2VJOA

Formyl-coa transferase mutant variant q17a with aspartyl-coa thioester intermediates and oxalate
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
427
structure length
427
Chain Sequence
TKPLDGINVLDFTHVAAGPACTQMMGFLGANVIKIERRGSGDMTRGWLQDKPNVDSLYFTMFNCNKRSIELDMKTPEGKELLEQMIKKADVMVENFGPGALDRMGFTWEYIQELNPRVILASVKGYAEGHANEHLKVYENVAQCSGGAAATTGFWDGPPTVSGAALGDSNSGMHLMIGILAALEIRHKTGRGQKVAVAMQDAVLNLVRIKLRDQQRLERTGILAEYPQAQPNFAFDRDGNPLSFDNITSVPRGGNAGGGGQPGWMLKCKGWETDADSYVYFTIAANMWPQICDMIDKPEWKDDPAYNTFEGRVDKLMDIFSFIETKFADKDKFEVTEWAAQYGIPCGPVMSMKELAHDPSLQKVGTVVEVVDEIRGNHLTVGAPFKFSGFQPEITRAPLLGEHTDEVLKELGLDDAKIKELHAKQVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FORMYL-COENZYME A TRANSFERASE
publication title Reinvestigation of the Catalytic Mechanism of Formyl-Coa Transferase, a Class III Coa-Transferase.
pubmed doi rcsb
source organism Oxalobacter formigenes
molecule tags Transferase
total genus 144
structure length 427
sequence length 427
chains with identical sequence B
ec nomenclature ec 2.8.3.16: Formyl-CoA transferase.
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02515 CoA_transf_3 CoA-transferase family III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1540.10 Alpha Beta 2-Layer Sandwich formyl-coa transferase, domain 3 formyl-coa transferase, domain 3 2vjoA02
3.40.50.10540 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Crotonobetainyl-coa:carnitine coa-transferase; domain 1 2vjoA01
2GCIA 1T4CB 1XVUA 2G04A 2VJNA 1PQYA 1X74A 1XK6A 2VJQA 2GCEA 1PT7A 1XA3A 4HL6A 2VJLA 2VJKA 2GD2A 1XK7A 4ED9A 1XA4A 1P5HA 2VJMA 3UBMA 2YIMA 1Q7EA 2VJPA 1PT8A 2GD6A 2GD0A 1Q6YA 1XVTA 1T4CA 1T3ZA 2VJOA 1VGRA 1PT5A 1P5RA 1XVVA 2VJMB 1VGQA
chains in the Genus database with same CATH superfamily
1RYDA 3L6CA 4DIFA 5JS2A 3R6GA 4ZZ1A 4XFDA 2JCVA 4RMHA 4OXKA 1MC4A 3ZH2A 1X14A 1MX9A 1TQ4A 2Y9MB 3CH6A 4GU5A 1MGOA 4RK4A 3TLZA 4MGIR 2VYND 3QJGA 4XSVA 1QF6A 2XKAA 1GLGA 3BMCB 1MKYA 4WXMA 2K6GA 2NT3A 1KEUA 3G5AA 4N54A 1QS0B 1ZI9A 3IP3A 4OQPA 1MIHA 2HCRA 1UDWA 4XIJA 5LD2C 1RFGE 3TRJA 4FFMA 3AQ4A 2DGDA 1GQRA 1OX4A 1U0JA 5DHFA 5BR1A 3W90A 4J94A 1X1SA 1ZD5A 5AVTA 4ZVPA 5IULC 2XCOA 2DT5A 1FS5A 1R50A 1QH8B 5JASA 4IXMA 2C92A 1QF7A 1UAYA 3LC1O 4WDRA 3P27A 1YKGA 1L5HB 2OXRA 3KWLA 4LX0A 1QHFA 2VZLA 4KWHA 3KE9A 4FHCA 4KK3A 4YRDA 1NXPA 1O97C 4PQGA 4RD4A 4W5HA 5BYBA 1QPZA 3SC4A 3DBOB 1V8ZA 5JC1A 4B84A 2WK1A 1WQ3A 5CCXA 5KNBA 4U7JA 2XCTB 1JKJA 3D1VA 4IJUA 1GARA 1QO9A 1ZIOA 2NXEA 2WHYA 7ABPA 4ARCA 2RGWA 1Y8QA 4PRLA 2R8XA 2NU6B 4WECA 3NHPA 4II2A 1Y81A 2HIMA 4QPNA 4B3FX 2WYUA 1WG8A 4IQFA 2AT1A 3C2QA 4N82A 3ZI7A 1TQHA 4Z51A 5K3EA 3OO0A 4AJ1A 5BN1A 1E4VA 4R2KA 5JE8A 5LQDA 3UWOA 2O8BA 3JALA 3AP1A 1SXJE 2J85A 3ZXXA 1XWWA 2UUBB 1XNQB 2C00A 1EINA 3GH3A 1GAEO 2AMFA 3AFNA 5CFRA 1OX5A 1CZRA 1Q16A 3N8KA 1DAEA 3OPXA 1Z4LA 1GGFA 3JR7A 4KPUA 3V1LA 4CDRA 1G9XA 4DRYA 3D8HA 1TLTA 3IAAA 4JSRA 3E9NA 4CKBA 3O8QB 5JYEA 1CRPA 4W5TA 1SCKA 3RM3A 4YLGA 1R66A 4OHCA 3MWYW 1EFLA 3AUYA 1S3SA 3HKEA 4CLRB 4TYNA 5ENDA 2ZI6A 4K9SA 4XPIA 1KK3A 2F48A 4KXLA 4QVIA 3DFKA 3QKIA 5FPTA 5IT0A 4KVZA 3KLBA 4JLMA 4UUNA 3WWZA 4D99A 2QP3A 5KB3A 4DZZA 1OTXA 1THMA 1J90A 2O7QA 2O14A 3A05A 5J9FA 5H8WA 5C3MA 3FFWA 4YI5A 1U2ZA 1I2DA 4RADA 1QB7A 2V7QD 5CM9C 1F2DA 2JI6A 2OQ2A 3EA0A 3NX4A 1DGQA 4YROA 3NH9A 1J8FA 2HSEA 3KCNA 2RONA 3ECAA 4R0NA 3A2KA 1WD5A 5KYWA 4E2YA 5FFFA 1X15A 1F5SA 3ZWXA 1EK6A 2R11A 4DA6A 4JYZA 1VLLA 4B46A 1JSCA 5AW7A 2XTZA 3OKCA 4MGYR 5HXAA 5DHPA 1GPUA 2MMCA 2RBKA 2P9TA 3L7NA 1S2DA 4X8OA 1JF8A 1XZQA 1Z4JA 3GJ5A 4GE0A 1MB0A 2VK2A 1BQEA 2GAFA 2QTBA 2PSDA 3G8YA 4TQGA 5KJEA 2YXBA 2YCBA 3ESDA 9LDBA 3C0KA 5JNVA 5LYJA 3E3LA 3A4YA 2QRGA 3LT5A 4RSMA 4Q9NA 4W8OA 2JDIA 3DWEX 3H4IA 3K5PA 4X60A 2MIIA 2FEKA 1F7VA 4V0ME 3F49S 3GEPA 2XMDA 1ZKDA 3BB3A 4MB2A 3UJ9A 3BYZA 4QNRA 1WXWA 2Z9DA 3VU1A 3WB2A 1X1EA 3S2FA 1IUPA 4I0WB 3OFND 4CLXA 1U8YA 3QWFA 1OXXK 3CLSC 5LQJA 1ATZA 3G8AA 1GTZA 3OESA 3I8OA 1KGDA 5JHGB 3K4HA 4KREA 2J3DA 4F9FA 3U3XA 2ZT8A 5DASA 3ROPA 3EIXA 4HEJA 2OO5A 2ZJOA 2IKSA 3EBOA 2V3VA 2NP7A 4PC1A 1ZC3A 3A6FA 2BR5A 3BJEA 5EJ9A 2GCGA 3LC7O 4WOCA 1E3SA 4ICIA 5DH9A 1G6OA 4NZ9A 3O4GA 3Q9UA 3NBXX 4R81A 1B0AA 4DIMA 1P1RA 1KQFA 3CCFA 3H1EA 1UXGA 4HPJB 4U0JA 5DOZA 4NULA 3BOSA 1SURA 1TC1A 3AIKA 3GGSA 3KSRA 4JLSA 3ENQA 3E9MA 4L4YA 3IEKA 2YVKA 4UAUA 4WFIA 5EJAA 3QVUA 2VTKA 4EB0A 2IYAA 4EY3A 5LZ9A 3TSWA 2YRXA 3Q0TA 3R0IA 3VPFA 2G1AA 3DDZX 2FWIA 3GFOA 3LBIA 4QGAA 5CK4A 4CM3A 5KHOC 2NPFA 3THSA 1NTRA 1YIDA 1K89A 3C3BA 3O3OB 3OA2A 4KR0A 2VXBA 1HM5A 2B5OA 4RIGA 3N3BC 1ABFA 2LIPA 3QBEA 4I3HA 4EHKA 3KJIA 1N0WA 4K05A 1GL3A 4FFRA 1KWGA 4URYR 2NZUG 2O7RA 2ZREA 3CJQA 3V5NA 4Z4QA 2ZIAA 3LO5A 3OY2A 3V9PA 4V1CI 2PZFA 3QXSA 5BW6B 4L5AA 3OEYA 2GFQA 3UV7A 2I54A 4P7GA 1LLDA 4DM3A 4EJ2A 1IE3A 3IVMA 4B80A 5L8VA 2FE4A 3KQLA 3G2LA 3IGFA 3K6KA 1E2PA 2W4IA 3GEBA 3NASA 5IJWA 3QBJA 3SYTA 4C0XA 3FR8A 4N18A 1QORA 1WXIA 1Z35A 3G5TA 1NRXA 5A4MS 3EXEA 5K6AC 1RPZA 4I6GA 3DZIA 2FDRA 3H8WA 4QUHA 3PNYA 3NRCA 2HC9A 4K6KA 4A3SA 1YE5A 4RC9A 4LV8B 1EG7A 1XTIA 3H1FA 4RZSA 2PKQP 3NKVA 5KWIA 2J5RA 4DARA 1M34A 2NZWA 1H2RS 2IPMA 1AKTA 3D3KA 3AXSA 2A86A 