4L3OA

Crystal structure of sirt2 in complex with the macrocyclic peptide s2il5
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
302
structure length
297
Chain Sequence
KERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGMIMGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Potent Inhibition of SIRT2 Deacetylase by a Macrocyclic Peptide Inducing Dynamic Structural Change
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords NAD-dependent protein deacetylase sirtuin-2
total genus 90
structure length 297
sequence length 302
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.-:
pdb deposition date 2013-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4l3oA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4l3oA01
5DGTA 1YHZA 1Q6ZA 4BN5A 2JI7A 1J8FA 2PGNA 2VBFA 4UTXA 4GM4A 4K9OA 2Q28A 3CLSD 1YC2A 1T9CA 4RMIA 3CLRD 3F6BX 2FRDC 2JLAA 4MZXA 1V5EA 4JU8A 4RJIA 4TWIA 5IMSA 5EJ9A 5K6RA 4D5EA 5MFPA 5DEIA 3CLUD 3PKIA 1T9DA 4QPZA 5BWLA 4UTRA 2DJIA 1S7GA 4UTZA 3JR3A 2EZ8A 4GPEA 4X3PA 4K9NA 4Y6QA 2H59A 4BVFA 1PT9A 3GLSA 4J16C 4L3OA 2X7JA 4IF6A 3U31A 2Q5LA 3HWWA 1V5FA 3CF4G 3FSJX 3ZGOA 2VK8A 2OO5C 3D4BA 2A1TR 3FLMA 2VK1A 4K9QA 4BN4A 4K9MA 1UPCA 4V1CB 1POXA 2NYRA 4JT9A 4RMJA 1QPBA 5DGDA 2OORC 4JUFA 1N0HA 4HD8A 3F6EX 2H2IA 1PNQA 2WVHA 5K6TA 3JWPA 4BVGA 3GLRA 3GLTA 4O8ZA 2H2GA 4JT8A 1ICIA 4KXQA 2VBGA 4RMGA 4FVTA 1M2NA 2HJHA 4L2IA 2OD9A 4KGDA 1O96B 4JU9A 2FWNA 1MA3A 1EFVA 3PKJA 2IHUA 2H2FA 4X3OA 4JSRA 1PNOA 4K9LA 3EYAA 1PO7A 1OZFA 5EJMA 5EJ5A 5EJ6A 2VJYA 3PDHA 1T9AA 4FEEA 3GLUA 2EZTA 4GM1A 4Q9DA 3FZNA 4GP9A 3IAFA 4QQ8A 1S5PA 1U2GC 2BRUC 2FN3A 4ZP1A 4IAOA 2NXWA 1U31A 1XLTC 1PTJC 1SZDA 3ZG6A 5MF6A 1E3TA 4F4UA 2Q5QA 4JUDX 1YTLA 1U2DC 2H4JA 2JI8A 1OZHA 1M2HA 1PVDA 2JI6A 4RJKA 5K3SA 3RIGA 4FEGA 5BWOA 1PI3A 4KPUA 2A1UA 4COKA 2H4FA 4F56A 5K2OA 2WVAA 3OE1A 1M2GA 2OD2A 4ZZIA 2PANA 2H2DA 2QQGA 3CLTD 2EZ4A 5EJ8A 1YI0A 3EA4A 1UPBA 1EFPA 1V5GA 1YI1A 1YHYA 1DJLA 1JSCA 1POWA 2QQFA 3U3DA 2AG0A 2FR8C 4JUCA 1UPAA 1Z8NA 4QELA 4RJJA 4K9KA 5AHKA 1PYDA 4RMHA 4GM0A 4BV2A 1U28C 1O97D 1HZZC 4K9PA 1YBHA 4MPRA 1Q1AA 2C31A 2FSVC 5FEMA 2VBIA 4UTNA 2EZ9A 2Q5JA 2W93A 3E9YA 4UUAA 1YC5A 2WVGA 1NM5C 4J1TC 2B4YA 4G1CA 4I5IA 4JUBA 4MPPA 4UTVA 5EJAA 1M2KA 3D81A 4GG1A 2Q29A 5MGNA 5BWNA 5D7NA 4Y6OA 4BVEA 2AG1A 2H2HA 2EZUA 2PGOA 4MPJA 1M2JA 4V1CI 4TWJA 1MCZA 1YNOA 2JIBA 4D5GA 1BFDA 4UUBA 4BVBA 5MFZA 5EJ4A 1Q14A 2V3WA 4Y6LA 4BUZA 1T9BA 1Y9DA 3EY9A 4BVHA 2JI9A 1OVMA 4JD5A 5EJ7A 2Q5OA 3K35A 2IHTA 4BV3A 2UZ1B 3IAEA 4C78A 4V1CA 4HDAA 4C7BA 3D7KA 1ZPDA 4IG9A 4R8MA 4UU8A 3LQ1A 1D4OA 5FYQA 1SZCA 2OD7A 2H4HA 4UU7A 2IHVA 1Q17A 2Q27A 1OZGA 3ZGVA 3HWX1 2JLCA 4FZ3A 4MQ5A 4JUAA 2UZ1A 2VK4A 3RIYA
chains in the Genus database with same CATH superfamily
2UUPA 4WUTA 3VNBA 2WA1A 2WKRA 1L7BA 2UV8A 5IZCC 4X20A 1EGHA 1V41E 1PYGA 5SYNA 1B76A 2ONZA 3K9QO 5HF9A 4RMIA 1N2ZA 5TPZA 1U0SY 3L7CA 3SJUA 2DC1A 1YQGA 2OCIA 3A58B 3E70C 3F3KA 5FOXA 3WMFA 4CFYA 5BSHA 1M8GA 5KSOA 2QB5A 1MX9A 1WF3A 1OZ0A 2AQKA 2GCIA 3EZ9A 2DFLA 3GLSA 2GM5A 4YAOA 3ZZUA 2VYVA 3PD1A 2WJPA 1CEYA 3R9XA 1X70A 1GL6A 4UEJA 4FS3A 4W9RA 2D5AA 2LKDA 2NU6B 5ITZA 2WD7B 1EDZA 3KKEA 4MS3A 4U8GA 4WUVA 3UWMA 2VDLB 2VIIA 4LECA 1KI9A 5E1DA 1V95A 3ZI4A 3H5OA 2IBSA 3CC8A 1HI9A 1QYWA 1TMGE 1GWNA 1A82A 1PFKA 2G0NA 5LP1A 5FA6A 3DZDA 1YMUA 2OCDA 2ZIXA 1L5RA 3JD1A 3Q11A 4JT4A 4KYIB 1EB8A 3BHJA 1UWLA 4IIFA 4NBTA 1P74A 4Q9LA 4XVHA 3NUZA 4KGDA 4P22A 2EFHB 5F1KA 1WWKA 2YYZA 4WLFA 3I32A 4A92A 1EFVA 2P9QA 4G84A 4LISA 3UK0A 2EKDA 2OAGA 3PT9A 4G2TA 1HQYE 1E6LA 1NW8A 3PSHA 4HQ6A 4QDJA 5DHUA 4Q9DA 1NTRA 3TSCA 1WQ1R 4BVKA 1SVMA 2PLFA 4IDDA 5IPFA 2FLWA 4EVSA 1KNXA 1MO3A 4WBSA 2RHLA 5LOVF 5K4GA 1JEEA 4FOTA 3D64A 2QSZA 3IQFA 2ZUVA 2ANCA 1U8CB 3QOYA 4GOKA 4RQAA 1XD8A 4YJ3F 3VC1A 3R40A 1EBFA 4F12A 4LZOA 1G1AA 5LYYA 1L8OA 1I9CA 6YASA 1Y8ZA 5KX5F 3KQNA 2QQFA 4C4XA 3IAM1 4WKOA 2CY0A 5DKFA 1RBMA 1EDOA 3HCEA 3ABSB 4I7EA 2AK2A 1Q50A 2FR1A 3PKZA 1Y6RA 1CR2A 1Z88A 1K3UB 1MTOA 4NARA 5AJUA 3ZY6A 4AD8A 1F8GA 4BFVA 5JZSA 1KZ6A 4AY3A 2C03A 2NAFA 3H2YA 4YUXA 2RAFA 2BKVA 3WK9A 2WG2A 1W4BA 5DI9A 3I9V1 4M36A 1NPTO 4ND3A 1TKCA 4IJQA 2ZYUX 5KWEA 3GCDA 2PD4A 3GDGA 5KAPA 3I5AA 1N9ZA 3ZD6A 2J6CA 1VL6A 5FNVA 4L4YA 5JAOA 3GLHA 1PAUA 2RK6A 4IIHA 1Q1NA 1FNNA 3L49A 3VTFA 2ZWVA 1AGRA 1AHNA 2W0SA 4G01B 1WNFA 1XGKA 4MHOA 3W5VA 4MW5A 4EAAA 3FSGD 2P67A 1P0QA 3LHKA 1G8GA 2AW3A 3OWHA 4KX3A 4QLBA 3VKHA 1M1YE 2WYVA 3B7GA 3C8DA 3L0CA 3PVSA 3KV1A 4B5KA 4F91B 2EL9A 5CX4A 2LCIA 3TPCA 4EEZA 4QGAA 4PRLA 4WIAA 4ERXA 3PX7A 2DTDA 3Q8WA 5JMOA 1R4ZA 3S2FA 4Z4QA 4G0NA 4NMXB 2N42A 1V8PA 2DM6A 2C8LA 4J4TA 2W2LD 3VDRA 1TU4A 3VR5D 2JJQA 1ZL2A 2DBQA 2R87A 3TQRA 2IS4A 1FTWA 2ZRJA 4IHKA 3IDAA 4GSKA 3D6TB 2F8TA 2D7CA 4F9FA 4ZN6A 2J0QA 2JIOA 2LE0A 3B5IA 3C70A 3OQVA 2A5GA 2ZU0C 3OZUA 1AU9A 4OFZA 2PA3A 3DSRA 3PIIA 1TB4A 2EBUA 3LLCA 3KKKA 2QN6A 3NGLA 4XZ3A 1L7NA 5IM4A 1OXKB 2MYTA 3R7WA 1GTVA 2V6IA 2WWRA 5SZJA 1OBOA 3QSGA 3RTAA 3ZCPA 1RYMA 2GN1A 4H18A 3M1AA 3KE9A 3VISA 3RAFC 3A10A 4DQUA 1F5NA 2DFPA 2WTAA 4Q9NA 2WT4A 2O4CA 3IUMA 1G5QA 4ISBA 