1YZ3A

Structure of human pnmt complexed with cofactor product adohcy and inhibitor sk&f 64139
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
263
structure length
263
Chain Sequence
PGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural, mutagenic, and kinetic analysis of the binding of substrates and inhibitors of human phenylethanolamine N-methyltransferase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Phenylethanolamine N-methyltransferase
total genus 89
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2005-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1yz3A00
1YZHA 3Q87B 1FBNA 2AZTA 3CJQA 3DMGA 3IHTA 2VZ9A 2EFJA 2PY6A 3FRIA 2LD4A 1YFJA 3GGDA 2CKDA 4M36A 3LDUA 5E2AA 3UJCA 3DP7A 4O29A 2OY0A 3P2IA 2NXCA 4A6DA 4P7FA 4EQZA 3UJ8A 4DCGA 4HTFB 4ER6A 3KPJA 3DR5A 5HILA 3TFWA 4DQ0A 3GWZA 3BKXA 4BP3A 5LQAA 5HIKA 4F86A 3ELDA 5GINE 4GF5A 2GS9A 1JTEA 3HCEA 4RTLA 4GEKA 3JWGA 5F2NA 2V7EA 3KQTA 4RTSA 5CCXA 3BT7A 3G2OA 3UJ7A 2AOUA 3KQPA 1EAMA 3HVHA 4E32A 5K8VA 5KVAA 3DLCA 2Z6QA 5C9ZA 1I4WA 2AOXA 1AQJA 3FYDA 5FTWA 1M0EA 2QYOA 3Q7EA 3ER8A 4LECA 1EG2A 2BR3A 2FRXA 3VYWA 2HR1A 4C03A 4X41A 3T7RA 3EVAA 2BR5A 5CVUA 4Y30A 2ERCA 3E23A 5EKXA 4C08A 4C4AA 3MHTA 5DTQA 3BWCA 1O9HA 1RI5A 5KQRA 4RTPA 3G5LA 3FPHA 1KPHA 1N7IA 4KDCA 4P7GA 5DX1A 3MAGA 2JHAA 3REOA 1YB2A 3TKYA 4KIFA 1R8XA 1XTPA 2ZLBA 5K05A 4YUYA 5LQCA 1XCLA 1Q0SA 1ZQ9A 3LX6A 5DX0A 2AOTB 1SQGA 2VS1A 1SVUA 3ORHA 9MHTA 1FJXA 3FZGA 2O07A 3DULA 2YR0A 4X1OA 3ID6C 4OBXA 4YV2A 5MHTA 1QAMA 3ANXA 5FULA 4ER0A 2P3QA 5FCDA 4C06A 1G55A 1NW5A 2HWKA 3OU2A 3B3JA 4H0NA 3FUTA 1IM8A 2AS0A 1VL5A 3HCCA 5IKMA 5E9QA 3G2MA 3O4FA 1PRYA 2IPXA 5K0LA 2OXTA 3M6XA 3PS9A 2PX8A 1R8YA 1D2HA 1YUBA 4HGYA 4YUZA 5FUBA 3KQVA 2FK7A 3UJBA 4OX9Y 4FSXA 1NT2A 2ESRA 5CUQA 1Y8CA 3IYLW 4PYKA 4BLUA 4CXMA 4DM3A 5HOQA 5CVEA 3LDGA 2VDWA 3HA5A 2IFTA 1NBHA 3EVCA 2AVDA 5EHIA 2OPBA 1SUIA 4PINA 1WS6A 5EKUA 3B89A 2ZZKA 3C6MA 4EKGA 2Z6AA 4EVIA 3E7PA 3GRRA 2Y1WA 2ZVJA 1U2ZA 2QE6A 5E8RA 4PYMA 3SXJA 2AOTA 1G38A 5DM0A 4CKCA 2FYTA 3C6KA 3NW9A 2IIPA 2ZULA 2PXAA 4RVGA 2PX2A 4HG2A 1RI2A 5GM1A 4EK9A 3A7EA 3AY0A 3GO4A 3LDFA 2ZW9A 1NV8A 3QOXA 3I53A 3NDIA 2UYOA 5HIIA 3FRHA 4RX1A 4LWOA 3VC2A 4YMGA 3PLAE 1TW3A 4LWPA 3FUUA 2AN4A 3QV2A 1JTFA 5EOVA 5HFJA 1PJZA 4PYLA 3UJDA 3HVIA 3HCAA 3RODA 4ER7A 3BGIA 2QM3A 2XYRA 4M7RA 4FP9A 3KPUA 3LBFA 4QTUB 3ELYA 3KQWA 2P8JA 1QZZA 4HC4A 1F3LA 4QTTB 1P91A 1X1AA 4XUEA 5T6BA 5FWAA 2GLUA 1I9GA 2AN3A 1NW3A 3NMUF 3GRYA 1XDUA 4RTJA 1SKMA 1L3BA 3EGVA 3NWEA 4YUXA 1XDSA 3HNRA 1ZGAA 2JG3A 2GB4A 3OE4A 3L8DA 5ICFA 1I1NA 4NECA 5C0OE 1MHTA 2OB2A 3F4KA 3I9FA 4AZTA 2H00A 2YXLA 5DM4A 1KP9A 5H02A 4R6XA 4Z2YA 2BZGA 5DSTA 1L9KA 2PV0A 2NXNA 2ONZA 2OYRA 2WK1A 2G70A 4AZWA 3HCFA 3LSTA 3DLIA 3M6UA 3JWJA 3UWPA 3BUSA 2PXXA 3C0KA 3G7UA 3EVFA 3DXXA 3HA7A 3NVMB 3QOWA 4ER5A 2CMHA 3OU7A 1M6EX 3PFHA 3G2QA 3V97A 5FA5A 5K09A 4RTMA 2DPMA 5EMMA 2ZFUA 5EQJB 3X0DA 5JUWA 2ZZNA 2AOWA 3AXTA 3TQSA 2PT9A 3GU3A 5CCBA 1G8SA 5ICEA 3M70A 5U4XA 2IBTA 4KVZA 3G8BA 3NJRA 2ONYA 2N47A 3DXZA 4QVGA 1F38A 5CVDA 5D1NA 5K03A 2ZBRA 1JR4A 5EIFA 5E1BA 3THRA 5BP7A 5DTRA 3KR2A 3AXSA 3P9CA 3FTCA 3PX3A 1JQ3A 4A6EA 3EEYA 3KR1A 4DF3A 4DZRA 5BW5A 3GXOA 3KU1A 3ERCA 2OO3A 3AJDA 2WA2A 1NBIA 1O54A 2YXEA 3C3PA 3O7WA 5F2KA 4PCLA 5K0NA 4FGZA 1R00A 4AX8A 2HNKA 1YF3A 1BC5A 5DTMA 3HEMA 2GA9A 1X1BA 4V0RA 3PT9A 4OA5A 1BKYA 1HNNA 1R74A 4PGGA 2ZBQA 1HMYA 2ORED 2V74B 3FYCA 4X60A 4CWAA 4P7JA 2GAFA 4GC5A 4U7TB 3FPGA 5GP1A 2AOVA 4EMSA 3NWBA 2XVMA 3GIWA 3GRVA 1SQFA 1JQDA 2NP6A 2I6GA 1AQIA 4KRGA 2F8LA 5EHGA 2OBFA 1JG3A 2ZIEA 4RTOA 1KHHA 1DUSA 4HTFA 4XCXA 4QVKA 1NW8A 2R3SA 5P8WA 2PJDA 3NTVA 3OFJA 3LKDA 4QDJA 2Y1XA 3H2BA 3A4TA 3IV6A 5LR6A 3DXYA 3LBYA 5EGSA 2ZCJA 4PGHA 4B17A 5DX8A 5T64A 5K0FA 3G2PA 2GH1A 1VP3A 3CVOA 3FUXA 1JG2A 3LCUA 4HSGA 1ORIA 2YXDA 3THSA 5E9JA 2QRVA 4GOLD 3RW9A 1FP2A 1NV9A 2IGTA 4MIKA 3A7DA 3EVGA 4QPPA 4PYQA 1KPGA 3FTDA 1RJDA 3LHDA 2CWWA 4OA8A 2ZSUA 3RIEA 3SSNA 2JH8A 3P9IA 4P7KA 3U81A 3P2EA 2DULA 3UZUA 5EIWA 5FHRA 3GNLA 1XXLA 2XVAA 3P71T 5EEGA 5KS2A 3EEOA 2I9KA 2VP3A 4R8SA 5GOZA 2HTEA 2G71A 3KPWA 4OBWA 5K0GA 1KYZA 2H11A 1UIRA 2FK8A 3TMAA 3I64A 5DSXA 3KPYA 3M6WA 3R24A 3B7PA 4CTKA 4FT2A 4E30A 1G6Q1 2P7IA 3AWIA 5C1IA 3S68A 2NNWB 1P1BA 4E2YA 3PFGA 3G5TA 3I5UA 3M6VA 4X63A 4G56A 2ZBPA 3BWYA 4QPNA 5HIMA 3UFBA 3UJ6A 3V8VA 4YMHA 3UBTA 3SX0A 8MHTA 2UYQA 4IV0A 1VPTA 3OCJA 4MTLA 4RWZA 4GOMD 2ZIFA 5HIJA 5JR3A 5DXJA 5ICCA 4PWYA 3SMQA 5K0EA 4X61A 4OQEA 3IEIA 3HTXA 4FZVA 4PNEA 2O0LA 3PX2A 2OB1A 4PONA 2YQZA 3OZSA 3WSTA 4KW7A 1BOOA 3TKAA 5E2BA 3OE5A 1P39A 4RVFA 5IH3A 4C07A 3DH0A 2PSSA 1X19A 2AVNA 4PCAA 3LKZA 4RTQA 3P9KA 2CMGA 1WG8A 4RV9A 2ZWVA 2WA1A 1B42A 2PBFA 4ZTBA 4BY9E 5GM2A 4C04A 3A26A 5EVJA 1JG1A 3DMHA 4DMGA 2R6ZA 3BKWA 5DM2A 4GOND 3UJ9A 4YV1A 2BH2A 1JQEA 1L3IA 2YX1A 5EMLA 3LPMA 4BLWA 3P8ZA 3E05A 3KQOA 2PWPA 3FTEA 1SG9A 3JWHA 2PKWA 1JSZA 3HM2A 3VC1A 5HZMA 2P40A 3A27A 3EVDA 1WY7A 1AF7A 4E2WA 1NW6A 2K4MA 3I58A 1QAOA 4XUCA 2PLWA 3G89A 4HRAA 5LSAA 1QAQA 3DOUA 4ISCA 5M5BA 5D1HA 1H1DA 2PXCA 3GCZA 2JJQA 