1YZ3A

Structure of human pnmt complexed with cofactor product adohcy and inhibitor sk&f 64139
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
263
structure length
263
Chain Sequence
PGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phenylethanolamine N-methyltransferase
publication title Structural, mutagenic, and kinetic analysis of the binding of substrates and inhibitors of human phenylethanolamine N-methyltransferase
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2005-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1yz3A00
4MIKA 1X1CA 2PWYA 2ZIFA 3REOA 3KQYA 5K0FA 1EQAA 1WXWA 3SR4A 4ER0A 3LDUA 5IH3A 2KW5A 3LBFA 5FULA 2UYCA 3LCUA 5D1NA 3OPNA 3OE4A 2AOWA 5DXAA 5EHGA 3R24A 1UFKA 1QZZA 3DMGA 3EVDA 1L1EA 1SUIA 3OE5A 4K6MA 4P7GA 2PX5A 3BWYA 1X19A 3DP7A 5CVJA 5FA5A 2E5WA 4OA5A 1R8YA 1I9GA 5FTWA 7MHTA 1MJFA 4PCLA 2YR0A 5ICEA 3KPVA 1G8AA 3TM4A 3MTIA 5BW4A 5ICCA 3D2LA 1VE3A 3FUXA 2DULA 1M0EA 1MHTA 4GQBA 5P8WA 1FBNA 3G2PA 1G8SA 3EVBA 4QTUB 2XBMA 3HTXA 2AOVA 3PT9A 4LWOA 4OQDA 1RI4A 1R6AA 4DM3A 3G7UA 1EAMA 3O4FA 5T64A 4B17A 2ZWAA 3LKZA 8MHTA 2IDKA 4ER6A 3GDHA 1XDSA 3FRHA 1UWVA 1VL5A 1XDZA 4P7KA 2P1DA 5DTRA 1YB2A 5CD1A 2QM3A 3KQTA 1JQEA 3FPFA 2FCAA 3TR6A 5CVUA 2IH2A 4EKGA 4QVGA 2IGTA 1F38A 3C6KA 5FWDA 5HFJA 2IBSA 3TMAA 3LBYA 3QOWA 4O29A 4QQKA 5EMLA 3BWCA 3Q87B 4GOOD 4GEKA 3I9FA 4FSXA 1O9GA 2P7HA 1X1AA 4MWZA 3GCZA 3LHDA 2ZZMA 1I4WA 1NW8A 3KKZA 1Q0TA 5LQNA 3BGDA 3JWJA 2EJTA 5LQJA 4GBED 4R6WA 5E1OA 4QPPA 1ZGAA 1SG9A 4ER7A 3BXOA 2IH5A 3CJRA 3MHTA 3HA5A 2OXTA 3FZGA 5EMKA 5FA8A 3G2QA 2AOXA 3TRKA 2AOUA 3QV2A 4E2WA 2YXDA 5DSTA 4C05A 5EOVA 5EMJA 3DMHA 2ONYA 3KR1A 3HNRA 1G55A 2QY6A 4R05A 2HWKA 4XCXA 1QYRA 2IIPA 5E9WA 3FTEA 3ELUA 3NDJA 2AN5A 4YUVA 2ZTHA 5HOQA 5K0GA 4QDKA 3T7TA 2P41A 3FUWA 3GU3A 3CCFA 2HTEA 3HVHA 2Q41A 3NJRA 5DLYA 4HRAA 3KU1A 3EVGA 1N2XA 2OKCA 1VQ1A 2O06A 5EKUA 4KW7A 1V39A 3G5TA 3M70A 5FADA 5K0BA 1Q0SA 4E31A 4YUWA 2IBTA 4IV0A 1YFLA 2AVDA 3FUUA 4KIGA 5EPEA 3U81A 2I62A 4BLWA 2JJQA 3A27A 3KR9A 3KQOA 1FP2A 4PYKA 3VC2A 5KYGA 1ORHA 1VP3A 3DTNA 4HTFB 2VP3A 4PGHA 3E23A 4EQZA 2NP6A 3O7WA 4CWAA 4POOA 1TW3A 3HA3A 2JH9A 4X60A 3UZUA 2XYRA 3FYCA 3OZSA 2Z6QA 1BC5A 2JHPA 3SSOA 1SKMA 3BKWA 2FRXA 1NE2A 2UYHA 3JWIA 4CTJA 3HA7A 3NVMB 3KPUA 3LGAA 3TM5A 3EEYA 3NDIA 3DLCA 3SX0A 4DF3A 3UBTA 5GOZA 1JSXA 1RI2A 5GIOE 4R8SA 5DT2A 1P39A 4CKBA 1KYZA 3ORHA 4L7VA 4EKIA 5GWXA 1TW2A 4RTNA 2UZ4A 2PX2A 4HGYA 3E7PA 5FHQA 4E30A 5E9QA 2B25A 1YF3A 4IWNA 5LQAA 3SM3A 2HNKA 2HR1A 3EVCA 2AN3A 3HEMA 5JR3A 1KPGA 1N7JA 3DLIA 3HVKA 2GAFA 5DM1A 2AS0A 2AOTB 1XVAA 1RI3A 2P3OA 3KHKA 4PYNA 5DX1A 2G70A 3HCBA 5CM2Z 5HIKA 3KPJA 4BP3A 3UJ8A 2ADMA 3FRIA 3DOUA 3ELWA 3MAGA 3AXSA 4X61A 4PGGA 1KPIA 1VPTA 3A26A 3EVEA 4RTSA 1O54A 2VZ9A 4H0NA 1QAOA 4C04A 2BH2A 3G8AA 4WXHA 3L8DA 1VLMA 4HH4A 3KR2A 2ERCA 4XUEA 3V97A 4RTLA 3CJTA 3E8SA 5CVDA 5EIFA 3EGIA 5DTQA 3KQMA 4R8RA 4C03A 5K0JA 4ISCA 1M6EX 2VDUE 2P8JA 2YXLA 1EJ0A 3GRUA 5BP7A 10MHA 2P7IA 5GP1A 1SQGA 1KIAA 4QQNA 1WS6A 4AUKA 5K0NA 4E33A 2NXJA 2CMGA 3LDFA 3CGGA 4PCAA 4ER3A 3M33A 3JWGA 4GOLD 1FPQA 4OA8A 3P97A 3SMQA 3THRA 2PXXA 4DCMA 5BXYA 4X63A 5FQOA 1NBHA 2PT9A 5EZQA 4CTKA 5GM2A 1I1NA 2ZZKA 5EQJB 5HEKA 1NBIA 3KQWA 1NW3A 1RJGA 5DM0A 5T67A 3SGLA 5HIIA 5EEGA 2YTZA 4KDCA 4YMGA 1DUSA 2QE6A 2OB1A 4AZVA 5FHRA 4C06A 2G1PA 3PLAE 4XUDA 3LECA 2O57A 5C9ZA 4RTMA 4G56A 3HCDA 3EEOA 2OB2A 2O07A 4HC4A 3GRRA 3ELDA 2QYOA 3FUTA 3C6MA 4LWPA 3LPMA 1QAMA 4P58A 4AZSA 1O9HA 3TOSA 4DCGA 3B3GA 2XYQA 1NW5A 4DMGA 5HIMA 3T7SA 4DQ0A 4E2XA 3LKDA 4PYMA 4Z2YA 3RW9A 3IHTA 3P8ZA 4CXMA 3G8BA 1Z3CA 4GOMD 5E8RA 2GA9A 2Z6AA 5DM4A 3OZRA 3S68A 3KPWA 1PRYA 1IY9A 1L3CA 1YUBA 4FT2A 2B3TA 2B2CA 2PX8A 4GC9A 2JHAA 1G38A 1ZQ9A 3UJAA 4F84A 1L3BA 3IEIA 2VDVE 5F2NA 3AJDA 1D2CA 4Y2HA 5K05A 3UJCA 5EGSA 2UYOA 5DXJA 4A6DA 5KVAA 2BM9A 3P9CA 5KS2A 4AZTA 2FK8A 2IP2A 2EJUA 1JTEA 4HGZA 3GRYA 4M7RA 2IFTA 2Y1XA 3I64A 1L3IA 1KXZA 3PX2A 4GUAA 3UWPA 2YX1A 3E05A 1VP9A 4PYLA 1R74A 1VIDA 2XYVA 1RJEA 1JG3A 4KWCA 3OU2A 4RTKA 2ZBRA 5E2AA 2G71A 2ZVJA 5JUWA 1EG2A 2O05A 4LG1A 3BGIA 3GIWA 2JG3A 2O0LA 4YV0A 2V74B 3EGVA 4DKJA 1RI5A 3UA3A 4F85A 3GWZA 3NMUF 4HTFA 4RYLA 2OZVA 3HCAA 3EMBA 1IXKA 2PBFA 1BKYA 5DSXA 3M4XA 5K0EA 1FP1D 3LX6A 4X41A 3P2KA 4FT4A 2UYQA 3A25A 1M6YA 3CKKA 2NXEA 3B89A 3M6VA 4FR0A 4LECA 2PWPA 5D1HA 3UJ7A 3G2MA 4RTQA 3I58A 5CCBA 3AY0A 5M5BA 1JR4A 3MGGA 4M37A 3AWIA 2GH1A 4M38A 3OCJA 5FCDA 2PGXA 4PNEA 3UJDA 1VBFA 1JG2A 2PXAA 2Y1WA 3M6XA 4P7FA 4V0QA 5LSAA 1X1BA 3R3HA 3G88A 9MHTA 3P2IA 2R6ZA 3ANXA 5DX0A 1YZ3A 5DM2A 5DRTA 4EMSA 3PS9A 2PT6A 1ZHFA 3AXTA 4YMHA 4RVGA 3RIEA 4OQEA 2AN4A 5ICFA 4YUXA 3PTAA 1YZHA 2ZCJA 3EVZA 4PWYA 3ID6C 5B1SA 2EX4A 2WA1A 2WA2A 3PB3A 4ZTBA 4BLVA 3HP7A 2ZIEA 3I53A 3TKYA 5EZSA 3KQSA 5LQRA 3MCZA 3MTEA 3C0KA 4RX1A 1NW6A 2AOTA 2BR3A 4OX9Y 3TQSA 4RSRA 4DZRA 4EK9A 3EVAA 4QVKA 3NWEA 2XVMA 2XVAA 4QTTB 2K4MA 4YV1A 4KRGA 3NTVA 3B3FA 5DRYA 4C08A 1P1CA 2YUIA 1U2ZA 2BM8A 2BR4A 3B7PA 2G72A 2EFJA 3DH0A 3OU7A 3BWMA 2N47A 3EVFA 1RJDA 3P9NA 4RWZA 4PYJA 1ZG3A 3DULA 4HSGA 2PVCA 5CIYA 2R3SA 