2PFKA 1DX9A 5D1NA 2QSUA 2HO5A 1DIRA 1BE0A 2C5AA 3KR9A 1W1WA 4BRWA 4E30A 1LEHA 1D2EA 3NM5A 3O3CA 4R31A 2XXAB 3GELA 3OIWA 4QNNA 2C4VA 3PDUA 4NU0A 4M0DA 1XP8A 4WXHA 3UAOA 3WC4A 5B7QA 2X0FA 1YS6A 5C32A 4GGOA 5EP2A 2ZJOA 3RSSA 3UHPA 3EZFA 5HKOA 2I2FA 3X1WA 4S3MA 1Y3BE 2NIPA 1VKNA 4KR7A 3MXOA 1LI4A 1R0KA 3G1TA 1PR6A 3TWOA 4DNXA 3FOAA 1U3WA 4HQ0A 2AK3A 3LO5A 2P90A 3N2EA 2C9DA 1PTKA 4UEKA 2JGLA 4XM2A 4WKCA 4E7OA 3EE6A 4LTMA 2IZ7A 3FZNA 2IHKA 4ZEMA 3I09A 1R9MA 1P75A 5H02A 4P93A 1T4CB 3HO8A 4LRSB 4G0MA 2PX5A 4BO7A 5DLQC 4DMRA 4XJSA 1L5ZA 2PVPA 1T6YA 2PUFA 1I2AA 1LW6E 2A67A 3TDKA 4DLRA 1TF5A 3FTCA 5DNEA 2DUMA 3S8MA 1NAIA 1Z5ZA 3BK1A 2ENUA 1PT6A 2WEKA 1XJ0A 3PQCA 2UYYA 3UK2A 3U44B 3Q5EA 4CV2A 1PGQA 4QELA 2CFSA 4HWTA 1Q7TA 4JCCA 4MWBA 4DKXA 3HV0A 2HQOA 4HLNA 2ONJA 3EWAA 2DETA 4NJEB 4JL6A 4KXLA 1QFMA 2CL6X 3DP9A 4M6WA 4BUCA 1VL5A 3HLYA 1GPYA 4K8RB 1SXJA 1IK4A 1SUEA 2JVJA 4HNRA 3IVCA 4J90A 3S2ZA 2P79A 1QH9A 4EATA 3PZBA 1Z35A 3E58A 3QUCA 4KSBA 2X15A 3HCOA 1NVAA 2XYVA 1TJ4A 4OIMA 1G7RA 2Q29A 3D8UA 5A05A 5F76A 5JRZA 4W5QA 3AVUA 2HLNA 3ITEA 1Z12A 2GF2A 2PGOA 2QZJA 3H5AA 4IJWA 3WLHA 1LLUA 2JIBA 2XMCA 2FLKA 4R2JA 1X7YA 1JTFA 1JHXA 3P5BA 5AVQA 3K7EA 2MWMA 1KPIA 3SF0A 1EFKA 2GVNA 2HXGA 1UDAA 3KZ1E 5ICMA 4ARCA 3D7KA 2ZATA 2YYAA 1QOPB 1U7UA 1ZK3A 3KTAA 1JALA 1OLSA 3CF0A 1SD2A 3VYUB 2FW8A 3RVDA 5L7TA 3X2EA 3OBBA 2UDPA 4KB5A 4R8RA 3ND5A 4GI5A 1PQWA 1UEIA 1B2LA 2O7QA 1W0CA 4QQFA 3NAZA 1SUFA 4PYNA 3WKDA 5LP6F 5JQGA 3VR6D 4JEMA 3PQ5A 2JFWA 1N78A 5E8RA 1JLLA 4P6VF 3E4CA 4U2BA 3NWEA 3U3RA 2ZBDA 1XP5A 5THKA 1KI3A 2GPJA 1K2VN 2JLAA 4U2CA 5HQ3B 3O8DA 1P9LA 1HKHA 2NACA 3CJQA 4MVYA 4Y2HA 3VM6A 4BBJA 1J5EB 4B4UA 4ZOLF 1NI3A 3V42A 4U6SA 5GGXA 4BWYA 1LW7A 5CLLA 4OCZA 1BKYA 3D3WB 3DOJA 4K9NA 3DDZX 5E6SA 4S1NA 5T7BA 3NHLA 3FCOA 3IIJA 3IE1A 4R2WA 5I9BA 4BO5A 1ZUIA 3T99A 2Q3FA 4F6LA 2XQGA 3I9MA 3PXBA 4XH9B 3WL6A 4ZAVA 821PA 3GPIA 3IP8A 1YS7A 1ZXXA 3DQPA 4RMJA 3G5LA 3I34X 3L8EA 4FNMA 3UA3A 1ZLYA 2QVLA 2OUKA 3G9TA 2R68A 2WYWA 1FPMA 4KQXA 1K6MA 1M74A 2CDBA 2P9HA 1BCRA 4DLUA 1XCMA 2FR0A 4N5IX 3LNCA 2AG8A 3WY9A 3AP2A 1XCJA 1SUWA 3P0HA 5TE9A 1HY3A 1GQQA 1QSGA 3B9BA 4PX5A 1Y1KE 4FMDF 3M3PA 1N0IA 1EVKA 2D1RA 2HWUA 1IRXA 3KQMA 3PZRA 1DELA 4L5CA 3IAM6 4KXWA 5DN6D 3W8NA 2AI2A 5ALNA 3SPXA 1MKYA 4Y9RA 4BFTA 5C8XA 2QPAA 2HMAA 1WU8A 3WMGA 2RAPA 3FCAA 1A2KC 3MTGA 2PMCA 4AZSA 3DYBA 2V7PA 4F6CA 3EASA 3UC9A 5LQCA 3HXMA 3P96A 3WQQA 5BORA 3OTHA 2CLEB 3HB4X 4B6OA 4ND8B 3RIGA 1G6Q1 3KTAB 2LCQA 3HJRA 4DFDA 3ZOKA 4BP1A 3CN9A 3ELBA 3GMTA 3W6OA 1NR1A 3RS3A 3TR0A 4ZHQF 5I7VA 3E15A 2GKGA 3JQBC 1GILA 1VMEA 2WU0A 4KQEA 4Y1GA 3BAZA 4DRXA 2FR8C 4BKUA 1NG1A 1UPAA 2CHVA 3DMRA 3TOCA 2ZCUA 1SC6A 4LOIA 1KFBB 1UXHA 2DFNA 2Q0QA 2QMHA 2GKSA 2PLAA 1LQ2A 1RIFA 2OG2A 4JCOA 5AKLA 4B7AA 2B0CA 5KWIA 3CW8X 4DANA 4BLOA 4KQMA 2PPVA 3VHXA 2C95A 4CG3A 1RJDA 2NVUA 1GKUB 1O9GA 2Z30A 4AM8A 4AUKA 1SXGA 2J0SA 4JEUA 5HZGA 5FBWB 3ZW9A 3T34A 5JAMA 3KUKA 2FWJA 1ZWKA 4X7BA 3OJXA 2WZDA 4F9EA 2BBTA 4E5UA 1SHUX 2Z83A 2JARA 2P6PA 4J0QA 1T2NA 1V3VA 4IJUA 1JWAB 3CXUA 3O47A 4IFEA 2WSLA 5DDIP 5FL3A 4Z4GA 5AW2A 1VB5A 1BWPA 1E9CA 3UJ9A 3K73O 3KJGA 4A73A 4YT8A 2H1OA 3G0GA 1G60A 5A9TA 2WHQA 1JI3A 3VYSB 2SCUB 3PC8A 3W7BA 5LXTA 4W5RA 4MDFA 4KQ2A 2IGTA 2P27A 1RJ9B 2YY7A 3BA1A 1KSFX 2B1GA 5E4FA 1XRSB 3CNBA 3HGTA 3RBXA 1ODKA 1SG6A 6ADHA 3LC2O 3IH5A 3WSTA 1PWYE 1WCV1 2XB8A 1QWOA 1U9IC 3STWA 3V3KA 2Q28A 1WMFA 3VSAA 4CFZA 3Q1LA 3CBQA 3I01A 2H57A 1XKQA 1O9HA 4L5JA 3VGPA 5HX7A 3JQ9A 2Q41A 4JXKA 4Y2JA 3SNHA 4C4ZA 1BRMA 4JMLA 5AHRA 5T4BA 1K27A 4S2UA 3NR2A 5TGDA 3ZI0A 4EJSC 5A3JA 1QHFA 1I6LA 4HRVA 1MA0A 5JEEA 3WB9A 1YQQA 2G07A 3KQQA 2IYAA 1E0DA 3A11A 5TDHA 4DL9A 5SZHB 4OBWA 4R9UC 5JSZA 2IEAA 3RANA 5SYMA 1YB1A 1RC0A 5K6TA 1N7JA 2H2WA 3PT5A 5TMPA 3JWHA 3SS8A 4B6SA 2IOHA 4EHHA 3GIWA 1M6EX 3VDQA 1UWKA 1FSFA 5ESDA 5IKXA 2O5RA 1Y5MA 4KUEA 3GLGA 2OD9A 4KZPA 2B20A 4JU9A 2XVXA 1DO8A 3QUAA 3D6NB 4N8EA 2WUGA 5CD9A 3TI9A 3ZHZA 2IZZA 1Z5OA 1S9HA 1PR1A 2W37A 2JC3A 3P4XA 2XNDA 4ZT4A 3SQLA 3WLNA 1HFWA 4E11A 4ZHQA 3R3VA 4N54A 1JQBA 3NBMA 3EEQA 2GDJA 3HJTA 4RPCA 3EIWA 4KU4A 3A6LA 2QTBA 3VOAA 3ESQA 4DUGD 1G98A 3DEAA 1H3EA 3TQIA 4RAQA 4CL8A 1PWXA 1LRLA 2VEOA 3RHZA 1YIDA 4H31A 2AJBA 2G36A 4ZVMA 2HRRA 4PF1A 5D7BA 2IEGA 1RZ3A 1UZNA 3GYGA 4DNQA 5IWAB 1M8KA 2DUUA 2X9GA 1EVIA 1ZH8A 3D1VA 1IRIA 4MQLA 4AMYA 2VAVA 1A7JA 2QTFA 2SKDA 4NG5A 3ABRB 4HTFB 4K9KA 5DBFA 1N3BA 3IHLA 4DPLA 3PUKA 1VBKA 2IYTA 3JQ6A 2IY8A 3WGQA 3PGXA 3DKKA 2XQKA 1BYIA 2J87A 2XBUA 4E6PA 1FFGA 3B1YA 3F3SA 3IPXA 2I1LA 3OLXA 1FNCA 4QULA 5E7IA 5HCUA 1QU2A 2VBIA 2I4NA 2GYYA 1G2PA 3DUFA 5BSMA 2B3TA 4TMYA 5JZBA 4XWKA 3MINA 4J76A 4IFTA 3GRVA 3CWCA 3IELA 3O7MA 3UAWA 4IHAA 1L4UA 5KMGA 3MG9A 2BHLA 4M1SA 4WVFA 5GJVC 5C81A 1IH8A 4V0QA 1BKDR 1I7DA 3L1JA 4TKMA 1A2QA 1HPLA 3OLQA 5FL7A 2QW1A 4PPQA 4UHFA 2Q3MA 4DEVA 2CXQA 3TXXA 1KU6A 2NXJA 2OM6A 2UUOA 5FUYA 5AQ1A 3K9HA 2GNOA 4CPDA 1YQEA 4WZAB 4D74A 4DCSA 2YJNA 1IBCA 1QRAA 3D9QX 1JQAA 4MYUA 5JSZB 1CR6A 3TECE 3O1HB 5DI3A 1JKXA 1TJPB 3G7NA 4Y9DA 1V3QE 2ODEA 3BX1A 1XD2A 1YQDA 1HNXB 1GLVA 4MSUA 1SCAA 1V1MA 