2VJOA

Formyl-coa transferase mutant variant q17a with aspartyl-coa thioester intermediates and oxalate
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
427
structure length
427
Chain Sequence
TKPLDGINVLDFTHVAAGPACTQMMGFLGANVIKIERRGSGDMTRGWLQDKPNVDSLYFTMFNCNKRSIELDMKTPEGKELLEQMIKKADVMVENFGPGALDRMGFTWEYIQELNPRVILASVKGYAEGHANEHLKVYENVAQCSGGAAATTGFWDGPPTVSGAALGDSNSGMHLMIGILAALEIRHKTGRGQKVAVAMQDAVLNLVRIKLRDQQRLERTGILAEYPQAQPNFAFDRDGNPLSFDNITSVPRGGNAGGGGQPGWMLKCKGWETDADSYVYFTIAANMWPQICDMIDKPEWKDDPAYNTFEGRVDKLMDIFSFIETKFADKDKFEVTEWAAQYGIPCGPVMSMKELAHDPSLQKVGTVVEVVDEIRGNHLTVGAPFKFSGFQPEITRAPLLGEHTDEVLKELGLDDAKIKELHAKQVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords FORMYL-COENZYME A TRANSFERASE
publication title Reinvestigation of the Catalytic Mechanism of Formyl-Coa Transferase, a Class III Coa-Transferase.
pubmed doi rcsb
source organism Oxalobacter formigenes
total genus 144
structure length 427
sequence length 427
chains with identical sequence B
ec nomenclature ec 2.8.3.16: Formyl-CoA transferase.
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02515 CoA_transf_3 CoA-transferase family III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1540.10 Alpha Beta 2-Layer Sandwich formyl-coa transferase, domain 3 formyl-coa transferase, domain 3 2vjoA02
3.40.50.10540 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Crotonobetainyl-coa:carnitine coa-transferase; domain 1 2vjoA01
1T4CB 1PT8A 1P5RA 1XA3A 2VJNA 2GD0A 1Q6YA 2VJKA 1XK7A 1VGRA 1XVVA 1T4CA 1PT5A 2VJPA 1P5HA 2VJQA 1X74A 1VGQA 3UBMA 1XVTA 2VJOA 1T3ZA 2GD2A 2G04A 1XVUA 1PQYA 2GD6A 4HL6A 1XA4A 2VJMB 2GCEA 1PT7A 1XK6A 2VJLA 4ED9A 2YIMA 1Q7EA 2GCIA 2VJMA
chains in the Genus database with same CATH superfamily
2CLHB 3JATB 4CV0A 3WL8A 1JVBA 3UJHA 1NV8A 3KHUA 3WISA 4GF5A 4B35A 2IDMA 4I6JA 2BFPA 3U37A 1R8JA 4DKJA 1X80A 1K9VF 2I4MA 4K9LA 1F17A 1Q1BA 2YXBA 2CHGA 2JLWA 4B3HA 2IV3A 4C07A 4LY0A 1U63A 4CMIB 2OCXA 3K0SA 3HC7A 1Z18A 3A1NA 3T4PA 1FDSA 2NUAB 4HVTA 3DP9A 1YDEA 5DGTA 4Q4LA 3C6YA 3WDMA 4KUHA 3W4KA 6GPBA 4Z1MD 2QNRA 2Z95A 4XXHA 5ELMA 3P26A 5JJBA 1Z4LA 4J1TC 3DLHA 1INLA 1I3OA 3OMLA 3RTAA 3QVOA 1GNRA 1RJEA 2HH9A 4INJA 4M1OA 3NR2A 3NPMA 3FMFA 2X8JB 1EG2A 2QL5A 3JQ7B 3MD9A 3WWYA 3OM8A 3H1FA 1S3FA 4Y0VA 3AUFA 3LQYA 4MA0A 1JG2A 5HIJA 3KLNA 1MV8A 3OFJA 3AVUA 3N53A 1XOIA 4O2RA 4BRSA 2RJNA 4JUCA 1YCDA 2VWHA 5K0JA 3LC2O 3UUEA 2BMJA 1BHJA 2OMEA 1P31A 1P74A 1OWPA 4OKNA 2W00A 1QB8A 2I2WA 3FRJA 3V46A 4XWWA 2HA7A 1PS8A 4L75A 3RJZA 3QNMA 1ATZA 2A33A 4G24A 4WFIA 1VTKA 3OZGA 3EZ7A 4GZ6A 1X3SA 1XZ8A 1YR1A 4Q9NA 3FI0A 4AJLA 1Q17A 4EZIA 5E4FA 4GXRA 1YU6A 2WILA 5LSAA 1EM8A 4EGQA 1OT5A 4KX3A 3DEIA 2R6ZA 4FQ5A 5JDIC 4F96A 1N7IA 2ZKLA 2X0KA 2EHDA 5JIBA 5KHLB 2IPNA 3OCYA 4LQCA 4RF2A 4QXQA 1E9FA 2AFHE 5ALKA 1X94A 5CYOA 4OLAA 3V1LA 5IK2A 4DMGA 5JWHA 3HB9A 3TQSA 3CH7A 4MW7A 4IIVA 4ZCTA 3CTPA 1D1TA 1OTXA 1W85B 3UWPA 2OXIA 2BKAA 3DDHA 4Z4CA 1M7GA 1REQB 2P6PA 4Q1BA 1V8FA 1QDLB 5JNRA 1A8SA 2X6TA 3K8QA 3TIVA 4YUXA 4FUTA 2NM0A 4HWSA 3P94A 4RTKA 1HOTA 4MMZB 5I7UA 4QARA 1QHIA 1H1DA 1F2VA 2IZZA 4Y2UA 4DCOA 3QLEA 5EVJA 5A62A 3RQIA 2VSQA 2RC6A 3SSNA 3U7RA 3JVUA 3W5HA 1SXIA 1IBLB 2V6MA 3SMQA 4EPTA 3AERA 2D1QA 5EUMA 4TXLA 4QATA 5AUPB 3ZTWA 4R98A 1Z88A 2JJMA 2EP7A 2H16A 3AF5A 4HMPA 4GFDA 2AK3A 3NDPA 5LNK1 4CQMB 1SIOA 2C5LA 3OZXA 4PG6A 3RIMA 2HK8A 2A3NA 5EOVA 4ZQHA 4CKBB 1SVNA 3OLWA 2WMNB 4RHYA 5AHOA 3RVNA 1FCJA 2A0YA 3KUDA 2NP7A 4DA6A 2J4DA 1M0EA 3FYHA 2V97A 4LISA 4M0KA 5EPEA 1ZGGA 4N40A 1POXA 2ODPA 2QN2A 2WTBA 3BHNA 3P4UA 4JJEA 2JZOA 4TWBA 4RZHA 2BIFA 3GFRA 5TMPA 3MYRA 1Z25A 2ZWIA 2PSJA 1O95A 5FTWA 4EG4A 4P53A 2M6LA 4FEEA 2WMOB 3HBAA 1GTL1 3DPSA 4QGSA 5JC8A 4F6LA 4Y18A 2O3TA 2FZGA 2A0UA 4P2GA 1BWRA 4LRYA 3TAHA 4YECA 4GSYA 3T7AA 4DJJA 2PGAA 4E5VA 4AG6A 1QG6A 4YRIA 1WXIA 3CJRA 1YZUA 1SG6A 1Y3CE 3G2KA 5EN4A 3RSZA 1JH9A 4LRTB 1H2WA 2B8JA 3JU3A 4A26A 3SC2B 3CXUA 1U0EA 1T2UA 4IYRA 3OZCA 3SXUA 2XTZA 4F38A 4R7ZA 4X1IB 4P98A 1I30A 2DBQA 4MH0R 5CDFA 1N5OX 1OQAA 4FK8A 1PK7A 1ZHOA 1ZK3A 4M9RA 4QYWA 3FMGA 3ZE2B 3DOJA 4D0NA 2WZBA 1T34A 1X92A 3G59A 4UFPA 1X38A 4B73A 1SD5A 3PK0A 3THWA 4X66B 1MV5A 3GJ6A 5KNBH 3MCZA 1X7GA 4JGGA 1ZCBA 5EIOA 3L05A 4GQBA 3ZH2A 4MYTA 1MT3A 4ZC8A 1GQRA 1KEUA 1GFZA 1PQ4A 2BTOA 3HWSA 3STYA 4CL2A 2O8EA 2ANBA 1U28C 1IG0A 2OG2A 4Q4JA 4QICA 4RIHA 4XJTA 3ZWXA 3ZVRA 1SB9A 3PFNA 1K6MA 2CNWA 3U7QA 4LTMA 1E79D 4KE6A 1U2DA 2E2WA 2ZE6A 3AY0A 4O25A 4YRZA 5AM2A 4DCCA 2FWAA 1KQOA 1PW5A 4ASUD 1D2CA 1ZVQA 3GMDA 3N8DA 3UT5B 1B8NA 2HMAA 2CJPA 3AEUA 3HKBB 4RQBA 3LNCA 2DB3A 1ZL0A 3TI7A 4Z7JA 1I1QB 4Z0TA 4XDHA 1L4NA 4Y1RA 3SR4A 1EVZA 1WETA 3OX2A 2WFAA 3LXUX 1OLXB 1VSUA 2HO5A 2QU7A 3AKCA 3IESA 1T2AA 2GCOA 1CFJA 4MGKR 4YRDA 1IB0A 1M6VA 1CRWG 1OGIA 1V7QA 2A8YA 2AJ8A 2HPZA 4R16A 1Z36A 3ZQ6A 1JLKA 3AT1A 1U3CA 3CH5A 3FPHA 4WCDA 4WBNB 1NF9A 1IOWA 4P4TA 3UMMA 4B6OA 1V96A 2DERA 4ER3A 1PJBA 4XVQA 3SC6A 2DH6A 3CLSD 3R23A 4PTLA 3ZWDA 3ZXSA 3O1HB 2VDQB 2H2AA 1E2FA 2QYHA 4KGXA 2J3KA 3A6EA 4RSMA 2QG6A 1FJXA 1E0AA 1P2FA 1ORDA 3TW8B 4D97A 4EVSA 4P36A 5C46F 1G2PA 4HR7A 3LBHA 4J0GA 3RFUA 3HN2A 4DCJA 3FFBA 2CVHA 4LJ8A 1U4OA 2A1UB 