1YFJA 3BT7A 2PSSA 1KP9A 1JTFA 3A4TA 2FK7A 1HNNA 3MERA 2CKDA 2DPMA 3JWHA 2ORED 4MQ4A 2GB4A 4FSDA 5KQRA 4P7JA 4E32A 5LR6A 3ER9A 3IV6A 2HMYB 2IPXA 3FTFA 5FQNA 2PV0A 3NW9A 4PYOA 1WXXA 3WSTA 2NP7A 4BLUA 3FPJA 2JH8A 3VYWA 3R9XB 1XJ5A 3SXJA 1B42A 4ER5A 3LCVB 3G2OA 4RTRA 3FTDA 4M36A 1HMYA 4U7TB 3NWBA 2AR0A 4IV8A 2IDJA 5MHTA 2QRVB 1OR8A 3HM2A 3V8VA 1AQJA 3BUSA 2WK1A 3GRZA 4AZWA 3PFGA 5K0CA 2F8LA 2PLWA 4GF5A 3SSNA 4RTJA 4E2ZA 5C0OE 1X1DA 2B78A 2ZW9A 3A7EA 5EC8A 2EG5A 1N7IA 3GJYA 4E70A 3O31A 4DA4A 1WZNA 4EVIA 1XCJA 4BP1A 4MTLA 4CKEA 4UOEA 2ZSUA 3FPGA 1JG1A 2P3LA 2VS1A 5HZMA 3DUWA 4PINA 3KQPA 1H1DA 3C3PA 5F2KA 3Q7EA 5E1BA 2AVNA 2LD4A 2GPYA 3G5LA 1UIRA 3LCCA 5DX8A 3EPPA 4RVDA 2ONZA 5E2BA 1SVUA 2ESRA 5U4XA 2OY0A 2OYRA 1BOOA 2Z6UA 1P1BA 4QDJA 4C07A 1F3LA 3T7RA 3UJ9A 1KR5A 5BW5A 5GIPE 3FTCA 2I9KA 2G8NA 3QOXA 1JQ3A 3TLJA 4CKCA 2OO3A 3UJBA 3ELYA 1WY7A 2IH4A 1JQDA 2C7RA 1FJXA 1QAQA 1Y8CA 2NYUA 1ZKDA 4XUCA 2FPOA 1R18A 3KPYA 5FUBA 1DCTA 5ICGA 2ZZNA 3H2BA 2C7PA 2PKWA 3MCTA 3OU6A 3THSA 2VDWA 4PYQA 3DXYA 3IYLW 3M6UA 3ERCA 4PONA 5KQSA 3FPHA 2CL5A 3P71T 4RV9A 5ERGB 1NV8A 2GLUA 4KVZA 3EMDA 1AF7A 1NKVA 3DXZA 2B9EA 3SSMA 3X0DA 3KR0A 3OFKA 1KYWA 4PIMA 2CMHA 2BR5A 4C4AA 1AQIA 5LQKA 3UJ6A 3OZTA 2ZIGA 5HILA 3GO4A 2ZBPA 3M6WA 5HIJA 2PY6A 1SQFA 2H1RA 3B3JA 5GM1A 3TFWA 4R6XA 3GRVA 5CVVA 3EGEA 2GS9A 3VSEA 5EIWA 3UA4A 2ZULA 5LQUA 1L9KA 3BKXA 3HVIA 4HG2A 1EJ6A 2OPBA 2ZBQA 2AZTA 3LSTA 5K01A 1IM8A 1SUSA 2NXCA 5DTMA 3T0IA 2V7EA 3P9KA 3ER8A 2AOUB 1TPYA 2PX4A 3A7DA 5IKMA 1WG8A 5FWAA 1G60A 2PXCA 4KIFA 2H11A 1BHJA 1JG4A 3P9IA 4FGZA 3KQVA 5EKXA 1AV6A 3G89A 3ME5A 2OBFA 2YQZA 3C3YA 1XDUA 4A6EA 2HV9A 1KHHA 3CBGA 3HCCA 4RVHA 4X1OA 4Y30A 3FPEA 4YUZA 1DL5A 1R8XA 3CC8A 2H00A 1P91A 3CJQA 4FP9A 4V0RA 5T6BA 4QPNA 5K0LA 1NT2A 2ZFUA 1T43A 4OBWA 5K09A 3LDGA 3F4KA 3TKAA 4U7PB 4NECA 3KQQA 2JHCA 3PFHA 3FUVA 3TPZA 5G02A 2PJDA 3HCEA 3SVZA 3BZBA 4RVFA 5LQCA 4RTOA 4F86A 4RTPA 5E9JA 2YVLA 5E1DA 2P40A 5EG5A 5H02A 4ATNA 4PIPA 4BY9E 3MB5A 2P3QA 4WVLA 5CVEA 1ORIA 5EMMA 2A14A 3HCFA 2P35A 3CVOA 3K0BA 3P2EA 5EEHA 3BWBA 2C7QA 1QANA 1RJFA 3DMFA 3HVJA 2FYTA 3OFJA 1JSZA 1D2GA 5E8JA 4FS8A 1INLA 4IKPA 1XCLA 2BZGA 2NXNA 2I6GA 1PJZA 4OBXA 4AX8A 3PX3A 3R0QA 1G6Q1 2ZWVA 5CUQA 1RI1A 1NV9A 1EIZA 1XXLA 5EHIA 5EVJA 2C7OA 2NNWB 2CWWA 1XTPA 3GXOA 3K6RA 3DR5A 5K03A 2YXEA 5C1IA 2QRVA 1KPHA 5E1MA 3RODA 3BGVA 3R6TA 5DPMA 4GC5A 1NW7A 5CCXA 1ZGJA 3DXXA 3FYDA 2ZLBA 3I5UA 2FHPA 4JXJA 1D2HA 5F2OA 3VC1A 5GINE 1R00A 3PVCA 4MHTA 2I7CA 3GGDA 4KDRA 5K8VA 3MQ2A 3UFBA 3NVKI 4GOND 3LL7A 4FZVA 3B5IA 4YV2A 4YUYA 4E2YA 5DWQA 3GNLA 4PYIA
chains in the Genus database with same CATH superfamily
2P5SA 2XMGA 3WL5A 4FM9A 1WWKA 2H9AA 3INRA 5THQA 2Y71A 4MUKA 2O8EB 1UINA 1AQ6A 3LCUA 2UYCA 4FHDA 4BCBA 4OMUA 2Z04A 3EPRA 1XG5A 2PKXA 3BPSA 2OV8A 4KQWA 1HLPA 4RZ2A 2IPLA 4TXMA 4YP1A 5FYQA 4M9UA 4A8JB 2XRZA 1JEJA 1QM5A 4M22A 3QMMA 5EQFA 1EB9A 3SHVA 1ZI9A 1EE2A 2ISQA 1R8YA 1KSGA 1ZUHA 2JDIA 1MJFA 1YUMA 3IUEA 1G8AA 3AFOA 1E5XA 2PH7A 2YN2A 2IEAA 3HP4A 1VE3A 3MNFA 1Z9BA 4YRPA 2PEZA 3NU1A 5H4GA 2VK2A 1J0BA 1LH0A 1PSWA 4CRWB 3G2PA 1Q84A 1CLUA 3RVQA 1RWWA 2AG8A 2PGIA 3BEDA 3VQTA 4RV5A 3G7UA 1NQVA 1R5NA 3O4FA 3WGTA 3ZWYA 3F5SA 2ZWAA 1ISSA 3FBTA 2Z3VA 3QF7A 4B4DA 4BGUA 2XWQA 2Y68A 3ASZA 4FEAA 3RBZA 1XDZA 2GYYA 4FGSA 2FU5C 1JQEA 4RVUA 2FCAA 2P9GA 1FLAA 3C6KA 2XXAB 3BCRA 4TVSA 3H2YA 4RUKA 3ZI0A 4C0BA 1X7ZB 4URHA 4TQ9A 4GOOD 1Z5PA 1X1AA 1K7YA 3D4IA 2CFCA 4R98A 2BMWA 3UANA 1CZHA 1F8GA 9ABPA 4GKVA 5GJVC 3TXYA 2IPOA 4A6XA 2A4MA 4XIYA 2IUFA 3DZCA 4X91A 3HUDA 1MQSA 3I4FA 1XQWA 1QK4A 1KDOA 2D8MA 4C5AA 4RLSA 1H5UA 3DUFB 2V6FA 1E58A 5D3ZA 1VJDA 1L8LA 2I8LA 4KX3A 3BIXA 4UHBA 4ZIRB 2JI4A 4YACA 3DMHA 1UQTA 1N5OX 2GVNA 3CSUA 1L1FA 1Z6YA 4ZALA 1BWQA 4MH0R 3I34X 2EZTA 4FYPA 1HT2E 1SOWA 2BEUB 1EM8A 1SCBA 4LX8A 5F78A 4OU5A 2Y1GA 3WV4A 5FV4A 5D7BA 2W6QA 3GUHA 5LP6B 2ZYWX 2CV0A 1Q83A 1IQ0A 4YEDA 1CY0A 3CW8X 3K1AB 2P41A 4BJHB 5DLYA 4Z0PA 3LUJA 5LZ9A 3ET5A 4WX2B 4TZ6A 1HRKA 4ZAYA 1WKBA 5ED4A 4PC6A 2QUKA 2YJ5A 4D4LA 2OSBA 4LHEA 2V3CC 3VA7A 1LLQA 5FV7A 2VLBA 1K68A 3AJ9A 1GNQA 3H97A 1FQJA 1P1KA 1VI2A 3P9YA 3VMMA 3T1VA 4A0RA 3ULKA 1RIIA 3A27A 4I81A 3IILA 2JFYA 1ORHA 1VP3A 2RARA 1GILA 3V1NA 3ICVA 4W5JA 1IVSA 3L4BA 5DN9A 2XOKD 1V8DA 2BEVA 4DV5B 1AMNA 3H3FA 3QVGA 1YAHA 3C45A 1D6NA 4I8XA 2OAEA 3GZ4A 5H81A 1KFCB 1PEKE 1XAIA 5D85A 3WB2A 3JARB 1DAPA 4A0FA 4F46A 3D4NA 4CTJA 1CDDA 5AM5A 3HPQA 2VTEA 4TL9A 3TM5A 2GILA 4IMPA 3NHAA 1LLFA 5PGMA 4EYSA 1C7FA 1T5OA 2G9RA 3LI2A 5AW3A 1VZ2A 4XYEA 3UPTA 1OVMA 1JU3A 2J9YB 1QK3A 4OI2A 4U0KA 5IJ0B 5B4UA 4GKBA 2PX2A 4ITUA 3TINA 1G291 1OXTA 1L5HA 2AUTA 4MLPA 3WNVA 3B20A 2YFHA 4YYEA 1EZ4A 5L8VA 2JFQA 5IMBA 1TKRA 2LXNA 1N7JA 1BMTA 3DLIA 2JBHA 2V7WA 3A4IA 1YBFA 4BB9A 2AS0A 5GJCA 2D1SA 3TLYA 1MX9A 3OP1A 3OZWA 2D1RA 4RKQA 2O7QA 2V55B 3B38A 3CVJA 4P36A 5FO1A 4X1YB 4O1IA 3FFXA 2X9NA 3FMVA 4UDNA 4K88A 2NYVA 3NXKA 5K6AC 5I4IA 2DWOA 4KGZA 2O0HA 4B85A 4INPA 1AK1A 1W2GA 1GDDA 3NM6B 4AXBA 1ILEA 3THOA 1WTAA 2FXVA 2Y1OA 4HH4A 2VYFA 3CZMA 1KH1A 4QGAA 4R81A 5NULA 3UYKA 1C3XA 2XWPA 