4L3OA

Crystal structure of sirt2 in complex with the macrocyclic peptide s2il5
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
302
structure length
297
Chain Sequence
KERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGMIMGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords NAD-dependent protein deacetylase sirtuin-2
publication title Structural Basis for Potent Inhibition of SIRT2 Deacetylase by a Macrocyclic Peptide Inducing Dynamic Structural Change
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 297
sequence length 302
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.-:
pdb deposition date 2013-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4l3oA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4l3oA01
1V5FA 2VJYA 4MZXA 4BN4A 2EZ4A 2FN3A 4G1CA 2X7JA 4K9OA 3GLRA 4UTRA 2JI8A 5BWLA 4RMGA 4UUAA 2VK4A 4Y6LA 4TWIA 4UTZA 2Q5JA 4JD5A 1YTLA 2IHUA 4RJJA 4ZP1A 1NM5C 1OVMA 2JIBA 2WVGA 4K9PA 1U2GC 5MFPA 4KXQA 4UTXA 1DJLA 5EJ9A 4RMIA 4UUBA 3CLTD 5EJAA 2H2DA 2OD2A 3RIYA 4J1TC 4UU8A 2OO5C 2WVHA 1OZFA 4GM0A 4J16C 3EA4A 4K9KA 4BV2A 1T9DA 1Q6ZA 2WVAA 1J8FA 5DEIA 1T9BA 5EJ5A 3RIGA 5EJ6A 2VK1A 3IAEA 2H2HA 2Q29A 2A1TR 3ZGOA 4QELA 2UZ1B 2Q28A 2JI7A 5MGNA 2B4YA 2DJIA 4GP9A 4F56A 1V5GA 5FEMA 3OE1A 5DGTA 1M2GA 1M2HA 4Q9DA 1PVDA 2FRDC 2A1UA 1SZCA 4FEEA 2H4HA 1Q17A 2Q5OA 2H2FA 3D4BA 3JR3A 2QQGA 4JUFA 4JUDX 4UTVA 4UTNA 5FYQA 3ZG6A 4COKA 1ZPDA 2BRUC 2PANA 5EJ4A 1U31A 2FR8C 4BVFA 1MA3A 5BWNA 1YC2A 1S5PA 4FVTA 1BFDA 4QQ8A 3JWPA 1UPBA 4JT9A 1PNOA 1M2KA 3CF4G 1Z8NA 2OD7A 2JI9A 4IF6A 3ZGVA 4K9QA 2NYRA 3F6BX 1D4OA 1Q14A 1Y9DA 2PGOA 3GLUA 4JUAA 4KPUA 2VK8A 1XLTC 2JLAA 2H2GA 1T9AA 4D5GA 4MPRA 1PYDA 1O96B 4X3PA 1PO7A 4L3OA 4UU7A 5BWOA 4Y6QA 3GLTA 4IG9A 4QPZA 4RMHA 2IHVA 4JUCA 4TWJA 5D7NA 1EFVA 4JUBA 1POWA 2AG1A 4GM1A 4I5IA 3U3DA 3K35A 1YI1A 2VBFA 3PDHA 5EJ7A 4K9LA 4MPPA 1M2JA 2H2IA 4KGDA 3F6EX 3GLSA 2QQFA 2OORC 4V1CB 1S7GA 1PI3A 4L2IA 2FSVC 4ZZIA 2EZTA 3EY9A 5MFZA 1YHYA 2H59A 3CLUD 3FZNA 1ICIA 3IAFA 3D81A 2Q27A 1OZHA 3E9YA 2UZ1A 1N0HA 3U31A 2Q5QA 4FEGA 5EJ8A 3D7KA 3CLRD 4GPEA 2Q5LA 2W93A 1M2NA 4FZ3A 2VBGA 2HJHA 2EZUA 2IHTA 4V1CI 5AHKA 1YHZA 4MQ5A 4V1CA 1O97D 4BUZA 4BVEA 5IMSA 4RJIA 2JI6A 3HWX1 4R8MA 1QPBA 2AG0A 2PGNA 2NXWA 4D5EA 1Q1AA 1HZZC 2H4FA 1T9CA 1POXA 1V5EA 1JSCA 2OD9A 3PKIA 1E3TA 2C31A 4IAOA 1U28C 2FWNA 4BVGA 4Y6OA 5K2OA 3FSJX 4RMJA 1YNOA 1YBHA 2H4JA 3CLSD 4GM4A 4MPJA 1MCZA 4JU8A 1EFPA 1PT9A 2EZ8A 1OZGA 4C78A 4JSRA 4K9MA 1YC5A 4K9NA 3EYAA 4BVBA 4O8ZA 1PNQA 1YI0A 2VBIA 2EZ9A 4BVHA 1PTJC 4BV3A 5K6RA 5K6TA 5K3SA 3FLMA 3LQ1A 4F4UA 4C7BA 4RJKA 1UPCA 1UPAA 4HDAA 4GG1A 3HWWA 3PKJA 5DGDA 1U2DC 2V3WA 4JT8A 2JLCA 5EJMA 4BN5A 4X3OA 5MF6A 1SZDA 4JU9A 4HD8A
chains in the Genus database with same CATH superfamily
1HL3A 2VJYA 3BE4A 3EDYA 1K4MA 3NOQA 3P8ZA 4JDPA 2YUIA 4MITA 4YJGB 3OCXA 2EZ4A 1BO6A 2AFIE 3CLTC 3DE6X 4DTIA 3BRSA 4I4TA 4RH3A 1HMPA 2O57A 1DC3A 4ITUA 4G1CA 1QTIA 1ENYA 1TTQB 2XOEA 2WAAA 3LZDA 4HAVA 2GYUA 1V8PA 1QIEA 2E1PA 2W2KA 1UUFA 1YKSA 3HY3A 5SYNA 5TPWA 2P8SA 5JUWA 3HFJA 2Z5FA 3OECA 1RM5A 4DDTA 3FNQA 4ZEXA 3TSCA 4B31A 2AL7A 3SHQA 3LX6A 4ZCTA 5BOSA 2VF8A 2NO5A 3OICA 2GILA 5AW9A 3SD7A 5MN6A 4ZVVA 3PG5A 3WBJA 1XTKA 1PR3A 1N77A 4LF8B 1UBUS 4DKXA 4L4XA 2VK4A 2FOLA 4IQ8A 2CVQA 5JY1A 1WXEA 3ELUA 1J8VA 2C94A 3DEHA 4Q1CA 1AC5A 1MJHA 4RLFA 3QJGA 5JSZB 5CCBA 4A0QA 4HAOA 2FFBA 1JEQB 1R4MB 3C3EA 2V59A 3P9IA 3WV5A 4AVYA 2ZB4A 4BQIA 2ATCA 4XQEA 1IOVA 2ORWA 3DOUA 4FQ8A 1Y7HA 4RH1A 3VH2A 1P1KA 4XGQA 3E9MA 3SICE 2DETA 1D6MA 3F4KA 1M0EA 1BXGA 2IS4A 1F14A 4JYPA 3DL2A 2O54A 3T9AA 4OQLA 4U63A 1T35A 3CJRA 4XJXA 3SC3A 5LZ4A 4Q24A 3RUFA 2A84A 4LOAA 5AW3A 3CZPA 4M1ZA 4F2HA 4TS4A 5LMNB 3EJWA 3ASVA 1NW9B 1PR0A 3PE6A 1R10A 3FSEA 1PGJA 1PJTA 1W4BA 2J0SA 4Y0NA 4WA7A 2XZOA 2DAPA 2HGSA 4GM0A 1YAJA 2DKFA 1WZUA 2PJDA 3MXTA 1Q3HA 3O95A 3CG0A 4OHKA 1UT8A 2HXSA 4Q05A 1L7RA 5DHPA 3W6ZA 4F5ZA 1H3NA 3N53A 3HCDA 1NVBA 2A1IA 3L07A 3UN1A 2XVZA 3R76A 1WETA 2VTVA 2QTNA 4P93A 5EZ6B 2WM9B 4CIDA 1U7PA 3NASA 4S04A 4JLWA 4A2CA 4MH0R 2AGVA 4FN4A 3RYIA 1IXZA 1E3LA 3BHNA 2GPSA 1MQSA 2RK3A 1GO2A 3MTEA 4FDLA 4ZICA 4PYNA 3A0RB 4KMRA 2GJ9A 2FN8A 2HUNA 5AUPB 1YD7A 1E2NA 1NRXA 2PX0A 3AR3A 2FPWA 2ZZNA 2R65A 1DTWA 1C1DB 5IYZB 5B4UA 1PT7A 5G4LA 4N7RA 1IXSB 1UODA 1H0HA 1M9NA 2DPMA 3WNCA 1F5NA 4OKIA 2CK3A 4EGCB 4XGNA 4BRZA 4F72A 5LXTB 1WRBA 3DDUA 3K09C 4L6IA 3TRIA 4PRZA 2EERA 3IIEA 5JCXA 4B3RB 2HHLA 2DPXA 2X2EA 3H04A 4KFSA 4UHKA 5KHLB 3HJNA 2I71A 1RJEA 2YVUA 3PC8A 3W90A 4J6FA 4EY3A 3BAFA 1DADA 4C0BA 4R9RA 1KEVA 3LD9A 5E1BA 4J76A 2ZTUA 4GI5A 2I9KA 1BJKA 5KU7A 2J4CA 5DLYA 2WSYB 4J03A 1PT5A 3HEBA 1ZR4A 2JDID 2CWWA 1TU3A 1TIKA 1KFKB 1SXGA 2YHBA 3GUHA 3H9QA 3DMRA 5E4FA 2J3EA 5CAEB 3WLTA 5ADUS 4NPHA 1O3YA 1E9VA 3GUVA 3V4RA 1ZJYA 4KDEA 3Q8MA 3X43A 4ZOBA 2CFRA 1T5BA 1W4RA 3CYFA 2B30A 1DCKA 4HDMA 2H4XA 4NENA 4PV7A 1HI9A 1ZNZA 4K3VA 2AC4A 2IV2X 2G1PA 3RAJA 3M49A 2Z9DA 1MOZA 4FGWA 4CCAA 1RBZA 1DI0A 1X13A 4N6OA 3F98A 3R5TA 5TMBA 3A4MA 3QWFA 2AJ8A 2WV9A 2R00A 4IXNA 4RSGA 4HJXA 4L50A 4C3OB 3E18A 4EEKA 2L17A 4JEIA 4L4SA 