1YZ3A

Structure of human pnmt complexed with cofactor product adohcy and inhibitor sk&f 64139
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
263
structure length
263
Chain Sequence
b'PGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
publication title Structural, mutagenic, and kinetic analysis of the binding of substrates and inhibitors of human phenylethanolamine N-methyltransferase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2005-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1yz3A00
2CWWA 2OB2A 3L8DA 1XVAA 4U7PB 5EOVA 5DSXA 5K03A 5EMKA 1I1NA 3X0DA 2P1DA 3BKXA 1R18A 5DM1A 3VC2A 1XXLA 3HP7A 1N7IA 1KYWA 4CWAA 4E2YA 5GINE 1Q0SA 2PJDA 3NDIA 2ZULA 3BUSA 2JHAA 3NVMB 3TFWA 3HVKA 3Q87B 2YVLA 1JG1A 2BR3A 3M6WA 2HTEA 3CCFA 5T64A 4A6EA 1KYZA 3KPJA 1XDZA 1L9KA 2GA9A 5LQKA 2VZ9A 3ANXA 5FHRA 4GEKA 1WXWA 2A14A 1NE2A 4KVZA 5C9ZA 3DH0A 3CC8A 3PFHA 3LGAA 2OBFA 2AOTA 5CVUA 2PWPA 3EGIA 4FR0A 4KWCA 4RTQA 2FCAA 1AQJA 3DMHA 4FSXA 3E23A 2H11A 1TW3A 2NXCA 2YR0A 3TLJA 3BWCA 3TM4A 2ZVJA 4GOMD 4OQDA 4NECA 4PONA 1KIAA 4QQKA 5EPEA 1SUIA 5E9WA 4RTKA 3TQSA 3THRA 4ER7A 3CJTA 2OKCA 3MHTA 3OU2A 5ICGA 2Z6UA 5FA5A 2HWKA 1D2GA 1MJFA 4HTFA 5BXYA 3BXOA 5EKUA 3T7SA 2ADMA 3DMFA 3NW9A 3FPEA 1FP1D 2JH8A 3UFBA 1BOOA 2CL5A 4DF3A 1JG3A 4LWPA 1EIZA 3HCDA 3LDGA 3EVAA 1NKVA 3G5LA 3O4FA 3GO4A 3WSTA 5G02A 3ERCA 2P7HA 3MERA 5HIIA 2O06A 5K0NA 3MQ2A 3G2OA 2BM8A 1SQFA 3KQPA 4FT2A 1IY9A 3P71T 4HGYA 4PINA 4R6WA 4V0RA 2KW5A 1JSXA 3LPMA 4KIFA 2F8LA 2IH5A 2BR5A 1RI3A 4WVLA 3TMAA 5IKMA 3ORHA 1OR8A 3UJ8A 2G8NA 4AUKA 5LQNA 3FPHA 2AOUA 5U4XA 1B42A 1VBFA 4KW7A 4C06A 2NP6A 1NBIA 5DRYA 3SGLA 4RTJA 1QYRA 4H0NA 1P91A 4BP1A 3FTDA 3GXOA 4FGZA 3FPJA 4FT4A 4BY9E 4YUWA 3NMUF 3I9FA 5E9QA 5ICFA 3KQQA 1XJ5A 2AS0A 3KQMA 4MQ4A 3UJ9A 4V0QA 3R3HA 3TKAA 1G6Q1 3NWEA 5CIYA 1KR5A 2ONZA 3CJRA 2ZIGA 7MHTA 3M70A 1JG2A 4ATNA 4U7TB 1NBHA 3EMDA 2R3SA 4RV9A 1QANA 4QPPA 4RVGA 1VE3A 5LQAA 1NT2A 5DXJA 5DT2A 2PSSA 5E1BA 3TOSA 3C3YA 5GP1A 3A26A 3REOA 3RODA 3K6RA 4M38A 3A7DA 5CVEA 5DTRA 1M6EX 2YXEA 4YV1A 2EJTA 2JJQA 3FPGA 5HEKA 2AR0A 4E2ZA 3D2LA 1NW5A 3B3JA 2OY0A 1YUBA 3LCCA 1MHTA 4BLWA 2PXXA 4E31A 4C4AA 4E32A 5GIOE 3LKZA 1SUSA 1PJZA 1SVUA 4EKGA 3ME5A 1DCTA 1P1CA 3BZBA 3IEIA 1ZQ9A 4ER0A 3UBTA 1IXKA 4YMGA 2PX5A 4PYNA 4XUEA 4AZTA 3P9IA 3AY0A 3T7RA 2G70A 2N47A 2E5WA 4F86A 3RW9A 4RVDA 4HC4A 5K8VA 1R8XA 3OU7A 4QVKA 5FA8A 3G8AA 1X1CA 2C7OA 1KP9A 2R6ZA 4GF5A 3KR0A 5LQRA 2ZLBA 2CMHA 4FP9A 3GRZA 2PX8A 2B78A 3HEMA 4G56A 4K6MA 2ORED 4PYLA 4P7KA 2O57A 1JTEA 1VQ1A 1JTFA 5F2NA 2ERCA 1G8AA 1XCLA 3P97A 2NXEA 2OYRA 1INLA 3R9XB 5HILA 4PYQA 1ZGAA 3GDHA 5DTMA 4X61A 4DKJA 3TR6A 3QOWA 1NV9A 3CVOA 3GWZA 4QDKA 2CMGA 5LR6A 3UJ6A 5CM2Z 2B3TA 3OE5A 3KQTA 4GC9A 1V39A 2AOXA 3F4KA 4P7FA 3JWJA 5GM2A 2GLUA 1I4WA 1UIRA 2PKWA 4KDCA 5KYGA 5BP7A 5CUQA 1JQEA 1F3LA 3QOXA 4OBXA 5CCBA 1YFLA 2I7CA 3C6KA 4XUDA 1Q0TA 4RWZA 2ZZMA 5ICEA 3UJCA 4QDJA 2Q41A 4HGZA 4OBWA 5KQRA 2AOWA 1L3IA 3ELWA 2IBTA 4RTSA 3LBYA 1ZHFA 2QRVA 4KIGA 1JG4A 2ZBQA 3OFKA 2VDUE 1D2HA 2BZGA 2PVCA 1ZKDA 4A6DA 3LECA 3FTCA 2P7IA 3HCCA 3PFGA 5E2BA 3TKYA 3NVKI 2PX2A 1DUSA 3EVFA 5GM1A 4Y2HA 1KXZA 2IH2A 2JG3A 4EVIA 1JQDA 5K0LA 4DMGA 3NTVA 4ER5A 4RTNA 2I62A 4PCLA 1KHHA 3LX6A 3C0KA 1QAQA 2HMYB 1SG9A 1XDUA 5EZQA 3DOUA 5CD1A 3AXSA 3G8BA 3OFJA 3PLAE 1ORHA 4E2WA 1AF7A 1RI4A 4EMSA 5EC8A 2XVAA 3E8SA 3P8ZA 3PB3A 3NJRA 2AZTA 4R8SA 3SR4A 1FJXA 2ZW9A 3ER9A 4POOA 5EMLA 1G38A 2FYTA 2VDWA 4OA5A 3R0QA 3LL7A 2JHPA 2IIPA 3GNLA 4X41A 1R8YA 3C3PA 5LSAA 2UYOA 5CCXA 4M7RA 2PY6A 3B5IA 3HTXA 1QZZA 3KR2A 3M6XA 4FSDA 2DULA 3GRUA 4YV2A 3PT9A 4FZVA 1QAMA 1WZNA 2JHCA 3EVDA 4IKPA 2ZBPA 4PCAA 5DWQA 5HIKA 3TRKA 2UYHA 8MHTA 1I9GA 3QV2A 4ZTBA 2WA1A 4BP3A 3LBFA 1NV8A 3HA5A 5HIJA 4OX9Y 3CBGA 3PTAA 5T6BA 4LECA 2BM9A 3ELUA 2ZWVA 5EMJA 2YTZA 4EK9A 3GIWA 1TPYA 4R05A 2QY6A 2IPXA 1N7JA 4QTUB 2I9KA 5DRTA 4RTRA 2ESRA 2ZSUA 1YZ3A 1P1BA 1QAOA 2AN5A 2ZIFA 3B7PA 4CKEA 3CKKA 5DX0A 3PVCA 4PGHA 3MTEA 3VSEA 2BR4A 3BGIA 3HVHA 2ZZNA 1VLMA 2H00A 4C08A 3MB5A 4X60A 2OPBA 3EVGA 3HM2A 5FUBA 3SXJA 2NXJA 2YUIA 4PYMA 3LKDA 4RSRA 4RTMA 4B17A 3TM5A 4EQZA 3KR1A 3VC1A 2P41A 1X1AA 5EHIA 2JH9A 3A4TA 4M37A 4DZRA 4YMHA 5FWDA 1NW7A 4HRAA 3NDJA 4GOLD 2HR1A 3UA3A 2P40A 3G5TA 3S68A 2PV0A 2O05A 3MGGA 4IWNA 4P7JA 3SX0A 2ZCJA 1O54A 3M33A 4MIKA 5EG5A 3FUUA 1ZG3A 1DL5A 3G2QA 2ZWAA 2EG5A 1YB2A 5E8JA 3IYLW 5IH3A 4CTKA 4HTFB 3P9NA 4HG2A 4OQEA 3UA4A 4F85A 3OE4A 1D2CA 5EEHA 1EAMA 1HNNA 1YFJA 4CKCA 2B25A 1EJ6A 2IDJA 2PT6A 4R6XA 3FPFA 3PX2A 2ZFUA 1G8SA 1EQAA 3HNRA 4RVHA 3HCFA 4X63A 2B9EA 3KQYA 3P2KA 2I6GA 3EVBA 5EIWA 5EKXA 1SKMA 3MCTA 3T0IA 1BC5A 5FTWA 2NYUA 3KQOA 3PS9A 3P9KA 3C6MA 4PYKA 1Y8CA 2P8JA 3LSTA 2O07A 3HCBA 5E1OA 2CKDA 2UYQA 4F84A 3A27A 5H02A 3V97A 2AOUB 2EJUA 4GQBA 4Y30A 3SSOA 4C07A 5ICCA 5EMMA 3U81A 5DSTA 1VIDA 3Q7EA 3B3FA 4E2XA 2EX4A 4C05A 2GH1A 5HIMA 2FK8A 1X1DA 4X1OA 1RI5A 2G72A 4RYLA 4Z2YA 3AXTA 5K09A 3G7UA 2V74B 3SSNA 3MCZA 1XCJA 2XYVA 5K01A 4HSGA 4YV0A 4HH4A 5BW5A 3THSA 1X1BA 2FHPA 3M4XA 3JWGA 4C04A 3MTIA 3JWHA 4PIPA 4CTJA 2IH4A 1ZGJA 4XUCA 