2VJOA

Formyl-coa transferase mutant variant q17a with aspartyl-coa thioester intermediates and oxalate
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
427
structure length
427
Chain Sequence
b'TKPLDGINVLDFTHVAAGPACTQMMGFLGANVIKIERRGSGDMTRGWLQDKPNVDSLYFTMFNCNKRSIELDMKTPEGKELLEQMIKKADVMVENFGPGALDRMGFTWEYIQELNPRVILASVKGYAEGHANEHLKVYENVAQCSGGAAATTGFWDGPPTVSGAALGDSNSGMHLMIGILAALEIRHKTGRGQKVAVAMQDAVLNLVRIKLRDQQRLERTGILAEYPQAQPNFAFDRDGNPLSFDNITSVPRGGNAGGGGQPGWMLKCKGWETDADSYVYFTIAANMWPQICDMIDKPEWKDDPAYNTFEGRVDKLMDIFSFIETKFADKDKFEVTEWAAQYGIPCGPVMSMKELAHDPSLQKVGTVVEVVDEIRGNHLTVGAPFKFSGFQPEITRAPLLGEHTDEVLKELGLDDAKIKELHAKQVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FORMYL-COENZYME A TRANSFERASE
publication title Reinvestigation of the Catalytic Mechanism of Formyl-Coa Transferase, a Class III Coa-Transferase.
pubmed doi rcsb
source organism Oxalobacter formigenes
molecule tags Transferase
total genus 144
structure length 427
sequence length 427
chains with identical sequence B
ec nomenclature ec 2.8.3.16: Formyl-CoA transferase.
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02515 CoA_transf_3 CoA-transferase family III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1540.10 Alpha Beta 2-Layer Sandwich formyl-coa transferase, domain 3 formyl-coa transferase, domain 3 2vjoA02
3.40.50.10540 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Crotonobetainyl-coa:carnitine coa-transferase; domain 1 2vjoA01
1T4CB 2G04A 1P5HA 1PT7A 2YIMA 1VGQA 2VJMB 1XK6A 2GD2A 1Q7EA 3UBMA 2GCEA 1XVTA 2GD0A 1T4CA 1XVVA 1P5RA 1XVUA 2VJMA 1PT8A 2VJPA 2GCIA 2VJOA 2GD6A 1Q6YA 1VGRA 2VJKA 1XA3A 1XA4A 2VJQA 2VJLA 1T3ZA 2VJNA 1X74A 4ED9A 1PT5A 1PQYA 4HL6A 1XK7A
chains in the Genus database with same CATH superfamily
2REOA 4CT4B 1QFMA 4C4XA 2C95A 4RXTA 4WJZA 3OZUA 1IOVA 5J4VA 4HTAA 3K20A 1A2QA 3FTEA 3C14C 2SKEA 3E22A 2AR9A 4Z6KA 2X8JB 2BKEA 1K75A 4IS2A 1USKA 5CX4A 1NVXQ 2COUA 2XCQA 4OLHA 3NJRA 1LSUA 2FB9A 1Z5GA 5FOXA 3RFFA 3SSNA 2BKLA 2J4FA 2NYRA 4DA6A 4OQEA 5LNK6 3MBOA 1ECFA 3YASA 4FUTA 1TKBA 3DYBA 1KEKA 3AEXA 2VHCA 1NC1A 2X3FA 4UEWA 3KYDA 4CT0A 3A1TA 3BERA 2GFIA 5H3LA 1I2BA 2GM9A 2Q0QA 2JZNA 4XYEA 4ZMSA 5LZ4A 1C8BA 2QZZA 3RJ5A 1DSSG 4GEKA 1R12A 1ZUHA 3FWKA 3GYBA 3LI2A 3VYTB 1CTQA 2H2FA 3OD1A 3GUUA 2W0SA 3KKMA 2BISA 4TSFA 5UKDA 3CKMA 5JAHA 1E2EA 2XOXA 2O3QA 4FMCF 3JYOA 1BMTA 1MUUA 1UP7A 1ZMTA 4R3WA 5BUCA 1E64A 2V8BA 3C4VA 4O4LF 2Q2QA 3QVJA 3PQ8A 2D7DA 1JDTA 4MRVA 2YDXA 1DBIA 3M4NA 2RGUA 4PFSA 1X1CA 3SDZA 3R9IA 2O8VA 3P9KA 4IP0A 5REQA 3M5DA 3W2EA 1FRNA 5B58C 5I7WA 4X3OA 1TFUA 1ZRMA 4KJZA 2NGRA 1DBVO 1JDNA 2CJWB 2W8ZA 3GAFA 3FX2A 4YJHA 2FW8A 2CMGA 1J2EA 1T5LA 1WF3A 1Z6XA 3DAOA 3KKPA 3LIIA 3BJEA 5H3HA 1SVNA 3UQYS 1L5HB 1P74A 1P1BA 2JI4A 5TQ0A 4XVCA 1LV7A 2R6R1 3EIEA 5TE9A 4CZ2A 3PPVA 3AUAA 3KPVA 2P2ZA 4YECA 3RODA 3WGOA 4YMUA 4LHSA 4P22A 4LZNA 4UCXA 3WGQA 2HQRA 3F3KA 3ZC3A 3TGLA 2FZWA 5ES4B 3NHSA 1XCPA 2HY7A 4D2IA 1W46A 3DH0A 3FVTA 1IBCA 4RGBA 4JU8A 4HGPA 4WVLA 2VA9A 5DIFA 3TRIA 3WO1A 3R74A 2GR9A 3CCBA 2AT1A 2NO4A 4UTZA 1LVGA 4TGLA 3BVPA 3H84A 2R751 1JLLB 4IUCS 4ZP1A 3WXBA 4HWPA 1G64A 3WLQA 1CRZA 3FTDA 2IVFA 3CZ5A 1XZFA 1R88A 3EPPA 4MUNA 3BFPA 2YWXA 1FTYA 1DTEA 1GG9A 2HRQA 2X2OA 3IAM6 4IVPA 4WY5A 5FKJA 4FB5A 3QZUA 3VXKA 3HMKA 1IM5A 1YL7A 3IP7A 3CRRA 2Z3VA 2CVPA 5HK9A 3H7IA 4N6NA 5GV8A 3QLTA 4AMYA 4EDHA 3K1TA 3TO5A 4RFLA 4IEFB 2DQYA 3TSOA 3Q98A 4AY6A 1J1IA 1EDBA 2DECA 5FI3A 2ECKA 3F7TA 1E5TA 1YGPA 2DUJA 2J6CA 2OO7A 2Z04A 3B3FA 3GUZA 1A7KA 3MWJA 3PDJA 1QKIA 4ZI7F 3EIHA 2A9OA 1IEVA 3RS5A 1DFHA 3I42A 4QFDA 3V7YA 2G1JA 2QU7A 2RH5A 4YJ2F 5FTWA 2G4CA 1XX6A 4BP8A 2CUNA 4U7PB 5BSHA 2I8LA 3FKQA 3KCQA 3KWLA 3UMMA 4BZQA 2A1TS 3B85A 4HDAA 4DIBA 3C4QA 1PZNA 5JISA 4LS3A 5FWXB 4MO2A 3DM5A 4Q66C 4QU9A 1NE7A 1C3LA 1P61B 3GD5A 4IXWA 3AUUA 4D46A 1SULA 4B7UA 4OLJA 1FDVA 4WH0A 1WUKS 2X0DA 2FG5A 4LXGA 4MUMA 5TVGA 2BI7A 2B4TO 5DHQA 3TKAA 2CVZA 5GJBA 2BHLA 1VKHA 2BKVA 4Y1EA 3AQIA 4ABTA 4BQIA 2XRFA 1DC8A 3VC2A 4BN5A 5AWFC 3SZRA 3NU1A 2FR0A 3P8ZA 4N3CA 5ITZA 3AF4A 3FFBA 4WLUA 3OQVA 3EVTA 1KVUA 4UPVA 4EW3A 4PBSA 3WVNA 4C01A 3SE0A 2E85A 2YZ7A 2AJTA 4J0QA 2O0LA 1N2ZA 1KAOA 2IHYA 4GC9A 3ND9A 3G2MA 2IYPA 4A16A 4QOGA 1RFLA 4RTRA 3C3PA 3VKHA 4I1OA 1KAGA 1KO7A 3OO0A 5EVCA 3NEAA 1YO6A 1WBBA 2YJGA 3INGA 2H1WA 1NN1A 1U5BA 1WUHS 3LLUA 1KKMA 4A9AA 3REFA 4N8SA 1JXOA 4R71A 1N2IA 4BLTA 4ENQA 1ODJA 4II3A 2JGIA 2UYOA 1FX1A 2JGRA 4JELA 4ZT3A 4YREA 1XVVA 3RC3A 3N8NA 4BDSA 2QWXA 4X3CA 3BSYA 3ECAA 5CT8A 4XARA 4FDLA 2OAQ1 1QG6A 4DUGA 1HFWA 3PUIA 1ORHA 3TE6A 4F0JA 3LHSA 4LBYA 2QL5A 4LSMA 2CW5A 5K0GA 1W581 4W8OA 1T9ZA 3ZCRA 3KWJA 1QU3A 1FU4A 3JCZA 1RM4A 1D1PA 3WTBA 3X3HA 4ENPA 2ZE7A 1PJ4A 3N59A 2BJVA 4JUIA 1ZM2A 1E6KA 3AJ8A 4OB6A 2PVSA 2UZIR 2ZIUB 4D6XA 2Q3FA 2JIBA 3QF7A 2O05A 4MYTA 3I2FA 4R1SA 3HTXA 5ALUA 3EUAA 2ZREA 4IDOA 4RJLA 3LGSA 4D3ZA 3UHOA 4DVGA 4JA2A 4UAUA 5TC4A 4ZJUA 1QV9A 4EHDA 2V7PA 5CMLA 2OBLA 3GN2A 4EHKA 3Q7SA 3T3NA 1HYEA 4JXJA 5TEVA 2NOAA 3HKEB 2BHTA 1P17A 1A7AA 4GOMD 4JVSB 4MKXA 1I5EA 1LRJA 1TVKA 4GOLD 5CHEA 3TTTA 3EOAI 2QQ5A 3TQHA 3S1SA 4RV9A 5JARA 2Z6VA 4IXNA 4CGYA 2EV9A 2Q1TA 3MCZA 