3EH1A 5JAZA 3WQQA 1UFQA 1JEYB 4Y2UA 4AURA 3ZNNA 5FLXA 2JLYA 2ZI5A 2C9ZA 3JX9A 3O4IA 2BM8A 3JVIA 3QFTA 1HYQA 2C42A 2FEOA 3R8XA 5BN3B 2VAMA 2X8WA 3UA4A 5LBTA 3U4QB 3RREA 3WP1B 1EVIA 1GFIA 2XMRA 1U1EA 3T5MA 4H3SA 3VSCA 2H29A 4IXMA 3FCUB 3VH4A 3WGKA 4CM6A 1IQRA 1FRQA 1XLVA 2GCOB 2OHHA 3PP8A 3LTNC 1O03A 2FN7A 4WCFC 1Y1QA 4E5MA 2FUEA 1QVWA 5LWQA 1G8YA 4PVDA 5KQGA 5GOZA 3UUEA 2GPWA 2PS1A 2VDPB 3JQFC 2C4TA 5AKLA 4HBGA 3VR2D 3DFUA 3BVPA 4CMAA 1SXQA 3MWGA 1UWCA 5KKNB 1B74A 3SF8A 3SS8A 2WWYA 2ORVA 3T1OA 3HCOA 4JI0B 2G07A 1A4IA 4IYJA 2FW7A 2FSUA 3SQXA 5AK5A 2RBKA 4MICA 1X7XA 2J59A 4Y1FA 4Z54A 4L57A 1L5QA 1W9MA 2NO6A 5DHTA 1UJ2A 2VQSA 4TSFA 4ND5A 3H6GA 2AUNA 4DIEA 3TW6A 3OX1A 1G6Q1 2CEKA 3ZDFA 3MQ4A 4DA7A 1YQQA 3OEHD 5K99A 3PFCA 1TD9A 4JQCA 3RVKA 2JAXA 2HMWA 4NAHA 4QQ8A 4NCBA 2P9CA 4OX9Y 1Z0JA 3QFHA 2G04A 2XUKA 1EXWA 3T7CA 1DPGA 1Y37A 5K8IA 3F1LA 3IIJA 3JQ7A 1E3MA 1S3SA 2C8VA 1KOFA 5JMOA 4QVKA 1XJ5A 1NBMA 3P5SA 5FFMA 1JBEA 3E3NA 3RRJA 2ID4A 1CZRA 2LXNA 3PGXA 4EF5A 2C83A 1CV2A 3MA0A 4JP5A 3RSQA 4ZI7F 1IJFA 2DWUA 1A9PA 2QQ0A 2PZJA 4G37A 3N2KA 4MAAA 3V8RA 3VU3A 1YS6A 1LX7A 3CNBA 1KGSA 4BRSA 4NYMQ 4K9QA 3NANA 4KKVA 2V0GA 2AZDA 2VJDA 2IEYA 2LBPA 2ZIEA 4NFHA 1A8IA 5IX8A 3LE8A 1EJBA 2OCYC 1VMKA 5EQFA 3WHIA 1PLJA 4LN1A 4NLLA 1SKYB 1Q14A 2AQIA 3H9EO 4YK7A 4OQNA 4B81A 2EW1A 4FN5A 3DQPA 4KI0A 1TIPA 2FCRA 2HQBA 2VK8A 2VXYA 5KYXA 4IGKA 3M1IA 3AY3A 3QV2A 2OG1A 3AB3A 3GIDA 3LKZA 3CY6A 4F4IA 2O4CA 4IZOA 4G89A 1QCYA 4TPKA 3VNAA 4XWAA 1GUDA 1NDUA 1WZNA 3RUIA 2HX1A 4CFYA 1C9DB 1WVGA 1P1RA 1W73A 2GPTA 4FK8A 1XIVA 3R3WA 2NZ8A 4XARA 5D1HA 2YX1A 1T3GA 2AKAB 3V1MA 2GERA 4UU7A 1OV4A 1ULUA 1Y1LA 2CUNA 3JYNA 1HTWA 3AV3A 4KXUA 1KO5A 1ZNYA 4UBIA 4HS4A 3KKEA 4FHEA 3NC1C 3GGCA 2Z1NA 1VSUA 5BMOA 2BTQA 1GFZA 5BSVA 3P52A 5CB4F 1E9DA 2FQWA 5ILGA 1L5MA 3QHQA 4I55F 4G07A 5EKTA 2WHPB 3KQYA 5EQDA 2QTVB 1Q1EA 2WZBA 2FHSA 2ZT8A 1BMTA 3A4YA 1ORIA 3JQ9C 4W8HA 3FIJA 2QYTA 1K68A 2GD6A 4CM5A 3CUYA 3TLEA 5BYJA 3MUOA 1C7EA 3EVGA 2HA7A 2P2GA 5C0OE 3CE6A 5IUNC 3ICVA 4F2DA 3WGOA 3MIZA 4PYLA 3G9UA 2AG1A 3C14C 2YIJA 5KNDA 1ISHA 2OGZA 3BFPA 3RFFA 2XGJA 1FY2A 3VJMA 3K35A 5I9SA 4YHBA 4H0CA 2YC2C 4EITA 4B32A 4R9UC 2J33A 3GWZA 4H1HA 5DNCA 2RC5A 5JCZA 4MPPA 4LF9B 4IGEA 3N3BC 1Q5PA 3TNDA 1ECPA 4BQNA 3I73A 2M2IA 1CR0A 3PI7A 4RXMA 1U0FA 1W6UA 2F17A 1UC8A 3WWCA 1HQDA 5HCNA 4AUMA 4XCXA 4Q3KA 3BDVA 2VJLA 5I5GA 1Z5PA 3ZHOA 4V1CB 4YMIA 2QJRA 3H9UA 1S0UA 3BA1A 3Q7SA 1D4AA 1Y4DE 1IU9A 1NUTA 1BCSB 2VLBA 1FJXA 3PGLA 5DM4A 1V3UA 2R6FA 5EXTA 2AYZA 1U8AA 4EGQA 2E7ZA 2RJOA 1GA4A 3L7YA 4EPYA 2X8JA 1UFOA 3OHSX 3UBMA 3KQVA 2VDQB 3ND7A 1NBHA 2PIAA 3TIXB 3MTDA 3HP1A 1HYGA 1CY0A 1DC5A 4DV5B 1EFUA 1Y1TA 2WT4A 3PDIA 2P9FA 4HEQA 5DXFA 5B58C 3D1JA 3SS7X 5BV1A 4CN9A 1Z68A 1VPDA 2GXSA 1CE8B 3I32A 4HSGA 4BLUA 1NVKA 5JCJD 3CKKA 4MUFA 2RSLA 5AO9A 1W5EA 2VO1A 4BCCA 1ZSVA 2RGYA 1QYWA 2DUUA 1WABA 5JTUA 1SVSA 2X9GA 2RGNC 3ITEA 5DNAA 4CPDA 4PONA 5GM1A 4EI8A 4ENQA 3ADCA 2C4NA 1OZHA 5KYYB 2VRCD 5DW3A 5AXBA 1RMQA 4CUJA 1MGPA 1YIAA 2HWYA 2XLCA 4QULA 5K8UA 5KOJB 3WGIA 1MX9A 1SB8A 3HMKA 1K5GA 1Q0PA 3DMYA 5DOZA 5KSPA 7YASA 1I30A 2VC2B 4WPGA 1E2FA 1E62A 3LA6A 3PUHA 3T3DA 5IFKA 5JZVA 1Q16A 3OJWA 2N9UA 3LW8A 4ZZ3A 3DT6A 4LFBB 2E5WA 3ZW9A 2PPVA 3I04A 3KFXA 4URFA 1ZVQA 1T5LA 1DWQA 3PCTA 4ILKA 3V3KA 3SX2A 4U8GA 3AHDA 5JSQA 2JCGA 2Z5LA 3PQ2A 3AJEA 3L8MA 1RI5A 4CQLA 1M1YE 3HDQA 3B38A 4Z4IA 1BWQA 2GO1A 1CS0A 2C9CA 3K6JA 2WJ3A 1KMCA 1NBAA 4UU0A 3ZD8A 2QZJA 3AJDA 4EAQA 2OCBA 4GKJB 4BVEA 2R6DA 4Q3LA 3V8NA 2IA5A 2OMKA 1LLCA 2AUMA 5AOAA 1KZHA 3OSZA 3ACDA 4WFKA 2QRHA 3UTCA 3RV3A 1QPBA 3H0CA 5AP9A 1GPMA 4S2EA 1K7XB 4ID9A 3V7YA 1K7EB 2C7BA 1L5NA 1P2BA 4TQGA 3DNFA 1FZQA 3PNKA 3W77A 1N2IA 1PFKA 3R0JA 4A0SA 3DBLB 5DTQA 3I5XA 1KP9A 3QWBA 4R2XA 3LTEA 4ALNA 3B7PA 3MTIA 1RBYA 4L8LA 1RI2A 1MLDA 2UZIR 3D3JA 4GR4A 5E9QA 1CDEA 1GPKA 3C48A 4DNQA 5K0NA 1KS2A 2CHEA 2ERCA 3PQ6A 1Z26A 1JG2A 2FUCA 4FMDF 1M5RA 1EK2A 5FXMA 2BFPA 1DRKA 5BT9A 3ADOA 4F6RA 1PG0A 1N6IA 3AU8A 3DEAA 1RMYA 2B3TA 3U48A 1BH6A 1NLYA 4D9IA 3RD5A 4DXHA 1U3TA 1JLLA 2KS6A 5DYWA 3L9WA 2Z04A 4RO0A 4CW7A 2B2CA 3P0FA 4KBFA 3UGTA 4BB5A 5FT9A 4PFQA 1P2VA 1SHLA 4JT2A 4OHWA 3RH0A 1XMPA 1R15A 4MQMA 2EW2A 2AMLA 2VCHA 2QTWB 1BS2A 1JHRA 1XMVA 1HXHA 2BFNA 1UDWA 3I42A 4LV8B 4Z0PA 3BJRA 5C81A 5C80A 1ZQ1A 5I45A 1MEJA 1ZRHA 4E32A 4LISA 2I4OA 4RIHA 4UXHA 3CRW1 3GNQA 3W1WA 2XBMA 4ZAYA 2D0PB 4U00A 3CRZA 3COYA 4BNNA 3R8FA 3EIUA 2VNSA 2O7QA 4RQBA 5ALKA 1H05A 3R44A 2FMXA 4EW1A 4A0GA 3VI4B 3ABZA 1P9LA 5DNYB 3AEUA 3AF3A 4R1TA 1XQ6A 1FFWA 4B82A 4DMGA 2AXPA 2VHUA 3R7FA 3REQB 1IM2A 4CR8A 1IVYA 4UUPA 3JATA 2QTZA 2O6HA 1XELA 3KM0A 1XYVA 4J4HA 3A58B 5TPWB 5I3ZA 4C4PA 2XSZA 2JEOA 2VDJA 1FW6A 1QWSA 2F8TA 3Q7PA 5BOSB 2GKGA 1PNQA 2FZVA 4ZQEA 3UPTA 2HLDD 2QD1A 4KWTA 2P6RA 1A76A 5FJJA 4A0FA 2D1QA 3DBVO 2HRQA 1WJGA 1XTQA 3C8HA 4MVYA 3TQOA 3QX8A 2M9MA 4TWAA 1UPCA 1WXFA 2W6NA 1I2ZA 3RSHA 1Z16A 4JJGA 3TZ6A 1EXNA 3D2LA 3FG9A 3G17A 3D0OA 4E31A 2QUAA 1HT2E 3OQ1A 5CVCA 2IBSA 1NXWA 4I2NA 2FWIA 4D3SA 2ZI7A 3GAMA 1BXGB 1NOJA 3KT6A 2XMBA 5CX4A 5K09A 2AJCA 2Q5CA 2W70A 2MT9A 