4L3OA

Crystal structure of sirt2 in complex with the macrocyclic peptide s2il5
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
302
structure length
297
Chain Sequence
KERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGMIMGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent protein deacetylase sirtuin-2
publication title Structural Basis for Potent Inhibition of SIRT2 Deacetylase by a Macrocyclic Peptide Inducing Dynamic Structural Change
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 90
structure length 297
sequence length 302
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.-:
pdb deposition date 2013-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4l3oA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4l3oA01
2JIBA 2FN3A 2Q27A 2VK1A 5EJ8A 3PDHA 1JSCA 4Y6OA 4JUCA 1N0HA 1M2KA 1T9DA 3FZNA 2H2DA 2X7JA 1Q17A 2VBIA 4UTRA 2JI8A 4V1CB 3JWPA 3F6EX 4UUBA 4K9PA 2UZ1A 5DGDA 3GLUA 3CLSD 2H4JA 4K9QA 2JI7A 1PT9A 1M2JA 2A1TR 4BV2A 4J16C 5K2OA 2A1UA 1YC2A 4RMJA 4RJIA 3IAEA 5EJMA 1MA3A 4BVHA 2WVGA 3RIYA 5EJ9A 2PGOA 1U2GC 1Q14A 1S5PA 2QQFA 5FEMA 4UTNA 4HD8A 3HWX1 4K9LA 3EA4A 1OZHA 4JD5A 3GLRA 2VK8A 4MPRA 1O96B 4X3OA 4IG9A 3LQ1A 4L3OA 4D5GA 3FSJX 1Q1AA 2Q5JA 2Q29A 1ZPDA 1E3TA 2EZTA 1UPCA 2EZ4A 1YHYA 4R8MA 1OZFA 5K6RA 4COKA 2IHVA 1V5GA 1M2GA 3CLRD 2FSVC 2JLCA 1YC5A 2OORC 4UU8A 5MFZA 1XLTC 3GLSA 5BWOA 4BVFA 1V5EA 4MPPA 4BN5A 2UZ1B 4JT9A 4RJJA 1SZDA 5DGTA 1PO7A 1NM5C 1PI3A 2FWNA 1PYDA 3PKJA 5IMSA 3D7KA 2OD2A 5MFPA 4MQ5A 4BV3A 5K6TA 4JSRA 5BWNA 4BVBA 4UTXA 4K9MA 4F56A 2JLAA 4GPEA 4I5IA 2QQGA 1BFDA 1HZZC 4J1TC 2W93A 2NXWA 3GLTA 2NYRA 2OD7A 1D4OA 2EZUA 3IAFA 4JU9A 1V5FA 2AG1A 3EYAA 4L2IA 2V3WA 1OVMA 1POXA 3CLTD 2OD9A 3CLUD 4O8ZA 4FVTA 2H2IA 4JUDX 1M2NA 4BVEA 4GM1A 1Z8NA 2JI6A 2Q5LA 4KPUA 5MF6A 3EY9A 1PVDA 3OE1A 3HWWA 2BRUC 1EFPA 1T9CA 1J8FA 4UU7A 4GM0A 3D4BA 2H2HA 5FYQA 2HJHA 4FZ3A 5EJAA 1O97D 4K9OA 3ZG6A 2AG0A 1Y9DA 1YHZA 2B4YA 1EFVA 4GG1A 4QQ8A 1SZCA 4KXQA 4ZZIA 2VBFA 2VBGA 1YI0A 2EZ9A 4BVGA 4RMGA 4JUAA 1YTLA 4Y6LA 4Q9DA 5K3SA 1UPBA 4UTZA 4Y6QA 4BUZA 4JUBA 4K9NA 1ICIA 1PNQA 3ZGVA 4MPJA 2H59A 2VJYA 4QPZA 4IAOA 3FLMA 1U2DC 4X3PA 1PTJC 1T9BA 1DJLA 3D81A 1M2HA 5AHKA 1YNOA 4C7BA 1U31A 5EJ7A 3JR3A 4JU8A 1POWA 1YBHA 2DJIA 1UPAA 4FEEA 2WVHA 1T9AA 3U3DA 4GM4A 2PANA 2C31A 2H2FA 4ZP1A 4BN4A 4F4UA 1Q6ZA 5DEIA 3F6BX 4MZXA 1OZGA 1QPBA 4V1CA 4FEGA 4G1CA 2IHTA 3CF4G 2OO5C 4V1CI 4GP9A 3U31A 2Q5OA 4RJKA 2VK4A 2WVAA 5BWLA 3E9YA 5EJ4A 4UTVA 4TWJA 2Q5QA 4C78A 1S7GA 3RIGA 2Q28A 5EJ5A 4RMIA 4KGDA 4D5EA 5D7NA 4UUAA 3ZGOA 2FR8C 2JI9A 4RMHA 4TWIA 5MGNA 2PGNA 4IF6A 1U28C 1PNOA 2IHUA 2H4HA 2EZ8A 1MCZA 4JUFA 1YI1A 2H2GA 4QELA 4HDAA 3PKIA 4K9KA 2FRDC 2H4FA 4JT8A 5EJ6A 3K35A
