HA 1FUKA 5LB2A 3NDBB 3JVUA 1TNDA 2XNDA 2ZXUA 4B6EA 3DZ8A 1XRJA 1R0YA 1GFIA 3GJ0A 4FIDA 2OHFA 1GL9B 4JLJA 1RRFA 2VHCA 4HLUA 3RRYA 2V6IA 3U7HB 1Z0JA 1G7RA 2JLSA 3H84A 5H1YA 3NBFA 3QKRA 1AJEA 1LS6A 1XTJA 2BKEA 2ZI7A 1EK0A 2GKSA 2Q3FA 4JKYA 1BS1A 2VIIA 4PHHA 3GLIE 1W4BA 4KFSA 3K70C 2C9OA 5AUQA 4ZV4A 3UMFA 4QJ3A 1JXMA 2ZSEA 2FX3A 4US1R 3BOSA 3WBJA 2CJWA 2FNAA 2QE7A 3R9WA 4TQUS 2RGGA 5FBLB 4UXIA 2V3CC 3U60B 1FUUA 2I4IA 3AF4A 2PLFA 4NCHA 4ZCIA 5FPKA 2XXAB 5TDHA 3WNBA 2O8EB 4DCVA 2V7QA 5E3HA 1JALA 1PUIA 3UG7A 3K0FA 2ZYVX 4NBSA 4C0BA 2IUTA 5H70A 4MYCA 4FWTA 4KSCA 1C1YA 1KKMA 3BFKA 4CDGA 1ZM4A 4JLPA 3WNCA 1HH4A 1KK3A 1VYTA 1TQDA 3LBHA 3TR0A 1UBFA 4DUGA 3ZVNA 2WJIA 3HP1A 2BEJA 1S3GA 1Z0AA 1XCGB 2ECKA 2XNDD 2OCBA 3QEJA 1CEEA 4JLKA 2Z43A 5B64A 1Z08A 3CPJB 2P2LA 2Z4RA 1S2MA 2ZJZA 2F3TA 4MYHA 1SXJA 4OHXA 3BORA 2HLDA 2O52A 3LBNA 3CNOA 2PZFA 3P4XA 4PC7A 4Q4HA 3GFTA 1Q12A 1NN5A 3OZXA 1G1MA 1VHTA 3PITA 1KI6A 4IXNA 3UXMA 5B30A 2PH1A 1E0JA 1N0VC 3C4JA 3F8TA 2PZGA 4OHZA 4TMXA 2QE7D 4Y0AA 1MO6A 4TYWA 2XSZA 3H0KA 4FMBB 4JIMA 3SFVA 1E9EA 3ADCA 4LYJA 1KI7A 5CYPA 3RWMB 1SVSA 3VAAA 4BEJA 5L3VA 2G6BA 4DSTA 3RSLA 4D0GA 2OCYC 3CPEA 2NMVA 4IOKA 4Q66C 1AGPA 4QGGA 3EAQA 2V7QD 2GZDA 2ZIAA 2FEOA 4DIDA 4NPHA 4QBHA 1LFDB 1NP6A 1G8GA 2EQBA 4RZ3A 2PJRA 1OXUA 5HZKA 2AKYA 2NG1A 3GJ8A 3NHAA 3THXA 5FL7A 2J59A 1O3YA 3MSXA 4DUGD 1M34E 2IX3A 2VEDA 2VP4A 2W58A 1GDDA 1KTVA 1NMYA 5JJIA 1T4GA 4HZIA 1CLUA 4UXHA 1KSGA 3M4YA 4BFWA 5DH9A 4KBFA 1SXJD 4KAXA 5HE8A 5EP1A 1D6JA 4KHZA 3QSYA 1HURA 1M1YE 3FYHA 4RFSB 3HJNA 3ZVRA 1LY1A 1RW4A 2VHQA 2BCGY 4I1SA 2PJZA 3B1WA 4B44A 1G64A 2C8VA 1KJYA 2WKPA 2OE2A 2PBRA 1KK2A 4A8JC 3DM5A 2G1KA 2NO1A 1TUIA 2QAGB 4OQLA 4RZ2A 2XEXA 1KO5A 2GTPA 2RHDA 2XSZD 3NC1C 1FQKA 4B33A 3HYRA 4HZUB 3L43A 5FPHA 3OESA 4M1KA 4PO1A 3AVUA 1OXXK 5DN6A 1BH2A 3SHFA 4I4LA 3SN6A 5CK5A 2W83A 4B3CA 4Q9IA 2YYZA 4U00A 1X6VA 3SYKA 3PUYA 2ZI3A 4YONB 1EWQA 4E03A 4AKIA 4URYR 3QXJA 5B2ZA 1JJ7A 2VHJA 4IVQA 3ZQ6A 5KOYA 2VYFA 4B73A 4V03A 1Z63A 4B3FX 1U2RA 3PEYA 4A36A 1DVRA 3X2SA 4LJ5A 4Q1FA 4W5HA 2IK8A 2OSBA 4DT1A 5KSOA 1TU4A 3K09C 3FDIA 2FSIA 2QAJA 1J8YF 4EFNA 3DZDA 2CK3A 5CDFE 3SBEA 3SDZA 1E32A 1UDXA 4F91B 1P3JA 2Z6VA 1EWRA 2HDNB 5D3MB 3QQ5A 5SZJA 3NIBA 3B6EA 1DAGA 3WMEA 4LYAA 1RJ9A 3FOZA 2LKCA 2RGXA 2C78A 1YZLA 2H92A 4P0TA 3QEOA 3VKGA 1XXHA 3I4LA 2XNSA 1OFUX 5FOUA 5JWHA 4FMCB 2DFTA 5KNCA 2Q3HA 2KWIA 4M1YA 5BN4A 4DXAA 1YZNA 1G3QA 2YNMA 3UKDA 821PA 4URXR 5C4MA 3IGFA 5C2JB 1TQ6A 2DFNA 3MD0A 1GRQA 3FE2A 1W0KA 1IXZA 2GCOA 2IYZA 2A7QA 3TRFA 1SHZA 2P65A 4AC9A 4KCGA 4DC9A 2NO6A 4US0R 1T5LA 5E7JA 1J2JA 3I8XA 1NN3A 1GILA 1KJZA 2O0KA 2QA5A 4BFXA 2D74A 2GA8A 4HAYA 1EX6A 3GLFE 4TLDA 2R8RA 3I5XA 5KDOA 3KKQA 3VQTA 4OK6A 3W5IA 4A6PA 4OL0A 5JWOA 5FH9A 1WMSA 1LF5A 2XTZA 5E7MA 5DISB 3K0CC 1IXRC 2FGKA 4EJSB 5JEEA 2CK3D 3THYA 2VPPA 4QHYA 2BJVA 3IO3A 3PR1A 1AZSC 1BMFD 3B8HA 1NLYA 4FXPA 2F6RA 4P4UA 1C9KA 2CHGA 1YZTA 2ZUBA 3PCRB 4IDOA 4II7A 4Q7KA 2UZIR 3R9IA 1NG9A 2WICA 3VX3A 5DE3A 4LZZA 4EUNA 4LV5B 4G5OA 5CB6A 1XJ0A 1SHKA 2BM0A 2R6AA 2GNOA 3A1VA 3GCGA 3SJCA 1GKUB 2HYDA 4B75A 1MH1A 4FMDF 4LRWA 1SVIA 3LX8A 5TY0A 3K1JA 1OB2A 1W0KD 4CRWB 2REBA 2NZ8A 4DDTA 4BE7B 5D3QA 4XWKA 3U6KA 1GM5A 2CEAA 4LJ6A 4MDEA 1ZYUA 2OEPA 3DOEA 3PEUA 4EPYA 3TKLA 4RKFA 2I1QA 4R71A 4W5WA 3QBVA 3L0PA 2CLSA 1NF3A 1MO4A 3CRQA 2JLWA 3K70B 1QHSA 4IDPA 4JZKA 4BPBA 4TLAA 5GVRA 4AG6A 4KVGA 1N6LA 3Q7QA 4B35A 4C0AC 1K5DA 1II8B 4K8OA 4LPKA 4CEJA 1P5ZB 2QY9A 4GT1A 2PX3A 2IWHA 4G01B 1P9RA 1F48A 3VKHA 1B0UA 2Y8EA 4Q7MB 4AKEA 1FX0B 2MSCB 5CIWA 2XGJA 2FZ4A 5DNYB 3QG5A 1Z2AA 1N25A 1DE0A 1G19A 1G4UR 1GNRA 1KOFA 2NO7A 4JT4A 4MRVA 3P32A 4PQRA 2QQ0A 1OH7A 3DPUA 4WBSA 3KTAA 3OFNA 4WOPA 3GJ7A 3AF3A 2WWYA 4PC3A 3MRSA 1T8TA 2FJUA 2SHKA 2VBCA 2VP9A 2VSXA 4XWAA 2G9NA 4X8MA 1DAKA 4XSGA 1U90A 2DFLA 3BH6A 4MITA 2VL7A 2QEQA 3ZDQA 5KHOC 4URZR 3M6AA 4IOMA 1P72A 3SJZA 3W6OA 3MWJA 1V43A 1Z07A 4Q7JB 1G41A 1CP2A 1RKBA 4HAVA 4Z1MA 1UJ2A 2B7CA 4Q4JA 1IONA 3TVTA 3C41J 1GWNA 3GLHA 5HPYB 2RGCA 1MT0A 3A58B 4CT4B 4CEIA 4NONA 3NBXX 1EESA 1YRAA 2QTHA 3VKWA 1X8KA 1ESNA 1P4SA 4PZLA 1E9RA 2BV3A 2RGNC 4Q21A 2YOFA 4EPRA 2X19A 2QRZA 1Y63A 5J4LA 121PA 