2HBQA 4V24A 2G09A 2ZR8A 1WG8A 2GFQA 4FX2A 4GICA 3EPKA 5KC9A 1RYBA 2OM2A 4KUHA 2G9UA 2QP4A 2W9XA 8ATCA 5IM5A 4O63O 3KVVA 2YWFA 4M8SA 3IALA 4PQGA 4ZVNA 2MSNA 1FCJA 3I2IA 1DBPA 3NVAA 3LECA 3ND9A 4J75A 5EL0A 2HYIC 2D74A 3NTXA 3X1DA 4RDHA 3WL6A 4D43A 1NM5A 3LPNA 1ZLXA 3K9LA 3RBXA 1PR1A 4AN1A 2V7PA 1K9SA 2DQSA 3CMMA 3HN2A 3JY6A 1K08A 3BXFA 3BC1A 2XWPA 3IOMA 3FBTA 4H35A 4XVHA 1L8LA 1R3UA 1M5UA 1IK4A 3WWOA 1VJCA 2OGSA 2NM0A 3BCUA 2KWIA 1I4EB 4DMKA 2VT2A 2YWGA 4F5EA 2ZE6A 3EGOA 4Q9HA 3KR9A 3NPAA 2WM8A 1WZ2A 1QYVA 2QVBA 3KU1A 4XR9A 2J09A 1Y4SA 1EFTA 1Z6GA 3C8ZA 4FCTA 1SURA 3D2BA 1EX6A 2R7NA 1FS5A 1L5WA 2M6RA 3KQPA 3T5GA 2XUAA 3UV3A 3RSSA 3ZX4A 4JBHA 2NUPA 1OZAA 3ZJYA 1XPOA 2FFAA 2HTEA 1KQOA 1LK5A 1DTWB 1Z88A 2BGJA 1QMPA 3BMNA 3CNHA 3K1ZA 1Z6QA 4UATA 4Z8XA 4GC9A 2HWWA 4QBTA 3T4XA 2F2TA 5HS4A 1NP3A 4JK3A 4K9PA 1U2GC 3N2YA 3FCSB 1PT6A 5CGZA 2OGUA 2JFPA 3QKIA 4KO2S 3UWSA 4UOQA 3C3YA 2YFKA 1Y8QA 4PXSA 2YJ4A 2OCAA 1RJFA 3WE7A 5JNLA 1OPRA 1A5AB 3S8MA 1YZ3A 2QX7A 2CBGA 1Z4QA 2CLHB 3EZFA 2FU5C 3AF1A 1BKSB 2IUFA 3RV4A 4E94A 1RZRD 3L7BA 2XHZA 4XSVA 5E4JA 1OXUA 4EA6A 2HGZA 4YRTA 2RAPA 1KJ8A 1T15A 1SCQA 4TYWA 2TYSB 2W2XA 1R64A 5K4GA 5U1PA 5DLQC 3PBKA 1V1JA 2HZ7A 4NENB 4YLGA 2V4ZA 4HDMB 1DG1G 2WTXA 4JJAA 2QPOA 4UXIA 2J8ZA 2VHZA 3ZVRA 3JV7A 1COWD 4BNVA 4EJMA 3C97A 2EGHA 4NE2A 2QRGA 4B6SA 5KEIA 2Q2WA 5JXWA 1VJTA 1VXRA 1B8OA 1SU6A 2E6UX 4PSVA 2KBFA 3L0SA 3D4NA 2G8NA 3PFHA 4BO1A 6GPBA 5KJFA 4EY4A 2JLVA 1KJ9A 1XK6A 1L9KA 4YPVA 1EK1A 2ZTSA 5FUQA 1Q6ZA 2XUDA 3FHOA 1E5QA 1H0KA 5D87A 1VMAA 2ZI4A 3KTAA 3OEEA 1OV6A 2VT3A 1GNVA 2DHQA 5AUNB 3UG7A 3V2IA 5JNSA 1TC2A 1SC1A 2IEDA 4FI3F 3NZEA 2HA5A 4TL9A 1GG8A 1XQYA 4CV2A 5CFLA 3QE4A 5EG5A 2GEBA 1G9XA 2BKEA 4QGGA 2QTCA 1MC1A 1UFKA 2GLTA 2HC9A 4I36A 2BGKA 4EZEA 1SQGA 4F04A 4K86A 3ASYA 3UT6A 4BZWA 2OY0A 3KAPA 5AVWA 1VIVA 1WV0A 1CT9A 1OXKB 5CHYA 1FTYA 4YFYA 3QFSA 2P5UA 2ZE8A 3U3JA 2GHRA 2H7YA 3CF4A 4DABA 4JMPA 4YTEA 1WSAA 3HXPA 4NRDA 4XZ3A 3SF8B 5HOQA 2LUOA 4PAGA 2AC7A 3G7NA 5DN9A 3OLCX 4QHYA 4QU8A 2VXCA 2APJA 3AGPA 4IVPA 2C1ZA 4DA8A 1X7XB 1GKIA 1QGAA 1RI4A 2C0QA 4ZU1X 1L5ZA 3EDQA 3E27A 3OPNA 5A1TA 2WNSA 4KCGA 3CGGA 3HO6A 4HRYA 1C4WA 1TM4E 4Y7CA 1N4DA 4P5DA 3VZRA 1KYWA 1IY0A 2O2JA 4EGFA 3ZD7A 1LPBB 3PDWA 2XTAA 3I2GA 5FEMA 5F7ZA 2PTGA 4DVGA 1UIMA 4PPNA 1U0GA 4AW9A 3EZYA 1CW2B 5A5EA 1A7JA 4MVXA 3JQ7B 3MPOA 3D6FA 4FBMA 4DJAA 1YZUA 4D4LA 1XRLA 4EVRA 5M5BA 1BOOA 2QOEA 3VR0A 3OFSA 2XXAA 1OBCA 4M86A 5YASA 3SEZA 1YMQA 2Z8ZA 4O1MA 1YVEI 3KB6A 4H0NA 3EVFA 3LC1O 3S1SA 4QTTB 3N2KB 1QXSA 5BQ5A 1YIDA 1E9CA 1U5AA 2J9ZB 1TU0A 4MVJF 2E21A 2VQ3A 2O8FB 4FEEA 1E1CA 1Z5VA 1Z18A 2GCGA 4FFNA 4Z0TA 2I2AA 4BLRA 4IWYA 3D59A 1K06A 3CZMA 3ID6C 1ZX1A 4LK2A 2ZJAA 3DR3A 4YX9A 3ETEA 3OZSA 1G5FA 3VC7A 3Q7IA 2XEXA 1KH3A 1YL5A 1GNSA 3DAYA 4A10A 4A8JA 4BVAA 4DOMA 3FETA 3T4EA 2W42A 1U0JA 4I1RA 5U4XA 4MI1A 1BRMA 1GCOA 2I3DA 5DRYA 1N1MA 4KK3A 4C6SA 4IP0A 3LLUA 4KOEC 3MBOA 1ITZA 4CKEA 3PD0A 3P2IA 1AB5A 4TKUA 5EY5B 3U40A 5IDQA 4COKA 1PJQA 5JXGA 1JQLB 1JR4A 1W4AA 4XDZA 1CX9B 3KDPA 1IN1A 1NW6A 5EJ4A 1NJ1A 2BT4A 4QDKA 1T5HX 3H97A 2O7VA 4EZIA 3IGFA 4FDMA 4OF4A 4ER6A 3MNFA 1C4OA 3AI2A 3FNBA 3RVSA 4BQOA 4PQYA 5ICCA 1VTKA 1H1DA 3B89A 4IEFB 4J94A 3SEQA 1RIFA 3C16C 4LRUA 3OUZA 3WLNA 3P71T 2Q7OE 1I1NA 1OBFO 5A9SA 5BVHB 3DXFA 3G49A 2XKKA 5EMKA 1DBWA 1NQ5A 3OIVA 3Q1KA 4GUDA 4QG3A 3U44A 3NGLA 2CHQA 2VNAA 4WCVA 4CGYA 4XD7D 3AM1A 1E6WA 2QJWA 3LUKA 3V4OA 1EFPB 1Z4KA 4EKGA 1B1CA 4LJ9A 1GVHA 1N8KA 2E6KA 3DBIA 3H7AA 3NAZA 3LDUA 3R7AA 1CUBA 3S99A 5I4CA 2K2QB 4KIGA 3PQCA 1C8LA 4RF2A 1T0PA 3JPWA 2XKBA 2B5WA 4HAIA 2PS9A 5EP4A 1D7OA 2JFQA 1ZUNB 2SICE 3LUCA 4QDUA 1YZLA 4JNCA 2JLXA 1FJGB 1L5RA 5CVDA 5KDDA 2F9LA 3OHMA 4N48A 3IVAA 5HX7A 3WQHA 3OIDA 5EEHA 3K6KA 4IQFA 4MEAA 5KX5B 2W90A 2PUHA 3UMSA 3UAGA 3ENKA 3IOBA 4EH1A 1UDCA 4D6YA 3FJYA 1IBMB 3ISJA 3EYWA 2M32A 2NXNA 4JXKA 1IATA 4L4ZA 3B9RA 3ZQ6A 1IUOA 1XCMA 1PYDA 1U0HC 3T7RA 2I4MA 1I1HA 3MTAA 4ZDIA 4B3FX 1I4OA 2WSMA 1VE5A 4W5TA 1U8TA 5JOQA 3R5FA 1NYRA 1XTIA 2X4LA 3GRAA 1W5AA 3PL1A 4LECA 4N65A 4YN3A 3W5BA 5IM4A 1H4SA 1XJWA 1HOXA 3IR7A 4NNPA 3DDZX 3GQVA 3OZAA 2GBLA 2PX2A 5FOSA 1UBMS 3ZW8A 1MX5A 2CFIA 3PXCX 4BC1A 4W9RA 3N76A 3UPUA 2QN9A 4RMHA 4EY8A 1BKDR 1ONBA 3OZFA 1QZXA 2O2SA 1LTQA 2IF0A 3FNEA 1AMOA 1FUKA 3O3MB 1E7SA 2D1SA 3MCWA 1DAGA 4HNHA 3AVXA 2OBYA 3KT8A 3QRWA 1YS2X 3WKAA 4RYDA 1CWUA 1P4RA 3BK7A 2OYRA 4CQMD 3I9OA 4TM7A 3PNBA 4G41A 2ZAGA 1N2EA 2RHDA 4R51A 2I7DA 2JGFA 5A4IS 3FWKA 3A6JA 2HLPA 1RYZA 2V7QD 3G2JA 4LCBA 1EFLA 1RPJA 2DQKA 4YCDA 2XMPA 1WDTA 1JR6A 1KDRA 3BFVA 2FDXA 5EJ7A 3NCTA 5GVSA 3AM3A 3ICQB 2JFGA 3NM5A 3PPIA 3E9QA 3IUNA 5DBHX 4G1VA 2BV3A 1XD2A 4KGDA 1BVYF 4P58A 1Z56C 3PEFA 3TNJA 1IIRA 1BMFA 1WKCA 4A5OA 5B6JA 4CKXA 4HY3A 5JISA 2ZWPA 3I1IA 5JWHA 1CS0B 1GITA 1AVTA 1DKNA 5JTTA 1LPNA 1V11B 1G42A 1PI3A 1YZNA 3EWSA 2RGRA 3QPUA 2NV0A 1AX9A 4HJRA 3NHFA 1L6RA 3A1EA 2DM6A 4XAQA 1RYMA 3ZE2B 2CKMA 5EHXA 1TB4A 3BS4A 1GRRA 4HWOA 4QIHA 4MV7A 4JI7B 3QVVA 5JW6A 3MMPA 3ZK8A 4GX5A 4FP9A 1Z2NX 2X4GA 3HYSA 3EFEA 4U0KA 3DV0B 3WGHA 5F4ZA 4ND1A 4N3GA 2FZKA 3E84A 1ZQ9A 1RJGA 