1X1DA 4UOEA 4RSRA 1ZHFA 2B2CA 5DLYA 1VIDA 5FADA 2O06A 2FHPA 4POOA 3OU6A 3G8AA 3BWMA 4RYLA 5LQKA 3BXOA 5E9WA 3TM4A 3BGDA 1YFLA 5DRTA 4BP1A 3KHKA 4QDKA 3P2KA 3UA4A 5K0JA 5CD1A 3KQSA 2ZTHA 3CC8A 4GOOD 4DCMA 5CM2Z 5BXYA 3R0QA 2IH5A 4ATNA 5K01A 4R05A 1EQAA 4QQNA 1WZNA 3D2LA 3HA3A 3GJYA 3LCVB 3ME5A 2OZVA 1OR8A 1WXWA 2YTZA 4GC9A 4K6MA 5K0CA 5EG5A 3TM5A 1RI1A 3ELWA 2B3TA 3MQ2A 1RI3A 3G88A 1JG4A 1R18A 4QQKA 1WXXA 5LQJA 2PT6A 1Z3CA 5EEHA 2O57A 2VDVE 3EMDA 4MHTA 4CKEA 5E8JA 1XDZA 4E31A 3TOSA 3GRZA 2ADMA 3SGLA 4XUDA 3GRUA 3OZTA 2UYCA 1YZ3A 3PVCA 3T7TA 1ZGJA 1Q0TA 2QY6A 4V0QA 4C05A 1XCJA 3E8SA 3R6TA 2JHCA 3UJAA 3MERA 1D2CA 4RTRA 3HVJA 4RVDA 5EZQA 1UWVA 3MGGA 5FWDA 2XYVA 4WVLA 1L1EA 2YVLA 3LL7A 4IKPA 1EIZA 4PYIA 5E1DA 4YUWA 5GIOE 5FQNA 2E5WA 3ER9A 1VBFA 3FPEA 3FPFA 4KDRA 3MB5A 4CKBA 2JH9A 4RVHA 3P9NA 1QYRA 2IDKA 3EGIA 2IDJA 1ZG3A 2IP2A 3BWBA 5LQRA 3C3YA 3DMFA 4FT4A 2EX4A 3LGAA 5EZSA 3P97A 1NE2A 3A25A 4DKJA 2P35A 3VSEA 1ZKDA 2XBMA 5DPMA 3EVZA 1JSXA 2CL5A 2OKCA 5ICGA 4KWCA 3KR0A 4GUAA 2C7OA 3KQMA 4MQ4A 3PB3A 2C7RA 2B78A 3K0BA 3LCCA 2BM9A 1FP1D 2ZIGA 5DRYA 5DM1A 1R6AA 2HMYB 3B5IA 3B3FA 3LECA 3DUWA 3NDJA 5GIPE 2UZ4A 3MCTA 4P58A 2A14A 4PIMA 2P7HA 2ZZMA 3B3GA 2PGXA 1RJFA 5G02A 4YV0A 3CJRA 2IH2A 3KKZA 2BR4A 1N7JA 1VP9A 4Y2HA 2NYUA 3HCDA 3ELUA 1KXZA 1UFKA 2FCAA 2P3LA 3R9XB 5BW4A 4OQDA 2I62A 4MWZA 4M38A 1DCTA 4IV8A 5LQNA 3TRKA 4R6WA 5DWQA 3CCFA 1T43A 3SM3A 4DA4A 2G1PA 2JHPA 1RJGA 1X1CA 3SSOA 1XVAA 3KR9A 4JXJA 5EMKA 1RJEA 4PIPA 4F85A 1O9GA 2H1RA 5KQSA 2EJTA 5KYGA 2KW5A 2IH4A 3SSMA 3HCBA 2NXJA 2HV9A 3DTNA 2B25A 4LG1A 2C7QA 1EJ6A 1TW2A 2ZWAA 3HP7A 3KQQA 3KPVA 2IBSA 5E1MA 4E2XA 1G8AA 2I7CA 1NW7A 2PVCA 3FUWA 3OPNA 5DT2A 3T0IA 3BGVA 3CBGA 1KR5A 1G60A 7MHTA 5DXAA 3EVEA 5K0BA 4PYOA 4R8RA 5HEKA 2EG5A 2Q41A 2YUIA 4AZSA 5CIYA 4U7PB 2PWYA 5ERGB 3MTEA 1V39A 3BZBA 3CKKA 3PTAA 3FUVA 5CVVA 1EJ0A 2PX4A 1XJ5A 3MCZA 5B1SA 4L7VA 4FSDA 2AN5A 2G72A 3HVKA 3EPPA 2PX5A 1ORHA 1DL5A 3JWIA 4PYNA 5EMJA 1M6YA 2B9EA 4PYJA 4RTNA 3GDHA 4WXHA 3TR6A 3M33A 3T7SA 5FA8A 2UYHA 1KYWA 3K6RA 1VLMA 4IWNA 5T67A 1D2GA 1VE3A 4KIGA 2P41A 4CTJA 2AOUB 3EMBA 3MTIA 3M4XA 4HGZA 10MHA 3TLJA 2XYQA 1RI4A 1AV6A 3OZRA 5EPEA 5FQOA 5E1OA 2BM8A 3CGGA 1VQ1A 4GBED 5F2OA 4E33A 1IY9A 4EKIA 4AZVA 1L3CA 3CJTA 3O31A 3FTFA 4E70A 4GQBA 3KQYA 1KIAA 1TPYA 3FPJA 5EC8A 4AUKA 1NKVA 5FHQA 1KPIA 3SVZA 2O05A 4M37A 4E2ZA 2Z6UA 3R3HA 4FS8A 3UA3A 3TPZA 5LQUA 1BHJA 3EVBA 4F84A 2VDUE 4YUVA 4FR0A 2P3OA 2C7PA 2AR0A 3NVKI 4BLVA 1N2XA 1FPQA 3EGEA 4HH4A 2NXEA 1P1CA 2EJUA 1QANA 4ER3A 4RTKA 2G8NA 2GPYA 2P1DA 1IXKA 3OFKA 3SR4A 1INLA 2FPOA 2NP7A 5GWXA 5CVJA 1SUSA 2QRVB 1MJFA
chains in the Genus database with same CATH superfamily
1V7QA 2YRWA 3DAYA 2C20A 4D3SA 2YWJA 2EFJA 3WYGA 2JIZD 1JJVA 4EMBA 3Q2OA 4UREA 1L5NA 2OFFA 2P2GA 2V6JA 3OX1A 1PT5A 2IIBA 2W9XA 2GT1A 2W6ZA 3AESB 3NOQA 4RKYA 5AM4A 5J9FA 2V54A 1JNXX 2H51A 5KYKA 2ZSKA 5CFNA 1VI2A 1EP9A 5HILA 1H5NA 3LV8A 4GZLA 5H4HA 4DQ0A 1ZEMA 2XCUA 3VZBA 1UOOA 3QX3A 1UJ5A 1C8LA 2Z4SA 1WMFA 4G1UC 4YRJA 2Y1DA 3PG5A 1O94A 3NIGB 3ED1A 3R6GA 4NPCA 5DI3B 3WL6A 5DCLA 4RJTA 5CDHA 3H2SA 2CNLA 3P9XA 2OP0A 2D7JA 3KQTA 1JSLA 3QKSB 3U3JA 1RZ3A 1SHUX 2JW5A 3DMDA 3RFXA 1M1YE 1WVIA 3KSRA 4GRAA 4E32A 4MRMA 1ZCBA 2YH2A 2P68A 2B1RA 1Q6ZA 4FE4A 3U4CA 4LRWA 4QYWA 1QWSA 1Z2CA 1T3LA 4KWEA 1B6GA 5EMNA 1EFUA 1UBUS 2YYZA 3QNMA 3HEBA 2FZ4A 5DBIA 1ZOOA 1ZI8A 5E3JA 2XIQA 4NDNE 4X7RA 5JS7A 1U9ZA 3TSWA 3TLAA 3WO1A 2ERCA 2NO5A 1Q16A 3DZBA 4L5JA 4GOKA 4DTIA 2H0QA 5FUWA 3Q8XB 3HZZA 1P9WA 4KQHA 1ONSA 4YONB 3W78A 2EFYA 2IS4A 1R0KA 3T3HA 1IMOA 2WAMA 3FR7A 5FAXA 2G07A 2Q4TA 2NO9A 2JBWA 3BD7A 4KK3A 1Q0SA 3I5MA 1ZRSA 3L77A 1AF4A 1II8A 4LVUA 2RCNA 3EAGA 1FU7A 1OSNA 2IUEA 4ZQEA 3U62A 1ZO8A 3UK0A 1NPDA 3BFPA 5LM3A 3PEWA 1UODA 1WXHA 2PUEA 5A0TA 1AOXA 2XJ9A 4LV6A 2WWHA 3PJRA 2Q7XA 4OBXA 4WK0B 3WAKA 5FLYA 1BRMA 4JLSA 4F5WA 4GT1A 4KEAA 3P96A 1T8UA 3NTRA 3MJTA 1F7VA 4KWIA 1N0UA 1CLUA 4IEFB 4MDYA 2BHNA 3MRTA 1Z74A 4NYJQ 4XD7A 1F51E 2HF9A 1H2XA 1WTAA 4EHAA 2AS0A 1KH2A 2AI1A 3B1ZA 1RNLA 3CUKA 5K0LA 2WJVA 1GNQA 1P6XA 3NALA 3TFQA 1FQKA 1O0CA 4D02A 1YXMA 4OAPA 3AB8A 4ZKDA 3REFA 4R0MA 1Y80A 4WFQA 4ZP1A 3Q7SA 3MWLA 1U1IA 1IOZA 4MO9A 1NVDA 1NBHA 4UPEA 2AHRA 4C4YA 1XPRA 1LSSA 3DKVA 3RS4A 4IJ5A 3AVUA 2IHZA 1BXZA 1FSFA 1OCEA 2D3TA 1V47A 3K2EA 3L0BA 2HHCA 4GNKA 1LFAA 2WILA 4HADA 4CCWA 4CMEA 1KYVA 2D1TA 1G38A 1W73A 2AX4A 5DVZA 4UBMA 3OIUA 1HNWB 3KT8A 3LPAA 1W2WB 4MRSA 3A7EA 3AY0A 3OP4A 4X20A 4C4XA 3I53A 2B37A 5TLSA 1JSRA 2W2PA 4AKHA 5C4GB 5AK4A 1ZM4A 3KJQA 3PXBA 1GUYA 3TRDA 2ONJA 5AI4A 4LWPA 1RBYA 4ICIA 2PD6A 4A9AA 2PS0A 2XNHA 5B58T 2XEDA 1E0KA 1P31A 1BOFA 2P62A 4FWIB 5H9VA 4ER7A 1V4NA 3FDZA 1JYFA 2OCDA 3QXCA 4P3KA 4WESA 5TX7A 2JGMA 1CQJB 2JZCA 2W8BB 5EIBD 4HAWA 4QTTB 2OC9A 2O2IA 2AFHB 3BN3A 4XM1A 3WADA 1RVV1 4OHWA 3WJ7A 5HJ5A 2G9ZA 4DLTA 3T35A 4MJLA 3BDIA 3IBTA 3WHPA 1I2AA 4PQFA 4LX0A 2OZKA 1VSVA 3ZEAA 4MCAA 3HNRA 3SOZA 2E4WA 5JROA 2VRWA 3OC6A 5LYJA 3D6UA 4YVFA 1CY0A 3RVLA 4IIUA 3TTTA 3F7TA 4B74A 1MHTA 4G5OA 5AKXA 4QYSA 5KCZA 1JMYA 2CYCA 2DOKA 1FDOA 1Y7IA 1EVEA 