4N9QA 4WBNF 1E96A 4I0WB 2EOAA 1FZQA 1VKZA 2I66A 2V4MA 4G0NA 3RYIB 3M8KA 3Q3GE 4N7JA 2LW7A 2QMQA 3H2KA 1YB1A 2KI5A 2PT7A 1KY2A 4HQOA 3NNSA 2XI4A 1WM1A 3U0VA 4GC5A 1ZIXA 5DX0A 2JDID 4MUKA 1NBHA 4LMAA 2O7QA 5I5EA 4BVAA 2ZIGA 3A32A 1MAVA 3KALA 2OO7A 2JFYA 1EFLA 2Z09A 4J07A 4HX9A 1A7AA 3FSEA 4OGKA 2OLKA 2UZ3A 1AXEA 2POQX 4LJKA 1NRIA 2JW5A 4YP0A 2YYYA 1DI0A 1DIRA 4MGYR 1LNZA 4GD3Q 3RSCA 4YDQA 3SQXA 3VC3A 4WWHA 5TC4A 1CS0A 1K6IA 1WSDA 2BBSA 2NVBA 2NZWA 3L0YA 3NTRA 5KVSA 1HNZB 1N2JA 1I4LD 3OIWA 2FZKA 4GC9A 2QNIA 4DQ0A 4E0BA 1KAGA 1ADGA 2I8LA 2IPAB 1N6RA 2VZEA 3FKQA 1QK4A 4TTVA 3FLEA 1Q91A 5B3JC 3MRXA 3IT1A 3ABIA 4H3SA 3NBQA 3EYWA 3ESYA 1U7OA 2J59A 1RQ2A 2L18A 2ZKIA 3JR7A 3O9ZA 3VKVA 2XE4A 4AY3A 3GCGA 5I4BA 1SUWA 3BXFA 3G1WA 1R6XA 3JQBA 3AWIA 1KKMA 1CY6A 1WS6A 2XRYA 4II3A 1KBQA 1F0PA 3E2PA 3PA6A 3O47A 1SCNE 3MYYA 5EZYA 4D3SA 3B9RA 2HA3A 1G7TA 3QVTA 2NSJA 4HNAA 3UCXA 4DJFC 3CMCO 4P32A 4PSVA 4NICA 4F0JA 1Q50A 3SYNA 1H4QA 1ZISA 4QU8A 4YCJA 5DH9A 1UPAA 4L4YA 2Q2QA 1G9SA 4Q1CA 4XYBA 2ILVA 3KWJA 4HDMB 5C81A 4Z49A 3BSSA 1XTQA 3RRYA 3OOJA 2FRDA 2WJIA 4F56A 1KO1A 4FOOA 1WW2A 5BV0A 2JI4A 2ZE8A 4X24A 2ISSD 4ZALA 3GLGB 4V3BA 1M0WA 3GZNA 4CW7A 4JUAA 3F7TA 5FP0A 4LQ4A 1VI2A 3PXXA 3P9NA 5HQJA 3VPXA 2VYNA 1GKUB 2NADA 2W0SA 3I1FA 3ZGYA 3R44A 3JALA 1G7RA 2V9CA 4L0MA 5B7GA 1WD5A 4HH4A 1BMFA 3GLHE 4L9WA 3VPHA 1KU0A 4D8TA 1QU2A 3FPKA 3CVOA 4DDTA 2Z5GA 4G5QA 4OFZA 1DBWA 2YS7A 4QDXA 3E3AA 5CFNA 2H2GA 3ZI7A 2GAIA 2NUPA 3PQ5A 3CG0A 2ZTUA 5TMBA 4BFTA 1ZXBA 1E6CA 1P1CA 1ZJ4A 2RONA 3NIDB 1MW8X 3OQIB 3H2BA 3B3JA 5AXCA 4DRZA 3EDRA 3WY9A 1V3VA 3T12A 3GEMA 4MR8A 3Q11A 4ND8A 4YJ2A 1QQBA 3A28A 3K3PA 1Z9BA 3LYHA 3UXEA 5D3ZA 2GLTA 3LVQE 3RAPR 1DMRA 3FNGA 3I53A 4EHJA 1H23A 1KYVA 3D6AA 1K7FB 2C96A 3HKEA 5BSVA 5T4EA 1GU0A 2VKQA 4EY4A 5CVCA 2H6EA 2EVWX 3AYZB 2ZB4A 5EKTA 4CWAA 3RS0A 1O94A 2B8WA 4UMDA 5B3AA 5F1YA 2RHCA 3OWXA 4BNFA 5DB4A 1UAAA 1L9KA 1V7ZA 2WLSA 1DIHA 1UAGA 3CLTD 4QFDA 1VGVA 1LRLA 5NLLA 3M49A 4RTJA 4Z4IA 5EP3A 1USKA 3CRVA 4GMGA 3KOOA 1A04A 1W0JA 2A5LA 4ZICA 4I08A 2YMMA 4ZCSA 3OQBA 1WHTA 4J0CA 4LMBA 5AKLA 1SB8A 3RTBA 3QU7A 2OHVA 3IOYA 3URMA 4F12A 5KDOA 4CUZA 1NLUA 2P2NA 3AEKB 3HH8A 5AI0A 4NBTA 3R7BA 5HYVA 2Q8PA 2IQ5A 3ZU5A 5BY2A 2YZKA 4WNAB 3G5UA 1P6UA 5FWNA 4AROA 1SU4A 2PJZA 3DCNA 4JLBA 5KJEA 4DGQA 1PEYA 4ZU1X 5ALHA 4BMYA 4ZMRA 4AJNA 5IYZB 1I94B 1E3SA 2PRZA 4GKVA 5C4MA 5I7RA 4O3MA 4LYJA 3KU4A 1U2EA 4Y6RA 5KDLA 3T9DA 2HMVA 2QV7A 1EMDA 1NQAO 4WJLA 10MHA 2P90A 4ESOA 1XCOA 3II6X 1KNQA 3LRXA 4O1IA 1AGNA 1OTYA 1T9GS 3G9QA 3PGLA 4O5AA 2QRLA 1U9JA 2VTVA 5ENVA 4YV2A 4PTZA 1IONA 3H2IA 1F6BA 4ZKEA 1U3FA 1XJ5A 4E4YA 5BWBA 4O4HB 2HADA 3PL1A 5JISA 2L0XA 2F8MA 3TW4A 2RJOA 3X44A 4A8JC 5K0EA 2WB2A 1GNPA 5CR9A 3AHJA 5H3LA 3TMAA 4MZDA 1KDTA 4H7FA 5IYZF 4D98A 3N76A 5CB4B 3ETNA 4KAAA 1Y7LA 2GZ2A 4JVNA 3H11A 4QIHA 4B81A 1PX2A 2ZTMA 2GJ4A 1I2DA 3LX8A 4C43A 4OHOA 1QG2A 4ZMBA 1JKXA 4KXYA 3E81A 3FYUC 4PZ0A 1UDWA 1KPGA 1HLGA 1R6VA 3GN1A 5LPNA 3IOMA 4DV1B 1EDZA 3Q72A 3RUCA 2EDAA 1EBFA 1T10A 4DC9A 1GZ4A 2AEEA 2HIHA 4O4HF 5IJ0A 2UUOA 3DBOB 3DD1A 4ME6A 3HCAA 3OEHA 1YC2A 2HWKA 2WJ6A 4OYHA 1S0UA 5CB4F 2HA0A 1J8DA 4B3IA 2WP8J 5BSUA 2JGDB 4J0EA 4TMFA 4B3XA 1ZXXA 2QLTA 4US2R 2V5VA 3C48A 1P33A 5H8WA 1H6BA 1CEYA 1Z6GA 3CPJB 2JD2A 4WBXC 4X1OA 4QSHA 3WSWA 3CEMA 1SRRA 1Z16A 3DLCA 5IVPA 2ZI5A 3DBRA 4RZ2A 4BVBA 1MB3A 2I3AA 2N47A 2WZDA 3DW1X 4QNMA 1I6KA 5AVJA 5K0SA 5L3QA 5L95A 1C80A 2HQBA 4ZIRB 2P2SA 4DMLA 1K9SA 1PFQA 1U2TA 2FR8A 3KX2A 4XD7D 2A5FA 1PNTA 1Z2NX 3RAEC 3IR6A 3EVAA 4HH0A 3DFZA 3HV0A 4X1KB 3GOHA 4LZZA 4M55A 4CM1A 2NZVG 5CCDA 2FX2A 1PGNA 4IQ0A 4EB3A 4HZUB 1N9KA 5LBUA 1BDIA 2WHPB 4XSVA 4NBLA 4BQEA 4KDFA 3MJHA 5MN4A 2JAQA 2TS1A 3DVAB 4C08A 4A2WA 3BKWA 1DC5A 3RUAA 1F0YA 1Q77A 5AVUA 1DX9A 3UAXA 1K8ZB 1XCMA 2C00A 2GTHA 2UXCB 1VGQA 1D4OA 1JHUA 5L7YA 4D43A 4EDHA 3IMFA 3D1JA 2G9RA 1XI2A 1KI7A 4RE5A 3PFFA 5IJAA 3UKJA 3KHKA 1NMQA 2H85A 4GO1A 5KQRA 1J9ZA 4BMXA 1R0ZA 5IMBA 3TPZA 4ESHA 3KEGA 1GZUA 1MO3A 1XQXA 2AZDA 2I9PA 1XL0A 5T4BA 3IURA 4MVJF 5HZMA 1ECCA 4DAOA 3IVGA 5FFNA 3LK7A 3WL6A 4EI8A 2AMYA 3MERA 4R1UA 5EJFA 3HJHA 4NF2A 3THYB 1M1UA 1J2RA 5K51A 5I3ZA 3ZDXB 1AG9A 1HDEA 3MWKA 1RLJA 4NE9A 4RSGA 1O89A 2HD4A 2B9VA 2FF7A 3ETGA 4GOMD 1UPCA 5ADVA 2G4CA 2B8NA 3MLEA 5SICE 5JJCA 5GIOE 1TO2E 3KPVA 3LPMA 4RYDA 1K8YB 4MOWA 1FYEA 1Y7HA 2K87A 1XCBA 4HVAA 2I71A 2CLCX 4W5HA 2I6UA 2EFGA 1RZ3A 3CPSA 3L43A 1B8VA 2FW8A 2JFHA 4OO3A 5IASA 3T5BA 5A06A 1LCIA 1YI1A 5IJ9A 2JF0A 2YV5A 4URWR 2ZJFA 3QA3E 3HR4A 3WLOA 2HU5A 3VNVA 2ZPTX 1JLLB 4N1AA 2E4AA 1E9RA 2Q2WA 3I2KA 2QTWB 4Y1EA 4F7DA 4Q93A 5T4FA 4P22A 4LC9A 4TLMB 2ZEJA 2AXNA 5CD1A 2FYTA 2PZAA 1X9IA 2Z43A 2H06A 4HN2A 2H92A 1XC7A 2Q9BA 3I6YA 1F12A 1MGPA 1SULA 3C1AA 4QE3A 1XMIA 1XAIA 5IM4A 4M76B 4OPMA 2NX2A 1GPYA 3BCHA 3RNLA 3DPUA 4FC7A 4LC0A 4GECA 3S3TA 1JFRA 2W2NA 4PLTA 2UZIR 2EG9A 2GK4A 1OC4A 4FHGA 1OWLA 2CK3A 2H17A 2QMYA 3CLKA 3N28A 4TKVB 3KAPA 1RHUA 1N3LA 2JIBA 3K1TA 4YMIA 3BWBA 2DPYA 2G80A 2FMHA 3JWGA 1XZMA 2MYTA 3RLFA 1DQRA 2NTVA 1W6UA 2IXFA 3TQFA 3OZEA 3OQ6A 2AD1A 1XBTA 4PNZA 3HS3A 2R86A 4QRIA 5CH3A 3S1SA 4JB0A 4R0VA 2Q0QA 4CCAA 2AWOA 2PSEA 3L84A 3PD7A 3ZLBA 3WKAA 4E70A 1LLFA 4PC1A 