3FIJA 3GY0A 1XMSA 4OGLA 5A04A 3OFJA 1Q17A 2HIGA 2R1ZA 4DMGA 2UYOA 2P0YA 4H7JA 4ZVNA 1D7AA 1E1MA 2PKYX 1HLFA 5DWVA 4K0KB 3DBLA 2AN4A 1ESEA 4RYLA 1Z0IA 1MOSA 1EFCA 2O3UA 2VJQA 1J70A 2W98A 3O03A 1JDZA 1K4YA 2LWIA 4NICA 4MI3A 4JI6B 4JHXA 4P92A 3EBOA 4NMHA 3UK6A 1JDBB 1RCFA 4DXHA 3B2QA 3CUVA 3F6BX 3ZHRA 1DAMA 1PD0A 1JEQB 2BMDA 2I29A 2PWPA 2J59A 5K0CA 1U2EA 5CNKA 2DBZA 3NWOA 3W6ZA 3OT1B 2DSTA 2MSEB 1NJ2A 1OPRA 3NBKA 1EVLA 1IMOA 4AKIA 1FLDA 1JLLB 1M72A 4KGZA 3QVWA 2GJ4A 4N3GA 3DFKA 5CGQB 1ZVMA 1R74A 3OZXA 4FOSA 2BKLA 2XNCA 2G3YA 3MNFA 4CDMA 2RGRA 3WHKA 1D4FA 2QRKA 3N28A 3COYA 4INZA 1IN5A 1XZQA 3ZGNA 2Z58A 4K9MA 4R16A 5CBPA 3QFTA 2WHPA 3F1KA 4ALKA 1EH5A 3GJ0A 3STUA 4HTFA 4CIDA 9ABPA 2QN8A 4BQIA 3EEOA 4P2BA 3QENA 5LMNB 3F7TA 5K0ZA 4DJEC 1WUYA 3AEYA 5KYYB 1LH0A 3FCUB 3L6DA 1P60A 1BQEA 3GFTA 4PFSA 4AP5A 3QFCA 3ID6C 1XN1A 4Z3DA 3LBHA 4FXOA 4J2HA 3NNSA 2R4UA 3P9CA 3ZHUA 4FEEA 1N2XA 1U7TA 5JS8A 3I1JA 5JDCC 3I2YX 3LXUX 4NG4A 1XZKA 3AVVA 3WMEA 2H85A 1T4GA 1GNTA 4BX2A 4U9HS 3NUGA 1AMOA 2HT6A 1A8UA 1NUQA 5DYNA 7REQB 2W8BB 1NUHA 2WMYA 1P2TA 3WK8A 1NKTA 2HNAA 4D8WA 4YRAA 2IX3A 3R8FA 3PX3A 2XRFA 2D2FA 2V5VA 2NO9A 4LDPA 2EHDA 3HPRA 1EJ2A 4OYYA 4ZOQI 5DBHX 5F1PA 4EWLA 3C5WP 4MJXA 3WJ2A 2OA0A 3R1IA 4MWTA 1QGED 3UW1A 2W6OA 3TLYA 2QTLA 3ZIAA 1D2HA 4HNGA 3OICA 1NSTA 1QDLB 4JI3B 1FRVA 2GF9A 1Y98A 2AMJA 4B9AA 1LJUA 4BDSA 1N33B 3K16A 3I2FA 4I5IA 3SQDA 1C0EA 1WCIA 1OBCA 3WZLA 1DP4A 2VPWA 2IYNA 3O92A 1VG0B 1EGMB 4OB7A 1EXDA 2PXCA 2F3SA 1MJ5A 1U0TA 2JNWA 3FNFA 3D0QA 3BXHA 4W99A 1SOUA 4NE9A 1OYYA 1Z6QA 3FYCA 4LJ9A 3THRA 4C43A 1O58A 2YIJA 1FSGA 1A2BA 4PZEA 2HF9A 3HEMA 4OI1A 3WYEA 4DLPA 1U6JA 4EA7A 2BIFA 1U7DA 4PHGA 3ZGYA 1CS0B 5JH7F 2WT9A 2Q62A 2ZRMA 5KYXA 4CEJA 2DH5A 3E3NA 5A4AA 4RZQA 3AMVA 3ZGVA 2V5UA 4TRJA 1ADYA 3H1FA 3ZUPA 4ETMA 3WL4A 4LMRA 1FLAA 2VTBA 1G8KA 3RWOA 4BN5A 1COWA 1GCIA 4KXMA 3RR2A 1TZBA 1U2RA 5AVWA 2MHCA 2QJWA 2JAHA 2DPXA 3JTMA 2WE7A 4BRUA 2OHOA 4A2CA 1NC1A 3AL2A 3UAZA 2WJVA 5J43A 1C7FA 1C1DB 2OHHA 1PJ2A 3DAFA 3P9XA 3WIEA 2YDXA 2QX4A 4G1BA 1XQ6A 3QW2A 2CJPA 2P3LA 3G0DA 4L8GA 3O8BA 3CNEA 3JW8A 1X7XA 2OO5C 1E0KA 1ORRA 3HYCA 5C7IO 3BWXA 4A91A 2WB4A 2IKQA 2DBVO 2YYSA 3DW3X 3PP8A 4D9EA 1Z4IA 4B3RB 1CF9A 1Z5WA 1S0UA 3HNRA 4YRDA 3S2EA 1QQ7A 3TKLA 1AN9A 2NSHA 3FR7A 5K99A 2BF4A 4O6VA 4DDMA 4N0EA 5LFAA 5FTNA 5B6IA 1A7UA 1M1UA 4MVJI 4XIGS 2PUHA 4ZI7F 2ICAA 3IFSA 2QUIA 1CJBA 1FRNA 2BH9A 2PWYA 4IF4A 1H0RA 3DBRB 4G0ZA 3SOPA 4IDBA 3IUJA 1KZYC 1MIOA 1E9FA 2XDQA 3HKCB 2PAAA 2BI7A 1JSLA 3TBKA 1DCFA 1JE1A 2P1RA 1U2GC 2EFDB 3DKVA 4PZCA 1M75A 1T8YA 3JQGA 1GPMA 3R3UA 1GU1A 1QORA 1XJWA 2BGUA 2X9QA 4M8KA 5AI5A 3UBMA 1I7SB 4QNRA 4MW0A 4TSRA 4TV8B 4D02A 1K2WA 1L8LA 1APBA 1AK9A 2ARKA 1TJ3A 2WWGA 3VR3A 4I08A 2BKXA 4L4UA 4A23A 2RH4A 2RGUA 2I2DA 3AUXA 4BFCA 4ZZIA 4G07A 4LZWA 2ONKA 2BKEA 4G6ZA 1N5OX 2WWFA 1YI0A 3R4CA 5F98A 1Z17A 4AU1A 4BKOA 3OLZA 2CZCA 3KEFA 5B1DA 3A3YA 1VKOA 3U3JA 1XF1A 2JFXA 4TTQA 3FTQA 2OYRA 1Z34A 3VBEA 3VZDA 2OENG 1WB9A 4XFDA 2YWBA 2EW1A 3F2IA 2A2ZA 1DJMA 2Y4OA 2PWAA 1Z4JA 4MPRA 2V7XA 2SICE 4CV0A 1C4OA 3P94A 2OT3B 4AJPA 2IEDA 2FFBA 4IXWA 2OMEA 4O4JF 3HFSA 3MN1A 2AH5A 4UZEA 3SC4A 2MR6A 2OXFA 1WSDA 3V34A 5K0EA 4MRSA 2CE2X 4EHDA 4PG7A 5C5DA 3R7WB 2YASA 4LZPA 2H9YA 5REQB 4NCXA 3VU1A 1MAAA 1VPEA 4W1QA 2PDAA 1L5KA 1XZEA 1Z45A 3FRIA 4EPTA 3MJRA 4F8JA 4U7PB 2GD1O 3G0IA 3N0RA 4LZNA 4LZZA 5M7EA 4B3GA 4UUOA 4F85A 1W7AA 2AC2A 4U63A 4I9FA 4OV6B 3S29A 3VR3D 1ORTA 4PZZA 2BTEA 3QPDA 2PX0A 5A71A 1Q95A 3LIPA 1Z7GA 2DWPA 4KWCA 5DIFA 1ZNXA 2FAXA 4LY0A 3ZS8A 4JODA 2IT1A 1FRZA 4BY9E 1QB8A 3OURA 1ZW6A 1BMDA 3NWJA 2A5LA 1IM5A 3KPJA 4CKBA 2PBZA 3RU9A 2PZKA 2X6RA 3B82A 3JRWA 5A0VA 1NI5A 1MB9A 1ZEJA 4QODA 5T4FA 2X1MA 5HK9A 1C3LA 4U9IS 3DDHA 5GM2A 1SXHA 1Q83A 1RE1A 3RVJA 1XQXA 4ZAFA 1XEWX 2Q1TA 4ZRMA 1K8ZB 1WF6A 2ZE7A 3OZDA 3TBHA 4DJAA 2XJ4A 4Z6KA 3OM1A 2O8NA 3G2LA 4XDHA 2QE7D 4U0JA 4HNSA 4MYDA 5HTKA 3SZMA 4DEXA 3P9IA 2IL1A 3CZRA 2HU8A 4Y6QA 4G0PA 4DG8A 1OB2A 1VG1A 3GBSA 4UHBA 3I62A 2HMYB 3I30X 3LC0A 5AVYA 3D4BA 3EEFA 1W94A 4DM7A 1QFJA 2D00A 4WEOA 4F3KA 1D2MA 1FDOA 3TMKA 1I4EB 3ZV4A 1UFRA 1FMLA 1E3EA 4MS1A 3VC7A 2PXAA 3TAUA 1I4LD 3UYKA 4DT1A 4NJEA 1GR0A 2PJDA 3R20A 4YJKA 4PGHA 2X13A 3UAGA 3GP8A 4I1IA 5AWFC 2RHDA 1WXQA 4MICA 1Y48E 2A7QA 3FE2A 3R74A 2HK7A 4CMJA 3CT6A 1IN1A 2QTTA 3BGVA 1BDHA 2A5YB 1NMYA 1UC5B 2C07A 3OPYA 4JNKA 1COWD 3BJZA 1GZUA 5IBRA 2FUNB 4KXUA 3GD7A 3IBCA 1G66A 3V2HA 4TQUS 4PN3A 1NNLA 1RLJA 4WKGA 4Q4HA 4CHGA 3OQPA 5DRTA 1MUUA 2P3SA 4ZHSA 3KL2A 4OHCA 3TL3A 4URVR 3W3AD 4LYGA 4V0RA 2I7XA 2I33A 1W75A 3H2JA 1ZIDA 4XVRA 3KXIA 3ZNQA 3AHGA 2VG8A 4RF2A 5F5NA 1V39A 3FNIA 2HIAA 2J9FA 1E2QA 2XODA 3GPDG 4A36A 1JIQA 3IERA 1E96A 3SX2A 3C8HA 1ZUHA 3NO4A 2PPLA 3IIKA 1FXUA 4WLNA 3O83A 4F5ZA 4WI1A 7MHTA 2RHCA 4KN8A 2QK4A 1XDZA 2VAPA 3BRWD 5AHKA 2H4WA 2AXQA 2QTMA 4JOBA 4YMWA 2TMKA 3PC4A 1PUIA 3CLSC 4PO9A 3OZVA 3W7VA 4WBNA 3WZMA 3ZLJA 1IUKA 3ANYB 2PZJA 1J33A 1XWFA 3GUVA 5HIJA 3ECCA 1DNPA 1ZM9A 1JQ5A 2CVHA 3DO6A 3FCYA 3KB6A 4FHGA 2Q07A 4NECA 5T8KC 5JCJA 2CFCA 2DU8A 2VCYA 3U4GA 5M04A 1EVEA 1TI7A 2FPPB 1B1CA 4J2TA 