chains in the Genus database with same CATH superfamily
2O5CA 5FTWA 3NAQA 1H66A 4NSNA 3ES9A 2A30A 4D0SA 2TMYA 5K45A 2A5DA 1H22A 3ORHA 2NO7A 1FDRA 1K6JA 2DWUA 4L6IA 4LXIA 5HF6A 1ZAKA 4QDOA 2Z57A 1MAWA 3WIVA 1Z62A 3VGJA 4QODA 4E2YA 1OT3A 2OE2A 3EXG1 4CL2A 4PQEA 5AJWA 2YWFA 4M1YA 3GT0A 2O1WA 2ZETA 3C3KA 1T0IA 2AOWA 3N39C 1NHGA 4AK9A 1U9CA 3K4QA 4MI3A 4RTLA 5A06A 4V2IA 1YGYA 3K5HA 4AX4A 4FCCA 7ABPA 4HO1X 4YCNA 1E60A 2JI8A 1ZGCA 1AUQA 5F35A 1TAQA 3HTXA 1R2QA 3FJ1A 3RUEA 3RTBA 2LW7A 4UMVA 2DQKA 3T5DA 1QIDA 2I1LA 3L7CA 2VWHA 3UBMA 1SQ0A 2F6RA 1VJTA 4I4NA 2KE5A 2XVMA 1HE1C 4WEQA 5THKA 2C8JA 3EXFA 2J3IA 4JMPA 3DE3X 5HRUA 3NHUA 2PVCA 1QYDA 2R1VB 1B2RA 3L43A 4MS4B 3H6HA 4UM8B 2VTBB 1QAMA 2ONJA 1PX0A 1H6BA 3UJ7A 4G25A 5DTJA 3ZE2B 4TMZA 4AAYA 1AM4D 3PQ7A 2QN7A 1RYDA 3RCBA 3VR2D 2ZUCA 1PQUA 1O03A 1LW6E 1JILA 1DQSA 3B6JA 3DS8A 2QAGC 3I3OA 5EL0A 3BH6A 5FNVB 2CDCA 3TNDA 3V7NA 3DULA 1T3ZA 4E3ZA 2SKCA 3RI3A 2OXCA 3W90A 2HCFA 4II7A 1FQWA 4DDTA 5A4IS 2DR2A 1Y4UA 1Z5OA 1LA2A 4DSZA 3IH5A 2YQ5A 4URUR 4MUFA 1XTPA 3SZ3A 4YV7A 4AIRA 5K0SA 2V1UA 4DLZA 1LC0A 3IKLA 4NYJR 1JL3A 2YN4A 2CLEB 5D86A 1KEEA 3AVPA 1O3YA 4FN5A 1PJRA 4EA6A 2I4NA 5B6PA 4TRNA 5LIRA 1ZFNA 5A9TA 1R37A 5B3KA 5DPMA 1NUQA 3BTVA 4M7RA 4C3VA 4F4CA 2I2DA 4FHGA 1TM2A 3A3NA 1O94C 1O6ZA 2XWBF 3COZA 3NR2A 1K66A 1IN7A 5IYZF 1ZS9A 4B35A 1T25A 1QGZA 2PAAA 1P2VA 5DLYA 2C8VA 4MV4A 1PL6A 3H9CA 1OJLA 4JI7B 1YZLA 3PS9A 5E9WA 1TVEA 2J32A 3WQHA 1TZJA 1P3DA 4UASA 5K99A 3KJEA 3LAWA 4X54A 2YUTA 3EVCA 4AO8A 4QUKA 1D07A 1PVVA 3SJ7A 1MFPA 5CHYA 2O7VA 4X65B 1N6NA 1KFJB 2E1PA 1SVOA 4DJEC 4JJAA 2R8ZA 1U9IC 4EF4A 4ZVSA 1M67A 1OREA 1XG5A 2A4KA 2OL4A 3W2GA 5CJPA 1PQYA 4TL9A 4CUKA 5IULC 4NBVA 4B82A 2BCGY 2P3SA 1JS1X 1N0VC 1V6CA 1YS6A 1OI4A 2HKIA 2QX4A 3LP6A 4MYHA 4Q37A 1ENYA 3V55A 4B6FA 1KU0A 1SKYE 2R84A 2BFWA 1DKPA 1ZHHA 3JATB 2ZYDA 4DDVA 4KR7A 3LUKA 3OG9A 1GTG1 1L3CA 1YOVA 3UMRA 2GYWA 3OIDA 2WHPA 2Q2OA 5AHOA 1Z33A 4RCZA 3VU9B 1U2GA 1NVEA 1BNCA 1R88A 4OLHA 1IATA 2FRXA 3L7YA 4D4KA 4DM7A 4CL0A 3QSGA 5KSWB 2BGGA 3FUWA 2JLBA 1VYTA 3EUAA 1KIAA 5BQOA 3ZY3A 3QITA 1Z0FA 2I1WA 1W87A 3OZ7A 4MV0A 1GITA 3VMFA 1LV7A 2NUPA 3R09A 3W5JA 1PR5A 2WD7A 4DLTA 2C7GA 2JLCA 1D0IA 3U6KA 5TJHA 3O1HB 1G8KA 3E3OA 3H2GA 5B36A 3TQSA 1JQ3A 4B1FA 4OQMA 4Q1FA 2UXCB 1OFIA 5H81A 3WVNA 4NEGA 1NI4A 4FMDF 4LTNA 3KJHA 3HBAA 1PUJA 1ENZA 4LWZA 4ZO6A 4IDHA 3VHRA 4QTTB 1ST2A 5HF8A 4KG7A 2D1FA 5KVSA 3H5VA 3IPRA 1N1MA 4GGOA 3CG0A 1IVSA 2OYCA 4NR0A 5T8KA 4DEYA 2JFFA 4ER7A 3SLGA 3WHKA 1XVUA 5JARA 4JT9A 1SZDA 5AM0A 5CAEA 3C14C 2HCBA 2QMYA 3PD0A 2JLXA 2ZW9A 2Y1KA 2GH1A 3A26A 1PFWA 3UTDA 1EIWA 4CLRA 1X7HA 2FY8A 1FMTA 4PYKA 1HO3A 2RHGB 5JQGF 4RXUA 2P90A 1SD5A 1YJAA 1DT5A 1U8EA 4CM8A 2H00A 1Z7BA 3CBGA 4H15A 3QIAA 5LU9A 4P7JA 3FZGA 4HTFA 