2WJWA 5FBQB 4BE9A 5CDSA 3ES9A 1AV7A 2AYYA 3OECA 2ONZA 1JKMA 4TLLB 4E6PA 2VJBA 3I09A 4A6PA 3G7UA 4AJHA 4P2GA 3CT6A 2AUNA 4ZEOA 1TLLA 5C4MA 4DGSA 2QSZA 4RPJA 4R5MA 5D3MB 3TS1A 5JUWA 3E3NA 4EITA 4N8DA 2VSQA 3OFND 4LCBA 4PFJA 5CCBA 2PBLA 2XPCA 3QENA 1J0CA 3PE6A 1CJVC 3Q3GE 4IQFA 1QNFA 3TTWA 4MV7A 3DXZA 1SGWA 1Y1QA 2G28A 2QLJA 4FWBA 4DYDA 1C30A 3FBTA 5CVDA 1MLDA 2M6RA 3H5OA 2OUKA 4HQNA 1RJ9B 2F43A 3VDNB 5BP7A 1Y6RA 1ADGA 2P0EA 5KSYA 1IJBA 1JAXA 1A98A 1EBUA 1OYVA 4J9VA 1UDAA 3GHYA 2GJ8A 4IXDA 4KUGA 3RNOA 4N40A 3VC3A 1R0RE 2PGNA 4QUKA 5K20A 3KSAC 1CKEA 1PN3A 4P3NA 4R01A 3PHLA 4E6EA 1PHRA 1JVSA 4JLVA 5IVIA 3KUDA 2ZJ0A 3O47A 2N75A 3QBJA 3H5TA 4Z3OA 2GTPA 3A8TA 2FWPA 2YDXA 3ROKA 3WRWA 2IYOA 1N5RA 1ZD9A 2GA9A 3KB6A 1D4AA 1J8YF 2F1RA 1ULZA 16PKA 2IHBA 5BVGB 5T7BA 4CWAA 3EGOA 4KG7A 1FTSA 5JSFA 4EMSA 1ZRMA 4ZARA 2Z9DA 1NNLA 1C29B 3ZJVA 1DJMA 5CHYA 1XN1A 2A92A 4LV5B 2I6GA 3CRQA 1O0SA 7REQA 4F6LA 1RHRA 2QAGC 3EZ7A 2OBFA 3NHKA 4RTOA 5DI3A 4Z9XA 3WXMA 5F7OA 5IDWA 1Q83A 4HTFA 3D0OA 3KELA 3TGPA 3GFRA 5GVSA 5KB3A 2QKYA 4DV1B 3LT5A 2EW8A 2X2PA 5ALJA 2FPLA 1D04A 4TTRA 1IY0A 3A4TA 1IONA 4M1EA 5JU6A 4P86A 1QOPB 5B6PA 1J0AA 1I4DD 3FZYA 5IJAA 2O8BA 4OQLA 3LUAA 4JEMA 1TK2A 3UKDA 4ACBA 2HX1A 4KP7A 3T54A 4WERA 2GK4A 1CEEA 1SD1A 3ZW7A 3E35A 1TZKA 4C6TA 1SOVA 2FUCA 2QRVA 1HQYE 1LDEA 1BFKA 2WM8A 3DFMA 1DC5A 3TEFA 4QU5A 2R8PA 3A7DA 1U28C 3C16C 3W2GA 4AS2A 2P4QA 5CYGA 4JHLA 2AYZA 2CWWA 3P0IA 4PG4A 5DI9A 2FRDA 4DG9A 1DJOA 3EIQA 2PLFA 4INZA 5EZYB 3UWOA 2APJA 2BMWA 3NBMA 1U2SA 4QGAA 1HI9A 4TMZA 5EIWA 4IGFA 2QD4A 3EEOA 2VP3A 3BHMA 1V7CA 3TRIA 3KEFA 3AEUA 2H2HA 1L0BA 5DYWA 4BNWA 3HU2A 4ILEA 3L4BA 1ZK3A 1FVFA 5LD2C 3KZNA 1OAAA 2MSLA 3SEAA 2VNHA 1A7KA 1C9MA 1Y33E 3NYQA 3TDNA 4CKWB 4BECA 2OD2A 3I9NA 2FMIA 2VAWA 3I5UA 3LLSA 4RSGA 4G56A 3BWYA 1DDGA 1U3FA 4FQ7A 4JLJA 3TVTA 2R6JA 3O3CA 3G1TA 5CJPA 3WNQA 8MHTA 4XOUA 2IW1A 4O4IA 4UVGA 2VC2B 3C3BA 1S3FA 2PBZA 3KZKA 1QDEA 1QGDA 2C31A 3OJLA 1PAUA 4WCFA 2P78A 3STTA 2ECQA 2F1KA 2IJGX 4ISBA 4LSZA 4Y6OA 1KBOA 2B0CA 2QR2A 5EJAA 1TVCA 2I91A 3VNAA 3GIDA 1F4LA 5JTUA 1BW9B 2QEQA 3FTPA 3WA6A 2Y0EA 4K05A 4LRTB 3PI6A 3O1LA 1THGA 1OXXK 4U6SA 1EJ2A 1L5OA 1GTMA 3KTAA 1EUDA 3GA5A 1UIMA 1W75A 4I6JA 1C3JA 2JLVA 5FT9A 1RYDA 4M9QA 1P7YA 4DUYB 4EAAA 2VYCA 3MWDB 2NGRA 2NSYA 4TRRA 1IY1A 2Q3BA 4G1BA 3ZY6A 1JSZA 2BGGA 1PFQA 2JCBA 2HPHA 521PA 1X80A 4US0R 4DMKA 1DRVA 1L7EA 5FTNA 2QL5A 3ZV5A 5AVWA 2ZXFA 5LSAA 1HSOA 3HJRA 3GG9A 1S5PA 3PHBE 5CT4A 2BW0A 4DM4A 2BTOA 1P2DA 4RPLA 5DLYA 5FADA 5TR9A 4BGDA 1W2GA 1WZ2A 1I2ZA 2BGTA 4ZAYA 3WKEA 1F9EA 4FDMA 2VWPA 2ZIWB 1K6EA 1JEQB 1NXVA 4RY8A 5JD3A 4YPOA 1QDUA 5DK4A 4MEJA 1UANA 2PL5A 4YT5A 2IV3A 3ETGA 3U3XA 1KZ9A 4MWCA 4DSZA 2RONA 4E22A 4Q6WA 3BILA 2DT5A 1QG2A 3ZW8A 4PC1A 3I01M 2XOXA 4JLBA 4OP3A 1PT8A 4ZOCA 4ERXA 3KS9A 2JGLA 1U1DA 3WK5A 4ZJUA 1S8AA 3AY7A 2VT2A 2ZUCA 1OXBB 5EIOA 1XELA 4E5DA 4KITB 4BMVA 4BNGA 2AC4A 1WU7A 1WZIA 3G0BA 4CMBA 5MGBA 4EGQA 1H0KA 3A70A 4PTZA 1KQGA 5E6UB 3N0TA 4BIMA 1RC1A 3L1VA 2WJJA 3OZTA 4ZKEA 2FG6C 4GD3Q 4OLHA 3RO7A 5CMLA 3T7TA 3T3EA 2UYCA 2H08A 4UDNA 2PE5A 4ZOLF 2Z5LA 3DB1A 1OPXA 3ZY5A 1U9YA 1PKEA 4DQUA 4ZJZA 2KLBA 3AZQA 4KZKA 1BN6A 1OT5A 3U1VA 2Q5JA 4QXOA 1QQAA 5K4HA 1N1DA 3DYBA 2EZTA 2I6UA 2JH9A 2YRXA 3D3JA 4DC9A 1U9IC 5T8KC 3VR6D 2QD3A 3SNHA 2OAP1 3ZH9B 4DCPA 1CVRA 4CCYA 5CNJA 2EP7A 1BYUA 1QIFA 1Y0BA 2EX4A 3PPWA 1FIUA 2CHEA 1UPCA 2H17A 2MOKA 1RP7A 1M0TA 3BULA 3JYPA 3OF5A 4HQKA 4NATA 1OBCA 2XBUA 3KQMA 5JH7B 4JBHA 1TT7A 4BBPA 3BSWA 1FP1D 3ST7A 1ESCA 5COAA 3B3FA 3D4NA 3LECA 3UPDA 3RLFA 2UZ4A 1BKSB 1DB3A 5J2TF 1KKUA 1O94C 1Z56C 2RGDA 4HGQA 4YHBA 1X92A 4YJHB 4FZRA 4RHXA 3CJRA 3D31A 4N3NA 4JSYA 3JALB 4HGPA 2AEJA 1AKNA 1H2BA 5HPYB 5CW1A 4EPVA 3T5AA 1P2SA 2CEKA 1DQZA 1RE1A 1JE1A 1IN6A 3GCWA 4YYZA 3LA8A 1J1ZA 3NTOA 4MGEA 5LZ4A 3AONB 3TRKA 3SM3A 1OXKB 1RJGA 1L8OA 2L42A 4G1VA 3A3KA 3S2YA 2I7XA 1RJEA 1QGUB 2I2CA 2ZPAA 3L3BA 1VI6A 4L08A 3H19A 3HCBA 4LG1A 1P7ZA 4UNSA 2BKUA 3D64A 3KPVA 4TYMA 4W5NA 2ZYWX 3T0IA 4ZO8A 4AULA 4BP8A 2W8ZA 1E3EA 3B8EA 3DZ8A 3F96A 4H1VA 1YS1X 1Z9BA 5FYDA 1GR0A 4C43A 4CLRA 4L74A 4GZ6A 4IQ0A 2NT3A 2GNPA 1OF1A 2JARA 2YUIA 4L8VA 5HRCA 4B46A 3R3SA 2OCYC 4HLCA 1FNMA 1Y6GA 1XJ5A 4JJEA 4FSDA 2G72A 1BNCA 4L72A 1ORHA 1SC9A 2GBIA 2O2ZA 1L4KA 2JLRA 3HFGA 3K4QA 2ZS9A 3S28A 1MV8A 1KJJA 1Z4OA 3KAJA 2LCFA 1XBTA 3GNTA 3K6RA 3KEMA 3L8FA 4ENUA 1G7SA 2YWBA 3KIPA 3IAM6 2V9PA 3ITEA 3BM5A 4GSYA 4ZO9A 1XYGA 2GAAA 2Q5OA 5E1OA 1N0IA 1CFJA 2G04A 4JI8B 4L28A 5J4LA 2IYLD 1QQ5A 1ACMA 4RKFA 2QR5A 3O31A 2JC3A 2WABA 3H4TA 3OCYA 4RZXA 1CJKC 4Z9YA 5G40A 3V4PB 3ZIUA 5K3OA 5JY6A 1KIAA 1W9HA 1BMQA 4HNQA 3TMYA 2YHIB 3NOXA 3R3VA 2C4VA 3O3NB 4ID9A 4R3NA 4BO0A 5C8ZA 4OTZA 1Z22A 4KHPB 1OZFA 1T9BA 4FMCB 4ENSA 3ZE7A 4RIIA 4DR6B 3AIIA 1JHRA 1QJ4A 3ZGYA 4BFXA 2PKRA 3DEYX 1X7YA 3ML1A 3Q3JB 5HQJA 5C3UA 4Y2PA 2RGXA 1A9RA 3ASUA 4F84A 5EE3A 3QKRB 4YRRA 1WDKA 2Q4BA 3NB0A 1S3SA 2C3PA 4H08A 4NZOA 5BWCA 2WG0A 1HBJA 4YAGA 2CD7A 3K9WA 4FNOA 3DCIA 4N6OA 1VZ3A 4E4RA 5AW3A 1RRCA 3ZZUA 4RQUA 3I92A 1NUQA 1G2PA 4URVR 2IK8A 2XZDA 4B84A 1P0QA 4G4IA 