4E5SA 4H31A 4PN3A 3MT7A 4FXOA 1NQVA 4MIEA 3OQJA 3UY4A 1H4SA 2C5FA 2GM4A 2VXYA 4J0IA 3EIUA 2OO5A 2QTBA 3BB1A 4NH0A 5MN6A 2VCHA 1G21B 5EHZA 1IG3A 2DFDA 5CFQA 2C98A 3B52X 2O1XA 2ES4A 1ZCJA 3B7GA 2FFAA 4LGYA 3KZKA 4FINA 2XKJE 1PTKA 2PTHA 3KCNA 2ZI9A 3DVQX 4Q1VA 2YHSA 1TT7A 2WSYB 4JJZA 1KU6A 2RIRA 3AJ8A 2UZ1B 3LQ2A 4DYDA 2VDOB 3WAGA 1RZRA 2F3TA 4KR3A 1A71A 5H82A 3TPCA 1U3TA 1G5FA 1K5HA 4C4SA 2YDXA 3GEEA 4QOGA 3RC3A 3E7XA 3E53A 3CRRA 1NJ8A 1XJCA 3G89A 3UC5A 3V1MA 4L27A 2BGIA 2JAWA 3CLRC 3K6KA 1DRVA 1UK9A 2AUMA 2EU8A 3K30A 2IUYA 1MQ9A 3TBFA 3KB1A 4MGZR 2WVHA 4EGSA 5JMTA 5L9AA 3LAWA 1W2WB 2HC9A 3KPWA 4B47A 5A6VA 2M6RA 1XDZA 3D2BA 3H0EA 1UDRA 4ZVKA 2JI8A 2WNHA 4ND6A 1Z5ZA 3BMCB 2Z4SA 2QXTA 5AJTA 2VF4X 1KY4A 5K2MA 3HP1A 1E1MA 1ZH2A 1LGYA 5F2OA 1XFDA 2MYUA 1WCYA 2QLMA 1XRJA 3JWEA 5EGNA 3COZA 1D7AA 1EQUA 2WD7B 4RF5A 4YMUA 4BWFB 1F2TB 3H42B 1FX0A 1EFAA 4DBZA 4QGBA 2DHDA 2C9DA 2SNIE 4R2IA 2HBZA 1ACLA 4B6PA 4BHTA 3CUVA 2D7JA 4F4JA 5ER6A 3KKMA 2HF9A 4EKEA 5KWEA 3LT0A 1GL3A 1F20A 3L6UA 4CHGA 1Z63A 1C8LA 4D9JA 2WA2A 1ZBQA 1FVOA 1V7PC 4W8HA 4GKKB 4B0OA 3I64A 4BKOA 4KR6A 1YNOA 3OBBA 1EU1A 3ZWPA 4BOYA 4X3PA 4K87A 2HI0A 3THXA 3IP5A 3KYDB 4AAYA 5BNIA 4YPOA 5GJCA 2AQHA 1D2HA 3A0UA 3L8CA 4AL4A 3SF8A 3H4IA 2CXXA 2QM8A 1O4WA 1YS2X 2GN6A 4KP7A 1AKEA 2JGAA 4P4NA 4AD8A 1U7HA 4HSGA 4LJ9A 2H2FA 4PHFA 4CNBA 3RVRA 2D4HA 1LPNA 1JH8A 5SY9A 5IT0A 1XTBA 4ID9A 1GQOA 1A77A 3SLKA 1X1BA 4LK2A 4DARA 5HRAA 1CE8B 1S2DA 1VCOA 3KB8A 1YC5A 1Y9DA 1SOAA 5FUBA 2C4WA 3H8JA 4MQ5A 1LBEA 1UKEA 1GPMA 1CEQA 4FLFA 2IYSA 4NI5A 2FY8A 4TZTA 3GRRA 1ZH4A 3VSCA 5L3SB 1VBFA 4DWVA 1ZWLA 3TIGA 4MQBA 1YS9A 1GUFA 4JFAA 2R8PA 5AXAA 5FB3A 2TECE 1NUUA 1SU8A 1C1HA 5D3MB 4MUHA 2JZCA 4DTCA 1E6WA 4ARUA 3BG5A 5CX1A 5HJEA 1YQGA 1N3IA 2IE0A 3NU1A 2OPHA 3DVRX 3PTLA 2YNMC 3U62A 2BBOA 2GDZA 4FE3A 4WKGA 2YOFA 4ZFNA 1RI1A 2IODA 4GQAA 3EUEA 2C58A 2N0SA 4OQPA 5KTNA 2ZRQA 4MS3B 4V0LA 1X7YA 4FE4A 2P62A 5DX1A 3QTTA 1RVV1 1TF7A 3AF0A 5E6SA 2QSZA 2XUIA 2BTEA 4RJ2A 1SKYB 1E62A 3OHMA 4E3WA 2OAEA 2XB6A 5IDVA 4MB2A 3S2FA 4BAZA 4DMMA 5ALVA 4IZHA 1COWA 4E1VA 5KVQA 3LWZA 3WXMA 4DDWA 3I72A 1SELA 3MT9A 4C0HA 4WY8A 1IOLA 1B0PA 4JOBA 2QX9A 4IPTA 4P31A 3BM5A 1IWBB 1KSFX 1HYQA 1FLAA 3OEEA 2W6ID 1DWOA 1P5ZB 1ORIA 2OG1A 2I65A 2WF5A 3IDFA 3PB3A 4G0MA 3DV0B 4ER5A 2NXWA 1T0PA 4WNIA 5NULA 3ZHRA 2HGSA 2HMYB 5HJ7A 1Q0ZA 3FWPA 2YWJA 3LCJA 1XMOB 2J30A 3Q9NA 4F7WA 3BQMB 4X41A 4DLRA 2RHOA 2QJTA 3AH8A 4EW6A 1RRPA 4R0MA 5EXPA 4O4JA 3ZJVA 4IYJA 3IQEA 1GUDA 2H5IA 1HH4A 2M32A 1ZR2A 1FK8A 4TTAA 1GGEA 1HE3A 1RHKA 1XRPA 2BR3A 5D5PA 1NFFA 2BLLA 2BI8A 2V45A 1ISGA 3MUFA 5CLQA 2XQVA 2Q7OE 5KQSA 1VMDA 3DEFA 1YE3A 2BFDA 4LOIA 4PS0A 5BOSB 4DQLA 1VPTA 2VYCA 1S02A 3MJRA 1Y1PA 2I3DA 1G9XA 4B4WA 2A88A 1BU8A 1MC1A 2FW1A 4MR9B 1MC8A 3ND6A 4ZGBA 1GAJA 2BONA 2QTHA 2B99A 3OTWA 1X13A 2OBLA 1SMKA 3SEFA 2WF7A 2JFQA 3FRHA 3ODPA 4J0JA 1GAXA 2YWGA 5JZBA 4I99A 2GN4A 1J7JA 3ON5A 5AQEA 3TSAA 3NTXA 3ZCSA 4A6EA 2PBZA 1JPNA 5J2TB 1Y5MA 1S3IA 4EB8A 3FF4A 1EVLA 1W1IA 4XJSA 4UBKA 3IV6A 1LX7A 3OPYA 4LVUA 3CEJA 3U4HA 3WB2A 3L0PA 3QMPA 3S2UA 4CM9D 4PG4A 3UHFA 4HXGA 3D8HA 4NZZA 5BQPA 1RNLA 3UGKA 2L82A 1N2ZA 3F7NA 1C5KA 3PZRA 5ALEA 4Z51A 2R65A 3A3KA 4MW6A 5HM6A 3PCRB 4S3MA 4EHDA 3LQ4A 1E59A 4TL9A 4J4TA 4R8LA 4CGYA 3FTPA 3JQ9A 3GN2A 4OOFA 1RPZA 5J2TF 1OR8A 1UPXA 2G40A 2ACWA 3FOAA 5HMLA 3WL5A 4Y6OA 1CQIB 4WLVA 1T4DA 3CCFA 3I04M 4HNHA 2BFOA 1D2MA 2YYZA 3CPEA 5CBPA 5FOQA 4CV3A 1QF6A 1V41E 5LYJB 2OB1A 2C92A 4AKEA 1IJBA 3O8QA 5C8XA 4CF7A 4IY1A 1HTBA 2R1TB 3GFVA 4URHA 3V4ZA 1Z6PA 3PUXA 4RSHA 4L0DA 3HO1A 2Q9CA 5LUAA 2SKCA 1RAEA 4GIBA 3R40A 5B36A 4I55A 4YACA 2RHJA 1IPEA 4MITA 3C4JA 4RORA 2FCAA 3W9YA 2ZWOA 1OV6A 3ZQ4A 3H4VA 4RM2A 1IN7A 1HRDA 3ZCTA 1A1SA 5LZ7A 3GLFB 5DWVA 1X7HA 2C94A 3RAFC 4JUDX 1UMBB 3D31A 3GUVA 5C5DA 2QX4A 5E8RA 3COVA 4M49A 4NENB 1MO6A 3NUZA 4PBRA 4LSGA 4ROSA 5LYJF 1SD2A 2HA2A 2R7NA 4LHYA 2J9YB 3FZNA 3OAAD 2LP4Y 4RCYA 1M1XB 2ABWA 2IZ1A 3DR5A 3B70A 3PR1A 4JLKA 1GGVA 4MWTA 3QLUC 2C8KA 1T8YA 4DCNA 5JLAA 1VHTA 1IMJA 2C1EA 3I1JA 4LC1A 1JDJA 3DWIA 4H35A 3RUPA 1L2TA 4L5AA 2QQFA 4RE6A 4YJFB 4AK9A 1DRJA 1P7YA 3MUOA 2JFUA 3IXLA 3QKUA 4MVWA 3DVLA 3FTQA 2HL6A 4FGUA 4CEHB 5L3ZA 2HYDA 3LUDA 4GR4A 2PXXA 4LI3X 1EX1A 2OAQ1 2Z57A 3OT1B 4JMLA 1KERA 2AFVA 3CKMA 4XD2A 3RANA 1BE8A 4MKRA 5EZSA 3L7YA 5JJ5A 2HY7A 3O03A 1FB5A 2DKOA 1NVGA 5BWMA 2OXEA 2XDWA 3D6MA 3CGGA 4OLHA 1OY1A 4QEDA 3A1UA 4PZZA 5KREA 2H3EA 4R54A 1B00A 3NM5A 1NV9A 2CMHA 1R9GA 3JZDA 1S3SA 3DCIA 3AKDA 2VK1A 1NXQA 4NMHA 5ES4B 3IKTA 1O77A 1F0NA 3QKRB 5AHRA 2Y0PA 5K1ZA 1L7EA 3LUGA 3PGMA 4L8FA 3WLJA 2BJVA 1NJ5A 1PTJC 5B64A 4ZYWA 3KDPA 2C0QA 4JLPA 3V2UA 5A03A 2H00A 1VPWA 1IJFA 4GX2A 2OQRA 4F04A 3DF7A 1KJ9A 1EP2B 3IUNA 3PGVA 3QF4B 1LDEA 1Z08A 1KE2A 4OBEA 1M5UA 5BQFA 3QENA 4DRXA 2ZIFA 3WRYA 5MN5A 4HYQA 1JDBB 3SX2A 3ZDEA 4CG0A 3UH1A 2R00C 4RGVA 4I46A 2VBFA 1UOQA 1N2BA 2J9FA 2VXOA 5B2FA 4F9FA 1P44A 1R37A 4NABA 4PCLA 3KB6A 3TCXB 4ZREA 1P9NA 2F4NA 2YVQA 5KPJA 3T1TA 1KJYA 1PQPA 1YU9A 2XKAA 3TFWA 1Q3TA 1DOAA 1L4EA 2BELA 3F47A 2G0TA 3KR1A 4TS4A 3VAZA 5AOBA 1TVCA 5JOQA 4OGGA 1Y4SA 2WUFA 3L0ZA 1C7IA 2IYVA 5G53C 4R2LA 1OBVA 1N7JA 1HDXA 1DKRA 3HUTA 1PD0A 