1YZ3A

Structure of human pnmt complexed with cofactor product adohcy and inhibitor sk&f 64139
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
263
structure length
263
Chain Sequence
PGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
publication title Structural, mutagenic, and kinetic analysis of the binding of substrates and inhibitors of human phenylethanolamine N-methyltransferase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2005-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1yz3A00
2B25A 2UYCA 3BWBA 4HSGA 3AWIA 4PYIA 3DXXA 2AVDA 4OBWA 5HIKA 5EPEA 2H1RA 1JSXA 1IXKA 3FPFA 3E7PA 1Q0TA 1JG4A 1R8XA 5ICGA 2IBTA 4QVKA 1EJ6A 2YR0A 3LPMA 4LWPA 4OQDA 2N47A 3HVHA 4V0QA 4P58A 1G6Q1 3VSEA 5CCXA 2Z6QA 3SM3A 5GIOE 3TMAA 3EVZA 5K0GA 1RI5A 3G2MA 4EKGA 2PXXA 1WXWA 1XCLA 2DPMA 2NP6A 1VL5A 3P9KA 2AOVA 2FHPA 3OU6A 5EOVA 1RJDA 2QRVA 4HTFA 2BR4A 4GOOD 5FA8A 5ICEA 2BH2A 8MHTA 5DM0A 3OFJA 2ZCJA 5GIPE 5DX0A 3I58A 1FBNA 2ZWVA 5FA5A 1XCJA 3O4FA 3HEMA 5LQAA 5EMKA 1NE2A 5CUQA 5E1MA 1X1BA 4PYKA 1L3CA 3GRUA 1D2HA 1DUSA 1VE3A 2GPYA 4BP1A 1YFJA 2Y1WA 3NVMB 3EEYA 1NKVA 2NXEA 4YUVA 4RTSA 5D1HA 5F2KA 2G8NA 1G38A 2OBFA 3FUTA 1UIRA 4XUEA 3HCDA 4PCLA 5KQSA 2P41A 2PBFA 5DTMA 5DSXA 1JR4A 2FK8A 3IYLW 3T7SA 1HMYA 3LX6A 3ID6C 2JH8A 5FWDA 2OB2A 4BY9E 4FP9A 2QRVB 4HTFB 1JTEA 2AOTA 5LQCA 1MJFA 4AZSA 3CJRA 5E9JA 2O06A 5EMMA 1TW2A 2PT6A 2YTZA 3LSTA 5ICCA 2C7QA 3FUUA 3DULA 1XDZA 2AOWA 1XTPA 3G89A 4LECA 3EVFA 3LKDA 3GO4A 3IHTA 4QDKA 4E33A 5JUWA 5GM1A 5GWXA 2VS1A 4EVIA 2O57A 3BXOA 3CGGA 3TLJA 3ORHA 2OKCA 2B78A 5MHTA 3P9IA 4PIPA 4KDRA 5ICFA 1BOOA 3FTFA 3SSMA 3NW9A 1N2XA 3FPEA 3TFWA 4DKJA 1DCTA 3KPYA 4ER0A 4FS8A 2BM9A 3DR5A 1D2GA 3CC8A 2NXJA 3M6WA 3MTEA 3QV2A 3GGDA 1Y8CA 2ZIGA 1U2ZA 2OZVA 3G5TA 4QPNA 4HC4A 5DT2A 5CD1A 3UFBA 5DTRA 3WSTA 3C6KA 4KDCA 4YV2A 4GEKA 2FYTA 2YQZA 3UJAA 2AOTB 1SUIA 3TKYA 2ZFUA 1YF3A 5HOQA 3A7DA 4GC5A 5LQNA 2ZIEA 3DTNA 4E32A 5CCBA 3M70A 4RVDA 4RTPA 3SGLA 4PWYA 3THRA 1NW6A 3KPUA 3MAGA 2PXCA 3M6VA 3O7WA 1KPGA 5EHIA 1JG2A 5GOZA 1FP1D 1VLMA 3SSNA 4V0RA 1AV6A 1ZHFA 2AOUA 5EMLA 4ISCA 1JQDA 10MHA 3KPJA 3UJCA 1KR5A 3ER8A 3EMDA 5LQKA 3FPGA 3HP7A 4YMHA 1JG3A 4G56A 2G71A 2IP2A 4R6XA 4DCGA 2OXTA 3AXTA 3KQWA 3BGVA 3KQVA 4CTKA 3KQYA 4EMSA 4DA4A 4MQ4A 2ONYA 2NYUA 1QAQA 3A4TA 4FSXA 5U4XA 3O31A 2VDWA 2WA1A 3RW9A 1FPQA 4M37A 3TOSA 1RI4A 4E2YA 5EC8A 1X19A 2BR5A 4QDJA 1NW3A 4C06A 3BKWA 2PGXA 3DLCA 3I9FA 3C3PA 1XDUA 3KQQA 4PYNA 3R3HA 4YV1A 1I4WA 3AY0A 4BLVA 4P7JA 3HCBA 1EAMA 2I7CA 4GOLD 2Q41A 2IDJA 2YXEA 3MERA 2V7EA 2PWYA 3P97A 1H1DA 5FUBA 4PYJA 5DRYA 2AOUB 2Z6UA 3PB3A 4IV0A 2Z6AA 3SMQA 2VP3A 4B17A 4IV8A 4POOA 2ZULA 3EMBA 3OCJA 2ZBPA 5G02A 1N7IA 4H0NA 2ORED 2ZW9A 2QE6A 3ELUA 4KVZA 2QY6A 5EVJA 5FQOA 1SQGA 3ER9A 3SX0A 3G8AA 1FP2A 3EGVA 4DF3A 5K0FA 1JSZA 3TRKA 4LG1A 5P8WA 2DULA 5EZSA 2E5WA 2ZSUA 4CKEA 3JWJA 3B89A 5DTQA 5HIJA 2XVMA 3THSA 4PYOA 3BT7A 3REOA 4X1OA 4RTLA 1I9GA 3UZUA 1Z3CA 1IM8A 3B7PA 2JHCA 2IIPA 2AR0A 5E9QA 3V97A 1HNNA 2P1DA 1ORHA 5EHGA 5E8JA 3EVGA 3Q87B 4YV0A 1KYWA 3CJQA 3DLIA 3IV6A 2PX8A 1NV9A 3EGEA 3HCAA 3M6XA 3OU2A 2NNWB 5BW4A 1RJGA 4MTLA 3QOWA 5DM1A 1ORIA 5F2OA 2B2CA 2F8LA 4AX8A 3KKZA 3B3JA 4HG2A 5E9WA 4F85A 2ZIFA 3M4XA 2NXNA 2EJTA 4A6DA 4PNEA 2GAFA 2IH5A 2PLWA 2QYOA 2AN5A 1JQEA 2IBSA 3PX3A 3LBFA 4GC9A 4E2ZA 3LL7A 1P1CA 1R8YA 3FYDA 3PTAA 3GRZA 3TM5A 1X1AA 3A7EA 3AXSA 3GCZA 3KU1A 4RVGA 3TKAA 3UJ9A 4BLWA 3HVJA 5T67A 1O9HA 3EEOA 4CKBA 2ZBRA 3MCZA 2EJUA 2AS0A 4GQBA 5CVUA 5C1IA 5K0CA 3GIWA 4ER3A 2AN3A 5K05A 5EKUA 4FR0A 3F4KA 2JHPA 5FTWA 1JTFA 1R74A 4FGZA 5HFJA 4E30A 3B5IA 4QQNA 5H02A 4C03A 4EKIA 2ZZNA 2EG5A 5FCDA 3BUSA 3LDFA 4Y30A 3FTEA 3P71T 1R00A 5K8VA 4X61A 1WG8A 4R8RA 4EQZA 2IH4A 3TR6A 3P2KA 1BC5A 3UBTA 3GJYA 3TQSA 2O07A 3GRVA 4XUDA 4ATNA 3PT9A 3FTCA 2CWWA 3HVKA 2CL5A 3A27A 3OZSA 4X60A 5C9ZA 4RYLA 2FRXA 2XYRA 3G5LA 4ZTBA 1RI2A 1X1CA 5KQRA 5KYGA 1KPHA 2HR1A 3KR1A 2GA9A 3EVCA 3HCEA 2IFTA 2PVCA 2XYQA 2EFJA 2YVLA 3NWBA 5FWAA 2HWKA 4GOMD 5K0NA 3KQPA 4OX9Y 5FQNA 2ERCA 3GXOA 3PVCA 4M38A 2PT9A 3GNLA 1R18A 3VYWA 4RTJA 3LKZA 4FSDA 3JWIA 5LQRA 4Z2YA 3R9XB 3DMGA 4PGHA 3PFGA 4O29A 1ZGAA 3GDHA 5T64A 1KHHA 5LQUA 2QM3A 1N7JA 1RI1A 3CCFA 5LQJA 4C05A 4Y2HA 3EPPA 3R24A 3UJBA 4HRAA 5E2AA 4C07A 4ER6A 4ER7A 4BP3A 4JXJA 3JWHA 3M33A 3BZBA 3FPHA 3LHDA 1WZNA 3UWPA 2NXCA 1SG9A 4OA5A 7MHTA 3G2PA 2P3OA 2OB1A 2WK1A 3UJ7A 3HNRA 1VP3A 2P3QA 5K09A 4QTTB 4E2WA 5BP7A 3SVZA 3FUVA 5EQJB 3U81A 3UJ8A 4MWZA 2GS9A 4PYLA 3UA3A 3HA5A 3IEIA 3LBYA 1QZZA 2JH9A 4HH4A 3LDUA 2P7HA 4OQEA 4RTRA 3G7UA 1XJ5A 3BGIA 3BWMA 2B3TA 3C0KA 2IDKA 1L3BA 2XYVA 2XVAA 2XBMA 3Q7EA 4DCMA 1YZHA 1SKMA 2VZ9A 1FJXA 3FRIA 4DQ0A 2C7RA 3DMFA 4PGGA 2OO3A 5DXJA 1EIZA 3FZGA 2O05A 4HGZA 4GUAA 5K0LA 2OYRA 3V8VA 4CTJA 1TPYA 3HCCA 5K01A 4CKCA 3C6MA 5GP1A 2IPXA 4KIGA 3P9NA 5IH3A 2YXLA 4YUZA 4PYMA 3QOXA 3ELDA 4E70A 2C7OA 1XDSA 3I5UA 3KR2A 4MHTA 5DWQA 3HVIA 3BWYA 4X63A 4AZWA 3PLAE 4F84A 1DL5A 4YMGA 1TW3A 5EG5A 4ER5A 3KQOA 3EGIA 3HA3A 1RJFA 1M6YA 1UFKA 3B3FA 3FUXA 4K6MA 4R05A 4WXHA 5CVJA 4BLUA 2P8JA 1ZQ9A 3NDJA 3OZRA 