2IYYA 4MDHA 4D97A 1U3FA 2YXBA 1S2MA 3EEYA 4FDVA 3MMZA 4JHXA 1MT0A 1T34A 3OJ0A 4FYKA 2JF0A 2W7TA 1JLLB 5KAPA 1Z7YA 1B0ZA 2GN4A 1N1EA 1QV6A 2Z08A 4R2HA 5KQRA 4ZK2A 4WW0A 2JGLA 1H85A 3DFFA 1Y5IA 2VT7A 3GEGA 3KNZA 3L1HA 4GWLA 1DFHA 1DBRA 3K0AB 4UUMA 4W5RA 2VJMA 1GHTA 2JG3A 4DF3A 2FZ5A 2NV6A 3KYDB 4RU1A 2Z6AA 4GR5A 3SYKA 3UK1A 4A2QA 3FSGA 3RS4A 5HYVA 5DI9A 1T25A 2H52A 4PZLA 3RLFA 1LJ8A 2HREA 1GZ5A 1E69A 4MJ3A 3I2HA 3U4QA 3BIJA 5C18A 2QUHA 3NHZA 3SZLA 5J2UA 4CDNA 3GNSA 3Q15C 1PJ3A 2CLIB 5CLHA 5DBOA 2JRCA 4YUWA 4MXDA 3RYFA 3OLYA 2GD0A 3AEUB 2JIZA 1RQ7A 3F90A 4AM8A 1Z5UA 2NG1A 4DSTA 1MC4A 3QOXA 1WPXA 2C3UA 2UZ3A 3OOEA 4BGIA 1O2DA 1IPHA 5GQSA 4BEJA 5DVZA 3V4SA 3P2JA 3JATB 1M8KA 5REQA 1HTTA 2NXWA 4QTUB 4QHSA 2UYHA 4GLOA 5AKEA 4Y9RA 4DA0A 3JR7A 1Z5NA 2I6UA 4Q4AB 3WGLA 3EVAA 4XJSA 1U0NA 2YNMD 3S7TA 1NVTA 3EGWA 1JRLA 5GJCA 4WZ6A 1ECGA 3B1ZA 3NNDA 4EG8A 1ND5A 3UAXA 3H5IA 1V8DA 4MMXB 1F2UB 5HIJA 3OZTA 3MJVA 1TEHA 4QAJA 1XYGA 4NESA 4F4JA 1OA1A 2NXEA 2J46A 2AJDA 1QMGA 2O14A 2YCLA 3PKIA 4HVAA 3AERB 1BEZA 3GJSA 1E3IA 2VH1A 3VPHA 1HGXA 2ZRFA 5K8CA 4LXIA 4C7OA 2NADA 2ZSIA 2H1WA 1PDVA 4BNKA 4B80A 4YRDA 1LKZA 1X7YB 3OY7A 1LBEA 3TG2A 1OB5A 1MQ8B 1D3AA 5TRTA 3K2IA 3B5IA 4JYMA 2OBXA 3ETCA 3Q6MA 4MS3B 3DLAA 3ND5A 4L22A 1OU4A 3AU9A 3UJ8A 4DUZB 2RGWA 3W5VA 1ZP6A 1WULS 3FSJX 3NTQA 3EQ8A 4JOQA 2C77A 1QUEA 1MMFB 4KK4A 1TCAA 1QFYA 1KYIA 3V8BA 4OQQA 3NBFA 3LCCA 2Y92A 3PNOA 1HFJA 2ZTVA 4JCOA 2PY6A 2ZJ3A 2H9YA 4JU8A 1C2TA 4IZHA 3VO2A 1V2GA 4DC9A 2JIDA 3T5BA 4L76A 5CDYA 1E1MA 4E7PA 2VHXA 4UFPA 2SBTA 3A3OA 1JQAA 1XEAA 3ZLJA 4S1OA 3PITA 3FFXA 4JAVC 1IULA 5IKMA 3MMSA 3TKLA 5CLQA 4M8NE 2FJPA 1NXTA 5EIEA 1IHDA 4WNCA 2FRVA 4MW7A 3TJRA 3L0PA 6YASA 1HDGO 2JKVA 3EEQA 3ZQUA 1KAEA 2ZATA 1WVIA 4DSOA 1GEEA 4HF7A 4QFMA 4B6QA 2VF2A 2X9QA 1H0SA 1SUEA 1GRQA 1Z6YA 2YZMA 1ODLA 4OQZA 1P1BA 1PTJC 3H3JA 2HV8A 1KR5A 2NUPB 2VDNB 4HVCA 4PPYA 4MB0A 3NC0C 1O77A 1C9KA 1UK7A 4GMDA 3R9IA 4BP8A 4EYSA 3DE3X 2XR1A 3BWXA 3AFOA 3CVWA 3U7EB 1F9AA 2HIHA 3ABRB 3BB1A 3DHNA 4TL6A 4ADSG 5HR5A 3C3PA 4BFXA 3TLCA 3OURA 2K6GA 1G9TA 3TRJA 3K8QA 4H7IA 1A2BA 3DR5A 3UV7A 3WL3A 3I9V1 2WC1A 5H4HA 2H5IA 3L6BA 4U7WA 1A9YA 3GLHB 1Y8QB 1EDOA 3GT0A 4XYLA 1J0AA 1SEPA 2GAIA 5TS2A 4MPTA 4PE5B 2I2BA 1AS0A 1UDAA 2XVXA 4KUGA 4UFOA 4WESB 3BK1A 2Q3CA 1OILA 3B6IA 1JDJA 3ME5A 3GD7A 1NG1A 2PO7A 3V80A 3I9KA 4DEVA 2ETVA 3HR8A 4IINA 2ZJ8A 1E8NA 1RADA 4F1KA 4ZVSA 4R2JA 4OQEA 3QK7A 1L5LA 2EJBA 4JU9A 4F06A 5I9LA 3SVLA 3FTEA 3N07A 4O8CA 4X94A 3HHEA 4KVZA 1UBEA 1N0IA 3EIQA 4C89A 1G16A 1MPTA 4Z3OA 1FNBA 4MZXA 2UYQA 5IWCA 1VE1A 4IIBA 2VDUE 1Q0SA 3G0GA 4E4RA 2ILVA 2GFIA 1O94C 2OXEA 2ZDGA 5FAXA 3SBOA 1LW6E 2D5IA 3THRA 5LZ9A 4NYMR 4XWGA 4INOA 4ROSA 2ADFA 5AKXA 4YRBA 5ES4B 3EFBA 3L7DA 2O2CA 4D0LB 3K0FB 2YINC 3GD5A 4MWEA 5DP1A 5GY7A 2YY5A 2EC5A 1QF9A 3HGQA 1WVMA 1JA1A 2BIFA 3KVYA 4NBVA 1XWIA 3KTAB 1H66A 4JGGA 3RBVA 2GRJA 3QXXA 2YZNA 3SOPA 5DCWA 2XB8A 4D26A 1S96A 2D3WA 2NVUA 3GEBA 1OWLA 3H4IA 2I54A 5ECDA 4ECEA 1DHRA 1SKUA 3MPUA 1O0SA 3OIUA 3V34A 1RLUA 3WNZA 1I80A 1PP4A 4CL8A 1DARA 3DWGA 1TEVA 4MQFB 3SJBA 4RF5A 1FFAA 5LA6A 4AYWA 3ER9A 1HDZA 1QYRA 1ZITA 3P9KA 4HRXA 3HLYA 3HVUA 3LKVA 1D2MA 1U2QA 5FOWA 1RC0A 2QRVA 2BFDA 3DM9B 4N9QA 5BXYA 3LOQA 3MS2A 4U7TB 2R8XA 1W4ZA 3GF4A 1FDOA 1CFZA 1EE2A 4IJKA 5EJAA 3BRWA 3NLLA 2FEXA 4MLCA 3RVDA 1W36B 1FLNA 2CHFA 4NIMA 5AOCA 1NAHA 2B8JA 1S7CA 4FFDA 1KJYA 4EVQA 4EYGA 3LWZA 1QFSA 4TMKA 3R0XA 2NOAA 2I3BA 4LBVA 1FRFS 3O2JA 3V97A 1VIAA 3H2KA 3R6LA 4EL0A 1VPWA 1CZLA 1K6IA 2WJHA 2WTBA 4RGBA 5G3ZA 4DM3A 3T41A 4FUQA 2YR0A 4F1WA 4MYCA 2F8SA 1QU3A 3JZIA 4PZUA 4XVRA 1T2NA 2QV0A 3GZTB 4JQOA 3VPSA 4XUCA 2I7TA 3ZS8A 4QDTA 3IV9A 3UYLA 1H69A 1DUIA 5DZSA 3AH8A 3M6VA 1U98A 2XXAB 2G9ZA 1JPNA 1LWOA 1Q2XA 5CT9A 4S24A 4YQYA 2CLMB 1CPYA 4HUQA 3M3PA 5IJWA 4FINA 4MW9A 4QGBA 1Q2UA 2IKSA 4ZEVA 2O8CA 1X8LA 2C9MA 4MGHA 3G88A 4I1IA 5EA2A 1I6WA 1HZJA 1ODSA 1P44A 2QMQA 3R6WA 1GL9B 1E1CB 1N2HA 2NYAA 2QLMA 4WFQA 4Q1AA 3KUUA 5B7GA 2ALJA 3ET5A 2XD9A 4ZYUA 3SR0A 5EJ5A 4KXYA 3FTCA 4K9RA 4MW6A 2NO4A 2DX7A 2POQX 1SVIA 3VHRA 2HHCA 5H81A 3FAKA 3STUA 5GZ3A 2P6UA 5JPCA 3RUEA 1DC7A 4WUTA 2C8LA 1XALA 1CCWA 4JDUA 3TZCA 1XJQA 1FNDA 3PENA 4HNRA 4RZSA 3FYSA 3M1AA 4I9NA 2YS6A 2IUEA 3HBNA 1YR8A 4MWBA 4NNJA 1TYDE 3DZFA 3P5BA 2B82A 4TKUB 2AXNA 2B7LA 3AZQA 3F7NA 5GAJA 1WQ1R 2P9YA 1PJZA 2PYDA 4M9RA 3WNBA 2P3OA 4P82A 1M67A 4NAUA 4B3TB 5FTJA 2BDEA 1Y1KE 4TLLB 1E1YA 1PT8A 3GDHA 1RPAA 4Y2HA 4OI0A 5FUMA 4JLKA 2BMFA 3LK7A 3O94A 5D3MA 2VSFA 1KPHA 3VPCA 3E6AA 3H05A 2X5KO 4RNCA 5AKJA 2CD9A 5BW5A 3U16A 1Y80A 2QMEA 4QOIA 1O54A 3EXG2 1CUZA 1V5GA 2NVWA 4R8VA 4MLDA 4A1FA 5A9SB 1ZN8A 1BA3A 4QJ5A 2WU4A 1H9AA 3NBUA 4Q9AA 3ZHZA 3ROXA 3U44B 4GRDA 2B9VA 4G8CA 3LP5A 1RHMA 2ZS7A 1AA9A 3PC8C 4IRUB 2V65A 5F12A 2OENG 2QE7A 3F3YA 1I9GA 2BRUA 3R7WB 2REXB 1CUIA 4D4KA 2P4SA 3BFJA 4EUNA 3EEFA 4UAVA 5KCZA 4AKGA 5M2QA 1PLLA 1SZCA 2GVNA 4E51A 1NNLA 2R6GA 3F8WA 4PGHA 4FKBA 5KYKA 4KAAA 1PCXA 4R3NA 1KDVA 5JC8A 3IRVA 4M37A 2BSAA 3MGKA 5BW8A 1JBQA 1JAIA 4NL4H 3D4BA 1ZVKA 4MRMB 4XVCA 3CB4A 3JSAA 3C74A 1Q19A 2WI8A 1XZLA 4MO9A 