5MGNA 2FRVA 3M9LA 4MKHA 1J9EA 2BJHA 2XMSA 5BP7A 3A9SA 1GRVA 2JIDA 3N2KA 1GZ5A 4MV5A 1CZRA 4FKBA 2Y1GA 4I4NA 5EHIA 5LC1A 3PVSA 3SJCA 1G0OA 5FUWA 3EIXA 2XB8A 2CHEA 3OQ1A 4UTVA 2O0KA 2Q3MA 2Q21A 3PEFA 4NMMA 4ENSA 4TXHA 3TFQA 4B40A 1AZLA 1N2CA 2FEXA 5IKEA 4PPFA 3RUHA 2GZ1A 1VL1A 3SE0A 4TMXA 5LD2C 1YJAA 1P4GA 1QVRA 1LNSA 4PWYA 3F3MA 4OHCA 1LBIA 4EG0A 1JEYB 2BEWA 3H9EO 2TMDA 3IOCA 4W7HA 5AKXA 3KM0A 2C3PA 2WYVA 2G88A 2HZ7A 2PFGA 3PFCA 3PKIA 5GMOA 2V4ZA 3SHWA 4BUZA 1MRNA 2Q7DA 3PIDA 4Q7QA 5LXTB 2XZLA 1A8PA 1ZI6A 1JB1A 3QFRA 4OQXA 4BNKA 3HUFA 1O7JA 4TSKA 5BVHA 1M5TA 1RABA 1RP7A 1MEEA 2V59A 3TSCA 3FCCA 2YY7A 3RKUA 1R4MB 2GBCA 4CTJA 1CPYA 1SXJE 1N9ZA 5CLIA 3B3QA 4WLEA 3V48A 5JD5A 5DHAA 1CS4C 1GV0A 2EDCA 1L7OA 3BHMA 4V1CA 4IG9A 4ZPJA 4X94A 1XTIA 3EZ6A 2Q46A 2J3LA 4QGGA 1GA1A 2RH9B 5FUVA 4WXMA 3AESA 1YQTA 3CSDA 2EX4A 5LXTF 2IZ6A 4D9BA 4R8RA 3REOA 2IU6A 4OFBA 1ZHFA 1PJZA 3DLPX 1XZIA 2JIRA 3W3AA 4AN1A 1QPGA 2YWXA 2ZIXB 4NDNE 5AYVA 3F3KA 3AW8A 2X0FA 4W9MC 4KGDA 3ZVKA 3MTBA 3BMOA 2RCYA 3BORA 1QNLA 1J0BA 4PTYA 3ZHTA 2E5LB 1XKQA 1C8VB 1ZCZA 5FOVA 2ODWA 2Z5LA 4MJLA 1N3BA 1GXSB 2HRZA 3U3OA 1FUIA 3X2FA 2PGJA 3ND5A 1JEDA 1XZLA 4AMVA 4K3UA 2W6JD 1T0JB 2I1VB 3FTCA 1Z4PX 4JVSB 5DW0A 5C0OE 3RWBA 4RKWA 4XA8A 4YRGA 1PQWA 2NU8B 1CR1A 1U9CA 1FFWA 3ND7A 1AA6A 3O3MB 1KDYA 4QPZA 5GINE 2XMPA 3AVPA 2YJ5A 3VNAA 1NMZA 1G20A 1NTRA 3ONEA 3SX4A 3W2FA 1LWOA 1A7UA 1IK4A 1YJ5A 5KTKA 1E1CB 1V5FA 1WP9A 1CUWA 4EGCB 5J4LA 4XIGS 1OGYA 4TWIA 1V26A 3A11A 5JCPA 1JR2A 1OVGA 3V8QA 3HFRA 4P1ZA 5TARA 3L3BA 3WK6A 3Q8LA 2ZJ8A 1WB9A 2PUFA 1X2BA 2O50A 2VYVA 4X8HA 1Q7BA 1SPXA 1NFQA 1N0UA 1ABFA 2NTEA 2P30A 1A82A 3LLUA 1F3LA 2Y76A 5BVGB 3WSTA 2NUBA 4ZKDA 3CZ9A 1SQ0A 1XZNA 1RAIA 2ZREA 1WF3A 4HATA 1RKQA 2B21A 1ODLA 2C4MA 1QUEA 2HOQA 2P9ZA 2W58A 3GZTB 1COZA 3NAGA 3K8ZA 4ZODA 3NTVA 2Z5FA 4RW0A 1JIIA 2H4ZA 3PPYA 2ATEA 1JXOA 4DSNA 2A5YB 4OUDB 1FQWA 2XQKA 1TU3A 4E21A 1L3IA 5K3EA 2P79A 1NUHA 1FMCA 1DX4A 1I5RA 4TN5A 3LC0A 3HBNA 1EFPA 2YWHA 2II6A 4MWBA 4UM5A 3GLQA 5HR5A 3BE6A 3R7NA 1S9DA 1U8AA 3UT0A 4PYRA 3UJ8A 3ZS8A 3E8MA 1EWYA 2PS0A 1T8RA 4ZZ3A 821PA 2GQ0A 3B89A 5ALUA 1O95C 2Q5JA 3IEIA 3H99A 4LEIA 4U0KA 5FI0B 4L5YA 2QR5A 5FADA 3TSYA 1D7OA 2Q0SA 3P9CA 4CDNA 3MWDA 5KOHB 3IJPA 2A9RA 3UXMA 1JQ5A 3D1VA 4GWKA 3A1CA 1CUGA 3CR7A 3D7MA 4RDHA 3LVFO 1PDWA 2Z98A 4BMCA 2JCGA 4RZSA 3CRQA 4US0R 3DJFA 3OX1A 3R3WA 5IP5A 1G7SA 1KHTA 1Z0KA 1XTRA 4WADA 5BYJA 3WGOA 4DA0A 2EQ5A 1RYFA 2JIZA 3GJXC 1LPBB 2DU8A 2IELA 4RPLA 4BVKA 1YK1A 3CNNA 3D4PA 3THSA 3RS2A 2B7BA 4ZJUA 3WA7A 5COAA 3STUA 3TG8A 2D4AA 1B41A 3DB2A 1SVUA 2BM0A 1GKIA 1Q0HA 2COKA 1F06A 1AKWA 3GJ7A 4HLDA 3LQ1A 3UQZA 3WR5A 2WK1A 4BMVA 1GWNA 3FDIA 4WK2B 3WGZA 5C1PA 3D8SA 5CFRA 3OE4A 4BNWA 1X19A 2NXEA 3NWJA 4IDHA 3GV0A 1IIRA 2APJA 3K0BA 4PANA 4YRRA 3W9BA 3D3KA 1JQBA 1USGA 3CQ9A 1WMEA 2OHHA 5I01A 5A3VA 2B69A 4BNDB 2X19A 4W5JA 2H0QA 3OIUA 1JAXA 1T36A 2YYAA 3LF1A 4GXTA 4W6ZA 4CBVA 4UAUA 5AK5A 2HKIA 1JDVA 1I51A 1DBSA 1P9WA 2YIVX 2FLVA 3EFHA 3FAKA 1YZVA 4PLPA 4XDYA 2PUDA 3I83A 1Z68A 2PS1A 1U2DC 1G2OA 2HJHA 2QGFA 1I14A 2CCGA 2WHYA 3HDQA 3KU1A 3LQKA 3O4JA 3Q98A 3TE6A 1OU4A 1YKGA 3P2EA 1U3VA 2V0NA 4JVOA 3UJBA 5HXAA 1XALA 1QLJA 3ROKA 2RKOA 4FZVA 4O1MA 3ZD7A 4JYPA 1KZGB 1LVGA 4HAXA 3EZNA 4MNTA 4RWEA 5CT8A 5K0LA 4HQLA 4YYZA 2Y3IA 3PVCA 3FMIA 3L77A 4Q66C 4B6EA 3HSKA 3ADPA 4KRFA 2R1ZA 3WE7A 1ODIA 3EZFA 5E4YA 4TS3A 4ZV4A 5KTYA 1U8ZA 2IX9A 2I4RA 5ERGB 4EIWA 2W8ZA 4H59A 4M99A 1GG2A 1UJ5A 4HTAA 3TBKA 5B4VA 2DQSA 4JK3A 3PRYA 3DDSA 2FMFA 4WN9B 4Y1GA 2VHEA 3AHGA 1BXGA 4KC0A 4KVGA 2A30A 2PCLA 3G49A 2BFFA 5DV9A 2OZLB 3I6QA 2J0UA 3HB0A 3CCCA 3O1JC 2HLDD 3OUTA 4XWOA 2PUEA 1LQ2A 5CDFE 4D6XA 1JHYA 3RFFA 4XWTA 2OGZA 4MUYA 4ZAWA 1GG8A 2YV3A 1FZTA 1GILA 2W8BA 1C50A 4FONA 1EVJA 5F3WB 3MINA 4P58A 1FC0A 2Q1XA 2VUTA 2TMYA 3CO5A 4EFKA 3U7GA 1AKRA 5KTMA 4X92A 3BHIA 2J7PA 4L7VA 4QASA 3DWEX 1VI5A 4XCQA 2C07A 3JD0A 4YNBA 1ULZA 4PZ9A 3VUEA 1ZAYA 5CMLA 4JBIA 4OHFA 5HILA 3DAFA 1RXWA 3PUJA 2GN8A 2IXEA 1XCJA 4IDDA 4R05A 5FEMA 3ZLUA 3CT6A 4RTSA 4ZWNA 2QZ4A 1B2RA 1E2JA 1G1AA 3DLIA 1U1DA 3EDQA 4FPXA 2R1VB 1PK9A 3K9GA 4WJZA 5AKYA 3KTDA 3MUEA 4RY9A 1OLOA 2BF4A 1CZNA 3L7MA 1H1LA 5DNWA 2PL3A 4W6QA 5EESA 3QK7A 1IYZA 3K1JA 3BK2A 4XAQA 3U3ZA 3NIGB 3IVAA 4EATA 5G0VA 3RJ9A 2QENA 1BYUA 1L5MA 1C4OA 2I3BA 2A0XA 3LLVA 4YCDA 2GF0A 5PGMA 3QWBA 2NXJA 2IGTA 3U9TA 2M9MA 1S96A 1QGED 5DXFA 1LF5A 5KJFA 2GYYA 2X1VA 4J8PA 1QHYA 3BB3A 1MH9A 2FA9A 3PENA 3ZLVA 3DQQA 4EYOA 2FMXA 3WGJA 1NYQA 3SD7A 3BF8A 4ABYA 4IX1A 1BCRA 1BYIA 3JQBC 4AF7A 4PO8A 2O6LA 1JN0A 3EH2A 4N65A 1LJLA 3C4VA 3QV1A 1OZFA 5FBLB 4IWYA 5BQ5A 4BQRA 1N9GB 2OEPA 5AI4A 5EC8A 3TDNA 5ALNA 3ROMA 2BDUA 4DABA 2ZRLA 1GPBA 2D2XA 4KXXA 2RE8A 4LG1A 5KNBD 3GG9A 2QN9A 3C4QA 2C5AA 1FTNA 4FYXA 4ETWA 3A6PC 4BXOB 3NDJA 2BKXA 4TRRA 1KMNA 3CLUC 3NW9A 3GF4A 4BO8A 2D0DA 2WSIA 1YFZA 4EG1A 4ZZIA 1ZLYA 3SYLA 1CJBA 2FG7C 2FRDC 2Z6UA 2Q2NA 4IDAA 1PSDA 5JR3A 4Z3OA 2HK7A 4B6FA 4CMAA 1KA9H 1K7SN 2XE6A 2CHQA 5ICMA 1BFUA 1JG6A 1FIUA 4XDZA 5JU6A 1BC5A 3DO6A 3COYA 2EKDA 2D2FA 2HGZA 3VR6A 4A1OA 1U2PA 1W4RA 3L0BA 5FBZA 2P69A 1ZVMA 2EW8A 3M82A 1QH8A 1CUIA 1S89A 4FSXA 1ECLA 4UHFA 5B1SA 3VPAA 4BVJA 3DZKA 5C7LO 