5M5BA 2PV0A 3G8BA 4M36A 2ESRA 1XVAA 3GRYA 2B9EA 5K0JA 3LCCA 1NT2A 5DLYA 1ZKDA 3T7TA 5EZQA 4KIFA 1WS6A 1AQIA 1QAMA 4RWZA 3KR0A 3KPVA 4RTOA 3E23A 4F86A 5CIYA 2YX1A 3LCUA 5T6BA 1KPIA 4LWOA 4UOEA 5DSTA 4IWNA 2UYOA 2Y1XA 3H2BA 4AUKA 1ZGJA 3FUWA 4U7PB 1G60A 2V74B 3A25A 3KHKA 3KR9A 2ZVJA 3M6UA 5EIFA 4GOND 5DX1A 5E1DA 4DMGA 2WA2A 3P9CA 1YUBA 3SR4A 4YUXA 3NMUF 5DPMA 2JG3A 2HTEA 2NP7A 3FYCA 3OPNA 1WY7A 3CVOA 2G70A 4XCXA 2CKDA 2YUIA 2JJQA 3BKXA 3P8ZA 4R8SA 3VC1A 3MHTA 1PJZA 4C04A 3ERCA 2KW5A 3TPZA 3NJRA 4M7RA 1JG1A 4RTNA 3JWGA 3OZTA 4YUWA 4AZTA 4U7TB 2AZTA 1YFLA 4YUYA 2VDVE 3EVBA 5HIMA 5GINE 2PSSA 3E05A 1VPTA 2AOXA 3CBGA 9MHTA 1IY9A 2GB4A 1VQ1A 1WXXA 2ADMA 4RVHA 4DZRA 5HZMA 5E2BA 1QYRA 1AF7A 3UJDA 2PY6A 4PIMA 4RSRA 5C0OE 3X0DA 1VIDA 2HV9A 3MGGA 5E1OA 2JHAA 1EG2A 5LR6A 2C7PA 1D2CA 5EGSA 5BXYA 4NECA 4E2XA 3KPWA 3CKKA 4QQKA 4RTMA 3CJTA 1L1EA 2G72A 3GWZA 1NV8A 1M6EX 3KQMA 2H11A 2ONZA 3B3GA 4P7KA 1EQAA 4XUCA 3T7RA 3OE5A 3D2LA 5FULA 1JQ3A 2FK7A 3EVEA 3K0BA 3MB5A 1NBHA 2R6ZA 2BM8A 3OU7A 1INLA 1KXZA 4WVLA 3NVKI 2PX5A 1B42A 5HEKA 5B1SA 4IKPA 3T0IA 4P7GA 3C3YA 3MQ2A 2ZLBA 3EVDA 3LECA 4QTUB 2I62A 2IH2A 2BZGA 5D1NA 1KIAA 1VP9A 3HA7A 3SXJA 5DX8A 5CVEA 2ZWAA 1KP9A 2AN4A 2PKWA 3SSOA 2G1PA 3ANXA 3OFKA 5CVVA 3L8DA 2H00A 3DXYA 5GM2A 2GH1A 2EX4A 2K4MA 2ZTHA 3ELWA 5EIWA 3AJDA 3RIEA 5BW5A 4PYQA 3I53A 1RJEA 2UZ4A 2P3LA 5FHQA 1AQJA 2IGTA 4FZVA 4C08A 1RI3A 2OPBA 3LGAA 2HMYB 4QPPA 2A14A 4A6EA 3DXZA 4CXMA 2HNKA 1P91A 1QANA 2LD4A 1KYZA 3DUWA 4AZVA 4P7FA 5JR3A 1M0EA 2OY0A 3P2EA 5E8RA 1XXLA 2PX2A 3G2QA 2AVNA 3R6TA 4GF5A 5F2NA 2I9KA 1QAOA 2O0LA 3PFHA 3TM4A 2VDUE 4FT2A 3I64A 2ZBQA 3NDIA 3DP7A 2I6GA 3DMHA 2ZZKA 1OR8A 3OE4A 1PRYA 2GLUA 3G88A 4RV9A 1T43A 2FCAA 2UYHA 4DM3A 3LDGA 3A26A 2BR3A 5DM4A 5IKMA 2ZZMA 3EVAA 1R6AA 2P35A 1O9GA 3BGDA 1YB2A 4PCAA 2CMHA 3HCFA 5K0EA 4RTQA 5LSAA 1BHJA 3DH0A 4OBXA 4EK9A 1P1BA 1VBFA 2FPOA 4KRGA 4OA8A 4RVFA 3RODA 3VC2A 5CM2Z 3P2IA 3FTDA 4FT4A 3S68A 5KS2A 4QVGA 1EJ0A 1G55A 5FHRA 4L7VA 1UWVA 2PWPA 3FPJA 1V39A 1ZG3A 5HIIA 1NW5A 5K03A 3HTXA 1F38A 2PXAA 2YXDA 3KQTA 3HM2A 4PINA 5CVDA 1P39A 5DXAA 3UA4A 2P40A 5FADA 1G8AA 5DM2A 1I1NA 1X1DA 3NTVA 2PJDA 3ELYA 4MIKA 1NW7A 5E1BA 3NWEA 2CMGA 2PX4A 2P7IA 3PS9A 1G8SA 1YZ3A 3GRRA 4PONA 5DRTA 5KVAA 1L3IA 4CWAA 3KQSA 5HILA 2R3SA 4KW7A 1O54A 3LCVB 3BWCA 4R6WA 1MHTA 1NW8A 1F3LA 1BKYA 1SQFA 1SUSA 4KWCA 4C4AA 5EMJA 3MTIA 4GBED 4HGYA 1Q0SA 3MCTA 1NBIA 1SVUA 5EKXA 4X41A 3UJ6A 4E31A 5K0BA 3FRHA 5ERGB 3E8SA 3K6RA 3R0QA 5EEHA 4RX1A 3G2OA 3GU3A 3ME5A 2UYQA 3DOUA 3PX2A 5EEGA 4RTKA 1L9KA
chains in the Genus database with same CATH superfamily
2Q7XA 1C1DB 2B98A 3HM9A 4CZ2A 2P2YA 5CURA 4ALIA 1RWBA 5AJTA 5HIKA 3KBBA 5ITWA 2GPSA 3A4IA 3P9ZA 1M8GA 1OHHA 5ICGA 2W98A 2X22A 1G20A 2UVPA 2FWAA 4RPLA 2H4HA 3IXQA 3L4BA 3LPMA 2YR0A 4LWPA 4EBFA 1KRWA 1XZNA 2Z57A 3G0DA 4OKNA 3ZCRA 1U2SA 4DNXA 3TMAA 1N2IA 1RI5A 2QAGC 1RCUA 2RHTA 3KD2A 4YYZA 5HM6A 3FPKA 3GVCA 2IUSA 2AG6A 3NOVA 1URPA 3JZAA 4U2EA 4BQNA 1I3NA 2FOXA 3FIJA 3M4JA 1E6UA 4C6TB 4LDRA 1XPUA 3MWYW 2OCGA 5F12A 2NZ8A 4EKYA 2WC1A 4L5YA 2REBA 3Q1KA 3RVMA 5LNK1 5GIPE 1J2YA 3GYBA 1FBNA 4CKYA 2AJLI 2VJPA 3D7NA 1Z17A 2OAQ1 5CUQA 4LJLA 1W6UA 2J7KA 4PLGA 2GN4A 1X7ZA 2WIGA 2JFOA 4NWIA 5BQXA 3BM5A 4CQLB 1J2RA 4KCGA 3KJZA 4NCJA 4C3UA 5E6UB 1QB7A 1SXPA 2IZ1A 1XV5A 2RGNA 3F78A 3K2QA 2PUFA 4RESA 3TR5A 2IHTA 5AVKA 4CDRA 1K06A 4NDAA 1CJTC 2F90A 3IODA 3NTOA 1VBKA 4IMPA 1ETHA 3EIEA 3LOPA 4IOMA 4PCLA 4DCUA 3I0ZA 1W93A 1YS7A 1X8KA 2OCPA 3LQQA 4CM7A 1EUZA 2BUAA 1M1ZA 1KZ1A 3BK1A 3EXEA 3QMVA 4JVLA 3QBEA 5HBRA 4AY2A 4XGQA 1Z5UA 2XNJA 3V8BA 3TQIA 1JBQA 2AI3A 4PZAA 5IT4A 4BY9E 3PU6A 4J1NA 4WXYB 1DJPA 4HTFB 1IBSA 1JTEA 4QHYA 2VK4A 1CFZA 1Y3BE 4GGOA 4AZSA 1T1IA 1I3OA 4K46A 4KXQA 3RSOA 1XZDA 3RUDA 1HKUA 1UZMA 2FLVA 4J1TC 5CM9C 5DYIA 3UMYA 2XGJA 2HCBA 1FFYA 1XJQA 3EVFA 3O1HB 5KVQA 3BMNB 3VYTB 5IHPA 5C7YA 3DLPX 4LA4A 3AZQA 2VT3A 3DF9A 4MKZA 5FT9A 3BXOA 3G79A 3KYBA 4RVNA 2OXIA 1NDQA 1T9KA 2IX9A 2JFGA 2ZYSA 2CK3A 3ORHA 4IOJA 5CW1A 3R4CA 3CEAA 1MABB 3C6BA 3W1VA 1Y9AA 2AQIA 1FFBA 1IY2A 3EEQA 5THQA 3AY6A 4IF4A 4TMFA 1BA3A 3FMPB 4K9NA 4LV6A 4EHHA 5HK9A 1DCTA 3DHNA 4CQMB 1DO0A 3I3SR 1ULZA 1D2GA 3PE6A 4YV7A 5AVSA 2NXJA 4GKKB 1Z7YA 2VYNA 1K3FA 4PZ9A 5EVCA 3ECAA 5GJBA 4FOOA 2D4AA 4PFKA 4J0FA 1BCRA 1MIOA 3LUKA 4R8KA 2ZB4A 5FJJA 1UUFA 1FNDA 2FH5B 3DVQX 5ILGA 3S81A 3KOYA 1EX1A 1QGDA 3SE0A 4EZEA 2JIRA 2R1TA 2FPPB 1UFRA 1IJFA 4J16A 1CXZA 1DEHA 4RVDA 5A4KA 5JBIA 4MIYA 3CSDA 2Y4NA 4L15A 3RFVA 5FPHA 2WIDA 3PC8A 3IQDB 1YA8A 4Y6RA 1VLMA 3WWEA 2R4TA 3UT5A 4Q4DA 5CNKA 3RIGA 5G0UA 3RUAA 2L82A 4X54A 4Z49A 1W6RA 3NWOA 2XR1A 4G0PA 4WBNF 2ZAGA 3THXA 9LDBA 1XP8A 2ZYGA 2ZAYA 1TECE 4WY2A 5D7BA 4MWOA 4XVQA 4R8LA 1Y4DE 2XH8A 3OFSA 3FCSB 2B3DA 1RAIA 2C7BA 3DT8A 4F1KA 2DEUA 2JIOA 5E4TA 5KWEA 2YWEA 3KJQA 3MAJA 4MQ4A 4DJ5X 3HDYA 3A4TA 2L17A 2CCGA 2ZYWX 2I3DA 2G76A 5AVVA 5HMMA 4M37A 1OI2A 1QS0A 2W8BB 3V34A 4UW9A 4BLPA 3R0IA 2ZXUA 3BKWA 1ABBA 4M83A 3WYEA 1VHLA 1XYGA 2ZBEA 3B1ZA 2J07A 2ZUTA 1JRLA 3FG9A 2DKNA 4I7EA 5ALSA 4PYNA 5F3RA 5KX5A 4CQMD 3PQ3A 