3VNBA 4KLNA 4DC9A 4XVQA 5BPHA 4TKUA 4TTAA 5CJPA 4R8RA 1GTVA 2HHLA 1CXZA 1FFSA 1PL0A 5AHWA 2WDZA 5EP2A 4QGHA 4B3MB 4QA9A 1XN4A 5JJLA 5LYJA 4E33A 4L07A 3LXXA 4IY1A 2WUFA 1G7SA 2REOA 3HB0A 3PC4A 1THZA 4IWYA 4US1R 3TYXA 1RP1A 3COYA 3DFFA 1SVOA 3G0GA 1W9MA 1OV6A 2A3NA 3HBAA 3KTAA 1DQSA 3M82A 3RRZA 1ECCA 5A9SA 1AH2A 1OTHA 2IZ5A 4II2A 2FA9A 5ALIA 5G53C 3K0CA 2BJHA 1PUXA 4DIFA 3BDVA 3C5WP 3CT4A 1GVHA 3VZSA 1PV4A 4P3KA 1UPCA 4RL4A 2VDOB 4PPGA 4LTMA 2CGEA 3T1QA 3OIYA 1ZGBA 1TPZA 4OY3A 4PQRA 4RTMA 1JL3A 3Q8KA 3VR2A 4DMCA 2PV7A 3H8SA 4FKBA 1HZZA 2YWHA 3GRRA 1U8EA 4TVBA 3A0RB 3UPUA 3WFIA 1SIBE 4EPWA 4PRYA 2BUCA 4ZMRA 1NW5A 3C6YA 4D9BA 1V2GA 5IPFA 2VATA 3FLMA 4DLWA 3LKVA 1Q19A 4G24A 2DT8A 3M81A 1Z0ZA 3L0YA 2UXCB 2JIBA 3RUDA 3RCBA 3GCDA 5J5VA 4X20A 4OLFA 4UUAA 5ECDA 3K0HA 4KPUA 3EOZA 3Q3VA 1OA0A 2PRKA 4L72A 2PANA 5DIFA 1NR5A 3K9BA 1VB5A 5TQ2B 3ZIAD 3CCCA 4ECAA 2B2CA 4GR9A 2YC4C 1KOGA 1G38A 3IPYA 3RVPA 2GCGA 2CNDA 5F73A 2Z9CA 1R27A 1N2GA 5EIEA 3R76A 4AWAA 3AU8A 2O0KA 1V25A 5KVAA 3T1YB 1FXWF 1YFKA 2C2HA 2IP2A 2Y1XA 3FR8A 3I9V1 4ZWNA 3E05A 4BEJA 2FSSA 4AJLA 4A1FA 1VIDA 4QRDA 5DHQA 1OXSC 1WXQA 2FZ4A 1W7AA 3EOAI 2H06A 2ZAOA 1M5RA 1OZAA 3ESCA 4UMEA 1NM5C 1HR0B 4G5FA 1Z47A 5DGHA 4Y1GA 4N9QA 5IJ9A 4QFMA 1NBME 3IIKA 3TL3A 1QKIA 2XCRB 1LA2A 2VYCA 3NMUF 3IULA 2BMVA 1DJPA 2GNOA 3FMGA 1I4EB 4O4IB 1SKQA 2JFNA 2PBFA 3ZXSA 2OHJA 4ZJZA 2Q3BA 3C3KA 3AB8A 4L9AA 4AN4A 1E2BA 1VB3A 1CP3A 3LRXA 4CV0A 2WY2D 4K6CA 1BHSA 4L78A 2AV6A 2X7HA 3M5PA 4HFNA 2O3UA 4PNPA 2GH1A 4YJHB 3UJDA 3GLRA 3DYBA 4QOEA 2VDJA 1MP0A 9MHTA 2R6ZA 2JASA 3ANXA 4DNQA 5DX0A 1HOTA 1RYNA 3DPUA 4C4PA 1ZHFA 4ESVA 4ZKDA 4OQEA 1UDXA 4XDYA 1V48A 5B1HA 2B69A 2AEFA 5HQ3B 3LGXA 4TMZA 4BQIA 3L8FA 2W2VA 4EM6A 1E7QA 2JGAA 4Y9DA 5INTA 4MUMA 1LDBA 4GZ6A 2C95A 2LTAA 1K27A 1KYXA 2RBKA 2YWEA 2EKZA 3G9ZA 1P5ZB 4WACA 2Q6KA 2HBZA 3AFHA 1GM5A 3KE9A 4WCDA 2Z30A 3NWEA 5FWNA 2NYRA 4EJSC 1US8A 3KWFA 3CNQS 5LQMA 1MGPA 2B9VA 1U5CA 1DBPA 4U1RA 1QV9A 4YCCA 5H0IA 2VZEA 1L7OA 3DH0A 1SM4A 1E3MA 2PUHA 4EPTA 1QIMA 1QYVA 1FVXA 1CJBA 2JS7A 2VYVA 1AE1A 2GJKA 4J91A 2A58A 4ZO9A 1JTFA 2WM9B 1E4EA 1ZIYA 4R0MA 1SMKA 2WAXA 1E9DA 1KBZA 4RHEA 3TNLA 3AVYA 4RF4A 2BI8A 3FGNA 4QATA 1LF5A 2AUNA 4E32A 4WK0B 2HA4A 4PBSA 4TSKA 2FWPA 4M0CA 2QQFA 5FQNA 1WXXA 5TXGA 3Q85A 1I24A 4A8PA 3CH6A 3AI3A 3FDFA 3REQA 2QTCA 4JDUA 1N8TA 1HNZB 4BEWA 3WAGA 5C4MA 5BT8A 1BQ3A 4BVBA 1XHLA 4ER5A 521PA 3G2OA 4TWZA 4Q1CA 1L4MA 1W4RA 1QE3A 2C42A 3FLBA 2CXPA 2RGXA 1FY2A 4ARIA 1DNPA 1T4CB 2MSEB 1J0DA 2QRVB 4ZYWA 1KEEA 1NTRA 1POXA 1C3VA 1YD7A 1BKDR 3C87A 3KOZA 4MRRA 1KDPA 1BXRB 1RYDA 3VFDA 5ELLA 2JI9A 4NYJR 4YT8A 1A71A 5LZ7A 1JG1A 1NJ8A 2BV3A 3D0QA 3NBQA 3W5BA 4JEMA 1FU8A 4RK6A 1BEUB 1A8SA 2GPNA 1E9SA 1NMQA 1XXHB 2BLLA 3TUZC 3UJHA 1A8UA 2ZJ8A 5KYYB 4WNAB 3SJAA 1T6YA 1P75A 2ONZA 1M5TA 2EP8A 4WKOA 2YXPX 3VAAA 1FDTA 4X7BA 2VRCD 3THRA 1I3NA 4DT1B 3FTCA 2VNSA 4C0AC 3LC7O 5ARDA 1PKEA 1Z13A 3IE2A 1XT6A 4MWOA 4BVJA 1KDYA 2VH1A 3KVVA 1U3GA 5IDQA 2Q7OE 1CUIA 4X6LA 3DXFA 1T26A 1XSEA 2N0SA 2VR1A 3QKRB 4MWBA 4E6PA 5IF9A 2QDKA 5D5QA 2KBFA 3I2GA 1FP6A 2N1BA 1TCVA 2ORYA 3FJ1A 5K51A 3DS8A 1AK2A 4FQ8A 1NDHA 1O96A 1JJVA 2FW0A 2R87A 3LK7A 5DTIA 3GCXA 5E3IA 3L8ZA 1AUOA 1ZR4A 1CUBA 2I1WA 3L5KA 2OZLA 4J4BA 3RAGA 2F8TA 3LBNA 3ZS8A 4TQGA 4ZJYA 5FLXA 2IXBA 1P1JA 1O8BA 1G3RA 1SC6A 1QWSA 1QHGA 4ARZA 2PYIA 3ADPA 5KYTA 2ZBPA 1SBCA 2WHQA 3FPCA 3B3JA 4CF4A 2I2WA 5GM1A 3M0EA 4L75A 3E82A 4R6XA 5GJBA 4AJKA 3NCTA 1JSRA 5F35A 1MQ8B 4HH1A 2IS1A 2CUTA 1VJ0A 1NHWA 4DZTA 3I42A 4WEQA 3QWFA 3AJRA 1JZTA 1Y48E 3I45A 3QUAA 1E62A 1I32A 5IANA 1V6AA 1R8JA 3P9KA 4MQFB 3EIHA 4JLNA 4X45A 1PVDA 3LM8A 3OQOA 1K06A 1GAXA 1DO0A 1S6YA 4KIFA 3CF4A 3ZCSA 3F6RA 1VPEA 4I4NA 3KQVA 4URYR 2BFOA 4BP9A 1Z8HA 5CA0F 4D8WA 2B0JA 2PRJA 3UT6A 1S8NA 4RIEA 1RD4A 3W7AA 2ECPA 4N82A 4HX2A 4A6EA 3NB0A 1ESZA 4CBVA 4RTSA 1ZH8A 1XCBA 1ZKMA 4EO4A 1ENYA 1ML4A 2F3PA 2X14A 2PMKA 3KS9A 3QI2A 3K6SA 2KPOA 3HO6A 1Z5VA 4Q3CA 3CWZA 1KVTA 3LQFA 3DC7A 4QGFA 2D13A 1EBUA 1QQBA 3N76A 3IR6A 4U7PB 2ZRJA 3AUKA 3OCUA 4XM0A 1MB3A 1WCXA 3ETLA 2GAJA 5KQGA 3QU4A 2A94A 1TECE 2AF3C 5CP8A 3TSZA 3BZBA 1COWA 2AW3A 4KRYA 4NPHA 2AI1A 4M99A 5FORA 3T34A 4EPXA 1IHYA 4F86A 1SULA 4PG7A 2WVHA 1P4RA 2GRUA 2Z5FA 5EG5A 3GAAA 1VC2A 1T9AA 4RSHA 2PZFA 4LJAA 2E7ZA 3SPXA 2DVMA 3MYYA 3NEJA 5JSFA 5EKDA 2QBYB 1NVEA 1ESNA 2QXTA 2OXFA 3OOHA 4FC6A 5EEHA 4BO3A 4YJGB 3AEQA 3MUOA 4IS2A 1I10A 1VIYA 1YGPA 2NO9A 4FZRA 3TQTA 1KC1A 2VK4A 1TCUA 3U4IA 5J23A 1JGTA 3D7RA 2DWUA 3JWPA 3R9XA 5TQ0A 4L4ZA 3HUTA 3VAYA 1D4OA 2X40A 2ZE6A 1K7EB 1UFQA 1HNXB 3ML1A 1GG9A 3NVDA 4BV9A 4EF6A 1CW2B 3K6RA 4WXPA 1KMCA 1TM5E 2B4AA 2DKNA 3C97A 1AMUA 3UAVA 3EPJA 4JH0A 1A1VA 1RDFA 4G0QA 1GV1A 3ND7A 4G63A 3HMKA 5DPMA 4HCJA 5CCXA 1SBYA 2MR6A 3EC1A 1K6JA 2QRZA 1U8CB 4BZXA 4OK3A 3TF5A 3KWJA 5CFMA 3O2NA 4MHTA 1QRDA 4G1CA 3O2SB 3VNSA 5L3VA 2GN9A 4EGCB 4G5RA 1YDWA 4L28A 3IUPA 4J0JA 4PLWA 2AD1A 4ZVSA 3U62A 1RQRA 1SCDA 3F4LA 4YV2A 4ER3A 1VPWA 2JGDB 4FX5A 1Q74A 4WNIA 4MIKA 3S1AA 1JFSA 1HX7A 3MT0A 1USGA 3OZUA 2ZVQX 4IYJA 4ER0A 4NOKA 3LDUA 1QVVA 4YB8A 