5IZCA

Trypanosoma brucei ptr1 in complex with inhibitor f032
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
267
structure length
248
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
publication title Exploiting the 2-Amino-1,3,4-thiadiazole Scaffold To Inhibit Trypanosoma brucei Pteridine Reductase in Support of Early-Stage Drug Discovery.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 95
structure length 248
sequence length 267
chains with identical sequence B, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2016-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5izcA00
3PDUA 5EMHA 3RWBA 5GZ1A 1MUUA 1QLHA 3IC5A 1HXHA 1ML3A 2FPGA 2P2SA 1U5AA 4FJ0A 3WGOA 1HLPA 2OXIA 3JYQA 5JO9A 2V6FA 1N7GA 4EI2A 4CM4B 3H5RA 4CMIB 1J49A 2B83A 4GI2A 3FNGA 3GDGA 1PJLA 3A28A 3ONDA 1XELA 3FR8A 3GUCA 5ENVA 1RM0A 1OC2A 1X0VA 3OBBA 3B70A 1BRMA 2HRBA 5JAMA 4BNTA 3KEOA 2C2XA 2DT5A 1E7YA 3E5MA 1PQWA 2NU8A 2QRLA 3FI9A 4BV9A 3MJCA 3WSWA 4IQ0A 4CR7A 1JN0A 3WDSA 2FSSA 2XAAA 1XIVA 4RDIA 2V6BA 4RO0A 3MJSA 2HCTA 4QXMA 3UAGA 5JSFA 1E3SA 5AVOA 2AEJA 4DIFA 2AEFA 4LMRA 3GMDA 3GT0A 3OMLA 1ENZA 1GPDG 3FD8A 3LLVA 5AXDA 2BGLA 4D79A 1GTMA 3ZWBA 3WLEA 1PJ4A 1QR6A 2H6EA 4Q9NA 4XQEA 1HL3A 1UDAA 5DOVA 5MGBA 3NRCA 3OEWA 5JDCC 3WLFA 1BVUA 5FI5A 4L4RA 2WE7A 2X6TA 4XB1A 3VZSA 3FR7A 4K1LA 2GN8A 4DVJA 2FZEA 3I9OA 2ZQZA 4BNVA 5JBIA 4LSMA 1WZEA 2NACA 5C7LO 3UGKA 4DWVA 1I10A 4JN6B 2EERA 1LRLA 3PHGA 1PSDA 3H9QA 3A1NA 1O94A 4Q3CA 1RWBA 4WLOA 2CDAA 2YUTA 3TOZA 1NAHA 3VOSA 2G76A 4CMEC 1UXGA 4LMPA 3ZNQA 4UEJA 1KC1A 1CJCA 3JTMA 1LLUA 4IIUA 1CEQA 1OBFO 1IPEA 3F6YA 3GNSA 1WDKA 3QA9A 3ZWVA 3AM4A 4BGIA 4DA9A 4GBJA 2VWQA 1MG5A 2IXAA 4MKRA 1P1HA 2PD6A 4NFYA 3LYLA 4ZQFA 4MPDA 4YJFB 2HMTA 4OO3A 2IZZA 5F1KA 4R68A 2QW8A 4CLHA 1IOLA 5FEUA 1WMAA 2VUUA 3NUGA 3PLNA 3V2HA 3G49A 2X5JO 3OICA 4K9DA 3ZV4A 3EVNA 1HTBA 1NYTA 3JD0A 1JAYA 4A5OA 3L0DA 3NDIA 5I9MA 1YQGA 3NAQA 1F0YA 3OQ1A 5L4NA 1UUFA 1DAPA 1WNTA 3BMNA 3ENNA 5CEJA 4E5KA 2P4HX 2BFPA 4K26A 4PLCA 4R3WA 3FWNA 4HFNA 1GV1A 1R0SA 4OM8A 5FFFA 5IF3A 4G2NA 1Y7TA 3RROA 4WLNA 2DBQA 4MVJE 1M66A 4Q3NA 4WEOA 4AJKA 2HAEA 1X7DA 5C7OO 4BMVA 1SMKA 3O26A 4C7KA 1PTJA 1JLLA 4NPCA 4BKRA 2XPCA 4R5HA 2DKNA 4I9NA 1EQUA 2VUSA 4RCVA 1YL6A 2PH5A 3GFGA 2CNBA 4IDEA 5EJ2A 1GQ2A 1H9AA 4HP8A 2NVWA 1KVQA 3GN2A 2VUTA 3HFGA 3K96A 4XKJA 5I8WA 4ND2A 2Q1WA 2UUOA 1KVUA 3C24A 1LQTA 4INAA 2CF6A 1D1TA 3GQVA 5AYVA 3OETA 1HDRA 2GASA 1HYEA 3O9ZA 3WYBA 1MFZA 3QWBA 2Y67A 4DC1A 5B1YA 2X22A 1N9GB 4CMHA 4FBGA 5IZCA 1GUZA 3UH1A 3NTRA 1UP7A 2YFHA 4IJVA 4R54A 2UVDA 1H2BA 2FR0A 3ICCA 3C7AA 3D5TA 2HRZA 2D1YA 1BHSA 4GVLA 2W2KB 2RH4A 4XQCA 4ONEA 1LRKA 3ZV6A 4A27A 4RVDA 1UDBA 1EFLA 2OOSA 4B79A 2VHWA 3ANNA 1C3VA 2Y05A 3EYWA 4NBTA 1VSVA 1J4AA 1RYDA 1T2CA 1E3EA 4XB2A 5A9TA 3RFVA 3U4HA 4ZN6A 4YT5A 2WD7A 1A4IA 3V1UA 3AY3A 5BQFA 4XGIA 4GGPA 1Y5RA 1HE4A 4NIMA 4XQ9A 2UUPA 1NTOA 3AJRA 4WLFA 4YRBA 1C1XA 4CMBA 2B37A 4KWHA 4WCFB 4EUFA 1PL8A 4CQMB 5B4VA 5A05A 2J5QA 4BKPA 1Q7CA 1DRVA 4ID9A 4PGFA 2O2YA 1MB4A 3EW7A 3S1LA 1UZMA 5L4SA 4GX2A 2CVZA 3GRPA 3SBOA 1OI7A 2FY8A 3BMQB 1F17A 4E5PA 4O1MA 3D7LA 1QV7A 4OJNA 4GMFA 2AG5A 4R01A 2PA3A 1EVIA 3LLSA 5DCWA 3ASUA 5L7WA 1PGQA 3SVTA 4BO1A 1U3UA 2FPPA 1FJHA 1XWFA 5T67A 3PGJA 1E3WB 4QTZA 1DIRA 4P8RA 3Q3CA 3F4LA 3IAHA 2X0JA 3UOGA 3O38A 3S55A 1I01A 1IUKA 3DOOA 4KTVE 3WR5A 3FRJA 3E03A 3ZWOA 4XR9A 5JFOA 3CMCO 4MVJP 1Q0HA 3MTGA 3Q9UA 4IDGA 4CPDA 3QW2A 4RZHA 1J5PA 3ADOA 4IDFA 4Y67A 4EJ0A 3DZBA 4RF3A 1VKNA 4OSPA 4JJIA 1AHHA 3L6OO 1A9ZA 3FSRA 5L4LA 4JP2A 3BMCB 5T8KC 4YQZA 3RU9A 1EVZA 4L8VA 4GX5A 5A5EA 3PJGA 1DC6A 4JLWA 4ZRNA 4Z0HO 1EMDA 3FNHA 4ZQGA 1QYXA 5CG1A 4UVEA 5G4KA 1YDEA 1GPJA 3OQBA 2PNFA 3KV3O 1GEGA 4E33A 2GZ2A 3U49A 4YT4A 1K89A 1B3BA 5I7EA 4CM6A 4WLEA 2QG4A 4GLLA 1O5IA 1A4UA 3NEPX 4PLGA 4BNIA 2EXXA 3TL2A 3WGZA 3HDYA 3LC2O 3AOEC 1D7OA 4QO8A 1ENOA 3ROMA 4K6FA 1VSUA 3JCZA 3PYXA 1LUAA 1FDVA 2W2LA 3D3EA 3HN7A 3UICA 1VL0A 4FC7A 4D0RA 4D41A 3PFFA 4RVGA 4HFRA 1ISHA 3ZZNA 2ZIZA 1GUFA 5CDGA 3WOHA 4YXFA 2QYSA 5KVSA 2A4KA 2Q1SA 4J90A 1SOWA 3OJLA 4RZIA 1FXSA 4DPLA 1MG0A 1VJTA 3G79A 5DULA 1ZCJA 3ZGYA 3O8QA 4BGUA 3ROKA 1T1SA 1QP8A 4U6SA 4XD2A 1H6CA 2NQTA 4FOSA 1PJBA 4Y98A 2WMDA 4PZEA 4RVSA 1PEDA 3S2FA 4W9NC 3WBBA 3TFOA 2NU7A 3VH2A 1ZXBA 3JQ8B 4E4YA 4N18A 3V2GA 3S2EA 2QIOA 1LDGA 5IN4A 1JW9B 3HADA 1T4DA 2X9NA 4GVXA 3ZWNA 1ID1A 1XU9A 3NT4A 3WX0A 3DZJA 1Q7BA 2FZWA 4NI5A 4XWYA 5HRUA 3W8FA 2JAPA 2XXJA 4LK3A 5BSFA 1V3VA 5C3MA 3W4KA 5AQ1A 5JXWA 1UP6A 3Q1LA 4U0JA 3K31A 4U7WA 3WMWA 3ICPA 3ZU2A 3ANLA 4FB5A 2X0RA 2Q2VA 1B14A 4R1NA 2NLOA 1XG5A 1Y8QA 1U3WA 1UXHA 2YHUA 3PWKA 1E3IA 4WECA 1NHWA 4IJUA 3PXXA 3GMSA 4IGEA 4CMEA 4PFJA 3CE6A 3AUAA 3RAJA 4HV4A 3ZHXA 2B5WA 5G4LA 1SO8A 3RFXA 4EJMA 2E48A 1YBAA 2CUKA 3I3OA 4L73A 4BNMA 2C82A 1KIFA 3KM0A 3BIOA 4NK4A 1U1IA 3OQ6A 2Z1MA 4YB8A 5IFLA 2EW8A 4CQMD 1O9BA 1P1KA 2GSDA 2E37A 4ZRMA 5I9NA 1I3LA 1YVEI 1Y9AA 2FPIA 4WCDA 3BHMA 2PK3A 5COBA 3PQDA 3B20A 1OC4A 2ZB7A 4GL4A 2GO1A 2WD7B 3UCXA 4KZPA 3GH3A 2NQ8A 5JPIA 2AEMA 1I24A 1BXKA 1ZBQA 2Y1DA 4JBGA 1HT0A 2DTXA 