3GBPA 1CP2A 4RF4A 2OAEA 4MV0A 3K9WA 4W4TA 5DK4A 4G67A 2DPMA 3F8WA 4GLFA 4OP1A 4KYTA 4XWWA 2VPIA 3A3KA 4CM5A 2HNKA 4LVCA 4QDTA 3CVVA 3JQAB 1KEEB 3KUKA 1GZ4A 1FUYB 2WNIA 4UVGA 4KQHA 3W77A 2H07A 4B7ZA 3ANNA 3Q3GE 3GAMA 3VYVA 5EIAA 2XT0A 2I71A 2XUKA 4RLQA 4UE6A 2RKWA 1BHSA 2I65A 4A82A 3OZAA 4KX5A 1HE4A 3K0BA 3BF7A 2H31A 3SN6A 3IELA 1H2WA 4PX9A 4RZHA 4H1VA 1L6RA 1UDBA 3DGEC 2QRKA 4YV1A 3D7RA 2Y4NA 3EFHA 4LRWA 2O3RA 1JFFA 3I5UA 1WPXA 1LH0A 4HFMA 4OFZA 1A2OA 4LSGA 1PZNA 2YWEA 1YKSA 2OYRA 2H4ZA 2IRWA 4OP2A 2XMBA 2AIRA 2W48A 4HWOA 5EIEA 2BUBA 4IIJA 2O2GA 1ONSA 3FB4A 4O0MA 1WO8A 1D7AA 3S0JA 1IDOA 4UREA 4TXHA 4IS2A 1PWHA 3L8DA 2H4YA 4YR9A 1GNRA 1NLMA 1OWNA 4Q47A 3C8ZA 1XMVA 4COKA 4O4LB 4ETNA 1RXEA 4MWSA 2Z5VA 3H4TA 1Q20A 1QGED 1SA0A 1TT5A 1ZD1A 5TMDA 3ZDXB 1OV4A 3ZWYA 5IAOA 1KZ4A 2P8SA 3SIWA 3UHOA 3KSBC 1PV4A 3E0QA 2I2AA 3X44A 2EWVA 3SLGA 4D3YA 2QG6A 1I2ZA 3I9V1 4NK4A 4OKNA 2PUVA 4QYWA 3C5CA 4DCOA 2OP1A 4TYPA 2B99A 1PS8A 1CY2A 3MMPA 3DDHA 1QRRA 5E4TA 4QFBA 3VO9A 1AE1A 1ZXBA 3H8JA 1BTOA 4NQRA 4EBBA 5JXGA 1SO8A 2PZ8A 4CKWA 1T2AA 3QYPA 4O4HF 2EGGA 6LDHA 5E6UB 1XCLA 3OZEA 1VE7A 4MVJP 3VAAA 4UBIA 4YCDA 4IV0A 1NJSA 4RLFA 5DSZA 5THKA 2ZZNA 1URPA 3H5TA 2NX2A 4LTNA 4N0PA 1MAWA 3VI4B 2G71A 1CRQA 1Q91A 2IXEA 3KZCA 2IGTA 3X1ZA 3NXKA 2XZLA 4EF5A 3EZLA 3BREA 1L5MA 4HGNA 4EGCB 3L4JA 1C1XB 3L77A 5JY6A 3LSYA 4G84A 2DQKA 1J09A 1U3TA 2CXPA 5ER6A 1RZUA 4KR2A 4F3TA 4QM6A 4MVWA 3ZCUA 1VMAA 4D8YA 1H2BA 1OWLA 4U6NA 4OQMA 2FPIB 4IJQA 4I55F 2J09A 1N77A 1D1TA 1UBGA 1YCHA 3ADOA 2WVGA 4FR5A 3ZXSA 4IKOA 4X1IA 3EGVA 2DPYA 3U1VA 2I7CA 2X23A 3BCRA 4MV1A 3W7VA 4BC1A 1M1XB 2ZT5A 3L8GA 4NBKA 1JAHA 5A03A 1FSSA 2FFHA 1N0UA 3PVCA 4KXUA 2P3QA 1X7WB 4Q66C 4U4AA 5DNYB 3EIOA 4BNTA 5CTAA 5IKEA 3RS9A 3VH1A 3LC2O 1TK2A 2GK6A 2OK8A 2RK3A 4EJMA 3CH7A 4WXHA 3OP1A 4Q03A 2V96A 2OZPA 1XK6A 5H7XA 3WZMA 3FUUA 5CFNA 5FA5A 3SIPA 1NLUA 3ESBA 1NX9A 5FP0A 3T54A 4AW9A 1BN7A 4EHHA 1PR5A 4E6PA 2LGJA 2NO0A 3E1SA 4KXMA 4HB2A 1M7HA 4MQUA 2DLNA 2GBCA 4A0HA 5CDTA 5AW0A 3A06A 2X2PA 1FMLA 3B70A 2WLTA 3QYJA 5AVKA 4YWJA 5CXUA 1TJ5A 5KX5F 3ONWA 3JAMA 5DWDA 1M6WA 1UBLS 2PCJA 4NHEA 3NBUA 4GX5A 4JP5A 1FDVA 4ZP1A 2IP2A 2HIAA 2NV2B 2PFGA 1DFGA 1LVUA 4H0FA 2P30A 4JELA 4F1KA 3DOIA 1HZZA 2XODA 3SQWA 4IMIB 1MEJA 5M2QA 1CJTC 1C9YA 4UASA 4XX0A 4BZXA 2FW9A 2ZBQA 1KEVA 4AIRA 5KCMA 5ADVA 4DLZA 4QA9A 3I1FA 3R7LA 2A14A 2FRXA 2I03A 2V8BA 3QVLA 4TSRA 5FBWB 2VJQA 2XYGA 5AW5A 5CAEA 1SCIA 3D8NA 2IUUA 2DF8A 3DAOA 5DLEA 1DAMA 1DKUA 4U7WA 2R4QA 2VQ6A 3ANSA 3R41A 5DRYA 2DWUA 3RTBA 5JFOA 2EFJA 2Q41A 4MI6A 1RVV1 3RT9A 1X7DA 3I5XA 5J4KA 2J0UA 3AOGA 3WA6A 2XNDA 2GZMA 2PA3A 1SMKA 1VA4A 2ZXEA 4UDOA 3UMRA 1PNTA 2DFLA 2L2QA 3DMFA 2XYVA 3FAKA 1EBUA 4NLLA 4G25A 1KRWA 1OFTA 3AXTA 4PYLA 2GJAA 5T3YA 3I4CA 2G7ZA 2FPLA 2GPTA 2RC6A 4L7QA 1NE2A 2JFPA 3EIQA 5D1HA 4ZEOA 3H6KA 5DIFA 1KKMA 2IOFK 3W9BA 3GQBA 3MTAA 2OTCA 3B48A 2ZDGA 4BLVA 2F62A 1RMQA 3KLNA 4BMOB 5AD1A 4LWZA 3KJQA 4JVLA 1Y89A 2APJA 4Z4HA 4JU8A 4O1HA 3DG9A 4OJKA 2IZ5A 2JI9A 3AERA 3E84A 4JLNA 3CLTD 4OF4A 5CEFA 3TLGB 2IK8A 3O9VA 3OICA 4X8HA 2CNKA 2FQYA 4WFQA 4JI1B 5C7LO 2BM0A 4R9RA 1TIKA 4BFLA 3THYA 3VNAA 3LBHA 1L5VA 5F2EA 2JKZA 4A26A 1U2EA 2CXRA 4EMTA 1E9BA 1MIOA 2W11A 1PWZA 4X54A 4ZDWA 3RAPR 4AT1A 5AHRA 1PDWA 1U2PA 3DEAA 1KZ9A 2FY8A 1AMUA 3L4BC 4A8JB 4QZVA 5IN4A 5KKCA 1KO7A 1MJFA 4AECA 4C1BA 2OAGA 1LRJA 4BRWA 4KRGA 2IT1A 4MK4A 1UP4A 3DE5X 3VNUA 3IX7A 2EG5A 1S5PA 1GAJA 1BQ4A 4Y2VA 4QRIA 1M9NA 1Y1TA 2JBAA 4RS3A 5DHQA 5G0SA 3C39A 3ASYA 1RM5A 3LY5A 3R7DA 3VR1A 4XUCA 2LDXA 4YUYA 2AOXA 2M32A 1USIA 1UKEA 5LBTA 5KQLA 4KEAA 1RP1A 3K6RA 5E6RA 1OUMA 1Q50A 4PGAA 4RGYA 3M1AA 3PA6A 3U1TA 3IIIA 3WGZA 4Z7QB 5BVHA 5ITVA 2ZK7A 3VR3D 2NTNA 1ISGA 5HDBB 2V45A 1Z5ZA 4FMPA 5JI3E 2QUIA 1TTQB 4NESA 3ZJYA 2ZVDA 2O2SA 1B8VA 2D1FA 4JS0A 2XIJA 3DMPA 3QPAA 2FEMA 2VBIA 3CIOA 3DZ8A 3A1FA 3PF9A 3SIRA 1X39A 1QIJA 2OO7A 3QKRB 4M1SA 1GQFA 1NZJA 2XUIA 4V0KA 1AXGA 4FEEA 3IAM6 3G7SA 4WXRA 5G1PA 3LYUA 1D1PA 4AO6A 4PM4A 1XZFA 5DM70 2QTFA 2HR1A 4KOAA 3Q9LA 1HE2A 4HZUA 3U7GA 2XTMA 5JSQA 1RWBA 3GB9A 1OU0A 1ACJA 2OGTA 3VA7A 4PLTA 3VPCA 3MS7A 3GRPA 3O2SB 4NS4A 2F3RA 3HXOA 3QOFA 1YUBA 4DSAA 1E1CB 3UG6A 3UUGA 2PUBA 4YRNA 1WV0A 3H2KA 3KU4A 2I91A 1AGRA 3MCTA 3N07A 3OA0A 4I50A 1UP6A 4PG4A 1AUPA 5ENVA 3R7AA 4D0NA 1HETA 2HDNB 2JCGA 2H7XA 1N6NA 3TMAA 4MV8A 3K9CA 2QN3A 3ZDBA 1S4QA 1U6IA 3IBCA 2CNLA 5K0EA 3P0JA 4OM7A 4A73A 4OMDA 4IH1A 1V9LA 2BGLA 1FP4A 2X14A 3BD7A 3CWQA 3MBOA 3N9IA 4G41A 4GMFA 4WQMA 5TMBA 4ZGGA 3UQYS 1HYGA 1T35A 2XYPA 2EIHA 3BXZA 2IUEA 4NJMB 5BT9A 4DMCA 3WSVA 1XNHA 1K0FA 1K88A 1U1EA 2DLDA 2NNLD 5CNKA 4HH4A 2I99A 1GTMA 1PUIA 2FPPB 1US8A 3DZFA 3EAQA 4BP3A 5F9FA 3OEEA 3KV3O 2ZOSA 4MUBA 5FI5A 2ZBVA 1Z29A 1ZOSA 4OGKA 4GHWA 4ILKA 3Q11A 4BX8A 1L5WA 2HQOA 1PZFA 4HH1A 1HOXA 4P9NA 4RA6B 3ZV6A 1O6BA 4ZDIA 5FBVB 3KWMA 4G0WA 3W2HA 2UYCA 1E9DA 4KE9A 2YN0A 1KMMA 3VNBA 4YPVA 3AINA 5CM8B 1GG2A 1GPBA 1DAGA 1V1MB 4LJ9A 1ZH6A 4JZYA 4KO3S 4DCSA 5JSUA 4INJA 5A9RA 2WB2A 3A6PC 1QFXA 2O5VA 1Y7HA 2C9CA 3L6BA 2VBCA 5DYIA 3U4CA 4CG3A 3W5HA 2XZOA 3B8HA 1P9RA 2R7KA 2PWAA 1UM8A 3ASZA 4LOLA 5CP8A 2AVNA 1J8QA 4AUKA 1G3MA 4ECEA 2PSSA 2ECOA 3R3WA 5JBIA 1CLEA 1O9BA 3K0AA 