1SJ9A 3BTSA 1B26A 2IYWA 1OKKA 3DEHA 3IQEA 1EHCA 1QX4A 1WF3A 1Y3FE 4D45A 3LVRE 4BMDA 1MEEA 4MIEA 5CNJA 1G19A 1FFHA 3JATA 2I3ZA 4P7GA 4QD3A 4BRZA 4YAIA 5AI8A 1ZM2A 2OHHA 1BNCA 2HA2A 2MSWA 2XDWA 4OA5A 4WBSA 3LHIA 4K87A 2YR0A 2FMTA 3TM4A 3CHYA 3QX9A 5C4GB 4EA8A 4HNTA 5AM0A 5ITZB 2NM0A 2PS9A 2CBXA 1P3DA 2VNAA 1E7MA 3BE5A 2NUPB 4D97A 2A0UA 2BRUC 5DEIA 1GAEO 1CF2O 1TC1A 1C4OA 1GV0A 1R6AA 2C5GA 2O6HA 2FF5A 2VHZA 3P9PA 5D3KA 1MRSA 1Q15A 2C92A 1JUDA 1ZESA 3JW8A 4G5GA 4GAEA 3RRFA 1HURA 5CNMA 6LDHA 5CMLA 1PX2A 2DFPA 3AT1A 3ILHA 3K9NA 2CNBA 1V95A 2FN8A 2RK3A 3JRNA 4FKZA 5F1PA 3QKIA 2IH2A 2A4KA 3CZAA 5BV1A 3L5OA 3TMAA 5FTMA 3EC2A 2J7PD 1OWLA 5C8DA 2QXYA 4RANA 1N6OA 3C70A 1KA9H 3AJ8A 1RAHA 4LJKA 4MEAA 5EMLA 5FUMA 3D6AA 3DBOB 5GONF 2CXHA 4Q7JB 4IHJF 2HEGA 1T1RA 1ITZA 2F1HA 1IY2A 3LG2A 3L77A 4GYKA 4AMYA 5LQJA 2NTYC 4FGKA 2XNKA 1I5RA 3S2SA 3TRDA 4IMIB 2CFIA 3U4HA 3RYCA 3IAXA 5U9CA 1Z3IX 2DERA 3G2QA 3IHKA 4MI3A 3SLGA 5KTPA 2JLUA 4CMAA 5A1TA 1FNMA 3TOZA 2OC4A 5EOVA 1MB2A 4ZGBA 1UC5B 2OD2A 4JJAA 1B0PA 4KSYA 1T35A 3TAXA 4L76A 1VHDA 1OFUA 2G82A 3MMPA 1X39A 1D07A 1RXIA 2AJLI 2VBIA 1SPXA 5TIIA 4MJ3A 3QM1A 1AG9A 1OFTA 2ZUBA 4JKIA 3T7TA 4LJ8A 2G28A 1SBHA 3W2EA 1DO8A 2MSKA 4KYTA 4Q7MB 2RC6A 1B43A 2OA0A 4QOSA 1QGED 3RVOA 2YC2C 3Q15C 5K2MA 2X86A 4HT3B 3B82A 5DSZA 4Q4AB 1C29B 2AMVA 4NBUA 1Q0SA 1SWWA 4EVRA 3AR6A 4QG3A 4CMBA 5EPEA 1H85A 4KIGA 3SZMA 1QHIA 1U3FA 1L8QA 1U7UA 3E53A 4FOSA 1K7FB 2M6KA 1OZFA 1N1MA 4IL5A 4N0DA 2V6MA 1F7VA 4QFBA 4ZOAA 3E9RA 1ZWLA 3PE6A 3QE4A 3FYCA 2IYTA 4RF2A 2E4AA 4UNRA 1T3HA 3SSOA 2SHKA 2FRXA 3AUYA 1A5AB 4KDFA 4QT0A 3T95A 3K0AB 2ORIA 4AFNA 4PAOA 4ENVA 2G6TA 3SX0A 1N32B 2ZDQA 4L73A 1WOYA 3C15C 4OOEA 1P5JA 4M8LA 4Q3AA 2QM8A 4I1PA 5JMPA 4YPOA 1EHIA 4HGPA 1UKYA 9LDBA 1P39A 4NDZA 1L5NA 4YP5A 3V8NA 1D2EA 4ACBA 4IXWA 3TD2A 3MS7A 2MYPA 2B25A 2NU7B 4MQMA 4UOQA 5EZYB 1XN1A 5JRDS 2WIKA 4O4LB 4M87A 4MQ5A 3VR3A 4BNTA 4OQMA 4LYDA 4DARA 3VZCA 5HYVA 1A27A 1GPMA 2DLDA 2EOAA 3RKSA 4KR0A 2P3OA 4WINA 3MJVA 3UATA 1A5ZA 1AS0A 5HIKA 3KPJA 4Y2PA 1B3BA 3OOSA 4D3FA 2VF4X 5CT8A 1S3GA 2NVWA 3R23A 1E8DA 4PGGA 5IVPA 2AQKA 1J25A 4CCWA 1WXGA 4G37A 3BTUA 4PFKA 2K7FA 1CEQA 1P4HA 4QOGA 4Y6LA 3HGMA 4ZO4A 5JLJA 4HVAA 3RIMA 1R3DA 1MW8X 3NBAA 4G41A 3QJYA 3V97A 3OQPA 2O8EA 5EIFA 3VNAA 5DNCA 4RMGA 5I7UA 5LFAA 2HXGA 2BT4A 3GXBA 4L5JA 4WFKA 4A8JA 5ERXA 2CVZA 4MI1A 1NDUA 4P3XA 4AUKA 2Z58A 3P26A 4B79A 3I6ZA 4CNBA 1C8KA 4BFTA 5ECGC 2P2GA 3IT3A 2JC3A 4FIZA 4OA8A 2G0AA 1AO3A 1HORA 1RC0A 2PO5A 3DOEA 4LXTA 4Y2QA 5CXXA 5DBIA 5EUBA 2GN6A 4P5DA 1ZRHA 1U0OC 4JI2B 2HJWA 2Q1TA 5EQJB 2CYAA 3DOHA 4EYOA 3B51X 3KFXA 1V41E 3IE0A 2IOFA 3WDSA 3P20A 3V4OA 4KFSA 2VT7A 2C97A 3ONFA 1DC7A 1YH3A 4NHOA 1MJHA 2NPIA 4HXFB 3QXSA 5HDBB 2FPSA 2DH6A 3PLAE 1OTYA 1XPRA 2II6A 3LECA 2C0QA 1AKEA 4FDUA 3O8RA 3GFBA 4GX1A 4JCCA 3H9UA 2IHKA 1OI3A 5SICE 3ELDA 4YY3B 4GR5A 1DKUA 1Z39A 3VKVA 2LRHA 3W6OA 2XXAA 3BTOA 3E7WA 1PYDA 4MW1A 5GGYA 5KTNA 2LPMA 2XYQA 1X7ZA 5ESXA 4EO7A 4NV3A 3T7SA 4QUJA 1J2TA 2V4UA 3INGA 3KUDA 4GHWA 4BZZA 3GDWA 3WKBA 1HE4A 3OOJA 4Z2YA 1N57A 3ZDFA 2IHNA 1EUDB 2V45A 3RRYA 3CG4A 2H1IA 1G0OA 3GUVA 1OH7A 2P11A 1OBOA 3IT1A 5ADHA 3BX1A 1EFRA 3DUFA 2E37A 2B7BA 2VL7A 5TQVA 1ODFA 3N2GB 4F4FA 3C85A 4ZIRA 3EY4A 2NADA 5BOSB 2VSOA 4LQDA 4Z86A 1QPGA 2VDVE 4YMVA 3OETA 2X6QA 2BEUA 4G1MB 1HDOA 2P90A 2ZYAA 1J00A 5AKEA 4AZ0B 2NV0A 2PBZA 1FNDA 1H6CA 3FY4A 5LP6A 4O2BF 3B1KA 3TZKA 3K1AA 5JPIA 3ZIUA 1VP9A 5ALYA 1R74A 3ZVRA 5LBTA 4Z2AA 2JI6A 1Q0LA 1P2BA 1GPYA 1PCXA 2R7LA 3ICOA 3Q98A 4MVCA 4MRNA 1OILA 1Z5UA 4DW8A 5AKKA 1KAEA 5L45A 2DQ4A 5I9NA 1U7XA 5IS2A 2X22A 2YH2A 1PGJA 2PMEA 4YYZA 2CCKA 1IJBA 1JDNA 2DTEA 2JEZA 4JVNA 2IYUA 3HC7A 3HCAA 1KQGA 3GWGA 3UWMA 3CIOA 4WY8A 1O95C 3H7AA 1FP1D 3O1JC 4H27A 4OXXA 3VSAA 4OKNA 4DSNA 1XYYA 5GZ1A 1M6YA 1W8DA 4NBRA 4QNRA 3WQBA 1MV5A 3IKJA 3JARA 2D8AA 3PCRB 4IQ0A 1CUEA 2PRZA 1LU9A 2PZMA 4X1IB 3P2OA 3FSEA 2YN4A 3BAZA 3A05A 4CMKA 1U2DC 3VJMA 1Y5LA 3ZU6A 2WI8A 3MFYA 4CV1A 2XF2A 1M73E 4G0PA 5AHKA 1K8ZB 1O8CA 5AIAA 5G1NA 3LYAA 4YRJA 4AN0A 1KEZA 3ABQB 4ALIA 5IJ0A 1LWNA 2VYNA 4J1SA 3I0NA 1CR6A 1GL9B 2JNWA 3IC5A 3OLXA 3EZNA 3X2FA 3ID6C 3ED5A 1D2MA 2HA0A 2PU5A 2QHXA 2ZRCA 3CNBA 3DE2X 4TLLB 4BLVA 1H4QA 4I55F 2ZYUX 5C51B 3KQSA 1J5XA 4KXNA 4DAEA 1T29A 1J5PA 3C0KA 2H2IA 3NAMA 3SX2A 2RGYA 1RMYA 4TLCA 1NBMD 2CKMA 1T0BA 2PM8A 2QRQA 2Z0MA 3U17A 3DFIA 1D8AA 1VKOA 4X1YA 4NBTA 3RJTA 4KITB 5AVTA 2PR2A 2XVMA 5FYDA 1DBQA 2K4MA 5IKXA 1YASA 3IAAA 5CK5A 1CLEA 5DRYA 2FUNB 4O59O 3UKOA 1OJLA 1N3BA 4LE2A 5JLAA 3GMTA 4BXOB 3UT5B 1Z0SA 4GW3A 4MUFA 1YU9A 3JVEA 4HEJA 2J59A 2WM3A 5LCXA 4MV7A 1YR1A 1ZD2P 1DIAA 2N47A 2NZ8A 3OQ6A 1IZ7A 5JD3A 5AM1A 3TNJA 4E5PA 2Q1XA 1FS6A 1OLXB 3R75A 4TWJA 2FW7A 2VF5X 4YCBA 3FSRA 3GA7A 1QDEA 1Z22A 5CX1B 3U3MA 4CKZA 1R4AA 4R51A 2V4MA 1WXEA 2Z95A 2R1VB 3TIIA 3ZDRA 4YNBA 1FFXB 2IVZA 1J24A 3P94A 3EG5A 3NW9A 4WI1A 3X1WA 5JCPA 5FFFA 3DT9A 4G8JA 2ZIZA 4PFQA 4YRNA 4KE6A 1I4DD 3M9XA 4RKWA 3CRRA 4UDOA 3QF4B 4GRIA 4FCVA 1W2HA 3RS9A 3AOEA 4OM8A 2CF6A 4JSRA 4X93A 3ZBUA 3LP8A 3L7NA 1HMYA 4MZXA 4Y3UA 3LUKA 