2NSYA 2HRBA 4YT5A 3ZWOA 1M2JA 3BYZA 4GF5A 2XDWA 3N0XA 1WSBA 2C1EA 1C8BA 2FVXA 4JFAA 4A16A 3AL3A 4B09A 1UPFA 2C78A 1GZHB 1RKXA 3PC2A 1Y80A 4OU4A 4UBMA 5CDGA 1QIDA 2Z2ZA 4MV8A 4YHBA 5E3HA 5LUBA 4H6PA 5E6UA 3DBHA 1JA9A 4MV7A 3WBFA 2BDTA 1BE6A 5AVOA 4UM8B 4UU8A 1V6CA 2QYOA 2INGX 4KLCA 5NLLA 1V4NA 5KJCA 3ZVKA 4PGMA 3KSRA 3V1TC 4I4TB 3KPUA 4KQ1A 1CJUC 5HA5A 1L5SA 3PCRB 4LY6A 3A2NA 2Q27A 3HWX1 3WGVA 1NXWA 1PZMA 1ZZEA 4L2IB 4YCLA 5J4HA 2NW6A 2KWIA 3K6SB 3B36A 3NW9A 4QL3A 2GFIA 3GCWA 3VR2D 1KEPA 2FP4A 1W5SA 4UQOA 1J56A 5EGNA 1C5KA 2AE1A 2IOYA 4HS9A 1J8FA 1Z39A 1E1NA 1XZMA 4ARZB 5L3QA 2WINI 1RLIA 4YJDA 3KFVA 2N0SA 3WLTA 1UOQA 1IFXA 421PA 4E6EA 1ABEA 2AVDA 2V7TA 4OP1A 1FIUA 3RS7A 2EWMA 2MMGA 4EBBA 3QV2A 4DVJA 3C3MA 2HB6A 2V6FA 4LDAA 4AW9A 3EOAI 1VECA 1VOTA 1HE3A 3QP9A 4ME6A 1MV8A 3C5EA 3GB9A 1OFUX 1IB6A 5JISA 3DBIA 4LBZA 3IJ5A 2CC2A 4D4HA 3L8FA 1ECFA 1N0UA 2XF8A 3P19A 1KOGA 1I1NA 1OAOC 4LXUA 2I6TA 3V4VB 3BERA 5EE3A 3SFZA 3EZGA 4UTOA 3F97A 4U2DA 3I6ZA 4LVNA 4DG5A 1YRHA 3HSYA 4OA8A 2POQX 1N5LA 3LT4A 4HUQB 4PQEA 1ZMXA 5EYPA 5FXMA 4YXFA 1YQ9A 3MGAA 4EZBA 5BSGA 2GPYA 3OZIA 2FQYA 1FA9A 4KFRA 3EPPA 4REQA 5AVTA 3T3OA 3WLIA 2ZIVB 4K9LA 3W1EA 2GCOA 4ZK2A 2Y9PB 2FPPA 2IEYA 3Q9NA 3IUSA 3IQHX 1QYDA 3JQPA 4BP8A 4F3RA 2PX4A 1ML3A 1MRSA 1TYDE 2WG0A 2XUDA 3IAFA 2NV2B 5G1OA 3STTA 3A9RA 3BWYA 2CLFB 2XTJA 4FFLA 2R6FA 2VDVE 4FYHA 5JARA 3VR5A 4L3VA 1VIYA 1C9YA 2F17A 5KOHB 1U2DC 3LYAA 3ZZNA 3JWIA 5ESRA 4IIXA 1KMNA 3OM8A 1SG0A 1ZQ9A 3QFSA 4JJ6A 2CDAA 3GH3A 3K8OE 3CRRA 3ZKWA 1QP7A 2CNKA 1PJLA 1D2CA 3ZNNA 2XUIA 1LS6A 1M5UA 2V5AA 3L0PA 4UNPA 1T4CA 1GT6A 3VDXA 4CKEA 3FW1A 3X2FA 3MS2A 2NTYC 2BH2A 3SQWA 1SRQA 2VNJA 2WFAA 4G5GA 1L2TA 3EXEB 3Q15C 4YAIA 4X85A 4QHYA 3HU1A 3PQDA 3FFTA 1AQYA 5T67A 4MGHA 1MH9A 4D98A 3AEQB 1KO5A 3HYRA 5B3JA 1BGWA 2QU7A 3H65A 3W3AA 1HDEA 5CXSA 5F23A 3FA2A 4HDSA 4ITUA 4MMYB 2LCFA 4YYZA 4H6VA 1J2UA 1XWWA 2QTCA 3JATA 3UB3A 3NHSA 4MWEA 2DMRA 4I1OA 4U7HA 3FSEA 1TEHA 1BC5A 1ONNA 2OB2A 3AQ4A 1E2MA 2PUBA 1WVGA 2Z5LA 4V1CI 5C46F 3K94A 3WJAA 1QU3A 3V6LA 3ASZA 2Y1EA 3E84A 1KJWA 1N77A 1ILEA 4YAFA 3NU1A 2G9UA 4Y0NA 4J29A 2P2YA 4RM2A 5GOZA 3SY8A 3OKAA 3PWTA 3OQBA 4ZOAA 1CVRA 1NPYA 1YQTA 1JQLB 1SRRA 1UH5A 4I4TF 4K81B 4YWHA 2ZRPA 3KSZO 4CM8B 2PKXA 4NMLA 3ZXXA 2QUKA 4EX7A 3AFGA 1JR2A 1DUVG 3TO5A 4OOFA 1FU8A 4M1WA 3GGOA 4M0LA 4B87A 1ZYUA 1Y4AE 4OQEA 2OCPA 2I2XB 4TS1A 2XCLA 2NQ2C 3MEQA 4DV6B 2Q8NA 2X1LA 4A2WA 3UUWA 2Y0DA 2IPNA 3DKRA 4PZAA 2ZDGA 2HTEA 2ZWIA 4B4DA 4PSUA 3TZHA 1KTIA 1QP4A 3M5PA 3G7UA 1UMCB 1XNQB 2VF8A 1CP2A 2B9EA 1QBKC 2V6BA 2C7OA 1N8KA 1W52X 4PXAA 4A1OA 3IXLA 1NXQA 3BMCB 4L74A 1J1ZA 1K7EB 3TE6A 1KAQA 2CNOA 1MB4A 1ZGBA 3TQOA 1BE8A 2GBPA 1E8NA 4WADA 1IZYA 5GONB 3R5HA 4G36A 4U3JA 1GTMA 1I9GA 1FYDA 2FTKE 3Q9UA 3L0OA 2PGJA 2JIZD 1QV6A 1VCMA 4FFBB 4TYQA 4LF4B 1GAXA 2QPOA 4L3WA 3V9PA 4ARAA 2PZGA 4YMUA 3O95A 3RTGA 4UXIA 1V7CA 4FMBB 5CB6A 4V1CB 4QHTA 1BZYA 1P9RA 3BAFA 3QXSA 4LOHA 3OQOA 4JGBA 1Z47A 4BNWA 5IF9A 3PWSA 1WNTA 4JJ8A 4AMVA 1RHQA 2HHHB 4G0UA 3S2SA 1WD7A 4YJ2F 2DT8A 1E59A 2H1LA 2V03A 1Z7YA 2TMDA 4V39A 1N1EA 3ZU6A 1N2JA 2CXUA 1ULUA 1ULBA 2CKDA 4YREA 1O96B 4DLZA 4P7FA 3Q7PA 4XB6B 1A5AB 1BHO1 3AERA 3EG5A 3H8SA 4J0IA 4X3CA 5A4MS 4OHWA 1U99A 3MJFA 2EKQA 1VHQA 2MMCA 2IE8A 2AKYA 2ANBA 2QGZA 3AI1A 3N6XA 3QK7A 3U1TA 1NPDA 2ZBUA 3HVKA 2YFQA 4FWBA 1GZVA 3B6JA 2BM0A 4HFJA 1XLTC 4IR7A 4MDHA 4CF4A 5JFOA 1M10A 4KRYA 1WXDA 3G9UA 2VNKA 4HNAB 1GSIA 3TNJA 2O52A 2PNFA 1Z7EA 2VL7A 4C2UA 3GEIA 1KO7A 1U11A 5K2OA 4ZVKA 2Q2QA 5KJEA 4D8XA 4KP7A 2XE6A 3GZJA 1MG0A 2QQGA 2I66A 4BB0A 1MAHA 2GGSA 2R6JA 4NCNA 3AJEA 2ZE5A 3QWIA 1XVTA 1VSUA 2Y67A 3L8ZA 3CZAA 5HPYB 1NWHA 1T4DA 4V2UA 4YCBA 3IV7A 2P6MA 3T4UA 1KP3A 5KYWA 1IB0A 4K8OA 1ZOPA 4B3DA 4O4JB 4TL8A 1E3QA 1USVA 3DL2A 3DQQA 4HI0E 1C80A 4YMIA 1DOZA 2JJ1D 3B51X 1B00A 3LQKA 5CTAA 4OHZA 1SUBA 2I1VB 4U3JB 3LBYA 3TPFA 2DY0A 3FZYA 1T13A 3DC7A 2GN6A 5T6MA 1BTOA 1II9A 4OFWA 2Q49A 3MCUA 4IX9A 1PK7A 3H0EA 5A3SA 4LNUB 2JBWA 3ESRA 3GZNA 4Q4AA 2Y66A 4GR9A 4TS3A 4XCQA 3FBGA 4E2ZA 5ICEA 3OT4A 3ABIA 2WHPB 1E2JA 1RABA 3F7OA 5DN6A 1QLJA 2QR3A 4GZ6A 4E88A 1LS1A 4ID3A 2OGWA 3BDAA 2OE2A 5ICFA 2HM7A 3C74A 4XGNA 2I22A 4XPZA 4UHCA 4AUEA 1OLOA 1XDUA 3AJ8A 4N40A 5DBOA 3VZBA 3JARA 3ILVA 3I23A 2Z2XA 1OREA 3OETA 1GN9A 1FP7A 1I7QB 5LXTB 5HP4A 4LBVA 3MCAA 3ZXYA 1NR5A 2RONA 4GOND 3WNCA 5J4LA 2GD6A 1OFHA 4RX1A 1VA4A 1LSJA 2QMQA 2Q5HA 3H99A 2H1IA 2GK6A 3MB8A 1R0LA 2AFRA 5GONF 3RUIA 1Y6JA 3EDMA 1Y5NA 5L3SB 3TB6A 1F06A 2N46A 4D80A 1E92A 4ARZA 2YOGA 5B7GA 3NIGB 3I4CA 4MVJP 3L1UA 2CYBA 3WQHA 4U7DA 3GLIB 1ZISA 2VI5A 1KZ4A 1R3DA 2P9GA 5ALRA 4ZPJA 4NU6A 1RMQA 2WZBA 5B4UA 5K8CA 4ND4A 1GITA 3L8DA 4RE6A 3OIGA 2G1UA 4W1PA 2CF5A 3PS9A 3FPGA 4G0WA 4H7KA 3T0GA 4TKUB 1BOFA 2VF2A 1EEHA 2YFHA 2E4UA 4EENA 5JZ9A 2ZIAA 5FV4A 4TTPA 2FSVA 4LXHA 2E48A 3NBAA 3O1IC 3DPUA 2XBMA 3PENA 1CV2A 1D2AA 3BVPA 1F8FA 2QV7A 2I4MA 1KJIA 2BFCB 1ZM2A 1QH8A 3C8ZA 1JPJA 5FIUA 4BWFB 2C2YA 3KWLA 3GH1A 4I4CA 3GUHA 1ST3A 2P35A 3ESBA 4QYSA 5LLDA 4F4UA 2JGFA 3ZBUA 2GZDA 4YUAA 4DCMA 2WOOA 4ZHQB 3ZE8A 5EWMA 4BO3A 1ZVJA 3L7LA 4EA8A 