1IJEA 1CU1A 3EA5A 1EG7A 2VRWA 3PV0A 2Q9BA 4U02A 4C7OB 4DLXA 1RFLA 3QJYA 1HE8B 4P4SB 5GJCA 4TYYA 5JHGB 1ZM2A 1E2JA 1IXSB 4OQMA 1GRRA 3KKOA 2OBNA 4LK2A 4WIAA 3F0TA 4TTRA 2A5GA 2AK3A 1ZD8A 3OFND 3P27A 3PJRA 3AVWA 1XEXA 4PANA 2W6IA 1E2GA 1W49A 3B78A 2NPIA 3HYTA 1QDEA 2R62A 3KQKA 4AKHA 1L8QA 1N6IA 2D4HA 2PCJA 2QORA 4NYMR 1DG1G 1JI0A 2IYQA 4QGFA 1JQLB 2WIBA 3OHMA 5EJEA 1XD9A 1ZRHA 2E1RA 3W6PA 1QHIA 4WXPA 1YR8A 3AH8A 2ZRAA 2W2VA 1XWIA 1M6NA 2QRNA 3RS7A 2CNWD 4FD2A 4Q19A 2IYVA 1KMHB 1WA5A 4JJZA 4ZCLA 4Z1MD 3G82C 1R8QA 4HB3A 2OFXA 4NH0A 4ERNA 1CR0A 4IEIA 4NCJA 3SI7A 4EIWA 3CNLA 4RZUA 4A8JB 2ZI9A 4ACAA 4HDCA 5FFMA 1R8SA 2D2EA 5E7IA 5C4GB 3MUFA 2FN4A 1NSTA 1W5TA 1KMQA 2C9CA 3L2OB 1IN8A 1E98A 1F2UB 1W4RA 1ZBDA 1ZJ6A 4RY2A 4D25A 5FI0B 2WVJA 4MGZR 2TMKA 3JZMA 3JVVA 1I4LD 1JAIA 2YHSA 4HAXA 2B92A 2ODBA 2JAQA 2NPFA 3TBKA 4ZO4A 1KNXA 3BRWD 2WMOB 4LHVA 1XTRA 4S2EA 4M1WA 3OIWA 1ONBA 5JCZA 1KO7A 3KKMA 2V9PA 2AD5A 1CXZA 4OK3A 1UKVY 4WVFA 3UPUA 2JA1A 1HV8A 4RCYA 4NL4H 4MKHA 5J40A 2W6ID 4DVGA 1OSNA 2ZREA 3WRXC 4BQSA 3SU8A 1ZW6A 2A5YB 3ONWA 2OFOA 4P4TA 1P2SA 2OLJA 4C3ZA 4DLWA 2DY1A 1FPMA 2BBTA 4TYQA 3WHLA 5K8TA 1E2IA 4KBGA 2JLXA 5EE3A 3RS0A 1RRGA 1XBTA 2F1IA 1XZPA 2H7VA 3ZZ0A 2P5SA 2ZJ5A 1Q21A 2ERXA 3CW2A 2RHMA 4QG7A 3UWOA 4P33A 1G7SA 1CJTC 1KSJA 3CZPA 4PPGA 2C03A 3AVYA 1CR4A 3U3KA 1CRPA 2FWRA 4G5RA 1XMSA 2UVQA 2V6JA 2AD1A 2WKQA 3X1YA 4ZIRA 3A1SA 4C4PA 2B8WA 3SBDA 4B43A 1AIPA 2FH5B 2HXYA 1XEWX 3T06B 1D9ZA 3LVRE 4US2R 1KSHA 4ABYA 1GVNB 1MRSA 4Q48A 3WYFA 5EQTA 2ZRJA 2PT5A 1E99A 1W4CA 3AM1A 4QBGB 2ZS9A 1E69A 1T0HB 2ZVPX 2IYLD 4BLQA 1UFQA 5KYKA 3I92A 4O25A 1E94E 5HTKA 4OI0A 2FFAA 1C4OA 1ZC4A 2IYYA 3CX6A 3ECCA 3JZAA 2CHVA 4YMTA 1P60A 1Q1EA 3NKVA 5HKKA 2QL6A 4FW9A 3BERA 3WYAA 2EWVA 3AVOA 4PPQA 2GVDC 4Q7LA 4CEJB 3AP1A 3T5DA 5G3ZA 3U7EB 3CPHA 4H9GA 1FW6A 1IOZA 4OYHA 1Y3AA 2XX3A 1SVWA 5L3QB 4M4SA 2WSSA 1OYYA 2XJ4A 4Q5IA 4TQAA 2ZR7A 2YINC 4UKDA 1S1MA 3V4RA 3I3SR 3KQLA 1J99A 4ZI2A 1KK0A 4AI6A 1MO3A 1N2CE 1VCNA 5FBRB 4Q03A 2QTFA 3SJBA 1UKYA 3IHLA 4OI4A 2AK2A 1F2TB 3W5JA 3R9XA 1AM4D 2YWEA 3ZGXA 1E2FA 4IDQA 5FTMA 2ZROA 4R7ZA 1QHGA 3ZS8A 4D6PA 1E9FA 4DSUA 4L15A 1TEVA 3BH0A 3IQXA 3QVVA 5JCPA 3B2EA 4URUR 4GFDA 1UEJA 3AF0A 3KFVA 1T8UA 1XNJA 2CHQA 4JLMA 1XF9A 3LLMA 3AUYA 1SKQA 3LW8A 3U4QB 5HKKD 1NI3A 1ZIOA 3L8ZA 4HUQA 3EARA 4B71A 4TYNA 5E95A 3REGA 4G1UC 3ZQJA 1U9IC 1G5PA 4PHGA 1ZM3A 2WWWA 3GLIA 1DEKA 1LS1A 2CCJA 4DB2A 2P6RA 4XIGS 5SZKB 2FG5A 4M0LA 2MSDB 3KB1A 3ND8A 3KJHA 2GBLA 2V1UA 1M8PA 2WSSD 2DFKB 2ZAMA 1YKSA 3HPQA 2IF2A 3GJ4A 3T5GA 3VU9A 1FZQA 2JLRA 3OAAA 4ZCMA 2IUSA 5DI9A 3T1TA 1L7VC 1JXOA 1H8HA 4KLZA 4TN1A 4GOKA 4JVNA 3TAUA 3EPHA 4DWJA 4U7DA 4HLUC 4Q01A 1RYFA 3U44B 4GMDA 4QRHA 1NLZA 4QJ4A 4DLYA 3THWB 5FI1B 3AVQA 3FKSA 2WAYA 3BXZA 3UWKA 2NIPA 3W8NA 4XJXA 1E1RA 3QG1A 1NIJA 4LJ8A 4ZDIA 3KXIA 5JEDA 4IVPA 3T1VA 1U99A 3IBGA 4NKRA 2O8FA 3H2YA 1P73A 1X1SA 3IHWA 3TQCA 1ZNWA 3U7GA 2D62A 1W36D 2O8DA 2NGRA 4PSKA 1P6XA 2ATXA 4I81A 1U0LA 1JPJA 2CLCX 2PEZA 4A0HA 5JJLA 1ZVQA 4IHQA 4O2LA 2ZM5A 4Q9KA 1V5WA 4HYYA 2OV2A 2EFEB 5TVKA 4JBWA 5TXGA 4QHSA 2FGJA 2ATVA 1JECA 1YR9A 2F9MA 4PQYA 3PXGA 3SJAA 3TE6A 1IBRA 3VR1A 2DWQA 4B3DA 1B23P 4E5UA 3B5JA 4P32A 3OAAD 4LX0A 3RRNA 2ZYTX 2D06A 5CIQA 4L9SA 4DSNA 3RLFA 3KUCA 4EQ6B 2ZU0C 2GJSA 1H8HD 3CF2A 4KODA 4Q9JA 5TARA 5JSZB 4D0LB 2IHYA 2ZRDA 1PJRA 1QG2A 2J87A 1MO5A 2RKOA 3DKVA 3Q85A 4PPFA 4AG5A 4DCTA 2P6NA 5M04A 2JIZA 1SXJC 1KSFX 2Q0HA 2ZR0A 2OUKA 4JVMA 4TZ0A 1LB1B 2B21A 4XTRA 3PG5A 5FOVA 2X2EA 3W3AA 3NC0C 4QJ5A 2QGNA 3LRPA 1X3SA 3X1WA 4DBLC 1YRBA 3FKSD 2XB2A 2BM1A 2QP3A 1NSFA 4ARZA 2ZPTX 3X1ZA 1E1RD 4V0KA 5FUVA 1NMZA 4HI0E 1A4RA 4DCSA 1MKYA 1PUJA 2XITA 4MKFA 3IIKA 1WP9A 1OXSC 2ZRPA 5F98A 4LYHA 5E4FA 2KJQA 1Q44A 3FMFA 1DADA 4Q4AA 2X1VA 4LCBA 1G8YA 4R98A 2JATA 4Q1EA 1DAFA 4NYIR 4WZ6A 2CMKA 2BKUA 3P20A 1G21E 1JEDA 4PZYA 1TPZA 2FFHA 2D7DA 2QM8A 1ZM7A 1K5GA 2ZR9A 4TQ9A 2DWOA 3KUDA 1YZGA 2F43A 2ZSAA 2WPDD 3GJ5A 5LBIA 4LOAA 1KIMA 1P9NA 3C5CA 4C0JA 3AEZA 1VTKA 5L3SA 1NBME 1TEXA 1GP2A 3QE0A 1P62B 2ZS8A 1HA3A 1SKYB 4HEJA 1P2VA 4GMXA 3P26A 1IN7A 3T34A 5GJWC 2WIAA 1A7JA 3EASA 1VCIA 4HAZA 4M53A 5HZHA 1FL9A 3BAFA 1KGDA 