5C7YA 4ER5A 4B5LA 4I8DA 5BRAA 1QQBA 1HLPA 1UP4A 2ZYWX 3P0HA 3RO7A 1RNLA 7MHTA 1MOQA 4IJQA 1FE8A 4U7HA 4MR8A 5DK4A 3ANSA 5LB2A 4DIBA 1SCUB 4L7VA 2G63A 2GOYA 2QJRA 3ED1A 3SIPA 3PYMA 3ZNNA 2CNDA 4UOZA 3CZPA 1II9A 3FWZA 5L6MB 5PGMA 4W9RA 4DDHA 3OZBA 2Q2VA 2VNKA 3HJCA 3GIDA 1KZ9A 3DYIA 4HWRA 4ZZ3A 1UM8A 3UYLA 2HRCA 4S1WA 4K3VA 1HDXA 3QJYA 1PKEA 2I8AA 4M9RA 2ZB8A 4LHSA 2Y1WA 4RLSA 5AVOA 4GU5A 3W7VA 2EATA 5AW8A 1E3IA 1XZNA 3ESZA 2GN0A 4FSHA 4WXEA 4L2IA 3ECAA 1AHIA 2IU4A 2X6QA 1EM8B 4OP1A 4YAUA 2V3WA 3G8AA 4L8FA 2WD9A 3WGHA 1FPQA 1VB5A 4RCVA 1H23A 2CVFA 3FZQA 5J4KA 3AGQA 4DMKA 3O93A 2WT9A 2NT3A 3QA9A 2NM0A 3KQKA 2CL6X 5K7SA 3IJEB 4IR7A 3RVQA 4K6MA 4BQRA 3K20A 4H16A 3CUEF 2I6UA 1PNRA 1EK0A 1GUZA 1P7ZA 3UWDA 3BRSA 2ZZMA 1Z6PA 3P45A 2POQX 5H82A 3F9RA 2P27A 2FUCA 3V6MA 2AZ4A 4BGUA 1E4VA 4BNUA 2VVTA 1GQYA 2QYTA 2JCXA 3T7DA 1A9XA 4IQ8A 1YONA 4QOIA 1I13A 5TT1A 4WH0A 4R9RA 4DM4A 1LZKA 5GZ6A 4LDZA 1LDNA 5HK8A 3ADCA 1OQAA 2HBQA 4CMHA 2CFOA 2I7DA 4MVJF 1QGOA 1T24A 3DOIA 5HQ3B 1ABBA 2EC5A 4PPNA 4ALJA 1Y8RA 1YH3A 2P9JA 4BEBA 5BMOA 4GI1A 5KJCA 1N6LA 4U00A 3U0VA 1SWVA 4IDQA 2NPIA 1JLLB 4OHZA 1JDBB 4YRPA 3Q12A 2F9MA 3MG9A 1GTVA 3O2NA 3CRRA 4D45A 4JGIA 1UIMA 2NVWA 2V1XA 5JASA 2JGEA 2XQGA 1Z0IA 3LA8A 4DA9A 2O4CA 4YWJA 1O97D 1ZISA 1OC4A 3BL8A 3MLBA 5JISA 2PQ0A 5EIBD 3M6VA 3ZG6A 2DUUA 2IKSA 5FT9A 3AI7A 4C30A 1TQ6A 2AG0A 4YMHA 4BLUA 2X5OA 4BFYA 3O0TA 3V2IA 2X2OA 1F0PA 2VSOA 2H2AA 1A1SA 3BT7A 2H52A 2XTMA 3STTA 2G08A 2VUUA 4AKHA 4B44A 5FTMA 3RVLA 2FG7C 3V2UA 1SZCA 1HRDA 4LYGA 4H35A 3THRA 4L07A 4UZFA 4C87A 5JRDS 4LF6B 3U3MA 5IAAA 1USGA 3RSHA 1WTCA 4R9UC 3ESAA 3K6JA 3N1UA 4TZ6A 2ACEA 1O8BA 4D9FA 4N3NA 3NNSA 4KBFA 3HCWA 3SSOA 5EWJB 4ZMSA 1IG0A 1RSZA 3LIIA 1QQ5A 4L95C 1ZD9A 4ZA2A 2DHQA 4LBVA 1F2DA 5ALHA 1J0AA 1T1RA 2VF4X 3RC9A 2PX6A 2CNBA 4Y9UA 1N3BA 3IUMA 1CUFA 4KO1S 2J08A 4DXAA 1DXOA 1FDUA 3I53A 1OILA 4LPKA 1AUPA 4KOEC 3TAHA 1T2EA 1J24A 3JWIA 3V8PA 2XCUA 2UU9B 4ZODA 3W78A 1T4MA 3CF0A 3HY3A 1NRJB 2PH1A 3E3AA 3PHHA 4OHRA 4CIBA 3MBOA 3NU1A 3N05A 3H86A 1WL8A 1GXSA 3OP1A 2GVNA 5EY5B 4F46A 4WXPA 3WLRA 1RXSA 1RXEA 2PGAA 4G0ZA 2WWHA 3M82A 5IM4A 5JZVA 4TXNA 1AQUA 1DCMA 3M81A 4U5QA 3KR2A 1OB2A 5C7OO 1XA0A 3GT3A 1SZJG 3LHFA 4QPZA 3LI2A 2AVDA 2C7VA 5ECWA 3IP5A 5KYUB 3ENWA 2IHBA 1A1VA 3KM0A 4BP3A 3M33A 5F7XA 3L6RA 4EJSC 4UNSA 4E13A 2QENA 2QRGA 3QVOA 2AOVA 2CHFA 2Y71A 1W19A 3IIMA 3KB8A 4PU0A 3IB6A 2CXUA 4FMPA 1C3JA 2Q3BA 4RACA 3Q40A 1M6YA 1LBIA 4ZI3A 2DUNA 2DVMA 2CLHB 5LYJF 2CCJA 2R7AA 1JAIA 4LOIA 3BMNB 1UZAA 1YNOA 3ONFA 5DCLA 5HKKD 4IG4A 3F7NA 5FI1B 3BGVA 3SXUB 1QFZA 3DM5A 4WZBA 3JQAB 3RYIB 2C1XA 1YGPA 3P8ZA 1I4TD 3MTAA 3BRWD 4H2DA 1CIPA 4WNAB 1U90A 3KCQA 3MLEA 4B9EA 3U4AA 2HQBA 4AJ9A 4GPBA 3N59A 1U3GA 2AVNA 2ILTA 1ODLA 