4XYLA 4CIWA 1CUVA 4YRCA 5DX0A 1DJOA 2PUDA 4M0EA 4LF8B 3UMRA 1HZJA 1BFUA 1N2IA 2XRMA 1EWRA 1PSZA 3PGA1 5LJIA 1A50B 1EFRA 3DNFA 3STXA 1AQNA 2PU7A 3ZDAA 3L93A 3QNUA 4FR2A 1KFKB 4HB4A 1IUOA 5C9ZA 2Q4RA 1Q7GA 3PHLA 3G2JA 4J1NA 3LVQE 5CDFE 2O06A 4NSNA 2QZ9A 4R9NA 3SSAA 1G9SA 4CKEB 2VWHA 1BGXT 2OZLA 1XAHA 4B43A 1XMPA 2RI6A 3KKPA 3MILA 4RLFA 3EQ6A 3Q7SA 4AIRA 5DFAA 3GRRA 4RBNA 3W78A 5FOVA 4ECEA 4DSAA 1KZ7B 3FWNA 5FFMA 3C15C 4ZWNA 1ZRHA 1Q91A 4YUWA 4MGYR 2ABWA 1Y1LA 5TLSA 3TIFA 1ORHA 1FDWA 5TGZA 1G5TA 3OIYA 4IQ8A 1Q12A 5EMKA 5CHYA 4ENRA 3T15A 4Z51A 3VPCA 5EKTA 2ECOA 2UZ3A 4K6KA 2MINA 2BISA 3GDOA 4FJ2A 2I8LA 3DMTA 4OGWA 1B0PA 5EG5A 4FW9A 3ZJVA 3UMCA 2OD7A 1E2PA 2F9MA 3QGMA 1DL5A 4K6GA 4AC9A 2CUZA 2C9ZA 1WKCA 5BNWA 4WZBA 1DPGA 1KO8A 1T2EA 2QUAA 2XDYA 3AKDA 4RLQA 3ABQB 1GIAA 3K0HA 2Q50A 1SA0B 3K09C 4HOYA 4EYGA 5AM2A 5DNUA 4KR6A 3F7NA 4A2QA 1JR6A 1KAEA 4CJXA 2WJ3A 4PXYA 3U9SA 1TUBB 2FWMX 4HDKB 1Z15A 4GM4A 4C7JA 3V1KA 2PUJA 3ZR4B 4FYWA 1VE9A 3QF4A 1MENA 2R86A 3CWZA 4WNAA 4I2VA 1NJ6A 1UK7A 1DBQA 2HHLA 5GIPE 5LD2C 2JGRA 3HKEA 4OM8A 4ZV9A 5HHTA 3BIJA 4O2AB 5D2CA 4DVGA 3JD2A 5DISB 1U0FA 3CLTC 3RVRA 1LK7A 3HGQA 4UHHA 5CURA 3UF0A 3AV0B 1DG9A 4O2RA 5EXPA 3V4FA 3WGGA 5IXJA 3ZVMA 2ZJFA 3MBIA 5LA6A 2IU6A 2WSYB 5K0SA 1DXYA 3VOTA 1RYNA 1UJ5A 3TSWA 1H3NA 4GX2A 4LZAA 4P8RA 3VR2A 1AX9A 1T10A 1BX3A 5DHPA 4JT8A 1XZNA 3BXFA 3NH9A 3PE4A 4FFBA 2AWOA 2GR9A 2R4QA 2PUCA 5L51A 1DTWB 2AXEA 3IDFA 1EGQA 3LV8A 3G2MA 4EECA 3UMYA 1W4CA 3RS0A 2WNIA 4EI7A 4C6SA 2HRZA 1NV9A 2OFXA 3M89A 1SIWA 4S1WA 5FLKA 3EYAA 2PY6A 4MARA 2IWRA 3HBFA 2NYAA 4HAOA 4L27A 1HQCA 1BXGB 5D3MB 3V8PA 2FP3A 5REQA 3K0SA 3SZRA 2BRUC 2XUAA 3RAPR 3BCSA 1H5QA 3GAAA 1XI2A 3ADKA 1HDIA 3FGNA 3JX9A 2A3NA 4OUDA 4JGGA 5COAA 2ZJBA 4MI6A 4OM7A 5G0WA 5DCYA 5T4HA 4FYIA 5F3RA 4FKBA 1VE3A 1FTGA 1DJPA 2CLKB 2V7BA 2GX6A 1C8LA 1AK1A 1RFLA 1WBJB 1XLUA 2WAOA 3BK2A 4HHEA 3KB2A 4GBGA 3TLKA 5LZ4A 1YXMA 2NTVA 1L7QA 5E9QA 1E99A 3WR5A 3FFBA 1NYTA 3I6QA 1EA7A 3EC1A 1NU6A 4QO8A 1VC2A 2FPOA 4BLUA 3H8VA 2AOXA 1XALA 1MB2A 5DW3A 2F59A 3BD8A 4F1KA 1UXOA 4Y2XA 4FFWA 3LCVB 3BTOA 1EP2B 2H8GA 3V2UA 4C2BA 4PX2A 2OQVA 2C97A 1U90A 4NV0A 2WYIA 4UTNA 1DAGA 1GFZA 1LC0A 2PUVA 5SY4A 5G4LA 1UBGA 3JYPA 5K2MA 1QJCA 5C80A 1A27A 4X97A 1TM5E 2KI5A 3BM5A 4LJ7A 1CJCA 2OZEA 2NM0A 1FL9A 4FFOA 1RI5A 2ZYGA 3ZXIA 1LZKA 3DVLA 1L4KA 4S0XA 2WIFA 5IAGA 5FYDA 3UXEA 2X9NA 4BQPA 2QORA 2P6OA 4ZVOA 3IVMA 3JQQA 1LX6A 4WY2A 2OAQ1 1P4SA 3G2NA 4O02B 1VLQA 4WD3A 1U63A 3TLAA 3G8AA 2ZREA 1S89A 1S2LA 4X90A 2CSXA 2C4NA 2M6KA 4DLAA 2M1XA 2XRYA 2ZUTA 3RFFA 1A95A 5JY6A 4UU7A 1PZEA 2Z5FA 4ALNA 4TN1A 2JGNA 4WRRA 4HRYA 1LK0A 4UATA 4ZJPA 4XIYA 5FTKA 1UWCA 4B48A 5FTWA 3PUWA 3OTOB 3ZJ5A 2Z04A 4QUIA 3ORSA 4FGKA 3SCZA 3D0OA 2XCOA 3ETNA 4NOLA 4H9GA 1H6AA 4DSNA 4ND5A 3AVTA 4MP8A 5BSUA 2ZXEA 3I5XA 1GZ6A 2VQ6A 1N92A 2OVBA 4P84A 1GCUA 4NFSA 1RIIA 3HBJA 4HFNA 2P5YA 2ZBEA 2QQ0A 4MVJM 1JKMA 4RZ3A 1X14A 4OQZA 1E1KA 3C7AA 4YP1A 3WL3A 5C51B 1TZMA 3G59A 2JGJA 3ENNA 2ZVDA 4KWIA 3K70B 1XYYA 3IQXA 4D3SA 5BUZA 3GBVA 3QXCA 4ZCSA 5BSRA 2FQWA 3UMJA 1KBQA 1RE0A 2GETA 1LDMA 2G5PA 1X1EA 2JGIA 2MDTA 2R97A 5CA0B 2PL9A 2B0JA 3MMXA 4PVDA 2I6SA 2H54A 1IWBB 3MBOA 4GWKA 2O2YA 1DMSA 4F5WA 4LFBB 1UKYA 2NU7B 3VNAA 4G1UC 3H2ZA 3VKUA 2HPAA 4Q7KA 3C6XA 3OO0A 3PF8A 4Q5IA 3H3JA 4R41A 5JECA 1V8ZA 4FFMA 5HF6A 1PNOA 4X8OA 4ZQFA 3AB7A 1Z2NX 3WIDA 3WGIA 1AGNA 1UIMA 5HCNA 4KYUA 3O38A 4FE4A 1QV9A 1XRNA 4K87A 1OTXA 2RDMA 5CVDA 3ZG6A 3ED5A 3KT6A 3KETA 1P80A 3NHAA 3I04M 5JMPA 1EVZA 1VGQA 2YV3A 4LJ4A 1O08A 1TLFA 1U3GA 2FCRA 2XDQB 3HKCA 4I55A 4KBGA 2JIRA 4H3HB 1I4WA 5KYGA 3SMQA 4E31A 4QUHA 1WMBA 3GXOA 4UVIA 4CG2A 1L4LA 2C2OA 1C30B 2ZZKA 1A4XA 3QG1A 4GMGA 1FMJA 1YI1A 1I24A 1U1CA 4CNBA 4BJ3A 1HNNA 1VJ0A 1MT3A 2HYIC 3WRWA 3E27A 3GWZA 2R3SA 1ISRA 4GYKA 2G63A 2JCVA 3CN7A 1U8AA 4K2AA 5BUCA 4OI4A 3T9AA 1W34A 1FTQA 3DP7A 4H3KB 3EGWA 4P3NA 4TV9F 1XXHE 4BXOA 4ZYVA 1KK2A 4L57A 3W9BA 1TQ8A 2ZAYA 4DJTA 4OFBA 2GYUA 4KQ9A 1VL8A 3BE5A 2ZBRA 4MW2A 3T9CA 1R1DA 3FWHA 3WFZA 1GCAA 1M0WA 2QRHA 1THTA 3AOEC 3DB1A 3HCAA 1DWPA 1U0RA 4YLGA 2X1VA 5DPMA 5TRTA 4B45A 1OLSB 1G8YA 4YUVA 3ZE1B 4C87A 1UM8A 1KGSA 3L01A 4CBVA 4OQDA 3QYAA 4XA8A 1PFQA 2VP9A 3THXB 1PX2A 4ARSA 1Y8RB 2IUEA 3FKSA 1Y5RA 1R9JA 4Q1AA 3LE8A 1KIMA 4NENA 2PM8A 4AN1A 1KR5A 2FQXA 1QO7A 4HN2A 4MW4A 1CHNA 1WDLA 1JHRA 5CVTA 3QU7A 1A8HA 3ASVA 3CEHA 2Z6QA 2WYHA 4KAFA 4M1TA 3N76A 3SBDA 5AW0A 2X2OA 3KZCA 2NU7A 2EYUA 4GQIA 2ZUFA 3GP5A 1X7WA 4JL8A 2PMFA 1P7PA 1QP8A 4I50B 1Z8FA 3PQEA 4L4RA 1TYCA 1P5JA 3QV1A 2FZEA 3GZ4A 3WP0A 1KAHA 4QXQA 2A0KA 3VPXA 2YIMA 1J06A 2AF4C 4RSRA 1KE2A 5CB4F 5CFLA 2FOLA 3O4VA 1U3TA 3GLIE 5IVPA 4WFQA 3TE7A 5I7AA 4YFYA 5KI6A 2BEKA 4B3BA 1ISIA 1W49A 4BLWA 4FNAA 1F51E 3MAJA 4UKDA 3I3OA 2OLJA 4JLMA 3CLUD 1SOMA 1TZ2A 4R2IA 5IT4A 2ZR0A 2BRUA 2OR3A 4OHPA 1IHOA 2FJPA 2V7UA 4GVPA 4PAMA 2VKQA 2NO6A 1GT91 3OMWA 1Q0PA 1R37A 4GBMA 3QZUA 1PQUA 3ISJA 4H6XA 4MCAA 4QBKA 3NJ4A 2OG1A 5DK4A 3CV3A 4Y2YA 1GN8A 3UT6A 4Z49A 1TLLA 1FX0A 3UJDA 1R6AA 2AHRA 2XOKD 4MO9A 3V8QA 4RTSA 1OWNA 3C8UA 2FEWB 3GVIA 2XYPA 2ZSDA 3UJ7A 5IJ0A 2Z0MA 1WHTB 