4DPKA 3TQHA 3GF4A 3GGOA 2CMDA 2CZCA 2AHRA 2YDYA 4OMUA 3W8DA 3U0BA 1D3AA 1WVGA 3GDFA 5K6AA 3HUDA 2Q1UA 1YBMA 4CV0A 1HE3A 1GEEA 4D43A 1ZK4A 3QHAA 2C2YA 4OSOA 4ESOA 3IS3A 1NP3A 2O4CA 4YQYA 5KKAA 2ILTA 2YHIA 2DFVA 2RAFA 3F1KA 3ZU4A 3IMFA 1V35A 1GD1O 3MEQA 3HDJA 4RPGA 4FR5A 1T25A 1GU7A 2VQ3A 4RPJA 4ZQBA 4DREA 3ZV3A 4P4NA 1E7WA 3MJEA 2A94A 5DP2A 1BDBA 2HJRA 3NGXA 4O6VA 1O95A 3GPDG 1ULSA 2WEKA 1T4BA 3PHIA 2R00C 5EIOA 1LBEA 1ZJZA 1E7RA 3INGA 1TXGA 2YYYA 4OIMA 4CM4A 4KDFA 5EINA 4UEKA 5A9RA 1R37A 1DJQA 1ZSVA 3H7AA 1MXHA 1DBVO 1QORA 3ZV5A 2P9EA 4II3A 3ZU5A 2UYYA 1U7HA 3ANMA 4YAKA 4M55A 3IJRA 4IZHA 2C59A 4MP3A 5DZSA 5EQDA 2ZJ0A 1Z7BA 3U4DA 4YDRA 2PD3A 3AY7A 4HKTA 5CDUA 3B1KA 1TA4A 4YRDA 2O3RA 3VPHA 2WSBA 1OFGA 2I6TA 3KSDO 3R3JA 4N54A 2A92A 2BMAA 2BELA 4E0BA 4IPTA 1ARZA 1X7HA 5JMPA 4QO7A 3GAZA 3L4BC 2DUWA 3I5MA 3MTJA 5CG2A 1PL7A 3BA1A 1Q1NA 5DBIA 3RBXA 2HMUA 4RVFA 3AU8A 5T5QA 4IDCA 4XQGA 3SXPA 3WGTA 4UAGA 4B4OA 4EUHA 5B4UA 1SB8A 4HXYA 4ND1A 4FC6A 1A7AA 4MKZA 1QYCA 1KEVA 3W4IA 4BMNA 1T2AA 3FBGA 4DXHA 1FDUA 4IQ8A 3G3EA 1O0SA 1DEHA 3GEGA 5CDSA 2EIHA 3F47A 1P74A 4BNFA 2C07A 4YAJA 3WNQA 1TLTA 2HK9A 5F21A 1QYVA 2PZKA 4OHUA 5EPOA 3V5NA 3VPSA 3WJ7A 3GR6A 1L7DA 3PJFA 5COAA 1FDSA 3JQCA 3RUIA 3G1TA 3VPFA 1ISMA 5B12A 1C0KA 1LLDA 4HADA 3MCVA 3F3SA 5ICSA 2BLLA 1X1EA 4ZICA 2HLPA 3KRTA 3M6IA 1DRUA 3LT1A 1SBYA 1VI2A 5TX7A 3JYNA 3JYLA 1JA9A 4AJJA 4XZ3A 3K8ZA 4XDZA 2ZTUA 1MP0A 1EEHA 3G1UA 4J4TA 2UV8A 1F06A 2Q50A 4XCVA 4WK6A 2R2GA 5G0TA 1H5QA 4YJFA 4PLFA 3LT0A 3OJOA 4GGOA 1FF9A 4Z9XA 5IN5A 4BOYA 4XRRA 1YWGO 3LU1A 5MDHA 3JD2A 1E6EA 4XYGA 2FMUA 1DFGA 2Y66A 3I9KA 2AQIA 1HLDA 3STHA 3BXXA 2EGHA 1NFFA 3RUCA 4L4XA 1WMBA 3PJEA 3VKVA 3JQDA 1X13A 4RDHA 1NPYA 2O7SA 1QKIA 1DHRA 2VTDA 4JX8A 2IEBA 4YA6A 2B4TO 3IDSA 3SEFA 5TJHA 4FOOA 1GFSA 2ZYAA 1A71A 4E5MA 4CM1A 4U0KA 5JDIA 2B35A 4YT2A 5I9LA 3GRKA 3U4IA 3TDKA 1Y5MA 2PKQP 1FDWA 2I66A 1OOEA 2B0JA 3ITDA 3ZWWA 4YAIA 1WP4A 1E7QA 1TT5B 1R6DA 1EK6A 2G82A 5B4TA 3PQFA 4XRGA 1LRJA 1XHLA 4Q3BA 3BTVA 5JMWA 2JAHA 4W9NA 3ZW8A 4XEHA 4BO5A 3Q0EA 3NT2A 4IS2A 3PPIA 1P0FA 2IDZA 1N9GA 3C1AA 4F45A 2VHZA 5KIAA 2JHGA 3PVZA 4FCCA 1LXCA 3D1LA 4FFPA 4A26A 2AE1A 2AQHA 2UDPA 3KYDB 4CUJA 5BSHA 3WICA 2NSDA 4ZQEA 1IY8A 1V3TA 3RQSA 2CDBA 3PTZA 5G0WA 5G0VA 2YHIB 4AL4A 1XCBA 1VC2A 2C20A 1R66A 2G5CA 5TS3A 4E2YA 4RGBA 3SLGA 1N92A 5GMOA 1JKJA 2JFHA 2YDXA 4I9UA 4Z3DA 4MP6A 2VOEA 4HWKA 3NX4A 1HRDA 5JE8A 3OJEA 4IIVA 2BI7A 3IJPA 3F1LA 5A5FA 4BS9A 3DONA 1QLJA 2O3JA 1ZIDA 4RPHA 4YJGA 4LGVA 1SNYA 1GDHA 2GNAA 3M1AA 4OKNA 3JQ9A 5G2OA 5HA5A 3WQSB 4CM8A 5I7FA 2Q4EA 3AUTA 2PGJA 2YFQA 2Z1NA 3P5SA 2Q1TA 1XGKA 1AHIA 3RUAA 4GH5A 1EK5A 1ZK2A 4EYEA 4WCFA 4XYMA 4CQMA 1OAAA 2FHSA 4J1TA 1A9YA 5JS6A 2DC1A 4J1SA 2BI8A 3GHHA 3VDRA 3GDOA 1F12A 4U6QA 3OA2A 2W2LD 3BZUA 4B4UA 1DPGA 2Q46A 4HUJA 3BMQA 4DBZA 1GUYA 1MV8A 3R3SA 7MDHA 4I5GA 1UZLA 4WUVA 4IDAA 4B7XA 1LEHA 1GQYA 2RHCA 4MVJF 1AXEA 1PJTA 5TQVA 1YJ8A 2GYYA 3TZCA 3NJ8A 2P4QA 5KJCA 1CDOA 4ROSA 3SJ7A 3OP4A 3NTOA 4XIYA 3NKLA 5IXSA 1E3WA 1I0ZA 5HWSA 3VZQA 4J49A 4NZ9A 3DEYX 2WYUA 4IDDA 4AJPA 1HWYA 1ZMOA 3TWOA 4BNUA 5JAIA 4GAEA 3H2SA 3DZIA 5CFZA 4DMMA 4NJOA 4PIVA 4AVYA 4RJTA 5L51A 4NHEA 4M89A 1YH3A 5I7VA 3BMCA 1ZO8A 1PWXA 4BO0A 3GVHA 4J1QA 4S3MA 3V2UA 3OIFA 3R1IA 1H93A 2EGGA 1CQJA 5HS6A 3WGGA 2VTEA 9LDBA 4WASA 1ISFA 1M2WA 4E3ZA 1R15A 2ZTLA 1GZ6A 3DWFA 4TRRA 5BNIA 4MO2A 1Z73A 3EC7A 5EL0A 1Z6ZA 4LCJA 4PZDA 5HS4A 2HSDA 1I3KA 3EZYA 3DFZA 1SOVA 1EUDA 2CVQA 2R00A 3GVCA 4MIYA 4UULA 4XIJA 5ENDA 1PZHA 4UUOA 3TZHA 3CMMA 5JCXA 4B8WA 1ZXLA 5DBFA 4F6CA 1PR9A 2GZ3A 4NBVA 4IINA 3T4EA 2P9GA 5FWNA 1HDGO 4MKXA 2GGSA 1P45A 1F8FA 4IS3A 2NM0A 5F3RA 3ZHYA 4IMPA 1E7SA 4E2ZA 1NVTA 3WGQA 3CINA 2CFCA 2DPGA 1BSVA 3TZ6A 2VWHA 4DC0A 1HE2A 2WYWA 2V6MA 2OZPA 2IXBA 2PGDA 4W6ZA 4JP3A 4G65A 1IE3A 4W7IA 1DOHA 2EF1A 2IYOA 3JQ7B 2W8ZA 5H81A 2E6UX 4L76A 6ADHA 4NU6A 3DO5A 4MVJA 2NADA 1BTOA 2PKRA 4JIGA 5KVCA 3CUKA 3TZQA 3L4BA 3JQ8A 1NQAO 4PLHA 1Z7EA 3ZWYA 1MA0A 5HM8A 4D44A 4FJ2A 3DB2A 3K73O 4X54A 3K6JA 5G0UA 5JW6A 4QEDA 3UW3A 2D5CA 4JBIA 4O0LA 4E5YA 1WAMA 2B36A 4NH4A 1NM5A 2DPHA 5COQA 1HYHA 1CYDA 4JGBA 3K5PA 1KVSA 1SCUA 3FBTA 4R69A 3OJFA 4ZGWA 3NT5A 3RD5A 1JVSA 4QFDA 3CSDA 4R5MA 4AJ4A 4KMSA 3I6QA 3C7CB 3GFBA 2J3KA 2HK7A 2YV1A 3V8BA 3KBOA 2Y68A 2HDHA 3EK2A 3R0IA 2ZYGA 3TJRA 1R4MB 2FR1A 2EV9A 2HMSA 2IODA 3DTTA 3GZNB 3LDHA 2G1UA 2DBRA 2CSUA 4O5OA 4XX0A 4IZIA 1K2WA 3DOCA 1YDWA 3PP8A 1ZZEA 4FGWA 1P1RA 3DR3A 3TF5A 3K2EA 4PLTA 4HNGA 2RHRA 5DDIP 1JKFA 5L7YA 3L4SO 1EVYA 1B3RA 3OEYA 1PGJA 3TNLA 3LQFA 5GY7A 2WJPA 1H94A 2J6IA 4DUPA 4BNWA 4A10A 4IJKA 4EDFA 3PRJA 4Y6SA 5DNAA 4I5EA 3N58A 4WGGA 4O59O 4K6CA 4NBUA 5IZ4A 1I5RA 4IQGA 1GCOA 2BKAA 2G17A 1KC3A 2GN6A 4J4BA 4YJGB 1KYQA 1BMDA 1DHTA 4NJMB 4CM8B 1UXIA 2DLDA 1E3JA 4BNLA 4D3SA 4MINA 4R41A 3T4XA 1B26A 2POQX 4CJXA 3EZLA 1HZJA 4RVUA 1WWKA 4F3YA 2IEDA 4AG3A 1W4ZA 2H63A 2V6GA 4BO6A 4MVJG 3DZKA 2ZCUA 1I3MA 1P3DA 5G0SA 4GPD1 5A03A 2WM3A 4XR4A 5KWEA 4Y6PA 3ST7A 1OMOA 2X9GA 1P31A 1A5ZA 1NBOA 1NQ5A 1Z75A 1E6UA 4KOAA 3WNVA 4CMJA 1U3VA 1V0JA 2X7HA 1HEUA 3U3XA 