1F12A 2Y0BA 3QLUC 4L8WB 5DXFA 1CWUA 3DV2A 3SXJA 3PR1A 1QLWA 2PANA 1XNJA 2NXJA 3CNEA 3PU6A 4ZP1A 3TR0A 3MGAA 1ICEA 4EEZA 4EI7A 1QUFA 3G8YA 1WAMA 2NGRA 4E5YA 3BD7A 1NJGA 2Q6LA 3FUXA 3O7MA 1E5DA 3K0CC 2QYOA 4NF2A 2DLNA 3T3IA 2QS9A 4P3XA 1WVIA 2PBRA 2FE4A 2YUIA 5IN4A 1YZFA 3WKCA 4ZYVA 3TTSA 1G66A 4Q16A 1O97C 1O0SA 4JZYA 4N8EA 1P44A 3IIIA 5JXJA 2GO7A 3GU3A 4FINA 2BFMA 3L1KA 2C07A 3QLVC 2OAP1 3F67A 3R3XA 4PFQA 3DL7A 3VAZA 5AVQA 3G82C 1JE1A 2VJMA 1XWFA 2VPIA 1HYGA 4P0TA 2PGLA 4BNMA 1G8HA 4JENA 4Q1CA 3MWLA 2GPJA 4YDHB 5J43A 1O87A 3VTZA 1N8KA 5KOHA 2YDXA 3P5SA 1OFVA 3HA7A 3NQ41 3B89A 4A6PA 2EP7A 2L69A 3PG5A 3ETHA 1KQPA 1Z5WA 3LPNA 1XQ1A 2JD0A 3X1MA 2FUKA 5FWYA 1BWSA 1J25A 2C42A 4ZOCA 4G8CA 5KTRA 1R66A 4FXPA 1CSEE 3VKGA 3ME5A 3AVUA 3T12A 2A9FA 3BDAA 1NBAA 2C2BA 2HBZA 1K5GA 2FETA 2F1IA 3CPEA 4I9HA 1JXMA 4K3UA 5E4TA 3A7DA 1CQPA 1ZXXA 4WI1A 3DB1A 4CT5A 2E21A 2JDID 5GJVC 3AX6A 5JLAA 5I7EA 1Z7EA 3HADA 3KDSE 3AKYA 3O5AA 1G5IA 4OOEA 3TLEA 4D02A 2VXBA 3FW1A 5AK4A 3N2GA 4V0MA 2CK3D 4BASA 1XZLA 1BCRA 4DRXB 1KXZA 2QM8A 1DELA 1GFZA 1TVKA 1C0LA 2QUZA 4M0FA 4XD2A 3TRHA 5IH7A 2XUDA 1ZDMA 4R71A 4PNHA 4QM7A 1HR0B 1ADGA 2FQWA 1FTWA 2QP3A 3K5WA 3IOMA 3OJWA 4WT7A 3ZKWB 2GCOA 2P77A 5E1BA 3UGJA 4CBVA 3X1XA 2H7CA 3L6CA 3DO6A 1B6RA 4XPZA 1ZJ5A 2Z8ZA 3QLEA 1OA0A 3SQXA 4DIMA 3ZHXA 2GESA 3MGGA 2Y05A 1IJKA 4OO3A 3RUDA 3TYXA 2WE7A 1R0XA 3AUTA 1N33B 1FFBA 2F43B 4TV8F 5A4AA 5KTTA 1N2OA 4RZXA 4YHHB 3RDPA 4DV4B 4GR4A 3NHZA 2DXIA 2PV7A 3V1YA 2Z3VA 2R2AA 3RKUA 1YJQA 2XUZA 4L5YA 4LQ4A 4XX0A 2RSLA 3A6FA 2CMHA 3FNRA 3BE4A 3QM1A 4JLWA 4PS1A 1CR4A 2QJFA 3VR6D 3VZDA 2PE5A 4AYWA 3DR3A 3PR3A 3RQSA 4RTMA 4KJXA 4LCJA 1OC2A 2NTJA 3N86A 3TSOA 1T5IA 1A9PA 4YRKA 4DJTA 2VTKA 3IPCA 2I22A 1SQFA 2QLTA 1CHNA 221PA 4XIGS 5B6IA 3I61A 3P9CA 3A1SA 3GDOA 4IGFA 4X8OA 4YCAA 1QH1A 5EE0A 2YJ4A 1XA4A 1F5NA 3C5HA 4QVGA 1PSWA 2R96A 2ZJYA 4JVMA 4NCIA 1STOA 2VS1A 4I1SA 5FOSA 1R0SA 1L4YA 1RKQA 3MJCA 3K9NA 4OGFA 3MILA 2C2GA 2XGMA 5AJYA 2CXNA 1L7MA 2VK1A 5F5XA 4IICA 1PVOA 1U0FA 4OU5A 1G98A 2K2QB 4BJ1A 3EDCA 3NHLA 4MVJI 2ZIXB 3KB1A 1R7RA 3PDHA 2C3OA 3WB0A 1UJ6A 2FR1A 4IHJB 1XFAA 2NTVA 1SKYB 3B6KA 5K8JB 4DBVO 5HGXA 3EVTA 1FB5A 3BMQB 4EZEA 1CE8A 1X86B 4FQ7A 4DLXA 4B3CA 3E1SA 5TMBA 2W7TA 4DZRA 3NJ4A 5E6UA 3KQPA 4TWAA 2QRUA 4Z6KA 1Z8DA 1QYXA 2WA1A 1WTAA 2ZRCA 3KVRA 3JAWB 3WJ7A 5KX5B 1JQAA 2QUBA 4RTJA 4UTRA 4XIFA 5JCJD 5C4MA 1BEUB 4A2QA 1FS5A 2PVSA 1EP3B 2QUAA 4GBED 4HGOA 4DCPA 4L5BA 4I14A 4HQKA 4DJFC 4F3NA 4EY4A 1EXVA 3JWPA 3HKEB 1N9ZA 2JGMA 3S8MA 4IX9A 3UT5B 1XVVA 3ZU3A 4MW0A 4L3WA 1QFJA 1ZX1A 2XIQA 3GLUA 4C5CA 1ORRA 3PWSA 2Q5EA 4PCUA 5A3VA 3SVLA 3RSLA 3J7TA 3OBBA 4P92A 1NJSA 4O4LB 4LX0A 3WWYA 2JGIA 2EEZA 1ZM9A 3RHZA 5AUOB 2ZI4A 3IR5A 2FA9A 4TVKA 1Q3KA 1TQ2A 2HC9A 