4ZO9A 3HCWA 4F7WA 4IIJF 3TBHA 3UNXA 2QPLA 4XSHA 3RVQA 4ER7A 1TZMA 1EVLA 3AKEA 1A0OA 2R00C 3FVQA 4WLNA 2O3UA 4P32A 3V4LA 4Q9IA 1P5HA 5ITVA 4KAFA 3CJTA 2ZPTX 3BH7A 3QE3A 1ZD2P 1QH8A 4FOLA 4O1IA 3J7TA 4PO3X 5DCUA 1N2OA 4KHPB 4X1KA 3E7XA 1RXWA 2FP3A 1TAUA 1BGWA 2BR5A 3FYCA 3IEPA 4CDGA 4WN9A 1EWVA 1X9HA 3P4XA 4K6OA 3O91A 1ZBQA 2DHRA 1U31A 1E64A 4ARSA 4CR7A 5CFQA 5AI5A 3CWQA 2RB5A 4HHEA 4XIIA 2GM4A 2ZJZA 5BWNA 1MUUA 1Z0DA 3FPJA 1E1NA 3LH5A 3OY2A 3RBAA 4BO4A 3N2ZB 3ERCA 3VKHA 2B7CA 4MQLA 4NULA 4V0SA 1MX1A 3PV0A 3GJTA 4RM2A 2HU7A 1JVNA 5AK0A 1WNTA 2GBPA 5D85A 5KTMA 4MKRA 1KVRA 4NBLA 4NQZA 4LRXA 1UKCA 4XOUA 4ZJPA 4DJJA 5AW1A 1P75A 4WECA 2P9EA 4XX0A 3ANMA 4F9FA 1MO2A 1WEHA 4D6PA 3TR0A 2ZZKA 4DFDA 1YR2A 2IU0A 2CV2A 1Q1QA 3QNMA 1P1HA 3M6WA 4G5QA 3UQYS 1MP0A 3HBAA 3RS7A 1L4GA 2KX7A 3OZGA 5EIBC 5K20A 4DIDA 2ZJ0A 5DRTA 2PYIA 4P4TA 1JT2A 1E4EA 4AKHA 2I78A 2ODBA 3OQVA 3T4PA 3UTDA 3RS3A 3ZZ1A 2JHGA 1E3DA 1XD2B 3FVTA 3OQNA 2YRXA 3G2HA 3I6ZA 1QF6A 4LQCA 4JUAA 5LYJA 1EVQA 2RH9B 3L5OA 3DDCA 2IHKA 1HE8B 4X5OA 5DBGA 2W43A 2P79A 4TN1A 3R24A 1XDDA 1G21E 1RI1A 2IDKA 3HEMA 4Q9NA 2I7CA 3PRYA 4Z7QB 4PIMA 4H6VA 3ZI7A 2JCSA 3LX4A 3DZDA 4OP3A 4ZO8A 2IPLA 4P4GA 1I6LA 3LPDA 1D04A 3OJXA 4CU2A 4DQLA 5B3LA 3A9CA 5CB0A 5DTRA 4LG1A 1RWNA 1V9SA 2VUTA 3B3AA 4JBXA 5TPZA 4QVIA 1IHXA 1FDTA 5JPIA 1OIVA 2PSFA 4GZLA 4JP3A 4BKOA 1XSEA 1IBSA 2O1EA 1JHOA 4F2WA 5C7OO 3RJMA 3ACCA 1A88A 3LBNA 2WWVD 5CBPA 4KNYA 1NWCA 3KEOA 4G23A 3LQRA 5EXPA 3WLIA 3C5VA 3ZLBA 2BI8A 1WP9A 2X0JA 2HH9A 4W1PA 2PYZA 4JR0A 3COVA 1SUBA 2JFFA 1GUFA 3UH0A 2GARA 3S2YA 3COWA 4A8PA 4KB5A 2AYYA 2Y66A 5KTYA 1Q84A 4RK7A 1ONPA 2ODWA 2GASA 3IP7A 4I5DA 3TTTA 1GTG1 2JGJA 1SKMA 2WWXA 4JBYA 3C3WA 4RQUA 2FPRA 4JITA 3ZE7A 4LCJA 1HDEA 1CUJA 2W2OA 5GADl 1A1SA 1W0JD 3GEEA 5DNEA 4MJXA 1GIAA 1YI1A 4HXGA 2F67A 2VJMB 4L0CA 4ZAXA 2ID9A 2RGCA 4H6XA 4YRCA 5ADHA 3WGVA 4DYDA 1JB9A 2DEUA 2OC4A 1NW7A 3TW0A 4D4MA 2H2IA 5HW0A 4HMPA 3T7JA 2JGIA 2ZCVA 4RD2A 1AHHA 3EAFA 3SBEA 1FP6A 2QX4A 1XBTA 1AF7A 1WDWB 1LK7A 3VJRA 3CLRC 4KREA 4G0QA 2YVLA 2ZE7A 2VUUA 4MUBA 1L7MA 1PUXA 2EKLA 3GH1A 3RAGA 4C7XA 1J06A 3A9SA 3KYCB 6REQB 4WOKA 3PS9A 3TZQA 2JANA 4B6JA 3KHSA 2HIMA 3MFYA 5JASA 2CT8A 3AR2A 4X54A 1TKBA 5REQB 4E5VA 4IHJA 2XUJA 4BBZA 3Q2OA 4BBJA 1FMLA 3NT5A 1H8ED 2QGZA 4J1QA 1TGVA 5FRDA 4ACAA 1JX6A 4XCVA 5IT9A 3ZEIA 1JH8A 2PD3A 3BE8A 2OQVA 3W6NA 3OQIA 1RHRA 4HP8A 4JODA 1XTUA 2CVFA 3OZXA 4DLLA 2WF5A 3HJUA 3IUSA 5D3QA 3ZY3A 2WSIA 3OM0A 1E4VA 4BQSA 4IFTA 5HDBB 2AMYA 3FCCA 3FZNA 4PR0A 2VRNA 3I4CA 4C7OB 2BGWA 1PEKE 1Z6XA 4ZVPA 2JLQA 2UZ1A 5J4VA 1RPZA 4KJXA 5DJ5A 2UVQA 2WU8A 3NEAA 3OF5A 3KJHA 1NDQA 3AEQA 4WX2B 4ZVQA 3SR3A 2WG2A 4X91A 2R6JA 2R6R1 1WXQA 2DUWA 3QPWA 1TRKA 4TWZA 4DNOA 1QHEA 5DBEX 2QR3A 2O2YA 2QSYA 4MQEA 3QOFA 4D3YA 1CNEA 4M2LA 2H9IA 2XMCA 2ZVQX 4FZ3A 3EFOA 3HC7A 4D25A 1X92A 4C3UA 4BFWA 4LZZA 3TRKA 4WBNB 1XFAA 4KVFA 1SCJA 4N76A 1MC8A 621PA 1R0KA 5A4JA 4BY9E 1Z4OA 3S40A 2ZJOA 4MQ5A 2VKTA 3RRBA 3P0IA 4Q3OA 3W1VA 1LF0A 2OFXA 5JAPA 5KNLA 2RGEA 3O90A 1ZRSA 4XR4A 4ZVTA 3NH9A 1YJAA 4XJTA 3AY6A 4P36A 1O5OA 2NSLA 3VNBA 2C88A 1MJ5A 4FR2A 4LZJA 2OUKA 2BN4A 2GTIA 4PX2A 5CLLA 4M1TA 1U28A 2PGNA 3IAM1 3ZHUA 1HY3A 1DX9A 3Q2KA 1H9CA 1Z0ZA 5B55A 2I1QA 3KVNA 1UDXA 4N7MA 4PG5A 5AHWA 2Q5IA 1CRZA 1AKYA 1R50A 4TKVA 4LF4B 2R5WA 2V96A 3STWA 1FQJA 1GSHA 5L7WA 4X7PA 1PR6A 5DSTA 4G4GA 1NWHA 4I50A 3CPHA 1N3LA 1D9XA 1Z13A 3RFUA 4DKJA 1POXA 3IP9A 2PMDA 3OLVA 4B3HA 4MRNA 3MTGA 5A3SA 4C30A 2OB1A 3D8NA 2H2AA 2XUPA 3ZW7A 2QTRA 2YQZA 3BMQB 4GS5A 2G83A 2CHVA 1UC4B 1B6SA 1B8PA 1WY5A 3HV0A 1TECE 3WBKA 4MV4A 4EX7A 3DOOA 4NCKA 1Y6GA 2IUYA 1CP2A 3RRZA 2FZLA 1NBIA 1W96A 1Z47A 4B8YA 4FHGA 3HJAA 1H65A 2DFKB 3T6KA 1QIFA 4XLTA 4YV0A 2J85A 1MF7A 1P5RA 4URHA 2UKDA 1MABA 4RSHA 2A5FA 1M0WA 3O8LA 1KAOA 1D2CA 1EZ1A 1FK8A 3WL5A 3DVRX 5CEJA 1FB5A 1DKMA 4FPXA 1GU0A 4Q03A 4NDAA 4ZV4A 1YBAA 2IY9A 2JH9A 1H0RA 4PYMA 4E5PA 1CR1A 2A1UB 3ROGA 3T8YA 1Q0RA 2XHEA 1CZOA 1CQXA 4UVGA 2VF4X 5ALOA 1UJ6A 1H3FA 2KE5A 4PHTA 1OSNA 5C8YA 3HCBA 3T06B 1NR1A 1TD1A 4HV4A 2XT0A 1ISJA 3HSKA 2VJQA 4Q1FA 1XCOA 2GDZA 4GUAA 3O8OA 2XNJA 4HO1X 4UMVA 5TVGA 1AO0A 1N32B 1JBKA 1Y0BA 2BGNA 4YP1A 3PGA1 4RF3A 1V26A 2UUPA 1K1EA 2ZSKA 4JLNA 5GGYA 1AK9A 1BMDA 3ZE6A 5F2EA 4Q7KA 1G3IA 1ZI6A 1VLMA 2CXRA 1WCIA 2NO7A 4U6SA 3R7NA 1U7ZA 3GLVA 4HR7A 4ZHQF 2HZBA 1Y8RB 3BWYA 2Y1EA 2RONA 1ULSA 1NN3A 4UQPA 5AI0A 4RTKA 2HWUA 3FVRA 3ACBA 4FSXA 4HUTA 3TIIA 5KREA 2G25A 1G4AE 1ULZA 2Z5GA 3C5CA 3B2QA 3H5NA 1KSFX 4RPKA 2RCYA 3IUBA 5K8TA 2WZCA 3CKLA 2NVUB 4AMGA 7REQA 2ZQYA 4BDSA 4ZKEA 5GINE 5TQ2A 4K87A 3WL4A 2X5OA 3RNOA 3WKDA 4IBOA 2GOYA 3QXGA 4XPIA 1S2OA 4HAWA 4A73A 5IC4A 3F5SA 4AQYB 4X00A 2FPUA 2NU6A 1F5SA 4PGMA 2ZJ5A 1IEXA 5HMLA 1U2TA 6NULA 4I8DA 1G2OA 4Z7OB 3SIXA 4HDSA 5BWCA 4QXMA 4BXOA 4G1MB 3H4VA 4Z1MD 3L40A 5DHAA 3SLGA 4HB3A 2FW8A 2ZSUA 3UCFA 4ANFA 1RWOA 4OGLA 3H6KA 3W3ZB 4BO7A 1NLMA 1DX6A 1J6UA 1CQWA 1KZYC 2ACKA 3VSEA 4W4TA 2EX0A 3PJGA 2JA1A 3IUJA 1LB1B 1VECA 2L2QA 4JUIA 4QUIA 4RWEA 5BSFA 3PUXA 3QM1A 4D9HA 5EXXA 1GL6A 2WFZA 3DCYA 3BIWA 5EHNA 2BELA 2VHQA 2VUHB 3PNLA 1YBVA 1RKXA 