3RREA 1FDOA 4LHEA 4CQLA 1QLHA 4TLLB 1DV2A 2VT7A 3E2MA 1QR6A 4LVCA 3RSQA 4GI5A 2H7XA 2BZ1A 2QORA 2WBLC 3BYZA 4HAYA 4R0NA 5CU7A 3SVZA 4DM7A 4BQSA 1E9BA 1M1NB 4M8IA 2C7OA 2Z2YA 4YJ3A 2O52A 1JB9A 3M0EA 4IOLA 5EYPA 5AW5A 1TTHA 1TUGA 4EMBA 1DGQA 3FROA 2YWEA 4KVZA 1C7JA 4PINA 1SCBA 2DKNA 1R4NA 2A86A 2JHGA 3BTSA 6AT1A 1UBHS 1XRQA 1CY7A 1GAEO 2CWWA 3NBZC 4B4UA 3GAMA 5A6SB 4MS4B 3ZVMA 1P2UA 4PU0A 1W5AA 1SXJD 2ZWMA 3S5UA 1G8PA 4L8VA 1NDHA 2QUAA 1IN4A 2XMZA 1EUDA 3DLAA 1AKQA 3GPCA 3NHBA 4JNKA 4O2LA 1BU5A 1CG6A 1O94C 3DWGA 3RS3A 4CMEA 1QRSA 2DWUA 1WMFA 2DBZA 2A0WA 2XODA 2WTEA 3DYVA 1EK6A 4M0UA 4P33A 5CM9C 4FZJA 2JHCA 4JBNA 1K63A 4HNUA 2P67A 4JASB 2KQUA 3L4KA 4F45A 1QKIA 5JHGB 1IHPA 2GF2A 3ZD9A 4N82A 4AN0A 3MTQA 3QYAA 1N4DA 1ZGJA 4PO3X 3DNFA 1VBNA 1F6DA 3NORA 3VH4A 1E3JA 1FYXA 3TINA 2QR3A 5LZ5A 3QSYA 4CRWB 5F78A 3SR0A 1S1CA 4TMTA 1AVTA 1NVEA 1CZHA 4LF4B 3T41A 3KLPX 1JDZA 5DHUA 2OYRA 3TECE 3V3KA 5M34A 1P4SA 4RETA 2PRSA 3U44B 4OF4A 1SUPA 2VPYA 1XRMA 2AR7A 2NLOA 1SHJA 2ETVA 2CCKA 5KYUA 2JLRA 3BBPA 3SZMA 4UULA 3VO9A 3KFLA 3K7EA 1ZMBA 3JPYA 1KL7A 1DXYA 1UF9A 1HE1C 2W90A 1JIXA 2YWRA 1WP4A 1CUHA 3F2VA 3F9CA 4HLCA 2QRQA 4P3NA 1OT3A 4GHWA 3DHYA 4M53A 3PC7A 3IE1A 1P6QA 3UV6A 4YP9A 1OFGA 3BGOS 3WK8A 5ITZB 1TM3E 1G8AA 4RY2A 5A1TA 2DHEA 1GFIA 2XGMA 3KZMA 4YRTA 2FPMA 3WK9A 4Y2QA 4IIDA 2GT1A 1JW9B 4EHFA 4G37A 3NCHA 1UBFA 1EHYA 1PFGA 2VRWA 5E95A 8ATCA 2D3TA 3I0NA 4QPDA 4X85A 2EIHA 3VR2A 4O8CA 1ZEMA 5JNWA 2ZIUB 1YZYA 3BGIA 3EF0A 1CRZA 1DBIA 1CIJA 1GNLA 4N49A 1HTTA 1E2DA 2JFVA 2WJJA 1G18A 2XUZA 5TGTA 3A1WA 2XYHA 4MLDA 3LZ6A 1W75A 4DTIA 3WV4A 4G8DA 3X0DA 1UWLA 4IDNA 3TZKA 2G76A 1SHKA 1GTG1 2Z08A 3LP6A 2AFHB 1RE0A 3EEIA 3QEMA 2EATA 1U7TA 4F72A 5KOJA 1Z4OA 3TW6A 3GJQA 2BE9A 2G1JA 1F8FA 2I4OA 3VYSB 1U0HC 2YJGA 1PUJA 1NVAA 4WESB 5BV2P 4RKYA 2IP1A 1QFSA 2RGNA 3N2LA 1O6GA 5I7VA 4D9HA 1KPIA 4KV7A 4GZLA 5EAIA 2CCJA 2FR8C 2C4KA 2I78A 2IUFA 2JBHA 1U4SA 2FW7A 3AX6A 4LMPA 4NOMA 3IQZA 5JXWA 2NG1A 4NNOA 3GLVA 3ZWVA 3TR6A 1RYMA 4RA9B 1OFUX 3WB9A 4G41A 1JPJA 3K5IA 2ZITA 4JQSA 4LDQA 2X22A 1MU0A 1ZY2A 1RI3A 5IKMA 5HP4A 4YRMA 3D7NA 3T0GA 3ZI0A 2RC5A 4MQMA 4C1NA 1JF8A 1UBJS 3G9ZA 3GW8A 4M1KA 4MPTA 4UPVA 1V11A 3HADA 2XRFA 2X0IA 2HMUA 5ARDA 2Q29A 2I3GA 2RH4A 3KVVA 5A4KA 4HI0E 4NE2A 4IV8A 4RZIA 5FYQA 3R09A 1LX6A 1QFXA 3SJ7A 2HXYA 2OAP1 1V37A 2ZJZA 3LCCA 3LUBA 2AOUA 4LDJA 1OB2A 3GELA 3I34X 2O3SA 2Y2UA 2SHKA 3LBNA 4RTQA 5HMMA 2PWPA 3PKZA 2X42A 1Y6JA 4XYLA 1O6CA 3HBFA 3O90A 3QVLA 4R1SA 1D07A 3MBOA 3OE1A 4OAOA 4S0ZA 4WKOA 2VSNA 3OMXA 1XZEA 4IXWA 1RKBA 4U2CA 1N1DA 4LNAA 4Z8YA 2IITA 3VPFA 4TT3D 3D6HA 1NVTA 2IQIA 4ZAVA 1JR3A 2XUKA 3AEXA 1L7NA 2JAXA 3ENWA 3ZUGA 1XMPA 5KNDH 3DDNA 3NHJA 4LYEA 4LJ5A 3CVXA 1A8QA 3NHAA 3KTFA 4Q4HB 1SQ6A 4DV2B 3M1YA 1XRLA 1KXJA 3WGLA 3V34A 3ZY4A 4U6SA 2WG1A 1PR5A 4FVTA 2Z0MA 4CKZA 4II2A 4CUJA 1O95D 2Y68A 1V9LA 4F1WA 4MHTA 1AY0A 2NVOA 3KPJA 2GN2A 3I1IA 4JXJA 4AIIA 1PG5A 5ECYA 3REQB 5FPKA 2X2EA 3ETLA 3R3SA 2ZYSA 4V0MA 3WNCA 2KW5A 3LOQA 4KTTE 1NGSA 5G4LA 4R68A 4JJ4A 1B76A 2AT1A 2EGUA 4UTNA 2NTJA 2YDYA 3AZPA 4G5RA 3PR2B 1T9BA 4FFRA 1W35A 3AKEA 4J3FA 4LV6A 1GT91 5DI9A 4GPZA 4RK4A 3K9WA 3ZWNA 3PT9A 2FSVA 1NVUQ 4HJXA 5DISB 4BFWA 3QRWA 1P29A 1E2IA 4L78A 4G4JA 1P0CA 1LVUA 4M7WA 4MEJA 2VC2B 4RL4A 1E5XA 3TX6A 3EVBA 2ZTVA 3DYBA 1FSSA 3HKDA 3OY7A 1ZSYA 4HQRA 2C3MA 3DXXA 4DRYA 2B94A 3RVPA 3ET4A 1VDZA 4DV3B 2ODTX 2V7QD 2WIDA 3MWJA 5AKGA 1EHCA 4P7GA 1E77A 4L02A 2QROA 1I36A 4KPUB 2FF5A 1TQ2A 4K0KB 1R66A 3HZOA 4U7FA 2FSUA 3M6XA 4LXGA 5DGDA 1OI2A 1F2UA 1RFLA 1J8YF 2IKSA 3NASA 3DMYA 2PRJA 3OLYA 2DTEA 3MXTA 3SEQA 4D8YA 2AD5A 4ZHQA 5HUJA 1KBOA 4KQ1A 2EARA 3HYRA 2DLNA 3DTVA 4E7PA 3AKYA 4XUEA 2QUJA 2RI0A 4M0PA 2ZIEA 3IAS1 5K09A 1JDUA 4JC4A 1WB5A 1MMFB 1V3TA 1QZTA 2A9PA 2I80A 3E22B 3UJ3X 1Z7WA 3W8EA 2IIBA 2OO5C 1UANA 1OXTA 2C4HA 2IPMA 2O1SA 2H4HA 1HDOA 4Y2PA 1S7GA 3ZV5A 3QLVA 4GPAA 1KJJA 4NOJA 1ODCA 1Y5LA 4B6QA 1QR2A 4WLNA 1NUTA 2W2MA 2QZJA 3WFJA 2YUTA 2R8BA 1E18A 1LSOA 5BSHA 2WAXA 2IF2A 1AU9A 2I55A 4DCGA 3J7AC 3V2IA 2DUWA 1BD3A 2QRVA 4ARAA 4DKXA 2VDJA 1EP9A 5F1KA 3KYBA 2ZR0A 1X70A 2VHVA 3N3BC 1YTUA 5B1DA 4J6FA 4L1KA 2I6GA 5IN5A 5CIYA 1R0SA 2IEYA 2RFLA 3SJUA 4DR5B 3PVZA 1Q7GA 2GEBA 2X3FA 3G17A 4GNKA 4I2VA 2XW6A 3C5HA 4HGPA 4X8LA 1W4AA 1AB5A 3KUXA 1A2BA 2HXSA 3T3GA 1EJBA 4TOIA 3U81A 3GY0A 3QHPA 1MDFA 3AUTA 5DBGA 3SFVA 1M7HA 2X2PA 3H83A 3R3YA 1FVFA 1T5TA 2RH8A 3IBTA 3ZK8A 4EHLA 3I9V6 5L45A 1F8GA 3RV4A 4D9MA 5JBQA 2VA9A 4B32A 2NO7A 2VOJA 1NBWB 3SYRA 2R0QC 2Q4BA 1NNUA 4TM7A 1EFRA 4HVLA 2BSAA 2XZTA 5JS1A 4AT1A 4F5ZA 3QVJA 1RYHA 2GLUA 1WUIS 1H6AA 1UFRA 5AESA 1E2KA 1UXKA 1EVEA 1NRWA 2QSYA 3ITDA 1LBQA 3OO0A 5DNEA 4DVGA 2QL6A 4DIBA 3K9NA 1R5BA 2HHCA 2QN7A 1S2MA 4I6EA 4K9SA 4NZ9A 5AD1A 4YY3B 4E07A 4KIFA 5AKKA 1PJ4A 1MDBA 4REQB 1AA9A 5T41A 4F60A 2Q1UA 4BO4A 3U1VA 4OXIA 4TMKA 3DE2X 3O92A 1GRCA 1IWOA 3DC2A 4TRNA 2IP2A 2YBEA 5C2JB 3AUKA 5EIFA 2JVKA 2O7SA 2YKGA 1NVMB 1OA0A 1P4JA 2CXNA 4A16A 2NYVA 1P1RA 4HDKA 5CURA 3V1UA 1B93A 1IEXA 4KX5A 4L0QA 1CDEA 4G07A 1OLUB 3ADBA 2ZBFA 5DTIA 2RGAA 4LXYA 3ROQA 3OCVA 2ZZMA 1DEKA 2OUIA 3PEVA 4PO9A 3WIVA 4G26A 1RQGA 3ABQB 1W0KA 3IVMA 4RGYA 3RSLA 2O7NA 2P1ZA 3A1VA 1VMIA 1VZ3A 