1FRFS 1QH0A 1ZISA 2D1FA 3W0LB 1G16A 3TNFA 3AR9A 2OAQ1 2F8LA 3NV7A 2FZWA 3L7CA 2B78A 2O2XA 4HWTA 5E3JA 3PGA1 5EJMA 1SZJG 3UCFA 2L17A 3DEZA 1UOPA 1UQRA 2CXUA 4RZIA 3HM9A 2PE5A 5KU7A 1IZ9A 1IBLB 4YDSA 2ZSFA 4YBZA 5J59A 1N36B 3IP6A 1YKGA 5K6RA 2LKDA 4Q1AA 3TH5A 4HRVA 4DUZB 2H4XA 2RAPA 3CRQA 5C32A 1NR1A 2CL0X 1A4IA 2VJKA 1J22A 1MRZA 2YZKA 1M2GA 3IXLA 2I80A 2Y2UA 1WUYA 1FVHA 4LNAA 3AHDA 1EB8A 1KNXA 2YQ5A 4LEIA 1TZCA 2FMUA 5FJJA 2EGUA 2V8OA 5TQ2A 1KR5A 2JD2A 2AFIB 1FTWA 2GTIA 4MW6A 2G8NA 2RCYA 1E89A 5M29A 3OZGA 3QLVC 3R3VA 5BWMA 1Z6GA 4D4GA 4G01B 1Y9EA 2A1TS 4D6YA 1VDZA 2ET6A 1XZAA 2VSXA 5FNZA 3AV0B 2PKWA 5DOZA 1MVOA 4TLMB 3Q3JB 4RKFA 1GPKA 4BV8A 4M86A 1KI3A 5IK2D 1YR3A 2QS9A 5JIBA 2B9EA 3C8ZA 4CJXA 5FX2A 5F3WB 1RC1A 1XMXA 3B6KA 3OJCA 3VKHA 2QJRA 3R5FA 1GSIA 2HUNA 3HYSA 2B7CA 3WR5A 4DILA 4O4IA 1AXRA 5I5EA 3PEEA 4GP6A 4FB4A 1A5TA 5HILA 5BURA 1R0BA 1QGZA 4IEEA 2FWNA 3E9MA 1S9HA 2Q29A 2ZI3A 3N74A 4JLUA 3DAFA 4N5IX 2FWIA 1F4VA 3GP8A 1HZJA 1IN7A 3UB2A 2QSZA 1VGQA 4K6OA 4RKYA 2GKGA 1RZ3A 1L9KA 2I3AA 1G20E 3E2IA 1VLHA 4YJHA 2QW0X 3B13B 1D4ZA 5DTMA 2H4JA 3GRFA 4PX9A 4DLUA 2WUWE 3GEDA 1W8IA 1PLLA 2F9FA 3EY9A 4GGMX 5KTTA 3HVRA 4FW8A 4P6VF 1K66A 4CV3A 4DJTA 3G3EA 4G2NA 4NLLA 2PRSA 1KVSA 2RHLA 2H3EA 4AKSA 1CF4A 5A02A 1NQOA 5HQ3A 5JC8A 4KXMA 1A8HA 1PNTA 3A1TA 3GEIA 1TTQB 4IGAA 4NXNB 2VDNB 3ZIDA 2J5KA 2ZDHA 4FX2A 3PNOA 2H00A 4FBMA 1V8PA 2WE7A 5D87A 1PHPA 1ZSNA 2G88A 2QRKA 3R4VA 3KKLA 1B23P 3FUCA 3PPXA 1GGKA 5FL7A 4P3OA 3PF9A 2R2AA 1RM4A 4RABA 4BPRA 1W19A 1ZRSA 2WT8A 3DBHB 3TJRA 5JNWA 3GROA 2JH3A 2UU9B 3E9EA 2O0MA 4LOKA 5WRFA 3W9UA 2Y76A 4ASUD 3HDYA 5KDOA 3N75A 2C98A 4RD1A 4MRVA 5AVXA 1UDRA 1MPTA 2GHQA 1QO0A 3CNEA 4LXGA 2Q5HA 3AUTA 2RHDA 4J4HA 3TUJC 4JLBA 4L95C 1PFVA 2IY8A 3AKDA 4KGXA 1LNSA 3M2TA 3D6HA 4FI3F 1ODIA 3A6PC 3IAHA 1F7UA 1N5IA 2HCJB 3EHEA 2GRAA 1KORA 3NTLA 2AGVA 3AUSA 4L5BA 4B87A 7ABPA 4X94A 1UZMA 3IB3A 1KY5A 2P2CA 2QJTA 4EJSB 1XVLA 4NZYA 1IXSB 5EVJA 3GLFB 5F3RA 1FNSA 3ANSA 3FCCA 4Y18A 2I91A 2BCJQ 1YI1A 1DPFA 2QWXA 3E9YA 3P96A 3OSZA 2P75A 3KT3A 1BXKA 1T4CA 4IIGA 2FN9A 4FD3A 2QRVA 3LC0A 2H3HA 3VR6H 5AVVA 4RDCA 2QD3A 2B2NA 1NQXA 4BVLA 1XMJA 1P0PA 2HO5A 4GS5A 4DM4A 5CA0B 3CNOA 1N3IA 3WKAA 1BXRA 3T5AA 3LKBA 2J7KA 3QNWA 4YJ3F 4J8PA 3IO5A 3LYLA 2LE0A 1VKJA 1I33A 3T1NA 3WLJA 5DLQC 1J9ZA 4NCHA 3C4VA 4Q1FA 1SVLA 2ZUDA 4TL6A 1AHIA 1SNYA 3D1VA 2Z5VA 4D82A 4HUTA 2UYGA 3N6XA 5JCXA 1G5IA 5CPFA 1WXWA 1XXHA 2WP0A 3QPDA 4DOMA 2JZCA 3K1YA 4EHAA 1TCCA 5DNYB 5KYYA 1QXSA 4WNAA 1JE0A 1RRGA 3WRVA 4BFYA 1NSYA 2FMFA 1E3IA 1IWBB 2YVAA 1ULHA 2YCLA 1IEVA 1S2DA 1ZCJA 2XB4A 3UFXB 5CT9A 1X2BA 3LT5A 3F8WA 1SWVA 3CEPB 3L7DA 5IC5A 3WKDA 4D3ZA 3DW1X 4FN5A 4DMRA 4DT1A 5ELMA 4HDOB 4KNYA 3AZPA 4PCLA 2XHZA 1PWEA 1MVNA 1UL1X 3KLNA 4G07A 3V1UA 1QP0A 1O03A 1TIBA 4XASA 2GESA 2JL1A 4YLEA 4B2LA 1M0EA 1RYMA 2X8LA 3ZV6A 2GF0A 1N2BA 4LJSA 4OBEA 3F5QA 4EF4A 3OZBA 5JZVA 3QKRA 5DU2A 1WUKS 4DQVA 1EAMA 3WBJA 2G1JA 3ECSA 3C3WA 5DBFA 1ORWA 3HS3A 4M55A 1N0IA 5AP9A 3V8RA 5IHXA 4R1UA 3FHJA 4FXOA 2X0FA 3CZ4A 4GZMA 1Y0BA 3ZIAA 5AIBA 5L4SA 4NV1A 1V4VA 5D51S 3RFCA 1KP2A 2RHHA 2A0WA 1D4AA 4M2LA 2VJPA 3QOWA 4K2HA 4O29A 4LF4B 2RB4A 1O6CA 2DBYA 1W9HA 1J2RA 4JX8A 3TI9A 3AHJA 3RFTA 3EQ8A 3GFQA 5ALQA 5BRAA 3Q8LA 4ETIA 3VR1A 1A9OA 1JZSA 1PNOA 4N0EA 4XR9A 3JWJA 2BM1A 5GVRA 4F5EA 4XXHA 1QZ3A 3AYXB 2XMQA 5TGDA 2IF2A 3OCXA 4G5QA 1HTTA 4MQFA 3R40A 1LGYA 2I1QA 5CDGA 2BKXA 2H9IA 2ZUVA 1NFQA 4OQXA 3V2IA 1Y1SA 3LUPA 3QKSB 4QASA 4XSHA 2RI0A 1JR3A 4EW3A 4XCXA 1I2ZA 5EXDA 5AW5A 4HB4A 3JQRA 2W22A 3N3AC 3OJLA 2GAOA 2IOYA 2WB4A 3MXTA 4GI2A 3NHWA 3ZOZA 2BGJA 1B2LA 1U99A 3I3OA 1XRJA 3LRPA 1ZK1A 2ZJ5A 3R8XA 5TEVA 2GBLA 1CUXA 2EBHX 1UKBA 2GXQA 4AO8A 1DOHA 1XWIA 1E79A 3L8MA 1NPYA 4HNUA 1Q57A 2F1KA 1YTUA 2G9UA 4P2BA 1E9EA 4Y9SA 3AZQA 4QIHA 1HETA 5AXDA 4BOYA 2EX0A 3CVVA 3KWLA 1WNTA 1CT9A 2CNKA 1CETA 2ECOA 1RM3A 5T3UA 1BWSA 3I0MA 1PL8A 3AM4A 4DLKA 2AL7A 1T5IA 4WUTA 3K3PA 4F4DA 2AG0A 1LVUA 1PUIA 1U7HA 4PLZA 3BKWA 2GZHA 3IEVA 4YJGA 4QTXA 3KPUA 1DAHA 4C89A 3OY7A 1VMDA 1ZJYA 3DHVA 4KLRA 1UXOA 5LOVF 4AYTA 3LY7A 1DTWB 4QXAA 4Q4LA 3KHUA 4CIDA 3CZQA 3H4IA 3WGUA 2R4QA 3IAM6 5FIUA 3V2UA 4JLVA 3OCCA 4P9NA 5C37A 4W9NC 1KQFA 2UZ4A 2IHBA 4E30A 3S0JA 3A1EA 1JPUA 1P6QA 4QXRA 5IU6A 2FMIA 3QEBZ 1Y42X 5DCYA 4G1FA 1DTSA 2OCKA 3MLBA 4MW0A 2I67A 4HLNA 4U9IS 5A06A 4EG0A 4P82A 4EG3A 3HU1A 1DXHA 3PD7A 1K4KA 2FUCA 4KWIA 5KYVA 4BRSA 4EFNA 5B30A 4DS3A 3KVYA 4IXDA 1G5RA 1PR2A 3VC7A 4DV3B 3PFBA 4H2DA 2IC5A 3KYIB 2F17A 4GLBA 3CLUD 4JUBA 3AI7A 2JGDA 4MQEB 3UV6A 3HYLA 3PUKA 4DNOA 5HKKA 5KIAA 2R6DA 2WINI 4G0ZA 2EWVA 1IQRA 2PUBA 5DISB 2IQ5A 1X8LA 2G17A 4A36A 5A5GA 3KVRA 4RK4A 2NNLD 4F9GA 4NP6A 2O1WA 3F7TA 5HUJA 2HLPA 4XWGA 4OJNA 4UUQA 2B6HA 1OB5A 3TZLA 1WY5A 5K0NA 4CQMD 4F1WA 3UHFA 3L0DA 3P5BA 4RW0A 5CT6A 1OT5A 3UB3A 5A3JA 1R9GA 2PHZA 1S2MA 4OAQA 5ITZA 1G2QA 4B1FA 5FQOA 2PDAA 1SC4A 4WZBB 3SZLA 3U0BA 4JLWA 4XB2A 1OYVA 3I4CA 1JBQA 2NUPA 3F5MA 1YR9A 2WNSA 1W0JD 1ZH4A 3LRTA 3TFWA 2O8BA 3GLHE 3ENKA 2RH9B 3M8KA 4QUKA 1ISRA 4TQUS 1S4QA 2ZUWA 3EFOB 2OB1A 2VBCA 3EUAA 2Y9MB 