1JG1A 2VXCA 3MUEA 4HZUA 5FHRA 3OU2A 3GQBB 1NMZA 4CUJA 1W47A 4IMPA 2KBFA 4BECA 1SBCA 1Q1QA 1S89A 4JP8A 4MKZA 2DH5A 3BSFA 1CCWA 4JJ4A 4NENA 3LS2A 2RGEA 2YFHA 2ZIVB 3FR8A 4OOEA 1DG9A 5A5EA 4ZT5A 3H2SA 3UY4A 1AB5A 1P9LA 2VH5R 4JBNA 3EF3A 2DCMA 5B6PA 4RTSA 3D8NA 1G291 1MT0A 1I14A 3WI7A 1NGSA 3QY9A 2HV9A 5J5AA 2X5OA 4D56A 5AVZA 4MDEA 3SF8B 1E3WA 4AECA 1XPUA 3HUEA 3L7IA 1SU8A 3S5JA 3GJSA 1QOQB 2WNHA 3ZU5A 1VZ2A 1VBMA 1YS4A 3O38A 5K3BA 4LI0A 3O7WA 5IJ0B 2VAPA 2GCOB 3BH6A 1OLSA 4LMBA 4ZOEA 2AEJA 5BSVA 1KK2A 1ISPA 1WXXA 3N6RA 2H18A 1XZEA 2QTNA 4RZ3A 4WECA 5JYBA 1TUEA 2Q49A 2X76A 4UM9D 3ZHQA 3ZDAA 4K9NA 2IXGA 3TR5A 1DKUA 2JKYA 1PLJA 1ZDMA 1B41A 3RU2A 4JOQA 3MSXA 3RC2A 1R8QA 1VE1A 2RHRA 3A9RA 4PC7A 4F2PA 2PZBA 1E3TA 1TYDE 1IYZA 3FIJA 5IDQA 2BZGA 3IUYA 3V2IA 4PZ0A 3SKVA 1R3UA 1E2FA 1NW9B 1R4NA 2BUCA 2FE1A 4INOA 4MV5A 1E2HA 1ULHA 4ITVA 4Q02A 1Z8DA 3K0AA 4DNXA 4CKEB 2UXDB 3GFRA 3BWVA 4IFBA 5HEKA 4ZAGA 3WGIA 2GD0A 1Y6ZA 4OHMA 2GAAA 1UXKA 3NBZC 1GNPA 2C2OA 5AIAA 3SG0A 2GPJA 2GMWA 2REQA 1GZ4A 5DGDA 3TW6A 5CA0B 3MAGA 5JH7A 4OHCA 3PFNA 1QTIA 1FE8A 1JU4A 3OX4A 4UBOA 2JHCA 3BPSA 2OOKA 3FDFA 2FX3A 3OQIA 4M8IA 4BO1A 4DNOA 2PYZA 1WXDA 3D5EA 4QTTB 2APJA 4EW1A 3F3YA 3ZPXA 1DDIA 2WTAA 3NM6B 4MDYA 4R2KA 3W3AD 1UOEA 1S2GA 2PZKA 3AUKA 2DT5A 3LKVA 4KWTA 4X0EA 2JD0A 2FW9A 3HJHA 5JADA 4HLUC 3ASVA 3LUCA 2WVJA 4M8SA 3DE2X 1EX7A 1BZYA 1TM7E 3ZGOA 4ZJYA 1JSCA 5AVKA 4ZZ1A 5L4SA 2BAGA 3ZYCA 2Q5EA 3B2QA 2C88A 4K46A 4EELA 2V7TA 4Y2PA 4GGMX 3PGLA 3TIIA 5HZHA 4QX6A 3PE4A 3Q7RA 1CUDA 2EDAA 3O8OB 3CS3A 1Z9BA 3ER6A 3EXG2 1VL5A 4Q12A 4MUXA 5E6SA 1TM3E 2QBYA 2Y4NA 4XE5A 4K6CA 2ANCA 3JVEA 4F3CA 2D13A 3KVNA 1XJWA 3MWGA 3U3KA 2I03A 1LF0A 1RNLA 2P9BA 2VDJA 2VCHA 5CLIA 5CIQA 3X43A 4CG2A 4X63A 5IYZA 3C4JA 2EXXA 1FJHA 3JWIA 3QQPA 1KMHB 3TAUA 3WWDA 4MW6A 5IABA 3DBRB 2H1SA 3NS7A 4NABA 3L7LA 1AY0A 2IDZA 4WTOA 5JS8A 1OFIA 3U1BA 1J2RA 2YNMC 2VTBA 2AI2A 3R3SA 1NW7A 1E9CA 1U94A 1Z5VA 3E18A 2A1UB 3AONB 2G5PA 3RTEA 1XI2A 2Y1DA 4P4UA 3NHWA 4BO0A 3M70A 1AHNA 1KPHA 4O33A 3CLSD 5CNKA 4ZA2A 5JV5A 3NDBB 4AKHA 1YK1A 3H9CA 2A88A 2I3DA 3OECA 2H48A 3OH8A 3PEYA 4W5NA 3FW1A 3GP5A 3IT1A 3GH1A 1VBNA 3LCVB 1MHPA 3H18A 2GM5A 1R0LA 1NDQA 4J9VA 4GUAA 2VHYA 4JSRA 5A5VA 2XJ9A 2AV6A 4RKFA 4ECAA 3RTDA 3VM6A 5ALHA 1BVYF 2WE7A 3P9RA 4ESOA 2CFIA 1IPHA 3E27A 5ULLA 4QDJA 4JEIA 2HEIA 3KZCA 4A92A 1K7XB 4GX5A 1MA0A 2OHHA 3CN9A 2Q4BA 5F52A 1YR6A 4QO8A 5M29A 4FC7A 3VKGA 2VK4A 2PT5A 3EWIA 2DAPA 3OKCA 3DVSX 5DIZA 1G16A 4C03A 3G7SA 5K8JB 2EU8A 1LWNA 1T6ZA 3BE4A 4FDUA 3LK6A 3RUIA 1DTWA 2YUIA 1HK7A 1JZTA 1HDGO 4WEOA 3UKJA 2MYUA 3U19A 2VSNA 2C2XA 2DBRA 3F2IA 3B36A 3KVYA 4HGNA 4AN0A 1Y6GA 1M6VB 1USVA 4AZ0B 1WCYA 4UMDA 3IP1A 3MYYA 2HQ1A 3VYRB 1Z4OA 4QG7A 4BS9A 1WD5A 2GBLA 4BUJA 2VQSA 3BT7A 3GBSA 1JEOA 3DPSA 3H5WA 1IATA 1A9XB 1I33A 1YNOA 2BMDA 1OBHA 2IPMA 2WOOA 3P4XA 3R3ZA 4NJEB 5ALZA 1XN4A 4DM7A 2GXAA 3A2KA 1LPOA 5L4NA 4M86A 1Z06A 3ENQA 4MS3A 3SK0A 1CQPA 2P78A 1T8YA 4FILA 3VDMA 4OIFA 4L9AA 5C1OA 3ELDA 2NZXA 5TS3A 2JGAA 3NTUA 4H1UA 4X90A 1NUPA 3BMXA 5FNZA 1ID8A 4C2TA 1WQ3A 3ABZA 1JS1X 4NPCA 2CBZA 4GRDA 3H0EA 2IU4A 3ABSB 1PSDA 2WAXA 4XX0B 2P2SA 2WT4A 4X94A 5BOSA 4PBRA 2NSDA 5TV2A 5K4HA 2OFXA 3FKSA 4UUNA 4FSHA 1E2LA 4Q3LA 2C3MA 3G2HA 3KXPA 2NZ8A 2EZ9A 3AM3A 4W8GA 1R6DA 4JOBA 1F1JA 5BT9A 1J09A 2AOWA 2P75A 5BUQA 1GTJ1 1H2AS 3L7KA 5DULA 4RDXA 3K15A 2ONJA 2CJFA 3B3GA 3P0EA 5E6UA 3U0VA 2WQ6A 2V6FA 4XH9B 1DU4A 1GM5A 1RYEA 1FYXA 4LSZA 4HH0A 4RU1A 2F8LA 3OM9A 3S81A 4L07A 5CDSA 4J75A 2OR3A 4B7AA 2VUTA 4CE6A 1N0UA 2H1VA 3CWZA 3CUWA 3AUXA 1UMCB 2HPAA 1I2CA 4DDHA 1XFAA 4DIUA 2W98A 4TSRA 4X93A 1VE9A 2VHUA 2BE7A 1D8TA 5ESDA 3PVSA 4MVYA 5EHIA 1NVVQ 1UJ6A 4JVMA 2D4AA 2AN9A 4MCJA 4NULA 2PGIA 5HKLA 5TPWA 3U7EB 4YVFA 8ATCA 2DGDA 4H6WA 3WICA 1RPZA 3NC1C 2WYWA 4FMCB 1ICEA 1SC9A 2BH9A 4QT0A 3B13B 1XZCA 2WHEA 3ETEA 4ZO6A 4O4LB 3ONWA 3R6TA 1F60A 1WKCA 3HB4X 4FONA 4NFSA 5KS2A 2I2DA 4OTZA 1CDEA 3QWHA 3STYA 3V7NA 3WQSB 1QXSA 4CQMA 2I62A 1NULA 1P75A 2ZP1A 1J0BA 2QENA 3OCWA 4PLWA 1SIWA 2LV8A 3DXFA 4AK9A 3T52A 4EMTA 3ZVLA 1PR9A 3WIDA 3U4CA 4RZIA 4P92A 3SZGA 1QCDA 3KEQA 2DR2A 1U0BB 4S0XA 1QGUB 3LA8A 1RWWA 1XDUA 3AIMA 3RRYA 1OTHA 1AZWA 1STOA 4M9UA 4RA6A 1Q0UA 1I3CA 1GL6A 4RAOA 1QE0A 2NU8A 4B6QA 4L0CA 5B4TA 4RWZA 1ADYA 1F14A 2YRXA 1E1NA 4QTYA 3PEVA 1RAIA 1INLA 4LMAA 3GGOA 4MWZA 3T3HA 2CLKB 2EFEB 2LWIA 4IRMA 3ILSA 2J45A 5B64A 5CX1A 3U4GA 3CLUD 4LDQA 4JH0A 2CHEA 4IFEA 4N5NA 4RW0A 4XB2A 3T9EA 4LDPA 4RTOA 4BFXA 1QTQA 2WHYA 1DIBA 1ENZA 2IYRA 3I4LA 3TLBA 4AF7A 3K0CA 2CXTA 3FPLA 4DUGD 4Z3DA 1SXPA 2P9FA 4ZU1X 3TCNA 5JAIA 2AN3A 3HU3A 3IX7A 4V1CI 2ZXEA 2PJZA 3WC4A 4WOBA 2YVLA 4YDHB 4AX4A 3LH5A 4NX2A 5E3HA 1A98A 4BVFA 4X7MA 1OKKA 1RPJA 1SCDA 2D1SA 4JQYA 1U02A 5ICFA 1Y4SA 1BEEA 3CX3A 1W44A 5HPYB 1E89A 3VFDA 5FI5A 2G6BA 3G68A 4NMLA 2R79A 2NTVA 2FX5A 3FVVA 2HXYA 3HJNA 5IG2A 1P3JA 4F93B 4ZI7B 3F8TA 4PM4A 2WIJA 2B1IA 1W1UA 1P3DA 1MH1A 2CL5A 2J0VA 3DE1X 5EJMA 4CHGA 4X62B 1KEPA 4YJ2B 3CF4G 1V1RA 1XL1A 3DOUA 3MF4A 1SD1A 1MAAA 3JYQA 4BMNA 3ZVMA 1YZFA 2IW1A 3ZKWA 1W52X 5HIKA 1AURA 3LRPA 1YK0A 3FSGA 1SG0A 3PRYA 1ECPA 3ACDA 3TG8A 4P84A 2W2QA 2Q7OE 5E95A 5C7LO 4MRMA 4IGEA 2YV3A 3KSMA 3Q6MA 4WHMA 