2CVZA 2JRCA 4NYJR 4PYNA 1MO5A 4I5IA 5LQSA 2P3OA 3AJDA 4GL2A 2VTKA 4B3BA 5K0BA 4IJ6A 3K92A 4YRFA 2V7TA 5A4JA 2BMVA 2VI5A 4C0BA 1ML3A 1XTTA 3MCWA 3CLUD 1R0KA 2H52A 2K4MA 2P7HA 3IILA 3L7OA 4D42A 3ROTA 3BCSA 4JY7A 5BQ3A 3VV2A 3VTZA 2WEKA 4KWIA 1I2MA 1JVSA 2K2WA 2O2HA 3GK3A 2J3MA 4PZAA 5DP2A 2I7CA 5E6RB 5EJGA 1EJ0A 2F4VB 2ZE5A 1BCSA 5IVIA 1M33A 4F4IA 4KOAA 2QD1A 2VK4A 1QGDA 2XVZA 1WXQA 1L5KA 4DSTA 4GKBA 3AG6A 1T8UA 4KBFA 4Z3DA 1NW8A 2VYND 3U7FB 2D7DA 1HDIA 4MYSA 1CJUC 1KFJB 2HLNA 4EJ0A 2VFAA 1A4UA 3TDKA 3ZU6A 2Z8YA 5LIRA 1MGOA 1BMFD 2IUEA 2UVQA 3RHTA 4I3HA 5BW5A 1NNSA 5G4KB 1KAMA 5MDHA 4JLUA 1E2BA 1LA2A 5DXAA 1SKQA 1E2QA 4BO0A 1XSEA 1OLSB 1AK1A 2MYPA 3NOXA 4KSYA 1FPMA 4CQJA 1R0CA 3NTQA 4BFZA 5A2GA 1RM3A 1T2NA 1X7XB 2PSFA 4D79A 4Q3EA 2CFSA 1UIRA 3IB3A 1TAUA 3SQDA 2ERYA 4P3XA 5SZKB 4EF4A 1A4XA 1NQWA 1NURA 1NVBA 4DG9A 3BL5A 5TMDA 2M98A 1FFGA 3ZU2A 5J23A 4M3NA 4GE3A 4AY2A 1M1YA 1LDMA 3OHPA 2Q62A 4I1SA 2GS9A 1MOZA 1KF0A 3DZDA 4AF8A 2OSBA 1WKBA 3K71B 2E37A 3G9UA 1E6MA 1IXSB 1NR7A 1VDMA 2DM6A 3GRKA 3JAKB 4LDPA 4B1FA 4BNYA 3UJNA 1GZ3A 3CS3A 4ZTZB 1QGAA 1V2GA 3ROXA 2HCJB 3UK1A 3QLJA 4GI7A 5I7AA 1O94D 2R68A 1VKNA 2D6FA 3R9XB 1HI9A 5IMSA 1UMKA 3E3MA 4N6GA 3T3HA 1CB0A 3L8EA 4JVLA 7REQA 3O91A 3PHGA 2EXXA 2LNDA 1XJQA 4KIJA 3SZRA 4BNNA 5G0TA 3GJSA 3KLOA 4FFBA 5EJIA 4QOEA 4WY5A 3V55A 4KYUA 4TYQA 2OCDA 9GPBA 5LOVA 3L8GA 5LQRA 1YASA 3O2NA 3B1ZA 5A5FA 3PXGA 3OZBA 2MSDB 2VP9A 2G67A 4PONA 4JWTA 2B4YA 3U6BA 4PX9A 4RTRA 2IPXA 2HSGA 3RIEA 4A8HA 1N5LA 3PT5A 4L28A 4LIPD 3MWGA 5JI2E 3KJXA 1JQEA 1Q95A 1WNTA 2IXAA 3JZFA 4L3WA 1IHOA 4N54A 5DHQA 1SKBA 3KQPA 4R8KA 3A6GA 2OGSA 2V6GA 1A1VA 3RCBA 4AY4A 2O4CA 5KNCH 1V43A 4H7PA 1NAHA 3M4YA 3I01M 4YI3A 1APBA 4B87A 3OKFA 4O63O 3BXPA 3C1TA 1HE5A 1WB4A 3I5UA 3NDIA 4GICA 1WXWA 4LKRA 2CL0X 2PSHA 3ZHOA 2C42A 3IQWA 1UKAA 1ISSA 5EP2A 3IHKA 4BKMA 2G36A 4BECA 1GZHB 4JROA 1KZYC 1B1CA 1D9ZA 2IYAA 4OCZA 4RK7A 5A0FA 2Z1DA 2C9MA 5HKLA 4NFLA 5T6BA 4M0FA 4FJ1A 4OJKA 3RB8A 4YIHA 1B0AA 3OURA 1CZKA 3WQBA 5IDWA 4CLDA 1I6MA 3PEWA 1K4YA 3JQ9C 2IYWA 3T6KA 3HJFA 4QDTA 1PI3A 4UZFA 2C78A 1M1ZA 1XZDA 2JBWA 4JQCA 4EI7A 2VJPA 2ISQA 4HQ0A 2C3YA 2G1KA 2QX6A 4URYR 4B6JA 4CI0B 3KQHA 2IHNA 1GUYA 2ODEA 1KEPA 1NQUA 4O29A 4BUCA 1TYAE 2NUTB 2GKOA 4DADA 1XQ1A 2X77A 2CBXA 4BTLA 1DEHA 1XEXA 1PR1A 3BDAA 5JV5A 3BWEA 3IQGX 1UBOS 5BNTA 2QP4A 4UAGA 16PKA 2KM1A 2OKGA 3E7DA 3OEHD 2W2KB 2B61A 3Q2IA 1CJSA 1QZZA 4DEYA 3A6JA 2OT3B 1SVKA 1C0PA 4I8IA 2DWQA 1QZXA 2QUHA 5AP9A 2GHQA 2RHGB 4TKUA 1KYXA 1NW7A 3ZTTA 4OV6B 2CN1A 4YP7A 3T9BA 2HR1A 3N2EA 5DBHX 1PYGA 1XQWA 2AF3C 3QVWA 1SZPA 3GRUA 1T3HA 7MDHA 4MW2A 1FUEA 1TD1A 3G7SA 5I9SA 3RYTC 2Q5LA 4UBMA 3IDSA 4NU5A 3SIXA 1EEXB 4A8JB 4I4CA 4JX9A 1L5RA 3D6FA 3KQOA 4R01A 4BIMA 2SICE 4G5FA 1YF3A 2IS6A 3GDFA 3PHBE 1JQAA 2WT4A 3N2YA 1Q0PA 4LSMA 4MW4A 4P83A 3R24A 1PV1A 2JFNA 4FR2A 5DGCA 2E82A 1L4KA 4GI2A 5EIHA 1F8YA 1SY7A 2V7EA 5EUCA 4BFVA 4UARA 3JQAA 4JS0A 3FYUB 2OM2A 1ZN8A 3R5TA 2BFCA 4Q18A 1OHHA 5CIWA 1SVIA 4ALLA 3OPXA 4IDQA 3ME5A 5CGQB 3BTUA 5CVEA 5F51A 1L8LA 4L7QA 1YQXA 4Z2AA 2XXAB 1KK1A 1GPUA 2VUUA 1ZRMA 2XAUA 4HF7A 3M5WA 3KOXA 4Y2TA 3TUJC 1XNHA 1FEZA 1FFXB 2I34A 1ZN7A 2W2XA 5AMXA 1SVOA 3X1XA 1EWKA 4ENQA 3PQ7A 3NTLA 4G1UC 1ZVVA 2N42A 3MIZA 4YVFA 4AWBA 4FZRA 2XKKA 3BWMA 4BZWA 1THGA 1DC3A 3JX9A 3KVYA 4R4JA 4XRGA 3UXHA 3LBAA 3D64A 3WIOA 2WJZB 1Z0ZA 2GI4A 2AZ4A 2Y9PB 2TSYB 3G2PA 3MPOA 4EHIA 4C2BA 4W1RA 1ABEA 3D3JA 5LWHA 1XLTA 3WKCA 2ONJA 3OZIA 2IH2A 4PSCA 3DXZA 4ZAGA 5TS3A 3FWZA 3KWMA 4MP8A 4YS6A 6CHYA 5F2NA 3I45A 1QP8A 3EZLA 4H15A 3A6FA 1VGRA 2PANA 2EGHA 5E7JA 5CCBA 1WVGA 2LWIA 4F9TA 1K5GA 4LZPA 4TLCA 5DW3A 2AI2A 3T5GA 1Z5UA 3CEPB 1EXMA 3RBXA 1WY7A 4DV6B 2W2QA 3FIUA 5C8ZA 3MJSA 2O8CB 1KDRA 1V9CA 1O5OA 1QHHA 3M6AA 3OTOB 3MGKA 4Q9IA 1AD2A 1GCAA 1CUVA 2HTFA 3ILVA 1JBKA 4JA0A 3USZA 4JKIA 4LXIA 2PIDA 3WMXA 5JAPA 2GCNA 2Q1YA 1TLLA 2XQFA 3QX8A 1QO7A 4JA2A 4JJFA 4W7SA 1N1GA 2BMEA 5G1OA 4R1LA 3D3WB 3GR6A 3MBIA 1DKQA 5KTPA 1KAQA 1QTRA 5E6UB 3NXKA 4I81A 5FPTA 5GADl 1DUSA 3Q3EA 3BWXA 4LZJA 3U3DA 2QLLA 1EK5A 4OSPA 3WDLA 4COKA 4PYKA 2PBRA 3P2OA 2XCRB 3O95A 2VZ0A 4LXXA 1WHSA 3FCAA 4D9EA 2B8TA 3OA0A 4J2HA 2ILTA 4LNUA 1XEWX 3HVUA 2QGNA 1S2OA 3NWEA 1I4WA 3R0VA 3V7NA 3GHHA 3OE7A 1DTWB 2DQYA 2GERA 3DO8A 3HJTA 5IJXA 5A4IS 5IDQA 3C3JA 2ZRBA 2CK3D 4EW2A 3ANYB 4TVBA 2E89A 5EZ5A 1R4ZA 3U4IA 3QELB 4FWIB 4BMPB 4N3CA 3W1EA 3W2EA 5F35A 1Z6TA 3U26A 3BULA 3U3KA 1RVDA 3HRKA 1J0DA 2REOA 5F3DA 3IIIA 2PXCA 1KJQA 4MWCA 3KQUA 4DXDA 4DR6B 3RVMA 2ZI6A 3GGJA 3TWOA 4Q9KA 3SYTA 2F1RA 1JHDA 3OF5A 4WY2A 4HWGA 4YMVA 5J1TB 2ZVJA 5AHKA 5ER9A 2ZVPX 4NJMA 3UK0A 1UBMS 5I47A 4WKPA 2O6HA 1K98A 5LM3A 3NIBA 3RAGA 3OIGA 2H7YA 1NI4A 3E61A 3TVDA 5B7QA 3OQMA 1EFTA 4J0HA 4XGKA 4P5EA 4O4LA 5E3JA 1AS0A 3C6QA 3KRTA 1ZM2A 3ZZNA 1RZRD 5IJWA 5I7FA 4PGMA 3IKMB 4G01B 4E5KA 2DYKA 5BYAA 2OENG 2NV2B 3ZNNA 3TO5A 2IZOA 2IDZA 4Q15A 4WA7A 1WUTA 3OPQA 3SHQA 5JLJA 1DEXA 2GHTA 1RP1A 4EYGA 3Q9SA 2VH2A 1I2AA 1TA0A 2W0MA 3S68A 4J0KA 4RWZA 1I3MA 5KIAA 3ZLJA 1ZUHA 3FF1A 3HP7A 1STOA 2DSTA 3O75A 2JLUA 5JECA 1RRMA 1RM4A 3R7LA 4BJ6A 2MINA 2O8NA 2ZS7A 1E1RD 5IN4A 1TB4A 3CNOA 2FPXA 1N2CE 1PN3A 3ELYA 4AQ7A 4Z53A 4GU5A 2IH4A 