2D3WA 2O2XA 4M6WB 3UHPA 2V6MA 5KWJA 1MB2A 2QNRA 2V4MA 4KIUA 5L3VA 1JPUA 3LE8A 5JH7F 1HE2A 5LCXA 2ZRBA 5AW4A 3EWIA 1H69A 2YJ4A 3W2HA 1QXSA 1SAYA 3T7CA 3ZWVA 4KLCA 1Z13A 3H1PA 4MWEA 1DX6A 4JJZA 4JL6A 4DLRA 4OP1A 1JHPA 3REQB 4EWLA 4HTFB 5KAMA 1SQSA 3L7LA 1U5CA 5CFPA 2NQ2C 3TFWA 1CS4C 4Q3KA 3BMCB 2PWZA 3DO5A 2DGDA 1A2OA 1Y5IA 3DQQA 3NM4A 3E22A 1J97A 4MV5A 2G40A 1YMUA 3UMCA 4TXLA 1LJ8A 1MIOB 3EH1A 3S5JA 1LY1A 5J4VA 2QENA 2ZI7A 2Z2JA 4OHCA 3G8DA 4UXJA 4CM4A 3EARA 3K2IA 1M1ZA 1R0XA 4EFNA 4OP2A 4OV6B 5DGTA 3TQQA 1AQJA 3PXCX 2XMDA 1Z4IA 1SXGA 3T3OA 2JI8A 3LQFA 5BSEA 2GN1A 2I3ZA 3OZIA 4AM8A 1KJ9A 2F90A 1RPZA 1Z0AA 3QKUA 2FRXA 1ISIA 2F9FA 2NVBA 3LHIA 3VO1A 3VYWA 4EJ2A 3I73A 3EVAA 3PJDA 5L7YA 2ODBA 2R0QC 2IEBA 1E60A 3QWHA 4HFRA 1L7VC 1CW2B 1RJ9A 1V3VA 3JQAA 1JHMA 3OIVA 1N2JA 5FPYA 1C1XB 2IPAB 1F1JA 2BP7B 1QVRA 2OORA 3GRFA 3OKFA 3WLMA 1N32B 1B74A 4MKIA 3ZD7A 1I3LA 3P52A 3RANA 4F9EA 3ZBUA 5T3YA 9LDTA 5JWHA 2Y0PA 1QG4A 3HXKA 4ZPXA 1UFRA 3HUDA 1FBTA 1SKBA 1V95A 3ZCQA 1ZM9A 5I5GA 4OHKA 3RU9A 5JDIA 3H8JA 1OLXA 1N9KA 3C3JA 3STHA 4LYEA 2D5CA 5KKAA 4MITA 1SG0A 2O1EA 3AR8A 4HQOA 2B20A 1RLUA 3IELA 3ZWWA 1KSFX 1QRRA 1T9HA 4NDAA 2WRZA 3FJOA 4H0NA 3UWSA 3HDYA 4JH0A 3L7DA 4K9SA 4UBIA 4WDQA 2FPPA 1OXVA 1CR2A 3OPYA 2XF8A 3S99A 1L7XA 3CW2A 3GVCA 5GV8A 3KDSE 2CWDA 1TNDA 1P33A 1AQNA 1TUBB 1YUBA 4XIJA 5JLJA 1U65A 1RMQA 2JI9A 1MO6A 3ZS8A 4INAA 5CUQA 1YB1A 2WUVA 3GELA 3A1WA 1D9XA 1LF5A 1H42A 2BONA 1V5WA 4TTSA 3KXPA 2AR9A 2OYCA 3OURA 3OZ7A 4OI1A 2BZSA 4LX8A 2DWQA 1YRHA 3DUFA 1NIPA 1SCKA 3RC9A 4CBVA 3LOQA 3H9EO 3S27A 3GRPA 2EKPA 1DBQA 4HNUA 4OQQA 1Y8RA 2CLLB 1T36A 1BXRB 1X7ZA 1AK2A 3HFSA 4DE5A 4GR9A 4XPZA 4MS1A 5DK6A 4RK4A 1O5OA 5FORA 1K88A 4MP6A 5LZ8A 3AF5A 4IFBA 3WFZA 4EK9A 5C8XA 2J87A 3VZQA 1NV8A 2BGUA 1T2DA 3PEEA 3FRHA 1DSSG 4RX1A 4HP8A 3E7XA 3CVVA 3I4CA 3ZVKA 4G09A 3ZU5A 3WI7A 5G4KA 4KPFC 5HFJA 3PT5A 2GCNA 1PJZA 3T9DA 3A6GA 2QXTA 1RAIA 1UJCA 2OHOA 4XASA 2VHVA 4ZVLA 3HCAA 3UJDA 5HM8A 4Q24A 4M8NE 1BS9A 1RMYA 3GMIA 3LBFA 2H3HA 4Y7DA 3R7BA 1KOJA 2CXXA 3ZDEA 2W6CX 3GLHA 3IO5A 2VP0A 2V6IA 4PLTA 4AY6A 3KLNA 2GLUA 3L4EA 5KWEA 1W5SA 2XZPA 1UEXC 3EGVA 4QBGB 4YUXA 2R86A 2XVXA 3WMFA 3SIWA 3MAJA 5B4VA 2B8WA 5C0OE 3V4FA 1E3MA 2V7XA 1LTKA 2CW5A 2BGMA 2DTDA 2H65A 2YV5A 3F4KA 1JF8A 1NSYA 3M1IA 1KP9A 2FQ1A 2IE8A 3PZBA 4LFBB 3DMTC 2NUAB 1X7XB 4RJIA 4EBBA 4Q7QA 2PV0A 2Y2UA 2DZDA 3W8EA 4EY6A 4ZYZA 5KYYB 1JMVA 1KJYA 2EF1A 2RBKA 4GMGA 3STWA 4UUPA 1K3FA 3LYHA 2XUFA 2FN8A 2FQYA 4PLHA 4AN0A 4KRFA 3RRZA 4IDFA 4AJLA 1ZISA 2DPMA 3OJOA 2ZFUA 3AYXB 4L22A 2BWJA 1YA4A 3MLEA 3NIBA 5DP1A 1RFLA 1POXA 3CZQA 4I0WB 1F4PA 1GRVA 1R9MA 2CFRA 4HDKA 1DG3A 1R0WA 1C8VB 1C7ZA 3JAKA 3CVJA 2QX6A 3RUEA 4TVKA 2C92A 1QH8A 1SVNA 4DIKA 1MA0A 3MQFA 3SBXA 1KH1A 4DA9A 1UZUA 1R5JA 2O48X 3EIHA 1UDRA 3HYLA 5J5AA 3T15A 1BJRE 3HJFA 5AH0A 3VNSA 2GHTA 3KR1A 3SQWA 2JLYA 1XROA 4IUCS 1PG2A 2A0FA 2JLBA 2HB6A 1F20A 1MC4A 3WQQA 2QJTA 5LA6F 4MRRA 2WWGA 3C3PA 1JFLA 1I3OA 4RA6B 4UUBA 3HR4A 3PICA 4I1IA 4W8HA 1ZK4A 1AMOA 4B3JA 2PU5A 1M6HA 3TLBA 5DTMA 1OXMA 2XW6A 1GAWA 3BEOA 1K2WA 2QL7A 1XVLA 1RKXA 4OJYA 5C37A 1P72A 2VJLA 3GJZA 4LWZA 3VR6A 3IBGA 5B6IA 4PGGA 1XF9A 4P82A 2VTBB 3H18A 4KLZA 1BMTA 2FZCA 1LW7A 3NWOA 2FTKE 1S8OA 1S2GA 2WWFA 1J70A 4Q9KA 3NWBA 4Q9JA 4A0RA 1YJBA 5C34B 4YMIA 3TXYA 1GGHA 1PJAA 1QZTA 3PK0A 4KAFA 1MOPA 2AI2A 4RVSA 2XNCA 4UNNA 4UZSA 5CHEA 1PEYA 1RBMA 2Q1UA 3WGVA 3MSXA 1R6UA 1W1IA 1DRJA 2ZUWA 4L3VA 4U7HA 3RIYA 4S12A 3SS9X 3OM9A 3VV2A 4D3ZA 5F33A 2J0EA 3S1AB 3BZUA 2QP4A 5SZJA 3ZWCA 1E2HA 1W8IA 2RHRA 3L6CA 2E49A 3IJPA 4LZWA 2CXNA 5AHWA 4RJJA 2OV1A 3I1JA 3IS3A 6GPBA 1M2OA 1V8PA 2OBYA 2PUTA 5T64A 4KBYA 3OX4A 3TLKA 2E1RA 3LLCA 3LUCA 5BSHA 1IIRA 2JJ1D 2ZYIA 3SHTA 4QLOA 4MWGA 2FP4B 1ENPA 4EGCB 2FP4A 2GERA 3DZKA 5DN6D 3D1VA 4IVNA 4M2LA 4CNBA 1Z35A 2DR0A 2V03A 4BGUA 4K5QA 4ZOAA 4BVLA 1ONNA 3O03A 2H4HA 3NR2A 3W1EA 1DQSA 1RXUA 3B1KA 3OZGA 3L0ZA 2OCIA 2X41A 2HTEA 3MWJA 4LMBA 2VPXA 2FRDC 3G5AA 3KHUA 4G4SO 3INNA 3TMAA 3QBTA 4G0XA 1JVNA 4BV2A 1EVJA 4ZZ3A 5ESXA 3GZNA 2P7IA 3RSOA 1HOTA 1U9CA 4E2YA 1Z7WA 1OC2A 4FJ2A 4HDMA 4B0PA 5IULC 4P3XA 3FX2A 4QPNA 2ZBPA 2DYKA 4CDGA 3KUKA 4DR3B 2UYQA 3PFNA 2PX3A 3KBOA 3OCJA 4RXTA 4QECA 3RREA 1ZLYA 5BSRA 4V0NA 1VE9A 1ONOA 3TIIA 3EDMA 3SZGA 1SUCA 4RZ3A 1KDPA 2OFWA 3ONWA 3NX4A 3Q41A 3OF2A 3U3DA 2ZXUA 3EH2A 3MUFA 3QVJA 4Z4HA 5REQB 1POWA 1LC3A 2C07A 1Z5PA 1QSGA 1Z7YA 2J46A 4Y0VA 3LKZA 3P4UA 3C7CB 2CMGA 1WG8A 4BLQA 2WHYA 1OBFO 2IXEA 2ZJFA 3ZWBA 2V6FA 3F7MA 1EAYA 2WJAA 1GKYA 1TD9A 1IBCA 5CH5A 4HNVA 1IDOA 2RGYA 2YZNA 1WNFA 3F6YA 5HP4A 3W5VA 2BEUB 1ZJJA 2WJ6A 4COOA 1VJ1A 5DW3A 1VMKA 3EIOA 1T2AA 2YIMA 5EMLA 1QHHA 1E1CA 1U0OC 3Q40A 5U1PA 5KX5B 5EE5B 1SXPA 4EB3A 1N6HA 3SHQA 3IAEA 2J3KA 5IC5A 3HGMA 4K9LA 3VR3D 1A1SA 1YL5A 5EKSA 4B2IA 1MQ9A 3K0SA 5J1SB 4GI7A 3HRKA 4LXGA 5ALHA 2VRCA 1FXWF 5TQJA 3K9CA 3NOOA 5P21A 1KZYC 4QBHA 4Z0HO 5L51A 1H1DA 5BNFA 5DASA 4KAXA 3OTGA 2HCRA 2WAYA 1FP4A 1W34A 1WV1A 3NKVA 2JD2A 4HAZA 4HO1X 3ZXIA 5CB4B 2QRQA 3FB4A 4A6XA 4H4DA 2G9VA 2OCPA 1FRVA 4E0BA 4DRZA 1R6VA 3IP8A 1U2RA 4XDZA 2X1MA 1K66A 