2FSVA 1ADGA 1DFIA 2EKLA 3NDJA 4O63O 1DC3A 3I4FA 1PGNA 3P7MA 4FN4A 1EQ2A 4DQVA 4M87A 2QHXA 3LSYA 4RQTA 1Q0QA 5JAZA 3ZWPA 2DU8A 2VHXA 2OP1A 3C1OA 3E5RA 4NMHA 4FIZA 4FQ8A 4RF2A 4B3HA 4GWGA 2X5OA 3PZRA 3C85A 4Z6KA 3ZNPA 3S2IA 3K30A 3O03A 1DJNA 4JJGA 4PZCA 1Z82A 3VH3A 3QWAA 4OYRA 3JQAB 1XR3A 2DVMA 3ITKA 3JQ6A 3DMTC 1VJ0A 3GG2A 1YO6A 4PVCA 4ZU3A 3VPGA 5L9AA 3GUYA 2OL4A 3JQBC 4IBOA 3F5SA 4QT0A 2FN7A 5TSDA 1KEPA 5CPFA 1LDBA 1LTHR 3QVXA 1I32A 1RPNA 2VWPA 4CL3A 1R4NB 3E9NA 4E6PA 1AGNA 2A9FA 1C0LA 2Q3EA 4DIOA 1PGPA 3RC7A 2V7PA 4IM7A 1GZ3A 4XA8A 1B8PA 2AMFA 2AQ8A 3PI7A 1YB4A 4AJHA 4OXYA 3T7CA 2X8LA 4D45A 4DTIA 3FHLA 3VZRA 3DBVO 4UREA 2X0NA 2AE2A 1ZK0A 5JAQA 3MJTA 3H9EO 5KJ6A 4AJIA 1K6XA 3CZMA 2VOJA 1WLYA 1M76A 1QRRA 3E6AA 3LF2A 2YZ7A 4BNZA 3E1KA 2DFDA 2I3GA 1ZK3A 3VH1A 3QQPA 3DDNA 3H9UA 5KNLA 3JD4A 2C0CA 4ZQHA 3IL2A 4HNHA 4EW6A 1JDJA 4ALLA 9LDTA 3OIGA 3HQ4O 5C37A 1YQDA 3RKUA 4JXKA 4D3FA 2VZ9A 2ZB4A 4URFA 3DQPA 2PGLA 4J9UE 2O23A 1JWAB 3DC2A 3EMKA 3ZI0A 4FFMA 2JCVA 4R9SA 2IZ0A 1CERA 4NK5A 3PLRA 4YEDA 2O3SA 4PRLA 2VRCA 3KOUA 4R9RA 1RM3A 5U1PA 4TRJA 2W98A 5CHEA 2GF2A 1TEHA 4CMGA 4DQXA 3UFXA 4EBFA 5LDGA 3I9LA 5TJ9A 3MJ4A 5JDCA 2RIRA 2Y1GA 4L74A 2AW5A 2NUAA 3BYZA 3B1FA 5IJZA 4IJWA 2GD1O 3H5NA 4PG7A 3ROPA 2Z95A 1LDYA 2BF7A 1B16A 3GOHA 4NG5A 1P77A 1Q7GA 1KS9A 3H8VA 4CMAA 1L1FA 3JQGB 1Q0LA 3AW9A 4ND5A 3MWDB 1PS0A 5BSGA 4LVUA 4E30A 3IUPA 5LC1A 3GHYA 4BNKA 1PU2A 1P1FA 1SB9A 3QIVA 4OAQA 4LCEA 1ULUA 3AOGA 4Q3DA 4H16A 3I23A 1KEWA 4Q3AA 4YBZA 2D5AA 2WD8A 4D0SA 1B7GO 4R51A 1E1LA 2OP0A 3H5AA 1I2CA 4ITUA 1LDEA 1U2GA 2HO5A 2UAGA 4JJFA 4MP8A 1PQUA 3ABIA 4BMSA 4CV3A 3I9JA 2GERA 3K9QO 3KHUA 3E9QA 5HTOA 2Y99A 2O3UA 4ALJA 3BAZA 1GQQA 4UVIA 3L77A 4NBWA 3HFSA 4AJEA 3F46A 4E2WA 1IPFA 3KB6A 5A04A 1SC6A 3TSCA 5F5LA 1HSZA 1TT5A 3D0OA 4KP7A 1ZW1A 4ND3A 1DIAA 2PWZA 2I67A 4CUKA 1P33A 3INRA 3HDHA 3S2GA 1UR5A 4E21A 4IDBA 2I5PO 1C0PA 4A73A 1E0DA 4WEQA 3F5QA 2F1KA 2JL1A 3E48A 3QE3A 1BGVA 1YBVA 4W99A 1WW8A 2Y1CA 3QVSA 2YW9A 4M49A 5THKA 4JNKA 5ICMA 3VVCA 4XYLA 4Z9FA 1O89A 2O48X 2Y0CA 3H65A 1M67A 2X4GA 1QYWA 3KYDA 2VZ8A 1SEVA 3RBVA 4TQGA 1XDWA 3HSKA 4IXTA 4ALKA 3DBHB 4DBVO 2C29D 3MZ0A 3RU7A 2ET6A 2H1SA 1R12A 3K92A 4YACA 1I8TA 3ZCXA 1UXKA 5IAAA 3SJUA 4BB6A 1VL8A 3AUUA 3N7UA 2VCYA 2I3AA 3C1TA 3PYMA 3HE3A 2QYTA 1C0IA 3KSZO 3HDQA 4XJSA 4PLYA 5JO0A 2HJSA 3F9IA 3GA0A 4R1UA 4F46A 4TSKA 3JYPA 3DZHA 3GY0A 3HG7A 2X5KO 1GR0A 4N5LA 5THQA 2D0IA 3UF0A 2P68A 4BO7A 5BNTA 1ZKMA 1NWCA 2GDZA 8ADHA 4OQZA 1V6AA 1E7MA 2HKIA 3BMOB 4TROA 4HFMA 3KLPX 2X9VA 5A3VA 3C7DB 2OO5A 1E5LA 4LISA 2C54A 3QP9A 1U8XX 2VRBA 2GLXA 1KERA 4DRYA 3SX2A 1PJCA 4K28A 4DLLA 3GVXA 2NTNA 3HN2A 2ZB8A 3QSGA 1GYQA 4B3JA 4S1VA 1YRLA 3LK7A 1XEAA 4GX1A 3PFWO 3QWHA 2ZATA 3BTUA 3I9MA 1E1NA 4BGVA 3ONFA 1F8GA 4GKVA 3OM9A 4L9RA 4MVJD 5CEEA 1DO8A 3WIEA 4PLZA 5JC1A 1W0CA 2IYPA 4BO3A 4CQLB 1LSUA 4FD3A 4XYBA 3H4VA 2VT2A 1R0KA 4C7JA 1BXGA 1IZ9A 3U5TA 1PQPA 5DT9A 4U8GA 2J3JA 3FF4A 4FFRA 2Y1OA 4IXWA 3GAFA 1MLDA 2EKPA 4AJ2A 3KLMX 4CLDA 4WE3A 5FF9A 3GK3A 3I4CA 1SAYA 4I9HA 5A06A 3UN1A 3A06A 1B8UA 2JFFA 3JD3A 1G1AA 3G0OA 4EEXA 1SEPA 1W6UA 2RH8A 5TF4A 3UKOA 3E8XA 3DAFA 3LT4A 4Y8VA 3AY6A 3H3FA 1VJ1A 3ORFA 4NBRA 4KTTE 3EGOA 5FI3A 2AG8A 3VZPA 3UCEA 5AXBA 2AXQA 3IOYA 3CTMA 1DAOA 4Z9YA 4IMRA 1T24A 4NNJA 3I6IA 4OKIA 4QX6A 2VT3A 5JCJA 3ZWCA 1V3UA 3ETDA 4J7XA 4BNYA 3JQBA 1IHYA 1NX6A 1NWHA 5T8KA 3CKYA 3GC6A 5TT1A 4D3DA 2J3HA 2I76A 4BIIA 1EUZA 2Z5LA 1ISJA 3H2ZA 4BUCA 2SCUA 1LLQA 1DB3A 4B8ZA 3RUEA 2Q49A 1XKQA 3RVDA 4YJDA 5TNXA 5TIIA 1YL5A 5IZCC 1EFKA 3IQDB 4JBHA 5A02A 3WG9A 2LDBA 3FTPA 4GX0A 4RORA 2DM6A 2D3TA 3JQ7A 4L4SA 1HYGA 1I33A 3DTYA 3GGGA 1K6IA 3CXRA 1GZ4A 1WXDA 3QVOA 3FWZA 5GZ6A 4NDNE 5IDXA 3G17A 1UZNA 5TLSA 5J23A 3AOEA 3WQQA 3JQFC 1JQBA 1DLJA 3HWRA 1NQTA 1TB4A 3PQEA 5CPBA 3DBRA 2CD9A 2JFGA 2HUNA 2YV3A 1WDMA 4J1NA 3C3XA 3WGIA 5K0ZA 1GCUA 2YY7A 3FPLA 1DRWA 4CMCA 1YOVB 1PL6A 1A72A 5CDYA 1X7GA 3GN1A 4MJLA 5DOZA 4BKQA 1CF2O 2CDCA 5F1OA 4I8XA 4N5MA 4BV8A 3CEAA 2IZ1A 3ETEA 1QSGA 4F6LA 2BGKA 2G0TA 4R4JA 2XF8A 4OL9A 2PZLA 4PG6A 5EESA 1DLIA 5KTKA 4L75A 4GWKA 1R4MA 3GZNA 3AM3A 1FMCA 1U5CA 1Y8RB 4TZKA 1KY4A 3U9LA 4BB5A 1NPTO 4TKMA 3Q2KA 5B37A 2VHVA 2DBZA 4R1SA 3NJ4A 3IKVA 3WFIA 1HE5A 1PX0A 3CH6A 3LZ6A 4UUPA 1J6UA 4WJZA 4MVJM 1CRWG 4EUEA 3KUXA 5TT0A 4L0QA 2NWQA 4WOKA 4U5QA 4WPGA 3A14A 4RF4A 1ZSYA 2JCYA 1ORRA 1UDCA 3PWZA 4IGFA 3UXYA 4ALIA 4OQYA 4J3FA 1N1EA 4HY3A 3VH4A 2VYVA 4NJMA 5L7TA 2IRWA 1AN9A 5T6BA 3A4VA 4CV1A 5JY6A 3ZH2A 4CLEA 1ADBA 2JHFA 4J0FA 5L53A 4YTEA 3P2OA 3Q6IA 2GRAA 4UUMA 4GKBA 3DBLB 4Q3EA 4AJLA 2I65A 5ILOA 1NR7A 2OUIA 4R1TA 1DC5A 3GG9A 1ONOA 2GZ1A 3KEQA 1U3TA 4YVFA 3RJ9A 4YR9A 1ENPA 4OH1A 1VE9A 4RPLA 3DAGA 4GQAA 3ZDFA 1PGOA 4GMGA 2FRDA 1R16A 1G0OA 1JTVA 2Y93A 4A03A 2OBYA 4CODB 4QECA 4Q39A 2OMEA 4LVCA 5CEFA 5T57A 1A27A 1EZ4A 1U4OA 4FDAA 4LSWA 3R6DA 1LC0A 5IXYA 2I9PA 2GCGA 3AFNA 3IUSA 4ILKA 3ZW9A 1Z45A 2NTVA 3HHPA 2GN4A 5A3JA 3KSUA 3DFUA 3L6EA 5I8ZA 3X2FA 3U09A 1BXGB 4KWIA 3QWIA 1YXMA 4BL5A 2VRCD 4PVDA 3JQAA 4G5HA 4J7CA 3D3WA 4TVBA 3KYCB 1ISGA 4TMFA 1P44A 3VTFA 