4P7JA 2I7CA 3GOQA 5DYYA 2QZSA 1PKXA 2V7EA 3K53A 1KNQA 2RBGA 1V5GA 3H11A 1XR3A 5A7GA 4D7AA 4JODA 2I1QA 5G40A 4K9RA 1ODSA 2JANA 1M1NA 2WJVA 3AG5A 3OCCA 2HSEA 1FUKA 4UDOA 4ZO4A 3OCJA 3PR1A 2ZBPA 2FEKA 1N7IA 2CXNA 1F1JA 3PPXA 4CLEA 4L0DA 5IJ0B 5FTLA 5THXA 2W2LA 4QNNA 2HMTA 2Z3VA 4UARA 4ZCMA 1IUPA 3G8AA 1PJ2A 4YGXB 1EI9A 2O8VA 3ZC3A 1DTWB 1XBTA 3OJLA 1S2LA 1UEJA 3DO6A 4WN3A 5ALQA 5LBUA 3JYHA 1G16A 2OA0A 2QLFA 1B93A 4XQCA 4DADA 2XODA 1Z3CA 1UK6A 1F8UA 4F6RB 2BDEA 1KH3A 5BNIA 3STUA 4EYGA 4J2TA 1NXSA 1J2TA 2JH3A 4HPJB 4JXXA 3QUTA 3M6XA 3THSA 1H1LA 3HCAA 1JIKA 3JYLA 1CQXA 1DIHA 2JGNA 4MVYA 4QBFA 1N6HA 1UADA 1VCNA 5ELLA 4BFWA 1D1PA 1S01A 5I9LA 5FLYA 4B3CA 4U2FA 2YXNA 5CU7A 4J2HA 1CUFA 1DIOB 3O8BA 1QIHA 4Q7QA 4AL4A 2EJTA 3PZBA 4MWTA 4BV3A 1E1CB 4MYUA 4QIHA 4LGCA 4KOEC 4L2IA 2D5IA 2NVWA 4NS1A 4ZVRA 3QMMA 3GFGA 5F9HA 2LGJA 4KN8A 5CYPA 1T2AA 2VYFA 1EUDB 1X42A 1H93A 3L8FA 2Q4RA 3UWMA 2E2WA 2VJKA 3QA3E 3RK1A 2QW1A 1RM4A 3FWKA 3QEJA 1EVKA 2R86A 5C4GB 4C03A 1KKUA 3GJ3A 5F5XA 4BASA 5F1KA 1TUBA 1F2UA 3ZDAA 3BUSA 1OASA 4JT4A 5IZ4A 3WLMA 1U9CA 2XBUA 1E62A 4E88A 5CG2A 1OU0A 221PA 3AFOA 1GRVA 1A82A 1CDOA 2XGGA 1F0YA 3H18A 3A6PC 3IEPA 2CWWA 2OE2A 2G5PA 1MU0A 2VAVA 4L3VA 2A9QA 4MKHA 1GGNA 1YQXA 4X60A 3BGSA 4E0BA 1SKQA 2YOGA 2B99A 3C2QA 3GF4A 4TTTS 4Z3OA 3U7RA 5FWAA 1B3RA 5B2FA 1GTZA 1RWMA 3ICOA 4MHOA 3FTEA 4HADA 2GCIA 3PGVA 3NDRA 3V4SA 4CM9A 4EB0A 4TV9A 4ID3A 3LKZA 1XMXA 2QUAA 3ZLTA 3DDUA 1ZL0A 3TBFA 1QU3A 2RCYA 1C1YA 2QP9X 2IUYA 1KHHA 2FX3A 4FZJA 4CG3A 3U56A 1CUHA 3GRFA 2QM3A 3COPA 1RI1A 2WRZA 2JGDB 4BO6A 4B76A 4BPRA 2ROQA 2M6SA 2GN1A 1M3SA 5D3ZA 1R5JA 3FN4A 2QLLA 2YVQA 3ZOZA 4Q0MA 5I4IA 2QBYA 2IELA 4PICA 2OUIA 4MCAA 4FX2A 5FD8A 5ADVA 1JWAB 4UAVA 5AFSA 1DS6A 3BJIC 2ZTUA 4C87A 2OBLA 3UJ8A 1SVSA 3SC6A 4ALKA 2IEGA 1OA1A 4PY2A 1SHTX 3NIFB 4ZQEA 3DV2A 3UA3A 3ZKAA 1EVYA 3KE9A 4DPMA 1L3BA 2NACA 3EMVA 4EKEA 4HBGA 2CVOA 3TTVA 5GJWC 1RHRA 1P17A 3A6GA 3D1LA 3VR4H 5BN3B 1P1RA 3THYA 4B6OA 3B1XA 2L19A 3DVRX 3HY6A 3KOOA 3OIGA 1IJBA 1L8XA 4LMPA 2JFQA 3CZ5A 5AOAA 1MIOB 1UF9A 4X6YA 3JPYA 5IXJA 3OTGA 2XDQB 3W8DA 2VRWA 5GPBA 3AGQA 4R51A 5GP1A 4DUZB 3D2BA 3VKFA 4W9NC 1G8FA 4I46A 2MMGA 3JS5A 1G8HA 3IELA 1PS8A 3AR4A 3ELDA 5TVGA 1XDSA 3H3XA 1XCOA 3VSBA 4WZAA 3HVIA 3QEKA 1L7PA 1QOZA 1YQUA 1QP8A 2P75A 3I6IA 4YMWA 1DL5A 4GMFA 4ABTA 1UINA 5AVOA 3CSSA 1KJWA 1YZQA 1ODKA 4CV2A 5M5BA 4Z6KA 4A8JA 3QXHA 4UAUA 2OO5A 4F2HA 2PSEA 2DJ5A 3IOBA 3OPYI 4XGRA 3GRYA 3WLEA 1A3CA 2IXEA 1IJKA 1VFPA 2PZEA 3CG0A 1R9NA 4HB3A 2B9EA 1ZNQO 5CGQB 4XJXA 2BEUB 2WWGA 3IXLA 3HDGA 5K0JA 1LFDB 3VH4A 2W22A 2VJLA 3FPSA 3T38A 1FCJA 1GQ2A 2I6SA 2PAFA 2XQFA 3DZHA 3HKEA 4KIFA 4NMXB 4NOJA 4K9QA 3N2IA 4XQ9A 5C8YB 3MWDB 1JP7A 1AHIA 3E23A 1P1HA 2FF5A 2YRXA 5AOVA 3ZK7A 5JCOC 3M0EA 4F1WA 2QYTA 1S2OA 5JAQA 3SEFA 3U16A 3CLRD 1QS0B 2OG1A 5EHXA 3DMYA 4G67A 1DJMA 3KSRA 1CRZA 1JSLA 2HN9A 2WJZB 2FRVA 4GOND 4NFSA 2KBEA 4OOEA 3ONNA 5H68A 4WFQA 3F1KA 4CFZA 2H92A 3CX7A 2VC2B 2HMSA 1T24A 5HKOA 3JD3A 2C82A 3LLCA 5KTSA 1WZIA 4YXFA 1LPNA 1RQGA 3GW8A 2VNSA 3HKBA 4LNAA 3A14A 4LVCA 4X3OA 3S8MA 1KK0A 3GLGA 3BJEA 4DR2B 1JAIA 1ODTC 5IT9A 1N5IA 3OM9A 3CWQA 3FMFA 1M1NB 1ZONA 1AUQA 1ICIA 2NVBA 3M3HA 4LCJA 3QU7A 3R7NA 2VDVE 2PS1A 2PV7A 1WW2A 2X9GA 2XUOA 4QT0A 4C0QC 2ID4A 1UBUS 1TKCA 2AOXA 2XE4A 3DD1A 4U3JB 4N82A 4RJIA 2ADMA 1W75A 4UPVA 5CPBA 4QYTA 13PKA 4M4SA 5E2BA 5BT9A 2X76A 3SS7X 3D6MA 3GZNB 3QXCA 1R0RE 1L2TA 1E1RA 2ZJBA 3BJMA 1FNNA 1AA6A 1T2NA 1ZK2A 4Y2PA 3VTKA 2QN8A 3EWNA 3LAWA 1PN3A 2VHYA 3H7IA 4LTMA 1JFFB 4G9BA 5CW2A 1JQ5A 3NPMA 3ZBUA 3DDOA 5JTUA 1SZDA 3IUSA 2NYRA 4N3BA 5JSZA 2G9QA 1C9NA 4Z0TA 2F43A 2CMFA 2ZDGA 3AR8A 3Q88A 4RS3A 2VPQA 3PXDA 4Q48A 2P11A 5CG1A 4JGBA 2O50A 3E9RA 2NT4A 3KJIA 3KJHA 1UBTS 1JEJA 1LK5A 2OVFA 3VDNB 1DE0A 4WVLA 3R7WB 3SHOA 2PX5A 3MTJA 5KB3A 1E0DA 4U7WA 4PRZA 3NVKI 1IONA 1V0JA 2GTIA 5DB4A 3S7TA 3SVTA 1WP9A 2QRHA 1CF2O 1Z4JA 2BBTA 2I62A 1KMQA 3V7WA 1L4FA 2JFVA 4UQPA 3UCFA 1LJUA 2J87A 1RYEA 4YAGA 1E5LA 1GFSA 3BL8A 4GR4A 2TSYB 3NKLA 2UZ0A 4GW3A 5GM2A 3O90A 1RXUA 1EFKA 2GCPA 4GMXA 4R68A 3K15A 4DTCA 1BAPA 4Y9TA 1K6EA 2H5JA 2JGKA 3EXFA 4KEAA 2W70A 5FHQA 3HNPA 4DTIA 5CD9A 2OPBA 1XMOB 2HMYB 1L5KA 4CMEC 3KK0A 2V4ZA 3E35A 1NW4A 4CN9A 4YRFA 1YQTA 1XL1A 4ETIA 4CM3A 3TINA 2OD2A 4G1CA 1SB8A 4PF1A 3ZU3A 1SCAA 4AZVA 1ZHHA 4JYBA 3PKJA 2A58A 3GNSA 2YVAA 3GMTA 1A8QA 3IE2A 3M83A 4V39A 1NMSA 5AKJA 1EP1B 2VDLB 1KEPA 2PQ6A 1ADGA 3EISA 2O2SA 3R6TA 1PLKA 4MUAA 4ZAYA 3KKQA 1F48A 1YCFA 4R81A 1MEOA 4UD2A 3SJ7A 4EVSA 2I6GA 4XOIA 1KOLA 3GG9A 1WF3A 1JUDA 4C3ZA 2AMVA 2FQQA 4AJNA 1UP7A 4ARBA 2TMKA 2QJTA 3R9IA 1HDGO 3E9CA 3DW3X 2IU4A 1TEHA 3KG2A 2JCYA 5JHHB 3EVAA 3QE0A 3EGOA 2RH8A 1QH1A 1PGPA 4R01A 4MUEA 3QOYA 3ZHSA 4EK9A 4D41A 3K2BA 1FMCA 1G3IA 2RI6A 1WUHS 1PL0A 3OZIA 2ZYVX 5FFNA 4M1OA 2JLQA 1UMCA 4MO9A 2BGNA 3ZK8A 1JIXA 3RAEC 1LBEA 3BHJA 1Y48E 1LLCA 2R1VB 3PQ2A 4DBVO 3WK8A 2JK1A 5JVDF 4JEMA 4KG7A 2YV3A 1A7UA 3COSA 4PCVA 3L7LA 2WJAA 1XZGA 1AF4A 1KKMA 2HYDA 2RK6A 2V7BA 4OREX 3G59A 3NRJA 2WU8A 4YRJA 4ZKDA 3TECE 1ZUWA 5CFRA 3O2JA 1XHEA 2QP3A 3U1VA 