4QPJC 2ON6A 3AWDA 4IJVA 4Z0PA 1HH4A 3CSUA 4H7KA 3ABQB 3OESA 2FQWA 1QZZA 1EXNA 3TFWA 4O59O 3I83A 1N32B 1M6WA 3H9JA 1W93A 2BEUB 2WJZB 4DG9A 2HWXA 1SNYA 4WK4B 2BI8A 4HLNA 5DWDA 5FR1A 2PGJA 1NQTA 3U17A 4ARVA 1DXQA 3P2OA 1SD5A 3PX7A 5FFNA 1IHYA 1N2CE 4OV6B 9ATCA 2O6LA 3R24A 4TMWA 1BGWA 1U1DA 4B40A 1E0AA 1PD1A 2AFRA 3CU5A 4LSGA 4C4TA 1H23A 1XHLA 3OSZA 4LF9B 1OXUA 3L0IB 3Q6NA 3L7MA 1XNJA 2BFWA 3L84A 5DHAA 2VDQB 2JLUA 2D1FA 2A86A 3P4UA 1DEOA 3AR4A 3LWNA 5A0FA 3GVXA 5KAPA 2GBGA 2PEYA 5DBHX 3AGPA 2PX8A 4MV0A 2OD7A 2G9NA 4B74A 3WGTA 2IPOA 2OB1A 1BXKA 3JZDA 1W2GA 1BHO1 1QQTA 3NHJA 3ABOB 3L4BC 3QF4B 4PYLA 4BFUA 4YT2A 4O4JF 4M1ZA 4ZCQA 2BUBA 2C7VA 1ABBA 2QGNA 3M6AA 1TAUA 221PA 1LD3A 2EJVA 4ZYVA 3GRPA 3CH7A 3HRKA 3TGPA 1YQTA 4M9SA 3FBWA 3JAWB 2YJ4A 2Y05A 1RHQA 4BMZA 4PN3A 1BDJA 5B3AA 4AXXA 1F8UA 1US8A 1YU6A 4MV1A 5CT4A 5GOTA 5IUNC 2MT9A 3B1VA 1FFAA 2PGLA 2BR5A 3HA5A 3R0QA 3ZLBA 5KYYA 1O9BA 1RCTE 1X7WB 2VKQA 1UKZA 3QHPA 4OXYA 1PVDA 2RKOA 1JYEA 1THMA 3IUEA 2HK6A 3IHLA 2HU2A 2KWIA 3TUZC 1DO0A 1JG3A 1ZD8A 2IYSA 4G5FA 3AZOA 3L6EA 3K4HA 1V8BA 4Q3EA 3ETCA 1ZQ1A 3WYCA 2EQBA 1P9RA 2R7AA 2VJCA 2AE2A 3OFKA 4B1FA 1VPTA 1WHSB 2VP0A 5GVSA 4OEHA 1OAOA 4Z4IA 2HJ9A 2OFPA 3A6KA 4YP1A 2W4IA 1WUYA 4V0RA 1T8UA 1E1KA 1NNSA 4EY5A 1P0FA 5ABPA 1C9KA 2A5DA 3ZDDA 1FX0B 5AKEA 5EE5B 5FWYA 3TJMA 2NXEA 2E49A 4L22A 4YMSA 3UV6A 1CVIA 4AS1A 4ARCA 3M1LA 2R9VA 2PD3A 2UZ1B 3MYRA 3GFTA 3UFXB 3ADOA 4HWTA 1A4RA 4KE8A 2CDNA 2GAOA 1ZH4A 2BYTA 1RXSA 1WW3A 1G98A 1NLFA 2JLWA 2P2CA 2YJZA 3LP5A 4EPRA 2YS6A 5BVGB 3KZKA 3PC6A 4YCSA 2J31A 2R62A 5KIAA 2PFSA 1AGXA 2IYOA 2R6CA 3KZOA 3MPOA 4P3YA 4ZZ2A 4RULA 4ER0A 3TQRA 4S04A 2AC7A 3OTWA 4WUVA 4X1IB 3UCXA 4HFNA 4EHAA 3N2IA 1D2CA 4D45A 3G1WA 2CXRA 4B71A 4GOOD 3H4VA 4KHPB 1DZ3A 2I4TA 2XNKA 4XYBA 5EAIA 2ZYGA 1U7OA 3RIGA 4NU5A 3THXA 3KDAA 2HU5A 3L40A 5FPSA 3SU8A 4Q9AA 4DL9A 4KR3A 2O1XA 1B8OA 1ISRA 3ZGZA 1ODFA 4PCUA 3UG7A 3P26A 2I2XB 1NP7A 2H6EA 4CVNA 1NQAO 4XXHA 3R5XA 4BX2A 4RX1A 2E5LB 4Y6RA 1EFKA 2C5SA 2ZM5A 3QYPA 1Z0AA 3LIPA 4LW8A 1V6CA 3A3KA 2PZEA 4FR0A 3R0ZA 3F5FA 4P38A 1TA4A 5EUBA 1KMQA 2QI9F 1W8IA 2ZBQA 1E1YA 1E2IA 1VI5A 1W5SA 1Y7TA 5AI0A 3W8FA 4B17A 3KQSA 2WQZA 4CN8A 4UTPA 1JQEA 1FYVA 4INPA 1T3LA 2I3GA 3QNWA 2CL7X 4KSCA 4L50A 3SSAA 5KYUB 2B1RA 3O4VA 3EVAA 1SB8A 3LQ1A 4WRRA 5C7IO 3CYFA 3BIXA 3GJQA 3LYUA 1K3UB 4ZIRB 1NMEA 5KTKA 4CUZA 2M32A 5DI3B 5FLXA 4WNIA 1PWEA 3WDKA 1EQ2A 1T5OA 4UE6A 1OYYA 1X8KA 1HURA 1T2VA 4H6XA 1DDGA 1F12A 1LQ2A 2ZVQX 2ZYDA 3DQQA 2XB2A 4EX6A 4ENUA 2FW6A 4YRAA 1VYUA 1KJWA 4AMBA 4EVSA 3ONNA 1YDWA 1KXJA 4P35A 4ZICA 2C3OA 3C1UA 1FW6A 1NVEA 1Q20A 2PUJA 4YP5A 4YI5A 3IB3A 3STWA 4ZT6A 3PYMA 5F1YA 2OGWA 4OQQA 1F8FA 2ZIFA 2Z98A 3CUVA 1KK1A 1RT9A 4AVYA 1AK2A 3EDOA 3TZHA 1HKHA 1V2HE 4RTKA 1Q1GA 1YB7A 4I6JA 4OMFG 2R1TB 1N3LA 4BNWA 3WP0A 5EG5A 4KL8S 4H7IA 2CVOA 5HZKA 3GLHB 3ORQA 4IGAA 4JQCA 3K9HA 3KQNA 1ECCA 2JBAA 1ILEA 2F17A 4FK8A 1IH8A 1GA4A 1OGJA 2BFNA 5IDYA 5B7QA 1TEHA 1AKEA 2Q9UA 2YN0A 5CLQA 2RBKA 1GAWA 1U7TA 1EFCA 2Z1DA 5F3RA 5FEUA 2NVOA 3CLVA 5A2GA 1G5FA 4N0MA 4H3VA 4CDGA 4I19A 1JE0A 2P9HA 3L7CA 1NT2A 3MFQA 1W94A 3OU7A 4L5BA 3C0KA 1Z3IX 1WMEA 4CV0A 4YXWD 5HW0A 3PRKE 1JLHA 4LJ5A 4FI3F 2O8FB 4IL5A 5JAUA 4OM8A 4JC0A 3ZVKA 1IHXA 3GQBA 1DARA 2OFWA 3JR3A 4PYOA 4WBXC 5BNFA 4LGCA 2X4GA 4DCUA 1S9HA 4JT2A 5CFLA 2BGWA 1EWTA 1ZBDA 1K7FB 3FI0A 4B32A 3QBVA 3FVWA 3THYB 1YOVB 4OXRA 2G70A 4TWIA 5C52B 2J33A 1LLUA 5C9ZA 4JX8A 1V3QE 5EXDA 2Q29A 4C3OB 1O6ZA 4JXZA 3A28A 4V38A 3GT4A 1QH9A 3DEAA 1JN0A 2YRWA 5FAXA 3B1KA 5C46F 1O9HA 3FIUA 5DHSA 2OD9A 1RMTA 2P0EA 1C81A 1AUVA 1S8NA 1RVV1 1ENPA 5E1BA 4R0VA 4DKXA 3F4LA 1UADA 4DZRA 1P81A 3UYKA 3MLBA 1AOXA 3UMFA 1GKIA 3OA2A 2OQRA 4HDRB 2O8DB 3T4PA 5IJ0A 2FQ1A 1ODTC 1PFVA 2GCOA 3AY0A 2PWBA 4GO1A 1GPAA 2GYWA 5FI1B 3I9JA 2BLLA 1P1JA 1V5FA 3GAZA 1Y5LA 3SLGA 1NBMD 3EBOA 3U0BA 5J58A 1XA3A 4AG6A 4DDMA 1P1FA 2FDXA 3AR7A 1JB9A 1QGZA 2XMZA 1BRTA 4BO4A 3E23A 3HR8A 1NURA 4XB6B 4E31A 1NVWQ 1H0KA 3SE7A 1H2RS 3OFVA 4WBNA 4E12A 2HJRA 2A57A 1GFZA 4POAA 3AR5A 2ZRFA 1JHPA 4JJKA 3W90A 3NGLA 4I99A 3UBMA 3GXBA 2CDBA 1PLLA 3CX6A 3MZ0A 1TZMA 4EIWA 2XAUA 2C4KA 1IBRA 3VKUA 4BXOB 2V0CA 3TXXA 1NVKA 4I4LA 4IBOA 1HV8A 3MC1A 4WK6A 4ZVQA 1GY8A 3E48A 4REQB 2GYYA 1CG6A 2ZS7A 4II2A 4LOJA 2J8ZA 1V2GA 1KY3A 2DQKA 2WKSA 3KQTA 4F2GA 3F6BX 1UEJA 3FPJA 4EG1A 2OZEA 4L95C 5A4FS 1GPBA 4IDBA 1MW9X 5CJPA 4IEIA 2JFZA 1EFUA 3EEBA 3VPSA 4DIDA 1XRJA 4IDHA 4XVUA 3TINA 3LXXA 2P3QA 4UQLA 5KWIA 1YA8A 1EM8A 1HKUA 1G7SA 3BB3A 5JDCA 3BE6A 1PIWA 3M5WA 4IO1A 4E6EA 3OPYI 5IKMA 1NA5A 1R1DA 1SHKA 3IDSA 3SKYA 5FTNA 3R3XA 3DB1A 2JIPA 1N4AA 3I8SA 1T5IA 4QBGB 3QXCA 4E09A 2NNLD 3ROQA 1XXHE 1FMTA 5KAMA 1QR2A 2PUVA 3SVLA 3BJMA 4Q7QA 2OGUA 2EL7A 3WLOA 4QOIA 5ARDA 2WIKA 4M1MA 3O8OA 821PA 1ORTA 1E77A 5CFMA 2VLIA 5TGTA 4E5YA 1RKQA 4K0RA 3U7HB 2OFOA 5LVAA 4TX1A 1HRKA 1P8AA 2CUZA 4NOMA 1F9EA 1X7YA 2I0FA 4HDNB 3WFIA 3GP3A 2Z6AA 4Z53A 5D6NA 3WB1A 2F9FA 1WETA 4LOLA 2B25A 2R65A 3QX3A 2P0AA 2YFKA 3TKYA 1DAPA 3QHQA 4DSOA 1V9SA 2PMWB 2IBTA 1F17A 1JA1A 2BGIA 3RK0A 3QIVA 5BN1A 1ZC4A 4EB8A 1ZG3A 5K45A 3FSGD 5DM4A 5HCUA 1DAGA 1WL8A 3RASA 3GV0A 2MR5A 4B7ZA 2I7XA 4QOHA 3IYLW 1TUBB 4BIIA 3HA2A 4MKGA 3NBYC 