2PRJA 1N2JA 1RJDA 3LW7A 1Y82A 2LP4Y 3AI2A 2BGTA 3N8GA 2F3RA 4E5UA 5GZ3A 1QRUA 2JGLA 1IRXA 1JSRA 3MQFA 4M36A 1NSFA 2OYSA 2ODBA 2OZLA 3TTUA 2X19A 4QUHA 3IUPA 4ZN6A 1P2BA 3QX9A 4M49A 1WF6A 4KRXA 1RKUA 1B74A 3VISA 3ZGYA 5JD6A 4RESA 1YDFA 3MWEA 2H1VA 2GZ2A 2Z1MA 5ESXA 3D8HA 2YIMA 2NT4A 3CCFA 4P93A 2I8CA 1P9WA 1IJBA 1MA3A 1JYEA 2HEGA 3DDOA 4CDMA 2PZKA 3GDFA 1M2WA 3KZOA 4M54A 1II0A 2JIZD 1MX3A 4TS4A 1QF6A 1TE2A 4FS3A 4PTYA 1PJBA 4RKRA 1JG6A 1Z3CA 4LE1A 4NMWA 5TQVA 4Q4JA 2PCJA 2RK3A 2W6ZA 1A2KC 1BHJA 3BJEA 5EIAA 4PSAA 5JADA 1HZZA 2P2GA 1VGQA 4N18A 4CLHA 3VPCA 4G9EA 4UTNA 1OZHA 1NUAA 3LKBA 4FD2A 3IODA 4KX3A 5DYIA 5ED0A 1T8PA 5EZYF 3TKLA 5AW0A 2F55A 1UBGA 5DE3A 5DMHA 2FSIA 3RBXA 3CH5A 5EEHA 3FFAA 5A0TA 1JI3A 1XTTA 2RG1A 4OHMA 4G4SP 3VOSA 4GLFA 3UJNA 5A04A 1BXKA 3JYPA 7AT1A 3F1KA 1EAMA 4LQCA 3HJHA 4RA9A 2VYNA 1U7DA 2VAMA 1AZLA 4PZPA 1I8TA 1ZSVA 1QVWA 4J6FA 2C2HA 2XYHA 4GOXA 3KLNA 1TRKA 5CT8A 5AP9A 3W05A 3DW3X 4AJ2A 6REQA 2QF7A 3SEQA 3FMVA 4HQLA 5DM1A 3VSAA 1KEKA 5EWMA 3AFGA 3F5SA 4X00A 2C9CA 2QTHA 4MR7B 4PC3A 3ETLA 3SKYA 1E3DA 2I4OA 4ZTZB 3NTVA 5JUWA 2M2IA 5HFAA 3M2PA 1ZXLA 2B94A 1Y3IA 4ZI5A 3CC8A 3I6ZA 1YHYA 5AVXA 4IM7A 2ZYAA 2DYKA 1HQKA 1UXOA 1WCIB 1Z0ZA 2P2CA 3CO5A 3T34A 4RQTA 3GX1A 3ITNA 1KMCA 4KQFA 2K87A 1ONPA 4L4XA 1NW7A 3BMCA 3B3JA 1C8LA 1JBEA 2RH5A 5CDTA 4Y2JA 1K63A 1N7IA 1T2DA 2OV1A 3L6UA 3MWYW 2HK8A 5TT0A 2YOHA 5EVJA 1YC5A 4RJLA 3H97A 1C1XB 4ZAYA 2IYQA 4LMBA 1XT6A 1N6RA 4U2GA 1QIMA 4LHEA 1NNEA 2FYTA 5ES4B 4O2BF 3RUPA 3S2UA 4ZV7A 1XLTC 1ZH4A 3W5DA 2RGDA 1V16B 2BC9A 3B7GA 3RK4A 3G2IA 4BO2A 4BVAA 1V3TA 2XEXA 1PT7A 3P4YA 4X1OA 5ITVA 1EAYA 3L6EA 3Q5DA 1K92A 2WFLA 2NV6A 3AF1A 1HZJA 2L18A 2HWUA 3BWCA 4OQEA 4OMFG 4RPCA 5GVSA 1Z7WA 3H9BA 3UK1A 1V1RB 1Y5LA 4BLOA 2EOAA 4JEMA 2VP4A 3WL8A 4TQGA 4J0JA 1QBGA 2H1LA 2VSXA 4HH0A 3T9DA 3GLIE 5H9VA 3WLPA 1AKYA 1O95A 1BH2A 4Q15A 4ZALA 5E38A 5HTKA 5M34A 3QPBA 1P91A 5F3DA 1T8SA 3KJZA 2JIPA 2O3UA 5JC1A 3DBHA 2XMDA 2X8AA 3BKWA 4IRMA 3GIWA 1PZGA 2VYQA 1JAZA 1T5DX 4JP2A 4RA6A 5LA6B 5I4BA 1A8QA 5BQPA 1EJ6A 1LBTA 4LC1A 5HVNA 2ORED 1RADA 2QUIA 4Y0VA 4ZZ2A 2GQ0A 2HF2A 1R4NB 1N8TA 2EJTA 3VKFA 3V9AA 4OHXA 1FLAA 4OYRA 4WD3A 2PLFA 3UJDA 4EMSA 4PZCA 1WMBA 3PXXA 3KR9A 1J21A 3P9XA 3WHPA 1GNSA 1AN9A 4GKVA 4U7PB 1RLOA 1JAHA 1D7AA 5TV2A 1O4WA 4CV3A 1X7WB 3FCEA 3EIUA 3SZUA 3WOVA 2OD7A 1T5HX 3EBOA 4HAOA 1FNDA 4LX8A 4P3OA 4P4SB 3BXEA 5DHFA 4ZT7A 5CR9A 4CE6A 3GFBA 4RF4A 5JO0A 3GP8A 1Y4ZA 3U26A 5K3FB 2KBEA 1DX9A 4AYTA 1NVDA 2QL6A 3SHTA 5EKDA 3O6VA 3FPJA 3ZJUA 1RBZA 5K2MA 1VCOA 2PLRA 3JY6A 5ITSA 4ZANA 3NG1A 5ER9A 2VOEA 3GBSA 2IIBA 1HWYA 3W5VA 2G25A 3QSYA 4PHCA 2BEWB 3IKMB 3URKA 4CMEC 2UV8A 1OH8A 1WSAA 5HIIA 3JAMA 4RZSA 3MW8A 3CEJA 4JLJA 4XR9A 5K51A 5HXAA 1E1RA 3TFWA 3PENA 