2JLYA 2JIZD 2C2HA 1Q1ZA 3ADBA 2HJVA 3UATA 3HPRA 5JWRA 3RS4A 2IHBA 2YOGA 4JLBA 1E9BA 4OHWA 4B47A 1EGAA 3REFA 3CWQA 4N0DA 3FGNA 3KJIA 3W34A 4ZI3A 3J81k 3B1ZA 4XVQA 2OM2A 5HCIA 3EZ2A 3RNLA 2J1LA 3EPLA 1YHNA 5CDFA 4G5SA 4LSGA 2H17A 2IYRA 3IIJA 1OPXA 3MAAC 1ZCBA 2JGNA 3CKLA 4HB4A 3EG5A 2G0NA 4WZAE 2CCGA 2F3RA 1AS2A 4DEXA 1T6NA 4HDOB 1TX4B 4KO8A 4LV8B 3BD9A 1WRBA 4MRSA 3E2IA 4WXRA 5BYJA 1JEEA 1IQPA 1ZNZA 4BGDA 4LGMA 4DRZA 4ILEA 1YZQA 4Q02A 1DAEA 5TV2A 2WZQA 2G88A 2QBYA 2WOJA 2YJTD 1BOFA 1KZ7B 2FA9A 4H1UA 1OIVA 3B9QA 2WWXA 5IT5A 1DAHA 1J90A 4DLVA 1NKTA 1CJKC 2XTNA 3GLGE 4WA7A 4KFUA 1UEIA 5FOWA 1FTNA 4EFMA 3SQWA 2ZRIA 1XPRA 2ODWA 4QC2A 3MJRA 1TU3A 4RZXA 3DHWC 5EUMA 5H8WA 5DN6D 4QM6A 3GLFA 3C7KA 3PUWA 1EFUA 3VR6A 3UMSA 2XZPA 4PC6A 1NIPA 2CE2X 1I2MA 2IWRA 3TIFA 3LX5A 2J0UB 3HWSA 4Q1DA 3ASYA 3WP1B 1G3RA 5JFGA 4LWZA 1D8TA 1US8A 3EWAA 2J5XA 3WMGA 2RB4A 3QY0A 5A5GA 1LV7A 4C30A 3PUXA 4Q1CA 1N5KA 3CH4B 4C0QC 2EFHB 1GKIA 4S35A 3VR3A 2VSFA 3R7WB 4E07A 5J47A 1CBUA 1WDTA 1KI3A 3QPVA 5CM8B 621PA 2FOLA 5FUXA 5F9HA 4NZYA 1DBSA 4YMVA 5FTKA 3IQWA 5IRCD 3BH7A 1Z3IX 1VKJA 4HATA 3ZIAA 4B2LA 1KI4A 2QMEA 2XOKA 4OJKA 4X8LA 1N0WA 3LWNA 3CBQA 4PC1A 3CNNA 5FPSA 5BW8A 3FMIA 4KV9A 3F3YA 4TL9A 3V9PA 4GRAA 3CZQA 2IYWA 1W0JA 2WMNB 4MRPA 1CF4A 5FUYA 1SQ5A 3A1UA 2ZJOA 5J4VA 4TL6A 721PA 5K8LA 3M0EA 4D4KA 3K8YA 2EFGA 1GL7A 1AKEA 2GF9A 3NWJA 1OLOA 4OQFA 3RSOA 3TUJC 4ACBA 2V54A 3CH5A 3LBIA 5LPNA 1XD8A 2AXPA 4BLRA 4CEHB 2GK6A 2ZVQX 3TR5A 1ZCAA 3E5HA 4ZDWA 2O0JA 3D7MA 3UANA 4B34A 4YLGA 1S1CA 2K5UA 4KFRA 1F6BA 3LD9A 4HLDA 5CM9C 1BMFA 2NO0A 1N6OA 5C18A 3LFUA 1XJCA 4MUAA 4IEEA 3O8CA 1KJWA 3T1OA 2O8BA 4FCVA 1AQYA 1D9XA 3WMFA 1TQ4A 1XZQA 3U5ZB 5JS8A 5P21A 4N1AA 4R2HA 2JJ1A 5F9FA 5KSYA 4J0QA 2JDIA 1XDBA 2Z83A 2OILA 1QHYA 2QMHA 1E9AA 3AKYA 1XTIA 1OHHA 5FOXA 5FUWA 3RC8A 1XEFA 3W9YA 3L8YA 3EW9A 1A5TA 4M1SA 5J4YA 3TLXA 3O8BA 2BBWA 1E2DA 1ZNXA 3QOFA 4IFEA 3QKRB 4IW3B 2WJJA 2OG2A 3ZIAD 1UPTA 2FPMA 2XOKD 4ZDJA 1JQJC 2WWIA 2H57A 1RRPA 3MCAA 3PIRA 4UQOA 2GJ8A 2IEZA 1RRCA 4RFVA 1D2EA 2IBMA 2QPOA 1M7HA 1W0JD 1I2DA 4HB0A 5TB5A 4Q9LA 3ZYCA 3QKSA 2CJWB 3H4MA 4JL6A 2CE7A 1ZC3A 5CLLA 1VDZA 3LH5A 4JLNA 5JLJA 2FE4A 5KTYA 2J7PA 4POAA 3B1YA 2VLIA 5HCNA 3MWKA 4ASUA 4F38A 1Z83A 1BYUA 1E9SA 1TTTA 4A2PA 1OFHA 4FMDB 3UK6A 4V0ME 4BWYA 1VG9B 3MGCA 4KLNA 3SFZA 3K0FB 1DS6A 1XD2A 1U81A 1ZINA 3CLVA 1CS4C 3OIUA 1Z6TA 5LDDC 4PSAA 2VF8A 3AV0B 4NYJR 1QVAA 2VA8A 2JJ1D 1MR3F 4GI7A 4C2TA 2JDID 3KXKA 2GILA 1A1VA 4RVCA 5ELXA 2O8CA 1OHHD 1H8EA 5A0FA 2ERYA 3T15A 3DDCA 1PLKA 2FEMA 3EA0A 3TJZA 2QG6A 3NVAA 1R0XA 3IO5A 2ZSDA 2RGDA 1SXJB 5EUQB 2GEDA 1NY5A 4ZKEA 4EPTA 3D3QA 2QM7A 1CJMA 1G6HA 3FMOB 3K9GA 2ZE7A 4JLAA 4Q4HB 4AYXA 4CW7A 1M2OB 5JECA 4I1OA 3BGWA 2GJKA 3TSWA 1KI6B 1OE0A 1M74A 4YDSA 2IF0A 3CX8A 1XP8A 3VR5A 1QVRA 5EE1A 2LWIA 4KSBA 2W2XA 2J7PD 1EXMA 5FPTA 3VR4A 3KX2A 4ASUD 5SZIA 3K0AA 3DL0A 5J5CA 2ORVA 1AS0A 2J45A 3VX4A 4D81A 3D31A 4JMPA 4NU0A 2BMDA 2V55B 1Z6GA 1Z6AA 3Q3JB 5BWMA 4F7WA 5KSZA 4BFZA 1FNMA 4PO8A 3EWSA 3THXB 5IK2A 1PV4A 3CRMA 2A78A 1S9HA 1K6MA 5H68A 1HT1E 2R44A 4RJLA 1PZNA 3DMNA 4D4LA 4EPXA 5JZVA 3FFBA 1JR6A 2BCJQ 2I1VB 4BZPA 3S1AA 3RABA 1H8ED 2ZUCA 4QKQA 1ETUA 3GEIA 1NL3A 5GVSA 1MABA 3LO5A 4ESHA 3QVUA 3KDSE 1GNPA 4JBXA 3U7FB 2NTYC 4UNPA 2VP2A 2WJHA 2PZEA 2OLKA 4JLDA 4XVRA 4LHWA 4C0HA 1SVKA 4Q47A 2CNWA 4A9AA 1HTWA 1J70A 3AQ4A 4PHFA 5AK0A 3TK1A 3HR7A 4QGAA 2W0SA 4Q1BA 1DAIA 2GXQA 3N70A 2GEUA 5JS7A 4HLCA 4R2IA 4GZMA 2OZEA 2NO9A 4BZQA 4B3BA 1KK1A 4IFBA 2QSYA 2BBOA 1E2KA 3CRRA 5J4HA 2H5EA 4C9BA 2LKDA 4RD4A 4P3YA 4BFUA 4C0KA 3ZJYA 3ICQB 2A30A 3RS3A 4JYCA 4DDVA 5IK2D 2HUPA 5FR1A 3GP8A 2REXB 1SVMA 2ZTSA 4YDHB 5FL3A 4AK9A 1EX7A 1GKYA 4DT1B 2J0QA 1TUEA 2BHRA 1RPZA 2ZRMA 3ZVLA 4BEBA 5DYIA 4LHXA 1DG3A 3LXXA 4FI3C 8OHMA 3WRYC 2UKDA 2V8OA 4JT2A 2IYUA 4MGIR 4V0OA 4CIDA 4PC2A 1RJ9B 1UBEA 3M1IA 3LQQA 4LC1A 1ANKA 2ZE6A 4M1MA 3K9NA 1G18A 1XXHB 2QP4A 5AJVB 221PA 5EE9A 5CYOA 1YU9A 2ZSFA 1J7KA 2J9RA 1KO1A 2J46A 2N42A 4YQFA 1A82A 5DI3A 5EXPA 4L16A 1E2QA 2EVWX 2GCOB 4A6XA 1P2UA 1QF9A 3ZD7A 3BB1A 1Z0KA 2R6FA 1IY1A 1S9DA 4OKSA 4BECA 1WBDA 2VHUA 3QIAA 2JASA 2A9KA 1X8LA 3LAWA 4QNMA 4WZBE 4YMWA 