3GMSA 4TUYA 5DU2A 1GDTA 1TK3A 2BFWA 4LF7B 3F6SA 3AF1A 1A77A 4IIBA 4B6PA 1QKIA 2KYRA 4GICA 3PIRA 2MSLA 2PYZA 1LVHA 3ROKA 3VH1A 1I1QB 3L18A 2P9JA 1K92A 4JBXA 5C4IA 2BSQA 4FLEA 3TJRA 2GO7A 2ZYSA 3A1VA 3CR7A 5EIBD 3EVBA 2R8OA 4CQJA 5HZMA 5F4BA 2PLNA 4YB8A 2QN2A 3SHVA 3FYDA 4EA9A 5C3MA 3F46A 3FYUC 3AY7A 4CV3A 4IAOA 3S7TA 3KYJB 3TTTA 1JTEA 2A94A 1ID1A 1M6WA 3DR3A 3VC3A 7ABPA 1KI6A 2A9VA 4Z9AA 1ZEMA 4GMHA 4LEIA 3HGMA 2H4JA 2FWAA 1C50A 1WP4A 1USGA 2KBEA 3AM5A 4TV9A 2OPHA 2FGJA 3FUTA 3FIUA 3EG9B 1VSVA 1O6CA 3O3MB 5EJGA 4F8EA 2B82A 1F38A 2QJTA 4N3CA 5HKAA 2ZKIA 2WAAA 4S05A 3M9LA 4FX2A 3ET5A 1IXSB 1SC4A 3K5PA 3FDFA 2BMWA 1WW8A 4B7XA 3AY6A 1C3VA 4LKRA 4MKRA 4F0JA 2F3QA 4AF8A 1IPHA 2O50A 1EWKA 2MR5A 2RH9B 1P4AA 2DH6A 3PCTA 1ZHOA 1L1QA 1WW2A 2EJTA 3PNMA 3GCZA 3MRVA 2ZRAA 4MLPA 5IT9A 2VHEA 4BNKA 2HK6A 2V74B 4I3FA 4G56A 2ZPTX 3RF6A 3X43A 1NVUQ 4BGUA 2ZRIA 4ZAZA 5LKRA 2ZM6B 4ITVA 2X9VA 2YL2A 1KBZA 1GPNA 2C1XA 1SBZA 2CL0X 4CMAA 3CNQS 3MCVA 4Q1FA 3T7JA 1UBCA 1W29A 3F1LA 1RACA 3M4NA 3ZWKA 1HXHA 4FFNA 3H87A 1N1MA 2G8LA 1KDPA 3PTAA 2ZI9A 4OOEA 5P8WA 3N3BC 3HPQA 1JDUA 3FX2A 4AB1A 3D3KA 4W5TA 5JJ5A 4V1CA 2TECE 4KPEC 2P4HX 2VNHA 4YRNA 1M6YA 1N5MA 4Y2RA 4RTQA 2VTVA 2POCA 4KIWA 4XXHA 2OK8A 2G09A 1RRCA 2J4DA 3AC0A 4O2BB 2Q0HA 2A9RA 4MDYA 1OLXB 3RNLA 4LY3A 1N2BA 1PZNA 3R23A 4YC7A 3PNYA 3LDFA 1AUOA 1M2FA 3MWLA 4DWJA 2QUJA 4PWYA 2OZPA 1XE3A 2PMKA 3F47A 5I7SA 3KUCA 2BGRA 4UTXA 1K5PA 4I5DA 4HVTA 4JT2A 5ECDA 3T5BA 2XZLA 2HTFA 4MUMA 3UUEA 2B99A 4RY2A 4C0SA 1NX9A 2XGSA 2B8NA 2F1IA 3A9VA 1KXZA 5GZ6A 1DDGA 4MAAA 5B1SA 3BA6A 3VHLB 4QPZA 1D0VA 1NC3A 5KTMA 4ZYXA 1WB5A 3CH5A 1EEXB 4FC6A 4XDZA 3ONVA 2F3PA 4TKZA 2BFFB 4Q15A 1IZ9A 1W59A 2UAGA 1YKFA 3PC6A 3ZHQA 2ZJ0A 4JJKA 4NONA 5ALUA 2D8MA 4KLAA 5FWDA 4X1IB 6CHYA 4DBLC 3RADC 2ZUDA 4K86A 4P4SA 2F9LA 1GRCA 2NYRA 3NHZA 2PJZA 3P0IA 2D1SA 3HE3A 4PBTA 4RVSA 4YMLA 1B6RA 1PGOA 3DEHA 3TINA 1BVUA 1GSHA 2VOEA 3QOWA 5FFNA 1ZS9A 3AKCA 3CUWA 1D2NA 1R0SA 2HWYA 3OAAA 4V2IA 2JHPA 5LBTA 1A5TA 1UBFA 2G9VA 3FKQA 3CR8A 2NUTA 4IICA 4DUZB 1CRPA 1W48A 1XQVA 2FG7C 2LR0A 4MGEA 4EKDA 4AKGA 3ZBQA 4FFDA 5D01A 1RXCA 4I9UA 1ZONA 4Q02A 3N58A 3LA8A 5DCUA 2PFGA 1USUA 1NURA 3HABA 1NUPA 2E5WA 4Z54A 5K6AC 3X1XA 4FCVA 3GEHA 4AJLA 5L6MB 3TRHA 1N2EA 4KCGA 1I1HA 3ZW8A 5LIPA 4XARA 1JS1X 3T95A 3FYHA 2WU3A 3X1DA 1CY4A 3DE2X 3VPSA 4RHFA 2VDNB 5LSAA 4OTZA 2W8ZA 5AKKA 4JLAA 5JASA 4OGKA 3QU5A 4DIEA 2R5FA 1JXMA 3CWQA 4EIWA 3T54A 3RVPA 3U3XA 5GJCA 4R68A 2ZM5A 3GDWA 5K03A 2R7LA 4JJAA 4XEUA 1L7EA 1PL7A 4GEGA 3UA4A 3PC7A 1A7AA 3UT5A 4RVFA 5DHRA 3Q2KA 2ZSFA 2I80A 5IM5A 5LNK1 1A5SB 1WKBA 1IOWA 1XNGA 4FX5A 3EXFA 1NV8A 1P7CA 2QX9A 2ZWMA 3VOSA 4URUR 3HA7A 1P0CA 3W5UA 3OEEA 4I1PA 3OESA 3LT1A 4FIDA 5CVUA 1LDYA 1KRWA 5AHWA 3GJ5A 4WLOA 5AW5A 4KZKA 1VI2A 1QVVA 3BPSA 3A6ZA 4MINA 3RK4A 4E03A 1X1CA 3U4QB 1EA5A 4ROTA 4CODB 1JHQA 3KLMX 3QKRB 3OE7D 5JZVA 3JPWA 2EDAA 4TQGA 4E13A 5AICA 1NXOA 3RWBA 1X19A 3EGEA 3SFVA 2X5OA 5AW1A 2XMDA 5F3WB 3FUVA 1QIKA 3L6OO 2D06A 4ZCIA 2OV6A 3DE6X 4XLTA 2O5VA 3DOFA 3NIWA 3RVNA 4DM4A 1UANA 3CBGA 2HF8A 5H70A 4ENVA 4JSTA 2PS0A 4E07A 5BN4B 3T7SA 2G5CA 3IMCA 2I3GA 1V8BA 2H7VA 4FHEA 3TEFA 1I80A 4ZVSA 3BTSA 1EIWA 4MUEA 4D46A 5AKJA 3LPAA 1OFVA 3DCYA 4X1YB 2DKFA 3CFYA 5ALLA 1JIXA 1VDZA 3GI1A 2O2ZA 1L8AA 3CEPB 5AK0A 5JU6A 2BY4A 4WK2B 3QX8A 3L9WA 1X80A 2WHEA 5JLAA 4OQXA 3ZK7A 1GZ7A 4U5XA 1A1VA 1XZPA 2NO5A 1H2EA 1KSJA 3EIOA 5DBEX 2CYCA 5TPZD 4HCJA 4CLEA 5KPDA 2JFPA 2QRQA 4BAUA 5CA1B 1KDOA 1PW5A 3BD6A 4LDRA 2XE7A 1YRAA 1OGIA 1Z74A 5KQSA 3PK0A 3REQA 2QN1A 1M0SA 4II2A 4QLOA 3TSYA 2NZ2A 4ITRC 5KJ1A 4MUGA 1CUXA 4DB4A 1DAOA 3RRNA 2F1OA 4HADA 4PLPA 3AVXA 4OYHA 3BFVA 1EFVB 3W6NA 3UMVA 4QRHA 1R4NA 4BJHB 1QX3A 3QMWA 1RHJA 2W42A 2GNPA 4FDUA 1VJTA 1TVKB 4Q1EA 3R2JA 1USKA 4EW2A 5EA2A 2QYHA 5D6OA 2GA9A 2JH3A 1UDXA 3EH2A 3FZGA 5A4IS 3FTFA 3LZCA 1S3IA 3QITA 1I01A 2XTZA 2C5HA 3PDHA 1PRYA 3IGFA 3F3MA 1E8MA 3FUUA 4RKRA 4INPA 5JSHA 1U3CA 4XVQA 4H1WA 3GMIA 4KE8A 1KL7A 1NZFA 3H2IA 4ZA2A 5FOUA 4F9TA 2SKEA 4BX8A 2B3DA 4BO2A 1AO0A 2MJLA 5ERGB 1ADGA 3P45A 4M1EA 1TADA 3BN3A 3C98A 3PNSA 2QLTA 1M2GA 3OE1A 2YWCA 1E6KA 2HPZA 1ADJA 3MIZA 5HE8A 3S81A 2TMYA 3NDPA 4PRYA 3ZYCA 1V25A 1J09A 4E4TA 1E1YA 3EDCA 5CX1B 2ZBVA 3HCCA 4JHLA 5EJ6A 4BTVA 5ADVA 3IJPA 3U37A 2CBXA 1WP9A 1O0CA 2PMDA 3K31A 3O5AA 2NZ8A 1ZCJA 1O03A 3GXBA 4LJ6A 3QVGB 4YCAA 3RSQA 4AURA 2YXPX 1QOQB 4Z4EA 5G0VA 2JD2A 4FGZA 1IL0A 2P4SA 3K8YA 4OQYA 3GLGB 1K5GA 3ROZA 2QX6A 1O95D 4M7PA 3OA0A 2VH2A 1V11B 4Q19A 4D8VA 4KSCA 1Q5PA 1T1EA 4RAOA 3K4PA 4HMPA 4HQFA 4KACA 1V8OA 3AUUA 4F4FA 1E5QA 2BMEA 1U7WA 2IY9A 3HB7A 3L8GA 4FBLA 4HZGA 2G82A 1DC3A 3ZBPA 5KQRA 4RKFA 5C31A 3SEFA 4D9IA 3N8NA 4FWTA 3D43A 2GEBA 3OPVA 1T9BA 4HDNA 1F5SA 2DQYA 4D82A 2I54A 3B8EA 4J6FA 4D0SA 1KDTA 1ULAA 4RZXA 3EFEA 2ZUBA 3SHWA 3SDZA 1RW4A 1UXKA 2B8JA 3IX7A 3LP8A 5E3JA 3ZS9A 4Z4FA 4Q12A 4RYDA 3RABA 1FVXA 5L7WA 2EFEB 3DE4X 4BX9A 5JO9A 5D85A 1EPUA 3GMDA 2EQ5A 4QUAA 4I50F 2WM3A 3E23A 5EERA 3H5RA 3USCS 4BMYA 2FFQA 1IWPB 3DM5A 4U7JA 5CDHA 2YV4A 3VR0A 1H0SA 1V16B 4BB9A 5F7OA 1SHZA 1Y37A 3FPJA 3AXTA 2WPNA 1OKKD 