2Q62A 1G8MA 2WIJA 4K9DA 1QMGA 2GZAA 1BS1A 2KMLA 2Z30A 1W5TA 1ZM3A 1ZKMA 5DNWA 3RUCA 2JJ2A 3IT3A 1UBNA 2CLMB 4BVEA 1U8YA 2A94A 3C1UA 3M5PA 5SZJA 3V7FA 4BLPA 4XWOA 4C2UA 1U0HC 3OUUA 4E08A 3NC0C 2G28A 3HB9A 1HX7A 3K94A 3NO4A 1SC9A 2BZSA 3KFLA 4BNTA 2VHYA 4Y2QA 5EZSA 3QJ5A 3GUHA 4WV3A 5FOTA 4YMGA 5JNTA 2B2XA 5FPHA 4IMIB 4GM0A 4C22A 1U98A 3N2IA 4U9UA 4EBFA 3K70C 4UU0A 5JVDA 3ZLBA 1TT5A 1ZVVA 4Z53A 2N1BA 2Q9CA 4X97A 5FYQA 5EGSA 4NU8X 3NFYA 1EPUA 3STVA 3TLJA 3WRYC 2HFJA 1GGFA 5A03A 5HZMA 4PNZA 4W7SA 3COSA 3OD5A 4IHKA 4OAOA 1CULC 1QHIA 5AUQA 1VL1A 5K3AA 3IO5A 2OFXA 2IX9A 2R7MA 1BMTA 1CJUC 1SBZA 4LZLA 4MW5A 5CPFA 4TRJA 3N0XA 4QJ5A 4Q7KA 4DV1B 3DT8A 3HB5X 3GLHA 4PIPA 2HLHA 1MV8A 3A0UA 3F71A 2ZXUA 2BZ0A 3GZNA 3OQ6A 1B8PA 1H2XA 3SICE 3YASA 2BI4A 1Y6ZA 4QGFA 3BERA 2HLNA 1K75A 2YJGA 3DFIA 2BMFA 2CJFA 2EL7A 3M4JA 4L6AA 4QQ8A 4BVLA 4B3SB 2GAIA 2DBZA 2FX5A 3DD5A 4CMIB 4YXFA 5CLFA 3QHPA 1TMOA 2ZBGA 3GMTA 3UMCA 4ID3A 1YJXA 2QX9A 1BHQ1 4IIUA 4ADSG 5FD8A 2PN1A 2ACKA 3PWTA 4QUJA 1E92A 2GK4A 2XMSA 5LP6B 2WHXA 1J4AA 5J4YA 3NGXA 2NP7A 3B6ZA 5ENDA 3I2HA 3GBPA 2YXNA 3MMXA 4HLCA 1RZRD 2NACA 1SVUA 3MIZA 1JE0A 1Z2AA 1PR0A 2Q6IA 1HNNA 3EQ8A 1OLSB 4OAQA 1YKGA 1SA0A 1WRBA 5FF9A 2FK8A 3PGKA 2IH5A 2FPSA 1H8ED 5KNCA 2Z9CA 2I3GA 2X9GA 3DZFA 3CH6A 4GMFA 1KE1A 2Z83A 3JYNA 1QU2A 2F3UA 2GEVA 2WWXA 2XUPA 2VAPA 3C6YA 3KVYA 3B60A 4HK4A 4WKNA 3DFFA 3E15A 3Q4GA 2HIAA 4LYJA 2L2QA 3TDNA 2GJSA 3BWVA 2GJ8A 2DCMA 1SC6A 1A71A 3JZDA 4NOMA 3S55A 3HXMA 2CXQA 1HDCA 3DZDA 3F6RA 1L4MA 1I7LA 3T35A 1ZD8A 3PE6A 1TL7C 5KQGA 4X8MA 5AKHA 5H1YA 2F90A 2EFYA 2Y4OA 2WDPA 1P0IA 1P9OA 2C2MA 3DB2A 4M0MA 4MRPA 1Q12A 4JNCA 4OQYA 3EDOA 2AEMA 3D3JA 1MOPA 2BF4A 2CYAA 3IMKA 2WWIA 3K2BA 4HNQA 2GVDC 3WWEA 2B69A 1DEHA 2G9ZA 5GM2A 1EDEA 3O8LA 3REGA 4AT1A 4HNUA 5CFZA 2VHQA 4XLTA 4XQ9A 5EJ7A 2C7QA 1A4XA 4ND8B 4QPNA 3C0KA 5AESA 1J7KA 5K0TA 5KCZA 1RLMA 5B58T 1ZK2A 3A2KA 2DQSA 3KLPX 1C5KA 2R6GA 2DJIA 3I8OA 5JR3A 2CMFA 1D2AA 5D8DA 1NR5A 2HPVA 1ZI8A 1MPXA 3LFUA 4BV9A 4D57A 2B5WA 1LLFA 1Y33E 2VT6A 2ZRPA 3PC2A 4B47A 4RZHA 4N7BA 3U9LA 4D6XA 1XCBA 1OWNA 4HNVA 5CEFA 5IK2D 3SX4A 2J5BA 4DHWA 1J2EA 2O8EA 2ZXFA 3M49A 3AM5A 3AK4A 3H5LA 4ZT5A 4GPD1 1MEJA 1YRYE 3I1JA 5JWRA 1EWTA 1XMVA 1B93A 2CDBA 4RSRA 1UDBA 2A9OA 2R6HA 2SKDA 1JSLA 1VKOA 3HN6A 1GVNB 4O5AA 3PZRA 3TJZA 4ALIA 4TROA 3UHFA 2GCIA 2G7ZA 1P29A 4LXXA 3PFGA 1F2UB 3WQSB 5IDXA 1Z17A 4H7HA 4QDTA 4CQMD 4F93B 3NDIA 4CVNA 4JY7A 5GINE 1X8JA 2CHEA 3HRKA 3JARB 4IFBA 1YHNA 4GPZA 2FU5C 3GOQA 3K16A 1TCVA 3BGWA 5CVUA 3PRKE 3WIOA 4HT3B 2H48A 1V5WA 3X1KA 3WLFA 4Z49A 2B35A 3DTYA 3DAPA 3PFFA 5DI3B 2OO5C 4ZI2A 2DERA 1K3FA 2VTBA 4MS4A 1AKTA 2HGZA 2VF5X 2PYIA 3RVOA 4DV2B 4E46A 2HFKA 6AT1A 2XZTA 4FONA 1WSDA 2Q5OA 1NVAA 5JSHA 4RJKA 5K8LA 