1GQOA 2HTFA 5HF6A 4BMSA 4WADA 3U7RA 4D3YA 4ETMA 1DKRA 4JJFA 4JLPA 5KVSA 3WK7A 4FNMA 4MV6A 3RQIA 2CT8A 2IH5A 3CIFA 2YINC 1UBMS 1XRQA 3PQEA 4HN9A 1DAMA 1XDDA 4MRAA 3TZLA 3A0UA 3WTBA 3GJYA 4OX9B 4GKKB 2BV3A 3V2HA 3DC2A 1QLHA 2BGIA 2H4WA 4YROA 5A9RA 2BEWA 1OD6A 2FEAA 1GQFA 1UZMA 5MN5A 4U3JA 1FRNA 2BFEA 2CDNA 5E8JA 5EIHA 3WK8A 1Y6JA 5E3HA 1HQDA 5CEEA 4QDZA 5BW8A 1SD2A 2HZBA 4IZOA 2NVOA 4NFLA 4Q5IA 1P2VA 3BK1A 1LDBA 4AMZA 2XQKA 2C83A 4CMKA 1DHRA 3IULA 3NP9A 1MAAA 1ECCA 3M9WA 4DVJA 4OOFA 5E1DA 4Q4JA 3SU8A 3BMOB 2E5WA 2HWWA 2OHJA 2OHHA 1Z5NA 3G9XA 4RF4A 3V7WA 1EWYA 5CB0A 1UOPA 4BCBA 5ILGA 2Q3LA 3BMCA 3EG9B 4B80A 1UKVY 1X7WB 2GESA 4C4OA 3RHFA 4QZVA 4FXOA 5B30A 2RHJA 1G9TA 3Q1KA 2NO4A 3B38A 5LQRA 4M55A 1K6IA 3QF4A 3E3AA 1QM5A 4DR5B 3O73A 1NE2A 1KSJA 2Q9UA 1WW3A 3V1YA 2C00A 3OQVA 2CL5A 4QO7A 2Q27A 2A1TR 2JHFA 2XADA 2XRFA 2C9YA 3AW9A 3CPEA 3N0VA 1E2JA 3ORSA 4GNRA 4CTOA 2WF6A 4XX0B 1CR1A 4LQ4A 1GLNA 1VGVA 1HDCA 1FQJA 4AO6A 5EJ8A 1A0OA 3NHAA 4XIFA 3A6LA 3IKMB 1E2KA 3E03A 1A95A 1DBIA 3FETA 5MGNA 3DDWA 1H2FA 1B1AA 5DRYA 1MJGA 4PRLA 2VYND 1C3OA 3NCHA 5GIPE 1OUMA 2ODTX 3WWZA 2IS1A 5LZ5A 1Z0JA 1IH8A 1XZAA 2AR7A 2R60A 2BFNA 1DU4A 7REQB 2GK6A 3GF4A 1TECE 1U11A 4MS1B 4N5IX 4QPCA 2HXGA 2P67A 3LQRA 2ZRAA 4B4WA 4YRAA 4LJ7A 5AVRA 3I62A 2FCAA 2P3LA 2NX2A 1NQ5A 2R6R1 3FZEA 1MPTA 3G2LA 1RC8A 4YQEA 3RHSA 3UK6A 5TQ2B 5G1NA 1LQUA 1DTWA 1NUSA 4ZU1X 3AQ4A 4MHOA 2GZMA 4HCJA 2HBQA 1T5LA 2O20A 2ATCA 1QMGA 3JD0A 1I32A 3IO3A 4LY6A 3SSMA 4EH1A 1ILWA 3LBHA 4RVOA 2AEFA 2C7QA 4RHUA 4WKNA 5EFZA 2F9LA 3VKHA 2G9QA 4KSYA 3HCOA 4IIGA 1K0UA 1SIOA 2WM2A 3B51X 3OPNA 4NU8X 3ZV6A 6REQB 3FOEC 2JNWA 5DXAA 2WUWE 4ZCIA 4LF4B 2C4HA 4CR6A 4LBZA 3HHEA 1R4AA 3QEOA 4WKGA 4UM7A 3S1SA 1YVDA 4Y3UA 2FFQA 1V96A 1JPNA 1TM4E 4OB8A 4AAYA 4I4IA 1JU4A 2CB9A 1AQUA 1YQTA 4L7VA 3W6ZA 5TJHA 1DFIA 3R76A 3WJAA 5EMJA 1RP1A 3RWBA 2VPWA 4TRMA 1V4VA 4YHHB 1X13A 2QQ5A 2LZ0A 3B2EA 1KYWA 2B3DA 3LI2A 3LKVA 3OMWA 3UKOA 4DIMA 2WYOA 2P0YA 2WIJA 4PRYA 3UOWA 3KT3A 3MINB 2AN1A 1ATZA 2ZAIA 2A3RA 1WF6A 3BQ9A 3X1ZA 5CRIA 2JLUA 4MUGA 5G0TA 4AZVA 1YFKA 3ADOA 2JIRA 1W29A 1G3IA 2BEKA 5B6JA 5K8CA 4KI7A 1XU7A 1EK5A 3DDNA 5IZCA 1XE3A 1O6CA 4CFYA 5JVDF 4N3GA 1XZEA 1Q1QA 2CXOA 2HY7A 1HYHA 2C4WA 8AT1A 3G7NA 3M5PA 3AI2A 5D2CA 4HUTA 3DEFA 3NFYA 1VPLA 3TPZA 3TVDA 4A92A 4BN0A 5C52B 5A1TA 4M49A 5AVJA 1BCSA 4WGGA 2C1EA 3L6DA 4FLMA 4D8UA 3HXTA 3F2IA 4TL6A 1FPQA 3LRXA 4X24A 4L3WA 1KQ3A 4Y7CA 2CZQA 1WU8A 3UNXA 4JBYA 4LYFA 3EK2A 1JHUA 3PCTA 1LWOA 4TV9F 2HA4A 4WXPA 3WQBA 2BKVA 2JCSA 3DNFA 4L78A 4F11A 4POOA 3SOPA 3QVOA 3U19A 3V4ZA 4OPMA 1FX0B 1Y3HA 2FP3A 5DTIA 1RM4A 1YV9A 2J3EA 2PIAA 2PY6A 3P1JA 4FGUA 4WA7A 1A97A 1P9OA 3NKFA 3AV3A 4M36A 1E3WB 4RK1A 5LMZA 2DUJA 5LP1A 1JR2A 4BGIA 4XGRA 4HTAA 3F5QA 3P9SA 3CVWA 3AUXA 2YHBA 2HM7A 3D1JA 5BW6B 3DAGA 4NOLA 4CM1A 2VBFA 1DKOA 4TWBA 1R8JA 4MW7A 4UEQA 2GS9A 3W0LB 1T0PA 1ZVMA 2XMPA 2QTHA 2YOFA 4MPRA 4PYRA 2DWCA 4EYSA 5IEJA 1PTJA 4MGZR 3LFUA 2Q5IA 2WHQA 3LVRE 1A69A 4K8OA 1YDFA 4ZVRA 3KKQA 3LG2A 2KSQA 2YJGA 5IXYA 4KI0A 4C6RA 2IYUA 4HZUB 2ST1A 2ZTVA 3MYRA 3RFVA 3VGPA 1ULBA 4G5GA 4LHSA 4X6UA 4DA6A 2G25A 4HDSA 1J8FA 2HF2A 4YH1A 2AA3A 2F3SA 3W9YA 2J48A 3ZQKA 1KVRA 3IQHX 2OD7A 1NJSA 3FOAA 3P4XA 3IODA 1C9KA 2HRCA 5DGIA 4AY3A 3VKWA 4MRNA 1RQNA 1PFUA 4NYMR 1DXYA 2GXQA 2HJSA 3IV7A 4MS4B 4JQOA 1LH0A 3U6BA 1DPGA 1XT6A 4D9HA 3FJ1A 3OD1A 5AKIA 5GJWC 4Y9UA 5G3YA 5SY6A 3CYFA 1HG1A 2AFIA 1Z62A 1EGMB 4TSRA 2EKQA 1UQRA 4P7BA 4Y2RA 5AIAA 3TW8A 5B7GA 4ZA2A 3OM8A 3QWAA 3ZZMA 1XMPA 4KIFA 3LUBA 1R8XA 2EFEB 2ZLBA 3FKSD 3PNLA 1M76A 1DAIA 3ORFA 1OX4B 4MJ3A 1N2SA 5DX0A 3QPAA 2M32A 4BWYA 1SU6A 2OGTA 1QP7A 2B5WA 1AB5A 2C3UA 1DEXA 4ZOQI 5KTKA 2G9NA 2CKMA 2WM3A 3QFHA 1W9MA 4BKRA 1OTHA 3P9YA 2AFVA 4PTYA 1XTIA 1QAMA 2P1ZA 3A2MA 4UW9A 1VL6A 3TXAA 3VU0A 5GOTA 3KKKA 5A5VA 4HNTA 4O4LA 2A9RA 3FZNA 2QUJA 4PSUA 5G3ZA 5B1DA 1UCFA 2JLZA 4PLYA 2DETA 1FX0A 1E96A 4LOIA 1EYZA 1U98A 3DL0A 5ESWA 2R4UA 3PF9A 1PV2A 1WB6A 3CS3A 1SBHA 2X6RA 1P2UA 3AEKA 3II6X 2YYYA 1HMPA 1RYEA 3ROPA 5LOVA 2BFWA 2ESRA 1DEKA 4BQNA 2HSWA 2VG8A 2POCA 1A8QA 3K9FC 1JEQA 5BWBA 4EG0A 3UQYS 4EFKA 4RHTA 1FS4A 4QPZA 4YFVA 3JTMA 4E14A 4G2NA 1YT5A 3K4PA 4ZDIA 3PXXA 1C9NA 4JVMA 2BCEA 1ORRA 1U0GA 2O3UA 2XWBF 4KE7A 4O0MA 3T7EA 4DT1A 3IKTA 1R5BA 2AFHE 1U1CA 1DUVG 3KTOA 4K2AA 2VAPA 1T1GA 4OXYA 4QRDA 2Q7DA 1LPMA 3BRSA 3FMIA 3HZHA 5AT1A 5IW8A 4A1FA 4DDMA 1VIYA 2OR3A 4O1IA 2VQEB 4DV6B 3AM3A 2AEEA 1IRIA 2VJKA 1QHSA 5HKLA 1ITZA 2P9QA 4FN5A 2AN4A 1NUUA 3A1VA 5E4FA 3WOVA 4R81A 3HRIA 3CWZA 4PYLA 1YGYA 2AD5A 3Q7QA 3HBMA 4LSWA 4MS4A 1FE8A 4G07A 1DQNA 2QRKA 3SYNA 4OOEA 4DC1A 4EL5A 3G49A 3I1FA 4BMYA 3KQWA 1WD7A 4EJSA 1GEEA 2ZQ5A 4M8LA 1BKDR 1J5PA 3PD7A 2Y27A 4M1MA 3CVUA 3DOCA 3W2FA 4ZZ0A 1EFKA 2PNFA 2QVZX 1THTA 4G5SA 1Q44A 4K6KA 1KZGB 2I1VB 4NTZA 4WLNA 4ZV7A 3JD3A 4W7HA 1Z5WA 2GB4A 3U4AA 1ZUWA 3DEHA 2ZJ6A 5L9AA 1P2TA 1BXKA 3DW3X 3DW1X 4AN1A 3GPIA 1KQFA 5A0VA 5DM4A 1CPYA 3HR7A 5JQWA 1X9HA 3CE6A 4FONA 1TGYA 1G2QA 4HYEA 2XLBA 5A9TA 4E3WA 1YHNA 4TN5A 2V96A 1DV1A 4M98A 3C7AA 4DIEA 2WFAA 4CKXA 5IT5A 1JJFA 3C0KA 1Y63A 