3ENKA 1W76A 4MA4A 2FMHA 1PJCA 1ZJZA 3GBSA 3KQSA 3HV0A 4HAOA 5A05A 3IPRA 4Q4JA 1O54A 4FCCA 5CDGA 5I7WA 2VSYA 5MGBA 1EDOA 5BN5A 4AO8A 4IHQA 1NBIA 4ESEA 3C87A 2UV8A 1G3MA 2J8ZA 1LKZA 1N6IA 2Q1WA 2FGJA 2W71A 1LI7A 4ND4A 3VU9A 2Y66A 2QVYX 3ME5A 4XYGA 1SXHA 4TLMB 5DV9A 3C3DA 5HKKD 3LUDA 4HN4B 2DC1A 1BE8A 3BWBA 4BB5A 4N8DA 4OXKA 3TGLA 4NZZA 4QATA 4UTPA 5BNZA 3ZEIA 3R44A 3OCZA 5EPEA 4NR0A 2GESA 2ZANA 1U8FO 1FFGA 2Q4DA 4L08A 3VR6A 5IF3A 4Q4CA 5LOVA 2OP1A 4GFDA 3U9TA 4MYDA 1L4BA 4ERXA 4QVKA 2QJFA 2H2AA 3AQ4A 5AI6A 3VSEA 4B3HA 3FMOB 1TJ5A 4XB6B 2DHRA 2ZROA 3BBLA 3EVZA 4URUR 3T3EA 2ZI5A 3NHYA 1WXWA 5DYNA 2DUWA 2KLHA 2AMFA 3QBTA 3CNOA 4M99A 4M60A 5AK3A 2H2WA 5LB2A 2B6NA 2PWAA 2XTZA 1A76A 3DKKA 3L8GA 1Q0LA 4RORA 5IJAA 5JBQA 4Y2GA 4TL9A 1EXVA 5HIAA 2IHJA 3TWOA 2FWMX 3GEBA 4JEIA 5DSZA 4K9KA 3F5DA 1FS4A 2I7TA 5EINA 4INOA 4FXOA 2GPYA 4QICA 1O95A 2R8ZA 2D4HA 3VDMA 2H2IA 4GO1A 3GUHA 4G1UC 4QBHA 4R9SA 2AZDA 4C7MA 5TB5A 5J2TF 1Y8QA 3EEFA 2EGGA 1PG0A 3FKQA 1KMHB 3WHKA 3F8TA 1BRTA 1GZ6A 3JZDA 3OHSX 1KFKB 2HUPA 3LQKA 1SCUB 1DJLA 1D0IA 4IHJB 5AK0A 5DNWA 3NBAA 4M9UA 4B2IA 1NQAO 3QY0A 4MP6A 3WNBA 5JRJA 1QOQB 1USUA 4G2TA 3A04A 2P9EA 2RHLA 5TDHA 1ZL2A 1Z6ZA 3L7IA 1EMDA 1PFQA 4Q6BA 2QMUA 1V7CA 4UHJA 3EPJA 5J1SB 3U4CA 3T9EA 3NVDA 2NAFA 1ZNWA 3F7TA 3JVEA 1XLTC 1J2EA 4K9MA 1T8RA 1C8VB 3PFFA 2MR5A 4LDPA 4N3NA 3HCOA 5BRJA 1ABFA 2R6HA 4MROA 5B3LA 3HJRA 3WKEA 3ETDA 5JSZB 2HA6A 3FCOA 2VJDA 1U7TA 5BORA 1UBLS 1FFCA 4FDUA 2VWGA 1T0PA 3NHBA 3FH0A 1T4DA 2J7PA 1YAJA 2W43A 3L06A 1BOOA 4X44A 4DMLA 3UMRA 4CL2A 4DM7A 5JZBA 3LX8A 3A9VA 3AVVA 5BSEA 2OXCA 3KVVA 3N59A 3FOFC 4LFAB 2ZIVB 2A5GA 4C89A 1W25A 1IEXA 1T1EA 1QJ4A 3O8DA 4XIFA 1Y3HA 2PNJA 2BEJA 4WZBE 4MVJA 5HUQA 5EUQB 1F8XA 2Z9BA 4IEEA 3WGOA 3DWIA 2FRDA 4O4IF 4PLCA 3RC1A 1Z7WA 3B6EA 1CTQA 1LPAB 2J0UB 5ALKA 4K88A 3ZBPA 1KTIA 3QKWA 4QM6A 1CY7A 1BG6A 1T9BA 2OD7A 5E2IA 3WFZA 3AK4A 3E22A 4YAEA 3UXYA 1CUCA 2YVKA 1CUEA 2C2KA 2YMQA 1NXPA 3EG9B 1T4BA 3OF2A 4RAOA 4V0RA 3TE6A 3DBLA 3PXXA 4CKXA 4CCAA 4OJTA 4MAAA 1K86A 5KSZA 4R1OA 2ET6A 4W5QA 1JFTA 5T41A 5EL0A 3W8RA 4BVBA 4NJEA 1P81A 5BMVF 2OR3A 1TT7A 3TLYA 2EYUA 3C5EA 3GLIE 3HP7A 3OZBA 1U1CA 1E64A 2G71A 2HO5A 1NDUA 4GPIB 3W3AH 4PWZA 4JUFA 1WKCA 3E2PA 3L0DA 4FE3A 1Y5LA 1AURA 5FLXA 1UAAA 1XZCA 2O7VA 1S02A 2B82A 4LDJA 4GKJB 1YJAA 3HCPA 4GX1A 1GPH1 4YRDA 1OOEA 3DKPA 1Q7EA 4HRXA 1NUUA 3T5DA 4D6PA 3WKCA 1I7DA 2XV1A 4RK7A 5GZ1A 4ME6A 3OE1A 4TS9A 1AKNA 1W2WB 3I30X 4X24A 3SDSA 3WGUA 4CTOA 3FOEC 2A0KA 1EK0A 3AY0A 5A1JA 2BKUA 1L5HB 2JVIA 2Q41A 4K28A 4PW0A 4JAVC 1RYMA 3VV3A 3SZMA 3I37X 2PGOA 3JATA 4K3VA 4U1RA 1SAYA 3DOEA 2VAWA 2XTAA 1UZLA 1Y8RA 2OO7A 4LVOA 2NZUG 3KTAA 1P5FA 3WOVA 1UQTA 1IPEA 1N2OA 4K6FA 4XE5A 4LS3A 2QY6A 4FE7A 1SQGA 5AT1A 3SX0A 3KLBA 4HB4A 1D0VA 4WWHA 5BUSA 4C88A 2BMVA 1JSZA 3TRKA 1YVPA 3KLMX 3ROZA 4XZ3A 2XVMA 4TVOA 3JQ7A 3REOA 2HEGA 1SG0A 4ZQCB 1EVEA 3RVDA 3VZPA 1CDEA 1GOTA 1IEWA 2IIVA 2AWNA 2JHCA 2QPOA 1R0BA 3P9XA 4MO2A 5SZJA 1QBGA 4BAUA 1P3Y1 1ZJ6A 5I51A 3HBJA 1VE9A 2HGSA 1LQ2A 3H8SA 1N2EA 1R2QA 5EP4A 3M82A 1KS9A 3OKAA 4IZHA 5GONF 2NNWB 1V6AA 5IPFA 3PXCX 4WN9B 4DG8A 2XUZA 1PF7E 2OFPA 3ESAA 4LNUA 2QTNA 1I2ZA 1N3YA 2DQZA 3AJAA 4UBJA 1PGJA 4XPIA 5FFMA 3SFZA 5ADUS 3IKJA 4JNCA 3KKZA 1PT7A 3UMBA 6AT1A 3ZKWB 4QE3A 3TNYA 4F85A 1IEVA 3FVQA 1ZWLA 2WZDA 3M4XA 3ZWQA 4A23A 3WLAA 4PNEA 1S7CA 2IITA 3HDJA 1SXJE 1T91A 3NQ41 1V9LA 1JQEA 2NX2A 3PX3A 3LBFA 4HLUC 1CY6A 2BKXA 1S96A 3AESA 3D6UA 4JR1A 4OMDA 4WY8A 3ZCXA 2CDCA 1J8FA 5KVSA 1C30B 4N8EA 2Y1OA 4NCXA 4C5CA 3A4YA 4NZMA 1JHVA 4L9RA 5A3QA 4DV0B 1HX7A 4J94A 1P19A 1RZ3A 2BFFB 3NIDB 2VH5R 5JNUA 2I4TA 1JDTA 3N2YA 5T3YA 1IVYA 3FNBA 5C1IA 1RFLA 3VR3D 3DFMA 3P9QA 1MFPA 5FTWA 1ISGA 2JA1A 4BU1A 4B7AA 4UKDA 2PH1A 4H59A 3EQ6A 4RIFA 1V45E 1USVA 4CKZA 4EUFA 1OU4A 3HFJA 5KMGA 2PBLA 4MDEA 4TPKA 2C9OA 4R8RA 3PEVA 2WWHA 2E85A 3MS2A 1V8PA 1XELA 2IW1A 3KOWA 2D8AA 4IJKA 4LRWA 3R74A 2CLCX 4AI6A 3PQ5A 3OZSA 1DT3A 2DUUA 1XMQB 4PPQA 5KYGA 2XYRA 3G5LA 4U63A 1DOAA 1JB9A 1E99A 1RI2A 2ATVA 1TAQA 2HC9A 5DM60 1LUAA 1Z29A 2PDAA 5JOQA 1V8ZA 4F93B 4QYSA 1JU4A 1WDMA 5CLGA 4K6OA 1QFXA 3GXOA 2YWJA 3R9KA 2PT9A 4BCCA 4XDYA 4FSDA 4D4KA 1R16A 2QI9F 2YW2A 1K8RA 5JD3A 4Z2YA 2RGEA 5DASA 4EY4A 3K0CC 1Q22A 1JHZA 1NT4A 3LBHA 4KI7A 3V4LA 5B3KA 1M8JA 4QHSA 1T0UA 1ESMA 2A9KA 4U6QA 4CMJA 1SIWA 2X0KA 2ADOA 2JFYA 4JLMA 4TN1A 4MS1A 5FBRB 4DAOA 1IXRC 3LC2O 4EELA 5EJEA 4RPKA 5LKRA 4JXJA 4KITB 3EFOB 2WTUA 2DBYA 2VBIA 1WZNA 4XWYA 2ZJ7A 3BTOA 1S3GA 1Y1KE 2BLNA 4J76A 4N6OA 3TRHA 3PCTA 3Q5DA 3URMA 2WK1A 4HNAA 5KIAA 4JBXA 3L41A 3ZVMA 2B2NA 2C3UA 2BMDA 3IBSA 4R41A 4B74A 4KU4A 2QEQA 3D6AA 3JVUA 5JS6A 1DMRA 3GLFB 2ODPA 1LBQA 3LT5A 4NU5A 4R3NA 1OBCA 3I73A 3N0TA 1ZGCA 1NPDA 1R9GA 3A3KA 4K3UA 1MAVA 2J59A 3EY4A 4EB6B 2G5CA 1QHEA 3DBRA 1TJPB 4KJZA 4FFBB 1EP2B 4BLRA 2XBMA 1WR8A 1JDSA 4ZVOA 1J5PA 1XVIA 3F7MA 3PFCA 3TIXB 4Y0NA 3ZHQA 5DBFA 2Q9UA 4XQGA 1NVWQ 2ZVPX 2V55B 4PGMA 4N54A 3KAQA 4PQYA 4CTJA 4H77A 1TPYA 4N1AA 4QOIA 1VMEA 1HDOA 1DP4A 2QMOA 5GZ6A 3MUEA 3U17A 1C2YA 3L0PA 4KO4S 1H0SA 1UFVA 5I7OA 1VKOA 3LDHA 