2GJ4A 4EATA 2P5TB 1XCMA 2ZJAA 3VU0A 1UBCA 2VRCA 5ALSA 4D9CA 4BQRA 4E1VA 1G9XA 4DA8A 1OLUB 1ENPA 2WFZA 1OGIA 4P58A 3JQFC 3KYDB 3ONNA 4QBFA 1J0CA 3ESAA 4NCKA 2BBSA 5AHOA 3ANNA 5DWVA 5JJIA 4R1SA 3JQQA 3J7TA 4B3GA 2R48A 4ZK6A 4WXEA 5BUCA 5CDTA 4ZVOA 2VQSA 3PTLA 1MENA 3Q5GA 3HLTA 4LISA 1JG7A 4QOHA 3ZE6A 1E64A 4BMYA 3B52X 4B3RB 3ZE9A 4ETNA 3O73A 2O48X 5ALHA 1RLOA 4CG2A 2Z56A 4KZPA 2YY7A 4FJ2A 3VJRA 1LPSA 3O3CA 2RD2A 1T6ZA 1JR2A 3STYA 2B3TA 3ZZNA 3KOMA 3RIGA 1BQ4A 2GEKA 2GF2A 1QV6A 4YIKA 4KPYA 2ZUTA 3LLVA 1N7HA 4AECA 1O58A 1N6PA 4Y2HA 4ZEXA 1YS7A 1OAOC 1ZMTA 1ZUIA 2EC5A 4MV1A 1JTEA 1NUTA 4L2IB 1WAMA 2QTZA 4R1PA 2IHTA 2VDWB 1QIIA 2VA9A 4PPFA 3QYJA 5FEMA 4D80A 3CXRA 4YP6A 5KTSA 1FLDA 3GCGA 3HJGA 4A2CA 4CGYA 3NXSA 1F8YA 5JVDF 3ZGZA 1JIXA 1NJFA 2G71A 2O2YA 3RS5A 5JXJA 4MVJH 2O05A 2BP7B 3OSUA 4Q4AA 1J90A 3N7UA 1YL6A 3IAS6 4N03A 2O0LA 4H7PA 4KX5A 2D5AA 4ZOLF 4AYWA 4YV0A 3UA3A 4LRUA 5F4ZA 3QUBA 4N8DA 1L5QA 1E7WA 1OC4A 4GM1A 1KL7A 1I6KA 1QOPB 3M4XA 4GM4A 1E6LA 4LZZA 4MXDA 1ISMA 3IKLA 4UZSA 5AVOA 1YJAA 4GUDA 3VSCA 2VK8A 2QVXX 3PKZA 4H3HB 3W3AD 4K81B 4N1AA 4GU5A 1ZM7A 4P32A 1EP3B 2ALJA 5SYAA 4CFYA 121PA 2ZRMA 3K0AA 4Q47A 2B83A 3FI9A 3ROGA 1EA5A 4YAUA 4L5YA 4HQ0A 3S29A 4QPJC 1YXMA 3IXMA 5TB5A 1TIKA 3BK7A 1U0FA 2JI7A 3R3JA 5LKRA 4DCVA 1YZ3A 5DM2A 2RK4A 2M6SA 4P98A 4YMHA 2VBGA 4XWYA 1BE8A 1ID1A 1QRAA 4JP3A 1MOSA 1E2JA 2HW8A 3KEFA 1CQJB 1F0KA 3E3NA 2CJYA 2NU7A 2FE1A 2W2TA 3HJBA 2QLNA 5EZYA 2CUNA 2PUVA 3LD9A 4O4LA 5EWLB 2IS2A 1SC1A 2CL7X 3ZU2A 2K2WA 2KWIA 2RDMA 3O8BA 1NKTA 4AT1A 5K99A 1E94E 3PFFA 2OCBA 1K3TA 1RWQA 1WEKA 3LX5A 3O91A 1QKJA 2XNDD 1TLTA 4K3UA 2ZBEA 1AIPA 1Z2AA 2ZG6A 4O2BB 3RLIA 4F7WA 4ZICA 1UXGA 1GLGA 2ODAA 2RG7A 2YUIA 3A1WA 3NHSA 2HJSA 4XVUA 1MG5A 1NJ1A 2ZM5A 2C0CA 2C5HA 3E70C 4M53A 3PKJA 3OU7A 4L4UA 4J1TA 5GQSA 1EIWA 1TE2A 2NZWA 1ZG3A 5ARCA 1SHLA 4NI5A 3NHLA 2PKRA 4TN1A 1Z8NA 3CVYA 1Y5NA 1EXWA 2CUZA 4ILEA 4BAGA 3M4JA 3JWHA 4ROTA 4JS0A 3TQRA 3TLCA 3HWWA 2IPXA 4KVGA 4DQLA 4IR7A 1AZSC 5C34B 3IBSA 5DH9A 3EUWA 4C7XA 2A59A 2XVYA 4Q6BA 3OCVA 3LQKA 3PQ5A 3NHMA 5T4EA 1D7AA 3AVOA 4D57A 4RHXA 3PXAA 4DCUA 1Q3KA 1AB6A 3BXHA 5DT9A 1EQUA 1DC3A 4H7DA 1E5TA 3HB5X 4QDXA 4EKYA 1E9CA 2W6CX 3H4MA 4ZYYA 1UPAA 4PSAA 2AX3A 1DOAA 1J07A 1U2SA 3DLTA 3H5AA 3PFGA 4J0DA 5EIXA 1ULUA 1TVMA 2Q0XA 5C0OE 1X1DA 1XRLA 5EC8A 2VAPA 3I05A 1WSAA 3I73A 4PG5A 3NDBB 1SXIA 5JCJD 6PFKA 1Y1LA 1IBKB 3ROQA 1RPJA 5KYWB 3OICA 2EW2A 2YDYA 1UBJS 1WOMA 3ABIA 1S8OA 3D8BA 5IT4A 3HSKA 4V02A 1EUDA 3AWDA 1P19A 3D6NB 4NF2A 4YJDA 4P38A 2C5FA 3ICEA 2EIXA 4O0MA 4BMCA 3BOSA 1TM7E 1Y7PA 4L15A 2X4GA 4REMA 3HJFA 4N3BA 3QFTA 5U4XA 4E15A 1NI4B 5I7EA 4KE9A 4KYIB 4LJ9A 1Z2PX 3I9OA 1F3LA 3N2GA 4QDJA 5GAJA 4EO9A 1UT8A 3LE8A 3NUGA 5BOSA 2J7PA 3IVAA 4ZPJA 1Y5MA 2IH4A 2OCLA 1J2YA 3Q1LA 4BLTA 1RLMA 3CLKA 3ZBQA 2ZS7A 2ZRHA 4AZ0A 3ZHQA 3LVQE 1R18A 4IYRA 4CDMA 1YTLA 4IFIA 4LHZA 3PPYA 1DCTA 4G26A 3QLJA 3VHXB 1RBQA 3X1XA 1U1DA 2ZDGA 1M1YE 4NU5A 4RU1A 4XQ9A 3CM0A 3HLYA 3ESXA 4UAUA 2C54A 1PVVA 3CSDA 1G3UA 4LWZA 4D26A 3D3WB 3R5SA 3B1FA 3TZHA 3K7EA 3VJKA 1G21E 4KXFB 1PR5A 1UODA 5C1BA 4X7MA 2JKVA 4C0JA 1Y8QB 3R7DA 4LX0A 2B37A 1SOVA 5TMDA 1JXQA 1H4SA 1B16A 5JDCC 2I65A 4NCXA 4BFSA 5I6DA 4C4AA 3E3LA 4Z54A 1GTSA 4UVIA 3B12A 2W8ZA 3WK8A 1YA4A 3WLSA 3MCWA 4E07A 5KTKA 4AG5A 1DQRA 1HEYA 1NN1A 4TGLA 4HR7A 2YNMD 2OGSA 1L8OA 4D43A 3WMRA 3WQQA 2ONCA 3RS4A 2CMDA 4OQZA 2JK0A 1OXXK 3QKUA 2I4TA 1TVKB 4X1IA 3Q8XB 1XDWA 3BGSA 2ZULA 4RFSB 3CLRC 3SF8B 1DELA 2OPBA 4H1HA 4U6NA 4ANFA 4CQMB 1VG0B 2RGDA 5AW8A 3OMXA 1BXGB 4KNVA 3GQBB 1FTQA 3NOOA 3Q41A 1GL6A 2XIQA 2HRZA 3A6EA 2JF0A 4JMPA 4QJ4A 1G8PA 1M76A 4JGGA 2NGRA 3QBDA 4HH3C 1JKIA 1JB1A 2A5YB 3X1YA 1UOQA 4QOFA 3ABOB 4JLMA 4TMYA 2PBLA 3L43A 1DL5A 4YRZA 4NMHA 1F6BA 3K9LA 1GITA 2C99A 2WWRA 3N39C 4PYRA 3UWOA 3ZW7A 1DX6A 3EK2A 4LGMA 4FSHA 4H16A 4TMXA 1D6SA 1KDRA 1V5FA 2AFHB 1GPJA 1H9AA 3KVOA 5BUZA 5CLLA 1NXTA 3WB0A 3TPZA 3UT5A 5I4KA 4BXOA 1T8WA 3FJYA 2EYQA 2J9ZB 2X0RA 3FHLA 3QE0A 1AS2A 1TRKA 4V0SA 3ZK8A 4EFMA 2W48A 3IDAA 4GZLA 1L7XA 2X8BA 2EWWA 3T7DA 2XEDA 1OLXA 2IE0A 3M83A 3PYLA 2LUOA 1PO7A 4TVOA 1SQ6A 3UGTA 1OE0A 5CX1A 3RSOA 2XZLA 2HC9A 1CZNA 2VAMA 3DMFA 1MJGM 3AX6A 4HGNA 2GM5A 4XD7A 3FZNA 4DPLA 3S70A 1FFXA 4GI3A 5H9WA 4ZK2A 1O0BA 2GJ9A 5KHAA 1OPXA 3DR3A 4EECA 2ZPTX 1G42A 4MV6A 3WLTA 5KCZA 4Q4HB 1WPGA 1CHNA 1FTNA 3QF4A 5EHIA 5K6AA 4AQYB 2PCLA 3VGJA 3G1TA 2CWWA 1IQUA 5ILOA 3R0IA 1YB6A 2AJBA 4KQJA 5I7VA 3RUIA 2XITA 4PSKA 4FHZA 4BNYA 3RAJA 2XKKA 1NNUA 1LLUA 5EJ5A 1EU1A 1P45A 2BEKA 3N70A 1V37A 1TX4B 1TT7A 4TM7A 1JI0A 4S0ZA 3ORYA 2C2BA 1LJLA 1MX5A 4LV5B 4F4HA 4C5CA 2KB0A 4MGKR 3AQIA 3UFBA 4A16A 1U4NA 4GOND 5HWSA 1UBHS 1YZYA 3BE6A 3U4QB 3NT2A 1WUHS 3U4AA 2VZ0A 1GNTA 4XB1A 3ESRA 2FEKA 5JZSA 4GEGA 3UMYA 1TZ2A 2PWYA 421PA 2WKWA 1EUYA 2C7GA 4H7HA 1AURA 3IFSA 1XEXB 1I7SB 2UKDA 4IILA 1Z5OA 2Q9BA 1K9SA 3Q7PA 4RIIA 5DE3A 3PV0A 3R7WB 4DCSA 2X5XA 1ES9A 3W6NA 3EVDA 4UTXA 1L1EA 1FUKA 1KWGA 2IXTA 1SXJC 1NQTA 3F6BX 2F3TA 5AW4A 4OP1A 4RXTA 5L9AA 1W30A 2HPAA 2AFIA 2FWJA 2RJOA 4FCTA 1MO2A 1EGAA 2NIPA 2E4ZA 3EXG1 5HX7A 