3LFTA 1FRFS 4F04A 5EUQB 1HT1E 4UVDA 3U37A 1KNQA 1PFYA 2ACVA 5JG7A 4A0FA 2NU9B 5GJCA 2NACA 2VDMB 1D03A 1PZHA 2PH1A 1CJCA 2WF6A 5DSZA 3SOZA 1Y98A 4BAZA 4TROA 4DNFA 2EBUA 2A78A 2ZJZA 1Y3IA 5FBLB 3WWOA 5AVQA 1W0KD 1P0CA 3RSCA 3UBTA 4II7A 4TN1A 1XLWA 5DTIA 3LQFA 3K1YA 4IXMA 2D1YA 4MV8A 3MMNA 2XT0A 2RC5A 2QTFA 2VJLA 5HG0A 1SOUA 3PWZA 3VR4H 1NC3A 1WD7A 3C3XA 4P36A 4AZVA 3HSKA 4ZN6A 3R77A 3R7WA 2G9VA 4AJNA 5BQXA 2GVNA 4C4YA 2VP2A 4UQOA 1RIFA 5FT9A 3RVPA 3SKXA 3UWKA 2ODTX 4EGFA 3HXKA 1NI5A 3K0CC 3IALA 2G83A 4BVJA 1G17A 1PQWA 1KZYC 2AJCA 3DCIA 2CVHA 2Q9BA 5I9BA 2W2NA 2OWDA 4X84A 4G0WA 5JLAA 4DABA 1JHQA 3QELB 4MI9A 4UXIA 4PF1A 3JD2A 4MGKR 4DMRA 1M6VA 2V6GA 521PA 1XDSA 4FHGA 2XUDA 1YZKA 4CFYA 2DLNA 1BQ3A 1KI4A 1ULBA 4BX3A 5CVVA 4C3VA 5G0UA 4CLRB 2RI0A 2JAHA 4MCHA 4O25A 3SAJA 4QDZA 1ISHA 1XU7A 4JKYA 1CLUA 1GIAA 2OKGA 3AHEA 3BICA 5ED0A 3JATB 3KIPA 3IIJA 1XRSB 3HBFA 2IZ7A 4DNPA 4CCYA 2CLMB 1JQJC 2P68A 4L75A 1JLKA 3AV0B 1P5ZB 3QUQA 4OHBA 5KMGB 3NKVA 3RLFA 5LKAA 4XX0A 2ECOA 2P41A 3KLPX 2FN3A 1E7MA 2A5YB 2IIVA 5ALTA 4CM6A 3J7AC 1ZINA 2SCUA 3BC1A 2FI1A 3QEOA 1C9NA 1Q83A 3WYGA 1X1QA 2QP4A 2XIQA 4JS0A 2ZZMA 1IIRA 5HYVA 3IV9A 4Q1BA 4K86A 3RKUA 4O1HA 4ZODA 1M2GA 2GN8A 3P9NA 4NZZA 2BJHA 1HX7A 1EFVB 4RQTA 1ZK3A 3AKEA 3FJ1A 1F4LA 1RWKA 1JFRA 3EZGA 3MRXA 5E9AA 4BQNA 3GWGA 1T4CB 1EK1A 1SCUA 3TLGA 3ZWXA 3MGBA 1VL0A 2JLSA 4BV2A 4OHUA 4QOJA 4A6PA 2IOYA 4CU2A 3B1JA 3OJEA 4HN2A 5AHXA 4OI2A 4W1RA 1C9MA 1FA9A 3L7NA 1Z7GA 5IBCA 1Z38A 1WCV1 3ZWKA 1OU4A 3B53X 1TZ2A 1EIZA 3D8HA 4O0MA 2F4VB 3RBVA 2NYUA 1EFLA 4JKIA 1CHDA 2RGYA 1CV2A 3KSRA 3N0WA 3Q0TA 1JHRA 1SCAA 1WZEA 4O4IF 4R2JA 3UKDA 3JQ8B 1WM1A 1NDHA 4Q47A 3NHAA 3Q3VA 2JDIA 2O5RA 2XCUA 4Y9DA 4CKWB 2WTUA 1CF4A 3ANYB 2G4VA 3RG2A 3W4JA 2ZQ5A 5M04A 1LC0A 3DVLA 3DO5A 3WY9A 2HPHA 5DYGA 2ACWA 1IN6A 3GX1A 3QU5A 2Q2OA 3O03A 4O4JB 4IQ8A 5BPFA 3WGVA 2HOQA 3HP7A 1SZCA 1YB4A 2EKBA 3UW3A 2GERA 4RETA 2IKSA 2Q3LA 5DGIA 1JH8A 1V6SA 3UVEA 1IPEA 2Y1XA 3DEIA 2DUMA 4JV5B 2YR0A 3U44B 1F4VA 3D6MA 1Z2AA 2QR3A 3IPRA 4WDQA 3JD0A 1R18A 1QGUA 3D6AA 1Y7HA 1M1YE 3GEEA 3KUXA 5LJLA 1H0RA 2G07A 4WZAE 4N9QA 4EB6A 3EGXA 5AHRA 4KWHA 3JYNA 1ZUWA 1BQEA 1U2QA 3KX2A 1XPRA 1RC1A 3B2NA 4QQNA 2Q5QA 3EXIB 1RLMA 2B92A 3SFVA 4PO1A 1RKUA 2PSHA 3DOJA 4UAVA 2Q4EA 3A9TA 3DD5A 4BFLA 3AG6A 4HO1X 3ZGXA 4HTFA 5IF9A 1TTTA 4V2UA 1KHHA 3LT5A 1SUFA 4KMSA 2OZLB 3D3WB 2PIDA 3MLAA 4PVDA 3PR3A 1CUJA 3JZAA 1EK0A 4OXQA 1LJ8A 3AUTA 2OC9A 3O9VA 4B6PA 5CGQB 5EQJB 1QZTA 3RG8A 1Q7GA 1QB8A 3DHNA 2VWHA 4G4GA 2ZSAA 3VO2A 4Q1CA 3T94A 1MJFA 1W48A 2VHZA 1SQFA 3OCVA 1BWQA 1GZ3A 2WJGA 2QX4A 4HAIA 4UOQA 3BXXA 3VR4A 4YMHA 3JQAD 1N0VC 5KSOA 4GWKA 3CO0S 3F49S 4KYIB 4XZ3A 3TB4A 5K0JA 2QDKA 3RAEC 5BWLA 4B3MB 1KR2A 3N0XA 2GBPA 1VPLA 5J2TF 3F7NA 3LF2A 4E2WA 2WSYB 3W3AH 4V3CA 2G82A 2ZJAA 1OW3B 2YC4C 3ENKA 2OK7A 4MUEA 1Q0TA 4G0UA 1L7BA 4HGRA 2QLTA 2QTHA 3N2LA 1JECA 2WIGA 4EKYA 3KLBA 4B47A 1XQ1A 1BWSA 4YLYA 3R8CA 9LDTA 5CFPA 3D54D 1C3EA 1GUFA 1ZP6A 2JGJA 3L8FA 3NM5A 3GMDA 1OLUB 1KVQA 3HCPA 1H2YA 1CKEA 5JJ5A 2PUCA 4R3UC 4K9QA 4Y2GA 3CUKA 4D8TA 1L7RA 4CLOB 3A4LA 3MGGA 1WUTA 4F4JA 1QLJA 4LF7B 1QX3A 4IHAA 1N77A 2WILA 4MQUA 3BH0A 3DBOB 4G8BA 1J1ZA 1F4PA 3KR1A 3K5IA 3ZHUA 2FK8A 4TT3D 4L57A 3OZVA 2ORVA 2XMSA 4ENTA 1E1DA 1P2BA 1UPCA 1DPFA 2WRZA 1VL1A 3FAZA 1OZHA 4I8IA 4J16C 4JXXA 3PGMA 4MKIA 4Q4HA 1NYQA 2IYUA 1PNTA 1VGVA 2VP6A 3GCDA 5TQ2B 4AXBA 2ZATA 1I9CA 1Y33E 2FWAA 2IUFA 2QD1A 3SQOA 3EJWA 4LCJA 5IN5A 3NHZA 3P27A 3DNMA 5JRJA 1FYDA 5IN4A 3X1WA 4M9XA 3GLFB 4F60A 1DJMA 3DMNA 2HO4A 2BKXA 2JF0A 5KQLA 3J80A 3GU3A 3U9TA 1BW9B 1O97C 1E9VA 5FUBA 2IKQA 5E0KB 1F6BA 2WFLB 2PUDA 2WZDA 2Z1MA 4ES6A 3DNFA 3I8OA 3T61A 3QWFA 3WJ1A 2F1IA 5I01A 2OLKA 4U2KA 4W7SA 2UYHA 2X5JO 2NXJA 3FWPA 2L69A 1FLVA 3QF4A 1FVOA 2OCIA 2QIPA 1DAHA 1U4OA 3N5CA 4KZPA 5J5CA 3HNOA 4NWIA 1GCAA 3H11B 3ADDA 2CLOB 3FF4A 5DNEA 4YQEA 1TE2A 2ZTLA 5DX1A 1COZA 3WLTA 1AQNA 1CJVC 3JS5A 3LOQA 1R27A 3DYIA 3LU1A 4JB0A 1Y9JA 3A0RB 2QUAA 2F48A 1Q57A 5GZ6A 3A6JA 2BSXA 2XLCA 3JAWA 5FADA 3H8VA 5SZJA 5FF9A 3SEFA 5I4IA 1OH5A 5K0SA 2HK8A 3A1DA 4OQYA 1EGMB 3QVGA 3W5SA 5E1DA 3KOUA 4IDQA 1LXCA 4BMCA 4QEDA 4HNTA 1Z0KA 1FTNA 4ASUA 4AMUA 4UD6A 3Q15C 1GVHA 1N9KA 5DRTA 1A4UA 3FUCA 1BDMA 3EIXA 2NYVA 2CXHA 2P90A 2VQ3A 3DOIA 3OUZA 4OAQA 2XQGA 1EFPA 2MMGA 2X4IA 2Z57A 3HI6A 4QGFA 4RL4A 2BC9A 1PHRA 5F1OA 3P9ZA 2XVXA 5E2BA 3AM4A 5EXTA 2AC2A 2ICAA 3SEQA 3WWYA 4EUFA 1TCUA 4Y18A 2YOHA 2NUTB 3IQDB 4BB0A 3CNOA 2OCKA 5A6SB 1KWKA 4X1YA 4PQFA 4CKEA 1AHPA 3DWEX 1FX0A 5SY4A 3TCKA 3HYLA 3PKIA 1RWMA 3V8MA 1JHVA 5KYXB 2ZUTA 4QJ5A 1TVCA 1J42A 3IH5A 1TJ4A 1KI7A 2Z43A 4NZNA 4URWR 3L1JA 4BJ5A 5I8WA 5GINE 1RQNA 1UXJA 1X8JA 2CB0A 3R2JA 2OXFA 5JBNA 2A2ZA 1PT5A 4ID9A 2ZSJA 3H99A 5AI4A 1H85A 5CB4A 1Q14A 1XKXA 5BVGA 2VRBA 2FEWB 5ALSA 4YCMA 3Q7TA 4C08A 4EQ6A 4W5TA 2I55A 1P4RA 3RS0A 1UBOS 3T7JA 3NVKI 3K94A 2B82A 5F2EA 2OYCA 3NHKA 5AKLA 4Z4FA 1V1JA 1RXUA 4E5PA 4MICA 1QPBA 1O5IA 4OVKA 5CH5A 1MTOA 1NJGA 2K2QB 1YZUA 3K8OE 3STUA 1T4MA 2CNWD 1JHYA 2NG1A 3DQPA 1PGJA 2JFYA 2V6MA 5DCWA 5C4IA 2NUBA 1G5RA 3O3CA 3DPIA 3SC2B 1E0JA 1LF5A 4LNUA 1E1LA 4OXKA 1U0NA 2XGSA 4QRDA 5BYAA 4KLAA 4ALKA 2Y0CA 4Q3OA 1ZEMA 2PSSA 4KO4S 2DMRA 2G9RA 