1FNSA 2I4TA 1SQSA 3TXXA 2LPMA 4BE9A 4TUYA 4RGQA 3WQSB 1DQYA 3HB7A 4YJHA 1FXWF 2H1FA 3F1KA 1TGVA 2VS1A 3C6ZA 3R5FA 2Q49A 3CE9A 4LZAA 5EWJA 3HV2A 1VSBA 3NETA 1BXZA 2ZBDA 3AUAA 1ADYA 1UWVA 2OBFA 3KD2A 3NT2A 1E5QA 1QG0A 3LQFA 3NHUA 3O5AA 4GE0A 4I6GA 4XYGA 3K2BA 2WQZA 3QG5A 2B9EA 4LZWA 4EGAA 2JASA 5FFFA 1GVNB 1KEWA 1UJBA 1VSVA 2JKYA 2PS9A 4GLBA 4MWDA 4Q01A 1JXMA 3QTLA 1H3FA 2JA2A 3QVGA 1ZZGA 3L1VA 4RVOA 1KZHA 3W5IA 3ZCPA 1Y98A 2G7ZA 1TIBA 4BEVA 4BQQA 4JC8A 3PLAE 4JV5B 1YBMA 5AOCA 2R44A 1DBQA 3EXHA 3GGCA 4HSEA 3ZWYA 2WUDA 1QDUA 3R4CA 1VKJA 4JL8A 3JQCA 3N1UA 4RZ3A 2XAAA 2VPPA 3L7BA 3PHIA 3A4TA 1ZGAA 3VKWA 1WG8A 1YMVA 4A92A 4NH4A 4K2AA 1V8BA 3NMUF 3PXDA 1VKHA 3I4FA 2LV8A 1C4KA 2BC9A 3FPAA 1YHYA 3FPEA 3R77A 4IW3B 4MYDA 5TQ0B 4BO7A 5K6RA 1YJCA 5YASA 1XF1A 1W5BA 4JLJA 4Q19A 3D4OA 4XVCA 2IHKA 1PGOA 4JQYA 1WV0A 3OJOA 5B4UA 4O59O 1A5BB 4IQGA 4UCWA 3PNOA 3L7AA 4YCSA 1DZ3A 4JR2A 2AZXA 3ZPXA 4K9RA 2RBEA 4Z1MA 1QHXA 3F96A 4M86A 3P2MA 1PZXA 3TIIA 5CDSA 2Z56A 3NHMA 4KU4A 1FDWA 3O31A 2HRDA 1Y8RB 2D74A 3OTHA 4GAEA 5COBA 4XJVA 3WFIA 5I8WA 5IPFA 4QYXA 3ZDCA 1N6KA 2Z9BA 3I42A 4WVLA 1KKLA 5F3RA 1G20E 1TM4E 4CIAA 4DMFA 4IH9A 1G8FA 4E1AA 3QXJA 1LLQA 1HSZA 5AR1A 3RHFA 3EVTA 3S40A 4RD3A 1OH6A 2CLSA 3UF0A 1MPTA 2CUTA 2IYYA 2WIJA 3D3EA 4M1EA 1E6LA 2R6JA 2ONZA 2ZVDA 3Q7IA 1E3QA 1LLDA 3SSOA 3D81A 1RHJA 1WKCA 1CX9B 2ZSFA 1WXGA 1BJTA 4UTZA 3W2GA 1YHNA 1Y1KE 4IO0A 2VDWB 2JC3A 1V6SA 3C3XA 4OX9Y 3MN1A 1PZMA 3IYLW 3OEED 3E82A 4ZT7A 3UMVA 2ZAOA 3QKWA 4N0DA 3LW7A 2VTBA 4L6AA 2VPZA 3ZH9B 1RWQA 1YQ9A 1SA0B 3HO8A 4DPKA 4MTLA 3DBHA 2FDXA 4YAEA 1WXXA 3WKDA 4YV0A 4JBYA 1WLYA 1GN9A 4PZDA 1R88A 4Y6LA 1V25A 2B92A 2K7ZA 1YI0A 3HYSA 5E9JA 4U9HS 1FNMA 4K3VA 3R7FA 1TX4B 2VJBA 2CVFA 3NB0A 4X6YA 3I76A 2ONCA 4IJMA 4NBSA 2RK3A 5C9ZA 2OBXA 1KFKB 4MARA 5GGXA 1PT6A 4JKOA 1AS3A 3AR2A 2Q5CA 3R7WB 3ILSA 3IODA 2FEWB 4KQ9A 1M6YA 5CDHA 2JANA 4RLHA 1J97A 2QMHA 3MILA 4M8KA 1J2EA 1V16A 1VIYA 2GEVA 3BWDD 3QPUA 3U0BA 3C6XA 1W96A 1VJ5A 3IPYA 3LDAA 3ELDA 1KFCB 4FDMA 5E3HA 5J43A 1W2GA 1B6TA 3HYNA 4IUBS 1GQYA 2YZNA 5IAOA 1NJ1A 3F5MA 2HW8A 4MHOA 1ID1A 5B1HA 1YVDA 4NCIA 5K0NA 3N86A 1YNSA 2OMKA 3M6LA 2E21A 4FGWA 1Q3KA 4YAUA 2W22A 4HOYA 2B35A 2OD9A 3BIWA 4AZTA 1HY3A 2EIXA 2PG3A 3PNMA 3QW4B 1NVDA 2E4VA 3ICPA 4J0DA 4NNPA 2AKAB 2OYCA 1EFCA 3IEXA 1R6TA 4KQMA 3T5CA 4M38A 5TGZA 1AM4D 3PEEA 3U17A 3UENA 3T5AA 4CJXA 2AOTB 2V54A 1NFRA 1QQTA 3KSMA 4YAFA 3FFAA 4GMHA 4NBNA 3UO8B 2X1MA 2Y9MB 2C99A 3NKLA 4BP8A 5J4HA 1I7QB 1YQQA 3H2SA 1U1FA 8ABPA 5KAPA 4K46A 3ZD6A 2YH2A 4ZXPA 2OV8A 1WXEA 2HDOA 1EAYA 1Z2PX 4MV7A 3ZX5A 2VP2A 3ENZA 2IOFA 2BZ0A 2J6IA 3M2PA 1RJFA 4UC0A 5E9WA 4BL5A 3ZU3A 1JHPA 4ZZ1A 2JBAB 2FFJA 4OHBA 4ZRDA 4JR0A 2A7QA 3O8OA 4V0SA 3B1WA 1D03A 3ECSA 2WRZA 4MWOA 2W48A 3FCYA 3RSGA 3CX6A 2PKEA 3N8IA 2UYGA 1X7ZA 3H6GA 1P9LA 3U49A 3KXIA 3AM4A 1D1QA 4DSAA 3G68A 1FVXA 2ZYHA 4HB3A 2VJYA 2GUWA 4Y9RA 5CK4A 3TRKA 1LQUA 3UV3A 4F92B 2CD9A 1ZVKA 2AFIA 3MJVA 3KDAA 2PBFA 1QANA 3AOEA 3NIWA 1O0BA 2VDNB 4ZCQA 1G17A 3H75A 4FHCA 4D1YA 1P91A 2D1FA 1S4QA 2B2XA 1XA4A 4OBBA 2PD3A 5DLPA 5FBWB 3AUJB 2GUGA 3VU0A 1W7AA 2HBYA 3TZHA 4LHZA 5KCZA 2YJTD 4Y0AA 3U4CA 1QFZA 3DULA 1O57A 2GA8A 3PGA1 4Y67A 5HIMA 5LZ4A 4WDQA 4CM5A 1IRXA 3GUCA 4XB6B 2CV2A 1JJFA 5CGZA 3S5JA 2DTDA 2ZROA 2GEUA 3GAAA 2ZWAA 4IMIB 1L5LA 4MUFA 4PO1A 1O0SA 1ZPDA 4QEKA 4HH1A 1Z2DA 1XMJA 3MRVA 1M34E 3AB8A 3T0IA 1E69A 5FBVB 2ETXA 2ZJ1A 1AH2A 3JAWA 3B51X 3PQFA 2PT9A 4WW0A 1NW6A 3O4GA 5A4FS 2J9GA 3W5BA 1EKXA 4XWKA 5C52B 4KUGA 4UAJA 4DUGA 2FPOA 1RACA 1ORWA 4IIJA 1VHQA 5C8YB 1L6RA 2PKRA 4PPNA 4YUZA 4GGOA 3P9QA 3O4RA 1O87A 1OE0A 5ALRA 2Q5QA 2YHIA 4BN5A 1M83A 3QWFA 2JL1A 2FOXA 4JHXA 3UAVA 2AVDA 1SNYA 2CJYA 3IKLA 3OEWA 2YJNA 3VI3B 4CR7A 3BK7A 4BWVA 1XZFA 4O08A 4EYSA 4CCYA 4IIBA 3AJEA 1J09A 4LE2A 1ZJJA 5IXYA 1KR2A 2L42A 1Q15A 3WYEA 1GPJA 1T4BA 3C7AA 1D2RA 2DWOA 2QN3A 3D2CA 4PFJA 4WOPA 3MRSA 4Y6SA 5G2OA 5C8YF 1CUXA 2POCA 3MVEA 3NHSA 4OQFA 5K3BA 721PA 1K7XB 5J47A 1H5NA 4N03A 4OI4A 1T2VA 4KXLA 1J8MF 3WLQA 1KWGA 5HNKA 1SHZA 1DQPA 1YVEI 3IALA 1OZHA 3D5TA 5EEHA 2P8JA 3ZHCA 3ZE1B 3AHCA 3H18A 2PH5A 5BN5A 5K8CA 5IUKC 3UKDA 3RSOA 4TV9B 3UXYA 1BXRA 2BKEA 2E1PA 1NXPA 3OX3A 4LE1A 5E38A 2CVPA 1VP3A 1RAGA 4S1PA 1VJ0A 5DWQA 4I7EA 5IZCA 1SXPA 1V5GA 3E05A 2TRSB 2YW9A 3THOA 4ETNA 2BGGA 1XL1A 3EFOA 3R5XA 3CUWA 2PZLA 2JVJA 4FYIA 5FHRA 3MS4A 4CMEC 1U81A 3AC0A 1L9XA 2CLMB 3M4NA 1O58A 4MDHA 4JENA 1U7ZA 1RBMA 3OOWA 4HFMA 4EO4A 4IP0A 4CM8B 2O19A 1E0KA 3NHWA 5FTMA 2P41A 4KE9A 1GPAA 1SO8A 2AJBA 1VHLA 2E18A 3FWYA 4TV9F 1MOSA 3V1TC 3EXEB 1ISFA 1WX1A 3DMNA 2AOVA 1QIDA 1CJVC 2QWXA 3FVVA 4PSKA 1W4BA 2R47A 2I2CA 4RQUA 4BO1A 1NUSA 2ZYWX 5F9HA 2R7KA 1OYOA 4GP6A 1PT8A 2BFBA 2ZOSA 1QGUA 1RKXA 3NKVA 2WOOA 4YAOA 2VJNA 1NY5A 3VNBA 4ENWA 2C59A 2EP8A 1EHIA 2FQQA 4UD2A 4ROTA 5LP6A 1MCZA 2MT9A 3QEOA 1KC3A 1X8XA 1YZGA 4LOJA 3UFXB 2FWPA 4PFKA 1HYEA 2FW6A 2HSEA 1ESNA 4YRSA 2R7MA 3PU6A 5LR6A 2IBTA 5BT9A 3ROGA 1E61A 2YRXA 5DLDA 4NR0A 5KYWB 3WLTA 3I0MA 3BOSA 1E5LA 2OFWA 1IQRA 3BMQB 2AR9A 1TADA 2XDQA 5CH5A 5B58C 2VAXA 2V5UA 3ZK9A 4TMVA 2AC7A 1L7XA 1ZK4A 4G4GA 3NCTA 1C1XB 1AXGA 1L5ZA 2SECE 3EDOA 4RANA 3NC4A 3HCDA 4TV8B 5FOXA 1CZOA 1ZR4A 4Q3LA 