3SHTA 1XKLA 4E2ZA 2LKCA 4KAJA 4OK6A 4OHFA 2QPLA 3WLIA 4QQRA 4QPCA 5CT9A 3RU2A 3PC7A 4HFRA 4GZLA 4EP1A 4Z7NB 2OLKA 4BX2A 1OU4A 2HQRA 4V0LA 4L8YA 1MLDA 4AULA 4HAUA 3DYVA 3NOQA 4WZBE 1BGWA 1N2JA 1BROA 1YTLA 2W2NA 3AKYA 1Y8RB 2VHVA 2VSYA 2Q7OE 4L9RA 4K9RA 4M3NA 1LZLA 1L4GA 4ZZ0A 3IKLA 3FF4A 4NEGA 4XTCS 1NSFA 3VO8A 1AK1A 1DIRA 1UMBB 2B4AA 3VPAA 4YAUA 2QX6A 1SG9A 3PDCA 4DBZA 4EGFA 4BFSA 5AOCA 1XTQA 4ZT5A 2O2HA 4ZEWA 2WNSA 4B2PA 2PLAA 3NHKA 3LL7A 1DEKA 1PUJA 5DI3B 2BFAA 1F60A 3KQMA 3N1UA 1M66A 1T9HA 2WU1A 3AUJB 3GT4A 5AJTA 2R48A 1YD7A 3NWJA 4RVFA 5AK0A 4ZWNA 1IY1A 3PIRA 2V4UA 3ER8A 1PL7A 1R0YA 4K88A 1HG0A 5D51S 1KMHB 4KLRA 5DPMA 2LKDA 1KAMA 1Y4UA 1PX0A 2IE8A 2PBLA 3TMYA 4K6MA 1KF0A 5LZ5A 3SHQA 2P9YA 4ALJA 3FPHA 4Y2QA 4YUVA 4UBLA 4GBJA 1E5XA 4RY8A 4DNXA 1Z13A 3WB0A 1YRHA 1BS2A 4JROA 1E58A 2KI5A 2CZGA 2UZAA 2DJIA 3T3DA 1RZRA 2HSWA 2JLRA 1X7YB 2V74B 3K0KA 4TQAA 2ZM5A 3I42A 2ZRGA 4P4SB 3WLFA 1PZGA 1Q0QA 5BNTA 1SK8A 3KB2A 2OB2A 3AHEA 2P4SA 2BDEA 4NU8X 3UW1A 3TW8A 1GCOA 1FDUA 5EKDA 2H2HA 1U0HC 1ECBA 1DAPA 4K9LA 4OD0A 3G13A 1QIFA 3UH0A 2Q0XA 3FTQA 4UPVA 1YT5A 1SULA 2VNIA 4QUBA 1DUIA 4PN7A 3IB6A 1W96A 4Q3EA 1YS1X 1ULUA 2C4WA 2HM7A 3LYHA 4NMLA 4W8GA 4EJSB 3PGVA 1V9CA 4FXOA 2BMAA 5KJCA 1L3BA 3HP1A 1NNLA 4OHKA 1YQWA 2HMTA 2WJ4A 2ATCA 5DHUA 4CKCB 1I2BA 3OT1B 2BTEA 3F4LA 1BU8A 2QT1A 3FPGA 4QGFA 2Z3WA 4RV9A 3VH2A 3HKDB 2QVGA 4JC0A 5K45A 3MINB 3D3NA 4C7XA 2WQ7A 5CH5A 1GVNB 2VYNA 5TR9A 1F3OA 2RI6A 2R6ZA 1G3QA 3WGVA 1E6WA 2IWRA 4ZOCA 5JQGB 1MNAA 4M9UA 3H5AA 3L1IA 3JXEA 3EX7C 2YZGA 2AG0A 2GZ2A 1EXNA 4R8KA 5CLIA 3IPCA 5KTMA 3PNMA 4Q93A 2HAEA 2XRYA 2WJWA 3HNPA 3MWJA 3OI7A 2MINB 3N2KB 1SRRA 4YDQA 2OUKA 4YCBA 2F17A 4MUNA 4L8LA 2I5PO 1C8KA 3TB6A 1QTNA 1YR6A 3IP8A 2OB1A 3Q40A 4QULA 1JQEA 4LIPD 4M60A 5B5SA 3G5MA 3T4EA 3K96A 4Q7MB 4RETA 2WM8A 2DX7A 1WOMA 3EJWA 4JQSA 4IMRA 1LX6A 3E18A 1UOQA 2QRJA 3FVWA 1QC5A 4C0SA 5HIAA 1M2GA 2OGUA 4X84A 3VM6A 1VL1A 3OG9A 3P0EA 3VUFA 3LKZA 1CUXA 2JIBA 1R12A 4D42A 4DWJA 4QOSA 1XZIA 1J8VA 4Z49A 1ST2A 4NECA 1B14A 5J2UF 2I4OA 3DB2A 4NH0A 5HPYB 2FYTA 4Q9KA 2YN2A 3DDOA 2YRWA 1E2EA 3RHFA 1C81A 2CFTA 1X8KA 3HS3A 2IV2X 1WW2A 1JYEA 3KOOA 4AP6A 7ADHA 5EE3A 1IY8A 3RVBA 4TKVA 2V9PA 4C7OA 1Y3AA 4TS4A 4M83A 1TQDA 1ZW6A 5HMMA 3QF7A 2OE2A 4BEBA 3KQHA 4N8DA 1OBCA 5BN5B 1VFNA 1ISHA 1RRKA 2Q6TA 4HRVA 4ISBA 4MVJH 3VJKA 3PUIA 3VPGA 3DC2A 1LUAA 3BA1A 1AY0A 2QJOA 2BFBB 1AA9A 2W00A 3I72A 1QIKA 2ZKLA 1GSAA 3GVIA 5DCYA 3HB5X 1NP7A 3GFBA 5DN6A 3BE5A 4TLEA 1QDEA 1KU6A 3DJFA 1OZFA 2BJWA 4XCXA 5FXMA 2AX3A 2G5PA 1PL6A 1BE0A 3U17A 1XTVA 4HX2A 1YZKA 4PSAA 3TTUA 1XVAA 1F48A 1NRIA 4JBNA 1Y1QA 3UAXA 2V7QA 4BNWA 4OHWA 3V1NA 4BNIA 1JXQA 4BFWA 4BJ5A 2OCAA 1FVHA 4ZVRA 5KTSA 3MWEB 3A6HA 2WFLB 3GLHA 3EGWA 4JBXA 2NXJA 1CR6A 5H4HA 3UJ3X 4RDCA 3LU1A 1FDOA 1X9HA 1ZMTA 2VSOA 3L5KA 4UNPA 3WYFA 5KDOA 3GZ4A 3MJRA 1C0KA 1O5TA 1XEWY 1OLUA 4GOLD 4TLBA 2G0AA 5CK5A 4RJTA 2ILVA 3GD7A 1EFHA 3ABIA 4PNZA 3UA4A 1U9CA 3FPSA 4UFNA 1F51E 4JI5B 3DWGA 3G5LA 4Q39A 5DU2A 4C21A 2EOAA 1AGNA 3CPJB 4D9KA 5HF5A 3BGWA 4IIHA 1W581 4X1YB 3AY3A 2ZYDA 3FNGA 4INPA 3SWWA 3ADDA 3BWXA 3CBQA 3TF5A 2HK7A 3NATA 4YP9A 2FU5C 4R5MA 2JIMA 3U4QB 1MRZA 4QSMA 3VVLA 5F12A 1Z7EA 5EUCA 2BF7A 4BMPB 1QU3A 2QMHA 5ICCA 3NTRA 2CGEA 4LG1A 3JWHA 4XB2A 3TUZC 3OFNA 2JVJA 1V47A 4CQJA 3G88A 3TQFA 2ISQA 4DPMA 4ZN6A 1Z12A 1OWPA 2OCGA 1C7IA 1GQYA 3CXUA 1GTL1 3KE8A 3MMXA 4MYDA 3SLRA 3FKQA 3IVGA 3HPRA 4G4IA 3ZH9B 1N25A 1MJHA 1ZM7A 4NCIA 1I3OA 3ZU5A 2CB0A 1XYGA 1Y3DE 3B5IA 4G5RA 4WGFA 2X6QA 8GPBA 1NMZA 3FNQA 4KWTA 5JDIC 1M2HA 4HXFB 3ABSB 4Q02A 4XLTA 1FFHA 1QQ5A 2NUAA 2QENA 4Y1FA 5GZ1A 2ZLBA 3P9QA 1VJCA 3PLAE 1NPTO 3DE2X 2F59A 2BC9A 4P4NA 2UU9B 3WL8A 1LDEA 1DE0A 1MR3F 3PC8C 3QIAA 4KQFA 3ZGYA 3CRNA 2EBUA 3MELA 3F1KA 1HDRA 3L84A 3F73A 3VU9A 1JLLB 1NVVR 2FK7A 2QRQA 3ICPA 3PWKA 4G89A 4CLDA 4MW2A 3C3CA 2OLEA 1CULC 3EZ2A 2QTGA 3AEXA 2P9CA 3EIUA 2TSYB 3JVEA 2PMEA 3UT5A 3V1MA 4E51A 1N8NA 2C2YA 3L6OO 3OIVA 2PGDA 4J0FA 4NENA 3M2TA 4WIAA 2ATIA 4N7BA 2QQFA 2Q21A 4ZV9A 1P1BA 3C6BA 3FYHA 1E2MA 3IAXA 1SB9A 3Q10A 4LOHA 4XZ3A 3T7IA 4UNRA 1FBNA 1ESCA 3V4OA 4KFUA 2DFDA 1O89A 4LZNA 2WUEA 4KHPB 1KSJA 5GAJA 3PICA 2QAGB 1O4WA 3G9TA 1E0AA 4RTJA 4N0EA 1SBZA 4GI1A 5KSPA 2G5GX 1LRKA 4QYIA 3R7BA 3MS4A 1PW7A 4UCWA 3QOXA 1ADGA 4BO4A 1KOFA 3RVOA 1DPFA 3I3OA 2XVZA 1K7XB 1UM9B 2GJSA 2ZRKA 3NOVA 4N4AA 2R5WA 4XDGA 3U4HA 1YDWA 2D8AA 5F7OA 1CYDA 2WOJA 3D7NA 2IPLA 4TLAA 3DLTA 2QQGA 3PQEA 3WIBA 3ZNPA 1NBME 4L74A 1EBBA 1XVVA 4O2AF 1E3IA 2EKDA 3NHRA 4ZGWA 1QZZA 4BUZA 1PJ3A 1GO2A 2E4YA 3N8IA 4GVPA 4XB6B 3I6QA 4GIBA 2RH4A 3AQIA 3NYQA 2I6SA 1SC3A 3DR5A 5FWDA 3UJHA 1DLIA 3N8GA 4HNTA 3LPNA 3X1MA 2QPOA 1M7BA 4RPCA 4GR4A 4TT8A 1PJ2A 1RYBA 4H7JA 4KPGA 4AJKA 5A5DA 5F7ZA 3WLNA 1QK4A 1Q77A 4IHJA 2I2WA 2ZSIA 2XE6A 3PF8A 2RHWA 4BQIA 1UQTA 1QQBA 1DTWB 4LJ5A 4AD8A 4YWHA 5LKRA 3DAGA 2HZBA 1L5GB 1IRIA 5HNKA 5BSRA 4NBWA 4GGPA 3ZEAA 3W5CA 1ZA1A 2J33A 1AKQA 3D7MA 3I2FA 4JUFA 3W4JA 2E4ZA 1D0SA 2LWIA 1KKLA 4UQLA 4FOTA 3G2KA 2NU8A 3ZU2A 4J1NA 1Z6ZA 1C1DB 1XOIA 1V6AA 2WJZB 3K8ZA 2IHZA 3NHBA 5DT9A 5L3ZA 3VSAA 3FCAA 4PZPA 3ZHCA 1XU7A 1UWLA 5EZ6B 6PFKA 1A9XA 3LCUA 1ZM3A 4YMGA 2PZLA 1NUUA 2ZPTX 1T2NA 4B3HA 2X8AA 