3MMNA 2CMHA 6YASA 2XA2A 2WPNA 1PVVA 1F2UA 4IDGA 1I2MA 5DBHX 4AMBA 5K09A 4NEGA 1Y5NA 4RTMA 2XQIA 2Q6TA 1VLHA 2R1TA 4CT0A 2WZBA 1TLTA 2HDNB 2ORVA 3JZIA 2DPYA 4Y2UA 4Q4DA 1GY8A 3WNCA 3ZGXA 5JNTA 1G3MA 4B4DA 5AOVA 4AF8A 5L95A 1ZVVA 1RAAA 2N1MA 2XKKA 2QM7A 2YW2A 1KDRA 3KJNA 3NC0C 2FDCA 2BFBB 1U7OA 2FKAA 3EJ6A 4R2JA 1CB7A 2NU6B 4H2DA 2GDZA 1OYWA 4DF3A 3FH0A 2Y0BA 3GXOA 3EYWA 1NU6A 2J4DA 4PSCA 1P4JA 1I5RA 1PR2A 1YULA 1T5BA 4O4LB 1SELA 1XEWY 2BHRA 2XTZA 5K0NA 4BRZA 5C81A 2K7ZA 3GC6A 5EUBA 3RD5A 2M2IA 5TE9A 1N0HA 2QVXX 1BRTA 1GFZA 2YNMC 4BXOA 4DLSA 2X1HA 1WOMA 1U2GA 3AFOA 4RZQA 2JGKA 4FR5A 5EAIA 4MP8A 1QOQB 2IT1A 4E51A 3G1WA 3RKRA 5BVHB 5GP1A 4MSUA 3RC2A 5IF3A 2C61A 3L49A 3CNHA 1G7RA 2XY4A 3GROA 4II2A 3ZJTA 1U4NA 1UEJA 4KKVA 2W2XA 3O4GA 4HB4A 3AFGA 3LMKA 5ITZA 3SD7A 2ZI3A 4RW0A 3TTUA 1B23P 5KAPA 1CDDA 1Z17A 2PZLA 2COUA 1JG6A 2BHLA 1M6NA 2C4UA 3E3MA 3NORA 3SLGA 1LX7A 1ZJZA 2WHEA 2MYTA 3QJYA 4TRJA 4FTWA 2J85A 3H2BA 3PNOA 4DV7B 3O91A 5JVDB 4YXWD 1MO5A 2YICA 1T9ZA 4I08A 5LBTA 1ZHHA 3D6TB 5EXTA 2H06A 2LGJA 3PUZA 4PGHA 1I7LA 3V00A 2GFHA 1GAQA 3DQPA 3K0FA 4NBUA 4RHCA 3DVAA 3UXMA 1BHSA 4LXXA 2J0UA 4CT5A 4HZUA 4RDIA 3KJGA 3G2IA 1H93A 1JXQA 1XD2B 3RW9A 4DPKA 3D0KA 1RAHA 1EESA 4PO3X 3RG8A 2YDYA 4MB2A 3ZJYA 1WUIS 5DN9A 4CN9A 4R84A 4G4GA 2XXAB 1AH2A 2BMJA 2HRDA 4NYIQ 1SC3A 3V1TC 1PO7A 1SBZA 4GZ5A 5B53A 3GNLA 3PDHA 3TUJC 5KU1A 3VZPA 2MYNA 3LQ1A 1MOSA 1CU1A 2LW7A 1CYEA 1R64A 3HCNA 5ITVA 2H4FA 4TV8A 2V7QD 4B6FA 3NM5A 2F48A 1E79A 3WS7A 2X8BA 3VO9A 3BRWD 1WHSA 3GLIB 1VBNA 4IDAA 2YZMA 1YZUA 3MBOA 4X63A 3FCAA 5HIMA 2RHMA 1ULHA 4UMDA 3I37X 2Q6VA 3P4YA 3STVA 1TC1A 4BRSA 4AG5A 3NAQA 4IV0A 4RWZA 2YIJA 3D8RA 4R9RA 4UHCA 4P5PA 4WI1A 1GZUA 3A9CA 3E27A 3HJTA 4TXJA 5JI3E 1LSJA 3EVNA 2ZRDA 3DV0B 4MLDA 5IANA 2F1IA 4V0MA 4OQEA 1Z83A 3ABSB 4W1RA 4DILA 4KR3A 4HWSA 1PFWA 2A7XA 2A9VA 4KW7A 2H7VA 1A7UA 1RR6A 1HTWA 2XUOA 3CZMA 3IA7A 3ZCSA 2RK3A 3ZQ4A 4WOKA 2H4JA 4PXYA 5A7HA 1B42A 5AJXA 3V55A 3U3KA 2V5UA 5CH3A 5H9WA 4QPDA 3G2JA 1ZU4A 3DMHA 1MF7A 3B2QA 4Y67A 5FBVB 4H1UA 3PBKA 3UJ9A 1RDFA 2OGZA 4X6YA 1EBBA 1WE2A 1ORDA 3ZOZA 5EERA 4I6GA 1M1XB 1L5ZA 2OV4A 2VOEA 1BEUB 1TEVA 5AKJA 5CX1B 2XDQA 3VC1A 3C7KA 1M2EA 1ZMBA 3LSYA 3DLBA 3OESA 2V3CC 5ALYA 4CKCB 3A1UA 1XTKA 1IDN1 3S29A 4B81A 1ZRNA 3OUUA 4ZT4A 2D74A 1NVVQ 4QFCA 4JODA 1Y1KE 3BWMA 3HYCA 3SYLA 3SWWA 1SN7A 1LI5A 3BGDA 1ZUD1 3EFHA 4AP9A 1JQLB 4F96A 2C57A 4PCVA 4BMCA 4QDKA 5CT9A 4JIGA 4TKMA 1UBNA 5BXYA 1BVYF 4C0XA 3PQ7A 2GYVA 4S1NA 1Z8DA 3R4VA 4RANA 4EUNA 3PDIA 1KRWA 3CEHA 4Q82A 4IF6A 1R6TA 4ZMBA 1M0SA 1QORA 3GGGA 3CUYA 1MUUA 1G42A 4G4SP 3MQ2A 3AP1A 1WV0A 2PWAA 4U9UA 5IWCA 3BQNB 3DMYA 1UKYA 1B0PA 4W9NA 4XM0A 2QTMA 4KWHA 1XA4A 3QMPA 4UHBA 5TDHA 3SJCA 3ZWXA 1MRSA 2J67A 4QYTA 4BGEA 5BV1A 2B30A 4HNAB 1JV2B 3OOWA 4LJ4A 1TIBA 2NN3C 2ZOSA 3RPEA 2FE4A 3JQGB 4YA6A 1XCJA 2C4KA 4RAQA 3DLAA 1K8ZB 4ZCQA 1J24A 2HWXA 3ETNA 3O84A 5TVKA 3A14A 1KYYA 4GS5A 1KFBB 3TQOA 2VFAA 1ULAA 3LL7A 1KQOA 4EYGA 1EIZA 4BV3A 2V8OA 4I4NA 4ENTA 5TT1A 3UB3A 5LP6F 5L6LB 3HI4A 4EG1A 3WLSA 3G7SA 4JFRA 4PQGA 4XJXA 3PNYA 4CLEA 3PRKE 5CLQA 1WM1A 2JGEA 2ZTSA 4UU0A 1D3AA 1JEJA 1PSZA 1L9XA 2ZG6A 1GGVA 3N8NA 1F0YA 4IHJA 1MT0A 4JA0A 7ABPA 3THWA 4I1PA 1PJ4A 2IX3A 3OY2A 2FPUA 3RBZA 3IIMA 1T1SA 4XYEA 2Q07A 1UH5A 1D1SA 1QS0A 3N2ZB 5HM6A 2HMSA 3O8OB 5FH9A 3TIVA 4KR9A 1CS0B 3O90A 4K1LA 3P5BA 2J30A 2IIQA 1TM7E 1X0XA 2Z1MA 3F5FA 4O08A 5CB8A 4IOKA 4C0QC 1TTTA 2ORIA 1T6NA 3A4NA 4NNPA 4MXDA 3AIOA 2DPGA 3B5IA 4EUHA 3IMCA 2CDCA 2CBXA 4B6EA 4AROA 3TX2A 5I4KA 1TQDA 1N3BA 3LXXA 4JUBA 2NSDA 3AEYA 2PX6A 1N7JA 1VP9A 4WTOA 5IM4F 2IHNA 2IH2A 1G8GA 2PSHA 3I39X 1ZSYA 3COYA 2XYHA 1Q0QA 1HFEL 4DARA 3GP3A 4F7DA 1IATA 5KPJA 1IE3A 1YBHA 4IV8A 4BV9A 4DQLA 3ZCPA 4R6WA 2HHHB 3ICPA 1EZZA 3PXAA 3AVVA 4ERNA 1P9RA 2IZOA 2CHGA 2VQFB 5A2QA 3MRSA 3BL6A 1Q6YA 4J7AA 2EJTA 5DW0A 3WBJA 2J0QA 1WXGA 4PPQA 4JR0A 4D80A 1RHQA 4BPBA 1CF4A 3KQQA 3JY6A 1RRGA 1L5VA 4J1SA 5DWVA 2I7CA 4JSRA 1EB9A 2PZEA 4MULA 4EJMA 4KB5A 2B4AA 1HNXB 3FGNA 1KOLA 4H27A 3DYVA 3OZDA 4IDNA 4PSVA 5AW7A 3DWFA 3O3MB 3RUDA 4AJ4A 1ZCFA 1NF2A 5IG2A 3BZBA 3CKKA 2CFSA 4RH0A 3D4PA 4DSTA 3GLFA 2FW0A 4C3VA 1H5QA 4OHYA 3MCZA 1NXWA 3NC1C 3D02A 1SXQA 4FWTA 4V0SA 2BC9A 1C2TA 3LXRA 4OMUA 4AWXA 1DOAA 2O7VA 4MQBA 1NZFA 3BXFA 4B7ZA 1B16A 1JIVA 3O8LA 3UWKA 3HLYA 3S1AA 3EDCA 2RH9B 1ZLXA 2ZI9A 2MSKA 4HXYA 2I3GA 3T7SA 2IY8A 1UDWA 1JFVA 2HT6A 4EI7A 5AD1A 1E92A 1E63A 1Q2UA 4N5DA 3QRWA 4ZT6A 4LRSB 3OA0A 1E9AA 4E33A 1BWRA 2B1QA 3BYZA 1L3CA 3QTLA 3MD9A 4CQNA 1B8VA 1QGAA 4QQFA 5CBKA 2X8JA 3P0HA 1SHZA 5A4MS 3WIDA 1HEIA 5A4FS 2ZIXA 1UK9A 4E13A 4AY2A 1V8BA 4ZDKA 1U0NA 3GX1A 4WKOA 2DRIA 1PU2A 1GARA 2VKQA 2BLLA 3ENKA 3LCJA 1XDBA 1GN9A 4FS8A 4B1FA 2AXQA 4Y1FA 4H3VA 1BHJA 4LW8A 4OO3A 4HS9A 3PHJA 1VE6A 1JDSA 1IZ0A 3ET5A 3H16A 4GEGA 4CEHB 4ARAA 2M9MA 3H99A 4PTLA 1C0EA 2A88A 3D8UA 2W7TA 2PZFA 3V48A 4KQCA 1OFTA 4G0VA 3IIJA 4FFVA 4LSGA 1L4NA 1TVEA 2HDWA 3MCWA 3O4IA 1K06A 3QUSA 1WHTB 3AO0B 1GTVA 4Y9SA 5AO9A 4G5RA 1ES9A 1K4KA 5CB6A 2O4UX 2CFCA 3CX7A 3HL4A 1U2QA 3JQ7A 3EASA 5HS6A 1YFJA 3LOPA 4HI0E 