2ZZKA 3DLCA 4AZSA 3VYWA 2GPYA 3LCUA 2C7RA 5KS2A 1N2XA 2XVMA 2ZTHA 5CVDA 2YX1A 3FRHA 3DR5A 1HMYA 4PYJA 4WXHA 1F38A 5LQJA 1WXXA 5FHQA 4C03A 3G89A 3JWIA 3BWYA 3SSMA 5DPMA 3GGDA 4UOEA 4YUXA 2PLWA 3BT7A 2V7EA 1O9HA 2QYOA 5DLYA 3TPZA 3ELDA 4YUVA 3G2PA 3FRIA 1NW6A 3BGDA 3GRVA 1VP3A 2FRXA 3OCJA 3I53A 5DTQA 3ID6C 3FYDA 5F2OA 3EGVA 4E30A 2IBSA 2ONYA 5K05A 3FTEA 3G88A 1XTPA 3OZRA 5JR3A 9MHTA 4L7VA 3DMGA 5FCDA 2O0LA 5DM4A 2FPOA 4RTLA 3EVCA 4FS8A 1Z3CA 5D1HA 4RTPA 3UJDA 1WY7A 2GAFA 3MAGA 3KQSA 2PXCA 5KVAA 4KDRA 4MWZA 5ERGB 2GB4A 5JUWA 1VP9A 3G2MA 4GOND 5EHGA 2NNWB 5C1IA 1RJFA 2OO3A 2AN3A 2YXLA 3EPPA 3HA3A 5DX1A 4AZWA 3BGVA 2C7PA 3DXZA 5E1DA 3GRYA 1T43A 1U2ZA 3OU6A 4OA8A 1UWVA 5DXAA 1TW2A 2P3OA 2AVNA 2IDKA 5E1MA 1WS6A 2UYCA 5EGSA 2OXTA 2GS9A 5CVVA 2UZ4A 1YF3A 2Z6AA 1R74A 3BKWA 3R24A 5KQSA 1FBNA 5LQUA 1KPIA 4DA4A 4AX8A 3AJDA 3FUVA 3KQVA 1JSZA 4RTOA 5D1NA 2NP7A 2IP2A 3CGGA 2AOVA 1X19A 3KHKA 1R00A 5GWXA 1RJGA 2P35A 4PYIA 4CXMA 2G71A 3P9CA 3EMBA 4IV8A 4DCGA 4ER6A 4YUYA 3KPWA 2EFJA 3KPVA 5FQNA 10MHA 1AV6A 3FUTA 2P3LA 5HOQA 3EEOA 2PGXA 1G60A 5E8RA 3HVIA 2OB1A 2NXNA 2QRVB 4QPNA 3FYCA 1AQIA 4GOOD 1IM8A 4GC5A 4PWYA 3HA7A 5FWAA 3DTNA 1XDSA 2FK7A 3SVZA 3UZUA 1BKYA 4QTTB 3HCAA 4DCMA 2AOTB 3EGEA 1L3CA 3KR9A 5HFJA 4O29A 3GCZA 3UWPA 1KPHA 2XYRA 2Y1XA 3KKZA 4YUZA 1YZHA 5GOZA 2YXDA 3O31A 5K0JA 3GRRA 1WG8A 3I5UA 3T7TA 3UJ7A 3FTFA 3SMQA 4DM3A 1L1EA 3O7WA 2PT9A 2Z6QA 3BWBA 4PNEA 3FZGA 1VPTA 5EZSA 4RX1A 3FUWA 3I58A 2AN4A 2VP3A 4PYOA 5EIFA 3OZSA 5DX8A 1NW8A 1BHJA 4KRGA 2DPMA 2VS1A 1EG2A 1JQ3A 2H1RA 3KQWA 4P7GA 3UJAA 3V8VA 1FPQA 1G55A 4CKBA 2C7QA 1P39A 4XCXA 5DM0A 3DXXA 5F2KA 1R6AA 2OZVA 1H1DA 2XYQA 3A25A 4BLUA 2HV9A 3B3GA 3ELYA 3PX3A 1M6YA 1UFKA 4R8RA 3DP7A 3KU1A 5K0BA 3HVJA 2IFTA 3KPUA 1ORIA 5FQOA 5K0GA 3ER8A 2Y1WA 3RIEA 4GUAA 4M36A 4MTLA 4ER3A 3EEYA 2BH2A 3M6UA 1PRYA 3OPNA 4EKIA 3IV6A 5GIPE 1O9GA 3A7EA 2K4MA 3HCEA 3OZTA 5K0EA 4MHTA 1RI2A 3H2BA 4E70A 2XBMA 5P8WA 4PGGA 5K0CA 4QVGA 5EEGA 1RJEA 2PWYA 4RVFA 2WK1A 5EVJA 2LD4A 1NW3A 2B2CA 3DXYA 4E33A 1KPGA 2PBFA 3FUXA 4P58A 1EJ0A 3IHTA 3BWMA 4PIMA 1RJDA 3KPYA 1SQGA 3B89A 3P2EA 3R6TA 4LG1A 5FULA 2PX4A 2VDVE 3CJQA 3LDFA 4DQ0A 3GU3A 5T67A 2P3QA 2PXAA 4BLVA 5K0FA 2G1PA 2WA2A 3E05A 3LHDA 1FP2A 3EVZA 3LCVB 5HZMA 3EVEA 2AVDA 1RI1A 2ZIEA 3DLIA 3SM3A 5B1SA 1JR4A 3I64A 3K0BA 3GJYA 4QQNA 5DM2A 4IV0A 5CVJA 5FADA 5MHTA 3LDUA 5C0OE 3UJBA 2ZBRA 4JXJA 5M5BA 3DULA 1L3BA 3E7PA 4ISCA 3AWIA 2QE6A 2IGTA 2HNKA 2YQZA 3M6VA 3NWBA 3P2IA 4LWOA 4AZVA 5BW4A 5LQCA 5E2AA 1VL5A 5EQJB 1M0EA 4GBED 2QM3A 3DUWA 5E9JA
chains in the Genus database with same CATH superfamily
4KVGA 4LSZA 2ATVA 2Q1TA 1QHHB 1BU5A 3A04A 3AFOA 1K06A 1TA0A 1VHDA 2HGZA 3DE4X 4I9HA 4JLUA 3IP7A 4E12A 5DM1A 3GRPA 5ULLA 5GVRA 2O7SA 3H1GA 3ZDXB 2QXUA 2I8AA 3BREA 3REFA 2JHAA 4MCHA 3JAWA 4ZCQA 1P0QA 3LY9A 5BNFA 1EFDN 3A6PC 1JG1A 2UXDB 1LEHA 1NI4B 1J49A 1V1MA 2QMHA 3GAAA 1NHWA 2AMJA 4ZOCA 5ALDA 1EWVA 1SUPA 5JS1A 2NU6A 1EXWA 1TO2E 1YQTA 2DTEA 5IBCA 3V8QA 3P52A 2VZ9A 4Y98A 5FHRA 2FPKA 2W6PA 1Z4MA 3EEFA 3VR3D 3W8RA 3ZD7A 2WF9A 3CUSA 2H59A 1UDWA 1V47A 4B73A 3SXUB 2IVFA 1AQUA 1W1WA 3C3EA 6ABPA 2X3YA 1N32B 4J9VA 1NPTO 5F9FA 2QMUA 4L07A 2ZYGA 4LSGA 3KIPA 3FROA 5FB3A 3SZMA 2V6MA 3LAWA 4BBAA 2LV8A 3PUVA 4BVGA 5JWHA 4F5YA 1X7XB 1ZOPA 2C88A 2DFPA 3PKZA 3SHWA 4D3DA 1K7YA 4ROTA 3ZI4A 3LLSA 4CV0A 1R0ZA 1ZVQA 2O3UA 1D2MA 1V7CA 5KJEA 4J6FA 1NUUA 1Q0RA 2G25A 4MZXA 5CNMA 4EP1A 4IWYA 2ATCA 2IYUA 4ZVQA 4C6RA 3B5EA 1UPBA 2EGUA 4ZOLF 4XCQA 1DC5A 3LO8A 1YB4A 3M5CA 1XKXA 3RYFB 4DV5B 2W6QA 3C74A 4TKUA 3MJTA 1UM9B 4OHMA 5EJ2A 2E4XA 1WSBA 1ZCZA 1KQOA 3DEKA 3R5SA 2ODPA 4PRLA 4BBZA 5CAEA 3GLSA 3NJ4A 4U7JA 4COOA 4PAMA 4XX1A 4ZHQA 4EWLA 2AGVA 3A3KA 5C5IA 1RQXA 2FHSA 5F2OA 5U1PA 4Q3DA 5DW3A 1GCIA 4BCCA 4TPKA 3GMSA 2VWQA 4I66A 2IH5A 3B1WA 3PNPA 1FFBA 1ZBQA 4GGMX 3UHOA 2FQQA 3OIDA 5JQGA 2DMRA 4KW7A 4NJEA 1YE5A 2OAGA 2XI4A 1NR1A 4ESHA 1P7ZA 4E94A 3H0KA 2HRCA 1SBHA 3FPJA 4HWSA 3FCCA 3E7WA 3NMUF 1Z5PA 5AK6A 2X0IA 3VU1A 2V98A 3DHVA 4FEEA 3VHLB 2W2KB 4A0HA 2C4TA 4MQ4A 3CIFA 5A3RA 1SC9A 4OMFG 1KR5A 1O95C 5LKAA 3HS3A 5DO9A 2HLHA 2VAXA 3NFYA 2R3SA 3U4CA 1GL3A 3V3KA 4L6AA 1BVHA 5B3LA 1NLMA 1QANA 4NBRA 4Q1FA 3GLGB 4H6XA 1YAHA 5DT2A 4YXFA 2Z09A 2BFFB 2C2YA 3L7DA 4N5LA 5I7OA 4U3JB 1P45A 1Q7RA 4NESA 2QVLA 2YXEA 3GDFA 5L4NA 3MUEA 5LU8A 1SVIA 4G5YA 5B6PA 3CH4B 2GN2A 1YUBA 2IS1A 4XPZA 2GXUA 1YBVA 3RV4A 4LOHA 2F1IA 2R1TB 1GIAA 3H4TA 4HJXA 2W2OA 3SF8A 4C4AA 2XOKD 4PO8A 3LHIA 1E1QA 1KO5A 1RBZA 1U28C 4OVKA 1UEJA 1T8SA 3TNDA 1QCYA 5ADWA 2GZAA 5JT1A 3F96A 4X20A 1T8UA 3IUPA 3ZQ6A 5L3SB 3OI7A 3W8DA 2NO4A 1NULA 3AY0A 3F3YA 4RLHA 1XTKA 2DB3A 1DFGA 1XRNA 4R1SA 4CKEB 5C8VA 1JEDA 2XA1A 3FMPB 3IJEB 4YRCA 4NF2A 5IAAA 1ND6A 1Z4KA 2GZMA 4CYMA 4F4FA 1O58A 2VK2A 1NLUA 2ZLBA 3HSSA 5KZMB 2CMHA 1LJLA 1FW8A 3HA2A 3PXAA 1RLIA 3HFGA 5AVYA 1CQJA 4FDVA 2FPPA 3IAUA 2B92A 4IDQA 3IELA 5JAMA 2OHGA 4M1MA 1X1QA 2Q50A 1JJVA 2XKKA 1LQUA 2RHOA 3GCDA 1QHXA 4FMDF 3AFGA 3ULKA 3TZLA 2LGJA 4Q34A 4JBYA 5J58A 1E5QA 3NS7A 1U0EA 1DC7A 2PGJA 1Y7IA 4AN1A 1ETUA 5DWVA 1Z5OA 