4MKGA 3BD9A 1RP1A 4YJ3F 1OT5A 3V7WA 1E99A 1V4BA 2KBEA 5CU7A 1J8QA 5FUWA 3NFRA 2J5XA 2XCSB 4BS9A 3U7GA 4C05A 1L5GB 4Z53A 2A5YB 4X7RA 4OAQA 5H9VA 5DWQA 5AK4A 1E6KA 4C29A 5JNRA 1XF1A 1ZK4A 3GT4A 3WB1A 2GPYA 2P1DA 5DNVA 2I67A 5KSYA 1SK9A 3HUFA 2FUKA 4YT2A 3CVXA 3PC4A 3TI7A 1SU8A 2ZR9A 3CZ5A 2J3HA 3DOJA 4RABA 4UZFA 5FL3A 4Z4GA 2O8CB 5J3JA 4BOYA 1N3YA 3OZUA 4GOOD 1YMUA 3FPEA 4I8XA 4I0WB 2FN4A 1QYIA 4UUAA 5BN4B 1LU9A 2X6QA 1J33A 1SVWA 1U0OC 4YJFA 3FPAA 3VZQA 3PNQA 1XB2A 1BGVA 1ZD3A 2H3EA 1KRHA 3GY0A 3L0YA 4HDKA 3N7AA 1P9NA 2ZI3A 4XVQA 5K3FB 4A27A 4AO7A 4PG8A 4B3MB 2O2HA 1A95A 1NM5C 1SOAA 3JWJA 4XTCS 4BE4A 3AEKA 4J91A 3W8EA 3QXSA 3V9AA 3NEPX 2JDIA 1FJHA 2AKYA 1FQKA 2WIFA 4H1TA 2CLOB 4FWBA 3IVMA 5CG1A 3REQA 3IP3A 3D5EA 1R0CA 2HL6A 3L18A 3O1HB 3SQWA 1VI5A 2A14A 5EJFA 2YBDA 1U8YA 4JWTA 3QWAA 5EIWA 1Z4JA 1K86A 4D0NA 3ROZA 4CIYA 1NYLA 3C6XA 1VLJA 1P33A 1A9ZA 2FZWA 2FFRA 4UBNA 2JC3A 3ESCA 3QG5A 4NX2A 5JHGB 2XCOA 4PLGA 3Q85A 5D3MB 1OE0A 1JNYA 2YICA 3CLKA 4L0DA 4V0ME 1TZJA 4D9JA 2CUZA 1G17A 4KR0A 2OM6A 3TM5A 1Q22A 2O20A 3UMCA 3WIUA 4OP1A 4EHAA 4NMMA 1UM8A 2PCJA 3BWBA 4UD6A 1UJCA 4PPQA 3ZWAA 4G0PA 4ASUD 3R5HA 3NIDB 4YPOA 1VMDA 4ETWA 4IFIA 1TQ8A 4W5JA 1FTSA 3EB9A 1KH1A 4Z9BA 1IPEA 3WIBA 1V6AA 2VDRB 4TV9B 2L69A 4LRSB 2NACA 3KL2A 3SZGA 3P0HA 5TJ9A 1RSZA 2Q6KA 3L46A 1U7XA 1NVVQ 1P5ZB 4FYIA 4F86A 1TVKA 2JCVA 3CU5A 4ABTA 5JI3E 3FYDA 5BRAA 1T24A 2EYQA 3WI7A 1M72A 4JJFA 1DOHA 3LT1A 1AS2A 2W2LD 1D2AA 3MFQA 1CRWG 3TTXA 3TSWA 1MW9X 4BO3A 5KWVA 5FL7D 4MYRA 1TKCA 2NGRA 2QSJA 4NOJA 1IOZA 3VR2A 4LMPA 4P80A 5SY4A 1O7JA 4Q0MA 4AD8A 3D2AA 3IH5A 4PPGA 5ALYA 1QQBA 1ZICA 1TPYA 1FMTA 4EP1A 5HBGA 4Q93A 2LPMA 3VMMA 4BFUA 2F1RA 2FPOA 3VTZA 5K0ZA 1I6MA 4S1PA 4AJ9A 4P38A 1PV4A 3LC7O 3ORYA 1NA5A 2DT5A 1LZKA 1XVAA 1C9YA 4J0IA 4KIFA 4RDIA 5BMVA 4FYHA 2YHAA 2YWXA 1IHUA 3HH8A 3P0RA 5TQ0A 1QH8B 3OEHA 1YGPA 1QZTA 4BKPA 3AEXA 5F2NA 4X1KB 4IV5A 1WKBA 1WSDA 3OZWA 4EB0A 5KTPA 4ZQHA 1BHO1 1PUIA 2FZ4A 2BP7B 1VHDA 4JMLA 3S27A 4B71A 1GCUA 2XEDA 2ZCJA 3VVMA 2XYGA 3VMFA 3HB9A 2YV2A 4R4JA 4KXXA 4F56A 5FO0A 1W19A 2EFGA 1B16A 1T3SA 3NHSA 4NS1A 1CHDA 1Q6YA 1YBMA 3I23A 3VU8A 1MVOA 2C9DA 2VP3A 5EIOA 4UTPA 4ROTA 1UT5A 4YJHA 5FNVB 3ZNOA 1QRUA 2JJMA 4ARIA 1M2GA 3G8BA 1VDZA 3BGOS 5DCYA 4JFAA 5EWJA 3CVJA 4Z4FA 3BTUA 1QQTA 2AJLI 1EESA 1FFBA 3FPGA 2NX2A 1H8HD 1WMAA 2QKYA 2IGBA 1QOQB 5JHHB 5T3YA 2IYVA 3L92A 3I0MA 1W36C 1K4YA 4LYDA 3USES 1ZOPA 5FOVA 5KPDA 2PX8A 5CDHA 2TRSB 3LL4A 1E4EB 1HFWA 2ZT6A 3FA2A 5LLTA 3EX7C 821PA 1A8QA 3D43A 5EZ5A 5HMMA 2ZM5A 4BO2A 2L18A 5JS7A 1USGA 2GF0A 2WT8A 3TEFA 2ANCA 2H2FA 4B3JA 5LYJB 1ZGJA 3BT7A 2C97A 2QQGA 1P9OA 1VHJA 2PZLA 2ZIXB 3NJRA 1IJBA 4EX6A 2B69A 3IE1A 2P1RA 3SLKA 3FCOA 2QPAA 3EOAI 2A9VA 4MUIA 1QGOA 2VDKB 3HJBA 4ODIA 3WK9A 4C4ZA 1PSZA 1X1QA 5JG7A 4P5EA 5KJEA 4QT0A 4HN2A 3S2GA 3ZE9A 4C04A 3PSAA 5H02A 2Z43A 2PWYA 5KTSA 1ZPDA 3I9NA 3D3EA 1D03A 1UXGA 4FCWA 3L04A 4NFYA 2HUPA 3KAKA 4IX9A 4Q6BA 3HKBA 3WRXA 2CXQA 2IEBA 4C43A 4DLZA 1BOFA 1LW7A 1U0LA 3H2HA 4KC0A 4N40A 5AJTA 3HKCB 2F48A 4BAGA 5CBPB 2WIAA 4BVFA 1H2ZA 4MB6A 1RRFA 1W34A 1J39A 2W4IA 2B1RA 4RDCA 2PTHA 3VU1A 3ZNPA 4YDHB 4GNRA 3TVDA 4A8JC 4EHDA 3DH0A 1P18A 1OX4A 3LBAA 3OTHA 2IZ6A 4H15A 1CJMA 4I5EA 4RVFA 5COQA 4EM6A 4ESVA 1NY6A 2QVZX 4F3NA 2GLUA 4BX3A 1C0PA 1XTRA 2J5QA 2V7EA 4M0CA 3SPXA 2OK8A 1M2KA 4OHYA 3FGPA 1J0CA 2JARA 2QE6A 3A2NA 3A9VA 4ZV7A 4EW3A 1BC5A 5BV2P 1IZYA 4HNQA 2Q62A 3BWDD 1D0VA 1PK9A 2GPNA 2CXOA 4PLPA 4URUR 5A7HA 4POOA 5IT4A 3D7MA 3HL0A 3QEMB 5LQSA 4HS9A 2IEGA 3CCFA 3BM5A 3REGA 2IH4A 3EWIA 2ON6A 4LMAA 5ALZA 1I3CA 5EZYF 3EPJA 4D7AA 4RD6A 3GDOA 5NLLA 5L53A 3WB9A 2QUKA 3LXUX 2UDPA 5GPBA 3AIMA 3AV0B 4JKIA 2YFQA 1NGSA 1OH6A 3IBFA 2OV8A 1E3EA 5KNCD 3WFIA 3GAAA 4OJYA 4JSTA 2YXLA 4R31A 2R1VA 3S1LA 4WBNF 3IV6A 4O02B 3TXYA 5CEEA 4YJ2A 1USIA 4H3HB 2OZPA 1NSTA 4NAVA 1JHPA 4BNUA 5JCJA 2IBTA 3GPLA 1D1QA 1J2EA 3GMDA 3SZMA 1NSFA 3UKDA 4CJXA 4AZ0A 1Z6PA 3OETA 1YQEA 2IYRA 3N3AC 2XXJA 4Y9UA 3FCYA 1Y34E 4K1XA 1O5IA 2OCLA 5TF0A 5BWOA 3DS8A 2HRZA 2VRCA 1Z7BA 2VP6A 3M5CA 3OQIB 2ONKA 4HEA6 4DLVA 4MWTA 1P1JA 3K53A 2IWRA 5JMPA 4LFAB 3BCRA 4C08A 4HNGA 1OROA 1ZZEA 2MSKA 1G66A 4OSEA 5FHRA 3U81A 3R3HA 1B3BA 1VDMA 2GHQA 3RBZA 1LQTA 3O3OB 3UZUA 3S81A 4HQFA 3OCJA 2QJTA 1GLVA 1H9BA 3LVBA 3O2NA 3TXAA 4NU8X 4D02A 4YCMA 5EN4A 4J9UE 2BFMA 3AEQB 3JVUA 3Q2IA 3H1TA 2MWMA 3L6OO 3PHBE 2GETA 3MWFA 4GD3Q 3RHZA 3VDNB 4B4VA 2FP4B 1V4VA 3P1JA 3QUBA 1MIOA 5AD1A 3VYSB 1MB2A 1D1SA 1DBSA 3WQBA 4U7HA 2GBLC 1W48A 1GYRA 3GFFA 5BRNA 5E9JA 1A9OA 4HT3B 1QRTA 3GLSA 1NFRA 4UBLA 2ZRIA 5G0VA 4FR5A 2N0SA 3WB2A 3U6KA 2COEA 3CUWA 3KQTA 1MDBA 2C5BA 4WNIA 5TEWA 3IT1A 1TUGA 1RLJA 2C04A 2QG4A 3ZJVA 1W5FA 1W4CA 1RM0A 3CNEA 3R0QA 1SVMA 4TVBA 3KTDA 5DMXA 1EIWA 1WMEA 1U8EA 1XYYA 1R4NA 3PSHA 4QUJA 2W4MA 2X14A 3MJRA 5L4LA 3RVJA 2H8GA 3OPXA 4RZQA 4UM5A 4QEZA 1W46A 4C7MA 2VK2A 3IEMA 2NZWA 1Z75A 3LX8A 1HE3A 2CJXA 2R6CA 4IXTA 4L9WA 4X20B 2OZEA 2W0MA 3S5JA 1Y1SA 1PYOA 2ANBA 1N6HA 4CG1A 3PTZA 3VTKA 4TZ0A 1HYEA 1C5KA 3HGTA 3ECAA 3QLUA 4BNDB 3LT0A 1IBLB 3A2LA 4I50B 1QG6A 5MFZA 1FYDA 3L1JA 4F6CA 3RU3A 2X5XA 