1OLSB 1PR3A 3BJZA 2QSUA 1LB1B 4RXUA 5B2EA 4Z4QA 4IIBA 1V11A 1P3Y1 1JHZA 1BQEA 1OQAA 4PQYA 3W79A 4B83A 4J03A 3V3KA 4KXYA 4MGKR 2YASA 1X6VA 4EVSA 4YMWA 4ND8B 1J7JA 1ATIA 1NL3A 2VDOB 1DQPA 2HKIA 3AF4A 2OC4A 3R6DA 4A7PA 2NUAA 5JJIA 2B8NA 4GRDA 3G0CA 2DMRA 2BUBA 4UASA 2LBPA 1EAMA 4KUEA 3DVSX 4U7FA 1RQRA 4R98A 2Y1KA 4GZMA 2ZUSA 4TZTA 1LGYA 1QFJA 1U5AA 3RS8A 4CMIA 5IPFA 1SQ5A 1RYBA 4JB2A 5AW0A 4E3ZA 1OBHA 5DGHA 3TG8A 1XZPA 2XB9A 2P6NA 1N5MA 3SLRA 3PPVA 3DDZX 1AXEA 1HE8B 3K4HA 4C08A 4M9CA 1FMFA 3CLTC 2QNBA 3E23A 1ADYA 4IIDA 2QN6A 4LQLA 1AX9A 2O3RA 3D0QA 3EOBI 2B98A 1W0CA 2GPWA 4HAIA 3E9ZA 4I1RA 3I0ZA 5IDYA 3R3XA 5G4KB 5BPFA 4YMVA 4I81A 1T1JA 2C88A 3E0XA 4CE6A 4UMVA 1X1QA 3LUHA 1YDWA 3UMRA 5EUMA 1XTPA 4N3CA 1W5BA 3FKSA 1L1QA 5AVVA 3SC3A 2HD4A 1ZQ9A 4WJZA 4DT1B 4XSVA 5JASA 2D00A 4JX9A 4RH3A 1NMYA 4H7FA 1G5IA 2IU4A 5K3DA 5K0ZA 2JJ8A 1Q3TA 2IYRA 3OEEA 4LJ6A 3LC1O 3CF2A 4PGFA 5SZKB 2NV6A 1ECLA 3WYAA 4ARUA 5B36A 1PZEA 3M81A 3THOA 3G6WA 4YRQA 1O03A 4NLLA 5FULA 3IAAA 4B9EA 2Q50A 2J45A 2OV6A 4L9SA 5L3QB 1UFVA 4YBRA 3IUJA 2CXPA 5FCDA 4C0WA 1WB4A 1Z5ZA 3A4MA 3QUBA 1C1HA 1MEOA 3FUTA 3GVIA 3NBFA 1KVSA 1VL5A 3I2YX 4YJFB 5B1IA 1J6UA 4OYRA 1MB0A 4TL7A 4GVPA 4Z6KA 2I4LA 3GZJA 3MCUA 4ZYTA 1T4CB 3GVHA 2OSBA 4JYZA 2GM4A 1QVAA 5CPFA 3RU7A 4QXRA 2OZLA 3AEQA 3T1OA 2FZVA 1I6LA 2FK7A 4PIVA 4F2DA 5LQDA 3H11A 3RJMA 5AI6A 1E3QA 3UWDA 3RK1A 4BNZA 1PZNA 2ZRPA 2XWQA 1E4YA 3ILXA 4UD6A 4YJ3A 4J0GA 5AKYA 3UFXA 3AB3A 4DWVA 1N6KA 3KEGA 4NG4A 4OBBA 1DEHA 1FMCA 4ZZ2A 4DM7A 3HZRA 3IIEA 4I9FA 4PINA 5LD2B 4NMHA 1N6OA 1Y9EA 2ZVJA 4M9RA 3EHEA 1XQYA 3M83A 1U31A 3LXUX 3PCXA 2AZ4A 2FYTA 1HZZC 3AYZB 3ODGA 4N49A 4WHMA 2H1HA 3A4VA 3W8FA 1RHJA 2IUTA 4WL0A 5AMXA 1XPJA 5FPHA 2ZJBA 5HG0A 2UYOA 3ONDA 3TLYA 3W5BA 2GNAA 1D0SA 4IDDA 3CURA 3GFSA 4OATA 2FXIA 5AQEA 3RIXA 1J21A 2OVBA 1WPGA 5EWJA 5EWMB 4DB4A 4A73A 2AKEA 3HVUA 1TLFA 1TM5E 1SXHA 2W6PA 1EIWA 3QVVA 3I5YA 4HAOA 1OAOC 4D74A 2I99A 2YS6A 4NENB 1QLWA 1Z6XA 4IRUB 2R48A 3ITNA 1DIRA 1IOVA 1V9SA 3ZH2A 4FS3A 1M2GA 1REQB 3I4LA 2DXIA 1EP2B 4IINA 4IJWA 1ACLA 4B34A 1AKQA 1CLEA 4EPXA 1UR5A 3K1AA 1FJHA 1ZL2A 4ZC1A 3DG9A 4MRVA 2OLJA 4GYYA 4KKXB 1FDIA 4NECA 4NF2A 4O2BA 3A6DA 1PJBA 1KZ4A 4LZLA 2J31A 3EQ7A 1SVKA 3H9BA 4FDUA 3FZQA 4P83A 1RYZA 3CW9A 3E4CA 3MMZA 4MUIA 3CNEA 3QLJA 3MWYW 3BA1A 4ALKA 2PMEA 3ZQUA 1ISRA 2WK1A 1KE1A 2J3LA 3GRKA 1A9TA 1VDZA 1Z39A 2QZZA 4L8FA 1COWD 3I34X 4LYAA 5KYVA 4BJ6A 2CXSA 2PXXA 4D4JA 3T8YA 1H6CA 2ZTLA 3PL1A 3PFHA 1MORA 1TB4A 1VYHA 1Z3IX 1E3WA 2Q1WA 3LP5A 5JSZA 1EUZA 1II9A 1K6XA 4OYLA 3T06B 4AJPA 4R68A 2WHPB 3TG2A 3Q0TA 3ZGVA 1CX9B 3WK4A 3GU3A 1ISPA 1K6MA 4H7DA 3ZUGA 1UXHA 2EWVA 2ONYA 2L17A 3VU8A 5LP6A 4CL2A 5JWRA 2IHUA 2JGDB 4Z9BA 2UUPA 1HR0B 1A3CA 2JFYA 3IT3A 3IVAA 1ODFA 4S1WA 2HGZA 3PX3A 4HH0A 4P4UA 4Z86A 3PL5A 1CERA 2K2QB 2RMKA 4PZCA 3VAZA 2IDZA 1NFQA 1O77A 1NXSA 2FJUA 1FVOA 2JGAA 5JAOA 2J0UB 5AKEA 2ATVA 4QL3A 5K8IA 3AF0A 4OXXA 1FFGA 1L5SA 3H2GA 5K5EA 4KPEC 2IHKA 1UT8A 1Y7HA 2D5BA 2BEWB 3BVPA 4PPFA 3ZS9A 1N36B 3OIGA 5JDCA 1BMFA 1S89A 1S6YA 2IWRA 3W6NA 4G26A 4DLAA 3ORRA 1N8NA 4FU0A 3E7WA 2G7ZA 1PDOA 3RYCA 1Z2OX 2FWNA 3I52A 3DBHA 5EQFA 1WOYA 3VBEA 3HDTA 3UICA 4BUZA 5A9SB 4HRVA 6ADHA 3CEMA 3SZOA 2PH7A 1H2ZA 2IYQA 1DG9A 2XR1A 1SUPA 3QFCA 3R5SA 4GPAA 3ZTWA 4EKEA 2ZRKA 3RYHB 1E62A 4MVWA 2QROA 5BN5A 1KR2A 2B8JA 1VIMA 1DEAA 3AZOA 1U7WA 2DUMA 1C41A 4GDMA 5AVKA 2UVDA 3D7SA 4JNCA 5A3RA 4KFSA 1F6DA 4DSNA 3PJGA 1N34B 4C2UA 3KCNA 3LBYA 1JFFA 1KMIY 3BSSA 3MWKA 3NETA 3PHGA 3PKIA 3C8UA 3K09A 1H23A 3OP1A 1ZCZA 4PC6A 4PR0A 4WFIA 4ZK6A 2P11A 4QXMA 2C9MA 2BGRA 2GH1A 1R5OA 2R7MA 1WUJS 2VP2A 2WT8A 4BQFA 1QTQA 1CV2A 3GGJA 5LBIA 3CWCA 5KNCH 3A3OA 1MC1A 2JLWA 4MIKA 5A06A 4DOMA 2XKJE 4QPPA 4DJTA 5SYAA 3RIEA 3SSNA 1X74A 1VMIA 4KH0A 4P7KA 4FM9A 3N58A 3ND9A 3R5FA 5HYVA 3U44A 3UG6A 4Z4EA 2DBYA 2PU7A 3KQUA 4RF2A 3S40A 3ROEA 1G7CA 4DJJA 4R8SA 1QHFA 2H1OA 4KREA 1UC9A 1UOQA 3ODPA 3ITDA 4TSKA 1UP7A 2DCUA 1W6RA 2REXB 1TMKA 3GUCA 3V1LA 3ZGLA 2OA0A 1CVLA 1KE2A 3LTEA 4H60A 3TW0A 3ZTYA 3R5HA 5LZ2A 5CP8A 4KOAA 1JDTA 3EW9A 4YB8A 4ZQGA 5IVHA 1E4OA 2ZUBA 5BXQC 3OQ1A 5EJ9A 3C5CA 1BQ3A 2C42A 2A5DA 2PA0A 4HX2A 4RPKA 1O5TA 3AJRA 1JXOA 1OW3B 3GOQA 5DXJA 4L15A 4NEHB 3QQ5A 3RIHA 3UOAB 2XODA 5LP6C 1KI3A 2O59A 1E9DA 1XAGA 2ZBFA 4FZVA 4KO1S 3ZNQA 2YY6A 4JGBA 3M2PA 3K70D 3CRMA 3H8WA 1BOOA 6NULA 3FGOA 1HDXA 4UCQA 1P0MA 4QNMA 1YI1A 5CCDA 1X7YB 2JI4A 5IM4A 1YRYE 2HQRA 5HZKA 3WMEA 1A5ZA 1Z4PX 3IAS6 2C29D 3ZHOA 5SV2A 1Q12A 4EG7A 1EP1B 2WF8A 5I4CA 2RBGA 2F8SA 1CZLA 2ZM5A 4W1SA 3LDHA 1M34A 3LKBA 4D9NA 1D7OA 1P62B 2R47A 5HMLA 4CCYB 4YV1A 5KWIA 2JBAA 5FTMA 1Q2XA 4WBNF 4AFNA 2V1UA 3KE9A 1QO0A 2V65A 1Z26A 3FTEA 1OIWA 3ZI4A 1SK8A 4DA0A 1H2RS 3C39A 1ORWA 3WQHA 2AMJA 2W43A 3A3PA 3SZRA 4DLNA 3GZ4A 1Y1LA 3DD5A 2Z95A 1PW7A 1FRQA 4ND6A 4Q39A 1R0ZA 1CZHA 3I58A 4HL6A 2QG6A 4ND8A 4HRAA 4IEIA 4R51A 5IUJC 2HV8A 3D7NA 1MJNA 3R7LA 1MZPA 2GN8A 2X7HA 1IPEA 1LSUA 3ENQA 3ZNPA 1X1DA 4R1SA 3KCQA 1UBRS 5GV7A 5BSUA 3U40A 3M3DA 3WZMA 3KL4A 1I1HA 1W44A 3EY9A 1CXZA 5BR8B 3G8AA 1NT4A 3IUQA 1SZJG 3SPXA 3ZWAA 1NYLA 1JU9A 