4LY6A 1R4NB 4J0CA 3UF0A 2PKWA 5JC8A 1GM5A 4A8JA 3RFVA 1KVQA 3FDJA 5J23A 1W1IA 3SC6A 2O1SA 3TSCA 5IJAA 1IAVA 3D8BA 4OAPA 4BEJA 2WWYA 2DF8A 3KKKA 2IW3A 5BYBA 3ZV5A 2DH6A 4WSOA 3FDXA 3HCWA 3MB8A 3QG5A 4BIMA 4Q1CA 5AUPB 4CCYA 3EDRA 1JZTA 4X65B 1RHQA 5B4TA 3K1AB 3DZGA 3WHIA 1XQXA 5KU7A 1EAYA 3QF7A 2AMLA 1U99A 3AZOA 4DJAA 2Y27A 1OKKA 1PDOA 2Z58A 3DOFA 4YAKA 1Y6FA 1GD1O 2GD6A 3O4RA 4GOXA 4QBTA 1K3FA 2DBRA 2POQX 1NUTA 4OXKA 5E4FA 4Z4CA 4Z1MD 5KTKA 1CQIA 4G63A 4H0FA 4NPHA 1O6BA 3NO4A 1X9GA 5T4FA 2IH2A 3LW8A 4NL4H 2JFYA 1WRBA 1EPUA 2H8KA 2VJYA 2YY5A 5G0WA 5E6RB 4A73A 4DMGA 1DJNA 1JHMA 2DT5A 4EG4A 1BEUB 3F6SA 3FVWA 1JS1X 3AGPA 1S3FA 3HXTA 3L4SO 4PCLA 3TJMA 5AW2A 2XRFA 2H0AA 1J39A 2EW1A 4Q3AA 2ICAA 3HKBB 5JFGA 3AEQB 4GM0A 1VMEA 4R16A 5ALKA 3C8DA 3U4QB 3B48A 4ZK6A 1IG0A 2R8RA 4WINA 4Y9UA 5G0VA 5ER9A 1ORHA 1ZY2A 3QNWA 1RZUA 1SQ5A 3BXGA 4HXFB 4A0RA 2WHPA 1QIDA 2IHTA 4V03A 1SWVA 2HDWA 2DY1A 5FDFA 3NJRA 1Z74A 2AZTA 2CJXA 3RG2A 2OFOA 5CB6A 4NNPA 5E4JA 5H7XA 1G5IA 4Q5IA 5BWNA 2W6MA 3AVOA 3K0KA 4RPHA 5CLQA 2FOXA 2WR8A 3VV3A 1HT3A 4NDNE 4UPDA 3VVBA 3KDAA 5CCXA 4CLOA 4BKRA 1Y33E 4R2LA 2O7QA 4RVNA 3U3RA 1N9GB 3NOVA 1QAMA 2QRUA 2V7XA 4IKPA 5L9AA 1CQPA 2J9YB 1JEAA 2JLBA 3Q6IA 5FUMA 3IVCA 2WA1A 1E2PA 5JVDA 3T06B 2C9ZA 2BIFA 2O6HA 4H31A 3VPHA 2G5CA 1C0IA 2AFIA 1YU6A 2YVAA 5KWSA 1QQ6A 1FDVA 1RKVA 1CQWA 4CL8A 2IW1A 4PHTA 4C6HA 1BD3A 2ZIFA 3L6RA 5CDGA 2F8TA 2F9MA 5KNDH 4EENA 4YIKA 2RB5A 3HVHA 3OLXA 4LTDA 3PGVA 2V7UA 1A77A 1RIIA 2WOOA 4C08A 3OC0A 1WCIB 4IKEA 3QK7A 1I4OA 3O2SB 3ZE9A 3ICQB 1N78A 2UZ0A 3CX6A 1XKQA 3WOHA 1JX6A 4ZRMA 2CNOA 3A3NA 1NX9A 2G9RA 2CKMA 3RU9A 5JROA 4Q93A 5JPDA 4G0QA 1C7JA 2ZXUA 3DHNA 2VQDA 4J4HA 1O96A 1JDUA 5CBPA 3E8MA 2C3OA 1MR3F 1QP8A 2O2EA 2I6XA 3LPDA 4HRAA 1NSFA 3Q8MA 3DJFA 4CLHA 3KD2A 3L77A 2NN3C 2DUNA 2PV0A 2WF7A 3MGGA 5CW1A 5DK6A 2X86A 5A7HA 4FLEA 4KO4S 1C30B 1H8ED 2EWWA 3EZFA 4WK4B 3PFFA 4LYGA 1DL5A 4YRMA 1KOGA 2VEDA 4W1PA 4DLYA 2X13A 3RWMB 4B6RA 4OXNA 4CTKA 1HT1E 3L43A 1ZWKA 3ODPA 4MMZB 4RPLA 1PYOA 2Z98A 4MO2A 3WLFA 4MV5A 2IDJA 1WB4A 3SHTA 3BD8A 2WHRA 5A2GA 3BXEA 1ZN9A 5B3JA 5HMLA 5FOUA 2AJBA 3BMOA 2ANCA 4RMJA 2EL7A 1SCUA 3H9GA 4G41A 1NQAO 5AJVB 5EKXA 1QFJA 3WV4A 1BC5A 4PLWA 1A8UA 1C1YA 1E0DA 1T35A 4G1CA 4PLTA 2VKQA 3P9KA 3VVLA 2XQGA 4DR7B 1GNQA 2Q9BA 4TWJA 3AK4A 3FNIA 3E9ZA 3VXKA 2R7MA 3OQ6A 2Y2VA 3VAZA 1SVKA 2VXOA 5ICCA 5IPFA 4LVCA 4BWGA 4KTTE 5C4IA 5AXCA 5KPJA 1JV2B 2ZRMA 3LHFA 3L7BA 5K09A 3SBXA 1B6GA 4WIAA 4N6GA 5J40A 2QLBA 3QF4A 1RP1A 3NALA 1UXHA 4Q19A 5KKAA 5LN1A 3DPUA 1PR4A 3BMXA 4ARBA 1GPBA 2RHWA 3PIDA 1V4VA 3VO8A 4A0GA 4BVKA 1WXGA 2WP0A 3RVNA 3PGKA 1OT5A 3MTAA 3HDYA 2WTXA 4LYAA 5DDIP 4D0RA 3LCUA 4ECAA 2YIDA 3L93A 5A2QA 1ABFA 3RVMA 4TTIA 1T2EA 3KLNA 5F1YA 2FPGA 2PUAA 2G0AA 4I50F 1E7MA 1GAWA 4UEQA 2WMNB 3QLJA 1CRWG 1QLHA 2KSQA 4YRSA 4OLAA 2VQEB 1NC3A 1WXXA 4JI7B 4BHTA 4X24A 2IU4A 4FBGA 5BV7A 1GN8A 4YQZA 2P2NA 3EDMA 3ZWNA 4JYMA 4L5YA 1EFVA 4YUXA 3THXA 4LJAA 2VXBA 1O9HA 5KKCA 5HQTA 1NM5C 1R0RE 5JWOA 1WVGA 3E3AA 4OHWA 3QPWA 4INAA 1JLSA 3UQZA 3ZGNA 4J0QA 4L76A 4ZVVA 3Q11A 3LTEA 4ES6A 5IJZA 1K97A 3OCJA 5JTTA 3GQVA 4JKYA 4JOSA 4PZZA 4BEBA 5AI9A 3T5CA 3K0SA 3FTEA 3B8EA 4GIBA 4GSLA 2ZYUX 2W11A 1XMXA 3P2OA 1PV2A 2FW8A 4UEOA 1SPXA 2BFNA 4RSMA 3UJDA 3HHEA 3SPXA 4J90A 2FW1A 3THWB 2GX6A 3BSWA 3QX8A 4G09A 4I8XA 4Q7JB 4YCDA 1GCGA 4CR7A 2GB4A 3KS9A 1UPTA 2DC1A 4CLDA 1ILEA 1IN4A 2OVBA 4FMCF 2ASVA 2BM0A 4ZVNA 2DVMA 3GVCA 2YXLA 3PHGA 5KWEA 1GAJA 3EDQA 2NPFA 4GE3A 4V1CA 2YIMA 3SS7X 3NXSA 4F5EA 2KLHA 3B9PA 4X1KB 4IL5A 3PWTA 2EKBA 1YF3A 1M33A 2XTNA 3LQ1A 1NG9A 4A82A 4YAEA 3R24A 5BWMA 4M7PA 3RD5A 1TMYA 2VTDA 4BZPA 1O87A 1ZH8A 1JEQA 2RKBA 4D0GA 3V6LA 5TS3A 4DBLC 2FEPA 2NP7A 4OGFA 1IG3A 2EKPA 3PXGA 4DY6A 1PCXA 5AK5A 3N5KA 4KH0A 4NYJQ 4CXMA 3HWWA 3VJRA 4P08A 5LLTA 3OMLA 1BN7A 4G5HA 3ZKWA 3GLHB 4AKSA 4ARAA 4ZAWA 3W2TA 3OURA 2NYRA 2P3LA 4H60A 3SE7A 5HOQA 5LQDA 1AV6A 4B6EA 1JZSA 1EUCA 2IUYA 2MSEB 3ED5A 3IDSA 4FYHA 5JZSA 2QRVB 2QN8A 2P1ZA 4LJ8A 3UK7A 1YS2X 2O0HA 5P21A 2Z1MA 2JAHA 4FTWA 3TOCA 3DO6A 1Q0LA 2IEGA 4MUEA 3NBYC 3WRYC 5ILQA 2DE0X 1UOEA 2GXAA 4Q0MA 3WLNA 1JN0A 6LDHA 4J1QA 1QHSA 3BAZA 1O3YA 5HVNA 3NP7A 2BFPA 1WG8A 1NAIA 3NHJA 1G17A 1XCPA 3O21A 2F3UA 2YQ4A 1QF9A 3G7SA 3FHCB 4P84A 4LRUA 5FX2A 2WQZA 4ME6A 1Z12A 2ZB3A 3W8NA 1XRJA 4YDSA 1BHJA 1FVHA 2ZG6A 3FI0A 4YCJA 1ZCJA 1EG2A 2IYTA 3R3XA 3ZC3A 4DNPA 5DEOA 5C8XA 2EQBA 1LBEA 2JGEA 3F67A 4XCXA 4MV9A 4WBNB 1AXRA 1H1DA 3KZOA 4A8TA 4F91B 3DVLA 1CUUA 2ZANA 5ES3A 2A5YB 4PLPA 4CTOA 5A6SA 1KMHA 2B69A 1H6BA 4E1VA 5HQ3A 1IOLA 1KH2A 1ESDA 1ZUIA 1E62A 2C31A 1QIFA 1MENA 1ZH4A 1Y4ZA 1P0PA 2RAPA 3IAEA 4QU8A 4RV5A 3RSHA 5I9TA 4C3ZA 6Q21A 3QEBZ 3U3JA 2CVPA 5ALMA 1TMGE 3MGAA 4K6GA 3O95A 3Q6MA 3OX1A 1P4SA 1BG6A 3DBOB 3MRTA 4GG1A 4IUBS 4ZOEA 2X8LA 3JPYA 3K9CA 3VFDA 3EZYA 2LD4A 3RVKA 3KEFA 3LWZA 4NBVA 4G1VA 4OL0A 1Z2PX 5H81A 3KE9A 4O2BA 2Y1OA 2WM3A 1RSZA 5IN5A 4YRAA 1KJ9A 4W5QA 4B34A 4AZ0A 1U04A 3DE2X 4LHVA 2BD0A 2JIZA 3D6VA 4EHNA 4EVQA 1X8XA 2GJ4A 3ZCQA 4JC0A 1MC8A 2WWGA 2YMMA 1TJYA 1C9DB 3UJ3X 1IBKB 4MUNA 1PZEA 