1XNGA 5E7IA 4AICA 4AVYA 3O3OB 5JQGF 2X2FA 2Y9MB 2ZBFA 3QLTA 1Y6FA 5K8LA 2W0SA 3UICA 4F3KA 3RS4A 1DJOA 1II0A 4BIMA 5IJZA 2OLJA 4ZRDA 4U4AA 1KH1A 2FEPA 2RB5A 4RHEA 1MORA 2QQ0A 4TTSA 3GGSA 3PHCA 2X5XA 1V1JA 4V2IA 4NCBA 5AP9A 2XTMA 5FI1B 3WGYA 1RHUA 3AV3A 1D6JA 2FPKA 3QVWA 2ODQA 2HXGA 1NI4A 1D4FA 1MQSA 1QO0D 5DLYA 4MRMB 3UHFA 4HUTA 4DC1A 4UBIA 2BGTA 1NG9A 2CF5A 1FTQA 3KR0A 3BTUA 3MWEB 4IG4A 2OSBA 5DYGA 4AZ3B 2Q9AA 5LYJB 4R1LA 4BNVA 4DJFC 4HH0A 4EY6A 1M5RA 1B8NA 2E9SA 5HKLA 2Y1XA 3DM9B 3VKGA 3WGKA 3SE7A 4HYYA 3KHKA 4MI3A 5JPDA 4AS3A 1OTHA 2WA2A 4FEGA 3SR4A 5HTOA 3AR9A 4KK3A 4J4TA 2JFUA 2MCFA 2ECFA 3OURA 4CEIA 3LNCA 3E8XA 1L5QA 4BO0A 1LF0A 1AMOA 2NTNA 4JP1A 3K71B 3ZIAA 4HEQA 4ZKEA 1VHTA 1NJSA 2DWCA 3AI3A 4I81A 1X7HA 1R0LA 4F2PA 4CIBA 1FPMA 5KU7A 1ISFA 1Z2PX 1LDEA 3GJ5A 2OGWA 1ATIA 3KTAB 3MFQA 3T95A 3VAAA 4S1TA 3ZHVA 2R79A 1E9VA 1Q1GA 1N2ZA 2H1LA 1YMVA 1N0UA 4H1UA 4MW4A 1VPTA 3CBGA 5LXTF 1IWPB 2OZLB 4JB8A 4AG5A 2V7XA 2HPVA 4FS3A 1WV1A 3JQ7B 4BNMA 4KYIB 3AVPA 3UJDA 3ZV5A 4E5YA 1QDLB 4DQVA 1YIDA 2RIRA 1NHGA 2ZRLA 5EGNA 4D9CA 4XRGA 1VIDA 3NHZA 3TLAA 3HH8A 2WY2D 5BOSB 5GVRA 4KWIA 1AQ6A 1M0WA 4NECA 3HYCA 3KPWA 4B2LA 4I4IA 3MXTA 1B8VA 1N57A 3C5VA 1PJ4A 3QFFA 4B6SA 2C4UA 1L1EA 3QI2A 3GWZA 1T6ZA 3EHDA 4XPIB 1DQSA 5FUXA 1S4MA 1FA9A 3BOSA 4JJIA 5AJWA 3K0KA 4JNKA 1GFWA 2QRJA 1G18A 3D81A 1A9OA 4LF5B 4Z4QA 3IAAA 1KXZA 4LCBA 1O6ZA 5A5EA 2J09A 4MUMA 4EGFA 2XCLA 2W2KA 3FFXA 4RL6A 2P2DA 4YXWA 4W5RA 3ST7A 1OC4A 3WIDA 4B3TB 3DAGA 2NNLD 4JYAB 2R85A 3L6DA 1WPQA 3WS7A 4YBZA 2WYIA 5CB4F 4KRYA 5BW5A 3MEQA 2H6EA 3L4BC 3IUEA 4GRDA 5KI6A 1ZZGA 4WD3A 1V1MA 2DWPA 4DSTA 4EB8A 1U7UA 1JMVA 3PD1A 4QPPA 2OORA 2A14A 1FNCA 3JQEA 2ZIAA 4UOQA 1NNEA 4O3MA 4X1IB 1WMDA 2GXSA 4OPMA 4I3HA 3VUFA 3OPMA 1I33A 1K5PA 3DUWA 3PTLA 3UHAA 1UBSB 5F35A 4DS3A 4P7FA 3DFUA 3PGMA 1CZRA 4LW8A 5L7WA 1XXHB 3BVPA 3P9YA 5AW5A 4COOA 3FZQA 3VHXB 4BGUA 3BCSA 5AQ1A 5M34A 3NS7A 2Q5LA 4YCCA 4IIGA 2IGBA 3L1KA 4TKVA 2FHSA 4DVGA 4YMSA 2X5OA 2JAWA 4WK4B 2L69A 1RW4A 1H8HA 2AWOA 2QIPA 1I36A 1PRYA 2GLUA 4JFAA 2AUTA 2G6TA 1XTBA 2IYOA 3AETB 3GFVA 1P6UA 1DINA 3F6CA 3JQ8B 4C1NA 1ULHA 2B35A 1U81A 3X44A 2PR2A 2RGNC 2BFAA 5BSHA 5IKMA 5FNVA 3N7UA 2QJWA 2QZPA 2QGNA 1NNSA 1Q3TA 2GDZA 1R4MA 1Z6XA 1XEAA 2I3GA 3WWDA 4AX8A 2BGLA 2RFLA 3L43A 3O8CA 1Z3IX 4Z4FA 1FZQA 4JLWA 2CC2A 3CIOA 3LC0A 3SS9X 1MN6A 3WXBA 1HEYA 2IEIA 3WLLA 4R71A 2ZIUB 4O6VA 2R25B 3L7CA 4QYIB 4YCJA 5G0WA 3K3PA 2P6RA 3WL6A 4LJSA 3TQHA 4HDSB 4NLLA 1FFAA 1KJJA 1CR6A 2FZ4A 3KZVA 4MWDA 4DR3B 3GN2A 3E3OA 3H0EA 3EIWA 4WKCA 3OQNA 2NO4A 1YI0A 3DBRB 3EFHA 4QOSA 4ZIRA 2VJAA 1B74A 2IEZA 3I8SA 3D59A 3PF8A 2VRCA 1PYDA 1YJXA 3FZNA 2PX4A 3L1VA 3IP9A 4PONA 1YZ3A 4U2DA 2HK8A 3V4ZA 4DPKA 4ZYYA 3E84A 3F5MA 4KZKA 5C5EA 4FMDF 5C4IA 4ZEVA 1E7WA 3QTLA 4Q12A 4F3NA 1FNSA 1XTRA 1YOBA 5BQFA 3MC1A 2W2MA 3ZHZA 5ENVA 4JC4A 5B4TA 1N33B 4MTCA 4LXHA 3O8NA 4RCZA 4TSFA 1T4GA 1L8AA 3ZWXA 4UM8B 4P38A 5K0BA 3U7GA 5ERGB 1M74A 4NFLA 3RB8A 3CO5A 2XZLA 3QGMA 4COKA 3AUJB 3SPXA 2AC7A 3B2QA 3T1TA 4RA9B 5IMBA 1BQ4A 1U8YA 1XTIA 2P0YA 2H18A 1Z0UA 3DZGA 2UYCA 3GARA 4CIAA 1ZYUA 1CUYA 4ZQFA 1E2UA 3C7DB 1UDCA 3DXXA 4OBWA 1NASA 3RS5A 4GDMA 3TQTA 2F3PA 1KC1A 4KDEA 1IEQA 2VJMA 1D1SA 1VG1A 1CUBA 1JAZA 3L9WA 3PC8C 5AHRA 1XZQA 3DOIA 1G3UA 3WLKX 1X87A 1X70A 4UNSA 5CCXA 2N47A 1AO3A 1DDIA 2XKBA 4IKEA 4LPSA 3X1KA 1VMIA 3F6BX 1WMBA 3D8UA 2BKVA 4B3IA 2NG1A 2WG0A 5K8TA 4KSCA 3P9KA 3ZGZA 1Q7RA 4N40A 4GVLA 5FWXB 4DOMA 4U9IS 2EWVA 4PQGA 2I2CA 4CV1A 2JIZD 3AM4A 2BH2A 1UPCA 3ZVNA 1TI7A 5F21A 2CDRA 3I58A 1EHYA 4OHYA 4Z0HO 2CNNA 3KDPA 2ERXA 1BMDA 3KVYA 2ZB2A 2F00A 1NMXA 4PYKA 1JEYA 5ISMA 4LGMA 1YFJA 2YY6A 1B0PA 5LIPA 4IJQA 4QGHA 2BBOA 2VCYA 1FL9A 2PZAA 1VZ3A 2YZMA 1LZLA 1C3EA 3ZYCA 2B4KA 2PRIA 3PF9A 4KO1S 3MTDA 1S1CA 2VLIA 4MUGA 4FKZA 1TF2A 1XTZA 3TOVA 4J3JA 2VDMB 4AW9A 5C81A 3Q6MA 5DFAA 1PU2A 1UIRA 2WMNB 1C41A 3F3YA 4KXMA 4LX0A 4CDGA 4EG8A 5J2UA 1NR5A 1UCFA 2GWHA 2FK8A 4Z4CA 3LGXA 2J3MA 2V5VA 4ZC8A 4E6PA 2JH8A 3LXUX 1C7IA 2HWUA 2QTZA 1RTTA 2D0OB 4JMLA 1LLUA 1QLWA 5IKPA 4OL9A 5JSYA 3OCXA 4FP9A 4YCAA 1VMKA 1K5HA 2HA0A 2V7QD 3I2KA 4B85A 1MVOA 2VIIA 3MGAA 1KI9A 4BX2A 4GSYA 1OBVA 4ZGGA 1M33A 3LP5A 3BA6A 2JIMA 3NHPA 3HS3A 4YDSA 2Z5LA 2Q7DA 2E6KA 4RVCA 2VCEA 1VE7A 1ADFA 1SQ6A 2H31A 3DVAB 5FORA 2PUTA 5FR2A 4D80A 3GEEA 1PR9A 4ZCSA 1HORA 3LK6A 3V6MA 3NONA 5LDHA 3TNJA 3OY2A 2ZSEA 3IMFA 3U3RA 1R0ZA 2HJ9A 2VUTA 2ZVQX 3B52X 2WU3A 5TPWB 3WSWA 2E5LB 1L5MA 3R3VA 2B8TA 1GG8A 1BKDR 2P9GA 5TJHA 4E4RA 2MSCB 2KPOA 4QPNA 5JWRA 4X0EA 5T4EA 5DT2A 2ATEA 3COVA 3Q3HA 4N48A 1NJGA 3WSTA 3MWJA 2AJBA 4HXGA 4KDCA 4EJ2A 3VVCA 3O9VA 1KS2A 1SUIA 2VH1A 3BIFA 2DWQA 4KNVA 3H1PA 3HN2A 1SBIA 2IHYA 4MUHA 4L78A 4UCFA 3VHQA 4TSRA 4DVJA 5LQNA 1E6MA 1GIAA 3NT5A 2BMJA 2HSDA 3BHNA 3ODPA 5JJBA 1YNSA 4GUDA 5L95A 3M6VA 2PNFA 3QWHA 3TSOA 4GQAA 4KQFA 4JC5A 4N6NA 3KT0A 5GOZA 3RYTC 3WB2A 1ZOIA 1WDKA 1ZHFA 4RW0A 2ZK7A 3QPAA 2BGIA 4G8CA 4UHBA 1RRFA 2C5SA 4YRCA 4YI3A 1P9NA 3NUZA 1FJHA 3WZMA 1KR5A 1GGMA 2Z04A 3A70A 4BB6A 4BPBA 3AFIA 1HE8B 3EGWA 1FFSA 3OT1B 4P83A 1OTYA 1RWNA 2ZJ6A 