1S7CA 1IAQA 4Y0NA 1RQLA 2Y9PB 3QIAA 1FMTA 3JPYA 2GPAA 2TMKA 2ZR0A 3ORRA 5CAEB 3H9QA 1LBEA 1H8ED 1XE3A 1GVNB 1KMHB 4JITA 3CMCO 5IYZF 3TS1A 3MMSA 4B4VA 3RYTC 4B45A 4M6WB 2HMTA 3DNMA 3NBKA 5EIHA 5AVQA 5EXTA 3IHWA 4J0QA 5HKOA 1NBAA 3MS2A 2GPTA 4JBYA 2X9GA 3TMYA 3PPWA 4BIIA 4EBFA 3IIMA 3WHPA 3VPBA 1AKTA 1PFKA 1TAHA 5HKLA 4GD3Q 4JKOA 3GJ0A 4R1LA 3PX7A 2J48A 3TR6A 3ZY4A 1GA1A 4EKGA 1ZICA 3CH4B 2PN1A 3ITDA 4KFTA 3B9QA 4YAEA 5TF4A 1DMRA 2VJLA 1EX9A 3C7KA 4CQJA 3EPLA 3GF4A 3EW9A 2WZDA 4KXUA 1NW8A 4JBXA 1R9NA 2CVHA 4D8YA 3D4BA 2WU1A 3GOQA 3IV7A 1TVEA 1Z4LA 3ND9A 1YE3A 3LXRA 5AXCA 2C5BA 1ZGAA 1N33B 1S1CA 2IH5A 1NVBA 4OLBA 4HZUB 5EWMB 5JSYA 3R3UA 5KC9A 3FZGA 2W42A 1KAQA 2FSIA 2XCIA 1NM5A 1QO9A 2QGFA 4NIMA 4IQ4A 1STOA 4FMCF 3WL4A 1XB2A 4QGGA 1AV7A 3W4KA 1XD8A 4CUZA 4FFBB 2QV7A 4AL4A 5HRAA 2ZROA 3S1SA 1L5YA 4LDRA 1JYEA 5E9WA 1CUDA 1UPXA 2WPDA 2IBMA 2R44A 2QW8A 1SD2A 4U6QA 1T2UA 1VE9A 1TZKA 3K9FC 3A9TA 4AG6A 1VGVA 3JAWB 4BTVA 1YR8A 2IV3A 3RB8A 1JXOA 2X8JB 1M8KA 3QXHA 4IFBA 2D3TA 4L3VA 4MEJA 2HQOA 3FDZB 3DOCA 4FZJA 2ZAMA 4YO7A 5ARBA 2FPLA 3HR7A 4V0ME 3DBHA 3KZVA 1EDOA 4HDCA 2KYRA 1KI2A 4OXYA 1UBRS 4WGGA 3WYDA 3GPLA 5SZKB 2RKOA 2WR8A 1B4DA 1CJTC 4JD5A 5AVUA 3EXEB 5E7IA 4HDKB 3OEED 4ZAWA 3HA3A 2ECKA 4DEVA 1J7JA 2GKSA 3H5VA 1BC5A 4IHAA 5HDQA 4XRRA 3L0CA 3IDSA 3SICE 5B64A 1ZWKA 2ISSD 4ALKA 1GRCA 1HE1C 2LKCA 1UMKA 3LGAA 3TL6A 1H9BA 2NPOA 1YQDA 2VUSA 1EEHA 1CCWA 3SIWA 1R88A 1X80B 2ORWA 3MJ4A 4IJ5A 4RA6B 4M21A 5JH7B 2IS4A 5ERYA 4LHVA 4CF3A 2QIPA 4C4TA 4EJSA 3GLFA 5CDHA 1NG9A 2BFAA 4JWTA 1LK5A 4PRKA 2WWHA 3OJXA 4GFDA 3QEMB 5ECWA 4IIDA 3ZI4A 3ZZMA 5IXSA 3T3NA 2CFSA 1GG5A 1KKLA 3CA8A 4RH1A 4JP2A 3GVIA 4LHYA 4PEVA 2FR1A 1XZJA 1HLFA 5TGTA 1NYTA 2V0NA 2HNKA 4I5FA 3KLBA 2P27A 2PWZA 3V2HA 721PA 8ABPA 4N5NA 2JZOA 5KYXB 1OLOA 1W52X 5F7JA 5B2FA 2VHQA 3QEJA 4UREA 1A7UA 5CA0A 1CY1A 5TX7A 3HCBA 1M7GA 2J5BA 3M3PA 5T8KC 4IIJB 2QPOA 4KAFA 3A3YA 1R4NB 3GFGA 2BKVA 5KUTA 4K0RA 1ZM9A 5IBPA 3LYUA 3T4XA 3G2KA 4NS1A 3BICA 1L5VA 3PQCA 4N9WA 2PCJA 4MW4A 1YDFA 3I4LA 4CKEB 3VU8A 5LUAA 1K8QA 4TROA 3TLMA 1SHKA 4OOFA 1ZMBA 1KJ9A 1UZUA 4XPZA 4M3NA 2RFLA 1OCEA 3SJZA 3VHLB 3WL6A 3LS2A 3ZWKA 5JZMA 3N2IA 3NONA 7AT1A 1KO1A 1U8XX 1UXJA 2NSYA 3UFXA 1E1LA 1U0JA 4KQCA 3LBIA 1JHMA 1KK3A 4PCAA 5DGIA 1QLHA 3T7IA 4DR4B 3JWGA 1X7DA 4NPAA 1KP3A 1HV8A 2NSLA 4BGVA 3LPDA 5BV0A 2O8FB 3U31A 3BERA 2VDQB 3T5GA 1JLKA 1K6IA 4KQHA 4MPRA 1V5GA 5IVHA 1PSDA 1O2DA 5L7YA 2VZ8A 2WSYB 1Y7IA 4EEZA 2UVQA 1BH2A 1LBTA 5MF6A 2RHCA 1NIPA 2IT1A 3ECCA 1EINA 3IR7A 3O8CA 3FAZA 4EI9A 1JHPA 1P1HA 2QE6A 2WIBA 3CF0A 5FHRA 2G1PA 2HQBA 3BJMA 3HN7A 4J03A 4QT4A 3QFHA 2YJTD 3MJDA 2OB2A 1BD4A 5C7LO 1QFZA 4MVJE 5J4KA 4QYXA 4MULA 1YBMA 1K5HA 3F49S 2QUAA 3M3DA 1ANKA 3OX2A 1K3FA 3HXMA 4ALNA 2RBEA 4ZDIA 3EE6A 3HZRA 1ICIA 1QHFA 1RWNA 2A33A 5ENVA 4JBNA 4G0VA 4WEOA 3P8ZA 4C0KA 3WZLA 4UTVA 2YHAA 1IY0A 4DJJA 2BFDB 2BGTA 2JEOA 2YMMA 3W78A 1LLCA 2FPUA 4HOYA 2PU7A 4F21A 2W4QA 2MTBA 3IBTA 4X8MA 3SD7A 5CVTA 3RJZA 1PRYA 4Q4DA 2C3MA 4LHSA 4PFJA 2C8VA 4UZFA 1Y4ZA 3QKSA 2D7CA 3WWCA 1AT1A 1D2CA 2L19A 1HYEA 1NPTO 2H2WA 2JLVA 4L6CA 4K9LA 4DSUA 4MQLA 2FK8A 3C8UA 1Q1AA 4FHEA 1EQ2A 2Q9CA 4KEAA 3CPSA 2YX1A 1R37A 1I6WA 2XYVA 4NBLA 3RANA 5IXJA 5DWDA 1P62B 2HSZA 1ZJ6A 2R97A 3KP1A 1RT9A 3LO5A 4PXAA 2EJBA 5DMXA 3MC1A 4PX3A 1KETA 4V1CI 5CDFA 1YIAA 3SM9A 4ZN6A 5JAPA 2R751 4QECA 1DIBA 4R8KA 1XK6A 3GI1A 1HY3A 1MW9X 4YJ2F 2W6IA 2UZAA 4H31A 1VHQA 4R84A 4LQ4A 5CGQB 3ECAA 4H17A 4JLSA 5FH9A 4UTPA 4KQ2A 2UYQA 2XRFA 3ZY2A 1G17A 3ASVA 4JR1A 4JYBA 4RMIA 4XIJA 1KVUA 3HKEB 2MR5A 3AY0A 1ZHHA 1JR4A 4IX9A 2ZRIA 4JZKA 5CLIA 3SG0A 5M5BA 4DV7B 1YIOA 3FGZA 3W7VA 5B57C 3PIRA 1DTWA 1ODCA 2RHGB 2HXSA 1Y6JA 2Z5LA 3ISJA 1H23A 5DRTA 5ILQA 3NBMA 4ASUA 4YUXA 1WBJB 2AN4A 2MSDB 1YZHA 1S7GA 2DKOA 2VTKA 3EVZA 4KIUA 2V5UA 3LBHA 2I4NA 4YCDA 1R1DA 1IC6A 1KAOA 2W7TA 3LXUX 3TKYA 2RHTA 3DMNA 5EZSA 3WFJA 2XYHA 3F6PA 4A15A 5J1TB 3WMXA 4RV4A 2QTLA 1DJQA 1N2JA 4RNCA 4K7JA 4DIEA 1C1XB 1WDLA 4H7FA 3NH9A 1PL6A 2VSYA 4I5IA 5KI6A 4XFDA 3EVAA 3AZOA 5JECA 1AZLA 3OE7A 1SVSA 4Q03A 3IVRA 3D6UA 4D0RA 3B3FA 1DWOA 3WK6A 1KO4A 1W5SA 3EQ6A 3LW8A 4H7JA 2BM8A 4MQEA 4R2KA 2WVJA 3O1HB 4ZT3A 3RYHB 5JVDB 4IVPA 3EVFA 1V96A 1EVKA 1XTVA 3BD9A 4TKVB 4G8BA 3RYFB 3HYCA 3OZAA 4R1QA 4N0PA 5CIYA 3GZTB 4FWIB 5H68A 1DKRA 1GKYA 3A4TA 1D1TA 4KUEA 3FA2A 2ZUCA 3MERA 2CKDA 2JGKA 3BRCA 5GVSA 1H8HD 3GFFA 3DD1A 3HB1A 5CTAA 4ILKA 2IU6A 3GR6A 4JK3A 1N9GB 1HYHA 4JB3A 1M0WA 2HGZA 1GGHA 2YWJA 3IMEA 1B6TA 4H1WA 4WZBA 3G0IA 4G2TA 3EDQA 1MTZA 1L4KA 5CDUA 1H3FA 5KNCD 2WAOA 4XWWA 1WD7A 5YASA 3G49A 1NX9A 2FSVC 3G82C 3KHSA 3KYBA 1EK2A 4TKLA 2FKAA 2CLOB 1DX9A 3IP5A 1M3SA 1DQYA 2ZI4A 2X7JA 3A1UA 3EFOA 3G8CA 2IDJA 4OH7A 4R0VA 1LX7A 1OR8A 1LQUA 2BKLA 1I6MA 1OSNA 1R9JA 4WD3A 4E3WA 1Z5NA 2AXPA 3EEBA 4HH0A 1DE0A 4F56A 1ETUA 2IIVA 4GF5A 2JJ2D 2XE6A 5CJ2A 3SSNA 2P77A 3H8WA 3VU9B 1AKMA 1WHTB 3UK0A 1OLUA 4EHBA 1J9EA 2PAAA 2RJ3A 3GNSA 3O31A 3KYDA 1U9JA 4HGOA 3TL2A 2XRYA 4MVJF 4C4OA 1ZJWA 5IAOA 4MTLA 3U3XA 3OPYI 3DUWA 4A82A 3UO8B 2G4VA 4NMLA 1UKVY 2BCEA 4AS3A 2Y6UA 2P0YA 