2ZBRA 4H3VA 2X7HA 3DZKA 4N82A 4UE6A 4DUGD 2XXAB 3Q8XB 1XC7A 2A92A 2ILVA 2PIAA 3ITKA 4HR7A 2ZT5A 2JGDA 4II3A 4F4JA 1KFEB 4YPVA 4ILKA 1CEXA 1XXHA 4BX0A 1K5GA 3WNZA 3A1SA 2IYYA 3GMIA 4GBED 4JJ4A 1A8IA 3U6BA 2OB2A 4YAWA 2WE8A 1PT5A 2JFVA 4X92A 1TD9A 1E7RA 1ZRNA 2A2ZA 3UV3A 3HBNA 4IHKA 4D0LB 1XCGB 3Q41A 3ZBTA 1OY1A 1AGPA 2PA0A 4JJ6A 4V1CI 1G19A 3ZJUA 2WV9A 3TGWA 1KYWA 3HLYA 4N7JA 4ZIRA 5CFQA 4LNHA 4XIJA 1C1HA 2XUIA 5THKA 2QXTA 1N9ZA 3NZEA 2DR3A 2C20A 5TIIA 2XCTB 1RBMA 4OXIA 1LDGA 2EJVA 2HTEA 1J9ZA 3IAXA 2DBQA 5T64A 4A6EA 5DGXA 3RK0A 4BCDA 1JE0A 1KYZA 3UUEA 2VT3A 3DEYX 2WSLA 5CR9A 3CNOA 4KE6A 4YQEA 3B20A 1K8ZB 1WXWA 5C5EA 2GM3A 4G1BA 4PXYA 5I7FA 1QGED 5AJHA 1Y9ZA 1Z2NX 4A36A 4LUCA 2J0QA 3E27A 5LJIA 4CM8A 1IQPA 1FVFA 5ALVA 3WFIA 2O54A 5TPWA 4PV7A 5FAXA 3OX3A 4AU1A 2P2ZA 5LA6A 3M3PA 1ZN8A 4AECA 4AJKA 4ER7A 4EEXA 2ZUVA 1J20A 3A14A 1WWKA 3O03A 3R20A 4HQRA 2NU8B 1X86B 4WESA 1UZMA 1AS0A 2I2DA 4MH0R 2NYVA 3RSCA 1MJFA 2VTKA 4I8DA 1NYRA 4AM8A 3PD1A 3M4YA 2P5TB 3QI7A 1UJ5A 4KO3S 1NOIA 4HEQA 4XQCA 5GZ3A 5DNWA 4AJ9A 1IZ9A 4DIOA 1QO7A 4N12A 3RFUA 1JQBA 2GNPA 3COSA 1K7SN 4QDOA 1YKGA 4EPRA 1VPVA 1W2WB 4IIUA 2LCIA 3OAAD 1MA0A 4ZT5A 2Z08A 2C4NA 3HMQA 5GONB 5AVRA 4XJTA 3MTJA 3TRDA 3G2JA 4TTAA 4JB3A 4J07A 3LT0A 4GEGA 1CJVC 1UMCB 3OOYA 5JJ5A 5K0GA 2V03A 4LZNA 1AUVA 1D4OA 4PSVA 1V5WA 1VE1A 1NUHA 3PGXA 1PR9A 5C53B 4LX0A 3CVUA 1OB5A 3TSYA 2FI1A 3F7MA 4BP1A 3GXOA 5JOQA 3QHQA 2QIPA 2Y77A 4IJWA 3QXXA 4BY9E 4S2UA 3RB8A 1AO3A 2C3UA 3M81A 3MMZA 4JK3A 2J5RA 4JI3B 3U44A 3GGJA 3P9XA 1IWOA 1V1JA 1WD7A 1Y3BE 4OUDB 1HEUA 1Q14A 2IT1A 1FUYB 2W83A 2X8BA 3PDIA 4WKOA 5TGZA 3T3IA 3PE3A 4BRSA 3ZD9A 5AVWA 4HEJA 5JCPA 5JY6A 3K70B 4D92A 4QPPA 1OIVA 1UPFA 3C48A 4Q48A 1BDIA 2OBBA 5IULC 1VSVA 2E4ZA 4RD4A 1IQ0A 1LV7A 3V42A 1UP7A 2HY7A 3T8YA 1YA6A 3AR3A 1XPUA 4H6WA 2BKEA 1VHWA 4GOKA 1U11A 1JAXA 2O4UX 4E2ZA 3DKVA 1Y1QA 3B3JA 1RU3A 1OFUA 4QBGB 3A6JA 2FPIA 1TIPA 4QJ5A 2ZBEA 2C29D 3ZDYB 3EXIA 2DPHA 3DO5A 2BFCB 4MQBA 3PPYA 1Z3IX 2A5DA 4RPIA 1QZXA 5JMTA 4I55F 3AJAA 2RJNA 3IDOA 3UBTA 4ZC1A 5G3ZA 1ZK1A 4CIAA 5HJ5A 1JR3D 1OAOA 2B61A 3KAKA 5D3MB 4BFUA 3AVYA 1Q1ZA 1FU7A 2FW7A 3AUTA 2PTGA 1V41E 4JJFA 2XX3A 2ZAIA 2EJWA 2E4UA 4HC4A 3W5AA 1YRYE 3DB2A 1QFZA 1ECLA 1S0UA 4HTAA 1GRRA 2CHQA 1YJCA 3I83A 3QFRA 4HZIA 3WK4A 5JXWA 3K6KA 2FMTA 2SKCA 4IVQA 1W94A 3GPDG 2C5GA 5LBTA 5KKNB 2ZAGA 4FZ3A 1TVEA 2YY6A 3GRZA 3WLHA 1PSWA 2QQEA 3K8QA 1S8OA 2ZRFA 3EXFB 2TECE 4GM4A 4G1EB 1QS0A 3LZCA 4UBMA 3RAGA 3B1YA 2D13A 4HS4A 5LVAA 1ADFA 3LYAA 3NV7A 4PTLA 4CQMD 4RPJA 3TLZA 2BW0A 1USWA 1EX7A 2WJAA 3AEXA 3EQ8A 3PNMA 4MPPA 4AMBA 5JD6A 2RH5A 4E3WA 1P2UA 3BM5A 1D6SA 5FBRB 1I4WA 3BK1A 4KDCA 3TO5A 1ZU4A 1P1HA 4YI3A 1IZZA 2IWHA 3OBBA 1Z4LA 3C6KA 2ZZMA 4IMIB 1YIOA 2WYOA 4IHQA 2GLTA 1Q50A 2ZQYA 5EFOA 2Q41A 3GCWA 4AULA 5JSZA 5KTRA 1JH9A 4Z54A 2XUHA 1XEFA 3JVIA 4UZFA 1M34A 2W2NA 3OJ0A 5TQ2A 1DHTA 3V7YA 1CJMA 1QG6A 5MN5A 2B94A 2R47A 4FIZA 3TCNA 3KCQA 4B2PA 4X7PA 1FNMA 3GJ8A 4BP9A 3ES9A 3OJWA 3B78A 3GLIA 2QPAA 1QGAA 1JU4A 2BP7A 4JP2A 4F5DA 3W04A 1SOWA 5JD4A 5KTPA 2C9DA 2P7IA 4BNXA 5IDWA 4LE0A 4W9RA 5EP2A 4DPMA 4MYSA 3IP6A 4QFDA 3PJDA 5FUWA 3I9V1 3RQIA 3SOZA 5F1PA 3NTVA 1NBMD 2CF5A 2I62A 3HVUA 4HDRA 4IG9A 4X1YA 5K8JB 4LFBB 4WH0A 4E07A 3P9ZA 1DTEA 3BFPA 1DUIA 1HLDA 1AKMA 4FHCA 5DLEA 5EXEA 2HMYB 2VUIB 5DYYA 4IEIA 2O7NA 1IJKA 3KKEA 4NK4A 5L3ZA 5I4IA 1FXWF 4FFSA 4CDMA 4B3GA 3FG9A 2COUA 3HEBA 1KMIY 2BEVB 4XTCS 2XNCA 2XLCA 3CLKA 2P3SA 5C8YA 1YHZA 2GILA 2YZ2A 4G1FA 1ULUA 3ADOA 3DZBA 4WT7A 3V4FA 1V45E 3JQ8B 1WW8A 3VH1A 4Z2AA 2WIGA 3SQDA 3LUKA 3EOAI 1J7JA 2E21A 2HEGA 3JWPA 3MCWA 4FCVA 3OLCX 4MYRA 3TF5A 5IX8A 5FD8A 1JH8A 5FBKA 4KBFA 1W5SA 3X1MA 2PY6A 4LDPA 1NR5A 1PJ3A 2IYVA 4RMGA 3IKTA 1RLMA 1QV9A 2W93A 2ZBPA 3D8RA 3EX7C 2QQGA 3UB4A 4YRFA 4LFCB 1EBUA 3HA5A 4OJNA 2HADA 5KHAA 2J3JA 2YWFA 3EPHA 4QODA 1CUXA 2RBKA 3KTAA 3JALA 5C37A 4OMCA 1G8PA 3SP1A 3INTA 2WB4A 3VKFA 2VNAA 3KG2A 3PVCA 5IM4A 4CL3A 1COWD 2D5BA 3VSEA 2BR4A 4WV3A 4QYWA 2BSAA 5SYAA 5LLDA 3RUCA 4RZXA 2WAYA 2OCXA 2D2VA 3CZCA 3F98A 1G9XA 2VPIA 1GO2A 4X54A 5LP6C 3TW4A 5BNWA 5HRUA 1XELA 4DSTA 3ROGA 2FUKA 2GHTA 4YJGA 3RSLA 3VU9A 1GNTA 3CNEA 1KZ7B 1F2VA 2BMVA 3EWNA 3KSRA 4J2TA 4RKRA 4AMUA 4TWBA 3GP8A 4B47A 2QX6A 3L8ZA 1A7AA 5CJ2A 4ZGGA 2G6BA 2NYAA 4TKVA 1US8B 1SK8A 3TUJC 4C4SA 3VNSA 1YDHA 8GPBA 2WHQA 5ALOA 5LMCA 3UC5A 4CQJA 3FUUA 3WL4A 3EZ2A 5L3VA 1WUTA 3UYLA 3AR8A 5E8JA 3VGPA 4NYMR 1Z7BA 4HYQA 1N6KA 3MM4A 5JXGA 1G5HA 1P29A 5A3QA 2JD1A 3WDLA 5LMNB 5HM8A 1U8FO 3OLYA 1W49A 4BAUA 4ZHQF 4X6XA 1WXQA 3TEFA 2FPRA 2ATXA 3KZ1E 1M6HA 2IPNA 2VBGA 3G7NA 2MIIA 1VSTA 2WG1A 1EG7A 2G5PA 3JARA 3NDBB 1F5NA 4RVHA 4TV9B 3ZR4B 4R1QA 3RT7A 5JQGF 3KQYA 1RXVA 1NRWA 2CL7X 4WHMA 3HDQA 3IIKA 4IF6A 2CW5A 2YASA 3HBAA 3QIAA 4ETNA 2QX7A 1JKXA 2PKQP 1JT2A 2UYQA 4RA9A 2ZYDA 4P9NA 3CWZA 4B8ZA 3LFTA 4D4KA 1GGVA 2HA5A 4F6RB 3O75A 4EYQA 1VIDA 4BGEA 1BWRA 2A1UB 4V0SA 2I6UA 1KJYA 3LCJA 4UM7A 3DBVO 2V74B 5EZYA 4EY5A 2I7VA 1XCJA 1ZL0A 3S28A 1Y8AA 4K9SA 1FQJA 4UPEA 2AW3A 3FW1A 4H6VA 2G1AA 3DO8A 4H3HB 1N8TA 2IEZA 3NUGA 5IEBA 3A1UA 