1TZBA 2C9OA 2H1HA 2GPNA 1U80A 1NWCA 2R1UA 2VYVA 3K92A 4DZTA 1ZL2A 4NJMB 2ODPA 1K86A 4BGIA 2CFOA 4EHJA 1Z6PA 4OHRA 4UMFA 2EERA 3HACA 3N2YA 1LW7A 4ETNA 5BMOA 1Z5NA 3G9QA 4MW7A 5DGTA 1YD7A 2DWQA 3HGQA 1SHTX 4JJ8A 4PZAA 3ROMA 3WGZA 2YZKA 7ADHA 3LJKA 3IKJA 4R8RA 2R5WA 2QXTA 4GI5A 2A0UA 1V3VA 3FD8A 4H7DA 5T6MA 3CQ9A 4LPKA 1A4XA 1Q16A 4G0ZA 5DI3A 4AROA 4H0NA 4C0BA 5I9SA 2FX2A 2I7TA 8ABPA 1MX5A 1E9BA 1L4HA 3DW1X 1UM9B 3DTNA 4C87A 4HNRA 2WTMA 1K63A 2PJDA 3CF2A 3WA7A 4WY8A 4MI3A 4BDTA 4KLNA 4I1IA 3A26A 2VLBA 3MWDA 2RCNA 4MB0A 3MINA 4DEYA 1WCXA 1KEUA 2A0YA 2PX0A 3U3OA 2F1RA 5JVDA 2CZQA 2WUEA 2WWRA 3IQIX 4GYJA 4DCSA 1XEXB 1JEAA 2ONYA 1UJ4A 3HKCB 3BGDA 2IE0A 4KJXA 5JDCC 3WL5A 5KTTA 3C3BA 4FEAA 1RKVA 3R5HA 4GWLA 4DCCA 2HUPA 4HEA1 4TTAA 3WGLA 3U7JA 1MPXA 4E33A 4GD3Q 2C5EA 2WTEA 2Q8PA 3G5UA 4GGOA 4KKXB 4Y9UA 3WNZA 3RFCA 2VKTA 1AVTA 4NU8X 3VKWA 2XE7A 4Z4GA 3HL0A 2HIGA 3Q1LA 2O4UX 2DWPA 5KB3A 2ZRIA 5MFZA 4M0DA 2NSJA 2C9ZA 3G9ZA 3LVBA 1DIGA 4ESVA 3E7DA 3CTPA 3D64A 3HA3A 2WWVD 1M73E 3C70A 3H5OA 4FU0A 4OU4A 3KQVA 5FYQA 4BO3A 2CK3A 3L04A 4G1UC 1UAAA 3B3JA 1XALA 3LKZA 1IU9A 1K4MA 1MN6A 1QAMA 3B9BA 3DBVO 4N54A 4XWYA 1Z62A 5EY5B 3T7AA 5FAKA 2ZYIA 5F64A 5TT0A 4ND8A 4BLWA 5CDGA 1IUOA 1MORA 1XTSA 3R7DA 1ZK4A 5F4ZA 4I4CA 5C80A 1FMCA 2IYAA 3WXMA 3L6OO 1ZI8A 1IEQA 1PG2A 5HJ5A 2XYQA 3LVQE 5JXIA 2WZQA 1BROA 3CIOA 4UJ3A 1RC8A 2SNIE 1HEIA 4X20B 2IODA 3THYA 2ZJ3A 4UU7A 4L0QA 3PS9A 4TUYF 2DQ4A 4H3SA 3W9SA 5KYTA 1Z5PA 3QKUA 2A9JA 1DX9A 5HRCA 3K8QA 4G9GA 1N2BA 2GK3A 2V6BA 3F6CA 3SP1A 1OBCA 4YRZA 2WHQA 2O1WA 4FYHA 3IULA 4XOUA 4RGVA 3SHTA 1HORA 1Z47A 3NX4A 4AJ9A 1TJYA 4HSEA 1MDBA 2LDXA 2QRJA 2WWGA 3DOFA 4ZZ3A 1WTCA 3KBOA 1ESZA 3SBDA 4NECA 5JASA 3R40A 4ER3A 2BEWA 4ODIA 3OQPA 2H2DA 3L93A 4HDRA 3FPAA 3QA9A 3CF4A 2GLTA 4JWTA 4QJIA 4DAEA 3HCEA 1NW3A 3E2MA 2ES4A 2XZLA 2YQ4A 3N0RA 3RJ9A 4MV6A 1NXQA 2I4LA 5ITSA 3MJ4A 4JLAA 4RFSA 2ODBA 9MHTA 4I9GA 2XH8A 1QG2A 2JIQA 2ZRKA 4W8HA 3HR7A 4JGBA 2CLLB 3CEPB 4HYTA 1J90A 4I81A 4MS1B 4U2DA 3AEQA 1Q7EA 4FDVA 3F98A 3BOSA 1JHUA 1O96B 1SVMA 2HNBA 2J3LA 1BFDA 3DV0A 1HE8B 1O6GA 2ZE5A 3G8CA 13PKA 2IZ1A 4QDOA 3W9UA 3ZHOA 4Q16A 3TD6A 3TWOA 5A4DA 4MRNA 1AQJA 2YVKA 2WFAA 1X70A 1C1DB 2GXSA 3BWYA 2EGHA 1W6RA 3D6JA 3DBIA 4EO4A 4Y2SA 4XA8A 2D2IA 1U99A 3N75A 4Y9TA 3H7AA 1QCZA 1TO6A 1FXWF 2V45A 4AY5A 4BXOA 5DXFA 3WYDA 1XDBA 2DP4E 1N8NA 1AN9A 1K88A 5BN4B 4EYOA 4LZJA 2JIRA 1UL1X 1EP1B 3R4VA 4ND4A 1G8YA 5FIUA 2CYAA 3RSQA 2PX2A 4R1OA 4ARUA 2XDAA 2JJ2A 3IXLA 4KYUA 5IFKA 5AQEA 1TU3A 3NAZA 3KQKA 1NSYA 2QTTA 4I3HA 3ERCA 4WD3A 2UU9B 3ZVRA 3PHIA 5GIPE 3A0UA 2X40A 3KU1A 1U3FA 4J1QA 2XWJI 4AYWA 1NXOA 2O2GA 3K9CA 2I6FA 5TJ9A 3RFXA 4KU4A 4JT9A 4PYNA 5LU8A 1G8AA 2J3KA 2Y67A 4M83A 4RD0A 4IH4A 1J2YA 1QHEA 2XBMA 4KBGA 1XRQA 2LBPA 3ONDA 2CMKA 5DEOA 4CKBB 1Q0PA 3V33A 1WVIA 4MEJA 1HL7A 1X8XA 2VT3A 3BXGA 4FPXA 2X9NA 2YZGA 5DM60 4YUWA 1CBUA 3WQQA 2MHCA 1GLNA 3GEMA 4PSCA 4TM7A 3AC0A 3E9NA 2Z4TA 3GUCA 4ZQGA 1XU4A 4R84A 1BMQA 3KR0A 4HQ0A 4LOIA 3TJZA 3ZK7A 4EY6A 2JGKA 3B6MA 1TF5A 2P9TA 1OXSC 3KXDA 4F1JA 1OBVA 3G8BA 3IEUA 3WP1B 1PVOA 2POQX 2WM9B 3SS8A 1PX0A 4FD3A 2CFRA 2YHBA 3QVUA 4IQ4A 1DAOA 1Y81A 4RMJA 3V9AA 4N8EA 3UA3A 5HKKA 1YGYA 1SHZA 4JCCA 5C5CA 3JQAB 4D4MA 3A05A 3IQGX 3I01A 4IJQA 3CFYA 3ZJTA 4LJ8A 3GJ8A 4ITRC 3A9WA 1JG2A 3L8MA 4FWTA 3H05A 1TCBA 1ZFNA 3H4TA 4O4IB 5HDBB 1GAXA 2JLQA 5B1IA 3IJEB 2C82A 4DPMA 5KU7A 1KYYA 1HNWB 1MIOA 3VJRA 3HDTA 2D2EA 1KS2A 2G71A 4X64B 5A9RA 5KWVA 2PQ2A 4X66B 1LB1B 1NXWA 3NTXA 1TUBA 1J7JA 2EKZA 3H3JA 4HGYA 5IBRA 3Q7IA 4TLBA 4UCQA 4V39A 4NBUA 3ZXYA 4BVKA 1M2OB 1KGSA 1KDPA 3R5KA 3D1VA 3HXTA 4YRDA 5IAEA 5IUKC 3ZS8A 5E3JA 3EVZA 4CR8A 5GONF 3Q5DA 4R8SA 1NF9A 1XXHA 1A9QA 3L4SO 4UTOA 2G63A 1RWOA 2PG3A 3DGFC 2ORED 4YJ3F 1MFZA 3BL8A 3W8RA 3AG5A 4CQLA 3T8YA 2EFCB 3PXAA 1GCGA 4DMCA 1WXIA 2Q3CA 1U0HC 4WX2B 1GWNA 2EWVA 2Z09A 3KQYA 3MTBA 5DI9A 5T4HA 2EQAA 5I51A 2GAJA 1BHJA 3ZHZA 4R1QA 2BKUA 3II6X 3VR5H 4B5LA 4IIEA 5FV7A 3S8YA 1A50B 1BXZA 3QWIA 3C41J 2XMCA 3DF9A 4H2DA 1Q1EA 4IHJF 2VQEB 2F6RA 2VP5A 5JJLA 2JJ1D 3K0BA 5BQ5A 1IG3A 3G8YA 1J07A 1GGVA 2JANA 5AW5A 3V55A 2XPCA 2VEOA 3LPLA 4BBPA 1EGVB 3D6NB 4BQPA 3HFRA 4PPNA 3NDRA 3QELA 3C5VA 3EW9A 3M7IA 3OPQA 1ZM3A 1JU9A 1W4RA 1TVMA 2FP4B 4TLDA 3NV9A 2B83A 4CLRA 1V7ZA 2HNAA 1FP4B 5A5DA 1EZ4A 1M7HA 1U8YA 1YJCA 4JOSA 3TM4A 4HAVA 4TQ9A 5KOJB 5EZQA 5J2TB 3FHTA 5COAA 4E11A 3IEIA 3MRTA 1ZUNA 4DT1A 3OOSA 3V48A 1QOPB 2ZRBA 4BX8A 1X3SA 2VN8A 4QNMA 3FHOA 2OBNA 2HMAA 1EYZA 2W6MA 4TKLA 2WAYA 4E88A 3JATA 1KJJA 4N3BA 2E6UX 1RXIA 3GEDA 3ISTA 4OGGA 4PR0A 3RABA 5CB4F 4XJSA 3T5AA 5ICSA 1W36D 2NPIA 4M8NE 4RHEA 1X1RA 2PN1A 5D5PA 4MARA 5HF9A 2QUKA 3E81A 1GPH1 3RYHB 4G23A 4F96A 1U8ZA 2VZLA 2E55A 4GLOA 2NTJA 3KOZA 1NBOA 3GGPA 4RANA 5HSGA 2GJ8A 1TDJA 1X7HA 3G5AA 1EFVA 3H1PA 3T1OA 4PIMA 4U00A 2CNKA 1IXRC 1EU1A 1LBSA 1Y37A 4KGZA 5B1DA 4ZI5A 1T4CA 4D3FA 3PFBA 1IXZA 4CBVA 1X80A 3S7ZA 2HHHB 1TT7A 3A58B 3IJ5A 2ZRLA 2CBXA 3TOVA 4AKIA 2AN5A 1GNVA 3ZZ0A 2HMVA 3I09A 1XQYA 3VAZA 1XTKA 4CNQA 3N8HA 1DLIA 3JTMA 1S7GA 1NJ2A 1T9DA 4OATA 4O08A 3AFMA 3GVIA 4ZVPA 3SYKA 5KWEA 4QXRA 2O2HA 1HETA 1N5RA 1ZIDA 1H2HA 2R8ZA 2QT9A 2W37A 4Q1AA 3RS9A 3N2ZB 3WV5A 2O14A 3L1VA 