4JNKA 4KU4A 4F38A 4PPGA 4C4AA 4GX2A 4F8JA 2YWHA 1IUNA 4I5EA 5HFJA 4TRNA 2QSZA 1S3GA 3G1TA 1RC1A 1Z16A 4WD3A 3A27A 2O8CB 3M9XA 4X44A 4MW5A 2HWYA 3USES 1E9CA 3WK7A 5FNVB 5JD5A 1LJUA 2NSHA 3KZ1E 1XT6A 2FPGB 1XAJA 1YJ5A 3UGTA 5EESA 3AHCA 2ZE8A 4B2IA 1XNRB 3QM1A 3GN1A 1VYTA 2QW1A 3HN6A 4HVTA 3BTUA 2F00A 2X0FA 4JWTA 5J43A 2PXAA 3RRYA 1HLFA 5KNBH 4XLLA 3LWBA 4LTDA 3D6MA 1XA3A 4KXXA 1EP3B 4TVOA 5IC6A 5H83A 5E1BA 5KYXB 2IEAA 5K5EA 2WTMA 4GNRA 3E3AA 1G64A 5HF6A 3N0RA 4N3CA 3BGOS 1KO8A 2GA8A 4KO8A 3D2LA 4RPGA 3TNFA 3ZI0A 1IEQA 1RKUA 1NVFA 2JLWA 4C06A 1KI8A 4UVHA 1CYEA 2MSNA 3VR4D 4CR8A 4IUDS 5A5VA 1WL8A 4H3SA 1L5QA 1XLUA 3T1HB 3ZQUA 1SVKA 3ROQA 3ZHXA 5DULA 3KS9A 4OHUA 4YASA 3RSLA 4GKAA 1TD1A 3UHFA 2W6PA 1SUSA 4M76B 4KQ6A 2CMKA 1XDWA 4D26A 3I4LA 5FBKA 1P4SA 1XPJA 3S2UA 2P6RA 2IW3A 2DMRA 1E6EA 3RU7A 2EXXA 1XU9A 3A6KA 4PHTA 2VK4A 3Q7PA 3GZJA 5EHXA 2CW5A 2H5LA 4ZTBA 3BX1A 5FO0A 4DSTA 1XVLA 2M9MA 4JDPA 2ODEA 3K9BA 1D4ZA 4D0RA 1FYWA 5FD8A 2VNHA 3L4SO 1RJWA 2QV0A 3DCNA 3BUSA 3VOSA 4C4PA 5IUNC 5LUAA 3BQNB 1ADJA 1IJFA 5KCZA 4MI3A 2YUIA 1VL8A 3TL2A 1HQDA 1C8BA 1HOTA 3QHPA 1Z7YA 3H3JA 3Q12A 4R2LA 2HN9A 3EC7A 2V98A 3OQHA 1K7YA 4Y9TA 1EDZA 5TJHA 3V4SA 1ZEMA 1F17A 3S29A 2YW2A 4ZCQA 1EX6A 3JWIA 2AYZA 1KDYA 2I1VB 3HJBA 3DNFA 1OGJA 5ARDA 4J16C 3UANA 2QLBA 3CUKA 1HE3A 3TB4A 4LXUA 5AKIA 2Y2VA 4ZCPA 3N7TA 1N6IA 3CW9A 3KJGA 4LJ4A 4OLHA 3VC1A 3EWIA 4F3NA 4O02B 4XOUA 3Q2IA 1G4HA 2Y0DA 2ZZKA 1MB3A 3CRRA 3ROTA 1N1EA 1P60A 4Y6GB 2ZYWX 3WLHA 2JLAA 4FR0A 3O0TA 1FY2A 1CS0A 2AUTA 2V58A 3VNVA 2VAMA 3EWAA 4QLOA 3KYJB 1JR2A 5K8UA 2HMSA 3G9QA 4YYEA 3BILA 4DMGA 3P0HA 4G86A 4JENA 1I13A 3JQEA 1USGA 3ZBQA 3U60B 2Q5IA 2A1UB 3Q5GA 3NJ4A 2W2KA 3DVQX 3MSCA 5LQSA 4P93A 2QR3A 4ZI5A 3PVZA 4WNIA 2AOUA 2XUFA 4OQFA 2JFNA 3MWDB 2YDXA 4RV5A 3HZHA 4IZIA 4LNUA 4LWOA 2PDAA 3JQ7A 4PNHA 2XOEA 4B17A 2WJGA 5BMVF 1BVYF 1UBOS 2HIHA 5A4KA 1A8SA 2D3TA 1F14A 1XFDA 4FSXA 4MQMA 1LBTA 3K1TA 1FTGA 4NV1A 4PRKA 1YBVA 2EJBA 2Y1LA 4E7PA 2F3PA 2XQVA 3CRW1 4DSZA 5EJ5A 5T4HA 5KYVA 4LZPA 1SXJB 1E0DA 3CMMA 3RC7A 1QR2A 1LLCA 3F6YA 4BV3A 1EJ6A 3PYMA 2ODBA 5LZ2A 3OSZA 3QV1A 2OCDA 3KKQA 1FFXA 1RLTA 4ZEXA 2ONJA 1ICIA 2MT9A 2HA4A 4WUVA 5G0TA 1V1JA 2Q5OA 1JEQA 3DV9A 2C2XA 2D0DA 3BIWA 4O33A 1IBKB 1BS9A 1V16A 1FXWF 4P08A 1IBMB 4NXNB 3BJRA 3ZJ5A 1DG3A 4O4JF 3A4TA 5K3FB 4GLBA 4OEHA 1BWRA 3DV0A 2YS6A 1R9NA 1ZS9A 2JASA 3V8NA 1ZK0A 4P3KA 3D43A 4MRMA 3DE6X 2JCBA 3GRFA 3NKLA 3LDAA 1VGQA 3OF3A 1M8PA 1CEEA 3O21A 1MNQA 3NNDA 2PXHA 8ABPA 2WYHA 3O4RA 1ZGGA 2P2CA 2ZRLA 4CEHA 3KXDA 3TRKA 3IUSA 4OI2A 4JBWA 1KDOA 3SK0A 2AXPA 4RACA 2B8EA 4ZHQA 1DIAA 3A8TA 3ENZA 2A57A 4MVJM 1VB5A 4O2BB 5D3ZA 3T61A 5IVDA 2D6FA 2CXSA 1QYXA 2C4VA 4XR9A 3SR4A 3TIVA 1VHWA 1SUAA 3ZIDA 1XCMA 4ER3A 3O8CA 4E3ZA 2QX8A 5AW9A 3ZHZA 4F7WA 1RQLA 3EGXA 5THQA 1ND6A 2AFIE 4RZ2A 3E9EA 4C29A 4RHCA 3D8SA 4P7BA 2P5UA 3AY7A 3WS7A 4NPAA 5EXXA 1JFTA 4OLAA 2J0QA 3P9YA 4QFMA 2VNAA 5F1OA 3L7KA 4NZYA 5IJ0B 3WBFA 5JWOA 3R7WB 5K0CA 3QF4B 3MJSA 2BBWA 2B9EA 2PPVA 3RT1A 3BMQA 3WLJA 5TEVA 5I9BA 3A2NA 1LGYA 1VKNA 2IZ6A 4NU6A 2XNSA 1P3DA 3CNHA 1XLVA 5F3DA 3T95A 5JYDA 1WABA 4FWTA 4KMRA 3QVXA 1R0BA 1U3FA 1JGTA 1MB4A 2LBPA 4M87A 1IXRC 4M36A 5FBQB 4JQZA 4CZ2A 3LT0A 2OVBA 4NVRA 2BT4A 3E58A 2PL1A 1MF7A 1RLUA 3NDJA 2QG4A 3JQBA 1J8YF 4RQBA 5D5HA 3ZW9A 3ZVKA 4CIVA 4ZOQI 5BN4A 1CK4A 2CV1A 2F3SA 4JY7A 3FCSB 3EQ6A 2Q6KA 4H3KB 4LY6A 1I6LA 3ZGLA 1RHQA 2V65A 3OZTA 1H6BA 2BI8A 4AMZA 2QUJA 4HDQB 1PX2A 4R1TA 3U7JA 2TS1A 3DOOA 4BZQA 4QXPA 2QYHA 1T1JA 1RNLA 4UEQA 1KL7A 1E3WB 5BQ5A 1JDBC 4ABTA 4I1PA 1BDHA 2ADOA 2Q9BA 3DFZA 3MEQA 2IXFA 3GIWA 1XROA 1C0EA 4L5YA 1Q2XA 2E48A 4NOLA 1GPWB 4C04A 2C5GA 3ABOB 4WLUA 4MV5A 1ZAYA 3SQOA 3UV6A 4AJ4A 1RI4A 3D7SA 5HVNA 2JGNA 5C9ZA 2RHDA 5C80A 2HXYA 2DU8A 4X64B 1C7EA 1KPGA 3OTQA 4GC9A 1E66A 1XTTA 4RORA 2YQ4A 3RRFA 5H80A 5LOVA 1F8FA 3V7YA 5EIBD 4LDPA 2FDCA 2VHCA 3C7CB 3O4HA 4M99A 4LRYA 4ND7A 4RD0A 3U49A 4D56A 4OI4A 4Q82A 4P32A 5JMOA 4B7CA 3TYXA 3ZCTA 3CF6R 2ZEJA 1L4FA 1L5FA 4GUDA 1ZGCA 1EFPB 5LQKA 2X2EA 4OQEA 2OYCA 1ECLA 2RDMA 1XTUA 1BYUA 3JATB 4NNPA 2GPBA 4FCVA 2WHPB 2ZB7A 2WIKA 2HOQA 3GCXA 4K9DA 2X8BA 3GBSA 3MUOA 3NRJA 4EPWA 4YMWA 1KIFA 4QFDA 2FWMX 1C9MA 4NARA 5TXGA 1A8QA 1JECA 1WP9A 2QD3A 5ARCA 3O3NB 4TWIA 3UXHA 1GUBA 1XTSA 2RFLA 3VTAA 3I34X 4U39A 4AWXA 3LT4A 1UUFA 4B85A 1NQUA 4AS2A 2PAAA 1WZIA 2O2ZA 1A72A 1BWPA 1L9XA 4BX0A 2GS9A 2OCIA 4CLOA 4HO1X 3PEVA 2XD4A 2M6KA 3K72B 2GN2A 1CJCA 2H1SA 2YZKA 3R1IA 3UNXA 5K6RA 2RGAA 3ZX4A 3OZ7A 3QBDA 3V4RA 1ZOLA 2O2IA 4ZYLA 1Y5MA 2CVFA 1V3QE 4ENPA 5L40A 5KNLA 3WJ2A 4IR7A 1UFVA 3C98A 3DCYA 4K6GA 5TPWB 3WIOA 1P1CA 3HVRA 4R6WA 3F7NA 4PY2A 3ZHBA 3N0TA 3UBMA 4JUCA 3D6VA 2YJTD 1ZJZA 3T9EA 1GZDA 4FCCA 3RVDA 4FOSA 1AU9A 3K1AA 2E21A 1SCUB 2WSMA 3NHZA 1SG6A 2XOXA 4KQGA 1RS0A 4YJ2A 1T5LA 1W87A 5DNDA 1QH1A 4P2GA 1DKPA 4NG5A 1JPJA 5EPEA 1TGVA 4JI0B 3AHGA 1A97A 2BZGA 1MG5A 3E8XA 3K3PA 4RFVA 2PRSA 1KEPA 3AVYA 1H85A 1TFUA 2EW2A 4EA6A 1M6HA 1E1KA 1K3UB 3RSQA 4DZTA 3EJ6A 2Q2OA 2PRJA 2PT9A 1PQPA 3WDSA 2PIDA 1YOVA 1Z82A 2NNWB 3KK0A 4H4EA 4IAOA 2AW5A 4TTPA 3RS8A 3IUNA 2Q5JA 1P5HA 2GM9A 2RJ3A 5TRTA 4J6FA 5EJEA 4S1WA 3TJZA 4RGVA 3AETB 2B2CA 3LNCA 1KGSA 4AZ3A 3JYLA 5FA8A 