4IIJB 1FRVA 3H4MA 4XUCA 5M29A 3JRNA 4MQFB 4Q4JB 1EGHA 2IZ5A 1VJGA 4RDIA 5HJ7A 5L4LA 3SVLA 1YVEI 3EXHB 4JMPA 5CP8A 1REQA 3KD3A 1BGWA 3ENKA 2G1KA 4TKZA 3FJYA 2BRUC 3QLUA 4XB2A 4NZMA 3SFZA 3E5RA 1E0SA 1IOZA 1P7WA 3BWYA 3QHPA 4K9PA 1ZIXA 2F3TA 1V3QE 3IAS6 3ONNA 4M0LA 4J0GA 2SBTA 1UXJA 4HFJA 2QYOA 1KDYA 4NG5A 3R8CA 4BO1A 1U1CA 4E08A 1ORDA 1F2UA 1VP3A 4GWGA 4Q21A 4YBZA 2HU7A 2VDKB 4UEKA 2I34A 5C5CA 1M2VB 1GA1A 4JBNA 4AY3A 3UFXB 1F4VA 1NVKA 4JJZA 5AW7A 1GZ4A 2H2WA 3DMGA 1KDPA 2GNAA 4FEAA 4MARA 3TQHA 1GSOA 2YFQA 1XFAA 3TX2A 1WY7A 1TAHA 4R0VA 5CH5A 4DLPA 4IINA 1TFRA 1W44A 3U09A 1Z5VA 3WNCA 4GOND 2RE8A 3Q9NA 3S2SA 4N5IX 4HV4A 1RJFA 2O23A 4FNMA 1K9SA 4RKWA 2M6LA 5JDIA 2IEIA 4ZV4A 3GRYA 3WMXA 1XKTA 1G41A 4K40A 2RCYA 1QGUB 2AVNA 3GLQA 4P5EA 3L7CA 5AICA 5FPTA 3OH8A 1HQCA 5FPQA 2OXTA 3NBMA 5JDCA 4LSMA 4BLQA 4I1OA 3QYPA 4UM5A 4GI7A 4WVFA 4Q24A 4KNVA 4DA4A 1CRZA 2QYHA 2P6RA 3E58A 3ZQ4A 1CY8A 3C1OA 1CHNA 3DC7A 4LCJA 4RK7A 4OQYA 2AOVA 4X97A 1L4GA 5CFLA 3B9BA 3UMFA 3V1MA 1I51A 1WTAA 1ZGBA 1OMOA 2GAAA 2L2QA 1F2TB 1KDRA 1TEVA 2P9ZA 2QD1A 4MHSA 4DCGA 3AWDA 4D3SA 3A4IA 3TFOA 1SHTX 1PR0A 4H4CA 4P5PA 2PGXA 2XEXA 1G60A 2GA8A 2DWOA 1GPJA 1I7DA 1EK2A 3QUQA 1FC0A 3BE5A 2G7MC 4JB8A 3JQ9A 2FP4B 3S8EA 1KAGA 3TKLA 1BO6A 4MJLA 1M1NB 1Z7YA 1B1AA 2VDNB 4WFIA 5HM6A 1MO3A 2BVNA 3I8OA 3O4HA 4G1UC 1VCNA 4N5MA 2L19A 3KR9A 4MKGA 2E82A 4HBZA 3QV1A 4OOEA 5REQA 2GARA 2G7ZA 1G64A 1TZCA 2Y1XA 5EWMB 4AYTA 4EG8A 3IUMA 1YQEA 2H08A 3Q3EA 1KAOA 4HQ6A 2JKVA 3K94A 4W9MC 1HC7A 4YJ2A 1S2NA 1WX1A 3BWBA 4QEDA 3MEQA 5E6UA 2WAMA 2PS9A 3KUUA 3CRZA 3B2QA 3O92A 4M55A 4BO4A 5HDBB 3L0SA 1RLOA 4NAVA 2A9RA 2PE5A 2GBLA 3R5HA 4OHUA 3EIHA 2H1RA 4Q3EA 4TV8A 4U0KA 3PRHA 4OUKX 3ELBA 4QDUA 3V4ZA 3VI3B 1GN9A 2A5JA 3L6UA 1DRJA 2RJOA 4Q1EA 5DM0A 3LZDA 2H2GA 3WYCA 1S2MA 2XYQA 2C5FA 1RLTA 2XH8A 1WHTB 3EC1A 2CBXA 5AKJA 4FYKA 4HNSA 1J2TA 1DARA 3OT1A 4CLXA 4CR6A 4F8JA 2HA6A 5IMSA 1GEGA 1YOVA 1Z8DA 5HA5A 3EH2A 3OPNA 4EKIA 2Q4OA 2V1XA 1UMDA 3HCEA 4NOLA 1BHO1 4YRRA 2PK3A 3HFSA 4KXUA 4R8MA 4DQXA 4OYHA 3K0AA 3FR7A 4B0PA 2LBPA 3NPAA 4PEVA 4RVFA 3AIIA 4E33A 3LS2A 4TT3D 2V5VA 1QRAA 2CXUA 4QPCA 2XMBA 2CXNA 1G2IA 3AJ9A 5D7NA 4EHLA 2VT6A 2QUJA 3P2EA 4PLYA 1E7WA 3DTVB 2YQ5A 1PYGA 2XVYA 3GU3A 5CLLA 4KGXA 2ZDQA 4TRRA 2WA2A 3TQQA 3VSCA 2BGLA 2OESA 1N6PA 3LCVB 3EVEA 2EZ8A 2ZIEA 3BFVA 3GHHA 2GZ2A 2GCPA 1WMFA 3PITA 3KBOA 4I6JA 1TF7A 5SZHB 3CH6A 3LT5A 4CLEA 1U1DA 2FPWA 3VPAA 2MINB 1VSUA 1EHCA 4O33A 1EUYA 3WFZA 1AB6A 1RQ2A 2IRWA 3VYUB 1SRQA 5A4AA 3U62A 2HNKA 1R2QA 3HK2A 4LK3A 4H1WA 1K8RA 4JS0A 1QRTA 2XJ4A 3EGXB 4BVFA 1QR6A 1P9NA 1JEOA 1XIVA 2PCLA 4N8SA 2OORA 3ZLVA 3EMKA 5SZIA 4BZZA 4KODA 4WDRA 2KI5A 3BHJA 1QHGA 3WNBA 5EE0A 3VTKA 4R1MA 1DAGA 3UNXA 2VF7A 1UINA 1L8QA 1R18A 3K1ZA 2ZTMA 1Q57A 3EGCA 1XZQA 3PV0A 1NY6A 4HDSA 3RSOA 3L04A 4JB2A 1VGVA 1C1XA 4FFDA 3AR5A 3HSKA 3VI4B 3D3JA 3UT5A 1N7GA 4TN1A 5AP9A 3Q87B 2G9ZA 2QA5A 5EQDA 1Q84A 4JH0A 3R7WB 4HN4B 4OJMX 3WQHA 4Z9AA 3S70A 5IJ9B 1YNOA 2FMIA 4FHFA 1USGA 3UV6A 1NRJB 5I9SA 3V6MA 2BGNA 2P9BA 3LQRA 4GICA 4HGOA 4PHCA 1U8CB 4JC4A 4UMEA 3OPVA 4MVYA 3K30A 4UUOA 2P8SA 4XSGA 5A5EA 4XLZA 1S7GA 1CQZA 1TJ4A 5H9VA 2AOTA 2RHHA 1I3MA 3NVKI 4V39A 4CN9A 3D3QA 1U0NA 2C4KA 4FHGA 1DC4A 1NKTA 1QQAA 4BB9A 4HPXB 4YJ3A 4LRYA 4KXYA 1DZIA 5KCZA 5LDHA 4CM4A 3SFTA 4UNNA 3THRA 4O2RA 2PV7A 3GJ3A 3H8WA 4DV0B 1SXJB 3F3KA 1PD0A 3ZLBA 3E0XA 3R0JA 4XIFA 1FBTA 3AFMA 3FJOA 4A91A 1TAGA 1LLDA 3FRJA 2N46A 3ENVA 3TMYA 3ZIDA 5A6VA 4D5GA 2JH8A 1HORA 3IPAA 4QHTA 3UFBA 2D1TA 4AJNA 1S2IA 1Q20A 3BULA 1OC2A 3PFNA 4K03A 4UM9B 2C92A 4HAOA 3WLPA 1JDVA 1JA1A 4R9VA 3DSRA 2N42A 4XARA 5DGCA 4MINA 1ZVVA 4DRYA 2O06A 4U2CA 1W88B 4RWEA 3BH6A 3DZDA 2VWPA 4F6CA 2CBGA 3OFND 3BJIC 2F8LA 4JVMA 2RC5A 1WO8A 3UQYS 4O3MA 1GDHA 3FN4A 2ZUTA 1RT9A 1FDTA 4UAUA 3AKZA 1H42A 5L7TA 1YE8A 3SAJA 3ZHCA 1QYRA 2AHRA 1WUYA 3OETA 2D1RA 4K9LA 4MUMA 1KO1A 1U8UA 4GYKA 4DR5B 3NHKA 3L7AA 1M8FA 3VX3A 1E1DA 3B1JA 3AR9A 1FFGA 3NVAA 3T52A 2Y0DA 3KL2A 1XQWA 2PH3A 3ESAA 1CE8B 3MS4A 4IXNA 4PGFA 3T38A 3TD6A 3WMFA 4ABTA 4K6KA 4BMDA 2NSLA 4M86A 1N2CA 4IMRA 4H1UA 4KI0A 1W5EA 4WY2A 3ZWXA 4RVGA 4RIIA 1Y1PA 2B8JA 3AV0B 3Q2KA 2PQ2A 4NAHA 2YYZA 4AIRA 5EUBA 3TSZA 6PFKA 2Q3HA 3REOA 1PJ4A 3GK3A 1LLUA 4J94A 4BATA 2Q3LA 5FYDA 3DA8A 3VGJA 5BVHA 4DOMA 5C7LO 4CKWA 1Q17A 2P77A 4I5GA 4I9GA 1PF7E 2OR3A 3FF1A 3BX1A 4ITVA 3BDIA 3GZJA 4P3XA 3PP8A 4G65A 1NVGA 5DLDA 1SVUA 1CF2O 1X1TA 4DHEA 1QXSA 4JC5A 3MF4A 1Z2AA 3WSWA 4ER0A 2RFLA 3I2HA 3IA7A 2BTOA 2CLCX 3L0BA 2HMTA 3FZYA 4GX0A 3CZPA 3S27A 3U7RA 4IY1A 3PQEA 5JCOC 3ZV3A 4RHEA 1N4AA 3E5HA 4OGKA 3NQ41 3ET5A 4GGPA 1S96A 4LZWA 2WTUA 1UKCA 1SUAA 1P17A 4E1BA 2OHOA 2MMCA 1KP9A 1JNXX 1TUGA 1V5EA 1KSFX 4OHRA 4UEJA 4H4DA 4YO7A 4C30A 2XCSB 3DL2A 4LY9A 1IN1A 1RMYA 4PYLA 1F0YA 4G56A 3QVVA 4KKVA 3FCSB 5PGMA 1J1UA 3PTLA 1JTFA 5F2NA 1B0UA 2E48A 1XWFA 2YZ7A 1QX4A 5CXSA 1A9QA 2LE0A 2P6NA 3IE2A 4L16A 3JQAB 3K53A 4YMWA 5KINB 1AO0A 2PUGA 4YBRA 3ENNA 1FYVA 3PIIA 4AKIA 5DN6A 4C6TB 1QE0A 3ICVA 2FGKA 2B1GA 4F3TA 3GV0A 2WKSA 4RHFA 1TTTA 4ZYVA 2IQ5A 1CY1A 1NMYA 3B3AA 4E5YA 4M1OA 