3Q6IA 4D8YA 3I1JA 3LLMA 5CDTA 5FAKA 1UXJA 4GP9A 5JJCA 2CXPA 4EG0A 2VWHA 3K6KA 4ZOLA 5LYYA 1TPZA 4NMMA 4HFRA 1E7YA 4F06A 2IYAA 2V6FA 3KEQA 2VDWA 4NKRA 2EJVA 1DQPA 1T4MA 4K26A 4YDHB 5IU6A 4OHVA 1KJIA 2DR0A 2OGUA 4IFTA 3F3KA 1KGDA 2V7GA 1SULA 3HCWA 4LDQA 1XDUA 5CITA 4OJNA 4LQDA 1FQWA 2PCLA 4YV1A 8MHTA 1A9SA 5AUPB 1I5EA 1XROA 3D3KA 5DP1A 5K0LA 3SHVA 1DKMA 1A4RA 1RPZA 2FJPA 1KDVA 4YJGA 3II6X 1OAAA 4DMUB 4YP7A 4DBLE 3GZ4A 4M8SA 4O5AA 3CUUA 3V8RA 2R9VA 4MS3B 3EMBA 1JDBB 1RLTA 4H0NA 2GRAA 4B7CA 3AUFA 2DY0A 2CXTA 1DTEA 3W0LB 5ITSA 1MTZA 3VV2A 4UNRA 3IAUA 1II9A 1A96A 3OX3A 4RENA 2Y67A 4DZTA 2HPAA 2ASEA 4FHGA 2A86A 4R4JA 3TTYA 1EGQA 1G5IA 5DGTA 1TQDA 3LSYA 3QA9A 1M0SA 4ECEA 3LV8A 3ZK9A 3W6OA 3QPDA 3N2GB 1RD4A 1RRPA 4BRSA 1B00A 1NFFA 1HETA 4I50F 1EEHA 2AR9A 2VDRB 1ZAYA 2CXOA 5F9FA 3GBPA 4TWZA 3FLBA 2DSNA 4JBHA 1SEVA 4I1IA 2GAFA 1LDMA 2B61A 1YU6A 2FXIA 2I4RA 4JYZA 2IH5A 4ZHQB 1HR0B 2Y2UA 4A0HA 1PJAA 2XWPA 3C1AA 2AEMA 3IJRA 4G36A 3PTAA 2JFBA 3B70A 2IEDA 3AXSA 4YCBA 1HE5A 4OVKA 3RYIA 3EPLA 4O2AA 5ALUA 3BIWA 3S40A 3WYCA 1TZBA 2WTNA 4B6EA 3MCZA 5ELXA 1MAUA 3MMPA 4A8JC 4K05A 5KYUA 3C74A 3FA2A 2VEDA 1VZ2A 2AN3A 4P84A 4OFZA 4BO7A 3BJRA 4FDAA 4GRAA 4YWHA 3VOTA 4OGGA 4EKIA 1GGHA 4ID9A 3HXMA 2EW2A 2CXQA 4KO3S 3AEQA 4XX0A 1N4DA 4ZOBA 5EHQA 3UENA 4EW1A 1Z0IA 1QQBA 3U1BA 1GGFA 3ZCQA 4G5XA 1EB9A 1ZIPA 5DCLA 4EHDA 2QT9A 4QBGB 3HPRA 1J24A 2XAAA 4I1SA 4FDLA 1IDOA 1NP3A 1Q74A 1DC5A 1P7CA 5JAZA 5DMXA 3HCEA 2ZJAA 3JRNA 2PSJA 3VR5H 4HZIA 5IM5A 3NCHA 2XZTA 3TUIC 1YR3A 2XMGA 1SBCA 1GITA 1SKBA 1SVLA 2Y8EA 2B83A 4TTPA 2JGRA 2RSLA 1TKBA 5I5GA 4D3SA 4GKBA 2O8FA 1MB2A 4PC1A 3HKCB 3GDHA 4IIJF 4P5EA 4CCYB 3KZNA 4BCBA 1JR3E 4EJSB 3K6SA 3D7LA 4OGWA 3M3DA 3DF7A 3RG8A 3RSLA 1UJ2A 3U7IA 5JI3E 2OC4A 5LVAA 1MKYA 1US8B 1KYTA 3JX9A 1ZD9A 3T41A 1QHNA 4BFXA 3PRJA 3OEHD 4A2PA 2EIXA 1GD1O 2V7WA 1TOAA 5CA1F 4MR8A 2ZUFA 2C3YA 3HBNA 4GNKA 1YSCA 3D7KA 4K8RB 1KYXA 3S2YA 4IDNA 5DHAA 3UO8B 1V4BA 3X1JA 2QTWB 3OLVA 3RANA 5FF9A 1H85A 2A5YB 2AHOA 2PQMA 4KV9A 2REXB 3I4FA 3RRMA 4EEXA 5BV0A 1EGMB 4HH4A 1QZZA 2QXYA 2XIQA 3RVOA 1Q16A 2P7HA 1S0UA 2SCUB 3S1AA 4YX9A 5LLDA 4NG5A 3I34X 2QZ9A 3I9LA 3G9UA 3TFOA 1ZN7A 2HM7A 1NXXA 1UDWA 2HIGA 2Y77A 4NBNA 1E3QA 3T7IA 1E9RA 3GNTA 4PZPA 4RKWA 2VZ9A 4G8BA 1FJXA 1R8SA 2CLFB 4FKBA 4EYKA 1JXOA 1VJTA 4MW9A 3FNIA 4F96A 3WBJA 4GUAA 2XF8A 3LXXA 2DFNA 4MEJA 1ZOPA 2HIMA 2XQIA 3DO5A 3IBGA 2WJGA 4OQFA 3ABIA 4OMCA 4U7GA 1VKRA 3C6MA 4D98A 5J47A 1ZM7A 1E6LA 3U7HB 2YXLA 1VLQA 1QVZA 2HX1A 2VN8A 3IULA 5F7ZA 4GMDA 3GMSA 3I1FA 4UJ5A 1RXWA 1N2CA 1ONNA 4WINA 3PGXA 5EFOA 2Y0CA 4ZAWA 3PTZA 1UFKA 2FEWB 3NFYA 1QB8A 3RS9A 3GLHA 1Z75A 5F52A 3WJ1A 4C7JA 4EVQA 5CLIA 2OWEA 1GL9B 4W5NA 1C2TA 5LD2B 5ALGA 2ESRA 3HK2A 2R44A 1PT9A 1NMEA 4G4IA 1CUAA 4GM4A 3WWYA 1RE1A 1OFIA 1Y1RA 1WCIB 3BX1A 3JW8A 4L02A 3RVLA 3FMVA 2QQFA 5EJFA 3U39A 2LIPA 1ZKDA 3EBPA 3T7TA 3WWCA 1TTQB 1AQIA 1QAMA 3ZEAA 1QRUA 3GZJA 4OMUA 2BJWA 3LCUA 1JILA 5DP2A 1DRKA 4W4TA 3TTXA 3E82A 3EZ6A 2FB9A 3MJHA 2KWIA 4U7PB 3M6UA 2Q5HA 1V9SA 3OZVA 4R0VA 4BKQA 4UM9D 3AYXB 1WHTB 3BQNB 1F9AA 1EKXA 2JG3A 1DARA 2BOVA 4OGFA 1XEWX 1WY7A 4A4DA 1I80A 2A5JA 4M46A 3GFPA 4OJQA 4Q21A 4S12A 2V6IA 4DIOA 1V47A 2HQBA 4P33A 5JO9A 1OH5A 1GSAA 4C7VA 2HZBA 1C7EA 2PD3A 2GZHA 1YV9A 1H6BA 1NJ6A 4I19A 4K1XA 4M7RA 3JWGA 4NJMA 4UTVA 4B3SB 4FPXA 4HUQA 2AZTA 2YH2A 2ZJZA 1XAIA 3CTMA 5HIMA 2OOSA 4LDZA 3HYNA 2P90A 3H1TA 1Z47A 4EHJA 1BJRE 2WWIA 2AJCA 3MWKA 1F4LA 3CQ9A 1Y1LA 1RRGA 1RFGE 3LLSA 1J25A 4GXNA 4RVHA 3SBDA 1RLUA 1WSAA 2H54A 3OVMA 1YOVB 1RS0A 1WL8A 4E1VA 3IVXA 3GMIA 1YHNA 2VJYA 3IEKA 3TH5A 2WD9A 5K2OA 2PE5A 1ZUD1 2XT9A 1AO0A 3QFTA 1GP2A 1JYSA 1IPHA 1P4RA 2G36A 1V48A 2PX0A 3QP9A 4L3OA 4MARA 1P1IA 1U1IA 4DT1A 3TF5A 5EP1A 2IPAB 3CR7A 1GNSA 5YASA 1RYDA 4ZJUA 2F9LA 1MR3F 1TRHA 1NV8A 1A8SA 2BIFA 4MB2A 3ZNQA 2H0RA 3WLRA 3PJEA 2GJAA 4WNAA 4EPXA 1BTOA 3MB5A 5H3HA 3DJYA 1BD4A 1IWOA 1NBHA 2WUDA 3HJGA 4I14A 3GBVA 1FU8A 1IBKB 4O4JF 5BT8A 2PQ0A 1GFIA 3VDQA 4C6SA 5ESRA 3C3CA 1OUMA 2BZGA 2JAHA 1U28C 2XQVA 4O2AB 4DR6B 5KOYA 4IX1A 2CLOB 2YDXA 4X6XA 1KY5A 3U19A 5F64A 3A9WA 5EXPA 1YR6A 2GBPA 2XNDD 3ELWA 3KV1A 3X1MA 4LYJA 4DYVA 3JASB 4L07A 2P2ZA 3WOHA 1N5KA 1N2BA 2NO7A 3A4MA 5AVRA 1X7YA 2H4XA 2MOKA 1RM5A 3NHFA 5DBOA 1O0CA 1KMIY 4EY5A 1YR1A 1YAHA 3CURA 4JI3B 5I4CA 1G1AA 3KAJA 5E9AA 5KPDA 1YZNA 4RM2A 2O19A 2C7VA 4FFLA 4LMRA 5JJ5A 4OUDA 1OH7A 1G7TA 3DKVA 3G13A 3CF0A 2VSNA 3HBFA 3D8RA 3G2QA 1J4AA 5AKGA 2IZ0A 3W90A 2X8WA 5JHGB 2WYVA 2I9KA 2RJNA 3ASVA 3REQB 3I8OA 3NBFA 3WZ2A 1R8JA 1Y5NA 3QIAA 4FQ7A 4P81A 3P32A 3B3QA 4W7IA 1Z5GA 4QOEA 1O95C 4L9WA 3UG6A 3PHIA 1MO4A 2FWRA 3SLGA 4DARA 5IZCA 3ZVLA 4EKDA 3A26A 4FI3C 2I5PO 3IOMA 3RRBA 4HR7A 2EV9A 3HRHA 4YI5A 2G80A 4JROA 1XI2A 4ILEA 3HCFA 1Q6ZA 2AI1A 5K0EA 1LPSA 2VQDA 4F5DA 5JMTA 3D43A 4EZIA 1KOJA 2DZDA 1ZK0A 4NYIR 4WNYA 2QRQA 3EQ8A 3ZU2A 1TYEB 4HNTA 5HHTA 2RH4A 3OIWA 1EJ0A 4L7VA 2A57A 5FUVA 5AW1A 4EHAA 2PWPA 4O4LF 4MV7A 1DIRA 1NW5A 3NTUA 4ETNA 1GXSB 2ZATA 1HK7A 4LXYA 3S1AB 1QTRA 2CYCA 1U8XX 4RM3A 3CT4A 5EYPA 3W4IA 4A16A 4MKRA 2K6GA 2QUJA 1I1NA 