5U9CA 1XR3A 3AG6A 2A5YB 4FYHA 2R8ZA 1A1SA 1JQKA 4OHPA 3BGDA 4QBGB 2JIRA 2ABWA 2VDJA 3ONDA 4MKGA 4TMVA 5AM4A 5LNK6 5LU8A 4HWGA 4TTQA 2PZKA 2HXGA 2ECQA 2AC7A 2IU6A 2NZVG 4HPWA 4PLCA 1W9HA 1IXSB 1XRSB 3OZBA 3ZQ4A 3ER6A 3CKMA 1ZJYA 1X3SA 1MAAA 3ORHA 3AL2A 3ZE6A 5HKBA 2FLKA 1XMQB 3ZCSA 4WK0B 4YMVA 3N2EA 1GNSA 1GITA 1Y3FE 1U8ZA 2VP2A 4EHLA 2QW0X 2INGX 5COQA 5HJ2A 2Q4BA 5KTOA 1LX7A 4ZU1X 2QZJA 1QHSA 2C8VA 2FXIA 4X8LA 1NVVQ 1FP6A 1RW4A 4Z7OB 2BL4A 2IY8A 1PFWA 1K86A 3IT1A 3QENA 2Y6VA 4HG2A 4BAGA 3BD8A 1C4OA 3SQMA 2GBLA 1RYZA 2XVAA 4Z0NA 3UICA 4F91B 1YJBA 1Q95A 2AJ8A 3N2ZB 4HI0E 4XYGA 2NP6A 2JI8A 2M6LA 1VJ1A 3I6ZA 1AH2A 5KOHA 4L4XA 1GZ5A 1T8RA 2OM6A 3SC6A 4B2LA 4E31A 3GGOA 3AP3A 1W29A 2Y1WA 3UFXB 3BERA 4OI0A 4FXPA 3G0DA 4LZAA 3WADA 3RYIB 1M6EX 2NGRA 1VE9A 3OUUA 3P26A 1NN0A 4J2HA 3WK6A 1OLSA 4B1FA 4F04A 5LNK1 3GAAA 2DHQA 3GFVA 1O8BA 3R09A 1V11B 1UJ4A 2CMDA 2IGBA 3A9SA 5BV1A 2WM2A 3UHJA 2C8LA 2OBLA 4OHMA 2PX6A 1N2HA 2J31A 3IT3A 4KPFC 3O8OA 3RJTA 1IHXA 1NR5A 2WA1A 4QXMA 5DM60 3AUSA 3ET4A 4G63A 5DV9A 1N5MA 3PDJA 5AT1A 2V6IA 1NVGA 1O08A 4LHYA 3OT4A 5CIYA 2IU4A 3DHVA 3U3ZA 1J8MF 3GEGA 4JNCA 3LKVA 1GN9A 4OJTA 4RKRA 1Z17A 5BSTA 3M81A 2JK1A 4FUQA 3OKFA 1SN7A 1O2DA 1V5IA 4Q00A 4MZDA 5FLEX 4Q1CA 4B4DA 1U1IA 2C5EA 1ML4A 1NXOA 3CVJA 4FUTA 2J0EA 2CB9A 4TM7A 4XIYA 3RSGA 4BO5A 1LBQA 4DC1A 1KI3A 3IKJA 1WHSB 4KMSA 4OXRA 4CR6A 1E5LA 1P7WA 4DIDA 1NMSA 4PCAA 2IS4A 1EHYA 1Z3IX 5JH7B 4M1MA 4BUCA 1Z56C 1Y6GA 1V7PC 1ZNYA 4I9GA 3TEMA 1UH5A 1N3BA 1DJLA 1U7HA 2V7WA 3HC7A 3WLTA 1HDYA 2P0EA 5JTTA 1Z73A 1TQ8A 1ZRNA 1S3IA 1RWVA 3C1AA 5TS3A 3JQDA 4GRDA 4B76A 4I1OA 1UK9A 4BNLA 1SPBS 5EKSA 1ZUNB 2NAPA 2QJRA 3PNPA 3QVGB 5I6DA 4NE9A 3M83A 3C6YA 1U81A 3D8BA 4BFUA 4R7TA 2CJWB 3ABQB 3I76A 2QVCA 4LWQA 4ZMSA 4GOMD 2OLJA 4L08A 5G0WA 4EFMA 2R85A 3CCBA 1DX9A 3V9AA 4MCHA 2OGSA 1HT3A 2ACWA 1E60A 1F8YA 2XY4A 3IS3A 4G4SO 1MT3A 3SICE 1GNQA 3EIEA 3J80A 3RBXA 5DNUA 2XQGA 2QUBA 1QLHA 3U0VA 3GX1A 3UH1A 4BAZA 1BXRA 4WZBA 3QQPA 5CXXA 3LECA 4GZMA 4HWPA 1JIKA 2BFDB 5IANA 2OXCA 2CY0A 5KAPA 4BJ6A 3TX6A 2H18A 2NPOA 2QU7A 4L5BA 2Z08A 1ECJA 5H16A 3FBGA 3MOSA 3QP9A 3EGOA 1OCEA 1GSIA 1IAVA 2CNDA 4PVDA 3LD9A 1W85B 4QJ5A 2G9UA 4RABA 4WKGA 5DX8A 5C2JB 3MUEA 3MWGA 5ICGA 5D6NA 5K8VA 1N2CA 4ZVSA 4BLRA 3ZWBA 1Y48E 4M0CA 2GDJA 2CLLB 3ZDDA 1LFAA 1NXVA 3FWHA 1O54A 4H60A 3NIWA 3SSMA 3RSOA 1SUBA 4UNNA 4EVQA 2AOWA 4MQ5A 4Y2YA 2XXJA 8AT1A 3Q3JB 4EI2A 2VH5R 1IY0A 1ZGZA 3AKCA 3P4UA 1GLVA 1AKNA 5C8VA 1GJRA 4G09A 4G0MA 3P96A 1YL7A 5HSGA 4FE7A 3RVQA 3WK5A 4M38A 4ZPXA 4EKNB 5HRCA 3HP7A 3OZUA 3PA8A 3Q6NA 4CU5A 3KJFA 5G4KA 2JIPA 3ICOA 3ZU4A 4UEJA 2R1VB 5JISA 1Z6TA 1E79D 1PZXA 1RWWA 4DY4A 4XQGA 2ORED 1EVQA 1U5BA 2Q45A 5AJYA 5I7UA 4DTCA 3UB3A 5D5QA 1FLAA 4MWCA 4AM8A 5ECYA 5L3QA 4MR8B 3Q6MA 1D2GA 4WY5A 3WY9A 2UYHA 4TYMA 3GRUA 1C29B 1XD8A 2EGHA 3UW3A 4BLUA 1ZMBA 3TR6A 2Z09A 2IEIA 5JVDA 4MNTA 4BO9A 3BQMB 5EKUA 1U0BB 1U3DA 1BWQA 1C8LA 3NV7A 3BH0A 1T0HB 4HYYA 221PA 3N2GB 1I3MA 2DG2A 4WZAE 4JJKA 1QOZA 5IT5A 3EZYA 2HSZA 3ERCA 2ALJA 1DKNA 1R6XA 3P19A 4I4CA 4AJ2A 4KSBA 5EJ2A 5HMLA 2GXSA 3U26A 3BH7A 2DLCX 4E4RA 1SOUA 2G25A 1PFYA 3WWEA 2SKEA 3PHLA 1OVMA 1XRQA 4TWJA 2PH1A 3IFSA 1IB6A 5JCPA 5T4EA 1A8IA 4B8WA 1CEXA 2F1OA 3GV0A 3ZZ0A 4AJPA 1PUXA 4ZYWA 1Z5NA 5B53A 3I0ZA 2FPWA 3NVMB 4P4TA 3B3GA 4HP8A 3L7YA 4WERA 3VVCA 3M1IA 4CEIA 1PFVA 2C20A 1LTKA 3M7IA 4ZVVA 5K0ZA 3DKVA 5F3RA 4O4HB 3ST7A 1PCXA 5AVZA 1Z26A 2J8ZA 3SR3A 3VC3A 3COJA 1KOGA 1LTHR 2I6TA 2Q2NA 3DPIA 4KH0A 2VDVE 1GA4A 4UPDA 2AQIA 2FEOA 4QNMA 4OBWA 3UK0A 2VRWA 1F38A 3LX8A 2YZ7A 2YRFA 4MUFA 1ZCZA 4BNDB 1PVDA 5DGCA 1FP1D 2X3YA 3O8NA 2BHRA 4ZJUA 4D57A 5LCXA 4G8BA 1UJ6A 2YHSA 3X1WA 1HZJA 4WA8A 1AF4A 1EK2A 4AF7A 3ZHQA 5LM3A 3KSUA 1KE1A 5B55A 3ZHUA 2JAPA 4L0MA 1UC4B 3KZNA 1FLNA 2PMDA 3ZWDA 1VJ5A 2YTZA 3A9WA 3LTNC 1BHO1 3GARA 3S2YA 1GPNA 4I55B 4IBOA 3DVRX 1ADFA 1VRWA 3CUSA 2QD2A 3B85A 2HJWA 4LF9B 2R4TA 2C2BA 1GRQA 1CWUA 1QHEA 2ET6A 1DC3A 3NVDA 3PX2A 3A4MA 4QNNA 2B5WA 1WZEA 2NLOA 3PDUA 4GI5A 4QJBA 3AJEA 5A6VA 1VPDA 1JAYA 4HDCA 5FJIA 1K7CA 4DDTA 1JFSA 2OZKA 4CKBB 2UVPB 1C4KA 1VLVA 3LJKA 4GNKA 4HQ0A 4ZODA 3N2YA 1XI2A 1OH6A 9LDTA 2WQ6A 3PNQA 4HXGA 2AI3A 2HKIA 2WQZA 5I4KA 2DETA 4CEJB 3LWDA 1JTEA 1AK2A 1VBFA 1FS6A 3GLSA 3NOXA 4P36A 4D44A 1JL3A 5IT4A 2DPHA 1DBVO 2J46A 3U44B 2BGNA 5DKFA 4J4BA 2IS2A 1P2SA 4Q4HA 4TMKA 1V9SA 3OOYA 4V38A 5AUPB 3LHIA 5HZGA 1J56A 3TTSA 5LJLA 2RB4A 3RREA 3MT8A 2HPHA 3G85A 3MTIA 4N6NA 5K0SA 4AQ7A 5C4IA 4W1PA 2ONCA 1G8PA 1B6TA 1ZM9A 2V7PA 2X41A 5K4AA 3STUA 4ARBA 4ZIRB 5K0TA 3U7QB 2GD0A 5KX5B 2EBHX 2P79A 1ZJ5A 2GAIA 1AHHA 3CPHA 4GH5A 4RZIA 2J7KA 4W5QA 3FKSD 2FZWA 4BTLA 3CNOA 4LV6A 4ML3A 3GJ8A 4L78A 5A4IS 1HT1E 1E0JA 2NAFA 5M5BA 4XM0A 3RVPA 1Q0ZA 2CNWD 2QWXA 1RM0A 3U5ZB 4M9XA 4YV7A 4L2IA 3SBXA 4AICA 1GM5A 2YVLA 5LQUA 4JFAA 1PYOA 3T41A 1NMQA 2FSPA 2OMKA 3A9VA 5CLLA 2OEPA 4NCAA 1OC4A 2OD2A 3KTAA 5CA0F 1GYRA 3IA7A 1U7DA 2ATXA 5ESXA 4DDUA 4GD3Q 4M1WA 1POXA 2A9OA 4EGSA 4PS1A 2BFFA 1FYDA 2VJOA 3R7SA 1F2TA 1QZXA 4J29A 4JMPA 4EG8A 1ELOA 1KI6A 1XTJA 1XZAA 3GEMA 4MRSA 3UJDA 3KR0A 3AC0A 1DJMA 1OI2A 4RXMA 2JFXA 1XMXA 3CLUD 1ZJWA 1B8UA 4KAFA 2A58A 4FYMA 1LPNA 4A03A 3TGLA 2GCEA 1JHAA 1XXLA 1Z5OA 