5CUQA 2WT8A 2GYUA 5JHGB 2REQA 4N7BA 4JCOA 5A7GA 1GGMA 3C7DB 1UOPA 3R2JA 3CNHA 4M9ZA 4WLVA 4QHSA 5K4AA 5JY1A 2AX3A 2HFJA 3BHNA 3WXMA 4LXYA 4LF5B 2TRSB 3L0OA 1IOVA 1KEEB 3WB1A 3OMWA 2OGUA 2VDUE 4TMVA 2VZEA 1B3BA 4H17A 1QJ4A 2JNWA 2PVCA 5FORA 1ZZGA 4PNHA 4R1TA 3L4BA 1SA0B 5AVKA 4IBOA 4QYXA 4EM6A 2EWMA 4JT4A 4XIYA 3KVNA 4O2BF 4TMTA 3ANSA 3BHMA 4MHOA 4CCWA 1HZZC 1K86A 1EVYA 5HKOA 1HNWB 4AS2A 2ZYIA 3ROPA 4GZLA 5BSWA 5CB8A 4I4TB 1UC4B 3DBHA 4OHCA 2P0YA 4Z3OA 5BNIA 3TQIA 3L0DA 3JTMA 4R41A 2I3ZA 4I2NA 3OFJA 3TAHA 1ZHOA 3WO1A 4B3SB 4EY4A 4Q9KA 4IJUA 1SWWA 3GFOA 1RMQA 4EMSA 2R84A 3IPLA 3E8SA 1Y4SA 2VJNA 2ZIXA 4JR2A 3W5JA 5TB5A 1G291 2CZQA 1GVHA 3IH5A 2VWGA 4Z4FA 4X62B 1JMYA 2Q2WA 3DAOA 3OA0A 5EL0A 5IXSA 1VYHA 4FI3F 4E5UA 5LSAA 2NACA 2YMPA 3EE6A 4ZOLB 5BUSA 5CFPA 1ATZA 4M7RA 4BB6A 3TLCA 1EX6A 4HEA1 4IGAA 4AKHA 1WL8A 3HZHA 4YV2A 5JALA 2WVAA 1PZFA 4AJ2A 4E5SA 1TTQB 4C5AA 1XUOA 4CF4A 3IBCA 3HI6A 4HZUB 3J7TA 3IDQA 4HYEA 4BFVA 2NVUB 3PTAA 2BZSA 4LSWA 5EMJA 2NV6A 1U2SA 2IHUA 2FMXA 3QSYA 4X5OA 2V0CA 3WMWA 4TS9A 1Y8ZA 2O8BB 2P90A 4S05A 3A3PA 2DUMA 3SQMA 4ERXA 5KNBA 1N92A 4UUAA 1RWBA 5L6MB 4KR7A 3TPFA 1T3TA 1BS2A 3L4EA 3A6FA 4XOUA 2XKBA 4X60A 3TTWA 3IUEA 4PC2A 5TJ9A 2YUIA 2B1JA 2DX7A 1SBZA 2QJWA 4KGDA 1C9JA 1OJ7A 1B93A 1PWXA 4NMLA 4CM7A 3M5DA 2F1OA 3M1IA 1BQ3A 3RGWS 3FBGA 3BA6A 3W3AA 4ENRA 4JGBA 4MWBA 3G0CA 5LA6F 2GN1A 1BEEA 3WLEA 1T8YA 5M34A 2QNBA 3N9IA 4M37A 5BRJA 4ZVKA 4B6GA 4RL6A 1P2TA 1B43A 1EE9A 1FP6A 3F6CA 3RWOA 3LF1A 2WJYA 3W78A 3WDSA 1G6HA 1GL6A 1M2GA 3KC2A 2JIOA 2R2AA 1VIVA 3BN3A 3M33A 3AV3A 4HY3A 4RA6A 4V24A 4Z0TA 3WKBA 3AVTA 4DSOA 5HE9A 2O7VA 3P5BA 1GKKA 2WZQA 3IYLW 4L75A 1HH4A 1TVKA 3FB1A 3UWMA 3ZJ5A 5LLSA 1Y7HA 1E89A 1UZLA 1D8TA 5KCMA 2FOIA 1E79A 3CPSA 3GJ4A 4OB6A 2K6GA 1BS1A 3ZZMA 1N2BA 2IZOA 2JRCA 5E0KB 1Z7WA 2VDPB 3BMCA 1JEEA 3GXBA 4KE9A 4AIIA 4D3FA 1FJGB 1PX2A 1XZKA 3E5MA 4X63A 1N3IA 2I7XA 4RD3A 4RM2A 1N25A 3DE0X 4NQRA 2A0XA 3NGXA 3BDVA 3HNOA 1SCAA 4R83A 1HYEA 4QQRA 2WC1A 2NYUA 4HUQA 2HV8A 2V7WA 3ST7A 3T5DA 2P8JA 1XP5A 4BZQA 4EEKA 4MR9A 2O8FA 4GZ5A 4C76A 3DZCA 3FAKA 1VKHA 4LXTA 1YD7A 2WLTA 4URZR 5IYZA 3SSOA 2JVIA 3RS3A 4C07A 4F92B 5KNCA 1XZLA 2HPAA 3OEEA 1IZ7A 3QFSA 3B3FA 2WUGA 4UXHA 2OOKA 2B21A 2X22A 1OV6A 3GHYA 3SF0A 3WRXC 1NVUQ 4QGFA 1QTRA 1W6RA 1Z18A 4HADA 5J5VA 2J59A 2QPLA 3W5VA 2I33A 3B85A 3KEQA 2BUAA 3ZWBA 4BPBA 5M7EA 2VF2A 4HSGA 4FMDB 4R5MA 7YASA 3A2LA 1X1BA 1E0JA 1EUQA 4A92A 4C04A 2GXQA 3S3TA 3I4CA 3H75A 4G8DA 1MO2A 2GCOA 2NO7A 2YNMC 3Q3CA 5EXXA 3VYWA 3O0TA 4W5NA 2V7BA 4S1WA 2NUPA 2ZRQA 3AY3A 3RFXA 4KK4A 1W5BA 1XD9A 4I81A 3ZVLA 2VTBA 2IOQA 1UFQA 1O5TA 3HUFA 4YECA 1J2RA 1YS6A 2IS2A 2F6RA 3BBPA 3DT9A 1S2LA 2OAP1 4FFVA 4RD2A 1MRNA 5K3DA 4PZAA 4AC9A 4WPGA 3BCRA 3AIKA 1ZAYA 4P3OA 4PG8A 2GEJA 1TK3A 4QU5A 2FVXA 3TPZA 5C7OO 1GEEA 1KYVA 1TM1E 2PDAA 3AVXA 1QIGA 4LY0A 3OM9A 3FRIA 4KLRA 3DF7A 4YI5A 4O2AA 4WNYA 3R3SA 1O8BA 3PRKE 4LZZA 4L4RA 4HNAA 1YI0A 4MEJA 3THWA 1V37A 1MGPA 4NAUA 3AETA 4GPZA 4MW9A 3AJ8A 3AP2A 4BDSA 1JWAB 1P3JA 5I51A 3MW8A 4CRWB 5BN3A 4LEIA 2CNWD 4HDKA 1VP9A 2CCKA 5LQSA 4LGYA 3U61B 1JFFA 4BX2A 3HA3A 4M76B 4GWLA 4CR8A 1EUDB 4LIPD 5KQGA 3BGVA 4IIFA 4X1IA 2Y68A 4B9EA 1U2ZA 2O2HA 2I7TA 3THYA 5EGSA 2UZ4A 4FFBB 3WMGA 3ZD8A 1DQZA 1PQPA 1XVIA 5KMGB 1ZNXA 1FRFS 5F2EA 4XB1A 3S40A 1F1JA 1TT5A 1M0TA 1OLOA 4M21A 3QUCA 4KAJA 3FR8A 3TNLA 1XD2A 1RYHA 2QROA 2Y0BA 3WQQA 3CGGA 1X19A 1QC5A 4QFMA 2JJYA 3OF3A 2WJHA 3QJYA 1LK7A 4KC0A 4IICA 3PRYA 4ZDJA 1ZD2P 3DOCA 4YRIA 3I0ZA 2ZS7A 1V5IA 4LJKA 2WMYA 1JLLB 1KZ9A 5HF6A 2NXNA 4NEHB 4HN2A 4PS1A 1IL0A 1T6XA 3GJ0A 4KAAA 1P0IA 5G53C 3CUWA 4JDPA 4ZT4A 4CIBA 3MA0A 3CUKA 1XL1A 1YJAA 3C8MA 3IP8A 3KSUA 3U0BA 4D9MA 4DN6A 5KSYA 2HMUA 1X8JA 3BIFA 3M4ZA 3OQJA 4NYMQ 4YN3A 3FKJA 4OLHA 1KPHA 3NYWA 5KDDA 5GOZA 4L3OA 5F12A 4AP6A 4EF5A 3E6AA 5BSKA 3DD1A 1NAHA 4LOLA 2WIAA 1ZK4A 3ZQKA 5IJXA 1CY7A 2MCFA 5C8YF 1XPRA 3CIOA 4M9RA 1F20A 1QYDA 4WNAA 5JBNA 4MI6A 4P7GA 3WLLA 4IH4A 4B4KA 2R00C 2YHBA 1X74A 3LY5A 1P8JA 1V3UA 2PU5A 3NHMA 2WLSA 4K7JA 4KQGA 1R6AA 1SIWA 2BEWB 4KVAA 2ZPUA 3B3GA 3NG1A 2DERA 4LYFA 1PBTA 1ZITA 4GMDA 5AXDA 1UODA 4JQOA 3T1YB 1BWQA 3SG0A 4HWRA 1W76A 4LBWA 4D9FA 1PRYA 3NWPA 4GRIA 2XB2A 2RARA 3MTQA 4D26A 5KYKA 3ZK8A 2ZIZA 1ULSA 2B1IA 1R37A 1JGTA 4RD1A 4S35A 4NJMB 2J7PA 4OIMA 1L1FA 3TJZA 3PUIA 2Z56A 3AONB 3ADCA 1KP3A 3EA0A 2X5OA 4UU1A 1L5WA 3DWEX 2GFIA 4WGFA 4XRRA 3UIEA 2VLBA 5E7JA 4Z5XA 1B0PA 5H3CA 5DTEA 1N5RA 3A4VA 4LVOA 2ZSDA 3EG5A 4R68A 4W8OA 1P18A 3R76A 4AF8A 5JISA 4TQ9A 1LDYA 1G7TA 3TZEA 1FDWA 1PNQA 3JYHA 2YHIB 1O94C 4P93A 4IV0A 4WOBA 3TCXB 2FJUA 5EJEA 2C94A 2E85A 2QLJA 4MRVA 3GI1A 5M5BA 3CVXA 5C46F 4QXAA 3PA6A 2X2EA 3R5XA 2YQZA 3NAGA 1E5TA 2O3TA 4MJ3A 4EX6A 1GTMA 1V43A 2I3DA 2JBHA 3Q7QA 5JTUA 1SCKA 3DPIA 4B87A 3DCYA 2ET6A 3TE6A 2WF8A 1PHRA 5FNVA 1BX1A 1XTSA 3DAYA 4OL9A 3N8KA 4U7PB 4BUCA 2YYSA 4F9FA 4Z4GA 2OGZA 3W7BA 3F74A 2J6HA 3X1XA 5JCZA 2XZLA 3KXKA 4G0UA 5T57A 1UC5B 1VYVA 2EATA 1Z83A 2J08A 1JWBB 2IYQA 3LBHA 3PI7A 4J16C 4Q37A 5EE1A 4I50B 4TXNA 3QNUA 4TLEA 4ZOBA 5G4KB 3U7GA 4QBIA 2B1QA 4NCNA 