3QUTA 1Y7TA 1XKXA 1V1MA 5BWLA 2GUGA 1CLEA 3QXXA 4Y8VA 5ERGB 1L6RA 2VDKB 4RZ3A 1SWWA 5FP0A 2ZPUA 3KCNA 2GXUA 4R7GA 2BWJA 2Q5QA 5F3WB 2BSXA 1QO7A 4CCYB 3MSXA 5JYDA 1EDOA 2R1TB 2OMEA 1AKVA 4FWBA 2PWZA 4LAFA 5G1NA 2IU3A 2IYYA 3CYFA 4B3GA 3I2KA 2VUHB 2OQIA 3OLWA 3TM5A 2YZGA 5AI5A 5DX1A 3X1YA 1XRPA 3D7RA 4U2BA 2CB9A 4FGZA 3TXAA 1FTSA 1IN4A 4CDNA 1FFXA 4DJAA 1TD9A 4XWTA 4ZK6A 1NP3A 4C0BA 1DGQA 3I6BA 5AJUA 3ZGOA 5KTNA 1IUNA 3HJRA 4E14A 2VSFA 4ASUA 3ZDBA 1P61B 2LIPA 2P4EA 4RLFA 4BFXA 2BBOA 4Q48A 3LO8A 1PT5A 3VV3A 1PNOA 1RE0A 4J3NA 9ABPA 3EZFA 3W34A 3E18A 2X1MA 2EX1A 4WZ6A 4JI2B 5E7JA 1BFKA 1Z82A 2WYIA 3GN2A 4G5QA 1QGYA 4LNHA 3HKBB 3PGMA 2G5PA 3JZMA 3A6JA 4LTDA 2XH8A 5BQXA 3RHTA 2AD1A 5DTMA 1QGUA 2W4MA 4E1AA 3AZPA 3KEMA 5D6OA 4MDHA 4MWGA 1WB4A 2ENUA 4J1SA 4WFQA 4QTZA 4NC9A 1QHHB 1JJFA 3AWDA 3TAXA 1UBHS 2ZJ1A 2JIQA 5CIYA 3V4ZA 1QMPA 1MABB 1NIJA 1TYDE 3HSYA 1XHLA 3JALB 3O91A 4UEQA 5ALTA 3NUQA 3BZUA 1LH0A 3W8RA 4ERXA 2SBTA 4FYJA 1W1WA 3BL6A 3RABA 4D6YA 1E5TA 3FKSD 3JATA 1CRPA 1KEVA 5KQSA 3X1JA 1Q22A 3W1WA 2HSDA 3GJ6A 3H1BA 3NBUA 4ARVA 4B6QA 3RYCB 1UQUA 4EHLA 2QE6A 2OG1A 1PJAA 1RWVA 1JHOA 1A9YA 2G8NA 4X1YA 3OTWA 4ECAA 3U4MA 1ULUA 5JECA 4XARA 1AQLA 1DRKA 3NHBA 2FF7A 2F59A 2PHZA 5TEVA 4ZHQB 4EUNA 3JWGA 2HLPA 5HJ7A 3FZNA 1QRAA 3T94A 1E59A 1IM8A 5M04A 3RJZA 4BO3A 3MELA 3ENNA 2IS6A 4FBLA 2JFNA 2FMXA 1WBBA 2B20A 3KE9A 2N0SA 5AI4A 4CTNA 2XDWA 4GLOA 4Z7NB 2YFHA 2ZSFA 1E1YA 1SXJD 2YHBA 4PG7A 3D8RA 2A4MA 2ALJA 4EPWA 3E7XA 3O4IA 5KSPA 2D06A 3COPA 4FFDA 4UMEA 3SMVA 3LLVA 4P81A 4UAVA 2PL3A 2AQKA 4JLDA 4NQRA 1VG0B 5EIXA 2SCUB 1USKA 3F96A 3ZU6A 1FEZA 5FNVF 5CFPA 3WLAA 1ONBA 3GXBA 1SRRA 1JIKA 5KNCH 3AW8A 4KNYA 3HXLA 1CKEA 4TZKA 2XNHA 3TN7A 3VI3B 2MSDB 1D4ZA 3UUEA 2HRDA 2BH2A 1DAKA 4R54A 5F5NA 2H07A 5LUAA 4TWBA 3TWOA 1WEHA 2OESA 1BRTA 1HM5A 4JR0A 1II8B 3SBOA 4EG7A 2O1EA 2IY9A 4KQ6A 4NONA 3Q41A 4O0LA 1NVMB 1MO5A 4JB8A 3UXMA 4IW3B 5EXEA 1NMYA 2D3WA 2WE8A 1E1CB 1SXHA 4R0NA 4E4TA 3EZ9A 3P9PA 1MRNA 3HE3A 4EA7A 3K9FC 2FQYA 4RH3A 4MHTA 1DKNA 2NSHA 3K09C 4J3JA 2BMAA 1Y98A 4HDRA 3DE5X 2ZT5A 1QFYA 4DYDA 1KORA 3MQ2A 1GL9B 4FR0A 2I4LA 4FGUA 5CDUA 1NRWA 1EFVB 2ODTX 1QNLA 2XSZD 1PK9A 3KYCB 4Y7DA 4ME6A 4MS3B 3CUVA 4AJEA 4OM8A 4PYRA 3ROMA 3KC2A 1GLGA 1KP3A 2ZRAA 3NKLA 1QR6A 1SD2A 2ZATA 2HREA 4ZAZA 4HHEA 3MUOA 2DRIA 4Z4IA 3CZ5A 2B7LA 1GCAA 4JLPA 2PRKA 3QBJA 1RJWA 1H1LB 3QMVA 1VLQA 4ZQCB 3JD4A 5JS8A 3A1VA 1CR2A 3LXMA 5HCNA 5L7YA 3STHA 1OXTA 2Z2ZA 4L5IA 5EXDA 1WW2A 3WK4A 1SY7A 3PTZA 4A8JC 5A2QA 2WSBA 4RTRA 4OG2A 5GONF 1EG2A 3U1VA 2W6NA 1KHTA 2C78A 1YVDA 1JN0A 3G5TA 3K2QA 3U2QA 2WJYA 3OOHA 4D4LA 3DDCA 4DCNA 4MJXA 2IXFA 5ALRA 4HLUA 1SK8A 2H1FA 3QIVA 5IARA 3FSJX 1DAEA 4G5XA 4P22A 4WLNA 1D0SA 1OZAA 1DCTA 1TGVA 2EQ5A 2GSWA 3FOAA 2M98A 