1KL7A 1U8EA 2DE0X 5BVHA 2CHGA 2C7GA 3JQ8A 4LK3A 3AL3A 4XIIA 3T1TA 4B33A 1NNI1 1S2LA 1JSLA 2D06A 2C5HA 2XI4A 2LIVA 3OEYA 1E6EA 1ZO8A 1PR6A 3IIIA 5EJ2A 1NLYA 3AK4A 2WWYA 4FDTA 4KR6A 4OHWA 2O0KA 2GQ0A 1E6CA 4O4JA 2PMEA 2C3UA 5JDIA 1JKJB 1R7RA 3JQDA 3KDPA 1Y9EA 2VJBA 5EL0A 5KNBH 4X85A 1J7KA 3U3DA 4EEKA 5CVTA 1SBHA 2JGDA 2O7VA 2V59A 2NLOA 1N3YA 3ZCVA 4HEJA 4MH0R 1YDFA 3NVAA 3DMYA 2ZCUA 2LRHA 1DG3A 3KZMA 4H18A 4OY3A 3DZ8A 5F7XA 4NQZA 1EUDA 1Y5NA 3R3YA 2C03A 4FZRA 4ZVNA 2N9UA 3NVDA 4MWSA 3RAFC 5AUPB 1UAGA 3EXIA 2ZRCA 1CVRA 1DKOA 6ABPA 4JEMA 3C3YA 4ZQFA 2X0FA 3QVOA 1DB3A 4LMRA 4C6TA 2W2XA 3TOZA 4EK9A 5AVRA 2NTNA 4I50A 4DLRA 4ARIA 2F8SA 3NJ4A 4A2CA 1SR8A 1R8YA 4E3ZA 3CKKA 2PS0A 3BGIA 4K6KA 2I6SA 3A9UA 2DZDA 4TWBA 1AGRA 1TKRA 2O57A 2P35A 5EE0A 1J8MF 4FGJA 5JXGA 1QM5A 3EARA 2A5FA 3QXXA 1XRMA 2JCXA 3W4KA 5IM4A 1PYGA 5CDFE 4CODB 2FN4A 1W4BA 1U9IA 3MMSA 2R6GA 3VR5A 2D3WA 4J03A 9GPBA 1QQAA 4YPVA 4CM7A 1QHXA 2PGNA 2Z2XA 1AZSC 4KN8A 3N58A 1QTNA 4AJ1A 4JL8A 2E37A 4Q7MB 3BWXA 1M9NA 3LCMA 1M8FA 1R50A 2RE8A 1PF7E 1UXIA 1Z0JA 1HYHA 1DJNA 2Q4TA 3CJRA 3GCGA 3HQ4O 4H1WA 3HG7A 2RGGA 4MRRA 2PO7A 4F85A 3HM9A 2PL3A 1VMKA 4G5HA 5CT5A 2ORIA 3Q87B 4AJOA 2RSLA 5LQMA 3F7OA 4WZAA 2QQGA 2DJ5A 4PQYA 1RMQA 1LZLA 3CRVA 3V34A 4DLWA 6AT1A 4FBLA 2A9QA 1LZKA 3EIOA 4F9GA 2YMLA 4HS4A 4N3AA 5AW9A 1FFCA 3OE5A 2LKCA 3STXA 4DAOA 4HDMB 4ZHQF 3W79A 4B3SB 2ZVPX 4RF4A 4Y1RA 4RMNA 4RPCA 2PUFA 2CCKA 1ZAKA 2JGFA 3JD1A 5K20A 2AEEA 3MWYW 4U7HA 5A7HA 3HO8A 4PTYA 3W6NA 3ZDCA 2FKAA 1UPBA 4V0QA 3V32A 1E2NA 1GZ6A 1QGAA 1YJQA 2DF8A 2WEKA 3F0TA 3LECA 2AYZA 3IOYA 3PRHA 3DZBA 1U11A 3LP6A 2FETA 4PZDA 1VMEA 2WJAA 4W6ZA 1Z08A 4LV6A 4B3HA 1T34A 1KH3A 1RQPA 4IZ6A 3H3FA 2O2SA 2RHTA 4D9GA 5JMOA 1NU8A 2J5BA 2J08A 2PQ0A 2IY8A 2VP4A 4I1UA 3UXHA 2XZTA 1T0HB 5LMCA 2QPTA 4L73A 5H1YA 4CM1A 3DE0X 4P3KA 2I4OA 2NUPA 2H4ZA 2WG2A 2TYSB 2E5WA 2O2EA 3AOEA 1OE0A 2ERXA 4KAAA 4QECA 3DULA 2ECFA 1NBIA 3MWEB 5E1MA 3VTKA 3CWCA 2WIDA 1XWWA 1Y3FE 1NUQA 4HB4A 1KP3A 2WFLA 2YXLA 4A6EA 4B46A 2AFHB 1KJNA 5BPHA 5A3SA 2IYEA 2A67A 2ZSKA 2FNAA 2X5KO 2ZYWX 1I1OA 3ZJ4A 8MHTA 3CSSA 1D2EA 1NP3A 1Y6QA 2HGZA 1PBTA 2PCLA 4WJKB 5ERYA 5AW4A 1DGQA 1EJBA 2LGJA 2FUEA 5CURA 2CWWA 1MQSA 3QG5A 4KQJA 3H11A 4ZV9A 2HN9A 4O63O 1CR1A 1Z73A 3CCCA 2PUTA 4CIWA 2MU1A 3KC2A 3L46A 3ELWA 4HYYA 1CK4A 1G7TA 4WCFB 2KYRA 4FYIA 4OQPA 2GPTA 3FTCA 5FL7D 3STHA 1I5RA 4ETMA 1M5RA 2PLNA 1D1SA 1X1BA 2AE1A 1APBA 3NDPA 3V1MA 2R1VB 1EHCA 2WD8A 2I78A 3QPWA 1CNEA 1D4ZA 4OGLA 4TOIA 4XB1A 5ALYA 2Z8XA 3G7UA 2RAPA 3NGXA 4NZMA 5LDGA 1U2ZA 4J0FA 1VIYA 5DLQC 1JIXA 2OHVA 1R8SA 1GDHA 3IT2A 1NJSA 4DLYA 2VSXA 4E7PA 3GJ3A 2GESA 1GZDA 4XQ0A 5PGMA 5JSZA 4LTMA 3RF6A 2W8BA 1JEEA 2VHEA 4MWGA 3VH2A 3ZS9A 4DMHA 1YACA 1ZIXA 2YINC 3N2GB 4Q21A 2PKCA 3QLUA 1EX6A 4HP8A 4M38A 4LYDA 3F9IA 3IODA 4QXPA 3S99A 1UBHS 3HXMA 1K97A 1MJHA 3QFFA 4TTPA 3BF7A 1W25A 1F3LA 1E1RD 5A6SA 2OMEA 4D6YA 1DL5A 4B6EA 4QD3A 1K9SA 3E2IA 2OXRA 2WG1A 1SCKA 2HXGA 4PRLA 3K9BA 3L7OA 4JNKA 4G25A 4O2AF 4ZVKA 3JYHA 3MCUA 3WIOA 1AH2A 4JBIA 4FKBA 1UT5A 1VP3A 5DVZA 1YRYE 5HK8A 2QQFA 5IBPA 5EJ6A 1L7EA 3C3MA 4QICA 4IKPA 4UM8B 4HDKB 4BNHA 1Q77A 2YN2A 1FUKA 3U5TA 1E5QA 4JI4B 2A30A 1R8JA 1C1YA 4EG4A 1GT91 2YWCA 3ZWCA 4TUYB 1X13A 2OO5A 5T4EA 1UFRA 2IPAB 2VDRB 2XUJA 4G81A 3J81A 2GPWA 1BWRA 4L3OA 2A9VA 3GIWA 4GFDA 4RNDB 2ORYA 5A1TA 3NBUA 1B6GA 2EKDA 5JHGB 1R9MA 1H6CA 4AKSA 2DHEA 3R3WA 4RORA 1W5EA 4PBTA 1L5KA 1JWAB 2IXFA 1NFFA 4UFOA 2IV7A 3KQQA 3OOWA 1S2NA 4F91B 3IIMA 2V5AA 4L4RA 3T7EA 4UE2A 2QW8A 5DSTA 4YDSA 2CGEA 3TK1A 3C97A 3WGJA 3WFJA 2GCGA 3KPUA 3AP2A 3HADA 2FPGA 4DV1B 1U0GA 1YHYA 3ZY2A 4GE0A 1H9AA 1VYVA 2QM7A 1T9KA 3DTVB 4L4SA 3EUFA 1GTSA 2HYDA 1IUKA 1UPUA 2W2VA 2XVZA 4WMLA 5ALXA 4X9XA 1DQYA 5AI8A 1XMJA 2VNHA 5HGJA 3O4IA 1FL9A 1UMBB 3OC0A 3U1VA 3FNRA 1ZJWA 4NFLA 4GDMA 1Y1QA 4LI3X 1Q0LA 5DRYA 1M0TA 3FDZB 5GGXA 3C3CA 3M6LA 5EHGA 1E20A 1PNRA 1C7IA 1JLMA 4UU8A 4XYGA 5LP6F 1ZCAA 2BFAA 3FVRA 1GR0A 1E5XA 3IVCA 4NDZA 1UDWA 4P9NA 4UULA 1LGYA 1O94A 4Q9IA 4ALIA 2X2PA 1AQ6A 1M33A 3DE4X 1V5WA 3AESA 2V6IA 3GG2A 3IBGA 4OGKA 4ZTBA 5JZSA 2P5TB 3K1AB 3NKLA 2R0QC 2DTEA 2QLMA 2CNBA 3D0KA 1DMSA 5LMNB 1YJ8A 4D5GA 1YMUA 2J5KA 4UHJA 1ZHFA 3Q0EA 3MOGA 1G0OA 1Y3DE 3HKCA 4IIUA 3S2GA 3IKMB 4M0MA 4BNJA 4YNBA 5DBFA 4AUKA 1FPMA 1DTSA 3OZRA 1MDFA 1PFGA 1K1EA 4OU5A 1I36A 4Q5IA 4BWGA 2WSSD 4F11A 5D51S 4KYVA 1F2TA 4UBJA 1MTZA 4LQLA 3HBJA 2RK4A 1WXEA 3A6FA 3FUVA 4R1PA 1B3RA 3A3OA 2OT3B 4DWWA 3IVRA 4UPDA 4AT1A 2D7JA 1VSVA 2WAAA 2ZZKA 1OAAA 4FW9A 5LXTA 4BTEA 5AW3A 5FRDA 3MXTA 1BDHA 2XEXA 4KMOA 1T2EA 2H8KA 1NM5A 2BMJA 2J09A 2VQDA 4NEGA 1NNEA 2QG9A 1ZD2P 3DKVA 2YJ6A 4OMDA 1YKSA 1TW3A 4M49A 2VJYA 1NYTA 1J2UA 1UR5A 3RHTA 1MCZA 2Y8EA 3CWQA 3G2NA 4OHFA 4XVRA 4O2RA 4BO8A 3PZRA 1LLCA 4FGZA 5BSFA 4U39A 1IN5A 3HCAA 4R8LA 3AB3A 1RYMA 5EGSA 5HMLA 1K89A 1WSAA 1YB1A 2VPIA 2W71A 3EN0A 3V1NA 3V4SA 1KAHA 2PMDA 1CZOA 1G2QA 2NO9A 3EQ6A 2JKZA 4LVCA 1OLOA 3GPBA 3KTAA 4ZRNA 1ZVJA 1AG9A 3G2KA 4MVJH 4YRCA 3UMRA 4DLPA 4E0BA 1ADCA 1CZHA 4KGVA 4X20A 3W5DA 2GVDC 1GUDA 1L7MA 3KFVA 1JU3A 1XZDA 4JSTA 4MAAA 1N8TA 4KAJA 5GADl 4JP1A 4DRZA 2HREA 4QPNA 2QXUA 2XNJA 4Z99A 2V3CC 1DADA 3FMPB 4XGQA 2I4RA 2DQSA 4FQ8A 1PJSA 