2DXIA 2O8CA 2JATA 1IPFA 2Q62A 1POXA 1T9HA 5IW8A 3FSGD 4X9XA 3SJBA 5K8TA 2AFIE 3D8SA 3KKOA 4R4JA 3N7TA 4ZI7A 3D8HA 5LNK1 2GZSA 4LDRA 4OU5A 1Y4DE 2C00A 3JVDA 4REQB 5DHQA 1EKXA 4W5OA 2QQ5A 3K5WA 5TQVA 1FFYA 5HS4A 2GBFA 4EYEA 1SKAA 4J3FA 2Q45A 4BV8A 5T3UA 2ZBGA 3VPGA 1G9SA 1ZISA 4NEGA 3EPJA 4Y8VA 4KWCA 4AXXA 3B5JA 1U5BB 3T9DA 2AD5A 3DMHA 3OLZA 2P9HA 5MN4A 2H11A 2Z57A 3A32A 2PUJA 2ZITA 3FNRA 3KWMA 2YR0A 3N2KB 2F2TA 2FVYA 1CRQA 1NZJA 1XU4A 2FSGA 2CMDA 3CO5A 3QW2A 4OQFA 4PG6A 4EPTA 1XHFA 1R64A 2ZVJA 3L06A 5TEWA 3JQ7B 5EZYF 3AHCA 3SJZA 3INRA 1J06A 4TUYA 5E9WA 3NPMA 2IYFA 2QI9F 4RZIA 4ABYA 4P53A 4EJSA 5CJJA 4K3VA 2DQZA 4MDEA 1QQ7A 2XAAA 4LGCA 5FXMA 3PNOA 4BAZA 4UDOA 5B3AA 4DRXB 3MHTA 3EJWA 5ICGA 3ZOKA 2Z6UA 1T1EA 5AH0A 4LCEA 1AY0A 6CHYA 1T25A 4G97A 4Z1MA 3M9LA 2F43B 3LF2A 2H4HA 2I71A 3LVFO 4JWTA 1QONA 4NS4A 1YK0A 5E6SA 3UK6A 3CGWA 3PQ5A 3ETDA 4X8MA 5KTSA 2JIQA 3PDHA 5LZ7A 1F0KA 3WRVA 5D5HA 3O4FA 4JT8A 3ERCA 4KMMA 1AS2A 5HIIA 3WQSB 3SD7A 5K0NA 2G04A 3QGMA 2BM8A 4C4ZA 5F7OA 1NN0A 2OHXA 1SC4A 5M2QA 2Q3DA 1FFAA 4R6WA 1YDWA 3ICWA 1WHSA 2XA9A 1EJBA 4C06A 2XZDA 3O1JC 3SGLA 4EUSA 3KJQA 2PS1A 4YXWD 4A5OA 4GI3A 4RMHA 2CLLB 4IZHA 4FT4A 1KK3A 3AINA 3DOHA 5CT9A 4TMZA 2QUAA 1KO8A 2IOYA 5AJXA 4V0QA 8AT1A 1YA4A 2JBAA 3NWEA 1HE5A 4PF1A 3OIYA 3IBGA 2P4HX 3D6UA 3F4LA 1PR3A 3SNHA 1U8XX 5JU6A 3ZDZB 1LLQA 2XB9A 2OLKA 5K8LA 2H4YA 1G16A 3IQDB 3U4DA 2AA3A 2V9PA 2ZTLA 1PFWA 2VRCD 5JNTA 1QPBA 1KZ1A 1ZI6A 4NBTA 2A57A 1K5HA 1E18A 1U8AA 3FPGA 4LYYA 5AW4A 2DWQA 5JFOA 4G0WA 3E48A 3NATA 1MHTA 1S2OA 3WSVA 4TWZA 1BJRE 3D3KA 5GIOE 3RIHA 4UVDA 4RMNA 3V2IA 3E22B 1F8GA 3RBAA 3G13A 1FUEA 1V8PA 1PEDA 2ODAA 1V16B 2QXYA 3BZBA 3EHEA 3IEIA 4HX9A 4EKYA 1P3Y1 1OLXA 2JEZA 2SHKA 1O0CA 2A3RA 2ZQZA 3P9IA 4L02A 4UCWA 4QREA 4Y0VA 2NUBA 1THMA 3HB4X 2ZE8A 3QKUA 4KN9S 1WZUA 4KLNA 3T7RA 3FKSA 4DV4B 1XX6A 4RH1A 3HYRA 2REOA 2WHYA 3EXHC 1TGVA 3EXEB 2F9FA 1B8UA 3OU7A 2FWJA 3IMCA 3MWLA 4H1TA 1H8EA 2PLAA 1GR1A 1M2HA 1KO4A 3ZWPA 5HUQA 4ZMRA 1H2RS 2QLFA 1LTQA 3K0CA 3AR2A 3OA2A 3NYQA 4GW3A 3ZPXA 2ERCA 4Q6BA 1WETA 2BFDB 4N03A 4Q3CA 2RBEA 2E89A 5L45A 1YCFA 5CG2A 2WUEA 1EK6A 3ND7A 3S2UA 3WBBA 1PQ4A 1TUBB 3PWZA 4YJHB 4UQLA 1YRBA 1K6MA 5AKLA 1X3LA 5K6AC 3ZNQA 2XXBA 3GT0A 4TV8F 4UW9A 5LR6A 2CT8A 1VBMA 3D7MA 4EEZA 1K89A 3RAFC 4EFLA 3CE6A 4IH1A 2IUSA 4YT8A 4XX0B 2H1CA 4LJSA 4A15A 5LCXA 2G9NA 1LUAA 4HDMA 4N5HX 4YREA 1XZHA 2Q5LA 2ECPA 4JBWA 4ZZ0A 1Q74A 1WB5A 4YALA 3WRWA 1Z6TA 2OGTA 2WIBA 2ZTUA 1DQRA 4YNBA 4HGZA 5CFMA 3TDMA 3K2IA 3DE1X 4NCKA 2VYFA 3W0LB 4L4UA 1YRHA 2OBXA 2Q5EA 4MVJA 3PG5A 4EIWA 1YS1X 2DJIA 1SKYB 1KSHA 1UIMA 2ZIVB 3OFKA 4U2GA 1E5VA 4E7OA 4EY7A 9ABPA 2NU7A 1HYHA 3H2JA 1M7BA 3V4PB 1N2GA 3OPXA 4ENPA 3EIEA 3MSCA 3TBHA 1UOOA 2A0FA 3VKUA 3TKYA 2A58A 5E2BA 5EI5A 3R9WA 3KL4A 3FWZA 4QT4A 2VRNA 1DDOA 5IKOA 4EVIA 4OSPA 5F64A 3D3WB 4YR9A 3M0EA 4FMPA 1DINA 1MZVA 3MWDA 1ZEMA 3BZWA 1KHHA 5KREA 4GMGA 4NP6A 2RHCA 4R7TA 1OYVA 2VUSA 2ZSJA 1L8AA 3G8BA 4DYHA 4RACA 1EK5A 2PZAA 1X7WA 1IJEA 4D43A 2AL7A 1W1UA 1DWQA 2AG6A 2UUCB 4WXEA 3ZV6A 4C14A 4BO7A 3QPUA 2AD1A 3IT2A 1NVXQ 3ENQA 2ZCVA 2BJWA 1XB2A 1JYEA 1LLFA 5B7NA 1YSCA 1JQLB 2IHYA 3VYTB 1V8BA 4KPYA 3H5IA 3PQ2A 3RV3A 3ZCXA 4N48A 3VR4A 3GT3A 3OLQA 2ZQ5A 5ELXA 1Q6YA 1JTVA 4WNIA 1SHZA 2UYOA 4EITA 2AYYA 3FCXA 3OF5A 3B5IA 4JUBA 4JEIA 2FWPA 4ISBA 5JLAA 5LYYA 4ZGWA 2DULA 2Y0CA 3RVSA 5B1EA 5HTOA 3SM9A 3EVDA 5FEUA 4Z4QA 4EAAA 2R6HA 3L0CA 3GEGA 4EB3A 3IQZA 2D4HA 3Q12A 3LBFA 4QASA 2H51A 1UJCA 3CBGA 2R48A 3ORSA 1QTNA 1ARZA 1XDDA 4EB8A 3GFQA 1IN5A 5C8DA 1D7AA 2QM8A 2XEDA 4FGSA 1Y5LA 2VP4A 3BWEA 1P1KA 2I9KA 2AJCA 3C3CA 3OFVA 4D8YA 4B09A 4OREX 3RAEC 1K75A 1Y5RA 1L4UA 1ZWLA 2VHXA 3ZE1B 4AG3A 1JFRA 3OCWA 3OX4A 1C50A 1VLMA 5GJWC 2DBZA 2NVOA 3RSSA 4ALLA 4B76A 4ZZIA 5KO2A 2PU7A 3FPAA 3F3MA 5J2TA 3DMTA 1OROA 4YJ3F 2X9QA 5I9LA 2RGBA 4G5FA 4EJ0A 4QX6A 2O20A 3TM5A 3G1WA 3SLGA 4EO9A 1QH1A 2DR2A 2FWNA 1J24A 5EMHA 3R0ZA 3OUZA 3DBRB 1NW7A 1G7SA 1T2VA 1XTUA 3KUKA 4IFEA 5DN9A 3QVUA 3UA3A 1USVA 2N75A 1R0YA 1XXHE 5LBIA 4DNOA 2FWMX 4D6YA 1RWNA 4NHEA 2V0GA 1SG0A 4L50A 1YB2A 4ZYZA 2GVNA 2X0FA 4PX5A 3QVWA 1J2YA 1E94E 2D00A 1UBJS 3JAKA 3EDOA 3ND6A 3ROMA 4E4YA 2PUDA 2H4JA 2WYVA 3RTCA 2Y1LA 2ZUUA 4K46A 4RL4A 2AEJA 4CKCA 1EJ6A 1N8SA 4I55B 3W1VA 2H2FA 1ZCBA 1P62B 1TKRA 2ACKA 3IMFA 4MW1A 4D44A 1EQAA 2W9XA 1Y6GA 1UDAA 1VC2A 2B9EA 2C0PA 2C4VA 5FFFA 1XAGA 4XIIA 1CIJA 3P2KA 4KEAA 4I6EA 3T3MB 5TQJA 5BYKA 4Q4AB 2VEOA 2DFDA 1C81A 1SIBE 3AHDA 2OENG 2BTQB 4Q4HA 4MVJI 4GYJA 1L4HA 3NNNA 4UHKA 1ADJA 5AHXA 8ATCA 2Q5QA 3K9WA 4WERA 3FSRA 3QKWA 4QUKA 4I6GA 5JXHA 1LNSA 4FOLA 5HKAA 3GLFA 3JQGA 4TL7A 4G25A 1H2XA 3RADC 4U63A 3W6UA 2F8MA 3TPCA 4HLDA 3A11A 4TKLA 3KX2A 1RFGE 1V71A 4FZRA 1Q11A 3AVUA 5K01A 3A0RB 3JASA 2XHEA 4JEUA 2RG7A 3O94A 3OZGA 3TDKA 2POCA 1ZJJA 2COKA 3AERA 1VL0A 3R6DA 4OGLA 4WFJA 4ZEOA 4CTJA 3TW8A 1Z6QA 4KYTA 5HRCA 3QMWA 4WN9A 4P54A 1AZLA 2OXCA 1FDIA 1DT5A 1PK9A 3Q0EA 4C29A 5F5LA 3OCVA 3U26A 1EFKA 2A5GA 3NHPA 3NTUA 3RR2A 3FRHA 1VG1A 1I24A 4YCCA 2B8EA 4WXHA 2H9YA 2ZIUB 4KQFA 3FGPA 4M0FA 2H17A 3CRVA 3K9LA 1WQ4A 