4HLQB 2AN4A 2OOKA 2X9NA 5KHOC 1H1LB 5IEBA 3U9TA 2DFPA 4OUDB 4DQ0A 2BC9A 3FYUA 2D0DA 3OO1A 5EJIA 4QTYA 1N9ZA 5CDTA 5IW8A 1FDWA 2RHMA 1LF5A 2OKCA 4DCSA 1IFXA 3D81A 4BYMA 1HPLA 3NNNA 3HRKA 4M99A 1A72A 3S29A 4LV5B 1XD9A 5L3SB 3ZU2A 1GILA 1P3DA 3DF7A 1XKTA 1QE0A 3AP3A 3I3SR 4QBHA 2ZBPA 5CD9A 3L7IA 5EPUA 4B2LA 4CV3A 1MABB 3KPYA 2JKYA 4MTCA 4EMUA 5IKPA 3RAFC 1VL2A 3BA6A 3BN3A 4JELA 4E88A 5JVDA 1T1IA 1O95D 1Z9BA 2RAFA 1D1PA 1ONNA 2C9OA 4HB4A 3FOWA 1EP3B 1EBUA 2IY8A 4HYYA 4DZRA 4F5YA 4WLEA 1R0YA 4X0EA 1RAEA 2X7XA 2CB9A 2XVMA 1QIGA 3C7KA 4E2WA 3HG7A 4WACA 3SMVA 2R79A 4IZIA 4QKQA 3AHGA 5C8YB 1KMHB 4NBTA 3SYNA 2IOQA 3VZSA 3E7PA 1YZYA 3FMPB 5EP1A 1JZSA 3O8OB 4QUKA 2VSNA 3CH7A 2HLDA 3NTVA 4LWOA 4Q12A 5K3CA 3T7TA 1XF9A 5HNKA 3VNQA 2AG6A 5I7SA 1DIGA 2AG0A 4OB8A 4P1ZA 1ARZA 1PGPA 2IP2A 4XW2A 2V7WA 1JWLA 1FVHA 5E9WA 1VG8A 1MZPA 1K9VF 4C0WA 1NFQA 3JYLA 2ZB7A 3D5QA 3WLPA 5DX0A 1QKIA 4A7PA 2DHDA 4NFLA 2KJQA 1SBNE 1NW3A 2GCPA 2LCFA 4DCPA 4JI5B 4CIAA 1K75A 3EIFA 3SN6A 1HURA 1IXKA 4HLNA 2EEPA 4RCVA 4BQFA 5FO1A 1KJZA 4O3MA 1D6SA 1BFUA 1U8FO 5DM70 1JSCA 1LXCA 3GVPA 3BD6A 4X97A 5TMDA 4XUEA 5JWOA 2OQIA 3LUPA 2BI7A 2Y76A 3AETB 1P1IA 2A4MA 2XAAA 3PXDA 4KL8S 4LOLA 2Q1XA 2G1UA 2OCDA 3USCS 3ZE1B 4ALJA 5EUQB 5EOVA 3TECE 3RAEC 4HDSB 4EKEA 4BJ6A 4RD1A 5HA5A 1LDNA 3A6ZA 4U7JA 4UVDA 1K66A 4YUVA 2MSEB 3G2IA 1I14A 2P69A 5E95A 3A05A 1OFIA 1QGDA 4WNYA 4KFCA 4L1KA 3GGPA 5AYVA 1GZ6A 3CCBA 2R8YA 4O2AF 1XU9A 5AM5A 4HYTA 3OP4A 1U2EA 2FMUA 1T0HB 2JLRA 2QX9A 3VDXA 2O2ZA 3KRTA 1QVAA 2V4MA 4JWKA 1YNOA 4RD3A 1HNWB 2GNPA 3THXA 3ND6A 1JKIA 2PJUA 4MLPA 5DN6D 3OIGA 4GM4A 4MW2A 2CDAA 2J6IA 3BQ9A 4Q9JA 1L1FA 1ETUA 4ZZ1A 2YN2A 3GUZA 4MKHA 1T0BA 4QLAA 1QX4A 3H2SA 4LX0A 5K8JB 1SKAA 3MC1A 4ILEA 4WOPA 2ZJ7A 4U4AA 3OU2A 1PEYA 3DEYX 5CNJA 4MWOA 4IDCA 4CKYA 1QB8A 2GSDA 1TCVA 2Z30A 1W29A 3NRJA 4NH4A 3RHTA 1ENPA 2IEAA 2GYWA 2OE2A 5I7RA 4HEHA 2CE2X 4UHFA 5LKRA 1P3JA 1HORA 1MO3A 1A97A 1M2WA 2WUVA 4N8EA 4O8ZA 4KPEC 2O50A 3AP1A 4WXYB 2PKCA 4YAGA 3L4KA 2PN1A 3QLJA 4JVSB 3TW8B 2QBYA 1WX1A 1ZSYA 1J0BA 2JIMA 3N75A 1QVVA 3HLTA 4TV9F 3CR3C 1X6VA 4CIXA 1KFEB 1Y5LA 4TLAA 2Y0CA 3G1UA 4IIEA 5JJ5A 3HZRA 3H8WA 4RH0A 5K3SA 4HDKB 1LC0A 3DUFA 1BVRA 3OPYA 1M8GA 1R12A 2YDXA 1S01A 2B36A 2YHIA 4DIUA 4AKIA 4YQZA 3AEKB 5IAKA 3W78A 1RZRA 1UMKA 3UHFA 2HU2A 1BNCA 1MB0A 2I3AA 2LP4Y 2ZIUB 4Z1OA 1APBA 3ZDCA 5FPKA 2ODNA 1FDVA 1ZOSA 4EHLA 2VTDA 1WR8A 4PNZA 1XRMA 3JASA 4KVAA 1Z5ZA 2A1TS 4IOMA 2GRUA 1G5TA 1CJSA 3SY8A 3VNUA 4WMLA 4KIWA 1COWA 4CIVA 1K6XA 5E7QA 5H83A 3LPAA 2IVFA 3RS2A 3OO0A 4MVJI 4NPCA 2B8NA 1JB1A 3QU4A 1QHHA 1U90A 5JE8A 4WEOA 3T4UA 3CB2A 4PHGA 2JLZA 5BPFA 2N1MA 3G2LA 1NATA 1A9RA 1V5FA 3AIOA 5LVAA 4GAEA 4HB0A 1Z6TA 3GXOA 3MUFA 4KDFA 3ROTA 2XCLA 1XPJA 1E7YA 1KI7A 3CZ9A 3HNOA 3R77A 1TK3A 1QIKA 2B34A 2Z4RA 3GLGA 3JS5A 1DV2A 1GAQA 2FN3A 4UE3S 1CK4A 3S3TA 3HI4A 3OT5A 3AW8A 5AKZA 1R9MA 1T4MA 3A6FA 3U9LA 4BMZA 4TS9A 3C6BA 3GLRA 2DSTA 1FSPA 1FLDA 1X7GA 3NR2A 5FNVF 2YVQA 2ZBRA 1X1DA 4PG4A 1TTPB 3WLKX 5GWXA 4F3KA 3SC4A 1XAIA 5IRCD 3A9UA 1U1DA 5DHFA 4RMGA 1ICEA 3QF4A 3NV7A 1U0TA 5CH8A 4Y6LA 3OMLA 4F12A 5JQGA 4TWIA 1EWKA 3MWDB 1GGVA 3ESBA 1XTJA 3T9DA 5IJXA 3CZCA 4GXTA 4O2BA 2IHUA 5JSFA 2QA5A 1KEUA 4XQ9A 3WFZA 3CXUA 3K9HA 4G1EB 5EMLA 1E6UA 3VAZA 1NVXQ 3N8KA 3KJNA 3LWNA 4KXQA 3KOWA 4P4SB 1AT1A 5KWIA 2PU7A 2CEAA 2CL0X 3KO8A 2FWMX 3LLSA 3EOBI 2Q6LA 3LO5A 1IN4A 2MMCA 2AOTB 2I6FA 1NPDA 3W9SA 3LA8A 4G9GA 2NMVA 5BMVB 5TQ0B 2OPBA 2P8JA 2VR1A 1QIJA 3ENZA 3PI6A 1KU0A 1QM5A 3HPQA 3K70B 1FL9A 4GWKA 1XL1A 4BPBA 2PQMA 3TH5A 4MKIA 3P2MA 1EK6A 1KI6A 5B30A 4GE0A 1F8XA 3PDCA 3AFHA 5HQ3B 2W6ID 2H8KA 3D8RA 1FFCA 2CY0A 2OBFA 5JT1A 1LQ2A 4Q21A 1Z7WA 3TLYA 1O08A 3B1FA 4M0UA 3KXKA 1XA4A 3TLGA 4YECA 2RD2A 2QM8A 1II9A 2X15A 4Q4DA 5EWJB 3RJZA 4BEVA 1P0CA 1CD5A 4GL4A 3DW3X 3ZCPA 3PHJA 5FTNA 5CJJA 2VJPA 1DUSA 4DJFC 4TMXA 4BV2A 3TRDA 1G6HA 2BFAA 3PD1A 1JALA 4PYQA 5CVUA 3I1JA 2CUKA 4ID3A 4UU1A 5J2TA 2IYLD 1AN9A 2LCIA 1QG2A 4LJRA 1KRXA 2BEUB 2AX4A 3IE2A 1CY8A 1R00A 1AS3A 2WJAA 2I1WA 1RLMA 4IGIA 1GQRA 2BL4A 3B2EA 2Q4EA 4B6OA 3BD8A 1GOTA 4GLJA 4I9HA 1E2DA 3TDMA 1O6CA 4DR7B 5JJIA 2OXRA 1X86B 5ADWA 3MELA 4Y0VA 4BO6A 2YY6A 4OB7A 5CFOA 5AVYA 5DM60 2RI6A 2VJNA 2A1TR 3DCJA 4OA8A 2OCKA 3M89A 2ZI9A 4N49A 4OAOA 4WRRA 1IM8A 1SCUA 5ALTA 5EFOA 1Z0IA 3LQFA 1QGED 5CGQB 1SXHA 2FGKA 1UBCA 1QGZA 2XWBF 3O4FA 1K6JA 2G3YA 5LZ2A 5B36A 2Q8PA 2HT6A 3S2FA 3RE1A 5EHIA 4QVGA 5LIPA 5MGNA 3G8AA 2FX5A 2YV1A 1QPZA 3FAZA 3G7UA 4XD7A 4FDAA 1D0SA 1XTSA 1XHEA 2GUGA 4F3RA 4JEHA 4HDNA 2IYWA 2WNHA 4JL6A 1J99A 3NCHA 4AYTA 1H4TA 1OX4B 5L9AA 3ZGXA 3GCZA 4URYR 1EBBA 3BWMA 1T3HA 1ZWKA 2Q45A 4Z9FA 3S5UA 1JKFA 3KOOA 1CUHA 3T3IA 5ALVA 5JH7F 1ZD1A 1C9NA 3IAUA 4R1NA 1XRNA 5ECYA 2PSEA 5CXUA 5HZMA 2B2NA 4N1AA 4CTNA 3JAMA 1SJ9A 5C9ZA 5C34B 2BPOA 2AOWA 4MS1B 5EAIA 7ADHA 4CR6A 2LNDA 2ZDHA 3MWLA 4I9UA 2NXJA 1UFVA 4R2MA 3K9CA 3P9NA 5KMGA 1A04A 1JZQA 2C9YA 3DMNA 3GAFA 3L7JA 1AIPA 3MTJA 1YA8A 2A9FA 1UFRA 1MJGM 1I33A 1YVDA 4Q4JB 4DV1B 2E4VA 2BCGY 4WD3A 2O9JA 3FFTA 4KV7A 5CT5A 4AJPA 4A4DA 5J43A 4S12A 4EY5A 3VSAA 4B3SB 4BFSA 2ZJ2A 3ICWA 