3A37A 3L0SA 3BFVA 3QF4A 1NLFA 3ADDA 3OEEA 2RGBA 3EXAA 3OEHD 4LYFA 4PPNA 3GEHA 4JL8A 3TH5A 1VIAA 3ASZA 3Q7PA 4NHOA 1L2TA 4XH9B 2HEIA 2ZYWX 2YZ2A 2OFWA 5AR1A 2VTKA 3THYB 1S96A 4U5XA 1XJQA 4BLOA 1OV4A 4BLTA 2IA5A 1ZIPA 3GJ6A 3QUSA 3SZRA 1Q22A 2G1JA 5L3RA 5DHAA 1Z29A 2ZRHA 1XD2B 1GSIA 2G0TA 4JYBA 4TMKA 1N5LA 5LD2C 2FF7A 4BZXA 3FWYA 2QENA 4FCTA 1UM8A 2DPXA 5KPDA 2FPKA 3GJ3A 4G3XA 2NZJA 3R20A 2IXFA 3GQBA 3KFXA 3IPXA 3U3OA 1DELA 2IS6A 3AP3A 2HF9A 1IAQA 2ONJA 4UJ3A 2HV8A 1HYQA 2VHTA 1ODFA 4DSOA 4TWZA 1GZSA 3R8FA 4JS0A 1QHHA 2QPAA 4JVLA 5FOTA 1X86B 2HCBA 4C0LA 3OEED 2GHIA 2PEYA 4MA4A 5J4KA 2FSFA 3RVBA 2PT7A 2F55A 2WSMA 2XZLA 1HUQA 4IVRA 1W36C 2QQEA 4TL8A 1RZ3A 4HSEA 2XXAA 4AIIA 4ZKDA 1HEIA 1JB1A 3TW4A 4AURA 1U94A 4DIEA 2O8EA 4PZZA 2V1XA 4KXFB 2YWHA 1X1RA 3IIMA 4B2IA 4KYUA 2QU8A 2Z0MA 2GBLC 4JJKA 1Z0FA 1T3SA 4M1TA 3IPYA 3K0SA 5IDVA 2R65A 1R0ZA 1G6OA 2YKGA 3DVLA 3DM9B 2ZRGA 4A82A 1HE1C 1HQCA 1R5NA 4XSHA 3RC3A 2A2ZA 4F93B 4E22A 2ODEA 4PR0A 4BLSA 4D4MA 2Q21A 3QNUA 4B3GA 3KTAB 3SOPA 3W90A 1SULA 3D8BA 5A4JA 3EPKA 3PUVA 3FMPB 1MRNA 3LLUA 1WCV1 2OO7A 3AF1A 4CYMA 2NQ2C 4PX9A 2J3EA 2GEVA 2DR3A 3C8UA 4F4IA 1QRAA 3O8RA 2PL3A 2HT6A 3LA6A 4A4DA 2AWNA 4GZLA 2KE5A 2N46A 3NBZC 3QXCA 4Q4JB 1IHUA 2WHXA 4AY2A 3IUYA 2ZRBA 3GLHB 1NVVQ 3LW7A 1P61B 4MH0R 2C98A 4W7SA 3BFXA 1YZUA 4CEIB 2A3RA 3QXXA 1KKLA 4X8OA 5B58C 3H1TA 3SEAA 2FFQA 4G5QA 4QFMA 2MMCA 2BMJA 4KYIB 4LC0A 4HB2A 1P2TA 1Q3TA 2XJ9A 2XZOA 2LCFA 4TTQA 3Q72A 3FVQA 5JMTA 2VP6A 3I32A 2R9VA 1R5BA 1VIYA 2RCNA 4DLSA 3MG9A 2HT1A 5KU1A 3NHBA 2CL6X 1Q57A 5BXQC 4LUCA 1DO0A 3W6NA 1T5IA 2W0MA 2W2TA 4KVAA 4ON9A 4L8GA 5FBVB 2G3YA 2Z4SA 3AVTA 5DIFA 1E6CA 1WF3A 1OT3A 1XEXB 1I4DD 1WXQA 4JL5A 4CGZA 3AKEA 1S0UA 1AN0A 2Q6TA 4O0MA 3RHFA 4RFSA 4P31A 4YXWA 1NBMA 4EAQA 2CVHA 4AKGA 2CL7X 3BE4A 3PUZA 4D80A 2QGZA 2GETA 2KBEA 1TF2A 4YC7A 1VG1A 3AF2A 521PA 1Z06A 2QAGA 5DGXA 4OI1A 1LF0A 1E4YA 4DDUA 3HU2A 2N1BA 1Z6YA 2BMFA 4HZUA 1YQTA 3TAHA 2FMXA 1XTSA 2OXRA 4MKGA 2V4ZA 3R8CA 1XMIA 2O5VA 3ZVMA 4K81B 4DEYA 1KO8A 2G83A 2RH5A 1SKYE 1P9WA 2AL7A 3I72A 2R6GA 4JBYA 4TL7A 2F7SA 1R5OA 3W3ZB 1HY3A 3QKUA 1OXVA 1KO4A 2WM9B 3E70C 4GNKA 4IOLA 5GJBA 3KKPA 4BFYA 3K53A 1W48A 4XVUA 1G7TA 2WPDA 1KDPA 1TL7C 4NYMQ 4A2WA 3D6TB 5G40A 4JLOA 1GUAA 1JAHA 2GZAA 2ZE8A 4NDZA 2F9LA 2AR7A 4MKIA 4ZPXA 3V00A 3OF5A 4OI2A 4DLUA 4FCWA 1W46A 2HXSA 3CF6R 1KAOA 3I8SA 3A4NA 4Q1AA 4MYTA 5D3MA 1JBKA 1GRNA 3AB3A 2QI9C 4YXWD 3EIEA 1NBMD 1D5CA 3I61A 3GLGA 3U3RA 1G8PA 4OJQA 2ANCA 4TMZA 3O8DA 1G291 3K9HA 2ZETA 2P6UA 1KDRA 2QN6A 5BN5A 2QNRA 3BJIC 3GFPA 4OHVA 2HF8A 1LNZA 1WBBA 4ZIRB 3THOA 2WTUA 1YR6A 4BASA 1W7AA 1IY0A 2OESA 1XPUA 3AVXA 1F3OA 3CRVA 4O3MA 1S4QA 2KBFA 2BOVA 2ZRCA 2ZJAA 3AGQA 3PVSA 4TMVA 1PLJA 3KQNA 1E2HA 1N5JA 4D4JA 1ZUHA 3GPLA 1JR3A 5EP3A 3HDTA 3EC1A 4D2IA 5KSPA 2F1JA 2ZI5A 1QHHB 1OF1A 2VP5A 1FNNA 5DHFA 1VG8A 4QXAA 4EPVA 1DPFA 1UAAA 1P75A 3EZFA 3QXHA 3RS2A 1RVDA 3T35A 3W8RA 4EJSA 1CTQA 4IDHA 4Y0VA 3IKJA 1AQUA 1TF7A 2GCPA 1F5NA 2ZYUX 5G41A 4KITB 1W47A 4O2RA 4XWOA 4MRRA 4UJ5A 2WAXA 1MOZA 2J0VA 4LHZA 3T61A 1ZP6A 3DOFA 3CF0A
chains in the Genus database with same CATH superfamily
3NHZA 1RI4A 1N5MA 3AIMA 3TECE 1HX7A 3ZZNA 5JXWA 1WE2A 3OF2A 3M1AA 5EESA 1U3UA 2IX9A 2OBMA 3G0IA 3L9XA 4MARA 2ZBPA 2B37A 1Z5PA 1VMDA 2VNHA 1TQ2A 1T0BA 1A2OA 4HRAA 4Y2JA 5LD2B 4QOEA 3OY7A 2YVUA 4MVYA 2DJ5A 4LJYA 1SZPA 3QXSA 3ZE6A 3WYDA 2DE0X 2I4RA 2JLBA 3IQEA 4WBNB 1QG4A 4X3PA 1C3OA 4B3XA 1L7PA 4Z0NA 3DAHA 3U4AA 2PXXA 2B4YA 1UINA 3RG2A 3MMZA 5E38A 3GN1A 5CNMA 3TQFA 1ZSVA 4I4IA 2Q3MA 1DO2A 1QE3A 3KEGA 1JSZA 4G1EB 4IBOA 2A0FA 4LBVA 3BIJA 4QUJA 5JTUA 3G5LA 2C82A 2Q1SA 3JYOA 4O4IA 5G0WA 3VJMA 2DFVA 3OLZA 2RGEA 4PSVA 1K06A 3D54D 1P29A 1COZA 4GPTA 2R751 4YJFB 2QLLA 3R8XA 1P9OA 5KB3A 1L6IA 3BQ9A 5DT2A 4KJZA 3LZDA 1G5TA 3PFKA 2HCJB 3GMTA 4EKNB 2VAVA 3OWHA 3SICE 4GI1A 2X22A 4FC7A 2NU6B 3LUBA 3RAGA 1RJFA 4TLCA 4C2AA 4RVFA 4PGFA 5DYGA 3C8MA 1E2EA 3FCCA 2IPOA 3KKZA 5BSWA 4A0SA 3R0QA 2JIQA 4MPPA 3KHUA 2VDVE 5GQSA 1FFHA 1TAHA 4F8EA 4QXQA 3B3FA 3OPVA 4W8HA 2D3WA 5F4ZA 3B9PA 2KSQA 1FX0A 4GE3A 1PQYA 1FVFA 1NBWB 2ALJA 2ZEJA 4G5FA 3TS1A 4DB4A 1ZKMA 2DOKA 4IQ0A 3SHWA 4Y67A 1E1QA 