1SQFA 4HFMA 4PICA 3QFHA 4A4DA 2QTVB 2J09A 3ND7A 4HTAA 1GG8A 4MHSA 5E1MA 4RQBA 3U2QA 4BUJA 3S8EA 2YN2A 2RH8A 4DR5B 3NFRA 4MIYA 2F8SA 4OUDB 1K1EA 5KMGB 3W1VA 1LB1B 3R6TA 4GQAA 4YAGA 4RO0A 1V6AA 3ZV6A 1O5TA 4JZKA 5CFNA 2XNHA 4YJHB 1K8YB 3EIUA 1SC1A 4R98A 5HCIA 4ZVQA 4REOA 1HWYA 3K2BA 5K05A 1IEQA 1OWMA 3IB3A 4X24A 4D97A 4CKCB 2X2EA 3DBRA 1J2JA 5FHRA 3ITDA 1KI8A 1YR9A 4A8JB 3KC2A 5L3SA 1TMOA 4RELA 2ZR7A 4AZ3A 3QM1A 4RPIA 1VJ1A 4FMDB 3ZQJA 1DOAA 3OCCA 3ZCXA 2IU3A 1YZNA 2FK8A 2YJ5A 2YS7A 3LX4A 4PYRA 4O2LA 1TL7C 5AUNB 2NOAA 4HP8A 1PL0A 1JBQA 2XMRA 3PKJA 3MMSA 1JEJA 1KYXA 1EZZA 2H5JA 4RH1A 2P9ZA 3N8KA 4QYTA 2QMUA 3MZ0A 3D7SA 3JD4A 1OGJA 2H06A 1NQVA 1X9HA 4MV4A 4WY8A 2AQIA 1PG0A 5ADWA 4KNYA 2XUGA 2JLBA 4DLWA 5JWHA 2Y1CA 4PVCA 1N4DA 3U61B 3W5IA 2P6NA 4AY5A 4CMKA 4ARVA 2NO0A 4KDEA 4BC0A 2VHZA 4O8CA 3DE5X 4ODIA 2H5LA 3DQZA 3D3QA 3F6CA 1SPXA 3TEMA 5EJ8A 4EG1A 4M8NE 3EA4A 1MX5A 4ZYUA 4J2OA 4NZOA 1MC4A 2QAGB 3JQRA 3KUUA 3P32A 4R81A 1FBNA 1NN3A 3SHQA 2HSJA 1CIPA 1MR3F 3BFXA 3GU3A 3LA6A 4WE3A 1D4AA 5EWMB 2JLYA 1Q1AA 4NPAA 2DF8A 2V0CA 1QMGA 1M2VB 5CDTA 5JZOA 3PUJA 1JZSA 1GKYA 3IURA 4ONEA 1EUDB 4IH1A 1ZGJA 2GPTA 1SMKA 4KQJA 1KS9A 2ZI6A 1QRSA 1NI4A 4NNOA 3UKOA 1LTQA 1IXZA 4CTKA 3SIWA 1H9BA 4LIPD 1R0RE 2BTQB 4ZEVA 2V8BA 5CDUA 4IFBA 2VPYA 2PLRA 3M1YA 3EULA 4ZU6X 4R2MA 4JP3A 2O2XA 2BZ0A 2UZAA 1XTQA 3WSVA 3BS4A 4KOAA 1HDXA 4DV1B 2C2BA 5D84A 3AINA 1P44A 3BF7A 1UM9A 1ADCA 4UDOA 4Z9BA 5CA0A 3ZDXB 4Q37A 3L6CA 1C3OB 3EEBA 4OAPA 4KI0A 4A03A 4P3OA 2CCKA 4A8JA 4W5NA 3PNKA 2NV0A 2DHDA 3DH0A 4OI2A 1W1IA 3V1MA 2O8EB 3MGGA 4TLEA 1E1DA 5I8WA 4MWCA 4KNVA 4KPGA 5BYAA 2IOQA 4OP2A 3TK1A 1CFZA 2JFOA 4AO8A 2HPVA 1Y8CA 2HT1A 5B5SA 3UZUA 3BQMB 3UICA 2FSIA 5JSUA 2W2NA 1RHKA 4RL6A 3KYDB 2XUQA 3MS7A 3I9NA 1FNSA 1NRIA 4YAJA 5EQDA 3W34A 1WUTA 1E62A 3O8QA 1JX6A 4IGKA 1W0KA 1CEQA 4OYLA 2FRDC 3FPHA 3OC0A 3M83A 4XPIB 3NATA 1ZD1A 1WMAA 4OHUA 5AKXA 1X7GA 2HJSA 4QU9A 2BM8A 3ZQKA 1BMFD 1WBBA 2EHJA 3CKYA 1D1PA 4AYTA 1NVTA 1F12A 5DSXA 4E5SA 5LM3A 5I4BA 1LBSA 4DUYB 2OFPA 1I6MA 4WXPA 4BRZA 1N1GA 3U4DA 4TKVA 3HDVA 3UXYA 1CJSA 3P9SA 2WBLC 2WSBA 3NJRA 4NYIQ 2O1XA 1JR4A 2VHWA 3OP4A 1OWOA 1U3FA 2QD2A 3TQSA 1INLA 4EZIA 1VKJA 3KZXA 3ZE2B 2GZSA 4BQEA 1SKUA 2YJ6A 3ROTA 3HKEB 5FR2A 1Z4QA 1RP1A 5CU7A 1YU6A 4LV8B 2NO7A 4ZVVA 1FVFA 1TF7A 2FRDA 3IJEB 4XUDA 2VBGA 2VLIA 1KZ9A 4URYR 5IP5A 5DM70 2O6LA 2HHAA 4P58A 1QUFA 3H1EA 1F7VA 5A0TA 4G0OA 4YR9A 4X93A 5GIOE 2CLLB 1EUDA 3QPBA 2IHUA 5LP6A 5TPWB 3OQMA 3VU9B 1BXKA 1Q22A 1BOOA 4G4SP 3RYIB 2WAXA 1E58A 1QGYA 5AJHA 4XVUA 4TSFA 1BN7A 1JAHA 1R8QA 1XRJA 2D5IA 2C92A 2YW9A 1HM5A 3AWDA 3GROA 4QDUA 4Y2VA 5COBA 4G8BA 1DLJA 1G6KA 4DLTA 1PVVA 2OQRA 5KYTA 3TVDA 2CEKA 2HHCA 3K1TA 3NWBA 3HO1A 1HFKA 2KB0A 2E4VA 3ZJ4A 2GASA 4ILEA 5EWLB 4IDAA 4GVXA 1UJCA 3QF7A 1D6JA 4QOSA 1QRRA 4PZPA 1YIOA 4XCVA 1SH7A 1QR2A 1WCYA 2WNHA 3AP1A 4I14A 1G42A 1D09A 1T36B 1IOVA 1XU7A 3LFHA 3TW4A 2BAGA 2UVPB 1B0ZA 4XR9A 5F9FA 1O2DA 1NXTA 2JLWA 5JRDS 1W93A 3LBNA 3G2IA 4XJTA 3TXAA 1W8IA 1TIPA 1T3GA 3K92A 4MKGA 5ER9A 3TLGA 4EHNA 3ZDEA 5DYTA 3QA3E 2WKQA 4LRWA 4Y9TA 2F2TA 3WTCA 3A2KA 4FYXA 2FVYA 1PD1A 1ZJZA 3DDOA 1UIRA 1ML4A 4P34A 3LGSA 3RK0A 4P7GA 4WH0A 1MQAA 4BMDA 1U4NA 2R0QC 5TT0A 5K0NA 5LMCA 4ZTZB 1C7QA 3EPLA 2APJA 1C1XB 1C8VB 1J42A 1JDTA 2IYOA 3LBAA 4HVAA 4ZI7B 1WDMA 2AXNA 4AJ1A 3CS3A 5BO5A 2VN8A 4M0MA 5BSEA 3O75A 3FWZA 2IUYA 3KVYA 1OPXA 2IHTA 2YZNA 1F0KA 1W5EA 4NBLA 4U2KA 3PNVA 4BO4A 4AY4A 4BYMA 3JAMA 1HE8B 5JI2E 2FPWA 1REQA 2FZ4A 4Y30A 4QVIA 3B38A 4DB2A 3IOCA 3VI4B 1XPJA 1I7LA 3HCPA 5AI8A 3IAAA 1DKOA 1X77A 2VLBA 2W83A 4CLDA 2W2VA 1KYWA 4OF4A 1OFUA 1T0HB 1KYQA 4ARIA 1ESDA 3R7BA 3VU9A 4RHCA 1GAEO 3FOCA 4PLWA 1JAIA 3WMWA 4BO0A 4RA6A 4Y1FA 4HH3C 1YC2A 4PHHA 3EXIB 1C14A 4ETIA 4N5HX 1QM5A 2GCEA 5JNRA 3SK0A 1FS6A 5CA1F 5TR9A 3INTA 1LPOA 2GD2A 4HAIA 1CRZA 1P8JA 3KDPA 5JWRA 1J5XA 1E1CB 1I13A 5DM1A 4UDNA 5IJ9B 1E18A 4RSMA 1XOIA 3SZ3A 2HSWA 3IDSA 3AIMA 1RHRA 1Z29A 3OZFA 2UVPA 4PC7A 1E3IA 2OO7A 4ZO6A 1QYRA 2D1QA 2MU1A 3A6JA 4S12A 3WOHA 3VMMA 3PGLA 3UWOA 4HBGA 3BKWA 4MQFB 1F8UA 3B1WA 3QFRA 2G67A 1KFJB 3ETJA 4R1QA 3I8XA 3GP3A 1CDZA 1YH3A 4BRSA 3PYMA 3LUPA 4TQ9A 5ES4B 4J3NA 3NJ8A 2W00A 4Y1RB 5IKEA 3OD5A 1RHMA 2RG1A 2QAIA 1TA0A 4BLTA 2PT7A 4RANA 1K06A 4QG3A 1DXQA 1JPNA 1RDFA 2QKYA 2Z8YM 1RI2A 3DMHA 3PHBE 4QEZA 1I36A 2RK3A 4YP9A 5AJTA 1EHIA 5H81A 1I94B 1E1QD 4LS3A 3SSMA 5DIZA 3WLKX 3MWGA 5B57C 2EOAA 5A4FS 5LZ7A 2WPDA 3TZ6A 2WJAA 1EJ0A 2CB9A 5LJLA 3U0VA 1FK8A 2OKCA 4MCIA 2VRBA 3L7MA 2Z5GA 3OY2A 1Z26A 4ZEWA 3K4QA 4M89A 4XFJA 4BZZA 3AG5A 3KXDA 1NP6A 2REQA 4QLAA 2PH3A 4RENA 2IV7A 1ZGCA 2OFOA 1NY5A 3EXEA 4N7JA 3VAZA 4F72A 3D3WA 4OAQA 5BOSA 3E0XA 3KHKA 2QN9A 3U7HB 4CCWA 3RH0A 3NORA 2X4DA 3W5JA 3S5UA 3SI7A 3H6GA 3HDYA 3IKMB 4XGQA 4OSOA 3PQFA 1S02A 3T1TA 1LC3A 1T43A 4HNHA 3DR5A 3ENKA 5C8ZA 3NRBA 3DLHA 1YAHA 4C4SA 3CLHA 3TTVA 3EHDA 3W3AH 5J23A 1BCRB 2ECQA 3QMPA 1CUHA 1NNEA 4EEKA 1RD4A 4PGFA 4MP6A 4F4IA 3ER8A 2SNIE 1CQIA 1EGVB 1L3BA 2Q4OA 5C53B 2P91A 3BHMA 1J90A 4OXKA 2YQ5A 5KC9A 4NAUA 5EJAA 2WTBA 2HA0A 3WK4A 1IAQA 1MZVA 1E4OA 1SVNA 4DNFA 4YPOA 4JVSB 