5AVOA 4QQNA 3K0CA 3MMNA 4P84A 3KTOA 4Z86A 2PZMA 4NCHA 2Y77A 4HQ6A 4KH1A 3DJFA 4CKBA 2I03A 4PCAA 3RT1A 2B8WA 1Q3KA 1KJIA 2FQ1A 1E89A 4TXJA 4LE1A 3H2IA 4CIWA 4LZPA 4D99A 3HA2A 2XOKD 5KDLA 1M8JA 2HPHA 3PHLA 4HZUB 1HT0A 1OLXA 2IP4A 1IXYA 3QMVA 5E1OA 3VR4H 5B1IA 5T5QA 3E9DA 2BRUC 4JYCA 5E8RA 3WX0A 3ZBUA 3PHHA 1L5OA 5ALQA 3SBXA 4AC9A 4WK0B 2XNHA 2PANA 2Q3DA 3LCRA 4AZ0B 2EWMA 3EPPA 4KO4S 1FDRA 5HHTA 2ODQA 1Y6ZA 3KXPA 1VLVA 5LCXA 3CSSA 4TX1A 4OOFA 5LDDC 3ANNA 2Z0MA 3B85A 4CQMA 1S5PA 2WP8J 3N0XA 1T8YA 1TM2A 2GBFA 3B82A 4TLEA 3AXSA 1SD1A 4IRMA 1KI1A 4Z3KA 1RR6A 2V7QA 1G20E 2VF7A 5BQFA 2J6HA 4NBNA 3D6JA 5AJYA 5T57A 3T38A 1CS4C 3MD9A 1N5RA 3LKBA 2G17A 1NN5A 3TF5A 4HSEA 1FFSA 3KZOA 3QEOA 4DWOA 1LBHA 4F0JA 3UJBA 2AHOA 1C8KA 3U56A 4LDNA 3ER6A 2QRNA 3M6FA 1WMBA 4WT7A 1A5TA 4RIFA 2H92A 3MD0A 1MIOB 4U5XA 4YT5A 2JVKA 3KVOA 3LBIA 1G2PA 4QRHA 1BD4A 4XSGA 5FAKA 3G3EA 1A9TA 1ZM7A 3EZGA 4YCNA 2PSSA 3WLHA 2CL6X 4M9SA 1Z15A 4LDAA 2WE7A 1TIBA 2V58A 4TTQA 4FONA 2GESA 4D82A 4B1FA 1PBTA 4LDZA 3ZHYA 5E0KB 2OCPA 4P0QB 1VA4A 1VLQA 3O4JA 4I66A 1IBKB 2ZANA 1DAMA 4B85A 2OBNA 3K2QA 2KM1A 1DDOA 3GFVA 5A4AA 2YW9A 4L7QA 3X1KA 5M7EA 3F5QA 1JKJA 3O9ZA 1XCBA 4EVSA 3AUSA 3O8RA 2AF4C 1RZUA 2IXDA 3CRVA 3FIUA 3RRYA 2AFRA 3V7NA 5B6IA 4B45A 2L42A 3LY7A 5CIWA 1UBHS 3OZVA 2CVZA 2W6JD 3O03A 4O25A 1Q21A 5E6RB 3ZDRA 2RIPA 1VGRA 3DVSX 4KXWA 4MW4A 1LPOA 1GNTA 2IODA 1GR0A 2RI0A 4U2GA 4HNUA 5IN4A 4HFJA 2W2TA 2B21A 2CVHA 3FYUB 2VJOA 4JENA 1QIIA 2GD1O 1DBQA 2IZ7A 4XGKA 2J6BA 4U9HS 1WHTA 2DPHA 1UOQA 1A5BB 3CONA 3CC8A 2P9BA 5DP2A 1PL6A 4LJAA 4X1YB 3TD9A 4Y9DA 5KBYA 3UFXB 1ID1A 1RTKA 1F3OA 1RYNA 5TE9A 1O6FA 3NT2A 4ZI2A 1XLUA 2BEWA 4LYYA 1EX7A 4Q1VA 3WYNA 1D4ZA 1C30B 4P3YA 2YIDA 4MR8A 4KMMA 4BZQA 3P94A 3SE7A 3W2EA 1UOPA 2HMTA 3NV9A 2FPMA 2GR9A 5A03A 3DV2A 3ABOB 3EK2A 5JVDB 2QRZA 3KSZO 1O8CA 2QL9A 4FFOA 4PSDA 1Z62A 3O2SB 1E7RA 5KTRA 3AVTA 4MWCA 4DBVO 1O0BA 3N2GA 5I48A 3HKDB 4PSKA 1R3DA 5CFRA 3EQ2A 4F21A 1XD8A 3B12A 1Z34A 1M2OA 2QZ9A 4G5RA 1IONA 4BLQA 1ZMXA 1SY7A 4D0RA 3HI6A 1FEZA 2TS1A 2WPDD 4UXJA 3WLFA 2I65A 3WS7A 4CHTA 1QZ3A 1S7GA 1DRUA 2J07A 2X58A 2XNCA 3IQZA 2KHZA 2YNMA 4OHVA 1NMQA 1U9JA 1XPRA 1ACLA 4U02A 5CD1A 4MO2A 2HT1A 1KFBB 3WHKA 4PO1A 1YQTA 1LY1A 4JH0A 4L5JA 3QUQA 1Y4UA 3ZQJA 1SXJE 1OXSC 5CM2Z 2QLTA 5JI2E 3HFGA 2VZEA 1IZ8A 4IFBA 4JNKA 1LTKA 3FNRA 3FWHA 1VRCA 2WSBA 2ZJ1A 3UIEA 4ZZIA 4IH9A 1FDSA 4M1OA 3ROQA 4EARA 1M2VA 1U9YA 2QX6A 3R74A 1T2CA 3AB8A 1YHYA 1SKBA 4RVGA 3LWBA 2HO4A 3RHFA 4PZ9A 4W5NA 3CEMA 2Q2OA 1AKUA 4H59A 4WZAA 3IX7A 4B0OA 3QU2A 4YLEA 2ZEJA 4OYRA 3HL4A 2AZMA 5JAUA 1H3EA 2QAGA 1BHSA 1X1AA 1ENOA 2PLAA 1MRSA 5DPMA 2PL9A 1EZ4A 4H1WA 1SVUA 4FNMA 1GZDA 2R7LA 1ODTC 1JLKA 4PZ0A 1Q7CA 1GYQA 4ED9A 3D7KA 1P4JA 3G0IA 2MOKA 4MR7A 1QHXA 4X7MA 4KSBA 4BVLA 1J1UA 2X6RA 4XM1A 3M3DA 1YTUA 3K9FC 1SN7A 4NJEA 4Y0AA 2EU8A 1ZK3A 4G86A 1PR4A 2YRWA 2RKWA 1DUVG 2Q5EA 3LAWA 2ZKLA 1DQZA 2J5BA 5AUQA 4D3ZA 3THXB 3L0OA 3JQCA 1BVHA 2ECQA 2PH3A 2I7XA 4WV3A 1LSUA 1YHZA 2FA9A 3O21A 2BKAA 1ULBA 1ZU4A 4PYIA 3IP5A 3PC3A 5ARBA 5HS6A 2ZU6A 1N57A 1NVVR 1F4VA 1XVUA 3EXG1 5F5XA 1K8ZB 3EBLA 3MOSA 4PW0A 3TI9A 1SOMA 3HUDA 3HACA 3JYOA 1DAFA 1NLZA 3RSLA 4DIFA 2IS1A 1U6KA 4CEHB 1TDJA 3FLBA 4NXMB 4PX9A 1P7CA 4LKRA 3ZS9A 3U6BA 2PU5A 2WKWA 1VJ1A 1QB7A 5EE0A 1C0KA 3LF1A 3M3HA 4HGOA 4QATA 2FE1A 4MROA 6LDHA 4ZODA 4GKKB 2CFOA 1P9RA 1ESZA 4PCLA 4DN6A 2IEZA 2HDHA 4L8YA 2WR8A 4LYAA 2GXAA 3DUFB 2PEZA 3DZ8A 1XZEA 1KVTA 4DAOA 2VJKA 3HB7A 3U4AA 3UOWA 2WB4A 1EM6A 1XKQA 2DFDA 3IQHX 4NOMA 2BMJA 4WDQA 2EJUA 1FPMA 5F78A 4EF6A 4YRJA 3K73O 1ZXLA 3RWBA 1U9ZA 4KGXA 1HEUA 3K20A 4RLQA 3AFGA 3D6AA 3MWKA 2ZWVA 3Q7EA 4CZ2A 2MMGA 4DCCA 3VFDA 3AUXA 1U28C 1YDMA 3SC6A 5IANA 2QYHA 4P2BA 4BVGA 1H5UA 4AUEA 2FWBA 2RBGA 1OC4A 5JXHA 4KR2A 1E7MA 3DE0X 3NRCA 4OK3A 4RMJA 3OKAA 2DFLA 4H60A 4NS4A 4QBFA 3FNIA 4QOFA 4P7GA 4ZMBA 3HU2A 5DNUA 2VQEB 1QHHB 5BV8A 1SXIA 1R8SA 1YBHA 2QVGA 4GBJA 4O0LA 4WEQA 3T1QA 5AT1A 4DWJA 3K1JA 1N2XA 2PRZA 4ALLA 1I24A 3D5TA 1SBCA 1K7FB 1E5TA 1ZK1A 5DHSA 2J1LA 4U3JB 3W9YA 4EO7A 2HA6A 1PT9A 3Q12A 4MVJG 3GLGB 1ZMBA 1EP1B 2BBSA 2HU5A 3UHAA 2I6GA 1W25A 1KJWA 2IJGX 4LTNA 2Q6OA 4AY4A 4BB6A 3ZDAA 3UATA 1Q20A 1QIHA 1RABA 4MVJP 3OZCA 3V1TC 1YRYE 3KETA 4L9RA 3L06A 4YP0A 2C03A 1CUAA 2AI1A 2FDCA 5ALGA 3X1YA 4BJ3A 3R5SA 5J5CA 2VBIA 4C5AA 1JAYA 2EZ9A 2QTBA 4A9AA 2SNIE 3E22A 4BLSA 4PYKA 5CH3A 4B7CA 3WAJA 1AURA 1N5MA 1THTA 1K5DA 3COSA 4IQ4A 3TK1A 5I7UA 2JW5A 2J48A 3ZV6A 1EB8A 5AM3A 2CGEA 4E5KA 3TR5A 1KBOA 1CVLA 5TQVA 4HFNA 1SXJD 3NJ4A 4O2BB 4ZGGA 3HXLA 1KOJA 3GFRA 2VQDA 1UPTA 4GOND 2VPWA 4RY9A 4BV8A 5DLEA 1PG2A 1M3SA 3NWBA 4IICA 3IDOA 3TSYA 1NI5A 1N5JA 2PFGA 1GARA 1QG4A 2Y0DA 5LQMA 4NU5A 1JEAA 4UM7A 5IEJA 1T2FA 2I29A 3BH0A 3IMFA 3W8FA 1WSWA 2FSFA 3VZBA 1YDGA 1QS0A 2V6FA 3M83A 4UHEA 3U5ZB 5LUAA 4OLJA 4Y6PA 4XE5A 3U3MA 4EVIA 5FTKA 1PQWA 2Q50A 2XQIA 2O2DA 4Q82A 3K4HA 1YUNA 3AINA 4JJ7A 8ABPA 1NJ2A 1TA4A 3EVEA 1U3GA 2I62A 2ASEA 2CXHA 3FFAA 1VYTA 1U7UA 3K96A 2FSSA 3K92A 3LHSA 3JQBA 3NUZA 4IGFA 4RHTA 4TWRA 3TKAA 4E5DA 4HD8A 2VXOA 1KI6B 1ZRNA 3A3KA 3Q5GA 4KQHA 4ZVMA 3IIIA 1US8A 3A31A