1JTVA 1TJ4A 3JAWB 4Y2YA 3UMMA 4GG1A 3OE7A 4PINA 2QD1A 1J07A 3ML1A 2VUSA 4CG3A 2VO1A 4ZMBA 5AUOB 2XMCA 3W8FA 3D3KA 1XALA 2G28A 1I7SB 1U8YA 2HLNA 1U4SA 3I0NA 3KSRA 1CR2A 3V4PB 2FSHA 1WLSA 4YUYA 1VCMA 3HKEB 4RIFA 3UOWA 1JHOA 4OJTA 4LI0A 4OQEA 4DLRA 3OLWA 5C9ZA 5HOQA 4X9XA 4JCCA 4JUDX 2HN9A 1EBBA 2WSBA 1VGVA 4MIKA 3VV2A 3R4CA 1N6KA 2PSEA 3D6JA 3U4GA 3ANYB 3IXMA 1IHXA 2WI8A 2H65A 2B8TA 3LQRA 1H65A 4F3TA 4OFXA 1AKUA 1KZ1A 3L1UA 3WSTA 3S5JA 2ZS7A 3GIDA 4Q24A 4Q12A 3K20A 1WTCA 3CKMA 2XVYA 1GDHA 4JVSB 4ZHQF 4R2LA 1TA4A 2BGNA 1XZGA 2E5FA 4MGKR 4NJMB 3FZEA 4PG4A 4K9PA 2PWZA 1IOLA 3QLUA 2R79A 3DDHA 4P4SA 3O2SB 2O5RA 2VYQA 2XY4A 5KVSA 1DU4A 1VMAA 2B8JA 1K7YA 3NI2A 3O94A 5HMMA 1UJNA 1UQTA 2DWPA 3LZCA 5ESXA 2F4VB 1F3LA 5BUSA 3LDGA 3EVDA 1J5PA 4N7BA 5DWDA 3ELYA 3GARA 3H1GA 3ROGA 3FF1A 5DX0A 4EDHA 4CKWA 4D45A 2GBCA 3WISA 1R4AA 1SPBS 2ZQYA 3TW8B 2GDJA 3I09A 4HBZA 3IP8A 4TMTA 4U8HA 4UM9D 1KETA 2Q1UA 2JL1A 5H5JA 4R7TA 4A5OA 1KAMA 2DR0A 4YUZA 4QOGA 1KPGA 1EYZA 3GC6A 4MV8A 3RAJA 2C4UA 3J7AC 4UHHA 2AZXA 1NVDA 2LZ0A 2PS3A 1XZBA 3B8EA 3VTKA 5JI3E 2NT3A 3IOEA 2HRDA 5BRJA 1C50A 1Y1LA 4PAMA 1P4GA 2OBLA 1RE0A 2B3DA 5CJ2A 2PR7A 4ZICA 1ESMA 1XLUA 3I73A 3OZCA 4WLVA 1EINA 4JKOA 3RTDA 1R0WA 4R69A 1PJQA 1T29A 1UADA 3LNCA 3Q9LA 1WUKS 5GOTA 4GR4A 3SS9X 3D8UA 1J8FA 4OA8A 4LRSB 3ZWYA 3BSYA 2FR0A 3VSDA 2E4UA 4ETIA 3B3QA 1RWPA 4B6SA 5AM0A 1PJ2A 1UUFA 1GSHA 1QH9A 3WOVA 4MV4A 2QLJA 1J22A 1XP5A 2I6TA 3AL2A 3CZAA 4M0DA 1XCBA 1XJWA 2VHXA 4Z0HO 3H5RA 1MEEA 1Y4AE 5FWYB 1EWKA 1ZMXA 3RW9A 5I7VA 3IEMA 1QIKA 3UA3A 5C8YB 3W2GA 4CLOB 4Q6BA 3WLIA 1IUNA 5KTKA 5JE8A 4MR8A 2EKLA 4B4VA 4BQQA 2MMGA 2YRXA 1Z0UA 3KTFA 2OGTA 4QNRA 4N0EA 5A4KA 5ADWA 5IABA 3I5YA 5L3SB 2ZI6A 3WLTA 3AKDA 3DP7A 4CQLA 1YR7A 1YZFA 1AZWA 4ROSA 2YV5A 3NWOA 3EC2A 1EFRA 4WXYB 1DXYA 1NXSA 1IZ9A 3CY6A 2PUBA 1XMOB 5FFFA 1N0UA 1ZHFA 3H16A 1H2FA 4UE2A 1UMCA 1FNCA 3TI7A 1T6BY 4KI0A 1ZM9A 3DHYA 5KDLA 4F4DA 3PD0A 2N47A 1CY1A 3JWJA 3DDZX 3I62A 2C7QA 2X3UA 3H11A 2NTNA 2AFHE 4ICIA 3U4HA 1CV2A 1XYYA 2LP4Y 3GPIA 3C15C 4AF8A 4AMUA 4ZDKA 1PR9A 3RM3A 3U26A 2VI5A 3IVAA 4C3VA 2C8LA 2W8BA 2BWJA 4EA7A 4ENUA 1U1FA 1GOTA 2E87A 1TVCA 4HDQB 4RABA 3EUFA 2F67A 3FSEA 4KPFC 1X7XB 1XKXA 3L5OA 5CB8A 2OQ2A 5BUQA 4MWGA 4Y1GA 2CNOA 1LBHA 2FP4A 4U7GA 3IXLA 5K6TA 1MX3A 2II6A 2PL1A 2IDMA 4FTWA 4B0PA 2FU5C 4ZVNA 1XQWA 3O2NA 1DJMA 1OWOA 3A36A 2YOHA 3UAVA 1PF7E 5KTNA 2QBYB 3BWDD 4MKXA 2QZPA 1NDQA 3PXXA 4XQGA 1FMJA 2BDTA 2VYVA 3Q5DA 4DOMA 1TZMA 1NQUA 2OMKA 3H99A 1MW9X 1NG1A 3UENA 5IT9A 3OQIB 4AJNA 2K7FA 2C00A 3LVQE 4OKIA 1QO7A 1OIXA 3NH6A 3KJZA 3O83A 4RVHA 1V4VA 1FF9A 2AOTB 4Z8XA 1LSUA 1Z0SA 2PRYA 1GU1A 2YCBA 5TS2A 1QRTA 1J8QA 3ORRA 4TV8F 1LPBB 2XADA 1UT5A 4BKQA 5DRTA 3VJKA 4G25A 4KWIA 3I45A 5ALGA 1QRUA 2JAHA 4WN9A 1LUAA 1GQFA 1GKLA 2BDEA 4PAQA 3RRMA 4EB3A 2HU2A 4JEIA 1E2MA 1PJSA 3DKKA 4GD3Q 3LSYA 3Q0EA 2DPLA 3ILYA 3L6UA 5L3QA 3NDPA 4NULA 1NQAO 2ZYSA 1Q74A 2VF5X 3L0ZA 3PQ2A 4X54A 2C5FA 4Y7DA 2JEYA 2XQIA 3V2HA 2D1QA 3MMPA 4GH5A 2IVZA 1GUFA 1XTQA 5DTRA 3DO6A 5KNBA 4ZMSA 2QT0A 4AYTA 1IVYA 1DQNA 2XUQA 3JSXA 1T5OA 3LU1A 2C2GA 5FI5A 5JPCA 1IJFA 2V7GA 4EUEA 3NDRA 1UBHS 4MDHA 4DV3B 1JJFA 4K9RA 2OB2A 1CKEA 3MOSA 3QVGA 4HPXB 4JLVA 2PQMA 4M9CA 4JP2A 3VYSB 1EJ0A 1EFHA 3ZXYA 1R8XA 3D7RA 3UMGA 1RZUA 2OCPA 2X3YA 1HLFA 3HU3A 2ONKA 1EVQA 3OJXA 4K6CA 3UJPA 5JBNA 4GE0A 4CTMA 3Q6MA 4X61A 1JKIA 3B6IA 5SY4A 4HGQA 1ULTA 4WKOA 4DIUA 4Q4LA 1U0OC 3R5KA 4TYPA 1NYTA 4BMOB 5AYVA 5IANA 1OAKA 2EFJA 3OEHA 1EFPA 1KYZA 1Q83A 2I8LA 2UZ3A 3AILA 3FPJA 3JCZA 4FDMA 4TT3D 1BQ4A 1L7EA 2AS0A 2PS1A 2FQ1A 4ZVKA 3GV0A 3SS8A 5BXYA 2I62A 5E6UB 2QT1A 1MQ8B 3LYLA 2O06A 3DEAA 4MULA 4F8YA 1CR1A 3FAZA 5JBQA 1NONA 3VZSA 1IBSA 1TMKA 5HR5A 3PR3A 4NNOA 4PAGA 3HVKA 4NY1A 3EG9A 1E6EA 5C5EA 4W82A 3IILA 4CLRB 4TKVA 5JCXA 3OQMA 2P9BA 2PX5A 3MTJA 2CYBA 5SY9A 3F6YA 4WW0A 3V55A 1UXKA 3FSJX 3G1WA 2BFCA 2LUOA 3EZ9A 2I4TA 1FRQA 4JC8A 4PQFA 4G0XA 3SE0A 4AYWA 3H9GA 1TO6A 2C2KA 2P41A 3WYEA 5CVJA 3ZOKA 4IDAA 3H9BA 4OM8A 4ENTA 1EB8A 1E2LA 1XDSA 1IY2A 2PLRA 4LW8A 3G02A 1A77A 4UFOA 3RTCA 3RC1A 2QMUA 1MBZA 1KI2A 3LVFO 4IMIB 1K66A 3TL2A 3WY9A 1C9MA 4KV7A 4RK5A 1SCQA 4JP8A 5IKMA 1J42A 2VJDA 5SYNA 