1LSOA 2ZTMA 3LC1O 4J2HA 4P22A 2EHDA 1XQ1A 3JD1A 4LW8A 4R16A 5BR7A 1R4NA 1WPQA 4FW8A 4C4OA 1KEUA 1YJQA 1JKIA 1P1JA 1I2BA 3PGXA 3FN4A 4KUHA 1LA2A 1Y6JA 2PLAA 1JWBB 4J43A 1F14A 4DIBA 3WWZA 4YT8A 4AFNA 3WTCA 2Y1EA 2FR8A 1KVTA 2NU6A 1TT7A 1NASA 1IYZA 1A7KA 1ENYA 3EUWA 3PHLA 5DCYA 2C5AA 4OGWA 1ONNA 1L7EA 3PHJA 3KYBA 2EKQA 2JD1A 2CVOA 4IY1A 3WIDA 4B7UA 4Z3KA 4MVJH 4DLAA 5ADHA 3AI3A 3W6UA 1XLTA 2TMDA 3KZVA 1EBUA 1B2LA 1YKFA 3N74A 1IZ0A 2JD2A 2OORA 4QQRA 5EQFA 2HU2A 3FTNA 2JKVA 1Y1PA 3ROQA 3FPCA 3Q9NA 2BFOA 3RC2A 4DYVA 4E13A 2O3TA 3DZFA 2PZJA 1MX3A 3PYLA 4OOFA 1N7HA 1JU9A 1PWZA 2QX7A 3DBRB 4OOEA 1AUPA 2HK8A 3DXFA 2DTEA 3RASA 1X15A 4CLOA 4AJOA 1UXJA 2R6JA 3KO8A 4MIOA 4TKLA 3EHEA 4JROA 5ITVA 1U7TA 2O2SA 3WSVA 2PH3A 1DSSG 1HDXA 1N5DA 1ISIA 2BD0A 2VNSA 4J2OA 4QUKA 1JAXA 1IB6A 4ALMA 1XA0A 4BQPA 2BFMA 2E4AA 3QY9A 1GAEO 3JQGA 2EP5A 4AJNA 6LDHA 3QVWA 3DMYA 4XYEA 5K6AC 1IHXA 2HQ1A 4MIEA 2D2IA 3OIDA 3QRWA 4NU5A 1GV0A 4TRNA 5BNFA 2EJWA 1I3NA 3VTZA 2A35A 1H6BA 5F5NA 3CZRA 1ZMTA 5JNLA 3NDRA 1BVRA 3D5QA 1Q2XA 2JCXA 3W1VA 3LF1A 1RJWA 3WWYA 4I08A 4B7CA 1VPDA 3QV1A 3ZHBA 1YS4A 4PLVA 5I7SA 1GL3A 2RBEA 3L9XA 4FSHA 4ZHSA 1YB5A 2YQ4A 4H3VA 3OJ0A 5IDWA 2DTDA 1T2FA 4CLRB 1CIVA 4PG5A 3WXBA 3DOJA 3HB5X 1T1RA 1Y81A 1H0KA 5ILGA 3TZKA 1LX6A 3H9JA 2WE8A 1E77A 4BNHA 2P5YA 3WTBA 4W4TA 2O50A 3WYCA 3VVBA 4UVHA 2ZK7A 3OA0A 1HDZA 3ENKA 2VYNA 4YJHB 5DN9A 4CV2A 1M6WA 1K3TA 1AE1A 4GSLA 3FCOA 4I5FA 4D7AA 1C1DB 1ZEMA 4XGKA 2VN8A 3WJAA 1JVBA 1VKOA 1W73A 4P38A 1QYDA 1GYRA 3MOGA 4MDHA 3JQFA 1PZGA 1M6HA 2FOIA 1YQXA 1LDNA 4FFOA 2Q45A 4PCVA 2O4UX 1QG6A 3AK4A 3EY4A 3ZU3A 1XSEA 3M2TA 5JYDA 3WMXA 3KTDA 3RKRA 4I5DA 1FK8A 1AXGA 3JQEA 2BHLA 4RVHA 3PZBA 4WOJA 3AU9A 4I1IA 4Z0TA 1V8BA 3C8MA 5ES3A 4J9VA 2ZJ1A 3DBHA 2ZB3A 5L40A 3U62A 2W4QA 1LSSA 1PIWA 4CMKA 1TI7A 4LRTB 4QSMA 2YQ5A 3I52A 2OHXA 1U8FO 5A9SA 4H7PA 1DIHA 2DQ4A 2OGUA 4RL6A 3EDMA 3RJ5A 3TFQA 4FGSA 5KVVA 1SPXA 1VRWA 4WKGA 3D3WB 1E1KA 1P1IA 1LLCA 4EITA 3NTQA 3OHSX 4YAGA 2QQ5A 5KJ1A 4ALNA 3O4RA 4N7RA 4FJ1A 3FNFA 4RF5A 8LDHA 1YE3A 2EJVA 2PY6A 3CPSA 4TWRA 1HDYA 5DBGA 4Z0PA 3UVEA 1KBZA 1O8CA 2D4AA 2ZYDA 5JCJD 3WGYA 4YPOA 1KETA 2F00A 1PJQA 3OSUA 3RC9A 1QXSA 4E2XA 1G6KA 3BMOA 2QZ9A 2FWMX 5LCXA 1U9JA 2EWMA 3W8EA 1U2DA 5K9ZA 2X23A 3GLQA 3GZ4A 1LQUA 4XDYA 1M75A 1PZFA 2DAPA 1D8AA 3TPCA 4D42A 3DAPA 5ITWA 2C7GA 1ZVMA 4BNJA 4DMLA 1O6ZA 4OXKA 4CM9D 3A9WA 5EN4A 4OXNA 4LRSB 4MOWA 4NQZA 4QFCA 4CQLA 2DBVO 1PJSA 1H6DA 3U4CA 1LI4A 4FFNA 2J5KA 2D8AA 3COSA 5JYEA 4BKUA 4EJ6A 2NVUA 1NVMB 4HBGA 1P0CA 3S8MA 1BDMA 5BSEA 1K6JA 1LSJA 1T2DA 4TRMA 2EG9A 3GVPA 1U4SA 2IE0A 3ONEA 4RPKA 4RLSA 5TGDA 4ZA2A 1RKXA 4TVOA 5KKCA 5JDIC 3M1LA 2GPTA 4YYZA 5CAEA 1HSOA 2BGMA 1EVJA 5T64A 4YAEA 1V9LA 1XU7A 1ZFNA 2B4RO 3CIFA 3WYEA 1K0UA 3IP3A 3ZNNA 4PG8A 3D4OA 4KUEA 2PTGA 4CLOB 1B8VA 2PKQO 5U4QA 1XQ6A 1EBFA 4WLUA 3RFTA 4BQRA 2XXBA 1X14A 2E49A 2H5LA 3QLJA 4FS3A 3WB9A 3KETA 1T2EA 4RLHA 4CUZA 4EGFA 3OH8A 1I36A 3BMNB 3WS7A 3WFJA 4UUNA 1N1GA 1LNQA 4BGEA 1FDTA 4KDEA 2V65A 5IDQA 4YCAA 4DL9A 5BT9A 5JY1A 3VDQA 2O3QA 3HJAA 2Q4BA 1PS8A 1UH5A 4BKOA 1ZK1A 3L07A 1D4FA 5AOVA 2P91A 3ZN2A 1H2HA 3ZNOA 1GYPA 2VYVD 4FPXA 1UP4A 4NR0A 3PK0A 3L9WA 2VWGA 1DIGA 3JV7A 3Q11A 4WNIA 4DPMA 1LJ8A 1NR1A 1LC3A 4HX5A 3GEDA 3MOIA 3PHHA 1YB1A 3PDJA 2C7VA 1T26A 1SZJG 3K2BA 2GR9A 3RBZA 2X58A 3BTSA 4CL8A 4BVAA 3JQ9C 3RI3A 3E82A 1RM4A 3OF2A 4DGSA 1H6AA 4JQCA 4B4WA 1YOVA 5L95A 5LDHA 4A7PA 4YWJA 4CR8A 3VC7A 2WDZA 1MFPA 4WCFC 4EZBA 5C5IA 1E5QA 1ZSNA 5CP8A 2FP4A 2OFPA 4E31A 3RUDA 1NHGA 1Y9EA 4BO2A 1ADFA 4ZD6A 5H83A 2JD0A 2BFAA 1BW9A 3FNEA 3NGLA 2EW2A 3W6ZA 1R0LA 1Y8RA 1IL0A 2B5VA 2VZ0A 3ZWXA 1QV6A 1NQOA 1BXZA 2P5UA 2HMVA 2QRKA 3W4JA 4MVJI 5GZ3A 3AI1A 1J0XO 1WZIA 3LC7O 3E9MA 3ASVA 2JJYA 2PV7A 3JQAD 3PIIA 3VKUA 1DDOA 5DP1A 4PRKA 3DL2A 4BNNA 1C1XB 1CWUA 2J8ZA 1I30A 1HF3A 5JLAA 3WBFA 2RCYA 1XYGA 2CY0A 3UUWA 2ZCVA 4KQWA 3ON5A 4ZVVA 2QZZA 3AWDA 2Q2QA 3BHJA 3TRIA 5AXAA 2TMGA 4CM7A 3RC1A 1LDMA 3ZWMA 5A9SB 5KJFA 1KVRA 1LU9A 3MJVA 1VLLA 1BWSA 4GLOA 1ONPA 2Q99A 4J7UA 4J16A 4CLXA 4BNXA 4DYDA 3GNTA 3INTA 5TRTA 3I83A 3DBLA 1QMGA 4H15A 4TZTA 3PEFA 3X2EA 5KVQA 1PZEA 4KQXA 2B4QA 5L3ZA 1ADCA 2AQKA 2HMWA 2X86A 4J91A 1DXYA 3OECA 5EERA 4CR6A 4CMIA 3NV9A 3DHNA 3V1YA 1UAYA 3ZHZA 1E92A 4D46A 4J4HA 4RQUA 4ZJUA 5DCUA 4R3NA 3KXDA 3VAZA 4A0SA 2J5RA 2H9IA 2ZQYA 1DFHA 2GUGA 3RCBA 4PLPA 5CDTA 5G4KB 4A2CA 4M86A 3D4PA 1WDLA 3HNPA 4IUYA 4Y6RA 4BO4A 1PS9A 3AUSA 2NTJA 3GPIA 4WNCA 3F4BA 3RIHA 5A4DA 3RUFA 4CM5A 1C14A 4XJTA 3UCFA 2J3IA 1MXFA 3QVTA 1HETA 2VHYA 2NVUB 7ADHA 1N8KA 2ZKLA 3KVOA 3TOXA 3KYCA 3I9NA 4II2A 2NV6A 4P4LA 1B15A 2PR2A 4BHTA 3AFMA 1CQIA 5H82A 1X0XA 4J0EA 2I99A 1S6YA 3GEMA 4KUGA 3EAGA 4HFJA 4DQUA 5U9CA 2B69A 4B3IA 4M54A 1VL6A 1U28A 3RUHA 3QJ5A 4YRAA 3P2YA 2Y1FA 1DIBA 3D64A 4UVGA 1RM5A 4B4VA 1PJ3A 1PJ2A 3E18A 4N5NA 3H3JA 3JYOA 1I2ZA 3LT2A 2PD4A 2X0IA 3O8QB 3H6KA 3WQRA 3DMTA 3B1JA 4J6FA 3SC4A 1OZAA 3ULKA 1EDZA 5IDYA 1IULA 1MC4A 4G81A 4JK3A 2WTBA 3IKTA 3P19A 1NXQA 1HZZA 5ER9A 4P4GA 5A1TA 1H9BA 3BTOA 3DZGA 4NFHA 2W90A 4DLBA 3GVIA 4Y9DA 1MC5A 3ETGA 3AM5A 5JC8A 