3L8EA 4H7FA 5A9SB 4GKKB 1SXJC 3JWIA 2GO7A 1UBKS 3MVEA 2J0VA 4AZ3A 2VJDA 1C9MA 4R31A 2H52A 3SXPA 1KL7A 1K6XA 3ELDA 1EDZA 5FP0A 5JNVA 1H0RA 3V4VB 2Z30A 5EHZA 4UD6A 2HJRA 1ULTA 1BXKA 3GRVA 4MRMB 1E2UA 1Z26A 2W98A 4S2EA 4CM9A 3M7IA 1VMAA 4GR5A 1VFNA 3ENZA 3N8NA 1MVNA 2XECA 3RTBA 4A23A 1RYNA 1IC6A 4R01A 4BMYA 5AW9A 3EBOA 4MNTA 3VC7A 2PNJA 1V8OA 2BZ1A 4UVGA 3I4FA 2O3RA 1EFPA 3V55A 4BGVA 3I9NA 2CLEB 4JA2A 1C0EA 4F06A 2WQ6A 2ZI4A 3EISA 3ONEA 3UB2A 3P32A 3ZW8A 1SZCA 3UGTA 1E2MA 4J76A 5CDUA 2NNWB 5K8IA 3P27A 3OKFA 1JUDA 2HWXA 4OQPA 1R9JA 5BWLA 3TB4A 4PNZA 4AZWA 3JRWA 3QEMA 1YH3A 2ID7A 3MSXA 2YXNA 3VR5D 4CU2A 1ZD1A 1NQXA 2IYAA 1TW2A 2ZKLA 4JLOA 2EF1A 2QD5A 3HEAA 5CVVA 1R74A 4MLCA 2EGHA 2HT6A 2ZT6A 1A88A 5DIZA 4M60A 1JFVA 1NQVA 1H0SA 4A4DA 5HNKA 4G36A 1QLJA 4BNGA 5A4JA 2R66A 3GGSA 4GR9A 5DCUA 5A02A 3PZBA 4EQ6B 4ASUA 4BN4A 3BH7A 3CNNA 3KPWA 2YRWA 3JAWB 3FHOA 2XMSA 3FUTA 1V1MB 2J5QA 1HGXA 4ZCMA 4GXTA 3K7EA 3U7IA 5JJKA 2HU8A 2PSEA 2PUTA 3NRJA 4KYIB 2G17A 2NU6B 2ZYTX 3X2SA 1Z82A 1RYBA 2X23A 5AKYA 2IEBA 3D4BA 3P0EA 4JVSB 4PR3A 5FTMA 2WBLC 1Z36A 2D7DA 2QRJA 1RZVA 1ZK3A 3KETA 3DL0A 4WOKA 1E59A 3NIBA 3HCAA 3AIOA 5DVZA 2O8EB 3VDQA 1KQGA 2GAOA 3BRSA 1DP4A 3KKZA 3R3JA 2JGRA 3TTYA 3I9OA 3C24A 5ALNA 4W99A 2ZBUA 3ETGA 3MXOA 2QX9A 5HYVA 4CVNA 4PZDA 4L4XA 5COAA 2GSDA 4MYCA 2NSJA 4N8EA 4EFDA 3DL7A 1PFGA 2R2GA 3CX8A 1RWVA 3TDNA 3NRCA 4TLMB 4XI9A 3E9DA 3IT0A 1C7IA 2C07A 2A78A 2XQJA 1VL2A 3OZSA 1RCUA 2BMEA 2BHNA 2I6FA 5ELMA 4INOA 3QEAZ 2UUBB 2YNMD 1CR6A 3KQWA 2Z2IA 3NHUA 1NF8A 1Q16A 3BXFA 3F3SA 1ZS9A 2CNKA 2OCGA 4MLPA 1GARA 4UOZA 3ELYA 1CD5A 4TKUB 5D2CA 3T3DA 2QTVA 4LYHA 5K0BA 1CP3A 4BYGA 5KHLB 4MITA 3DTTA 1UT6A 1ORIA 2AF4C 3OT4A 1BQEA 3Q7RA 3E53A 3G59A 4H3KB 4K5QA 1GV0A 3RC3A 4ENSA 3ER8A 2O4CA 3S44A 1UBMS 3GJRA 5KTOA 1JIVA 1M34E 4OEHA 5B2EA 4JVLA 2WYHA 2I4NA 4JGIA 1E64A 1YL5A 1LRKA 1BHSA 2IU3A 2YFHA 3B38A 2IYOA 4YAUA 1I2AA 2EEZA 3JVEA 3PC3A 1R0CA 3GLIE 1ZH6A 5EEGA 4Q47A 1N5IA 1LS6A 4YT5A 4M1EA 5HFAA 2WK1A 2EWVA 3L18A 4AY4A 5JQGB 1JDPA 4RK1A 2PBFA 4HDQB 1EJ0A 4NJEB 3ZY3A 3QX9A 2ZSHA 1D2AA 2PJRA 3HJNA 5CVCA 1Q1EA 4EA6A 4Z7QB 3R4CA 1XTBA 1EA5A 1HE2A 3AR6A 2GPTA 3FIJA 2DAPA 3RRNA 3G2LA 2BEJA 3DLIA 4LXQA 1O77A 5G3YA 1FA9A 2QR5A 1F06A 1MB3A 2NNLD 3EY4A 5CFNA 1MGOA 3Q0TA 1UKEA 4RFSA 3ZHRA 1BE1A 1JLKA 1XZBA 1XI2A 2VRBA 4JXJA 4BEVA 4C0SA 2EERA 2Q1YA 1VHTA 2CNLA 2I5PO 1JR3A 1PQUA 4F2DA 5HKBA 5TMDA 5ABPA 4HAIA 1O6FA 1QK3A 4PPFA 1AA9A 3CH5A 3GP5A 1U2RA 1TO6A 5EQJB 1P0FA 4BO2A 3TUZC 1YQXA 3IL2A 3EEBA 1RBQA 1DSSG 1TKCA 2PUCA 3ZS8A 5BQFA 3DOOA 3W6ZA 4LOJA 3K70D 2PWAA 3MD0A 4Y7CA 3BGOS 4YONB 3A4YA 1X42A 3OMXA 5F76A 5FUQA 1T2CA 2QU7A 2PZBA 4Y2UA 4J2HA 1EJ2A 1P9RA 1QG0A 4MRAA 2DRIA 3IEUA 1EVLA 3O3NB 1E2LA 3AESA 2BI8A 3FPKA 4G3XA 1JJBA 2BR3A 3UXYA 4CQMA 5JI2E 3A06A 1UBEA 3IAAA 3NCTA 1SUCA 3SVTA 3W4IA 1DX9A 1BCSB 4HNGA 3D2BA 4OBWA 1N2EA 2YWJA 3C16C 3KWFA 4JYCA 1J0AA 3U9TA 4N41A 4WACA 5IYZF 1J25A 2GRJA 3KCNA 4IDBA 4FUTA 4FSXA 4XVRA 1TW3A 4YH1A 1L4YA 1BN6A 3KSMA 5A5FA 2P9JA 2YV1A 1OH5A 3TLJA 4MP3A 1AMOA 4UASA 2FPPB 1MB0A 4LVUA 2C2ZA 2PL5A 3OM8A 4L0CA 3SC4A 4Y6QA 1SB9A 1OFGA 4C3VA 5CFRA 3TTVA 2H1FA 2QJOA 3IBYA 1DJQA 3LX8A 4ARUA 3SZUA 3ZXXA 3HU5A 5AVXA 4RZ3A 3MOGA 4CBVA 2H63A 3NC0C 4HB2A 5FWXA 5HKKD 4HTFA 3JVVA 2QL7A 3IUNA 4ZU1X 3ZY4A 1U2GC 3E3LA 3S81A 4Y2JA 1RWXA 1LSJA 2CY0A 1MVOA 3JR3A 1K27A 5KVCA 5ECGC 1F3OA 1MNAA 2N9UA 3B7GA 3D1JA 1NBMA 3OO0A 1ZJZA 4UHFA 5C35A 4D9HA 3RYCA 3NBZC 2HSEA 1YK1A 1S01A 4RZ2A 3OCCA 1O95A 4DJDC 4E3ZA 1Z6PA 2ILTA 4F3NA 4H2DA 3REGA 5JRZA 1HLGA 2DTDA 5I5EA 1MG0A 1NVVR 1T4MA 4CCYB 1SELA 5I47A 3HJCA 3P71T 2BR5A 3GOQA 3KYCA 4GKVA 1W4LA 2QB5A 4O2AF 4UUBA 4WVLA 3KK0A 1T1SA 2VBFA 3MN1A 2YV4A 1G42A 2WEKA 5AM2A 2NP6A 4OAQA 4RTJA 1CQIB 5A9TA 3F6EX 4XR4A 1CLEA 3OKPA 1KQFA 2G5GX 2EP8A 1JQKA 2NZJA 3LYUA 2FFJA 3EBPA 3ONVA 4BCBA 2GDJA 3RVQA 1Q1GA 2VLIA 1N6HA 3KQMA 1W5FA 3AEYA 4PHHA 3U39A 1JIQA 1NIPA 1RFLA 1U28A 2VP5A 1TJ5A 3BL6A 5AESA 1Z5NA 4MAMA 1MC5A 1C8VB 2MHCA 3Q4GA 2X0EA 4HNTA 3QBTA 3O8QA 2GKGA 3SC2A 1D9XA 4I5EA 1HXHA 2WHPB 3H2IA 4GFDA 4AN0A 2FTKE 1ZRMA 2ONKA 4LHYA 3TOSA 1ZRSA 3VSDA 5TMBA 5K45A 3ADKA 3FCEA 3KDPA 3ND5A 5AIAA 4UNRA 2JJQA 4DC9A 1WOYA 4QM6A 3C5CA 4HATA 1OLSA 4OJQA 3HJGA 1OX4A 4XSVA 1HV8A 5FIUA 4RK6A 4B80A 3ZUPA 4OSEA 1EM6A 2IDMA 4UHCA 3HV2A 3C4JA 2M6SA 3NWJA 1GG5A 1W48A 1D5CA 1PP4A 3EXG1 5B2ZA 4EKGA 5JD3A 1FFEA 5LB4A 1WW3A 1Z37A 2AQKA 1OFTA 4D56A 3TRIA 4ZO9A 4ALNA 1TZJA 1PJSA 3IX7A 2EKDA 3GBPA 4F6LA 1LBTA 1N8NA 2AFIB 4IZ6A 4CEIB 2QGNA 1WIWA 3WVNA 4A5SA 1D1QA 2Q07A 1VCHA 2EFHB 3FYUB 4FNAA 4IJQA 3L0ZA 4R5HA 4XGNA 3TVYA 4F86A 2F3QA 1I5OA 4TM8A 2YRFA 3ABZA 4DLBA 3GJ5A 4MV6A 4QVKA 2FMKA 3CV3A 1FSFA 5IBRA 5H68A 2EOAA 2I3BA 1I80A 4TOIA 5LQRA 4DPKA 1M9NA 1J2UA 2HJGA 2R87A 3HEMA 3MJFA 4I9UA 5KOYA 2XCUA 3T94A 1XCLA 2HXGA 1CDDA 5D3ZA 2W6JD 5I3CA 1F14A 3FCUB 4NYIR 1ZIDA 2W70A 3GDHA 1PJBA 2DECA 4OLJA 5KYUB 1LPMA 1NURA 1O96B 3F8WA 3ZE8A 5LFAA 4NZOA 3MIZA 3AUXA 3DEZA 3TJRA 3UJ6A 4M3NA 4KQ2A 4EDFA 1V39A 1EZZA 4WD3A 2GPNA 1O4VA 4ZOAA 4CFYA 2HN9A 4TSFD 2JKZA 1CXZA