1R6TA 2YASA 4OI4A 5I9SA 3JU3A 1X74A 1FOEB 3KL2A 4TN5A 2BRUA 3O21A 1OWNA 4YPFA 1I0LA 4PC1A 5ALWA 5DX8A 4HMQA 3FRJA 3SEAA 3IESA 3LLSA 4RE5A 3WY9A 1GNLA 3BWVA 3FDIA 3ZVKA 4DCOA 3WQSB 1Z82A 4Q1DA 1D6MA 3AP3A 3FHCB 2OYRA 1T2VA 2VF8A 3KEQA 4NFLA 1EMDA 4HI0E 3UJ9A 2OPHA 1PGQA 4BNMA 3WSWA 3EZGA 5FBZA 1CP2A 2R8EA 2ZRNA 1Y3CE 2VJOA 4MWEA 1ZVQA 4IEIA 4E4YA 1CNFA 2YVUA 4QEDA 1XMPA 5BQFA 1QAQA 1Y8CA 5CH3A 4ED9A 2QVBA 4HVLA 4WK2B 3UGKA 5CBKA 4XUCA 1D2RA 1VG1A 3WDMA 1E2EA 1TMKA 4L2IA 3KB2A 1HE8B 1LF0A 4FILA 1SRRA 3MWYW 1T9HA 1IK4A 1LUAA 2VDWA 3LW7A 4OPMA 1HE2A 4RGQA 3ERCA 4ZT5A 3H2ZA 1R7RA 3CN9A 3HY4A 1RQ7A 4LMBA 3O75A 2CL5A 1F0NA 2ZE8A 4I46A 3SBEA 1QUFA 5B7GA 4R7ZA 5ERGB 3VDRA 2PH3A 2BP7A 1ZL2A 4U2EA 1QX3A 2NV2B 2QX9A 1AD2A 221PA 3PNSA 3X0DA 4CMEC 3T94A 3EMKA 4DLBA 4ZEMA 3QNUA 4XCQA 4WLFA 5AVYA 2JATA 2QQ5A 2PO7A 1YRQA 1CVRA 4LTNA 4F9EA 1FF9A 1KYTA 1PGPA 5DN6D 1MO4A 4ABYA 4FWTA 5BSWA 3MGBA 3T1OA 3M1AA 1HDZA 3ZYCA 4PHFA 2R5FA 5UKDA 4PBTA 2CD7A 3JS5A 3TG8A 4XIGS 3GT0A 1OFGA 1IIBA 1Y4UA 4DA9A 4PHHA 4F4JA 4HBZA 4B4WA 5LQUA 1BSVA 3H1PA 4IHKA 3HYNA 4XQGA 4Z8XA 3WGIA 3IL2A 3KDPA 2MT9A 3A04A 1D2AA 4ZVMA 2AOUB 1TPYA 3CLRD 4NH4A 1T25A 1B74A 1RHRA 1QP8A 3L1KA 1GPDG 2PXCA 5BR7A 1H3EA 1WXHA 2A57A 1CQJA 1NLMA 1QB7A 1ZVMA 2DPGA 2GASA 3IUBA 5F5XA 3NDRA 5LKAA 4FJ0A 1J2UA 2VAXA 5EWLA 4QJIA 1MU0A 3SN6A 1RJ9B 1L5LA 4J2OA 3ZVLA 2IOHA 1LTQA 2XJ4A 2J30A 3EGWA 1NXWA 1QNFA 1SCNE 2JGFA 3L4KA 2G04A 4OBWA 3GV0A 1SBNE 2X77A 3RVMA 4QBHA 4O2BA 2NZXA 3FXAA 1DCFA 3VH1A 4F4CA 5C31A 2HDWA 2GUGA 3KBOA 4Y9TA 4D9FA 4UM9B 4S1OA 2ODQA 4ZDJA 2QLMA 1GTMA 1HLGA 4UXHA 1LCIA 4EUHA 2C03A 5KJEA 5EJ9A 3W9SA 4N7MA 2ZKLA 4EYEA 3NC0C 2GZRA 2I0FA 2V9PA 4LOIA 5E1DA 2H0AA 4BRUA 4FOLA 4M9SA 2EIHA 1F0YA 5J2TF 5CR9A 2M9MA 5ANRB 4ZZ0A 1Q17A 4JYMA 4BJ6A 2XT6A 1WDKA 1G3QA 4J0KA 3QX3A 2XNCA 3EEFA 1GZ5A 4CCSA 4HX9A 1I2DA 1ZIPA 3K30A 3F8SA 1Z38A 3VR6D 3ZGLA 4BZWA 2H1WA 4BC0A 4ITRC 3AW9A 4W6ZA 3UXHA 2Z4TA 5C1IA 3AKZA 2P9YA 1SU6A 4DV1B 4IZHA 3O1LA 3U7RA 3UJNA 2WJGA 3K8YA 4OHCA 3FBGA 5IZCC 3NIBA 1KJIA 5F2OA 4OGWA 1ZINA 2FHPA 1D5CA 4DEXA 3ETGA 4K28A 4HXGA 1SBZA 4WN9B 1LS6A 1LVGA 3RM3A 1DTEA 3QPAA 1P2DA 2VPXA 4KHZA 1CEEA 3NEPX 4L9WA 4CNQA 4S24A 3K0EA 3VKWA 5A3QA 5GPBA 3TB4A 2BZ1A 4F72A 4CEJB 5TEWA 4L8FA 5GOTA 2N75A 1P8JA 4D5EA 4YUYA 5KYWA 5C2JB 5FUYA 3NYQA 2VTBB 5K6TA 2ZIFA 4CFSA 3JYOA 4M1KA 4RGYA 5IH3A 3VH4A 2QRPA 1SVWA 4JLKA 1L7NA 4JVOA 2DAPA 3BWDD 1NI4A 4M7PA 3FYHA 1B7GO 2IYPA 2PX5A 4Q21A 2WM2A 4JYPA 5IFKA 4D74A 2CHEA 3WRYC 2FLVA 3QBEA 4PY2A 1YZKA 2JGIA 3DNFA 4CM6A 5LUBA 2OC9A 4BZPA 1T3TA 5LB2A 4GGOA 3PC8C 3CF6R 1F3OA 1Q7EA 4GQBA 5EJ8A 1GKUB 4D41A 1EYZA 5KYUB 2NZ2A 3IPXA 1WZEA 4MKRA 3VHXA 2UXBB 3DB1A 3HN6A 5FTLA 5E38A 5T64A 1I3OA 4PZZA 4AJOA 4B17A 1BAPA 1YZNA 5AKLA 4DZZA 1XTKA 2ZSAA 2JLSA 5GZ3A 1SKAA 1NVKA 3MRSA 1A9QA 3D3WA 5FXMA 3VTKA 4D9KA 5M04A 3QVWA 1Y8QA 5C81A 5CVUA 4RELA 1Y9DA 2FW6A 3RGGA 5JWRA 1DLIA 3AF6A 2BMEA 4V24A 3PDWA 3RTAA 2DGDA 4QPDA 2P7HA 4M0FA 4U2CA 3EB9A 3TOXA 4MV5A 4OXQA 2Z1NA 3JZFA 4PSUA 3GLGB 4H15A 1GGEA 1R2QA 1N8NA 1TVKA 3EZYA 4N54A 4RFSA 2XF8A 2AIRA 4OHMA 3SF8A 5E4TA 2PWBA 1NUQA 1OU4A 2F2TA 3AB3A 3R6GA 3W04A 4ENSA 4FFLA 5AVZA 2PEYA 4G0OA 2Z98A 1BXGA 4E2WA 3GQBA 3C1OA 4ZOCA 4C7VA 4EGAA 1HL7A 1FP7A 1ZM4A 2GEDA 1CR2A 3C16C 1CERA 2CK3A 4XI9A 3NC4A 4I4TF 4XGQA 4WGFA 3WA7A 1FFEA 2QNBA 1G55A 3R5HA 5JG7A 1PYOA 4PF1A 2DLNA 5CFNA 1XMSA 3PG5A 1RHUA 3W3AA 4G4JA 2Q46A 2XE7A 1O95A 3UJ3X 1DMSA 1KOLA 4YR9A 1H0SA 2GLTA 2PMFA 4WCFC 2Z2IA 1Z7BA 2PNJA 5ELXA 4R7TA 2HTEA 2Q41A 2IYSA 1XRQA 4GP9A 3JTEA 3TSAA 3NT4A 2RGNC 4RK0A 5J9FA 4CIAA 5I45A 2OD9A 1VHWA 3ODPA 2WABA 2O54A 4AO7A 1V39A 1U2DA 2AFHA 1L6IA 1W35A 4E31A 3L7AA 2X2PA 3O5AA 4X95A 1TOAA 1V8ZA 1ABEA 1BEEA 2GCPA 2GR9A 2QD2A 4EG7A 1PJTA 8OHMA 1NPDA 1TW3A 2AJ8A 2QR2A 3Q6MA 3QHQA 1FDVA 1NJ5A 2XA9A 2VJQA 1PLJA 1UBUS 2GO1A 5AOCA 2A9PA 4UHJA 1XMQB 1QGAA 1M6VB 1UC9A 2JKZA 2XNDA 2WJAA 4UVEA 1G1MA 3VAZA 1DKNA 2ZUUA 3PGLA 4MVWA 2Z57A 1SXGA 3WLNA 4Q4HA 5IT0A 1F2TB 2BTEA 2HHAA 4IVQA 2JW5A 1JFLA 3OM1A 1YQGA 1E2NA 1NE7A 1VYTA 2DFLA 5FR2A 4HGYA 1IIRA 1M2OB 1C0KA 5C1OA 4B6SA 4MUGA 4EFDA 3MPUA 3QVLA 1QVAA 4D0GA 1S9DA 1CUZA 3U26A 5MN6A 1BCSB 1FVOA 1WDTA 1OH8A 4LXIA 3WYFA 1JLSA 2YZ7A 4OV6B 4C4ZA 2CDNA 1IZ0A 2AOTB 4NWIA 5DX1A 1UBTS 3ADCA 1YQQA 3B60A 3PWZA 3GW8A 4QULA 5EKSA 1NXSA 5K3BA 4FUQA 2EQBA 1DC4A 1GGVA 4BMXA 1P60A 2XDAA 1CB7A 3K5PA 5EXXA 4BNJA 2ECQA 2PA3A 5A7FA 5K45A 3PBKA 3V8BA 3U4QA 4LRWA 2FQYA 2OQ2A 1VPLA 2O5RA 1Y82A 2Q5JA 4IDOA 3U4CA 3VR5A 3ZD7A 2GLXA 2HO4A 2BOVA 1TYAE 2EKDA 2YZMA 3PNMA 1T8RA 2ERCA 1XEXA 2Q2VA 3CJTA 3IQGX 3R7WA 4AMBA 1T2FA 5JFOA 3ZLTA 4CLEA 4OJTA 4C03A 1VPVA 4KBYA 1XFAA 3E81A 3UWSA 5BP7A 1P5FA 2O8VA 4JENA 1SQGA 3BA1A 3NCHA 4P4TA 5FTKA 4C7KA 4KLCA 4D1YA 2GUWA 5JCJA 3VDNB 2PXXA 4QTYA 2Q2OA 1JDJA 2AQ8A 4JUAA 4DGQA 1Q14A 4ZCTA 5GM2A 2GCOB 5AW0A 4DV4B 1H4TA 5HEKA 1NBIA 2AZMA 2I3BA 4OIMA 5CAEA 3R8FA 4NG4A 1KMHA 3TFQA 2YL2A 5E8RA 1B8UA 5CEFA 4M6WA 4BP8A 1XV5A 4U8HA 3RKUA 2IHVA 2Q45A 1W88B 3FNEA 3FR7A 4LRSB 2G7ZA 2DMRA 4EGJA 3DEKA 3S5UA 3ZWOA 4C88A 3C6XA