2YJZA 3EVTA 1CETA 2PZMA 1EDOA 2OBNA 4M1QA 4W82A 2BH9A 1PR3A 4EEZA 4PG4A 3PIDA 1KY5A 4PLWA 1B0AA 4CM9A 3HZZA 4LN1A 2X1HA 1E6WA 1ZJYA 3DHYA 2NNLD 3WGHA 3RSHA 1S7CA 2VYND 2PFGA 1NFQA 2D59A 3TL3A 1D1SA 1UJMA 4BO9A 4CM3A 3PJDA 4E32A 1EUCA 1Y8QB 1VM6A 3MWEB 3JSAA 1BG6A 1DC4A 1GADO 2ZTVA 1ZEJA 5IG2A 3SLKA 5TC4A 3VPXA 3BHIA 1EE9A 1UAGA 4BNGA 3UHAA 4AICA 5KOIA 1X1TA 1W8DA 3VHRA 3GNQA 3M2PA 5KJEA 3SC6A 3ZWAA 3IIEA 2EEZA 2NVBA 3ADPA 2O7QA 4XGNA 5HBRA 1EE2A 2YV2A 1N2SA 4AJ1A 5C7IO 1MGOA 3NYWA 1BW9B 1HDCA 5KCZA 2EP7A 1YL7A 2BRUA 2WYVA 5DF1A 1YGYA 2WWRA 4NFSA 1ZH8A 1P9LA 2VNAA 3OFSA 2Y0DA 2E82A 4BO8A 1NPDA 1E3LA 4W7HA 1E1MA 3T7EA 3H9GA 3IP1A 3B6ZA 1ZNQO 4JCOA 5AXCA 2CF5A 3I1JA 2GN9A 2Q2WA 1Z74A 4PN3A 2NU9A 1GY8A 1HKUA 5FYDA 1NAIA 2DUUA 1NFRA 2P9CA 1HDOA 1K5HA 3TN7A 4E12A 4CLRA 2C5EA 3Q2IA 1YONA 1G0NA 3HB4X 3L6DA 4M8SA 5L45A 3V1TC 1NVGA 3LVFO 1ZUD1 1KOLA 4ND4A 3DHEA 2LDXA 4WLVA 4YJHA 4GSKA 2W2KA 3AI2A 2AA3A 2Y0EA 5F1PA 1C1DA 4RV9A 1TVEA 1NNUA 5ER6A 2QRJA 4FFLA 2XOXA 4UEOA 4E5NA 3PWSA 3D4NA 3GGPA 4UVDA 1RYEA 3QWFA
chains in the Genus database with same CATH superfamily
2WKPA 1J8VA 3UAOA 2IEYA 3CJTA 4UDXX 2XCSB 1M2OA 1OX4A 3FFWA 1HXHA 4FJ0A 1W1UA 3VO8A 4EJ0A 1G21A 1NVWQ 3D4LA 5ERGB 4S35A 2OXIA 3MWFA 3D81A 1N7GA 4BRWA 1F7VA 2I6GA 5E4TA 1KZ6A 4EO7A 3S1AB 2B83A 3QX9A 1X2BA 2W0SA 2GMWA 1VLQA 2VG8A 3DBIA 3FNGA 3A28A 3GDGA 1CE8A 3HI6A 1XELA 4UCXA 5AH0A 5ENVA 1U3FA 1FLVA 1RM0A 4J94A 1OC2A 1X0VA 1Z6XA 3B70A 1BRMA 3AJ8A 3H97A 4FLMA 1DPFA 4A4DA 5C5EA 4W5NA 1X9GA 4BX8A 1Y4UA 3RNLA 3U6BA 3E5MA 2O07A 4I1YA 1J25A 3KR0A 4KXQA 3RS0A 3H7IA 4YMVA 1N0WA 2OFXA 3F3YA 3KLOA 1E9BA 2GZDA 1E1CB 2YC2C 4IDNA 4N5HX 1N2BA 1ZY2A 3V7WA 1FZQA 3IEUA 3G59A 1JXQA 2DR3A 3K20A 1ZS9A 3OFVA 4GU5A 4KI7A 3WSWA 4ZO8A 1EIWA 1KK1A 2D62A 4FYHA 1PZNA 2PWBA 2AMVA 3ZU6A 5HKKA 2IITA 3WBKA 4J03A 2FSSA 4ZFNA 5KUTA 2XJ4A 3GUHA 2V6BA 3FLEA 1Z8DA 1KY2A 2AN4A 3MJSA 2NYRA 3ZHSA 3FYTA 4CG0A 3GI1A 2NZ2A 1FUIA 3LT5A 1HFKA 1RACA 1Z17A 3OP1A 2R87A 4YMWA 3GT0A 5EXPA 3WQBA 2FX5A 5AXDA 3X1JA 1W2GA 4TPKA 1PJ4A 1QR6A 2G71A 1UBJS 4Q9NA 1K86A 1CUZA 3KUDA 4W6QA 1V5EA 2RE8A 1ZZGA 3OEWA 5JDCC 1ZWKA 1BVUA 5FUQA 3FWYA 3GQBA 3I37X 1AKWA 5ED0A 3R7FA 4L16A 1E3TA 4Q1EA 4BNVA 3V8QA 3D3JA 3A27A 1NUTA 3JAKB 1HDEA 1FU8A 3C3MA 4QXPA 2RONA 4L8YA 5C7LO 3UGKA 4BJ1A 3SVLA 3GCWA 3H0CA 3HFRA 1OR8A 2GZMA 2HXYA 2IP1A 4FZVA 4M1KA 4QU0A 5DWDA 3TEFA 4OB7A 5BW4A 4MWCA 1I1HA 3G7UA 1XNJA 1WY5A 4G5GA 4II7A 3ZVKA 4HI0E 1O94A 5LD2C 2WJIA 3OO1A 3RVRA 4B4KA 1NQVA 2YUTA 1NAHA 4RMHA 4PM4A 1GU1A 1TEXA 4JC8A 3LCCA 3R09A 3A7EA 1KYXA 5H3HA 4F2HA 4M22A 4LMPA 2WF9A 2IHTA 2QD5A 1Y7PA 1RAHA 1S5PA 4OQMA 3LV8A 2MSDB 4YRQA 5J2TF 1Z2DA 2H85A 2HA7A 1CY1A 1F0PA 2RGNA 3BXEA 4UDYX 3U17A 4UTRA 1QBGA 3CRZA 3SC3A 5JEDA 1LLUA 4OHRA 4R8VA 1CEQA 1OBFO 1UBEA 1P18A 2IYNA 2CXUA 1MVLA 1Q57A 3AM4A 3AR5A 4DA9A 2XDQB 2AFHE 2VWQA 5ALPA 1MG5A 3HLKA 3GLGE 2GPWA 5FB3A 2QXUA 4NFYA 1G8PA 3E4CA 3L6RA 1K5GA 3AEXA 3RABA 3L8DA 1KMHA 1YIOA 2HHJA 1FFXB 1K9SA 2QY9A 4P92A 2M6RA 3P32A 4HJRA 2XSZD 3U9TA 8AT1A 2FEOA 1EUCB 2YASA 2QW8A 4GI3A 5GPBA 4MDFA 1XLVA 1XZFA 4RPCA 4CLHA 1AA6A 1AS2A 5JQGB 4RVNA 1B43A 2O7NA 3PSHA 2OHFA 5FEUA 4CYMA 3O94A 2JFVA 1NZDA 2DKFA 1KQNA 5LWHA 3U3OA 1H65A 3T95A 1FUKA 2B6HA 3QTTA 4WY5A 1CQXA 1NYTA 4K8RB 1INLA 3BXFA 3L0DA 1QOQB 3WKEA 1FL9A 1YQGA 4KG7A 1G20B 5A4DA 1XTTA 4KC0A 2MCFA 2OAGA 2QT1A 3DM9B 3BMNA 5CEJA 3DULA 1EB9A 4E5KA 4J0HA 3QF7A 4L0DA 3WLTA 4LTNA 1FDOA 2HM7A 3OSZA 2VBIA 1Y7TA 4IRMA 5C53B 1WUIS 4GDMA 1QVRA 2A14A 2J87A 3MMSA 1M66A 4F5YA 3S8YA 4G8DA 4WXYB 3PX3A 3O26A 4KVAA 3R5HA 4IX9A 1BRTA 1Z06A 3I42A 4NPCA 5FL3A 5FTWA 3RRBA 4R5HA 4XIFA 5FKJA 5HCNA 1QQ5A 1CUXA 1YL6A 2ADMA 2WHPB 3GFGA 2BP7B 3VOBA 4X66B 5I9TA 2CNBA 4IDEA 1DL5A 3O74A 3JPWA 1GQ2A 2YHBA 5BQPA 4CTKA 1ND6A 2LV8A 1Z15A 2NVWA 3HFGA 4FFSA 4HP8A 3MJFA 4IV0A 4JJEA 5HK9A 2A3NA 1FFGA 2NUPA 2ZSUA 4FMDB 3WSTA 3LCUA 4HAZA 2QN8A 1P4SA 4LYJA 5HGXA 5DNCA 4OREX 3VKWA 2CF6A 1D1TA 1TF2A 5AYVA 3LPNA 1V8PA 3NC1C 1J42A 1KQ3A 3MGGA 4YI3A 2QRZA 3EODA 3B1YA 1DBQA 3ZY4A 2IYWA 3LQKA 1RYBA 1TPYA 4NRDA 1SVUA 4TS4A 2X22A 2PGNA 1NJGA 3PFKA 4L8WB 3K05A 1DG1G 1ZD9A 4MV5A 2FAXA 1GUZA 3MGAA 4HZUA 1WRBA 5FUBA 5J2TA 4P33A 3VBEA 2YFHA 1PR4A 2B61A 3ET4A 4IOJA 1DUIA 2OV1A 1OTHA 3DYBA 1MOSA 3EEYA 2HRZA 3H16A 3ICCA 1AB5A 1ZH4A 4GVLA 4KIGA 4MQUA 1ZICA 4ONEA 4RFLA 4XQCA 4BMDA 4DUGA 4FMCF 2YXLA 2RG1A 4UQLA 2VHWA 1EG2A 3ANNA 1C3VA 3EYWA 3QQ5A 4KAJA 3L1JA 4WXHA 4CFSA 1BJTA 1Y3IA 1VSVA 3SKYA 4Z7QB 1UJCA 1E3EA 2DLNA 2KM1A 2YFKA 4XB2A 1XDBA 3RFVA 5BN3A 1PFQA 4C2TA 2WD7A 1I4DD 4DA0A 4DTCA 5HUQA 2JI9A 4XGIA 8ATCA 1KA9H 4CCWA 4XQ9A 2C3UA 3FVVA 4E5DA 2XCUA 2CV0A 4U39A 2FPOA 3MUEA 3AQIA 2BTQB 5CB0A 3F8SA 5C18A 3EJ6A 1NTOA 1QGUA 3AJRA 1BS2A 3O93A 3ASZA 3GYGA 3VR3D 1N34B 3K9HA 2ACWA 1N8NA 2OB1A 3LPMA 2DCMA 2P0AA 3E0QA 1FS5A 2B37A 1BU8A 3CNLA 4KWHA 4WCFB 3JWGA 3TR0A 4BKPA 2I7DA 2DERA 1Q7CA 4MUEA 4ZI7F 1DRVA 4X7MA 3E70C 4B81A 4NE7A 1UZMA 4MRPA 2ZSFA 1M6VA 2CVZA 3G0IA 1OI7A 1S8AA 3BMQB 3NVDA 2XI4A 4O1MA 1H2FA 1AV7A 1LTKA 1QV7A 4IHQA 2OVFA 3ACCA 4D8TA 4G0MA 