2IYTA 3UOGA 4FMBB 2O2XA 3O8RA 4W1RA 4MQFA 4NCKA 4B47A 3SDBA 2WSIA 3C41J 4HXYA 1YKGA 2ICAA 1VDZA 3SJCA 3VYVA 2XUAA 1MOZA 4HMOA 1UEIA 1PJTA 4HNRA 4MRRA 2NYAA 3KDAA 3DD5A 4QOGA 3GA5A 1XN4A 2WFMA 1XRLA 5EJGA 2IS4A 3I5XA 5HM8A 4BRUA 3I09A 4C7BA 1YB7A 3HY3A 4YONB 5TR9A 1SVUA 1A95A 1NQXA 1T6YA 1DKRA 2VP9A 4AXBA 1W46A 2OV8A 4OXRA 5B36A 4PX9A 1JYFA 2PYDA 3CF6R 5DBHX 4ALLA 4UZFA 2C97A 3TZ6A 1FSPA 4LOJA 5EJ5A 1YZFA 2FSPA 1GAJA 1OLSA 3H84A 1HYHA 1ZU5A 1KZ4A 2FRDC 2F8SA 3S2UA 3R5SA 5KSPA 1TQ4A 1XTVA 3TQOA 1JSXA 1PNTA 3O8QB 1TAGA 4H7PA 1IXKA 2WTBA 2XX3A 2X13A 2BCEA 4P4TA 1MH1A 4BTVA 2R7KA 4D3DA 4JSTA 3K9FC 4ALMA 1D3AA 2HDHA 4C0KA 2IJGX 4ZREA 3R1IA 5C4MA 2AEEA 3MMNA 1FRVA 2BGKA 3OQMA 1UQUA 4QPJC 1VXOA 1ZJWA 1FVXA 2VJNA 2YXBA 2YWCA 3IVGA 3LL4A 3LM8A 2P62A 1B15A 2G40A 3OZFA 1X1QA 4WH0A 4WT7A 4KNYA 1ST3A 3GFTA 4MMXB 4YRLA 2P2GA 5HA5A 4ZVQA 3KJNA 4WOBA 5DM0A 4XQEA 5HBGA 2NPFA 3ZV4A 1EPUA 1ID8A 2XRZA 1R0WA 2QVCA 3NBUA 1V25A 1PWHA 2WJPA 4BEJA 1CW2B 4FB4A 1IVSA 1IULA 4GMHA 3AMVA 4OOFA 3HQ4O 1GTJ1 1GNTA 3Q3VA 3N2LA 1JHPA 1W4ZA 2PH5A 1QHHA 2Q4OA 2CJPA 5KYYA 4B0PA 4BNKA 2BYTA 5JAMA 1RWVA 4R9NA 1GNVA 1DAIA 1HYEA 2J4CA 2OBMA 2YASA 2ZT5A 3KLOA 3V8PA 2HBYA 3DV0A 5J23A 3B7WA 5D1HA 4QULA 5A7HA 1LH0A 4WI1A 1P1FA 3BDAA 4G4SP 3LPDA 5KQSA 3MLEA 4Z99A 1N9GA 1FJ2A 4B9EA 3K5PA 1CR4A 5FKJA 1VYTA 4ZVLA 1TLLA 3IVRA 3Q12A 3ANSA 3CF2A 1GKIA 4JC8A 5HKKA 4WBNA 4XOUA 1NVKA 2W4MA 3MB8A 5G2OA 4JITA 5FPYA 1WSWA 2R4QA 2D13A 2WAMA 4Q9AA 5JBNA 4KDFA 5ICCA 2C7QA 3PENA 1CU1A 1JA0A 3REGA 2GFIA 3RK4A 3JR7A 1Y7IA 4YBRA 1K8XB 1TM2A 3VPAA 2WLTA 5I48A 3SDZA 5E7MA 3CGGA 1LI5A 2WM2A 3AILA 3HO6A 4Q03A 1JB1A 1A5BB 2FPRA 4B40A 1SU7A 2HIAA 2VT2A 1X1EA 3TXAA 4DKJA 3GCWA 3DWGA 2EBUA 2YV5A 3ZQ4A 4LZZA 5CXUA 1PLLA 5H5JA 3ICEA 4DMCA 2WSYB 5H0IA 4MUKA 2GO1A 1YRLA 3FHOA 5CD1A 4M49A 2FMFA 4KO8A 5JADA 5JRZA 3EEBA 3QU2A 1SU6A 4J7UA 4FU0A 2Y1LA 3TG2A 3UJAA 3BK2A 1ZGBA 2NUTB 3TKYA 4KGDA 4DLBA 1QP7A 2JJMA 5G1OA 2NYVA 5KYVA 3HB0A 4GL2A 1U4NA 2QD2A 5JSKA 3K70C 3KPUA 4LOAA 2WD7A 2ODBA 3KP1A 4L0MA 2J3DA 1GGJA 2D5AA 4GU5A 3WQQA 1D7OA 3RSQA 2X8JA 3WQBA 3IA7A 3M9WA 1MGOA 3ETCA 4OUDB 3VPGA 2FG5A 1J07A 5LU9A 2O3UA 3A1EA 2MWMA 3E3NA 1NR7A 2Z8XA 3QXJA 2DU8A 4ZO7A 4F97A 3H5OA 4ZEMA 5IDXA 4AC9A 3BMXA 4KXXA 4M0FA 1UR5A 5KSWB 4CUJA 2NUPB 3K8QA 5INTA 3P96A 2O7QA 1GUBA 1HYBA 5DHUA 2B69A 1K2VN 4D4GA 2BELA 4RULA 2D0PB 3KQYA 3WLHA 3F6YA 1W5SA 2RKOA 3F4LA 3IL2A 1O87A 4JJEA 1YC2A 2CNWD 2UUBB 2FXVA 4MVJI 2N9UA 1BQ3A 1U6IA 4IIXA 2JNWA 4OKSA 4UC0A 1B6SA 4G0WA 2NOAA 1P2SA 1FMJA 3B6ZA 3GXBA 1YF3A 1PGQA 2WOJA 2DUMA 5IJ9B 5K3OA 3HCBA 4CE6A 2GM3A 4XW2A 4LJ5A 4NFHA 4Y98A 4KP7A 3JYPA 7REQB 1MCZA 5SZHB 4UFPA 3ZI4A 1JHYA 4PSCA 1IM5A 3PZRA 3NANA 4POOA 3HC7A 5MFZA 1GGVA 4XM1A 4CMHA 1B0UA 2NO5A 2WJ6A 2BDUA 2WNIA 4V0OA 4IW3B 4URHA 3DZCA 3QFCA 4JVOA 4HVLA 2H9YA 5BQ3A 3PQFA 4M86A 4MQFB 1JNYA 3IV9A 3G0CA 2G67A 3MBKA 3BT7A 2FSFA 4P4NA 2PRZA 2X1VA 1D09A 1U3WA 2YYYA 3IAXA 4O0MA 4S0ZA 4YP6A 3TSAA 4BO2A 3MSXA 1TMKA 4UDNA 5TQ2A 5ESDA 4IF6A 1T9CA 3VR4A 1SUBA 1W36B 5A5DA 1V8DA 3NBYC 4I1RA 1NTRA 1T36B 2MSNA 1M2EA 1ODCA 3G5MA 4Y6LA 4CQJA 3VX4A 1J20A 2B2CA 4F0JA 3G2KA 2FFRA 1OLSB 1JBEA 3B6MA 1Y8ZA 3JZIA 2Y6VA 1IN6A 2AUMA 4JLJA 4DV6B 4A6DA 1BS2A 2O2HA 4MK4A 4V0LA 5KNDD 3PHHA 4MA0A 2FMIA 2IBSA 1DZ3A 2D3WA 4E2ZA 2ZEJA 3RNLA 3DE0X 3FNHA 1SCNE 4WESA 1ZNZA 4UMDA 2DQKA 2P30A 3DP9A 3MD0A 1L1FA 4C9BA 4O2LA 1I14A 1O9HA 3V8MA 3O8OB 4YPFA 1I4OA 4IDHA 2YWHA 1BDHA 5AI4A 5G1PA 3ZJ4A 2YOHA 2ZP1A 4FR0A 1M66A 2IF2A 5KOJA 2OQRA 3E9QA 4CIVA 2FMXA 5HFJA 4W8OA 1EX7A 4KLZA 5H02A 3LGSA 4ABYA 4ACBA 2JDID 3SMVA 4E1AA 3LDFA 5A4MS 1RXVA 4RJ2A 3W6ZA 1SQ0A 3DTVA 4OHPA 2W5UA 3TLXA 2IH4A 4V1CB 2O5CA 4A91A 3BERA 1E3WA 3AGPA 4KVAA 4BVFA 2NUAB 2V7TA 3FYHA 3LZDA 2H16A 3NC4A 4LZAA 4BMYA 5HRCA 1UJMA 1EAYA 1JVSA 2PIDA 2PVCA 2ODWA 3DYVA 3JQ9C 3OWXA 2YVLA 1V4NA 1VG8A 3RSHA 4DUYB 1ZUIA 1N77A 1QKJA 1IJEA 1CS0A 1VRVA 2O4CA 2LZ0A 2VL7A 3CZPA 3NIGB 4MW6A 3U7JA 3VFDA 4UNNA 5DGDA 5JH7A 2XNHA 2HRDA 3IPCA 4NY1A 3AL0C 2RAFA 2GEUA 4HWRA 2C9CA 2Z43A 4QXQA 3U62A 4GE3A 3QNWA 3KX2A 3MMXA 1N7GA 3IURA 3UUEA 3C4JA 4EHIA 4HGQA 1GZ3A 3UJBA 5E2AA 4E94A 4ER6A 4BP3A 4C4RA 2GN8A 4RJKA 2DUJA 1TZKA 4UVGA 2BFBB 2XUFA 1ZI8A 3SC2A 1QFZA 1K88A 1YK0A 2G06A 1NQVA 1U3VA 2I80A 2P3OA 3G2PA 3I23A 5JEDA 4IJ5A 3PC7A 4GHWA 2DSTA 4JI1B 1Z4MA 5K09A 2YIVX 2QUBA 3IAM1 4I4TB 1UM8A 5JE8A 1MA0A 3BFKA 2XQJA 3OQBA 4MP3A 4DA7A 3L1HA 3GLTA 1SOAA 2A59A 1RADA 1GKLA 3JYQA 3VR3A 3CB4A 1SNYA 1M2OA 1UDRA 2V45A 3P4UA 1ZGZA 3P2MA 4AJHA 2Z4RA 1OFTA 2P9QA 5EWJB 4RF5A 1OFVA 3C70A 3PPYA 4OQQA 4ZU3A 4IH4A 2VPYA 1ZK3A 2PL3A 5EY5B 3FYTA 5IF9A 1N25A 4DQ0A 4OIFA 9ABPA 4NU8X 1TMGE 5SICE 4W1PA 1W59A 5CXSA 3CCCA 1VHWA 2KI5A 4ISBA 2OCIA 1RTKA 4Y7DA 1HQYE 1I10A 3D7RA 4KIGA 1U80A 3T5TA 5IH3A 1A4UA 3RC9A 4IH1A 4RSMA 3OH8A 1WUIS 3FVRA 5G4KB 4ZI5A 5KJ1A 2BFDA 5ENDA 2CL0X 2CUKA 1HL7A 1SC1A 3HP4A 2NU7A 1N3BA 4LFBB 3D8BA 5AM4A 4C4YA 4KMSA 2DH5A 4R1TA 3OZRA 4M36A 1U3CA 2YNMD 1Z62A 2Z2IA 2PU5A 4HDRB 1ZJYA 5DULA 1Y8AA 2X0JA 3K94A 4BAGA 1OYVA 3GLRA 1V11B 3ROFA 5K4GA 1KC3A 