2UV8A 3AH8A 4Z9FA 2ZSJA 3L1JA 3KHKA 3EWSA 4IFIA 5E0OA 1XN4A 1F7UA 3AHHA 4P4NA 2AFRA 2UZAA 3CNNA 2BT4A 4N1AA 1HY3A 5E6RA 2Z08A 4Q02A 4ATNA 1OYOA 2ZJ2A 3RUIA 1TO6A 2FPSA 3R77A 2FZLA 4BMPB 3SBDA 5B55A 2AW5A 3IBYA 4PX3A 1D6JA 1DHTA 1RI3A 3G88A 2MSCB 4G85A 5CBPA 3JYQA 1JIKA 4X94A 1CR6A 1MPXA 2R8XA 3ZDZB 4FCCA 3WAGA 1V37A 1V5IA 2C2WA 4BZWA 3GVXA 3MFYA 5KYWB 4NU6A 1PYOA 3R7NA 3W8NA 4DMMA 2O8EB 3C1AA 3DL4A 4EG8A 1TA4A 2EZ4A 3F3SA 1HT3A 2VTVA 3UW1A 2O8BB 3HQ4O 2DHRA 3C70A 2QPAA 1NYRA 1OLSA 4L8WB 3BXPA 4RLSA 4RVDA 4WACA 4DR4B 4MV3A 1Q0HA 2MT9A 3FB1A 3DR3A 1YI8A 4MVJI 3ZV7A 4DLZA 2CFOA 4L4SA 2DY0A 4OLJA 2JLXA 1WHTA 3ZVNA 3PIIA 4O5AA 1QIHA 2QF7A 3MB5A 4CKBA 3ROTA 1Z16A 1YQDA 2AFIB 1Z4QA 3CUWA 2C04A 1KYXA 1E1KA 2FZ5A 2HNAA 2FVXA 2R9VA 3HKBB 3MVEA 4KL8S 3EGIA 4Z9AA 5AXCA 1R4MB 3Q8KA 2BE9A 3C3YA 1EUDB 4KOEC 4GBGA 4BLRA 3EULA 5KNCD 4Y8VA 2AZXA 1WDLA 3GUHA 4GP7A 1SHLA 3RNLA 4FGKA 3ASVA 3PD1A 4C7MA 4PQRA 2AWOA 4RA6A 4JYAB 4FOPA 4QU0A 1LNSA 4HYQA 4OCZA 5BSGA 4CMIB 1ZU5A 3IFSA 3P26A 3OVMA 1ZAKA 2G09A 2HA0A 4HN4B 5FL3A 2C1ZA 2FQQA 5E7MA 3L5KA 2XT9A 4Y6PA 1R4ZA 2JFXA 3RU2A 1RZRA 1H2WA 4QXQA 3T7JA 4D9FA 3NG1A 1O6GA 2IYPA 2HFKA 1W5EA 2ZZMA 2DWPA 2OV2A 2P7HA 3B3GA 3N7TA 3GEEA 3JAKB 2Q0XA 4Q37A 1AUXA 3LQ4A 2CLCX 2HCTA 4HDMB 3FWZA 1IYZA 1NOJA 4OKNA 1Y7LA 1TJ5A 1JHDA 1HC7A 2QUHA 2KBEA 2RHBA 3KDAA 4KQ2A 4ZVMA 3V2GA 3WYFA 3W1WA 1Y6QA 4M38A 5DOVA 4UFNA 3Q9NA 5DWQA 2M6KA 1GSOA 1KI2A 1S2DA 2QT9A 3AVOA 1CZRA 3TPFA 5JJKA 4JQYA 1UMDA 1M6VA 4K2HA 2QM0A 1VFNA 5JTTA 1SOMA 2ZANA 2NXJA 4XB1A 4YLEA 5CA0F 2EBFX 3L6RA 5LNK1 1UOEA 1AKUA 5EN4A 3D3QA 3FUWA 3GCDA 2P6UA 2P5SA 4HDRB 3V7YA 1KR5A 3CLKA 3B9BA 4CQLB 3EUAA 5HKBA 4ZQFA 1GFIA 2J3IA 4CIYA 2B1IA 2AH5A 2PR2A 2R8OA 2C9CA 5KYUA 2PX4A 3V1MA 1FYWA 5JJ5A 1BH2A 1RWXA 1LQ2A 2EJBA 4K40A 3GLVA 3AHEA 4FX2A 4PYNA 3NT5A 3GFTA 4L76A 1LFDB 3N5KA 3K2BA 1X3LA 2P2ZA 3MC1A 3SDSA 2DFDA 1GTSA 2WIDA 2HLDA 1ODSA 3EMVA 3FXAA 1X80B 1JIXA 3HXLA 4KIGA 4BO9A 2QI9F 4QBKA 4QQ8A 2XT0A 1VE7A 3EBPA 2B0JA 3AR2A 1GQ2A 2BF7A 3JWEA 4JUFA 5C5IA 4GECA 3W5SA 2GZ3A 3ZLVA 1Q0ZA 2BGLA 3FTFA 3MTDA 2V7BA 3LK7A 3D59A 3NWJA 1RACA 3UH0A 3HB0A 1HTBA 4TWIA 1V41E 1U7ZA 3Q11A 4Q1VA 4AS3A 1H4VB 3EUWA 1ODCA 2YFHA 4IZIA 4BX9A 2D1FA 1JIJA 4S0XA 1LVUA 1DGQA 4LN1A 3R3WA 4MKZA 4YUVA 3SKYA 3Q12A 1TM1E 1NVBA 1RLMA 3A3NA 3CLUC 5C5DA 3QE9Y 3O21A 3EGEA 3NVKI 4NQZA 2CZCA 2G8NA 1WO8A 4TYWA 3PDIB 2HOQA 4MDEA 2Y67A 5ELLA 1Z08A 3B70A 4CYMA 1HDZA 3FWNA 3PUVA 1SVSA 2G1UA 4MS3B 4MYCA 1AO0A 2W42A 1PV4A 3QVMA 2F3RA 2W5UA 3OQHA 1P81A 3DVAB 2ZT8A 4Q9AA 4NNJA 4U2GA 4QXPA 1FLNA 1U5BA 4H6VA 3DP7A 3WGHA 4O29A 2OY0A 2VO1A 3A4YA 3O4RA 3WHIA 4EFLA 1PGOA 1SPBS 3Q5DA 1FXSA 1LBQA 1WKCA 4PRZA 4YAUA 4LJ9A 4DLBA 3VM6A 3ICOA 4LYGA 1C5KA 2ACKA 1X8JA 2I8AA 1Z6GA 2IUSA 3LY9A 2HUPA 4HQ6A 4BB9A 1B41A 4MCHA 5IH7A 1R7RA 2FMHA 3UMMA 4KXFB 3CR8A 1JTEA 4J07A 5GZ6A 3TD9A 1VLLA 3OOEA 4LGVA 1X7GA 3EZ6A 1QFXA 4DLLA 2AC7A 2GPAA 3IQDB 2H2GA 4N7RA 4NESA 5LYJB 5IKPA 1Z06A 3LW8A 1K92A 3CY6A 1WP9A 4RLHA 3QVLA 3GD7A 3ADKA 5EL0A 3VV3A 2GXSA 3H9CA 3BE5A 3P9PA 1XCMA 3L84A 4TUYF 2QR3A 4B7AA 3ZE1B 5DP2A 2A84A 2ZU0C 4ZHQB 1TF5A 2OXFA 4AW9A 1KY2A 1E18A 3ADPA 3AI1A 1ODLA 2D2FA 1Z12A 3UENA 1FPMA 3WLEA 4D92A 3L07A 5JS6A 1IN4A 1YJCA 2HK8A 2ZYHA 3L7BA 3T95A 5REQA 1RTTA 4RL4A 4O4HB 5F12A 3R0ZA 4BCCA 3IUSA 4REQA 3TQTA 2EFGA 3MN1A 1XD2A 3OQIA 1QFZA 9GPBA 4Q0MA 1O87A 1PL7A 1JLKA 1BSVA 1JILA 1MABA 2E4AA 1JG7A 2IXBA 4GG1A 4UATA 1UQTA 2JKYA 5HWSA 4U2DA 5KOYA 5E4TA 2AMLA 1XNHA 1YDGA 2XQVA 1SIBE 1H3NA 5I45A 5KYXA 2F2TA 1ZAYA 1T8SA 2GUGA 3DULA 2YR0A 4I1VA 2CFTA 2LDBA 1D1PA 1IVYA 1EHYA 1GZ7A 3G0HA 3QLVC 1A9XA 4RPIA 3F4LA 4WNYA 5MN6A 3R40A 5SICE 4UCWA 2HWKA 3D6AA 3QE4A 1M8KA 3B3JA 4NCKA 3JXEA 1PJSA 1P75A 3OZWA 3BTVA 4JKYA 1E69A 2P2NA 4FFRA 1AUQA 1CUHA 4Y1GA 4Z7QB 2VHQA 3GEHA 1IUNA 5AM2A 1OZGA 2GEBA 1R8YA 4JVNA 4ZAXA 5ALXA 1LD3A 1NT2A 1ZMRA 1VPWA 1AKTA 4HGRA 3EYAA 4LISA 4HQFA 5ELMA 621PA 2DKFA 4F93B 2QLLA 5CD9A 5IT4A 3LDGA 3QNWA 4E15A 4A8JB 4EPYA 3LWZA 4C0LA 1KFJB 1TC2A 4NOKA 1W5FA 4EKGA 1NRWA 1RRMA 2VDPB 3BMXA 3QMWA 2R1VB 1E7QA 1Q50A 1F8YA 3K0EA 1HORA 3C6KA 3NT4A 2VSXA 2PXAA 4DSAA 1GRRA 1RI2A 3E9EA 4JN6B 1ZJ5A 2XDQB 3U4HA 3SICE 1XCOA 1YE3A 1ZD3A 3CBQA 1PVDA 3JS5A 3KALA 3RS9A 1T9DA 3VNRA 4YMGA 2QYHA 2XTNA 2GBGA 2YMLA 3VPFA 4QATA 3QJGA 4KQJA 4GXRA 3RSQA 2HJVA 2Z3ZA 3TI9A 1EDBA 5LPNA 1GUZA 1GCIA 3PI7A 3LS2A 3I0NA 4H1HA 1MKYA 1KQPA 2AFHA 2PS3A 2RGGA 1WXFA 3PYXA 5JG7A 4OLBA 1QDLB 1A2KC 1CQJA 1WUTA 2W8BA 2C7BA 3DP9A 1GA1A 4Q1EA 5CNMA 2F64A 1RZRD 3ZV3A 3U7EB 5KSZA 1TK9A 4JK3A 1O7JA 4JI3B 3N2EA 4NFYA 2H1SA 1ZDMA 3BIWA 5ALKA 4NJEA 1D9ZA 4IVPA 4ZQIA 1N2EA 5DNDA 1VKRA 1PGPA 1YFZA 2NLOA 2TMYA 4D99A 1KIFA 3TKLA 4QFDA 2AE2A 3DNMA 3ZX4A 3COPA 1IMJA 4LJAA 5I9MA 4P93A 1QV6A 4RHYA 5LKAA 5TIIA 5JH7A 1YC5A 2O14A 2X13A 3NZEA 4UPVA 4PS1A 1U1GA 1O2DA 1TCVA 3FHOA 4YAJA 3M6UA 3JWJA 3VQTA 1VHDA 2I33A 5JAZA 2ZM6B 4TQUS 2GN9A 1V9CA 3QYJA 5L4LA 2AJTA 1IQUA 4KSBA 4XYLA 4BZXA 5JNSA 1ODTC 3X0DA 4JZYA 4JBGA 2QTCA 4H3SA 4UVIA 4B4UA 1OB2A 1JHYA 2HMTA 4HNSA 2XMGA 4LZOA 3ICQB 5BOVA 2HA6A 2JB9A