4MKFA 1Z5VA 4PS1A 2IKSA 2BE9A 3C43A 3T1QA 2Z5GA 4DLNA 5HFNA 2P8JA 1SUWA 1RWWA 1KL7A 3U7RA 4DCCA 4HQ6A 4MR7A 4C22A 1PGQA 1U0RA 4BFSA 1QGED 1U3UA 4AB1A 5FORA 3X3HA 1HTTA 2DFNA 4DLVA 3FM9A 1JDUA 2C7QA 1RC8A 3Q3CA 1Y34E 3IAHA 3NBYC 1YRBA 1L0BA 1ZGJA 1XN4A 2D2XA 2QLJA 3NB0A 3SSMA 4TYYA 1JDNA 3DOOA 2CVFA 4QYIA 4P7GA 3WLSA 1T2UA 4M9UA 4GD3Q 4XR9A 3CMCO 1RT9A 1Q0HA 3MTGA 4IDGA 2CD7A 3N2KA 4CPDA 1ZHOA 5C52B 3CWZA 2VEOA 1W5AA 3H84A 1J5PA 3ADOA 3CR8A 3LWZA 3QW2A 3DZBA 4FR2A 4JLPA 4AJ9A 4J0DA 4OSPA 3VYTB 1E6CA 4EY8A 4OU4A 3GP8A 1XRLA 4OMDA 3SQLA 3ER6A 2OY0A 2Z8YA 4X3OA 3FMPB 4MULA 1OLUB 5IUNC 1LF0A 1M34E 2A67A 1QYXA 2ZRDA 3A6GA 5CG1A 2QRVB 3L46A 2J85A 3OQBA 1A9XB 3EIUA 3HY6A 1X80B 1HEYA 4E33A 3OCJA 1CY0A 2GZ2A 4IGAA 2O8CB 3R9IA 3IE0A 3IBYA 4V38A 3TLGA 1I6MA 1LPMA 1T8RA 2GEVA 3GLGB 4CIYA 1S3IA 2QG4A 4GLLA 1ECGA 4DUYB 1O5IA 1A4UA 2IHJA 3NEPX 3NJRA 4PLGA 4BJHB 4XWWA 1KJ9A 3TL2A 3LC2O 3UA4A 2OXCA 2Z83A 3EGDB 4IH4A 5F73A 5E3HA 1AQLA 3PYXA 1EA7A 3BSSA 2W2LA 3D3EA 3EXFB 4HGNA 2BN4A 4RZXA 4YP9A 3UICA 3CE9A 1GHTA 4TT3D 3ERCA 3C14C 1UM9A 3PNMA 4H7HA 2QXYA 3BE5A 4ZOCA 5J4KA 5L3VA 1ISHA 2ZIZA 2CLIB 2VQFB 3K53A 4D57A 3S1SA 1T5IA 4HDMA 4ZI7A 3QKSB 4YXFA 3PEUA 5MFPA 1P5HA 1BCRB 2ZS8A 1QWOA 4J90A 3OJLA 4DPLA 1P72A 3K1JA 1DINA 2ABWA 2C31A 4HRAA 3K15A 2XDYA 1EYZA 1JI3A 2QUIA 4BGUA 4C3OB 3EQ8A 2QQGA 3G9UA 1MJNA 1ZM4A 4NBLA 4KAFA 3KZCA 4JDUA 4JUCA 4QL3A 3VR6A 5ITSA 2WMDA 3TFOA 4DV6B 3S2FA 4W9NC 1QIMA 2NU7A 3CZAA 1ZXBA 3VH2A 1XCGB 2B4YA 3JQ8B 1UPTA 3X1YA 2VDWA 4E4YA 4N18A 3V2GA 3S2EA 5IT5A 5IN4A 1OXSC 2LUOA 2FHPA 3HADA 4LRUA 3LLUA 1IG3A 2WM2A 1R74A 4LHEA 4MQBA 1SU6A 1XU9A 1NY5A 2E55A 2QX9A 2ZSEA 3NT4A 4NULA 1Q7BA 4NI5A 4RZ2A 2FMXA 3SS7X 4HAVA 2X5XA 3PC2A 4H18A 1DAGA 3K0CC 4IFIA 4NCIA 4QUIA 2JAPA 3W8FA 4C0JA 1RMQA 5BSFA 3GLVA 2RJOA 3ZI7A 1CF9A 1UK8A 1BE0A 2VP4A 4U0JA 3VYSB 3WMWA 1FSSA 2HNAA 3L4JA 4NOKA 1R6VA 2X0RA 3KU1A 2Q2VA 4KI0A 4UQOA 1VLJA 1B14A 3FWHA 3OZ7A 1RJDA 1TKAA 1XTUA 3AKZA 2IBTA 5JSUA 2C2ZA 1XG5A 3MWEA 1R0ZA 4Z9BA 1KMQA 2JPDA 2VJMB 3UT6A 1C4KA 5DT2A 3LQRA 4IGEA 4E4TA 4CMEA 2JB9A 1RFGE 3AUAA 3GZJA 3RAJA 2R7MA 3WL4A 3ZDEA 4R2WA 4HV4A 3H5OA 3HCEA 2OCBA 1SOAA 3CZPA 3RFXA 4WXMA 1PR1A 2FEKA 3E7WA 3HDTA 4UOZA 3I3OA 1L4UA 2FKAA 4J1TC 4L73A 4NZYA 4L78A 1KIFA 5LB4A 1M33A 4GUAA 3BK1A 3RRNA 1FP2A 3X43A 4CEHB 3QXHA 4F85A 1AO0A 5EEGA 4KWTA 1VRVA 4LXIA 2M1XA 2J0EA 2PYIA 1SQGA 2RBKA 3SOZA 2IYLD 4B0OA 1P1KA 2GSDA 4BIMA 5I9NA 1YVEI 3BK7A 1QJCA 1AC5A 1KDZA 3UV6A 3ZQUA 2XOEA 3PDCA 3TFWA 2JJ8A 1T9GS 2ZB7A 3D6VA 3R6TA 3N2IA 3AJEA 3KXKA 4NZOA 5HQTA 5DKFA 3DAOA 2WTXA 4KH1A 1QHSA 2NQ8A 3GH3A 5DASA 1Y8CA 2AEMA 1E32A 3O31A 5DLPA 1EFRA 2W2QA 3I30X 4RY0A 1Y1SA 1YVPA 1P0PA 1T35A 4XB6B 1OLOA 4FYWA 4NU0A 3HO1A 4BLQA 4C2UA 3F9RA 3U4GA 1HT0A 3WZLA 5BR1A 3RARA 1XEWY 2FRVA 2I87A 4UZEA 4EHLA 2AB0A 5KI6A 5TE9A 4RKFA 2PRKA 1DBWA 2CZCA 3A7DA 5DHRA 1KJIA 2WPDD 3VU0A 3EY9A 4WZ6A 4RA6B 3P2EA 4LDNA 2HRCA 2LBPA 4YRMA 3HWSA 1WVGA 1P0QA 2B0CA 3GDFA 3P2IA 3HUDA 4B84A 4AIIA 3H2YA 4CV0A 4D43A 1GEEA 4F3CA 2NAFA 3QHAA 4L5YA 2C2YA 2W6CX 4ESOA 2DWPA 1VOTA 2CHEA 1K97A 3LQ4A 4JBLA 3T15A 3K6SA 3HZRA 2ZR7A 3KKMA 1QGOA 3QKIA 2YHIA 2ZUUA 4G5XA 2C7OA 2LCIA 3M4YA 1XQYA 3ZU4A 3R8CA 2WWTA 3VKUA 3HDJA 2HIHA 4L8LA 3O2QB 1GU7A 2PZGA 2BFCB 3ELWA 4ON9A 4DREA 1UJ5A 3ZV3A 4Y2SA 3GJRA 3K8YA 4X84A 5DP2A 1RI5A 2HJRA 3NGXA 2FUEA 3ESQA 4I2VA 4M0MA 1M34B 1ULSA 2J41A 1T4BA 1U9CA 3PHIA 4D9MA 5LSAA 1QGYA 1YHNA 5B1HA 3D43A 3DO8A 3K9NA 5B3AA 4C5CA 1LBEA 3INGA 5DWQA 4C76A 5JH7B 1W76A 1TXGA 2YYYA 4OIMA 3MWLA 1CUVA 4JT8A 3SFZA 4J29A 3MNFA 1S2NA 2XVMA 4HVTA 4L2IB 1DJQA 3ZE1B 2PQ0A 1I4LD 5AW9A 4F9FA 2IPLA 5JSZA 3H7AA 1MXHA 4D6XA 5I3ZA 1YS6A 4LZZA 2CK3A 2PMEA 2FFRA 2UYYA 1CR1A 2Q4DA 3VR0A 2FJPA 4G1VA 1KJYA 2VDRB 5JQGF 5AVXA 3OZBA 4JLAA 3A1FA 1OXVA 2IUTA 1G7SA 1NLZA 2D1QA 1L5ZA 1QH1A 2OORC 4YDRA 5FR2A 3D6FA 1A8IA 2HR1A 4R1MA 5ABPA 1E2PA 2BEVB 1JG2A 2O3RA 3BJZA 3FB1A 1G8HA 2I03A 3KXLA 1T8UA 3R3JA 2JLUA 3D7NA 3ECSA 2BELA 2XUOA 3RVKA 4IPTA 1T1EA 1ARZA 4U2FA 2UYCA 4QO7A 5C8ZA 3JASB 2DECA 4JZKA 3ZLUA 4AECA 1UQUA 4B47A 5DI9A 1YZUA 5E8RA 2P9BA 4M1OA 3L8YA 2RHDA 1P5ZB 3EWNA 3TQOA 1SR8A 3V42A 5K3SA 3A32A 3AU8A 5EJAA 4BC0A 1RI4A 3SXPA 4UAGA 2DJIA 4F21A 4EI7A 4ZYYA 3NUQA 1T0PA 2FLWA 1IM8A 4ND1A 3LP8A 1P9RA 3ETNA 4DA8A 4LOIA 1KEVA 1E1QD 3D8NA 1T2AA 5CNMA 3PJRA 5JJIA 3JAKA 2DPYA 4DG9A 1TZKA 4IQ8A 4OQPA 3PFIA 1ZD1A 1SQSA 1O0SA 2I1LA 3OF3A 3V7NA 5AO9A 2Q6IA 5CDSA 5K3EA 2WWWA 4BNFA 4FMDF 2PEZA 2FW8A 3DE4X 4HGZA 2G9UA 1K6MA 2C07A 2J3MA 4Z2YA 1H4TA 4LYAA 4HSEA 1QYVA 1U9YA 1KMMA 1OU4A 2NTEA 2ZT6A 3OLYA 3GGJA 4OHUA 2GCOB 4N0EA 1L7DA 3V5NA 2VDLB 2EBUA 3BXPA 5JPDA 1PTKA 2P6PA 4K9LA 3B85A 4U3JB 4M0PA 4XXHA 2KLBA 5JZSA 1L5YA 4EKYA 2IY8A 5B2ZA 3C4QA 2FSIA 1C8LA 3MCVA 4F92B 1JFFA 1X1EA 2OHJA 2TS1A 3CZQA 4HQ0A 2HLPA 4U2BA 3M6IA 4BU1A 2F3PA 1E2NA 1D4AA 1YA8A 2YNMA 3HA3A 4TMKA 2XDQA 4UBLA 4ZVMA 4RTLA 5EZYA 1DJLA 1MP0A 1EEHA 2ZTUA 1JUDA 4OK3A 1PE0A 1FLNA 1RYNA 4XCVA 3O75A 4PLFA 2CNWD 2AD5A 4RHCA 1FFXA 1T8SA 1FF9A 5IN5A 1Q21A 1RYFA 3PENA 4E08A 4XYGA 7REQB 2GWRA 4AP6A 2FMUA 