5K8CA 4ZHQF 2I8LA 1KY3A 1A9XB 1BX0A 4A03A 5GADl 2CVHA 3DDZX 1N78A 1Y5MA 2E4AA 3VPHA 1C7QA 3H13A 1NJ2A 3OA2A 1XHFA 5CNIA 3KYCA 1J8DA 3LCRA 1J5EB 1W581 4XM0A 1GPLA 5KOHB 5IS2A 1MW9X 2HNBA 1FXWF 2NAPA 1AY0A 3AEKB 1FDVA 3UF0A 4Z2AA 5BUZA 4LBVA 2V74B 3QV1A 2EZ4A 1K7YA 4IWXA 1M5TA 1Y42X 3C15C 3IQGX 5K3EA 3F6RA 2B20A 3RO7A 4PSVA 1XPOA 1GTG1 3BD6A 2C2BA 4UXHA 3EGDB 1P5RA 2COKA 4R54A 1T2FA 2G70A 2WJJA 1TZCA 2KE5A 3P8ZA 4S1VA 1PYOA 4UCQA 1UJBA 2J3HA 4UU0A 1G9TA 1EE2A 3NYWA 2BRUA 3SZOA 1MXHA 3Q6NA 3GD5A 3GT0A 2VNHA 1YB6A 2F3QA 1DX6A 3ZQKA 5B55A 3WMEA 3AH8A 2DR2A 1IDN1 1WIWA 4JDUA 1AS2A 1E9EA 1T8PA 4P3KA 3CG4A 3EF0A 4YMIA 4CF5A 3NC1C 1CJMA 3QKSB 2YFQA 3I61A 9MHTA 3CS3A 5AXCA 4Y2YA 4TV8B 4H4EA 2A9PA 4JGIA 5AW8A 1EFVA 1GKUB 3LF2A 4MZDA 5TGTA 1DAHA 2WHPA 2VLBA 1EG2A 4QUHA 5TQ2B 4BJ5A 1VJCA 3CF4A 1IL0A 1FLDA 4PS0A 3DFKA 5J40A 2CJFA 3ZH2A 4W63A 3UM9A 3G2IA 4IIFA 3I1YA 4PGFA 1QO0A 1EVIA 2H1IA 3E7FA 4NCNA 4QU0A 1ZPDA 1UXKA 3V1MA 4HXEB 1E61A 1BYUA 4DA8A 3RJZA 3AFMA 1DX4A 1JQ3A 3EVEA 4RE6A 5A6VA 4NG4A 3IEUA 5T8KC 1INLA 1V5FA 3TBHA 3IIJA 4RIEA 3WQRA 4QLAA 1Q7BA 4ND1A 2ZU0C 2ZB8A 4B82A 3GLFE 3EVDA 1IZYA 1OWLA 2V3WA 4WESB 1WDWB 3L7NA 5B5SA 3H2JA 1QLHA 3WTCA 5L3QA 5JVDA 3HV2A 1E9FA 1E1KA 4QFDA 3I0NA 4HMPA 4HN9A 1TIPA 2B1QA 2PG3A 1RAGA 4HEJA 4NU6A 1POXA 5EIWA 4JQSA 1NVMB 1CYEA 3TVYA 4TXHA 4UUQA 4R5HA 1Y63A 2P3LA 3DZFA 3IAFA 3A58B 5I9TA 1A9YA 1NVGA 4FZVA 3MTQA 1HDZA 1RI3A 4Q3NA 1JHDA 3WB0A 4DC0A 2GERA 4JA0A 2DBQA 2YV1A 3DE6X 5JCPA 1QV7A 3LRXA 2B4AA 3OJEA 2EWMA 4CM5A 5F1PA 4BQSA 3MT9A 1QUEA 2LD4A 3GH1A 3V46A 5HRUA 3D3WA 3PFBA 2YYAA 4ZWNA 5JR3A 2WR8A 2BGMA 3IDQA 2JCVA 3CLUC 3LUPA 3L02A 5IC5A 1E60A 1U9IA 4L28A 5LDGA 3U3JA 3VX3A 1W96A 1SJ9A 2B30A 2ZJ1A 1QAOA 4BVHA 5A2QA 2RGCA 5J4HA 2OGZA 4IMJB 3TLGA 3I64A 3BD8A 3HUEA 3N7AA 2C84A 5A4IS 4F5WA 5JIBA 4O2BB 3PUYA 3DT6A 4P3OA 2TMYA 2I2BA 3OKCA 3HJUA 2GBGA 2NQ8A 4ZYVA 3GJSA 1ZKMA 3R8XA 3IBYA 5EE0A 3DA8A 1GAEO 1R6BX 1DADA 2QP4A 3N0RA 2ZZMA 2P35A 4A73A 3VNVA 3DYIA 2QRPA 1GYRA 3LY8A 4MVJG 5JWHA 3E81A 1JDNA 2ATIA 3VZDA 1GTL1 3OIFA 4A1OA 5CVCA 1Y1PA 2VXCA 1JEEA 3D4NA 1YI8A 4X1YA 1B8OA 3D5EA 4M6WB 1Q2UA 1KJNA 2WHYA 3LYUA 1WXEA 4KREA 1CZUA 4OSEA 2P27A 3GDFA 5IEJA 1UIMA 3UY4A 1PSZA 5AOBA 4DIEA 2KSQA 3ZHCA 5HZGA 1I8TA 4J29A 2VJCA 4IJVA 2PUCA 2IK8A 5LUAA 1PFWA 4ZZ3A 2CMGA 3GJZA 3EFEA 4ETMA 3GRRA 2W6MA 5ERXA 4BC0A 4JI0B 1LSUA 4B6GA 3MTBA 4D46A 2C5AA 1BD3A 2V7UA 5HTKA 1RBYA 3ZTYA 1NVUQ 3U3OA 5J2TA 5I9NA 4KBYA 4U0KA 3OZAA 4HGYA 3MCTA 1ZVJA 2BC9A 1FIUA 4YH1A 1XTKA 2BP7B 1XA0A 3BCUA 4IJWA 2VK8A 1SA0B 3EQ7A 3LKVA 3N39C 5EIEA 2GN0A 2HQ1A 2IXBA 3UCEA 3GV0A 1R3UA 2B25A 6Q21A 3WWPA 3TW8B 5J9FA 5C46F 2IYLD 2AKAB 1QH8A 1JA1A 1FQJA 4YPVA 1W85B 2PLAA 3I12A 3RSSA 3E7PA 1VYVA 4IQ0A 1H2WA 1D8TA 3AFNA 4ARSA 3BXHA 4F9EA 1AJEA 3T7CA 2O7RA 3MZ0A 3UG7A 3PSAA 2BBWA 2ZE6A 5K3FB 1XO1A 5DLPA 2BZ1A 1E2KA 2J5BA 1TMOA 2C5FA 1DQYA 5JZSA 4KQ2A 1SBYA 4L76A 1OXBB 1N36B 3ZN2A 5KJEA 2AOVA 5EJ6A 4U6NA 2W6CX 1YQDA 4J9UE 1CY4A 3W3AA 3WP1B 1QGAA 1ZWKA 4UATA 3CLSD 3L0ZA 5FA5A 4QTYA 2CSXA 1DRUA 1IZZA 3I2FA 4KFTA 4G0YA 3FDJA 1JQKA 1HRKA 1WCWA 2QMZA 1VE3A 2OCBA 3MLAA 1CLUA 2ZS7A 2PRSA 3BH6A 4O4IA 2J9ZB 3Q8KA 2PGIA 1CJKC 4NESA 4LXXA 1PJQA 2J6CA 1G5HA 1D9ZA 2W6ID 3RAGA 1ULBA 2X8AA 1RKUA 1RMYA 3E5RA 3S29A 3ZLUA 1UBCA 1RQPA 1QYWA 1XXHE 4DBLC 3QPBA 3CEMA 4ZYLA 5KX5F 1MAWA 4L6IA 2QX4A 3IB3A 5FR1A 2IOYA 1NVEA 4AZ0A 4UUPA 3ZIUA 4HRYA 2CB0A 1K27A 3QHAA 5BMVA 5FWDA 3LFHA 2AFHB 2F1JA 4WNIA 3SFTA 4BEWA 4PV7A 5HJ5A 4GPEA 4QGGA 5ANRB 3BRWD 3V00A 4Z9YA 5LQCA 3WK7A 1ZUNB 5EMMA 5E9JA 1PZXA 4PPNA 1J7KA 5HF8A 4A1FA 4CFSA 4FZRA 4F04A 4DCTA 1Z26A 1T9GR 1PE0A 1XJWA 1E2HA 2H85A 3IB6A 1EFLA 2H2DA 1I2CA 3R6WA 5B3JA 1PL8A 5JUWA 1UMKA 3FDXA 2O57A 4MW7A 3TLJA 1W8IA 4BFLA 1ST2A 2YS6A 4HLQB 4E5UA 4QNMA 3UXEA 1T2CA 3S7ZA 1LPPA 2DLNA 2BVNA 4RLFA 4P80A 2Q2VA 1H9AA 4GX0A 2N1MA 2RKWA 3EAGA 3CC8A 3M6WA 1ZDMA 2ZDQA 2H2HA 1EVLA 2WT9A 3GGDA 5KHAA 3LHKA 3UV7A 3ZZUA 4CM4B 5DVZA 1L6RA 2YWXA 4QAQA 1W1IA 4EFNA 5L3QB 1K08A 5DBGA 3SZRA 5A03A 4NBUA 1QV6A 5TMBA 1R50A 4TN5A 2ZR7A 4XYBA 3UAZA 1IE3A 1U5CA 1ORVA 1W35A 3BCHA 4FJ0A 3R7BA 3OBIA 4JBYA 1YZUA 3INNA 4BDTA 3R7AA 1M8FA 4LC9A 2AFIB 3O7WA 4TUYA 1RQRA 1ULAA 4UVIA 2ZJ3A 4BZZA 2DUNA 3DJFA 1JHMA 2IU6A 4BVKA 3CW9A 1N0IA 2P4SA 1Y81A 3EQ9A 3AV0B 5DIFA 4G1MB 5GONA 5TF0A 4M7OA 1E4EA 1JXQA 3FBTA 1E3LA 1BNCA 1L5LA 4FHCA 3VYSB 3O4HA 1KSFX 3EMDA 4C0LA 2DERA 1X9GA 1XU9A 4MHSA 2V7QA 2O48X 4X5OA 2IDZA 1YKSA 1R6DA 2QX8A 1JH9A 3H1GA 1HSZA 3KQWA 2YDYA 1XLUA 2Q5EA 3GUUA 3TXYA 1VE5A 1Y3DE 3EIXA 5IH7A 3VXKA 2IXAA 2Q3MA 2ZETA 5IHXA 3RQIA 5L7TA 2CV0A 3M49A 4OB7A 2G63A 4QWWA 2XZOA 3BBPA 4DLVA 5JDCA 2QSUA 3CLKA 3QXGA 1BDJA 3CPEA 3ANYB 1PVOA 4AMVA 1PR6A 2QGZA 4N7RA 3PNYA 3ZXSA 3INRA 1EAMA 1JFVA 2QUHA 4TV9F 3TQFA 2O1SA 4URYR 1IUOA 1N0VC 2IYEA 4D9BA 1RLIA 3SLRA 1U0FA 3ETGA 4LXQA 1SHKA 1Z2NX 3LUGA 4GP7A 1U3GA 5AIAA 3JVDA 1BXRA 2CMKA 1SD5A 2VXYA 1TYBE 1ZC4A 2CCJA 4ZI7A 3LQ4A 1GG9A 1NU8A 1OTXA 3X2SA 4A10A 3NIBA 3EG5A 3FDZA 3HI4A 3GVHA 1IHYA 5K3BA 2OWDA 3ZCUA 2DULA 4L27A 1FZTA 4MOWA 2E5WA