2AH5A 2G0TA 3A1EA 5AJXA 2NTYC 1P9OA 4L75A 4B8YA 1PJZA 2A9JA 2I6XA 2V55B 5U4QA 5DGTA 3TEFA 5L7YA 2FE1A 2WSYB 3BXXA 3B9PA 3U39A 1I0ZA 2JC3A 4G0OA 3I23A 4A6PA 5E9JA 2C2HA 3C3MA 4F60A 4HDRB 2W2MA 4D8VA 1TZMA 5IJXA 1YFZA 1H4SA 3KQVA 2KWIA 1PDOA 1OMOA 4GXQA 2GEFA 2Q1XA 2IHBA 1G0OA 2WIDA 1WY7A 2YXEA 3QHAA 5DW0A 1STOA 1OXKB 3I30X 1Z4QA 3MXOA 1CIVA 3B1KA 1WWKA 1IZ9A 2ZUDA 4L7VA 4Y2TA 4PR0A 6AT1A 1YZYA 3EYWA 4QVGA 1RDFA 5CDFE 2OG1A 4R2XA 2OWDA 5F1KA 1QRUA 2D5BA 4REQB 4HB0A 4WZ6A 3G1WA 3CSSA 3V97A 3M5DA 3TBFA 2YC4C 4HUTA 5AOBA 2VPYA 1L4BA 5AVJA 3O93A 3MJVA 4AG5A 3ZE1B 1G21E 2D1TA 2PLFA 4Q3CA 1J9ZA 1GUZA 1P7YA 3BVPA 3KX2A 4B82A 1ETHA 1H6DA 4AC9A 3UK7A 1K7EB 5FWXB 1QE3A 5CT8A 4C4TA 4RD2A 1WV1A 1XF9A 2D7CA 1GCAA 2VCHA 4G07A 5JNLA 3E9ZA 3UGQA 4F4JA 3MTBA 5C34B 1ZUWA 2CWWA 3HYLA 1JHYA 4JLKA 5BSVA 4LYHA 1YZ3A 4ODIA 4B31A 5AESA 5A2QA 1LPOA 2WRZA 1R5OA 3OOEA 4JLAA 3ODGA 5BWNA 3JD0A 3T3EA 4IKPA 4M9CA 4R54A 1U0RA 4HUQA 1C2YA 5AKJA 4MKRA 4S24A 3HXMA 3RT7A 5CH3A 1OBHA 1P2FA 4FDUA 3OCVA 4Q9JA 2ICAA 1E20A 2FR8C 1EK5A 3H9EO 4YRSA 4JOBA 4UU7A 1AGXA 3C43A 1WE2A 3ABZA 4Q7EA 1UDAA 3PIIA 1TA4A 2X9QA 4Z6KA 2NQ2C 4AJOA 3K9GA 1G63A 3F2VA 4P3YA 3TOCA 1WB6A 5DP2A 1X13A 2GKSA 3RVSA 4X6LA 2GX6A 1G3IA 3C3WA 5CT5A 4WK6A 3V4FA 2Y1EA 2DKNA 1HV8A 1E3EA 2QX9A 4NBSA 1KEZA 1FA9A 1FB5A 2C29D 1NQXA 2QYOA 4PF1A 5JO0A 2Z6UA 1U7UA 5F5LA 5DT2A 4WXYB 1JNXX 3H4MA 1DT5A 4TWBA 3SS8A 2QZZA 2X5XA 3DOFA 1N2IA 4RVOA 4BC0A 3GCWA 3IOMA 2R7LA 2YHUA 1II8B 5EHZA 4WDQA 4W5WA 1IHPA 2WZDA 2M6SA 1PT9A 2HO5A 1WBJB 2X5OA 3CURA 1KDZA 1PL0A 3W8FA 1GN8A 4M8IA 1JFFB 4HQ6A 4ZD6A 5I9MA 3C48A 3L7DA 1TUBA 1R10A 2G70A 2FPOA 3SMVA 5L9AA 2F8MA 4S04A 4Q9AA 2RHJA 5DMHA 4ZYYA 2PKYX 3LVFO 3Q41A 1AM4D 1E7SA 5TS2A 4EB6A 4LXTA 4CG1A 4NMMA 2O57A 2MR6A 1T0IA 1H22A 3F7OA 4M9QA 3RAJA 5A4AA 5IJZA 4HEA1 5BRAA 3PQ7A 3QVSA 4C78A 1D6SA 4NH4A 4F9EA 1KK0A 5ER9A 3GUZA 1BMDA 1TT5B 3HGQA 3AH8A 3EG9B 1UFOA 1ORTA 3ZG6A 2GWHA 3GP5A 3RVRA 3RRBA 1KY2A 1NW5A 2MSLA 5J59A 4UAJA 1OFIA 5AJUA 4AYXA 2G9ZA 2HZ7A 3FA2A 3EQZA 3GAZA 3IUYA 3U4DA 1LSJA 3I6IA 3OQ6A 4KQCA 4NZOA 4DB4A 1GL9B 3ZCPA 4AKTA 1BJTA 2IZZA 2JGDA 5I45A 6GPBA 3H5OA 5SZJA 3Q85A 3L4EA 3WNBA 3N76A 1R8YA 3RGGA 5TSDA 2Q2WA 4JB8A 3ZYZA 4OSPA 4BMDA 5CD9A 1SEPA 2CUZA 2CLHB 3PNLA 2YJ4A 4I9HA 3BXGA 1V0JA 4JU9A 4L95C 4KO2S 4UVIA 3FTCA 1E5TA 1H5UA 4QYMA 1M0WA 3HQ4O 4TMWA 4RMIA 1SHTX 4B3MB 1O94D 2Y76A 3G49A 1I7DA 1KJ8A 1B26A 3AHFA 4Q21A 1LPBB 1QHHB 4FFBB 1K6XA 3NNNA 3W9UA 1S8FA 3UBTA 3WKEA 1KH2A 2NVUA 4PRYA 4Q1VA 3WJ1A 1L5NA 5INTA 2UXCB 2H2WA 1CERA 2F3TA 2FF7A 2J9FB 3DDNA 4IIXA 3PC4A 3R0ZA 4QUEA 5ICMA 2UZ0A 1YJQA 4EO7A 1VHLA 2VXCA 4DCVA 4EKGA 4D46A 3Q7QA 5JWRA 1AO3A 1QCDA 4KSCA 2JFZA 4CQMB 1TF2A 2A2ZA 2QNBA 1DWQA 5FOUA 2FVXA 3AI2A 1T0UA 1KAEA 4CCYB 2B8WA 2Z2KA 3KPWA 1Z37A 2G5TA 2XSZD 2ZWVA 2XRFA 3KSZO 3MLBA 4PPYA 3TZEA 1HE5A 2Q9AA 1OWMA 4M0EA 2VQSA 3OIYA 1MEEA 2WVJA 1RHMA 4WBXC 5JCOC 1AB5A 2ZTSA 1I7NA 1W2WB 3NI2A 1EAYA 4Q0MA 1TYAE 5EG5A 1M6YA 1AUQA 3R3UA 3KKNA 5E7JA 4RAOA 3CF0A 3KFXA 2EZ9A 1U7WA 2HEGA 1PFKA 2GJ8A 1NNSA 2P9BA 4OJNA 3T7CA 4L5CA 3DD5A 3AF1A 4Q1BA 2XWJI 4XWAA 1KA9H 4DVJA 1CNMA 1NBIA 2JJMA 4X97A 1QAMA 3WE7A 2PR2A 4O0LA 1CF2O 4B4UA 2FWRA 2P65A 1IHYA 4F4DA 1R3UA 3CT4A 1T9DA 1L7PA 4KFTA 4ALKA 4NFSA 2WUWE 5I01A 9MHTA 2Q99A 1PNOA 3LXMA 1DXOA 1WKVA 2FJPA 4DR6B 3DAPA 3P9PA 4OAQA 5CW1A 1L7RA 1L5ZA 3HCAA 2H3HA 4IG9A 5CCDA 1SBQA 3SJZA 4WWHA 4AN4A 1T5DX 4WJKB 4F5EA 3F6CA 4ZO6A 3WGTA 3ZY6A 4ZFNA 5CHYA 1S2NA 1W88B 3SBDA 5K8CA 1DSSG 5CAEB 3ZDEA 4R9VA 1E2JA 4DLTA 4HKTA 5JCJA 1SKQA 1R4MB 1CY8A 5KQGA 1A9ZA 1X92A 1XNJA 2Y1CA 2QVXX 3WK8A 5LMUB 2GLTA 3DO5A 4MWTA 3KVYA 2Q28A 4X6UA 1YFJA 1T8YA 4K28A 1DC4A 1YS6A 4I8IA 3UB2A 3A7DA 8LDHA 1QGUA 1L4MA 3KYDB 4YMIA 4Q4CA 1OASA 2RG1A 3ITKA 1KQGA 1CDOA 2HEIA 3DFUA 5FT9A 3IULA 1VPWA 2CHFA 1QJCA 1GILA 3CISA 3TDNA 5A3VA 5FKJA 5DTMA 3ZI4A 1KJ9A 2BSQA 2YIVX 1KI4A 2IELA 3BCSA 3DM9B 3RYFB 2ZW9A 2QF7A 3W8NA 1KEKA 4XWOA 1X7XA 4AF6A 1TAUA 3I39X 1FFGA 3Q7IA 4X65B 1NHGA 1A77A 1E1RD 1CZHA 1ZVMA 3LGXA 4IIGA 2FFJA 2BHNA 2XXBA 4BB5A 4KQJA 2GSDA 1MTOA 3LOPA 1XTBA 4PTZA 1R4ZA 1ULAA 3CO0S 4YJFA 4H15A 4ASUD 4CGZA 3THYB 3RKSA 1Z06A 2WWFA 4LAFA 3VZDA 2CE7A 1OXUA 3ROKA 5G1NA 4FW9A 2AW3A 4GSLA 3SJAA 1OY1A 1P74A 4JT9A 1E4YA 5J2UB 1N6KA 1X80A 4URXR 1USKA 3BEDA 4YCJA 3OLXA 3P52A 5MGNA 1EEXB 1XBTA 2P6PA 3OHMA 4F84A 4RX1A 4TV8F 2IBTA 1WUIS 3KQOA 3Q3EA 4TKMA 2HHAA 1GPMA 3FDZA 2QRNA 3ZE9A 4J0JA 1WNTA 1EQUA 1LC0A 1UCFA 2ZFUA 2GMWA 3EH1A 2ZYIA 2JLUA 3G0CA 2Q1YA 4HDKA 4IJWA 1Y42X 2HLDD 1SOVA 3EDQA 3ME5A 1I0IA 3L8EA 3ETDA 4AJJA 1GTVA 3HN2A 4G2TA 2VPPA 3TS1A 2A59A 2J4DA 1JEAA 1L7DA 3IEXA 3C3PA 4US0R 4XEUA 1ISRA 2YYZA 1ECGA 4MKHA 3NHLA 4QYSA 1TKAA 3KT0A 1BOOA 1GGMA 4KZKA 4OBEA 3ETHA 5ALHA 4ARUA 4BQFA 4QUJA 2PS3A 1J25A 3ZVRA 1UOOA 4AKEA 3CEHA 1E2HA 2W2VA 5C1OA 5I8WA 1Q3TA 3LPDA 3FWZA 3QVOA 4U8HA 2PLRA 3ED1A 3DFIA 8ADHA 3WGQA 1QDUA 3FLAA 1GDDA 2ONYA 2WTEA 4PSCA 5KTPA 1TI7A 2NM0A 2BMVA 2G67A 4RKEA 4X0EA 5LZ8A 5DISB 3CZPA 3RFCA 3PYXA 1UAAA 1TZBA 3FH0A 1J8DA 1QE0A 3BRQA 4GF5A 5L53A 1UOEA 2RBEA 2SKDA 2XAAA 3P2EA 1ZGJA 3LRXA 3QFRA 4Z9AA 1UAGA 4Z9YA 4MS4A 1RQ7A 3N2NA 2AFRA 2ZBRA 4L9WA 3HBLA 4LMRA 4ALLA 1FNDA 