4A0GA 1SG6A 2J30A 3ICPA 3SYLA 1BW9B 4CR6A 1X8JA 2X9QA 1FZTA 5AJWA 5FJJA 2PD4A 2BFWA 4G36A 1YMQA 3PNOA 2ZJ4A 3BSWA 4G0VA 1WZIA 1QM5A 3A9VA 4OBEA 1JF8A 3FPGA 3L84A 4PS0A 2HJWA 3AESA 1NATA 1QV7A 2WFLA 4GWLA 5KTTA 2H52A 2HNAA 5DNCA 1DQPA 2PMWB 4RY0A 2RC6A 3MHTA 3I2FA 5IC4A 2IUUA 4EZBA 2B2XA 3SC3A 4MUJA 4B87A 2Q5FA 1WNTA 1V8ZA 3S2EA 4RMHA 4H7JA 4CV1A 4M1OA 1W73A 4PNPA 3GR6A 4ZV7A 1BSVA 1FE8A 1Y5LA 2VAMA 3RD5A 5J2TA 4DV0B 2FEWB 1EK1A 3LO8A 5HS6A 2GK4A 2H18A 2EYUA 2WNHA 4I9NA 4P5EA 1PNOA 5ITVA 2VF2A 2NSJA 3QHAA 1ZH8A 3GZJA 5E0OA 2C7RA 4I1VA 1C80A 3GUZA 2C96A 3CEMA 4NP6A 3DKIA 4ZXFA 3CCCA 3WKCA 2GNPA 5T4EA 5AUPB 5HIIA 1II0A 3WLEA 2M1XA 1NN1A 3V2IA 2OCGA 5JSZA 2WYOA 1MB0A 3KB2A 3LK6A 4EHAA 2BEWB 5TMPA 1YZHA 3L0IB 1MZVA 2X6RA 1LX7A 1H05A 2J67A 1RLOA 2Z1MA 5JAPA 2O8CB 3V6LA 2R8BA 3UK2A 1D09A 1ORVA 3DMDA 4QL3A 1UBKS 1GAQA 4O0LA 4XRRA 2H48A 3ZX5A 1SU8A 1URPA 1N8NA 1JIKA 2PFKA 4KLRA 5F64A 5HGXA 2ZVDA 1ZA2A 4LIPD 1RVV1 2Z8ZA 1Q3KA 1AC5A 3C16C 4MUBA 3Q0IA 1CQPA 1U3CA 3LXRA 1HQYE 2AYYA 2CC2A 3KR1A 3P2EA 3EZ6A 8MHTA 1UP4A 4M9ZA 2Z30A 5JVDF 4GW3A 3I34X 1NAHA 3HCFA 3DXXA 3PUJA 5HG0A 2ASEA 1JU3A 2GXSA 2XTMA 1EGHA 2P27A 3BWVA 4UUPA 2ZUTA 3S2IA 4B6FA 3Q9SA 4KUHA 3PKJA 5E9JA 5IF3A 1B16A 2ZYRA 3IE1A 1AE1A 4KFCA 2I4OA 5AHXA 2BGJA 3QYFA 4J07A 2H1LA 5M29A 2WSLA 3ETLA 3O21A 4BNDA 4DCGA 4R0NA 1KZGB 1USUA 2VZ0A 4NH4A 3A6PC 3RFVA 4FQ8A 2Y66A 1T3GA 4PTZA 2Z3WA 2KPOA 4JWTA 4NAVA 4QBIA 2VP0A 5LDHA 1OWPA 2ISSD 2YQ5A 3AHEA 1ORIA 1Y4DE 2JJ8A 1W2GA 2PMCA 5E8JA 5F1KA 3R3WA 4MPDA 1TT5A 3CM0A 5HVNA 5BR8B 5DNVA 4ZHSA 1J0DA 1OLSA 2QPTA 3MB5A 4G5GA 4ZOLA 5GONA 3QX8A 4FGJA 4KZPA 3DCJA 4PWZA 5B7NA 1YWGO 2Z6QA 4Q05A 1ZK2A 3MWDB 2PWPA 3KOZA 3ISVA 2JC3A 3T3GA 2R6ZA 4XVCA 4AZ0A 3TQQA 3JASB 6GPBA 1H4VB 4JC5A 2E5WA 3GLSA 3H0EA 5F33A 3WYBA 4MW2A 3RT7A 1BIFA 1BVHA 3G2JA 4NE2A 4ENWA 3PGXA 3JQFA 2V0NA 3F5QA 4CKCB 1TKAA 3FA2A 3QM1A 4KQIA 2GD2A 5EP2A 4C4ZA 3DLBA 4LF5B 2W6JA 1SH7A 4LYGA 4R8LA 2AUMA 4IXDA 1IYZA 2Z3ZA 4HDSB 3UN1A 1W1WA 4KN9S 3Q7IA 4Y30A 2IW3A 4CF3A 4D56A 4ZFNA 2EKBA 5HCUA 1SU4A 3BMOB 5BUZA 3EPJA 4KXLA 3PD1A 2H1OA 5ALIA 5IM5A 4ZTBA 1L5KA 1T8RA 1Y1TA 4MUGA 4Q18A 2IC5A 1LW7A 3Q5EA 4DZZA 2ZRNA 1C1DB 3O0TA 4WINA 3UY4A 3DZHA 1QS0A 4TLLB 2BHLA 3DLCA 4DHEA 2WHRA 1KI1A 1PZGA 3IEUA 5CMLA 4CZ2A 1A8QA 3IMFA 1N8KA 2IS4A 1FK8A 1UPXA 4CT5A 3LJKA 2GVZC 4QLAA 4ITUA 3UJAA 4YASA 1CRLA 5CEFA 3O03A 4UU1A 3ACBA 3ZXUB 1E3IA 1NXPA 3O47A 4YGXB 1G7CA 4UCFA 3PEVA 2CV1A 4LFBB 1WZCA 1BHSA 4UTZA 4AM8A 1W9HA 3GN2A 4IZHA 5DVZA 5J1SB 1BHQ1 4E08A 4LZJA 3SMVA 3JD3A 1H94A 1JL3A 2DBQA 4P3PA 4BBZA 3DLHA 3C3MA 3KR2A 2V74B 3HE3A 3PFHA 4N49A 3V1YA 3FKJA 3BK7A 4NDNE 4PX2A 4D42A 3N3BC 1NUAA 2FZLA 4L4RA 3UAZA 3HGTA 2YMMA 2GEBA 3LUFA 4EKDA 3T9EA 3CF4G 2EKPA 5F77A 1VCHA 2P3SA 4DCNA 1AQLA 2DLDA 4RTRA 2XUZA 2B69A 1SWWA 4PLYA 2YC4C 3ORSA 3OURA 3RSHA 3H2HA 3TYXA 3MWEA 3D3JA 5JW6A 2OGZA 4DTIA 1VI2A 3BBPA 3WHIA 2E0IA 1G16A 3DEZA 2CLDX 1WR8A 2I67A 4Y1RA 4M7WA 3FSGD 1OX4A 1RTKA 2HMVA 1DTWA 1O77A 2ZKIA 4Q15A 4WK0B 5CK4A 4DBVO 1PLLA 1K7CA 1SJ9A 1V7ZA 4WOBA 3DAPA 1EFTA 2KB0A 4KXYA 3WDLA 4AXXA 4ZYVA 4TMWA 1BNCA 2ZRFA 3QNWA 4LXHA 5FQNA 1NOKA 1SBTA 3RHTA 1WEKA 2RB5A 4EKIA 1C5KA 4HXGA 4MV0A 3DDWA 2VUIB 1KVQA 4GYYA 1UL1X 3C7DB 1WPXA 2EEZA 2HF7A 4HCJA 1MB2A 4X5OA 2QQ5A 3ADPA 4NZ9A 3NG1A 2B6HA 5AJXA 3WYGA 1ENYA 1RAEA 2Y1CA 3JPWA 3NXKA 3PT5A 4X60A 2GYWA 2EQ5A 4G4SP 4XTCS 2COKA 1RMYA 3K9LA 3WL3A 1BCRA 3F5SA 3C97A 3QF4B 4OQYA 1BWPA 3FIUA 1UBUS 1YNSA 2I3ZA 3V48A 3QPAA 4DIOA 5L8VA 2YN4A 4YJ2B 3AUAA 5K01A 4EWLA 3OPNA 2J5KA 1WP4A 2XTJA 4J8PA 4E0BA 1KY2A 2Q50A 2AE2A 2ZGVA 3CW8X 1T3TA 1QORA 3D2LA 1OTHA 4Q9HA 5KQGA 1AG9A 2E5LB 4KPYA 3E4DA 3TXYA 3QF7A 4F9GA 3NHLA 4B1FA 4RTJA 1HT2E 5DV9A 1NF8A 1FTSA 2IE8A 4UUQA 1CVRA 1YRWA 3H2JA 4BVJA 2QVCA 4BUZA 1VDMA 1VKNA 1CDZA 2CDNA 1D2CA 3TD2A 4D3FA 5C81A 4B9EA 4LSWA 1F06A 3TMKA 4ZC1A 2VNAA 3HCOA 4F4JA 3ZWPA 5J2TF 1GQ2A 3SG0A 1FUKA 4F9TA 1W4ZA 4LNUA 5AW6A 3AYZB 3JQAD 2GZ3A 1R0YA 1GFIA 3GJ0A 5LQMA 1GL9B 4CV0A 1RRFA 4RHUA 4XLLA 3KWLA 1ORRA 1GTSA 5HZGA 4M3NA 3U7HB 2CXRA 4S1VA 3H84A 2NNWB 4TS4A 1K6IA 2Q46A 2OA0A 1XTJA 2BKEA 4OXXA 1KY4A 1REQA 4GQAA 2P1RA 4GVXA 3SPXA 5D51S 