1LFDB 3EZ7A 2HA2A 5JQGA 2Q2OA 3N2EA 1HLDA 4OGFA 3BXXA 4EG1A 4H35A 4MR8B 1IH8A 4L4XA 4Y1RA 1ES9A 1ZITA 1G291 1MPXA 5EJGA 3I62A 1KJWA 3F7MA 4C4XA 1QHHA 5LQUA 1G20A 4A36A 1P4AA 1YI8A 4YA6A 4G37A 4AZ0A 3W3AH 1RXSA 4RWZA 2W6PA 3TQQA 2Z4SA 5KNCH 5CYOA 1GFSA 2KWIA 2ZYAA 1RJ9A 4E5MA 1NJ2A 1SU8A 2JRCA 3ZXSA 1QYIA 1RRCA 1R50A 3FYUC 1U0JA 3AXSA 2QJWA 1V26A 2G9ZA 2PKQP 4Q7MB 1TD1A 4DEVA 2LVBA 2ZSBA 5C34B 2C5LA 1U7UA 5DLDA 4YQFA 1JQAA 1QO0A 2R1ZA 1S2MA 2HJHA 4DV0B 4DQ0A 4WZZA 3BCRA 3DNMA 1Q2UA 1TJPB 2YZKA 3DFKA 3N8HA 3CUTA 3KX2A 5M04A 2BP7A 3MAJA 2QJTA 4KXVA 4OK6A 3GP3A 5M3BA 1RU3A 1T5BA 4K2HA 4XRGA 2GXUA 4QASA 3AB8A 4FEGA 4ITVA 4JYPA 4QHSA 2A1TS 4TV8B 5IMBA 3GT4A 1PR5A 4Q3BA 2AI1A 1MMFB 5JMWA 2P2CA 3K16A 16PKA 2M6LA 3VV2A 2ZSAA 3EUEA 2C7PA 3ZW8A 3TLEA 1KI7A 3DPSA 3OT4A 3Q0EA 4BWFB 5CVEA 3PPIA 1GDDA 2IDZA 3C1AA 2QPLA 4KKXB 4KMOA 2VHZA 4EY5A 5CLHA 3VUFA 4A26A 2R8BA 4E7PA 3EXAA 1SHLA 4V2IA 1IY8A 1CY7A 3O2NA 2CDBA 3PTZA 3NAMA 4Y9SA 1C8BA 5G0VA 1XCBA 1DAMA 1R66A 1ULZA 4XWGA 4E2YA 1XZKA 2YWXA 4YRSA 3R5SA 1N92A 1RPTA 3QV2A 1QO9A 5J40A 4L72A 3NX4A 4BEVA 1N0VC 5JE8A 2GPNA 5KQSA 2BI7A 4URZR 4JQOA 4X95A 3DONA 2L42A 2O3JA 1P8AA 3PL5A 4RPHA 5DTQA 4LGVA 2XA1A 3EIFA 1UBGA 2YMMA 3VHQA 2GNAA 3V4FA 3BUSA 4L6CA 4OKNA 2BTQA 3LI2A 3WDKA 1TMGE 4Q9AA 3WQSB 4CM8A 1N2EA 1IQRA 2YFQA 4F60A 2QLBA 5FOSA 3P5SA 3U48A 2W6IA 1Y4DE 5B55A 5I7WA 1WV0A 1XGKA 3GCXA 1AHIA 2IUEA 5AJYA 1EK5A 2GO7A 4RNDB 2Q0HA 3ZR4B 4WCFA 1QLWA 5CTAA 4HDKB 5ULLA 5JHHB 2RK6A 4BFYA 1Z4JA 2DC1A 4J1SA 2BI8A 4IKEA 3UWKA 2ZRLA 5LQCA 1EWQA 5FCDA 5BQOA 3BZUA 1X77A 3N6XA 1U1FA 4JBXA 3MCZA 2Q46A 3EGEA 3VSDA 5LWQA 3BMQA 2I91A 4DBZA 1MV8A 4QXRA 2PBRA 2ID4A 4B7XA 2H1HA 4ZP1A 1TJ4A 5HKLA 2RHCA 5BV8A 4CETA 5TQVA 4ECEA 1L1QA 1YJ8A 2GYYA 4KXXA 3AUYA 4ZZ0A 2ZWPA 1DG3A 3OP4A 3QFTA 2QRQA 5BMOA 1RWMA 2RHOA 3B7WA 2ZSHA 3NKLA 2AOWA 2XITA 5HWSA 2VQDA 4IV5A 3B89A 2O14A 4GM1A 2AOXA 4AJPA 4KIUA 2EJUA 1ZMOA 2CMFA 3IQWA 3BXZA 3C41J 5JAIA 4W9MC 2VL7A 4E09A 2XUIA 1JJAA 1N6HA 1D2MA 4GAEA 4RHUA 1WKCA 4HXFB 3UB4A 4BZXA 1SCIA 5CFZA 2YQZA 5KSOA 1VB3A 4PIVA 3ZKWB 1I13A 3RBAA 4EP1A 4RADA 4ZT7A 2IK8A 3NBUA 5I7VA 5KTPA 2Z6AA 3FF1A 1N1MA 2CLHB 1FMTA 4S3MA 4F71A 3B2EA 1OLUA 1H93A 2EQ5A 2H48A 1G17A 1M2VB 3UBTA 4RKRA 3LIIA 1QZXA 2BFEA 2ENUA 2PMFA 1JR3E 1RQNA 1DT3A 1ZONA 2VNJA 3EWSA 3ICVA 4WFQA 3WGGA 5HFAA 1A9XA 1ISFA 4HNQA 4RSMA 3PPVA 1L8OA 1ZH0A 1R15A 3CLTD 1NOKA 4N41A 5EL0A 3GLGA 1DCTA 2PX5A 4LDQA 4PZDA 3ZLBA 5HS4A 4U7GA 1G5RA 3AUXA 1P6UA 3HYLA 3EZYA 3P71T 5KMGA 3KSAC 3RC8A 3CRQA 1MQSA 1EUDA 2CVQA 3GVCA 2GUWA 4RANA 5ENDA 2YKGA 2ZDGA 2I80A 5IASA 1XVLA 1PZMA 2GM4A 3EGDA 3HCOA 2QT0A 4ER5A 4R7TA 2UVPB 5CM2Z 3HXTA 4F7DA 4RHEA 2GZ3A 3N2YA 3MWGA 2V1XA 4IINA 2BT4A 3D02A 3MA0A 2J9XB 4HQKA 3KJEA 2P9GA 4NCXA 5L6LB 2GGSA 4ARAA 4H1UA 4KNYA 3B12A 5T7BA 4QBTA 2SCUB 4OH7A 4TL7A 3VR5H 4EGAA 4YCLA 1FRFS 1Z4NA 4BWYA 2YIJA 3NBXX 4QICA 4XPIB 3UJ3X 3DDUA 3FIJA 5FWAA 5IK2A 5CK4A 3ZH9B 3NHZA 4JP3A 5AKLA 3SZOA 1KFKB 1RWQA 4TXHA 5BWNA 1WHTB 4KIJA 1YACA 2PT6A 4GXNA 4R2XA 4MAMA 1QFZA 4BNDB 1IJFA 3C1UA 3DO5A 4LQLA 4DMUB 4QG3A 5F9HA 3PC8C 4JIGA 3WKCA 3PCTA 3QE9Y 3HJTA 3W5HA 3WWCA 3MTBA 2Z8YM 2WPNA 2HSJA 2HYIC 3AEZA 4R1OA 3L4BA 3JQ8A 4J75A 3PT9A 3FVWA 4PIPA 5E4JA 3ZXXA 1MA0A 2HB6A 4WX2B 4BCCA 1CTQA 1BE8A 4FJ2A 1K27A 1SCKA 5IUKC 2P1RA 4AAYA 1P8JA 4AG5A 1KO1A 2JARA 5JW6A 5CFRA 3CLVA 4ASUA 3UW3A 1X7WB 2QNRA 4XEUA 2PWAA 3OOWA 3X44A 1DAFA 3VAYA 2B36A 4NH4A 4EG7A 5COQA 3BWDD 2RHMA 1GCGA 3QX7A 4GQBA 3K5PA 4OL0A 1YDGA 1C9NA 3FBTA 4R69A 1DJPA 4ZGWA 3D6MA 3DPUA 1K68A 4I1RA 1WNFA 3QVGA 3M6WA 2E4UA 2FLVA 4L15A 1VSTA 4NCKA 2C4WA 3HJUA 5LUBA 2XB4A 4DCPA 4BLUA 4CIXA 2HK7A 1WV1A 3FWKA 1Y1QA 2JFXA 3WLKX 5JH7F 2VJOA 3C3EA 1BYIA 4F84A 3EK2A 2VJMA 3IODA 2PSEA 1CP2A 3IHTA 5A7GA 2FR1A 2HXSA 1MO3A 2IODA 3DTTA 3EG9B 4PINA 1QZUA 2H4FA 2CSUA 2WAOA 4XX0A 3F67A 5AOBA 1PR6A 3GLIB 4J16C 4K3VA 4M0UA 5B1SA 1BDJA 3PP8A 1ILEA 3EA5A 1IBKB 2VTBB 4WK0B 2F1JA 5IXJA 1J8MF 3C3JA 3HXLA 2RGUA 3B5EA 2BGNA 3EIOA 5L7YA 3L4SO 1EVYA 5JSYA 1PWEA 2GJ8A 2ZBRA 1EJ0A 3OEYA 2DQYA 3LQFA 1S4QA 2PS1A 2R11A 1H94A 1MAHA 3AEYA 3SQDA 4BNWA 1XXHB 3BJIC 4UXIA 3TE7A 4EDFA 1L5GB 3ONNA 5ERYA 3H8SA 1SXPA 1T9ZA 1EFVA 1X39A 2OO5C 5DNAA 1L5LA 5KO2A 2EQBA 4WGGA 3N86A 4PPYA 3FSJX 4O59O 5ALXA 2XUPA 4CF5A 3OAAA 4B7ZA 1I5RA 4IQGA 2AUTA 4I81A 4ZI3A 2GA8A 4REOA 5IVIA 1R0WA 1JIXA 3GLKA 2E6KA 1Q0RA 2P78A 4HWOA 1DHTA 4OBEA 4P6VF 1ZHHA 3T7JA 4NFLA 4Y9TA 2DLDA 1J00A 2CHQA 3TCXB 4BN0A 4OHKA 1XROA 3T4XA 4DUZB 4CJXA 5KTNA 1HZJA 4UE2A 2YJ4A 1WWKA 1WD5A 4HGOA 4GF5A 5F78A 4ZEVA 3CVYA 4EB6B 1W4ZA 2H63A 1P6XA 3ESYA 2GHQA 1XNQB 2R6HA 2J5XA 2DLCX 4XGQA 1U6KA 2INGX 3KHSA 4ENVA 2BHSA 1M2KA 1EPUA 1MH9A 1UBCA 2B92A 3H5WA 4G5FA 4RA6A 5EMMA 3AB7A 3ZX5A 1VE7A 4F9EA 3QELB 2B4KA 4LE0A 2OILA 2Z2JA 4XR4A 3RYHA 1OHHA 1S2DA 2X9GA 4KQEA 4CNBA 4U2DA 5IU6A 4KOAA 4A2PA 3ORYA 4LA4A 2X7HA 3BVPA 2C42A 3Q3GE 1HEUA 3GZTB 4FE7A 2VF4X 3WIOA 1IBRA 1M5RA 3ESZA 1ADGA 1T3LA 2O8VA 4NS1A 1DC3A 1UJ4A 2HXGA 3K0FA 1FYVA 5BQ5A 5CFQA 2VDJA 1TUIA 4FN4A 4PWYA 1TO6A 4IR7A 3LSYA 4RUKA 3ANXA 4KGDA 2AR9A 