1TECE 4IO0A 1X19A 3T4EA 1H22A 1W36B 5IC4A 2H52A 3HCNA 3ZU3A 3O26A 1PRYA 3ME5A 4KWEA 5GONB 1TA0A 4XD7A 4HEA6 1U8UA 5K8LA 2CEAA 1KQGA 2JI6A 5IS2A 1QFZA 3VZBA 3OOJA 2H4HA 2BMVA 3T7IA 1G5HA 1EJ2A 1ZM9A 2PXAA 4MNTA 1QBGA 3EX7C 4RPJA 3ZV6A 1N9GA 3QW2A 4H7HA 4JI0B 2Z58A 2QUZA 4ZYTA 1MJNA 2C9BA 4H7FA 1MJGM 2VQ6A 1ZGJA 3DOOA 1ZRHA 2WF8A 4GR5A 4MS1A 3RYCB 4JI2B 3IKVA 3BK2A 1XGKA 2Q6LA 4HNAA 1XB2A 5GV7A 4MQFB 3TW8B 4IHJB 2OGZA 3SWWA 2BF7A 1Q91A 3UAWA 4DV2B 2QL9A 4QGBA 1E3JA 5H70A 5CA1F 1C1XA 1C1DA 4WNAA 2ENUA 2P1DA 5AM4A 3VR3A 1LS1A 3AJRA 2I3BA 3NIDB 4HQ6A 4CDNA 1O8CA 1SM4A 5JI2E 3RAPR 1AKMA 3ETNA 1OX4B 3BQNB 3E8XA 3JQFC 3K4QA 1VC2A 4ABYA 1A8HA 2H3HA 3UUEA 4YRPA 3K5PA 1R66A 3T5CA 3MAJA 2ZI3A 1VMDA 3IT0A 2JL1A 3DAFA 2W9XA 3COVA 4H3HB 3VZDA 1YVDA 3NNDA 3QYAA 1M1NB 4Z8YA 1EKXA 1X39A 2VAVA 3EZFA 2TMYA 4HAYA 5KSZA 1E79A 2JFXA 1CIPA 1QVWA 1HTWA 3KK0A 4K9OA 4RDCA 1TRHA 4QRIA 3LWBA 1ODSA 4MUFA 2BTQB 4URFA 2FFRA 1NP6A 3GJ0A 3MG9A 4MRAA 2HMYB 3L18A 2GILA 1SPXA 2R8PA 1ES9A 1I7DA 1L4EA 2I2BA 1ZD3A 1PGQA 3LVFO 3PNLA 3Q2OA 4MS4B 4QATA 1KZ1A 4WT7A 2QMYA 1MU0A 4G9EA 4I3FA 1KAQA 1SUBA 4DG8A 1COWD 4WZBB 5C2JB 2AQ8A 3ASUA 1GTMA 2IHBA 3NOOA 5AK6A 3O1HB 1G3RA 3OTGA 3FB4A 3MD9A 2KB0A 2CDAA 4EKDA 1G4UR 1U8AA 1VSQA 3WV4A 5NLLA 2O2IA 2XITA 3FDIA 5C18A 2FRDA 2HKIA 4CF5A 2V7EA 4KDCA 5DCUA 2E0IA 4RESA 4RJ2A 4JA0A 1O2DA 5J47A 3EPHA 3H5VA 3EF1A 3S2YA 3RRFA 3GLGB 2PANA 1XQ6A 4K3VA 4ETIA 1R5BA 1N6NA 1RYZA 2XQIA 4PC6A 4LRYA 1T6NA 4JJAA 3JWJA 4KFUA 3C3AA 4JBYA 4PS1A 2B30A 4JKOA 2ASEA 4TRNA 3H1EA 4TTRA 4FWIB 5CDUA 2UUAB 4UUPA 4QREA 3GVPA 2J4CA 5DASA 2GF2A 1KOGA 5AFSA 4BGEA 3LUJA 3ZCXA 1MNAA 2VXBA 1LNQA 3K6SB 2R4QA 2VWGA 1E7WA 2E82A 1X1SA 1ZESA 4RDIA 2IPXA 1NI3A 3LK7A 5LM3A 3M1AA 1XKLA 3KQOA 5JDIC 3IHWA 2Z8YA 1MB3A 3JWGA 5H7XA 2HJGA 3WWZA 1V7CA 4W6QA 2C4VA 4CF3A 3CPSA 4I46A 3PFGA 1FBNA 3OOYA 2OB2A 2R8XA 3NT4A 3SVTA 4B45A 1E4EB 3EEOA 3C5CA 1CY2A 2J9FA 1YR2A 3ZHYA 4MVJA 2ABWA 1NHWA 2PV7A 4PZUA 3UXMA 3ABRB 3H2IA 2J07A 3NT5A 1XCBA 3M6MD 3TBKA 2QRZA 1YUNA 3LL7A 4RHCA 1XA0A 4AZ3B 4WE3A 2YZ2A 2IEBA 4M2LA 1BEUB 1S02A 1ZN2A 1Z6YA 1Q15A 2WKPA 3KQWA 4EYEA 3ROTA 1YQEA 1GZUA 2AX4A 1UODA 5F73A 1LH0A 1NATA 5KNDA 1B8PA 1U8XX 3V2UA 4BNKA 1REQB 2H5JA 2VHTA 3P1JA 4ZRMA 5EMMA 3AUSA 4ZRDA 3DL2A 2I71A 3HEAA 3NVMB 2YY6A 2WWFA 3UC9A 1ESEA 4FGUA 3VDNB 4NONA 2YUTA 1U9IC 4GMFA 2Q45A 1RYHA 3OMWA 4LN1A 3ZCUA 1P0PA 5SYNA 5JU6A 1FTWA 3DMPA 3FXAA 2OUIA 1T6YA 5G3ZA 2J3JA 1G1AA 3RIXA 3W05A 1JPNA 4OL9A 3I4FA 5IMSA 2FP4A 4TT8A 1GZSA 1GUAA 4MUAA 5A9SA 1FP4A 4J3FA 3JASB 1NNUA 1HT2E 1WY5A 3O93A 4JP3A 2IXDA 1SQ5A 3P2JA 4L8WB 4R8KA 3U3MA 4ZMRA 5BORA 3DDCA 3NHPA 5A04A 3E6AA 1FBTA 1LNSA 3IIEA 3CNLA 3LBIA 2HC9A 5JCOA 1C50A 4F84A 4BEJA 1ZN7A 2BDTA 3A14A 2J9ZB 4PYJA 2H08A 3SIWA 3IR7A 2NZUG 3CE6A 3IRVA 4HADA 2YOFA 1VPEA 3E05A 3A32A 1FCJA 3HB1A 1CQIA 3NOQA 3HU5A 1TJ3A 1A8SA 3D7SA 3ZDFA 5LD2B 5KKNB 4PX2A 4YCDA 4EHNA 1E2KA 1IN4A 3I0MA 1ZVMA 4RO0A 5K0ZA 2F55A 2W4MA 1M1UA 4ZHQB 5BW8A 2RG7A 2QT0A 2OTCA 1RRFA 2I4NA 1EFTA 5EIBC 3ZWYA 2XADA 4Q4LA 1JEYB 5L3SB 3U4DA 1P62B 1OREA 1ZSNA 2ZWOA 1C7EA 4K8OA 1ZHHA 3NANA 5DLEA 4G26A 1K2VN 4IX1A 1I9GA 3BWEA 1DKLA 1EBUA 4QBTA 4MW0A 4WWHA 3ZH2A 2YTZA 1LLQA 4D5EA 5AIBA 2QJFA 1BNCA 2BELA 2EBHX 1GTZA 1MGOA 1HL3A 1MRNA 2W48A 3M83A 4HN4B 3L6BA 4UHKA 4ZC1A 3C87A 4KWIA 1KSGA 3UJNA 3PIIA 3WOHA 2VDNB 2BEVA 2ECQA 4HJRA 2LD4A 3F9RA 3QTBA 1WB6A 1QIKA 2VYNA 3Q3CA 1Z2NX 3NBQA 4P08A 5FPYA 1W4ZA 2WZBA 4I5IA 2JH8A 2OZPA 1EFRA 1XCOA 1OB2A 4OFBA 1Z28A 2BSAA 4R8MA 4XFDA 4FTWA 3TDNA 3I9OA 4N1AA 3SXUB 3R9WA 2ZJ5A 1A9SA 1L8QA 3LUKA 3WRWA 3PDIA 3JARB 3PNBA 4A3SA 4HX2A 2XV1A 5F9FA 1XZLA 3CN7A 5I5GA 3UV3A 4YR9A 3ND6A 3QJYA 3EXHA 4ZO4A 4RIEA 4YAWA 1NVGA 3MJCA 4UQPA 3ZD6A 1YWGO 5FA6A 2AHRA 2QR5A 4ND1A 5JJKA 3OSUA 5HBGA 2GZHA 2P9YA 1TJPB 3GRVA 4IX9A 5FBQB 3RVJA 3REQA 1YSCA 2V9PA 4CR7A 3E53A 1XTUA 3RGWS 3ZNPA 2VDLB 3TRKA 3LC2O 4D82A 1TO2E 4ERXA 4FYKA 2HMWA 3FNIA 2RARA 2G8LA 3AP3A 4QUDA 4A8HA 2PLFA 3OU6A 4BNFA 5JCJD 5KJFA 4NCXA 3L3BA 5CDHA 2VT2A 1NVTA 2GWHA 3LUAA 4BWVA 2WKWA 1XMXA 3C1OA 2X2FA 3H2JA 5IEJA 3E1SA 2A35A 2IZZA 1IQUA 3C85A 3I2JA 3NKFA 5BYKA 2B7LA 3FA2A 5CP8A 3E9MA 3M34A 4Z54A 1UDCA 1Q50A 4MRSA 4PO8A 1LTQA 3LC1O 4AIRA 5IXSA 2IYVA 3T41A 1L4LA 2P4QA 1S3FA 2KBEA 1J5XA 3OZSA 3QLUC 3ZWNA 1GRNA 2CMFA 1NQXA 4QUHA 2HWWA 5ER9A 4X54A 4HQKA 2VJDA 1Q84A 3CE9A 1OH8A 2ANBA 2WWXA 3PWSA 3CVJA 4X60A 1TB4A 1PTJC 3T9DA 4NYMR 5CYFA 3GEGA 1M7BA 3GLVA 3SJ7A 1VG9B 1SFRA 2Y1CA 1HE4A 1JPUA 3ZJYA 1SXJA 1YULA 1M2VB 4FD2A 1ZGGA 1ZXLA 1YKFA 1TC1A 3EVBA 2JG3A 1IY2A 3EUEA 3DFFA 2A7QA 4XCQA 2X7JA 3FOWA 1RQ7A 1VHWA 1WQ1R 1BHSA 4X91A 2IEZA 2IYNA 3S27A 4DILA 2MTBA 4O2AB 3ZYZA 3CO5A 3R8XA 1ECGA 3K72B 3TQQA 4URVR 3N8DA 4O2LA 3V1TC 4B6FA 3ICVA 5IKXA 3VTFA 1UOQA 3BGWA 2JGNA 3IQEA 1PT9A 3QX8A 2OO5C 4M1TA 3EJ6A 2LVBA 4LYAA 2VRNA 5LA6F 2IIPA 4KIWA 3E9YA 5BO5A 1CJUC 1S0UA 2PD4A 2F1KA 4DY6A 1QZ3A 2GZ3A 4DC0A 3VPHA 5DH9A 4W5WA 1JR2A 2AOUB 2AVNA 4HC4A 4LX8A 3WLMA 1VCIA 1RXWA 1ULTA 4HDMA 5JS6A 1NN5A 1QZUA 4DGSA 2FEKA 4BJHB 2ZI6A 1ADGA 2M1ZA 2I3ZA 3QMVA 3WLSA 2XYVA 1BVRA 1QHYA 2QUJA 4MUBA 5E9WA 5DYIA 3RKRA 1Q12A 2XMPA 5TMDA 4BMPB 1J06A 5CFOA 5LUAA 1IOZA 2B4RO 5JZ9A 