3OKCA 1BS1A 3I2JA 3GLIE 2O2XA 5AUQA 3VAYA 1ES9A 3UMFA 4QJ3A 1CK4A 2IUYA 2WUGA 3BJEA 3H6KA 2AMJA 4G56A 4I50B 3IAM6 4YMIA 1V9LA 1E5XA 2CJWA 2QE7A 5DHSA 1JQDA 5ESWA 3T7CA 4UQPA 2RGGA 3CLTD 1RHQA 1U02A 1AKVA 1O7JA 1UBNA 4UXIA 5CFLA 3UBTA 1FUUA 1X7HA 1UPFA 2I4IA 3L6RA 3AF4A 4OB6A 3USZA 5ALVA 2I76A 3DTNA 1D4FA 4KXQA 5JJBA 2QVZX 2ZTUA 4G8JA 5TDHA 3WNBA 2O8EB 3ESAA 2H7CA 5DFAA 1V11A 2V7QA 2C2MA 5DEOA 1TIKA 4HFRA 5HUHA 5DNWA 1M2JA 3GPCA 2ZYVX 2IUTA 2YXBA 5H70A 3S99A 3SXUA 4HMPA 5A6SA 1T4MA 1XVAA 1KKMA 3BFKA 4Y9SA 3U37A 4CDGA 5KCMA 4JLPA 3WNCA 5I51A 1H0RA 1KK3A 3MAGA 4B7UA 4MUIA 1RZRD 1H1LA 4H17A 1P2DA 2GMWA 1CY7A 3LHKA 3C3CA 4RPIA 4I9HA 5AVSA 2G8LA 4CPDA 3ELDA 2WD9A 1G0NA 4REQA 3RREA 3BAZA 3GH1A 4QUDA 3T3IA 3MTBA 3LL7A 2JI8A 3QMVA 4G8BA 3SEFA 2PX4A 4X91A 4FM9A 1B8VA 1QH8B 1S2MA 3OCZA 2F3TA 5HQJA 3RSGA 4OHXA 3WYNA 5CB4B 4K9QA 5DW3A 4M46A 3S2UA 2NZVG 1RJDA 3HRKA 4ITVA 1J0BA 3MJSA 4QT0A 3CNOA 4X93A 1M1XB 4PC7A 1XZ8A 2EBWA 1POXA 3D6NB 3MD9A 1E7MA 3STYA 4BV3A 1M2OA 3GFTA 1Q12A 3OZXA 1CVIA 3GAAA 5EMKA 1NF9A 4IDDA 1O5TA 1W94A 1N9KA 1SCNE 1N0VC 2FR1A 3GNQA 3QI7A 3F8TA 2IFTA 4HH4A 4B84A 1B3BA 3M4XA 1M76A 2WF8A 2EL7A 3DDUA 5IJAA 3EC7A 2GR9A 5JY6A 1F6WA 2FWJA 1TDJA 4LWOA 4B34A 4FMBB 1DDOA 4XFJA 4ZEWA 5CYPA 5HK8A 2C2BA 5L3VA 2YW2A 4HS9A 1E6WA 1ADFA 1ZKDA 5CR9A 3VZBA 4GSKA 2OC9A 2VQ3A 5K0ZA 1KAHA 1YACA 2VT2A 1CQZA 4MP8A 3PXAA 2AMYA 2XCIA 3EAQA 2GZDA 2ZIAA 3KOYA 4EARA 1NTOA 1Q95A 2HJ9A 4QBHA 1LFDB 4ER3A 4EM6A 3ITEA 3B5EA 2C8JA 3L7NA 3G1UA 3H5IA 2BF4A 4ZODA 3NHAA 2AI3A 4KHPB 1CZHA 5FL7A 2NUTB 4NESA 3WGYA 3RTGA 4RTPA 1DCFA 5CU7A 4DUGD 1NULA 5KYNA 4NBLA 4NV1A 3OFJA 5IX8A 3PHCA 4XQEA 1IMOA 2Y3IA 3AYXB 4L0QA 4ZEXA 1EG2A 2B4TO 2J9ZB 2QD3A 5M7EA 1U3FA 3DB1A 3UK7A 2OCIA 1CLUA 4BFWA 2GRUA 1SXJD 4AQDA 5IXYA 5TC4A 4N6OA 4KHZA 2ZQZA 1ZVJA 4HJXA 2G07A 1ILWA 1M1YE 1EP9A 3FYHA 3FAKA 5CXQA 1L5NA 1IY8A 2PJZA 2ON6A 3SQNA 1AV7A 3MFQA 5CFMA 1G64A 3AUTA 2HCTA 2WKPA 1SOWA 4MA5A 2OE2A 3ZBPA 2QKYA 4XX1A 4HK4A 4OQLA 4HQFA 5EZQA 4W9NC 1KO5A 2GTPA 3DCNA 3NC1C 1FQKA 2ISQA 3IP1A 3UHPA 3JU3A 3L43A 4EFDA 4PO1A 1U4OA 5DIZA 2XT0A 1E7SA 1GNSA 1ZD2P 4LRTB 4LDNA 2I6QA 4P7GA 4DQVA 3SHFA 2AFHA 2WHEA 3L8CA 1MX9A 2W83A 4G97A 2IZ7A 3NBQA 1TVKA 4FS3A 4Q9IA 5CK5A 2YYZA 1PZXA 1MENA 3AXSA 4RHFA 2ZI3A 4Q3BA 4Z4EA 1FSSA 1EWQA 2JCVA 4URYR 1RPNA 3ZQ6A 3G89A 1N3LA 2VHJA 4XX0A 3FCYA 2ZULA 4QELA 1YVUA 3QFHA 1UJBA 4FR2A 3S7TA 1Z63A 2XB6A 4II2A 2XKJE 1DSSG 1YI0A 4PX3A 4DY6A 1PR3A 2CVQA 1C9YA 4Q1FA 1YE3A 3WXBA 4OY3A 2OD2A 1E6LA 3JAKA 2WJAA 5KS2A 5J1TB 3K09C 1LFAA 4IFTA 2RI0A 3MJFA 3HKBB 4GXTA 3H2IA 5CVVA 4DMUB 4EFNA 2CT8A 4G0UA 3QOWA 2QDXA 2HA0A 1ICEA 1Y81A 4WNIA 5K0NA 1RI1A 3SDZA 3REQB 4EQ6B 1UDXA 3I2YX 4F91B 3FOEC 3AEYA 1OWLA 5C5CA 3CH6A 3ROZA 1RKXA 3QU5A 4P0PB 1DRUA 1NBIA 1W35A 4IS2A 4EGQA 4EENA 2Y6UA 4LYAA 1G2PA 1VHJA 1YAHA 3OZEA 1RJ9A 3FOBA 4Y2UA 2LKCA 1CETA 4HWTA 5BSEA 1T8WA 2H92A 3FVVA 1NNSA 4OHMA 5TRTA 3OTGA 3QEOA 4TVBA 4F72A 3N7TA 2ZUEA 4FLEA 4D3YA 2XQFA 1R0LA 2XNSA 2FLVA 5FOUA 5JWHA 1YBFA 4FMCB 3CVXA 4M98A 3A28A 2KWIA 5BN4A 1Q11A 1RMQA 4D98A 4QPDA 4DXAA 5IJ9B 5LC1A 1O58A 4URXR 3U7JA 2IOFA 3R3YA 1B8UA 3ZXIA 4L95C 4GYKA 4MA0A 5DN6D 1FLVA 5B12A 2NNLD 1IXZA 2GCOA 2QTMA 3TRFA 3LIIA 2P65A 2FX5A 4KN6A 4E94A 4EG6A 4F5EA 2XOXA 3OZ7A 4G0YA 5CHEA 4DM7A 1Z5OA 2JHAA 2UYYA 3EXFB 1Y3FE 2Y77A 3G0OA 4WLNA 2DPGA 3I8XA 1NN3A 1X1QA 2BUBA 3OZWA 5E7JA 3C3EA 3SI7A 4A6EA 4R1QA 2QA5A 2ZCJA 3FDXA 1R4NA 2GA8A 2L69A 1EX6A 4IIGA 1BX0A 1Z35A 2V7EA 1KR5A 3GLFE 2R8RA 3LCVB 1Y80A 3F7TA 5K6RA 5CJJA 1IZ8A 4DM3A 1AQJA 2D3TA 2BGUA 3PRKE 3VPXA 3LSTA 1VKHA 2V97A 3K0CC 3ZU5A 3UK1A 3SC2B 3P9YA 1QB7A 4UVEA 2XAAA 2WK1A 3DE1X 3OZSA 3PQ5A 1CUYA 1QNLA 1OX5A 1Y6ZA 1X7ZA 1QOQB 1AZSC 4CKXA 1NLYA 3QOXA 4KQEA 4X1IB 3L1HA 3KZMA 4FXPA 2PMEA 2HSZA 1T6ZA 3KL2A 3OLXA 4Q7KA 4F6LA 1L8LA 4D8VA 2WICA 1A8PA 2ZLBA 5DE3A 2AGVA 2NQTA 3B36A 3VX3A 4P22A 2XWSA 2G5TA 1ZWLA 5F7OA 3T5PA 1L7MA 1V5GA 5DBHX 4YAJA 2CF6A 4LV5B 5CB6A 2ZM6B 2EFYA 4ZALA 3ROPA 1VPVA 2KM1A 2O1XA 1E5QA 1SHKA 3H8WA 1LLFA 3PP8A 5KNCD 2GNOA 3I6ZA 4GLLA 3A1VA 2AI1A 2YNMD 2JJMA 3A1DA 2HQSA 2J9GA 1GKUB 5DF1A 3V33A 4B75A 5I9IA 1Q7EA 2NZUG 1DXQA 4GOMD 2ADMA 