4XD7D 1K6EA 2OFWA 1I9CA 3QVWA 1EGAA 4CTKA 4J7CA 4DUZB 2VXYA 2GZ3A 3PFCA 4H1UA 2HWWA 2HPZA 1KI7A 1PLKA 3ZDFA 2FMTA 1EH5A 1MC5A 4MYRA 2X15A 4LGMA 3OJOA 3ZIAD 3ZN2A 4EOGA 5DNCA 3I1IA 1WOYA 1KMQA 1QOQB 3B1XA 3FYUA 4KUEA 4U9UA 3WAKA 4X5OA 5L6MB 2PUAA 3JARB 5GONF 5B6PA 2OO5C 1RJ9B 1USUA 3MRTA 1UPUA 2Y05A 3O75A 1BN6A 1A7JA 1TEHA 4IDCA 1CQZA 2MHCA 2WV9A 2UV8A 1NVXQ 1Z22A 4LOKA 3T3IA 1US8B 1D6JA 1DHTA 3KAJA 3L4BA 4ZT7A 3VU0A 1HYEA 2G09A 1O95D 4DIOA 2HADA 2C5BA 1WNFA 1XCBA 4M98A 1Y37A 4ZC8A 5SV2A 4I81A 5T64A 3UZUA 2O5EA 4Z4GA 3AIIA 1MEOA 4EHNA 4HL6A 2VH1A 1U0FA 1WVMA 4M0PA 4P38A 3DZJA 1AUOA 3S1LA 3UGKA 1KORA 1KE2A 4II7A 4C2TA 3GZNA 2B2XA 5TLSA 3NBMA 4ZYXA 2VHYA 1H0RA 3PQDA 5DTIA 1M67A 2NYUA 1QF9A 2ID7A 1R74A 2WG0A 1MO6A 1YK0A 4M1TA 4BGIA 1F8GA 1N9GB 1ZYUA 2JA1A 3JYPA 1Z0KA 1PQWA 1I33A 3GEDA 3THOA 4QFCA 3RC8A 1C9NA 1RHJA 4OJYA 3P2IA 4D4IA 5ILQA 1WHTA 1JILA 2VKQA 4QOEA 2FZGA 2VTBA 5G41A 4MRNA 4MR9A 4ZO8A 1H65A 1E1MA 1D6MA 1FPQA 4GZ6A 3A26A 5C31A 4MIKA 2OV2A 3TM4A 3UOWA 1F5NA 2TECE 5KMGA 1Y80A 2M6RA 1B93A 1QHYA 1XXHA 2NZ2A 2R6JA 2FW7A 3QV2A 1W1UA 4Q3NA 4C22A 2YVUA 3BD6A 1F06A 3UJ6A 2Q9CA 1AMOA 5CVTA 1PAUA 2XMCA 3B2EA 1R9MA 1PR3A 3IJEB 4B4OA 2OZLB 4PFSA 4WT7A 3T3NA 5K09A 2C98A 2QOEA 2OR3A 2PH5A 1JHQA 2ZB2A 3LLMA 4KQEA 3NWOA 5CITA 2RD2A 1OXTA 2PGJA 2WEKA 4B9AA 1QBGA 4XXHA 3B5EA 2EKQA 3HDYA 1EVJA 1VP3A 4JITA 5LDGA 1PNRA 3I9OA 4KIGA 3VYSB 5PNTA 3LY9A 1Z6XA 4O2AB 2FW8A 2QJWA 2XUGA 2VPQA 3VKGA 2H1LA 2NPIA 1YRAA 2H1VA 4R68A 2R2AA 2BCJQ 4S35A 2W2OA 3LLVA 2P6NA 4CT4B 3UMYA 1D4OA 1RYMA 3GUYA 5TEWA 2AFIB 3WJAA 1CB0A 4B3JA 1LQ2A 4FDTA 3RYCA 4E4YA 3G2PA 1XCJA 3OWXA 4KQMA 4OYYA 1DELA 3ZCXA 3ZY5A 4BBPA 3U4MA 5EXPA 2QVYX 4KJXA 5J4YA 2DQZA 4ARZB 5B3AA 1JJAA 1TE2A 1W8IA 2IIPA 2QIPA 2W2LD 3C24A 5GM2A 5B7NA 1EU1A 3BL5A 3MG9A 4WCFB 4RTSA 2O2YA 4MUGA 4BWFB 1AS3A 2GEVA 2A0WA 1L8AA 4HQKA 3GVPA 3PX3A 1X1BA 4EECA 5BW4A 3TLYA 4DV3B 2B37A 1WY5A 3C6QA 5JYBA 2C7PA 1E79A 4YP5A 3L92A 3ZQKA 1KARA 4ENRA 4KE8A 4EF6A 1JKFA 2ZRQA 5EPUA 2E4UA 4RK1A 1EESA 5IN5A 1FVXA 1G7RA 2HU8A 2WG1A 4IDFA 1ADYA 1F1BA 1Z39A 4LISA 5KKNB 4XJTA 2XCLA 4B6GA 4R3WA 6CHYA 1AZLA 4MLDA 2EKBA 4FOOA 4P6VF 3UTCA 2F1KA 3PFIA 1QJ4A 1MO4A 2HMVA 1NT4A 1PNVA 2V59A 4ENUA 2XT9A 3IDFA 4FHEA 3TL6A 2C3PA 1M0SA 1Z0ZA 1Y7LA 3P5SA 4G5SA 3KR2A 3SXJA 4BEVA 4BDTA 4F6LA 5A3JA 1JR6A 2A5JA 2ZRAA 1M83A 3IVXA 2QN8A 4ACBA 4RFSB 1N2GA 2H2GA 5EZYA 3QXGA 2YWFA 2XT6A 4HDNB 3S5UA 2Z4RA 2ZIEA 3UAVA 1DDOA 2JD1A 4YQFA 1N2BA 3DB1A 5TB5A 4MYHA 1S4MA 3DBRB 1YS2X 1IHOA 2Q6LA 3WA7A 1IPFA 3QI7A 4IINA 1Q57A 4OO3A 5DIZA 4YFVA 9ATCA 1ZD4A 2A88A 1KZGB 3A6EA 3PQ3A 2JG3A 4ZXFA 4Y18A 1UINA 2VJPA 4FSHA 2WJVA 3IB3A 4CYMA 2NYVA 4OVKA 1H9BA 4JHLA 2YOFA 1DOZA 3D0RA 4E4TA 3P9XA 1NE7A 4C3UA 3HDVA 1H3FA 3FMPB 4TZTA 1G5FA 4W99A 4EK9A 5CA1A 3CMCO 1MVNA 2PRYA 4KE7A 5GWXA 2IHTA 2WWIA 4U9IS 3W06A 5C5DA 1KJWA 1A04A 2VATA 1NATA 1GA6A 1IATA 2P1RA 1IL0A 3D6HA 3OIDA 4RUKA 3R40A 4KXNA 1KYVA 3PCTA 5KWEA 3ZLJA 3PNVA 3E1GA 3WQSB 4R7ZA 2JNWA 2HUPA 4Z54A 5I51A 1IUOA 1CZKA 3EHDA 1GGHA 4UOQA 5JH7A 4LX8A 4LRUA 2CVPA 3INRA 2BKVA 1OXMA 1IIBA 1DFIA 1M75A 2FWPA 2GRAA 3EXAA 4FKMA 4OYRA 4KR9A 3GA5A 5I4CA 1KSFX 5KC8A 3PFGA 1EQ2A 1U7XA 3HYNA 4LTMA 3LBNA 4HBGA 4CJXA 1JYSA 1Y0BA 5TF4A 3U2QA 2C78A 4M22A 5K0FA 16PKA 1QMPA 2VWGA 2HLHA 2YY7A 4IDQA 5HJEA 5YASA 2PD6A 3GLIA 2ZROA 1W25A 4MV3A 1J5XA 2R1UA 3AUUA 3TCNA 4QJ3A 4DUPA 4F97A 3RF6A 2REOA 5AI8A 5B3KA 4NBNA 3TLBA 1BOFA 4WKOA 1ZONA 3RYHA 3JWPA 3D02A 3GLVA 4IWYA 4P82A 3OBBA 4D82A 4PLZA 3UK2A 4CWAA 2P9ZA 2DYKA 3AR7A 1KDPA 3ZGNA 2V6FA 3PP8A 3D64A 4YDSA 5IDQA 1LPMA 1GKYA 1RWXA 2CK3A 2JCSA 2FP3A 2WFMA 4A0RA 1AKRA 2WIJA 4DCUA 1HZZC 3CA8A 1UMCA 4PYMA 3DOEA 1P5FA 3DLPX 1WUJS 1Z34A 4ZRNA 3HXQA 3DBIA 3K7EA 3ZDCA 3QX3A 2DBRA 1Y4DE 2GT1A 3PUWA 3K09A 3NM5A 1HLGA 2DHDA 3VMFA 1E5VA 5E4FA 4BPRA 2W98A 4YJ3B 1EKXA 3N2IA 3FKSA 4WNCA 3QLTA 1SKBA 4JUDX 1JE1A 3VDNB 2I8CA 3PJFA 3TECE 4MDEA 3UAGA 1PR9A 1SHKA 4PLYA 3OCXA 3LUHA 3USCS 2CNWA 4C3OB 2QJFA 3CF4G 3NW9A 2AMVA 3EFOB 1Q7BA 4FGWA 5I3ZA 1D6NA 2A5GA 1JAZA 1JDZA 3B53X 4LYYA 5DDIP 3NDPA 5CX4A 1YZLA 1W7AA 1PSZA 5CLGA 5BMVB 1P81A 1R6AA 2IQIA 5B1SA 4C5BA 1FUUA 1RI5A 2YMPA 3LBYA 1UBTS 1L5OA 1P2VA 1UZUA 2G72A 1XEAA 2ISSD 2ZB4A 3H1TA 13PKA 5KVCA 5KTYA 2ODNA 1PFGA 2PU5A 3QSGA 1QH0A 1RWPA 5IC5A 5ESRA 1PJQA 1OW3B 1XLWA 1T9KA 3SQNA 2GPAA 4TS9A 3DYBA 4PXAA 2F1HA 4XI9A 1KFEB 3G8DA 3DBLB 3O1IC 3VQTA 3FFBA 1P4GA 3UJCA 3DMYA 1GT91 3ZTWA 1EX1A 2IYYA 2J32A 4BNFA 4EYQA 1ZH4A 3IEPA 4HH3C 4ZQHA 4W1RA 4A0QA 3D8TA 4BLSA 3G2MA 3DEJA 2BFWA 2GPJA 4OG2A 4O4JB 4QBIA 3RAEC 2H1OA 1YFKA 4ND3A 5KNDD 3WLRA 5FLYA 3VV3A 1GWNA 2YMMA 5FL3A 1U31A 1HYQA 2AL7A 2YASA 1C7QA 1DBIA 4UCQA 3F9CA 3L8FA 4ZI7A 1W5TA 3NHMA 4ZARA 3M4JA 4AKIA 1K5GA 5TJ9A 1E4OA 3L6RA 4S2EA 2PGAA 2VUHB 4C7BA 1C3LA 1USVA 3Q8WA 5HQ3A 5I48A 5EIOA 2JFUA 4M0MA 4US2R 4UTOA 2AG5A 1FX0B 2RSLA 3P8ZA 2B1QA 2DC1A 3FFXA 3OPYB 2BHTA 5FUMA 3QE0A 4O1MA 3SHVA 4RVCA 2BM8A 2ZE5A 3BE8A 1IB0A 3DUFA 3NT2A 3L93A 5HQJA 4CMAA 4DM4A 1GA1A 5JXIA 3R5XA 1C1HA 5E8JA 2R3SA 4DRXB 2HA6A 4MWOA 5IWCA 1ISJA 2KQUA 3G79A 3WRYA 3O1JC 1RE0A 2YJGA 3HADA 4LBYA 4QTUB 5CX1A 3QOWA 4PYQA 3RE1A 5C5EA 2ZE6A 1NLFA 2J6CA 5KOJB 