3HY4A 1NNEA 2JEZA 3OOJA 4XLTA 3ZWPA 2DU8A 2RIPA 2OP1A 4B33A 3U5ZB 3W79A 4FIZA 4FQ8A 3HYCA 5CX1B 1YMQA 2XADA 4C9BA 1DQSA 3PZRA 3C85A 4DNFA 3V80A 1N2HA 1M34A 4ZC8A 3ZNPA 1J24A 3S2IA 1WUTA 3KSMA 1QS0B 4HS9A 4O4LB 4Q7KA 1CUGA 1DJNA 2QTWB 3MT9A 1Z82A 3FB4A 3QWAA 4I36A 4N3GA 3UY4A 3VH3A 1XR3A 4QFBA 4L2IA 3GG2A 5AJXA 3DTVB 2WAMA 1QPBA 3F5SA 2GD6A 4IBOA 3TTVA 1OI4A 3EC2A 5FV4A 2BMFA 3L6UA 4MW7A 2PCLA 121PA 2FPMA 5ALWA 1LDBA 1LTHR 1U0HC 1X8LA 4O29A 1I32A 3SBDA 4MEBA 1YUBA 4QREA 3TB6A 4QRIA 2H4WA 2F1IA 1R4NB 4MUXA 1A8PA 2R1VB 3CUYA 4HB2A 3W9YA 3HYSA 3EC1A 3TLMA 1UJ2A 3EBLA 1KQPA 4NABA 4Q82A 4EHFA 2EYUA 2V7PA 2XNJA 2HD4A 4XA8A 2ZJOA 2RMKA 3TLJA 3PI7A 4Q12A 1A96A 2B8TA 4AUNA 2I7XA 1NJ1A 2X8LA 4J0GA 3JASA 3WGJA 5LNK6 1I5OA 2D8MA 4OF4A 3CNBA 3Q2OA 1WR8A 4FYKA 5FOWA 3E7FA 4YUYA 5JAQA 2B94A 1MB3A 4KXUA 2G9RA 2Q9AA 2ZAGA 5K0CA 1O96B 1U7ZA 3MUOA 5F2NA 3UW1A 5K8LA 5CGQB 1KR5A 3N1UA 4C0QC 4KQGA 1M76A 1R8SA 3VR4D 4YRKA 1N8SA 2XD9A 1NLUA 3TW8B 5EJ8A 2VPIA 3E1KA 2DFDA 2I3GA 2KX7A 3MT8A 2EIXA 4PZ0A 4B73A 4HPWA 2UZ4A 1ZNZA 3OZUA 3DDNA 1KFJB 3H9UA 2ZR0A 3VR6H 1EGHA 1N2CE 2P27A 3RSZA 2CFTA 3ENQA 2P7IA 1N0IA 4PC7A 4XLZA 4EW6A 1V6CA 3WYFA 1XEFA 5CLIA 4TV8F 4LJ9A 1PZXA 4E2FA 5LP1A 3A9TA 1T1JA 1WO8A 2VZ9A 2H18A 1R27A 1XYVA 4LY6A 4HS4A 1UWLA 1Q3TA 4IWYA 5FQNA 4JI8B 2GCOA 3A4TA 3K35A 3EQZA 2X5NA 3EMKA 3DNPA 1F6DA 2AG6A 1M0TA 4JQZA 2JCVA 4R9NA 4U3JA 4ZVSA 2IZ0A 1CERA 4L28A 3RRYA 1OUMA 3UXEA 3ZIUA 4EAAA 1HA3A 1UC8A 2AOVA 3H3XA 4B82A 4EHDA 2OGTA 4TRJA 2W98A 5CHEA 3U3RA 1TEHA 3PEWA 2ZZMA 1Z4IA 3AVQA 2RARA 4HGQA 1YA4A 5KOYA 2VKQA 3ESBA 4M60A 3W90A 4EL0A 2EL7A 2YWBA 5KNDD 3FCEA 1IHUA 4LF8B 2OGSA 4YHBA 1JEQB 2VIIA 3M4XA 4DNPA 2R65A 4IJWA 3ROPA 2Z95A 1LDYA 4BJ6A 2BF7A 3GOHA 5F9MA 5K3CA 1XJCA 1P77A 1Q7GA 1KS9A 3KFXA 3MWKA 4NG5A 3TMYA 4TX1A 1UKZA 4XGRA 2SECE 3CNQS 4TWAA 4DV5B 1Q0LA 1W52X 2J33A 1Z4OA 2EW1A 2EARA 4R05A 3MUNA 5HUHA 5KOJA 3NP7A 4X45A 3PUXA 1KDTA 5AICA 2RAPA 3OQJA 1KOJA 2H9YA 7REQA 3IB3A 5GJBA 1D04A 1GR1A 5EGNA 3PBKA 4FBLA 1DDGA 1SB9A 3F49S 5BYAA 3QIVA 1W4RA 5DM70 1EU1A 1TC1A 2C83A 2XNKA 3A2MA 2GCNA 2CVHA 3PXDA 4X1IB 1CEYA 3FMOB 4ER7A 1JHVA 1KEWA 4UTPA 2C2OA 5CLLA 1UBUS 4R51A 5JROA 1RKQA 3MGCA 4DR3B 3WDLA 5PGMA 2J5BA 1B76A 1U2GA 2ARKA 2FVXA 2UAGA 3PHBE 5E2AA 1SBCA 5AUQA 3DKIA 2WJ3A 3TDNA 4A0RA 1G8JA 3UYKA 4BMSA 4CV3A 4ZV4A 5JZOA 3ADDA 3W06A 4N7MA 1HMPA 2O8EB 4ALJA 2O3UA 1CF4A 3I09A 4X85A 2PO5A 1AK1A 5JFTA 3H9CA 4AJEA 3B13B 3N6RA 1ELOA 4ANFA 1IPFA 4CEIB 3KB6A 4JUBA 4P3KA 2QUKA 1UMCB 3ZQJA 3ILXA 4Y7DA 3MW8A 3KS9A 4IH9A 4QPNA 1TFUA 1Y5LA 1ZW1A 1Z36A 2OBLA 1E2KA 3MILA 4IV8A 4CUKA 3BS4A 5KYGA 3QEOA 3Q7SA 3INRA 2VHQA 2VP5A 4JI4B 2JI4A 1M0SA 1NMXA 3HBNA 1KIMA 4MWTA 4OUDB 1PI3A 3S2GA 2QD2A 1F48A 3F71A 4TV8A 4BATA 3I5YA 3DMRA 4IDBA 5EKTA 1FS6A 3NTVA 2X0FA 3RSGA 4A73A 2WKWA 2BBTA 5J5AA 1J8YF 2PFSA 3F5QA 1TIBA 3GUZA 2F1KA 3TG8A 1BGVA 1X8XA 1YBVA 2H1WA 2Y1CA 5THKA 2YW9A 1BEUB 3BRWD 4JNKA 3SXUB 3CLSD 3TK1A 4DJEC 2G7ZA 1QX4A 2O48X 2X7XA 1LPOA 3DL0A 4MHOA 1XMOB 1C8KA 2GK7A 3L82B 3II6X 4HH4A 3RBVA 2AJ8A 3I0NA 2AFVA 3OU6A 2GBPA 1Y6RA 1GVHA 2Q3HA 2ZYHA 3TLAA 2WIDA 5EFZA 1W48A 1VKZA 4MPTA 1ZW6A 3DBHB 3DDWA 1KSJA 2VXBA 4HWSA 4M98A 4MV9A 4H6WA 3QPBA 2WNIA 4MZXA 2BI4A 2YZ2A 1YAHA 4CIWA 1MZVA 1UXKA 5FBRB 1XVIA 4YONB 5TVGA 2ZUSA 3F73A 1TK9A 2D2FA 1D09A 2Z3VA 2V0GA 1GZSA 1KARA 3HE3A 1P2GA 1C0IA 2QYTA 3HKDB 2YJ6A 4DV1B 5CVJA 4HDKA 3J7AC 1PBTA 1CUHA 3LTNC 3HG7A 2X5KO 1GR0A 4IIDA 3UF0A 4G67A 3LCMA 3BKWA 1ZKMA 3GCDA 4C08A 1K5PA 1NWCA 1A3CA 1RBZA 1XDGA 1V6AA 4QOEA 5IVKA 5FQOA 2EX0A 5CLFA 4TROA 5A3VA 2QAGC 4HFMA 4MI3A 1J9EA 2X9VA 3C7DB 1E9FA 4V0SA 3PVSA 2XWJI 5HG0A 5K0EA 3ELDA 3QP9A 2ZRIA 3IUEA 4D92A 5DTEA 4CI0B 4K28A 1W34A 4DLLA 2I4LA 3DVQX 3EXEB 2L69A 1VZ2A 3ECCA 2ANBA 3HN2A 3L84A 4EYQA 2ZSKA 4YRJA 2WNSA 2HF8A 1AF7A 1CW2B 4S1VA 4GX1A 1TM1E 3W9BA 2WKQA 3H1AA 3NONA 3PFWO 5HF5A 5C51B 3CA8A 4GIBA 3Q7EA 1N2CB 4DZTA 2IS2A 4L9RA 1XLWA 1XRMA 2NQ2C 3FPBA 3PNSA 3R3HA 4S2EA 4D0NA 2ISSD 2X4DA 2IYPA 2V5AA 4NOLA 4PSKA 3FAZA 1NRXA 5DYNA 3H4VA 2WTEA 1K0FA 2JAWA 3PQ3A 1PQPA 2W83A 4HL6A 4UPDA 2MR5A 2QX4A 4U8GA 1VG0B 3FF4A 4BYGA 2A2ZA 2JLVA 5DCLA 4BN5A 1A0OA 3LBYA 2Y1OA 2ZJ7A 3HUFA 1ODIA 3GAFA 2EKPA 3M82A 1FRNA 1GILA 3MCTA 4UHHA 1Z4MA 3ZBPA 3GCZA 2OM2A 3EEFA 2VJLA 1Z0ZA 2E4VA 1BKYA 4LDPA 1V71A 3ICWA 5A06A 3A1CA 3JVUA 3UN1A 3NTLA 3A06A 1B8UA 2RSLA 1G1AA 3G0OA 3TNYA 2VAPA 4X71A 2RH8A 2POCA 5TF4A 3UKOA 1A9QA 3E8XA 1ZVVA 1UXOA 2F7SA 3P9QA 2IYVA 1JE0A 2Z57A 1LKZA 2NPOA 5YASA 4Y8VA 3AY6A 4E70A 2WWIA 3B8HA 1ZVJA 1OYYA 4TKUB 3MQFA 5FI3A 4EVRA 1E9AA 1IC6A 1SVNA 5AK6A 3RRMA 4DJFC 2AXQA 1N3BA 4IUCS 2LTAA 4YLYA 5CITA 1ECFA 2PS0A 3O0TA 4L57A 3OU7A 2QTFA 5K4AA 1Z68A 2LXNA 4TLBA 1KDVA 3ZGOA 5MF6A 4FP9A 4UNPA 2UVPA 3MMZA 5TPZA 4QX6A 3BERA 5JV5A 1Z2CA 3B53X 1IXZA 4BLVA 4DM4A 3JQBA 1I7NA 3CKYA 2X9LA 3GC6A 3CX3A 5TT1A 4AF6A 2I76A 3NZEA 3H5TA 2Z5LA 4KU4A 1OB5A 1NUHA 4XIGS 1NIJA 2R6R1 2SCUA 1AZWA 1LLQA 1YRHA 2Q6KA 1YRAA 2H29A 1XKQA 1VP3A 4G0OA 4PCAA 3RDPA 4MDEA 2ZVPX 4XPIA 1OFVA 5TNXA 1RS0A 2F67A 2DUMA 2BJHA 1WEKA 3IQDB 4IWXA 3WG9A <