1I4EB 3K1JA 4M8KA 3ZHCA 4FFRA 1T2VA 1FXWA 3U1VA 5JT1A 3WB0A 3FLMA 2RIPA 2NSLA 2BR4A 1GM5A 1DJOA 2J4DA 4LJ6A 4RUKA 3F6PA 3NKLA 1ZYUA 2OEPA 3TLGA 5JJ5A 3PEUA 5E1DA 3MT7A 5C52B 5FO0A 1KOGA 4R71A 2K2QB 3ASVA 5A0TA 3PQFA 3OUTA 2CLSA 1JG4A 1MO4A 4GRDA 5B58T 3R77A 2R7LA 5COQA 1Y3HA 2C4KA 1RWOA 1QHSA 1T4CB 1GPMA 2PRSA 4EG4A 1UZMA 3GAMA 5HJEA 1QYDA 3EVFA 2QTBA 2MINB 3NANA 4PRKA 4BFLA 3CO0S 4BPBA 4GYWA 1WJGA 4KVGA 5E6SA 1V35A 1N6LA 3JQGB 4KDEA 1PT7A 3DDSA 4L4YA 1K5DA 3NAQA 4LPKA 4M7PA 4CR7A 3B3JA 1X9GA 2E48A 1HYEA 2RE8A 2O50A 1ODJA 3SDSA 5AVJA 3QVOA 1EUDA 3FPEA 2HUNA 5C8ZA 2XGJA 1NX6A 4M0PA 3IMEA 3VXKA 1XROA 1Z2AA 1DE0A 1U7WA 4JT4A 2CMFA 2QQ0A 1USKA 3ILHA 3DPUA 2HTEA 4WBSA 1N5OX 3OFNA 3ZK9A 1FMFA 1GGKA 1JZQA 3ANSA 3DCIA 2WWYA 4QDXA 2IDZA 4C5BA 3W3AH 4UM9B 1NX9A 2VBCA 3D81A 5J2UB 1KVTA 2G9NA 3BL8A 1J1UA 1DAKA 4CG1A 3BH6A 3F46A 3F3KA 2C57A 1DC7A 3BWYA 4JFAA 3ZDQA 4DZRA 4IOMA 1OMOA 1UK8A 1K8ZB 1EP3B 2GYYA 4FFNA 4MQEB 3LVBA 4QTUB 3RSFA 1I01A 1E8MA 3MWJA 4L85A 3U16A 1NR1A 1V16B 1RKBA 1J0AA 1ZN2A 4RVGA 4Z1MA 2B7CA 5ALWA 3CUSA 4ZQFA 3TVTA 1GWNA 1GUZA 4UW9A 3VR5D 2UDPA 2JB9A 1MDBA 2RGCA 1MT0A 5F5LA 2OQIA 4G9GA 4IQGA 3DBRA 4NONA 4RELA 4IUBS 2F59A 2HEGA 3NBXX 1TIBA 3UJ9A 2QTHA 1HNWB 3MERA 3RJ5A 5K6AC 2JFFA 3S2SA 2RGNC 5F5NA 2NV2B 1UANA 5LA6A 3V8VA 4EX7A 5CVUA 4EPRA 1QOZA 1C7IA 4D9IA 3RS9A 5J4LA 1CU1A 1SUSA 2PZJA 3KD3A 4RAOA 3RFFA 4U02A 2AOUA 1ISJA 2VXCA 3QJYA 4DLXA 1L5MA 3KDAA 4B8WA 1I0IA 1YUNA 2FEPA 2XWBF 1BE1A 5ALPA 3H6GA 5IAGA 3AETA 1OCEA 1IXSB 4HEA1 4OQMA 3L4EA 3K1YA 3KKOA 4IMPA 4JT8A 1Q0LA 2OBNA 3NFRA 3QVKA 4LK2A 1EFAA 3I6QA 1EE1A 3PJRA 2AK3A 1MMFB 4U2BA 1HI9A 1YBHA 1WSBA 1XEXA 4ZQBA 4ALLA 1W5BA 1USGA 2B25A 3KYDB 4L07A 1E2GA 3EXG2 3HYTA 2R62A 2WKWA 3KQKA 2IP1A 2WP0A 3BJMA 4YRCA 5JSHA 2AJLI 2GHQA 2AN4A 3LG2A 1Z4NA 2L19A 2PGJA 2IYQA 3SF0A 4QGFA 1C8KA 2E1RA 3W6PA 5E3IA 4WXPA 5EPEA 4OBBA 3AY0A 1YR8A 4PNZA 2BDUA 2ZRAA 1JKJB 2W2VA 2QRNA 4B5KA 1NWCA 2RHTA 1WA5A 4OSEA 4YACA 2ZIXB 1MRZA 4ERNA 1UZUA 2JFPA 3QEBZ 1YC5A 3CNLA 1M6YA 5C1IA 4A8JB 2ZI9A 3VH1A 4ACAA 1F0NA 3QBJA 2YS7A 5L45A 4FNGA 4MK4A 1JHZA 3PXCX 3T4UA 2R1VA 4NBVA 3RBAA 5LQCA 3MUFA 3T41A 4ZAGA 4QUIA 2FN4A 1Z8NA 4MB0A 2IIPA 4AMBA 2WAAA 1WM1A 2PKQO 3L2OB 1W4RA 1ZJ6A 4RY2A 1BXGB 2HADA 5FI0B 1YE5A 3VYRB 5I4CA 1E0DA 4QT4A 4RQAA 1C8BA 1SC4A 1RLJA 4UBOA 1YZ3A 3R5JA 4HAXA 4RHCA 1R88A 5KX5B 2POQX 4ZO4A 3GRFA 3BRWD 2QM3A 5EA2A 1J9EA 1ZI6A 4WK6A 1XTRA 1QANA 1DMRA 4FSHA 3RYFA 4NJEA 3OIWA 4RL4A 1DBQA 1KO7A 2BFFB 3HCWA 4RTMA 3CS3A 3FYDA 1PIWA 3NNNA 3RUCA 4OK3A 1UKVY 4WVFA 5FD8A 2JA1A 3LHIA 4M83A 2BCEA 2W6ID 4Y9DA 2ZREA 4MLZA 1QWSA 4N0MA 3SU8A 4XIFA 2QW1A 1XGKA 5EQDA 1P2SA 1NXVA 2BBTA 1DCKA 1GA4A 1P1BA 1YULA 1JEAA 2IHUA 2YTZA 4DJDC 3WRYA 4EY6A 3TZQA 1JDTA 4GKJB 1R4ZA 1XBTA 5H4HA 3M33A 4RH0A 1YFJA 2ZJ5A 1AKRA 4K87A 1E8NA 4L02A 1WV1A 2RHMA 3MMSA 2IQ5A 4K03A 3UWOA 2EX4A 1G7SA 3MJTA 3T6KA 4KLCA 3WLLA 3JRXA 1DKPA 1QO0D 4BEWA 1CR4A 3N2LA 3U3KA 4ZOBA 3DXYA 4WXHA 4ZYYA 1XMSA 5ES4B 1CRPA 2PGDA 3GFFA 1RM0A 2FH5B 1CRWG 1D9ZA 4LTNA 3LVRE 1F51E 3GDOA 3I58A 3V7WA 4US2R 1KRXA 4FDTA 1MRSA 1H2XA 5TQ0B 1DHRA 4N54A 3RLIA 2HY7A 2F90A 2ZRJA 3CNQS 1WPQA 4LXUA 1JT9A 2HA3A 1E69A 4HNGA 1RNLA 2ZVPX 4J03A 4CODB 5FA8A 5JD4A 1UFQA 2VVTA 3T5MA 5KYKA 3AW8A 4O25A 2W4QA 5HTKA 1GG9A 5K1ZA 3DSRA 2FFAA 5EAIA 3ZIDA 1A9QA 1FXWF 4PM4A 3WTBA 4AKTA 3KLMX 5E9QA 4YMTA 1GT91 5CYGA 3NKVA 1Q1EA 4GF5A 1U2DA 2QL6A 4D8WA 1R9MA 4MVJD 2JFUA 3E6AA 4E1AA 2Y2UA 1BD4A 3ZHBA 4YR9A 1NLUA 1RM5A 4UHJA 1RRMA 3AVOA 2ECQA 4Q34A 4AN0A 5JZ9A 3A3NA 1NW4A 5IPFA 2Y0EA 5G3ZA 3U9LA 1O95A 3ISJA 4H9GA 2OP0A 4UBNA 4XXHA 2WUEA 1O96A 1GQQA 3RYHA 4E1BA 3R3XA 1OBFO 3FW1A 2XX3A 1RACA 2WJWA 4M4SA 4DMCA 1T5DX 2ZIWB 4MVJG 4Q5IA 5JSFA 1UBMS 5HOEA 1QC5B 3U4IA 5HTOA 2O7NA 2VDUE 4KDCA 5KYGA 3QFFA 2ZR7A 3L1JA 4HN2A 5DULA 4CJXA 3PFFA 2YINC 1NQ5A 4FQ7A 2IHTA 3Q1KA 3PT9A 2GA9A 4CMKA 4ZI2A 3KK0A 1MO3A 2ZUWA 3S44A 2GLTA 2YJZA 4F21A 4AUKA 3SJBA 3BMXA 4ZK6A 2TS1A 1F2TB 1CUCA 3FDJA 3LPDA 5ITWA 3PFCA 3R44A 4FHCA 4J75A 4YUWA 1MB3A 2XUFA 3QHPA 4RPLA 4R51A 2ZROA 1PJ3A 4R7ZA 1DT3A 3ET4A 2H3HA 3GBPA 1WV0A 4OHPA 4D6PA 4AJHA 5MF6A 1ZR4A 4V0SA 3FJYA 4L15A 1TEVA 3KP1A 3QVVA