4WFJA 2MWMA 4QDZA 4I50B 1DJNA 5B6PA 4GXNA 5C1IA 1Y9JA 2IE8A 2Q3LA 4GBMA 2IPOA 4F2WA 3GP8A 2J3QA 1X9GA 3GFSA 3IMEA 4MMXB 5HTKA 4B83A 4B7AA 3CVWA 1F7UA 3LT5A 3EFBA 3JYNA 1VECA 5T4HA 2CJWA 4Q37A 5GVSA 5CG2A 4FFLA 2YY6A 4ESVA 4TSRA 1WXDA 3OSUA 4ZRMA 3D8TA 1BE1A 3F71A 4DDKA 1SC9A 1KXZA 3UJCA 1MB2A 2QSUA 4CKEA 4TV8F 3VHXA 5LD2B 4I50F 1EX9A 1AKMA 3IAM6 4MRAA 1KY5A 2NO5A 3C98A 3ZIUA 2NO4A 1X80B 1K7CA 2DBYA 4DMKA 4I1YA 4H2DA 3AV0B 4BBZA 3EOAI 2H5LA 2SKDA 3SDZA 2RGNC 3E9NA 2H2WA 3EDCA 1N2SA 1BS1A 1VPEA 1KVRA 2RGEA 1QU3A 1AHNA 4ZVSA 2QAGA 3R2JA 4WVFA 4J3JA 4F11A 4RPJA 2ORYA 3RARA 4F86A 1U2RA 3W7VA 1XTSA 4LJSA 4YHHB 4N8SA 3U39A 4PZUA 5JNLA 3IQHX 3G0DA 4N3NA 1ZMTA 1QOPB 3F7OA 4QT4A 1GPDG 1ZAKA 4AZ0A 4DA4A 3F46A 2NXCA 3AKZA 1GDDA 3QEAZ 4DDHA 5EE3A 4DMHA 1PJLA 1J4AA 1TMOA 4XUDA 3N2IA 2BTQA 3BDIA 2WC1A 2FQXA 2FPUA 2Q4EA 5DLYA 4XB2A 1LDYA 1ND5A 4UNQA 2HHAA 3FCXA 3FCSB 5HX7A 1T1RA 3QBJA 2XB2A 4K9DA 1I0IA 1DTEA 1JEJA 2A58A 2DPLA 2VYVD 4PCUA 1FFCA 4WD3A 1YO6A 1HZJA 3PJDA 4S1OA 5CT9A 3VR5A 4JI4B 3M33A 2ON6A 3AJAA 4L6CA 1CF2O 4RPKA 4ZN6A 1CDDA 3DSRA 3QXHA 5HK8A 1I7DA 3IUQA 1XHLA 4ARVA 5IF9A 4YQZA 1PJCA 2HSDA 5KJ6A 1W5SA 2XOKA 3PDWA 5AM0A 2Q3DA 2QYTA 3QFFA 3WMGA 3IUYA 3FUWA 1T25A 4MKFA 1EM8B 1CY2A 4MICA 3AGPA 4RK5A 5DLQC 4BO6A 3CU5A 4LRSB 4J3NA 2XV1A 4F6RA 4B0PA 3P27A 2HMWA 5FYDA 2DHRA 1VA5A 2VBIA 4IX9A 5K3OA 4M8SA 3T3DA 5EMLA 3A2KA 5LQKA 5E7IA 1VSQA 3UHJA 5IX8A 2ZT5A 1YD7A 1C29B 2VJCA 3KEMA 5DNDA 3ZE9A 5IHXA 5JY6A 1QQAA 2FXVA 4H18A 2QIPA 5B1YA 4AS3A 2VRCA 4X9XA 4ZT5A 2VUIB 1XAHA 2OLJA 4Y7DA 1S9HA 3IA7A 3Q15C 3JYHA 3KYIB 1LC3A 3O9VA 3G0BA 1GLVA 3BH0A 5LQJA 3RV3A 3GJZA 4PC6A 2UYHA 2B2CA 1U65A 4HXYA 4RFSA 1FQKA 2ZR7A 3AERB 5J9FA 3GJRA 4F46A 3BE8A 2JIZD 2CLDX 4EUSA 2IBMA 2IHZA 2FSVC 1DADA 4QTYA 4AY5A 1TIKA 4Q47A 4F5YA 1TKRA 2PZMA 1JSZA 1QCZA 4MRRA 5GJBA 1H3NA 1GR0A 1NQ5A 2BGJA 1LH0A 4L5JA 1FU4A 5ADWA 4L5CA 1QFYA 4FBGA 5IANA 5JD4A 1NMEA 2CL5A 2RGDA 2X6QA 2WG2A 3FG9A 1KP3A 2VF5X 2XXBA 2P9HA 5B1EA 4IINA 4LF6B 1J20A 4DSUA 1FSPA 2AE2A 3EQ6A 4UMVA 1D2EA 2GN0A 3U1BA 1Z0FA 5KMGA 4ZDKA 1EX7A 4FDVA 2HLPA 1LPSA 1Q20A 2WAAA 2JFXA 3JASA 1EXDA 1G98A 1RDFA 1KEEA 2GPAA 3LPAA 1IQUA 1QB7A 4XQGA 3DE7X 1JR3E 4QYIA 5JDCA 3BZUA 4RULA 3ECAA 3DXFA 1RC1A 2H9YA 3QU5A 4EZEA 5F7ZA 4BATA 5A3JA 4J16A 4H1HA 3BJRA 1CUUA 2JVIA 4ZAZA 3U3RA 1XVUA 2NWQA 2O5RA 1UEJA 2Z8ZA 1I4TD 3G2HA 3BSWA 4H4EA 3WZ2A 1F7VA 1LTKA 3SXUB 2WIBA 3K16A 2P6RA 1XFAA 1L5OA 3LTEA 3QFCA 3E35A 3EVEA 3QLVC 5CLLA 5TRTA 4F71A 2PUBA 4UTXA 2CBZA 5JH7A 1QE3A 4IGFA 1LRKA 1L1EA 1PIWA 3IOEA 5AVOA 1E3EA 4Y2SA 4HPJB 2JGMA 6NULA 3LHSA 3ZDZB 2GILA 1JSLA 4M8LA 3THWB 1Z4JA 4XFDA 4MB0A 1K92A 1LBHA 1G3IA 4KQ6A 1F3OA 1YCHA 1T8WA 2CXPA 2DP4E 2EJTA 1RJ9A 4LK3A 5EMJA 4A36A 1YB2A 3VDNB 3HY4A 1NMYA 1BA2A 1X74A 1MVOA 2JS7A 3GPLA 2O8EB 1DELA 3PNLA 4Q4JB 3T7SA 3IAM1 3VC1A 1XRRA 1NQXA 4EVRA 3Q6NA 5K8TA 3B1FA 3K5WA 1VRWA 2C0PA 2Y27A 5JE8A 3U7QB 1F60A 3VJMA 5JEEA 1P19A 2EEPA 1NHWA 2PWBA 3GJ3A 2GXAA 1U94A 3DKIA 4WSOA 4C7KA 4JIGA 5FQOA 1SUSA 3D4NA 3ISVA 4I9NA 4XWAA 3AEUB 3QEJA 2IXTA 5TY0A 3OQOA 2OY0A 5JRDS 4Y6QA 5KTOA 2J7PD 3G5MA 3AVQA 4UMFA 5I9BA 4Y1RB 5DF1A 4H6VA 5ILGA 2G9ZA 4EY5A 4URUR 3EEOA 2ZCJA 5KNDD 4IICA 3C14C 1HG1A 5EP4A 3P9YA 3BA1A 1CUSA 2GCOB 3O8RA 1FP6A 1OAOA 1G8HA 2A4MA 2ZWPA 1M6VB 4IR7A 4L57A 5FO0A 3VOBA 3O0TA 5JJIA 1WPXA 2G17A 2VLIA 4QRDA 1IEQA 3WB1A 4A10A 1YAJA 2R6FA 2V4UA 3T3MB 5JQGA 1T1JA 4GZ3A 4K6FA 3K70C 3LM8A 4M9SA 1MB9A 3KSUA 1AK2A 4G5GA 4ZVTA 4EFMA 3ICWA 1SC3A 3CZ5A 1JKJA 3EY9A 3LYAA 4NBUA 5I7WA 2GESA 4F3YA 1GZ7A 4D57A 1GIAA 4D8XA 4MO9A 2ZJAA 3NKFA 2OLEA 4RHXA 4KOEC 3K0HA 2HJVA 4LSWA 4ACAA 3QOYA 4B8YA 2IDKA 4JYZA 4FCCA 3PPXA 1NMSA 1EWQA 3VDQA 3KZNA 2GPNA 2QUBA 4ZQFA 3M3DA 4BJ3A 4DZRA 2HQSA 4O5OA 5ICSA 4GBED 3JVEA 3RS8A 4XM0A 1VLMA 1FU8A 5K3CA 3SLGA 1BROA 3IHWA 5H70A 3CT4A 1ZKMA 4RVUA 3TBHA 4G63A 5M5BA 2N1BA 3HZRA 3OZAA 1PJ2A 2G04A 1UK8A 2ZIAA 3ONVA 3AILA 2O1EA 2KB0A 1WSAA 4CLXA 4B74A 2LKDA 1CW2B 2D1TA 1EH5A 3NONA 4E32A 4DXHA 3DDZX 1CQXA 2ZP1A 3QJ5A 3BGWA 1LSJA 3NVMB 5AVSA 2GK7A 5T5QA 1JFLA 2WWYA 1OASA 2ZQ5A 1HG0A 2EZ4A 2FEKA 2H18A 4P7BA 5IVDA 4D9NA 4DBLE 3W8FA 1C7FA 1IN8A 3CZCA 3O8BA 3G9XA 4C89A 3FCUB 2O57A 1CS0B 4Q16A 1JQ3A 2PY6A 1E2UA 3DONA 1Q0QA 3GOQA 1W5FA 2VNSA 2AJCA 4DY4A 1VIDA 3L6RA 2P5SA 1UPBA 2GEJA 2HA4A 2OHOA 3CZAA 3RRJA 1JJIA 4AQDA 5FTLA 2JFGA 2ZS9A 4UQOA 4D3XA 3AHHA 2OGUA 1A2QA 1JIQA 4RUKA 1I24A 4X71A 3I05A 3ZHXA 4D26A 3LUKA 4ZJPA 1EWTA 2W6OA 3BWCA 4JBGA 5CLGA 2XOXA 1L3BA 2RBKA 3A9TA 3FDZA 3HFGA 1QIMA 3NHKA 4KQGA 4UM8B 1M7BA 5EZYB 3RRBA 2QUKA 4HNAB 1C3LA 1JSXA 3A1EA 4YK7A 5DE3A 4IDOA 2B5VA 2WD9A 2RCNA 4A0RA 3LX6A 3E9YA 4XIYA 3DTYA 3K0AA 3ESCA 4GEGA 1NONA 2EQBA 3HGMA 4OIMA 3BWVA 2GYVA 4C6TA 3VBCA 2Z2KA 4E94A 2AOXA 3EIWA 2Z6VA 5CEEA 1EXWA 2QRZA 1EGHA 3EGIA 2XNDA 1E4YA 5EZYF 2O8BA 3GLHA 1NI3A 2GTPA 5EEGA 3GZNB 1L7PA 3VR5H 1HC7A 4ZO7A 3VKGA 3KVOA 2AF4C 2HEGA 1M2VA 2G9QA 1EG7A 2PKCA 3FOWA 2IYTA 3JALB 1L4UA 4X45A 2C3OA 4KLZA 1E7MA 4RC9A 2OWEA 2ECQA 1ZK2A 1SD1A 4I8XA 3SAJA 1A0OA 4DJAA 4MPJA 1Y4AE 4F5WA 4NE7A 2ID7A 1Y3IA 3ADOA 3DE0X 4KBGA 1BEZA 5A7HA 2NUPB 1WIWA 4GMDA 1VB5A 5JAHA 1M5RA 4GW3A 1II9A 5BN3A 2O59A 5G0SA 3OOHA 1E4EA