1GRCA 2W2KB 4DRXA 6CHYA 1DQSA 3DE5X 4C7VA 4F12A 3V7WA 3FTQA 1V8ZA 3MTQA 4NYIQ 2QGZA 1MABB 3GJ4A 2WJYA 3UJ7A 1NSFA 3RDPA 1Z0ZA 5CDFA 2D5BA 3C43A 4XIYA 3D8SA 5IMBA 3ODGA 4Q7KA 2WWWA 5IVPA 4BE7B 1NWHA 2VDPB 5EWLA 3TG2A 2WKQA 4CTNA 2AJLI 4M98A 3JQGB 5I9NA 4EBFA 1AMUA 5FUMA 5F4BA 4D44A 3LCRA 4BB9A 4KWCA 2C0PA 4YUAA 3L4KA 3UJBA 2H7XA 1FRVA 2GN2A 2QX6A 5H9WA 4NNJA 2C29D 2QTRA 3MWEA 1JA0A 2O5EA 2QB5A 3OF3A 2AL7A 1EHYA 4BGUA 4D0GA 2QW0X 4RZUA 4QQRA 5DCYA 4IYJA 4J1NA 1OVMA 1A5BB 2AFHA 2MYNA 1Q0QA 2QMOA 1JSZA 2QT1A 2BRUC 3KAQA 3QMPA 1O94C 2D8AA 3AR3A 2F3SA 1ST2A 2HXSA 4PHCA 3E1KA 1XKQA 4C6SA 4DUYB 2OAGA 2VL7A 4N0DA 1LK7A 5LP6B 1F2UA 1RP1A 2FMKA 4XCXA 2Q3MA 1CUFA 2Z5GA 1N5IA 4LJRA 2B5OA 2V7BA 3S8EA 3MJDA 1UC4B 2O0HA 2W0MA 3T1QA 4EOGA 4E1AA 3N2KB 3M5CA 4FUQA 4LDNA 4M7PA 4TRMA 1CDDA 1L7OA 5C34B 1VA4A 4GZMA 2K7ZA 3V4RA 3WLKX 1DIOB 1QDUA 4KLRA 3MUOA 4HN9A 4N18A 4ZAFA 1AS2A 1NVDA 1X8LA 3GEIA 4G0XA 4WIAA 2BGRA 3MJRA 4PWZA 4ZT7A 4B43A 5KVSA 2EAUA 2IYFA 3VR3D 1AB6A 1I6LA 4GBJA 3QGMA 4OQXA 3CH4B 1EVYA 1NM5C 2FPPB 2EWWA 2MINB 3OT4A 1LNZA 4FBMA 4Q15A 4Y2HA 3CVYA 3B12A 2BVNA 2XUGA 2DUUA 4XI9A 5J4KA 4GPAA 3DE7X 3U7GA 4LDAA 4GPBA 3EC2A 1F38A 4JZYA 3R7SA 3MLEA 2QDXA 2QTAA 3O31A 2G7MC 3F71A 3WR5A 5JHHB 1TL7C 1JRLA 2AMFA 1WNTA 4IIHA 2JLZA 1Z0IA 4BMOB 1Z26A 3DWGA 5LOVF 1KOLA 4J0KA 4E5VA 1QRDA 3IUBA 3VU9B 1KE1A 3NTRA 1DBQA 5J59A 3DF7A 3L0BA 1U6KA 5CB0A 2NUAB 4YT5A 4DR3B 1OB5A 2C4UA 5DYWA 2VK2A 1VTKA 3LWDA 4PNEA 2HQSA 4M53A 2F1HA 1IY0A 4GL2A 4WL0A 2G08A 4GQBA 1GCIA 4CG1A 4B3DA 4W99A 2HFKA 4YMIA 4HDKA 3DT6A 4PGAA 1UWVA 3NPAA 3P19A 5DLPA 1XRLA 2V58A 2B78A 2HWUA 5I45A 3CZCA 2WOJA 1N78A 2JJ8A 1C9JA 1ARZA 1UPFA 3RFTA 1P0IA 5MGNA 2ORWA 2QV7A 2BHSA 2XSZA 2HLDD 4DFDA 5IC5A 3V8EA 1SXGA 1PR2A 3OT1A 4GP6A 4EVIA 1VKRA 1P0QA 4DLZA 2QN2A 1SUAA 4IUBS 3P32A 3FROA 5D1HA 4FR5A 4HT3B 3I2HA 4O6VA 3U5ZB 3T3GA 1RAGA 3VR6H 1XLUA 4OHZA 4GE3A 2IYLD 2G40A 4ZZ0A 3OT5A 4H3KB 4KQCA 1XMQB 1NUAA 1YHNA 2DPHA 1CRQA 3KYBA 1JT2A 3O3NB 4JQSA 4OX9B 4UUBA 1GLVA 4K9MA 4QG3A 4PZEA 3WL8A 3ORHA 3PQ3A 2Q28A 2YWRA 5G02A 3ZV3A 4AJIA 3TZLA 3LPCA 1XQ9A 3K2EA 3SX4A 1QDEA 4I2NA 4MXDA 4S1NA 4GM4A 4TWRA 4RVDA 3ZWAA 3GFGA 2JFFA 1H1LA 1JDPA 1WRBA 3EIFA 3KXLA 4KVGA 1Z5ZA 4QPDA 1XVLA 2BZ0A 2B8EA 3FDZA 4PAMA 1YRQA 2WABA 5FTLA 2A3NA 1XFDA 2AN4A 3K8YA 4N7RA 3BREA 2CJYA 3RRMA 3SQLA 1N8SA 2HA5A 4I5DA 1Q6YA 1DJQA 1VG1A 4HWRA 4BLQA 4FW8A 4LGYA 3PA6A 4PLHA 4G2TA 3ZZ1A 2J5XA 2G80A 1U7HA 3DMTC 1MB0A 1LPNA 3K1AA 3PEEA 3PFIA 4L5AA 4YWJA 5SY6A 1ZNWA 4HLQB 1X0VA 3D2AA 4ALLA 3NH9A 1U7WA 4PYIA 1HT0A 3KVOA 3OBBA 1E1QD 1ZM7A 2Q1UA 1GPUA 1Q1AA 3B9QA 3N7UA 1XU9A 4PPGA 3ZI4A 3KB1A 3PFFA 1NVFA 3GGJA 4I1PA 3QSGA 4UMEA 2JAOA 2QZSA 4TV8F 1JDZA 5MN4A 1BGVA 4GLJA 1IWOA 3GW8A 3DTTA 2AZ4A 2INGX 2PGDA 5DM1A 3NXKA 1M10A 4FNAA 5ECGC 3W6ZA 3WLHA 4S1VA 4JI8B 1DHRA 3U26A 5FPHA 5JQGA 4D81A 5TT1A 1NF8A 1OMOA 3QVKA 2GEKA 4NCNA 4DJTA 4UOEA 1G21B 4MSUA 1P73A 2XCSB 4KLCA 4ER7A 1IZ8A 1KY5A 3AEUB 5E4TA 1XTJA 2BOVA 1GU0A 3E9CA 5CG1A 1LQUA 5BOVA 1SQSA 1YZHA 2RC6A 1C4XA 3C8MA 2Q3BA 3DDUA 3DKIA 3I5YA 2W2MA 4JITA 2FOLA 5AI5A 5E7QA 1WQ4A 1ZD4A 1ZL0A 5DX0A 4D4JA 2XVYA 5LQRA 5E2AA 2DB3A 4AO8A 4KPGA 1RYBA 4IGIA 4QHTA 3HN2A 1QOZA 1QVRA 2D0OB 3B1ZA 1BS1A 3RIEA 2CD7A 1R74A 3VYWA 1VPVA 2E7ZA 2PZLA 2X14A 3JAKB 3KM0A 1KDZA 2HO5A 3BGOS 3NWPA 5AJYA 4S05A 1L7XA 1KFKB 4GIBA 2IYXA 3EASA 4IG4A 1SQ6A 4HFJA 4A0GA 5JWRA 1J49A 3UUFA 1UBTS 4UZSA 4CM8B 3HBMA 3QBTA 2VTDA 2ZLBA 3Q7QA 1XNHA 2ZITA 1SC1A 2OOSA 1V45E 1V41E 3D0QA 2Q4OA 3ZY3A 3F6SA 2XW6A 3F7MA 4I4TF 4OUDB 2ZVJA 1DIHA 1I30A 4NH4A 3BD9A 2FLKA 4QRHA 1EJ0A 1XAJA 4D0LB 4DCVA 3UPTA 3UWOA 1WDWB 1EVKA 3GFQA 3W5CA 1KI2A 4X1OA 2XUIA 1JSRA 4ND5A 1RWVA 1BXGA 4JT4A 4EATA 1RWXA 2ZDHA 1XCGB 1EFRD 3IGFA 4PSDA 3QJ5A 4Z7OB 4U7JA 1ULSA 1JLRA 1MC8A 5KPDA 2PSDA 5FNVA 5ALJA 1MO2A 4MYUA 5JNTA 4XFKA 2CD9A 4ZU3A 2WV7A 4PXAA 2CLSA 1MQAA 5HWSA 1G9XA 3MOSA 3RR2A 1YF3A 2RIPA 1UJ2A 1L4GA 3VZPA 1RZRD 3CPJB 4HMPA 2I6UA 3FJYA 3IBYA 3LQRA 4KDFA 3ESYA 4MQFA 1PI3A 2AKEA 1GXSB 4IHJA 2KW5A 1R15A 1Y9AA 2E4XA 3KT0A 3PYXA 4K28A 1EVEA 4NDAA 2ZGVA 3JYPA 3V4OA 3VR6A 4DUPA 1PV4A 4G97A 4NHOA 1RRVA 1CUAA 3C3DA 3LBFA 4M0UA 4PQGA 2GDJA 4MJLA 4YRJA 2PRZA 4L1KA 3AHJA 2AFIE 4LVOA 4J49A 3MPUA 1NYLA 3EWAA 4FFBA 1XVIA 4PC3A 4OSOA 1CUXA 2XOKA 1JFFB 4V0MA 4ARAA 2ZE8A 4L9SA 5IZ4A 5K2OA 2C2GA 5I8ZA 1N3BA 4J43A 2O23A 2BBOA 2PEZA 4NOLA 4QUKA 5KINB 1RW4A 3CZ9A 2JFPA 1JXQA 2PMFA 3ECSA 1GNSA 2H5LA 2WAMA 2XKJE 4MW2A 2C7QA 4IR7A 1HLPA 1YI8A 2FJUA 1OXTA 2Z3ZA 4RZ2A 4RY2A 1XP5A 4LY0A 4B73A 1ZIYA 4WA7A 3PEWA 4KTVE 1C5KA 4IMIB 2FFBA 3EA0A 3CVOA 3CZPA 4PLGA 3RVDA 3LUGA 4EABA 3EXEA 4B09A 1D0SA 1I51A 1U0SY 4MS4A 1Y89A 4IHKA 1P6UA 2KX7A 3P7MA 5F7ZA 2R7KA 3L0ZA 2LTAA 3I5MA 3HUFA 4NBWA 1CNMA 2EG5A 1L7NA 1O3YA 2COKA 2H06A 1WA5A 2ZOSA 4XEUA 5D3QA 4D26A 4KR7A 3EVEA 1E2DA 2FZEA 4WZBA 2LKDA 3IHTA 2B6HA 4DLNA 4QOFA 5LR6A 1ZXBA 2B9VA 3L2OB 1KP9A 4WKNA 3HEMA 1L5OA 3OQ6A 3L8ZA 5A0TA 1G3IA 3G82C 4J4HA 4ND6A 1V8OA 3SHWA 4BE4A 3M4ZA 3VU0A 4M36A 4OP1A 5LBUA 3G0DA 3WYNA 5K0FA 5TSDA 1QX4A 5FUQA 3D6VA 1P7WA 4PCAA 4B2IA 3GFSA 5LQNA 3GLGA 1H3NA 3TBFA 1I32A 4DSNA 4MGIR 1Z17A 1WPGA 4W1SA 2X0JA 3IURA 5EZ6B 4A82A 4E32A 4CCAA