5BN3A 5BWBA 1WXEA 3OOSA 2BC9A 3A7DA 5KHLB 1X87A 4BXOB 1EZ4A 1VLJA 2IF2A 3OD1A 4DV3B 2G76A 3E22A 3QI7A 4CF7A 4PC6A 3SIXA 4MV5A 3QVOA 2FEAA 2L17A 4TTRA 3U19A 4JX9A 4QFMA 2A0XA 3MMNA 4K03A 4XWWA 1IHDA 3OCXA 3OM0A 4X64B 2H1HA 2I3BA 5ALQA 1H1LB 4D42A 2JAWA 2NMVA 1Y4SA 2W58A 3L07A 5ECGC 1E9VA 3I5MA 1KQPA 3CUTA 4BQOA 1P81A 1PW7A 3THXA 4HDOB 4QSHA 3KOZA 5JAZA 5IFKA 1L7RA 3I83A 1EKXA 3FI9A 3F8TA 4KLZA 2AT1A 4GP7A 3LP5A 3GUZA 4F46A 3RFTA 2PANA 1RZVA 4INAA 4J07A 2H9AA 1OSNA 5CAEA 4Y7DA 5I9SA 1RWOA 4FP9A 5JG7A 5EWJB 1S01A 5LB2A 3ZIDA 3JAWB 4BHTA 3EBPA 4GH5A 5EP3A 1YB7A 2Z8XA 2O8CA 3AR9A 3OMXA 3UWPA 2V0GA 4X3PA 2PYIA 3OLYA 3WWEA 3LXRA 1QIGA 1TA9A 2FF7A 3JSXA 2A58A 4GMXA 4OHMA 4V0KA 2O2GA 4I0WB 2GTIA 5CCEA 5IS2A 1KIFA 3RC2A 2R00C 4Y98A 5LIRA 5DGDA 4HS4A 1M1YB 3ERCA 1QCYA 2GEKA 4CR7A 2OP0A 3DFMA 4RIGA 4M7WA 3VA7A 4QG7A 1J0BA 3BGDA 3OZGA 4MQUA 2R2AA 2FX2A 4OB6A 3ZU3A 4ESVA 5KVAA 2VWQA 4F8YA 5CFMA 4NULA 1M2NA 2XEXA 4FD2A 3CT4A 1DIAA 3NDJA 4YV1A 1ECLA 3GT0A 4UZFA 1KY5A 4PYKA 1EK1A 2C58A 2FP4B 2FETA 1W76A 1Y9JA 3AX6A 4GLJA 4K6OA 4C89A 4OXRA 4X60A 2OBFA 3SJZA 4BAZA 1ENYA 1JAXA 2IPAB 2BFOA 2V7QA 4H0NA 1ZH2A 5ALHA 2H48A 4G86A 1U31A 2E7ZA 4LAFA 4XQEA 4N1AA 3T0FA 5T41A 2J3QA 3AZOA 3M1LA 3I28A 3H9JA 3U1VA 4B4WA 4BVAA 1X13A 3HFJA 4XUEA 4YGXB 1B8UA 5KNBD 1VLMA 2LNDA 3LXMA 4QUDA 4M1KA 1A9RA 3OCVA 5J9FA 3ZNPA 1K5HA 1WB6A 5FPYA 1VCNA 1MB3A 3WLMA 4BS9A 5EQTA 1UEXC 2X3UA 1AGXA 1HQDA 1YHYA 1DJLA 3G3EA 1WB4A 4RK1A 3WGJA 4IG4A 4GKVA 1I7NA 1P1JA 4JBHA 5BPHA 1CJKC 1QTNA 2HJWA 1EFHA 3NC1C 4XFKA 3CLRC 4QHSA 4TV9B 2J0EA 5AKIA 4PBSA 3J81A 4TTJA 5BNZA 1LSOA 1P31A 2BFMA 3NLLA 5IDWA 1IHUA 1IVSA 2NYVA 4LNUA 1KDVA 5DOVA 1UOPA 3JQ8B 2Q9AA 5IN5A 1G41A 3SGLA 4D0GA 2ECFA 5BPFA 4BEVA 5IM4F 2Q7XA 1O6FA 4BNLA 3CRMA 1JE0A 3FKJA 3SHTA 2C4MA 1PJCA 2J6IA 4WBXC 5A62A 1G0OA 4X9XA 4C03A 1U80A 1E4VA 3I72A 2ZT7A 1K6JA 1MD9A 1N5KA 2GBGA 3SC6A 3P71T 2PUWA 2XF2A 2HHJA 2Y4NA 4ES6A 3DBOB 4RS4A 4IIGA 5D3KA 4EVRA 5L4SA 4RVCA 1R66A 4L75A 4R8MA 4JJ7A 4WFJA 2HDOA 4UVEA 1VP3A 1NULA 3D0RA 2YCBA 4RVGA 2HW8A 3FHTA 3ZWCA 4BTEA 1IVYA 3G9QA 4JR0A 1PG5A 5EZYB 4FZ3A 3CVXA 2OCBA 1QH1B 4YH1A 1U8ZA 1YA8A 4WOCA 1HNWB 5CITA 3GJTA 4AROA 2I03A 4NZ9A 5IC5A 4JS0A 1O1YA 2KS6A 2QRPA 2C3UA 1MOPA 4R5HA 4UBKA 2PWZA 2WV9A 5DYWA 5JXJA 5B30A 1YACA 5BY2A 3PGKA 1B0AA 4RULA 5LMZA 3GJQA 1KAGA 1COZA 3UVEA 3VR1A 5FTMA 3CO5A 4A6PA 4G0VA 3DV9A 5ULLA 3AEKA 1Y6FA 4BEBA 3CRQA 4X84A 4N8DA 3I92A 1ECBA 1U2QA 4KWHA 4ZO7A 3STYA 1EK2A 3V1LA 1ZMBA 2UYHA 3JVIA 4MYRA 3TIXB 3F9RA 1G5HA 3QWAA 3GF4A 5BWCA 2VO1A 3JVVA 4BNTA 1CR0A 2RGAA 3F2VA 3QLVA 5F12A 1YQWA 5AVXA 3GLFB 1VSQA 2VDKB 4OJYA 1ID8A 3Q0IA 5MGBA 3E8XA 3LO8A 1R5JA 3FJOA 2I4IA 1AO3A 4K28A 5F7JA 1V1MB 4ZGGA 1XMVA 3QKUA 1K0FA 3CJRA 2IU4A 2EP7A 1FP6A 2O57A 4MLCA 1H0KA 2G40A 2V59A 2XCSB 3INYA 4GX0A 4P4SB 2IITA 4WNIA 3FG9A 1BGVA 4PQYA 1QZZA 3P9RA 3V4RA 4C04A 1FFHA 1KP2A 4UFPA 4QNMA 3KSBC 4PZUA 4WCFB 4KQ6A 2L69A 1W85A 4PV7A 4AZVA 3DZCA 1N5JA 3FBTA 2FEOA 3LKBA 2IHBA 1T1RA 1ZVKA 2C5LA 1ZIPA 3TSOA 3KBBA 3CIFA 1UT6A 1YZQA 3KR0A 4QJBA 1U9IA 1VMIA 3KD3A 3M70A 5KVSA 1ZM4A 2O3JA 2UVQA 2YMPA 3V4SA 1V48A 4X5OA 2C7BA 2DR0A 1NBAA 3L1IA 5D3QA 3PUXA 1RWPA 2XUFA 1KETA 4QGHA 1RJ9A 3OJOA 4M9ZA 3R5JA 1ZM7A 2ZR9A 4II7A 3TSAA 4UDXX 4RJJA 4W1SA 4LNAA 3Q7TA 4YAUA 4ZT5A 2AG6A 1KYZA 3HK2A 3AF4A 4AWBA 2PTHA 1UDWA 5CT8A 3SQNA 5HSGA 4TXJA 1IBMB 2QGFA 2FPGB 5KYYA 1JIKA 3GOQA 4HLCA 3VNQA 1O96A 5A1TA 3LZDA 1I14A 5D1HA 3UJNA 4ZKEA 3E3AA 1Z33A 4A0SA 4IJ6A 4QKQA 3FMFA 5IH3A 4ENUA 4UNRA 3K53A 3VVMA 5ALSA 2PHZA 2Y6VA 3GA0A 3RBAA 3K05A 1H8ED 2JJ2A 1A2OA 2V8OA 4JBWA 1FNMA 5HRCA 4N82A 1AKRA 3H84A 3ZHOA 3AM4A 3BMQA 3II6X 4N65A 1RXYA 4TMKA 3O0DA 3RS5A 3WBBA 5FI3A 2BN4A 2PH7A 3C1TA 5FPSA 5JQGB 3W5BA 2JFBA 3MS4A 2WB2A 4CKBB 1IBLB 3RYTC 3BRWA 5JC8A 1D4OA 1R0BA 2FMIA 3BTVA 5DE3A 1RYDA 4YRJA 2GNAA 3OIVA 1JA1A 2IYVA 4E21A 4ZZ1A 3TM5A 4U8HA 5J5AA 1B8VA 2B7BA 3B3AA 2GILA 2OHVA 3VZPA 5KWVA 4M22A 3ROQA 2YOHA 3HBNA 4OLBA 3O9MA 3K6KA 3RLIA 5A5EA 2YY5A 4E2YA 3BWDD 2P5TB 1HG1A 3DVAB 4DR1B 4J94A 1AS2A 3NWPA 3VBCA 2QIOA 1KTVA 3IUYA 1MEOA 2OV3A 5IF3A 2QW0X 1NQWA 4YALA 1PFUA 1M54A 2JGEA 2PRSA 2XVMA 1W5BA 1L4FA 1T91A 2XX3A 4B81A 1FVOA 1GLGA 2VH1A 2DJIA 3IRVA 3R0QA 2EJBA 3LD9A 4QGFA 3DWGA 4R1UA 4BQFA 5EUBA 3JWEA 1KAOA 4YMTA 3PEYA 4PG6A 1SQSA 4FEAA 3W2EA 4AY2A 3K5IA 2K7ZA 4OQQA 1D7OA 1H2YA 3KKNA 3BE8A 1XK6A 2ACVA 5KTRA 4Q9AA 5FBLB 5FD8A 3DFZA 4ZEOA 2PLWA 1QQBA 2ES4A 2VJNA 4R1NA 1OT5A 3RV4A 3DAHA 3NRCA 3UN1A 1Y3IA 1PNQA 2CMFA 3MT7A 4WCDA 3UNXA 1G9TA 2RGYA 3OF5A 1KK1A 5HDQA 1CETA 2OZVA 1BW9B 2E89A 5LU8A 2OCXA 3Q8XB 1DEXA 2NV6A 2CLHB 3F71A 3T5MA 2WJGA 4QD3A 4FW8A 1AN0A 1ISGA 2O14A 1BH6A 1QKKA 1ZD2P 3AUKA 4LQDA 4YV0A 3ZZTA 5I7FA 3IEMA 2YHBA 3C5VA 2B4KA 3MOGA 2D7DA 2X0DA 3LC7O 1JG6A 2QVYX 3SJAA 4BZQA 1YDHA 5CB4A 1ATZA 4DCOA 4DQDA 4DZTA 1PNTA 1UOOA 4FKZA 2NAPA 1KH1A 3NGMA 2D5BA 2P11A 3OU2A 5M3BA 3VTAA 2JAPA 4BLSA 3NBYC 3HTXA 5IJZA 3Q5GA 1QPGA 3A70A 2MCFA 1HL7A 3DEJA 5B36A 3FGZA 1EQAA 4Z1MA 1OZHA 2O2SA 3DV0B 1VLLA 5LXTF 1SU4A 1WLSA 1EQUA 1GSAA 2BTOA 2VHYA 3AB3A 4IZHA 1A96A 1QRDA <