3IHKA 3DTVB 5JU6A 3W5DA 4MUIA 1NXTA 3GMDA 2CUNA 1F20A 2Q3CA 6ADHA 3A9TA 1P2UA 3SFTA 2NXWA 4L1KA 5GOZA 3UMBA 3NOOA 3EXIB 4KQXA 1ZOOA 2WAAA 2QBYB 2KX7A 4A5SA 1FTWA 1JU4A 1RVDA 2VG8A 1N3YA 3FDJA 2VJYA 4MR7A 5ALYA 1O77A 4HDSA 5AMXA 4AYTA 3NMUF 4DXHA 4MS1A 3G2NA 3KPJA 3K70B 2JGMA 2JJYA 4YRTA 1GG9A 2IBSA 4BXOB 1N1MA 3OJ0A 1RJDA 1QCCA 2XWSA 4XM2A 2PYDA 2JF0A 3C70A 4WJLA 4MDHA 3H0EA 3AILA 4AJHA 1G2PA 4UJ3A 2G9QA 4QXOA 1MQ8B 4WNAA 1TTTA 2WHXA 3ZK7A 4CM1A 4Y0NA 2C31A 5DM0A 2Z0MA 4D0LB 2QL7A 5TC4A 5BUZA 2IF2A 4C08A 5JDIA 1UPBA 1QTRA 3ROEA 1V43A 1YU9A 2XJ4A 2JH3A 2VZ0A 4DG8A 1QUEA 1T2FA 1GQOA 2VTEA 9GPBA 4I14A 2OBYA 2M98A 2W6NA 1DCTA 1UBUS 3A1UA 4KJZA 4BVFA 2IDKA 4BY9E 3TAXA 2ZG6A 1NW7A 2FCRA 1G8SA 3R9IA 1WSAA 5FTKA 1IZZA 2JAQA 2WJYA 3M5CA 4WLOA 3UIEA 4UJ5A 1O96B 4GM0A 2CDCA 1TC2A 1W4BA 2ID4A 2H4JA 1XVUA 1L7MA 2GEJA 1KFKB 2HV9A 3OJCA 2QUAA 5G40A 2ZR8A 4KPYA 2DJ5A 5KSWB 3BPSA 3QMPA 1B3BA 3LH5A 5EZYF 4HB4A 2C3UA 3U9LA 1I5EA 1ZCFA 2XVXA 2C5SA 5ITZA 4N3AA 3VNRA 4YP7A 2D1YA 2EKLA 2FZLA 4WPGA 4D02A 4NWIA 3C15C 3SI7A 4OX9Y 2GO1A 3QBVA 2VF5X 1C5KA 3D3WB 3EPRA 3REQB 5LWHA 1Y3CE 3JYQA 4B44A 4PX5A 1MX1A 2NU7A 3KNZA 3UMFA 3MB8A 2P2NA 3NPMA 3GH1A 3ZYCA 3MJCA 4S12A 1I5OA 5T4BA 1QX4A 3KYIB 4YCLA 1G291 2EZTA 3FDIA 1XMSA 3GLKA 1FLVA 3GVCA 3LGSA 3ZCRA 1WUTA 2BCEA 2ID8A 4BN5A 1OE0A 3DXZA 2GXAA 5JRDS 5KVSA 2G4VA 2G1JA 2QTVB 3IE1A 2BGRA 2B98A 4ZHSA 4KC0A 1BJKA 2DWCA 7REQA 5F1YA 1PQYA 1V39A 5JJIA 5JSKA 1M8KA 4DV2B 1U5CA 2O0HA 3BWDD 1YZVA 3LXXA 1O94A 5FB3A 4D2IA 4ZRDA 3T3PB 4D8WA 2QAJA 2QN6A 3VR5D 3V80A 3GLGE 1O03A 3PSAA 1K7FB 2A1TS 5C8ZA 2FRVA 3GWGA 2WAMA 1ISSA 3R4VA 4HAVA 3W79A 5FDFA 3ROXA 4FD2A 2IXBA 1T6ZA 5LC1A 1PJRA 4C7VA 2CHVA 1CJSA 2PQ6A 2W4QA 3B13B 3MB5A 2F55A 1KYXA 1YRQA 2RH9B 5SICE 3WK4A 4BCBA 3CRVA 3OX1A 1CJBA 2F43A 3UPTA 1W36C 4QJ4A 1I8TA 1V5WA 1RXVA 2A5FA 4I3GA 2V5VA 1I6WA 2VRNA 4Q37A 2G08A 5HILA 4A92A 2AZMA 621PA 4MROA 2JIDA 1FTSA 1N4DA 4G8DA 4ZU6X 1FFDA 5C8YA 3DHNA 2CV2A 1WZUA 1RI3A 2HQBA 4FMDF 4TWAA 2R8BA 4E5PA 2VJAA 1B16A 2X86A 1L5YA 3AR5A 2XSZA 2DPLA 4UE2A 3PBKA 3F6PA 2BUAA 4NDNE 3WZLA 1E2LA 3PE6A 3MAGA 3B1FA 1QO7A 1VCIA 2Z95A 1LF5A 2JRCA 4FX2A 5BWMA 1J0BA 4URZR 3QW2A 1U3VA 2V7TA 1F2UA 1K66A 1SOMA 2W93A 3AJ8A 3GJTA 1NUPA 4P0TA 5IVPA 3MD9A 4DW8A 4HSEA 5BSWA 2B9VA 3C16C 2X4GA 3JZDA 3KJEA 3MMZA 2ZI3A 4U6QA 4IGEA 2P75A 4KP7A 4DJ5X 2QM3A 1T8TA 1HNNA 2Z56A 3QSYA 2XRZA 2TMKA 2JGFA 3PRJA 1Q1EA 4RTOA 2FJ0A 2ZBEA 3IO5A 3U81A 4DBLC 1QK3A 4D97A 1NYLA 2I2FA 5FJJA 2F3QA 3K94A 1CY0A 2F3UA 5TQ2A 1WEKA 3HJNA 4BFYA 1R7RA 3EEYA 1WBBA 1QFMA 4H3HB 5CVCA 4EG7A 2BYTA 2HJ9A 4IL5A 5K7SA 2PEYA 1DOAA 1EVZA 3I9FA 1JYFA 2WICA 4QHSA 4CMBA 1TM4E 5BWOA 1LLFA 2OBMA 3H75A 4XGRA 2VHQA 1N8KA 1FJXA 5THXA 2L19A 1WXEA 2ZRBA 4EMUA 3WDKA 3OTIA 1CDZA 3IIMA 1L1QA 1L7VC 1NF3A 1KYTA 4QHYA 2NUPB 3S4YA 3CYFA 1TCUA 3B3FA 1P4AA 4O25A 1N78A 1NWHA 3NYIA 3IAS6 1ZWKA 5A7GA 3ZD8A 3INTA 1BCSA 1XQYA 1OHHA 3IJRA 4YRGA 5GIOE 1E1QA 2ECPA 4K7JA 4NNOA 3WYEA 4U3JB 1A5AB 1RRCA 3CKLA 2K7FA 4PAOA 3JAWA 3MQ4A 1M54A 1NOJA 3GELA 3HEAA 2BCGY 4JVOA 4IYJA 4OBXA 3TPZA 1W4LA 1NBHA 2ZRFA 4Q6WA 3VR2D 4E07A 4RDXA 2DUUA 2P6MA 1W48A 1E1RA 2WA2A 1UJNA 2VHUA 4X6XA 4D1YA 1SCDA 1VKOA 3QNUA 1P5RA 2QDKA 3G02A 2L18A 1C9KA 1LTQA 3OFKA 1JDTA 1WX1A 3DLCA 4WH0A 1GKLA 4A2QA 1G9TA 1M2OA 3E1KA 3ORFA 4O4IB 2GCOB 4PSDA 4QQKA 4W7SA 4ZI7F 3L04A 2JFQA 4MV9A 1A3CA 3X0DA 4E88A 1EFVA 1KBZA 4OBBA 4W5RA 3PJEA 3HI6A 3RTEA 1ADBA 2BGKA 1HF3A 3UMGA 4F4HA 1E9SA 1WM1A 1L5RA 3PQ5A 3ABRB 1E2GA 1JKXA 3ROMA 2V8OA 1JH8A 5B4VA 1Z5PA 3K32A 1NVKA 5JS1A 4G01B 1R8JA 4XDZA 1SUIA 3IAS1 1A2KC 3V1KA 4CETA 1EB9A 2H8KA 2HLDA 3MYRA 5A62A 1DQSA 1ZA2A 2LNDA 1XZMA 4R84A 5EEHA 5JEEA 4FR2A 2EQBA 4KACA 5K8IA 2DERA 5LP1A 3FSRA 4ND4A 1JJIA 1DPGA 1OAOA 2PPLA 3U37A 1Y5NA 5BPFA 2ZJ6A 4LXXA 1P7PA 2KLBA 4NJOA 3M34A 1GV0A 3QITA 4DEYA 4IVRA 4N49A 4DIKA 1RM4A 4GOOD 2MJLA 3LLCA 3AT1A 3F7MA 3KLOA 4X20B 4D3DA 5A7FA 2IXDA 2YOGA 3CUEF 3EPLA 3JSAA 1KP9A 2P9EA 3DXYA 4BLOA 4A8HA 1RAGA 2HIGA 4BNXA 1RRVA 5L45A 2BEUB 1NQVA 1RXUA 1Z4OA 4LXIA 3W5IA 1NXWA 1HX7A 4DMFA 1XQXA 1Q0SA 3SLKA 2WPDD 2VSQA 3K15A 4H4DA 2Q8NA 4E70A 4L4RA 2GF9A 3E4CA 1MJNA 2QGNA 5IZCC 3JZMA 2DFKB 4EY4A 3LQKA 1OAAA 2D13A 3OAAD 4POAA 5F7JA 4R8RA 2QRUA 4QE3A 3D7LA 2C3OA 2GJ4A 2UYGA 3ZKWB 3BXHA 3ENNA 4ABYA 4NAHA 1VLJA 1DIGA 1XC7A 5B1EA 2IZ0A 4AY2A 5H5JA 3NTXA 4Z9XA 3PUXA 4I4TA 4EG6A 1J2RA 2HA2A 2OC4A 3LUPA 4CCSA 4U5XA 1YGPA 1SCJA 4D41A 4RLSA 5IK2D 4ZAZA 4TXJA 2SKCA 5AJZA 4AN0A 1R8QA 2J4FA 2R4UA 5FL7D 2NSDA 4K03A 1JJBA 3O8BA 1P19A 4DNFA 1G21B 2GN6A 4B43A 1RZ3A 2QTNA 2XGOA 3HCNA 4Y9DA 3ZDQA 1UK6A 2X8JB 3M1LA 1S9HA 3L7AA 1RWKA 3GUCA 4AK9A 1Y9EA 2QMOA 1O95A 2ZRNA 4YAFA 5B2ZA 3WDMA 4DYHA 4CFSA 1B4DA 5EXDA 1E3QA 2GSWA 1EIZA 4XFKA 4EL5A 4HGYA 3P4XA 5I9SA 1HTWA 4EHFA 3CUTA 1HA3A 1XKTA 3AFHA 5LLSA 2J07A 2X5KO 3C3EA 3CR7A 4DQ0A 1U2GA 3H5WA 1M2VA 4L6CA 4COOA 1TADA 1XD2B 3OE5A 4XAQA 1T3ZA 1O6ZA 1XDBA 2VBGA 2VO1A 3NETA 2HMWA 1IWBB 1DKMA 4QUDA 4G6ZA 4B45A 1Z15A 1PJ4A 4IIBA 2GNPA 1MN6A 1QKKA 2PTGA 2YHIA 3AWIA 3F5SA 4II3A 3WRXA 4AMBA 5J2TA 4REOA 5IZCA 1R5JA 2CEAA 2XJ9A 3D5QA 4JJ4A 2EZUA 3BMOA 2FEWB 3JQGB 5IPFA 2YFYA 1T8PA 3W4KA 1GRCA 1NJ8A 2VJLA 1Q1GA </