3G89A 4JT4A 4O5OA 1T34A 3U3JA 3D6NB 4EENA 5BV0A 3B1ZA 1G5RA 4KGVA 3ICEA 4DIFA 5JNUA 2NZJA 5L45A 1E3TA 1ZOIA 2AR0A 3PKZA 3I45A 4HDSB 1DOZA 2D13A 4UXIA 2IK8A 4G63A 5HQ3A 1A5BB 3BSSA 2BKXA 2EZ4A 2MSCB 4B73A 4C4RA 4H08A 4G0OA 3W5AA 2WYVA 5CXUA 5AKIA 2R7KA 5DDIP 3CSSA 4LDAA 4OA8A 4CIAA 1GZ4A 4EKEA 5A4FS 2MJLA 3NHPA 4UHDA 3VNVA 5D84A 3RRFA 2PUVA 1Z4QA 1ZCAA 5KJEA 2KB0A 4NIMA 1YQTA 4D4IA 3SE0A 2H2WA 3WDSA 4R1SA 1IDN1 1FFDA 1KOJA 1VIYA 2FQXA 5T64A 5IDVA 1SXJC 3I30X 4S0XA 1SUDA 3I6MA 4L78A 2PG3A 1Y3FE 2VRBA 3H2JA 3ODPA 3IEPA 5FPPA 5BORA 2GNPA 2P8JA 4C04A 3OT1B 4DPMA 1XF1A 1ZGZA 3KV3O 3PQDA 5A02A 5K3DA 1ZMOA 3KXKA 4ZXFA 1GCUA 1BGWA 3TUJC 2WJHA 3WSTA 4H3KB 4DDMA 2Q6VA 5AVRA 5CA1F 4OX9Y 3CWQA 3RYFA 1LX6A 3PVSA 5WRFA 2OGTA 1GP2A 3NV9A 4ZTBA 1RLJA 5KYYA 3H2KA 3GLGA 3P97A 4B85A 3ZLJA 5DYNA 4PZZA 4DLBA 1OLOA 5H5JA 4I9GA 1CY8A 4TL8A 4Z7JA 1CUJA 2XPCA 2GR9A 4OATA 4QOGA 5EWJA 3HYTA 1JA1A 4MQ5A 2RGXA 1Y1QA 1YB7A 4AG5A 2LDXA 5JROA 2CNWD 1I4LD 1ORWA 1SC4A 1V2GA 2LVBA 1P5HA 4HRXA 1LSUA 2DG2A 5I7SA 3IIKA 4F06A 4R40A 5L8VA 5C2JB 2IOFA 6GPBA 2VPTA 1NY5A 4A36A 3OEHD 2PTHA 2CZGA 1XX6A 3BZBA 1GNPA 2RK4A 3G7UA 5KO2A 5LU8A 1BVYF 2PO5A 4CU5A 4UULA 3QVLA 1ZA1A 1BRMA 2EIHA 3MHTA 1NNLA 4X6UA 4PCLA 2F9LA 3QE4A 5IKMA 3CFYA 2AL7A 1W75A 2JAHA 3KLOA 3EIHA 4OXRA 1Z34A 3UUWA 5KYUA 1ECFA 2HQ1A 3E5HA 3CTPA 1GGKA 3KT8A 3JSAA 1YZ3A 2FWPA 3RVNA 3UAGA 2QN2A 4ARCA 4IVNA 4IUYA 5AVVA 1U8AA 2Y1LA 1Z08A 3CBQA 3EFEA 5M29A 2I4RA 3A3YA 2V54A 1ZCZA 3CT4A 1NLYA 1XO1A 3O90A 3PUHA 1Z56C 3HVUA 2QPAA 5TEWA 3PJRA 3C3YA 1AB6A 3CLUD 2VNIA 3B53X 1N0WA 2I2WA 3WSVA 3BMNA 4UM9B 4INPA 4KLZA 4XJVA 2Q46A 1ZGBA 4LFAB 1JHVA 2P79A 3N3AC 1U2DA 1Y6QA 4KB5A 4E51A 5J4HA 3ZGNA 2VYCA 1Z9BA 3JQAA 1XCLA 3D6HA 3OJFA 2Z98A 4L1KA 4L3VA 5AW9A 3TQRA 4ABTA 1V48A 5C5DA 1VHLA 5LZ4A 3I73A 4EH1A 2MYUA 3O31A 1VM6A 1RHMA 2C1ZA 3KKKA 4WNAA 4X8LA 4F5ZA 5A62A 5GIOE 4LJRA 1BOOA 1PZNA 3QTBA 4Z9AA 4GM1A 3WADA 2CXHA 2JFZA 3B78A 1JU3A 1QK4A 1VI6A 4WVLA 4KPUA 2UVPB 2R8EA 2F7SA 4EKNB 1DBIA 2P40A 5KC9A 1KKUA 4RZ2A 5KNBD 1MZVA 2X8WA 3AZOA 3KKLA 1P2FA 1MC1A 1MH1A 5EMMA 2NMVA 4ZEOA 3R5HA 3EVAA 2ZJBA 1CJMA 3SC3A 2R6FA 4NVRA 4OIMA 4ZI7F 3NVKI 1KF0A 2X0IA 3DTVB 1JPNA 2WZQA 4M8LA 4LVCA 5DTIA 2CXRA 1EX7A 1UQTA 3FNBA 4G2TA 3VSDA 3G1WA 1G7TA 2A84A 3FNFA 4OUDA 4NKRA 1QGDA 1XSEA 3KSRA 4U2DA 4KHPB 3K8ZA 3M6XA 4HEJA 3RRZA 2RHTA 5BNZA 3GH3A 3GAMA 3C3XA 3H6GA 2CLKB 4LJKA 4QECA 4C6RA 1ORIA 1J49A 5JC8A 2BBWA 2PS1A 4OL0A 1GRQA 1QTRA 2DZDA 2I2XB 3DVRX 4N7MA 4OGWA 2BUBA 3QP9A 4JR1A 1KBQA 1EUYA 2AWNA 5F1OA 3AQIA 4WLOA 4EUKA 2Z3ZA 2XTZA 4A73A 4M1KA 4YAKA 3DDHA 1DKMA 4G5YA 5JZBA 1MENA 5F2EA 4ZC1A 2GTIA 4LJSA 2Q9BA 2ZRGA 2AV6A 3FETA 3ZBPA 2BE9A 4W8HA 4D9HA 1OWLA 4ZC8A 3LIPA 5C18A 4K5QA 1WD7A 4O4IA 4QOFA 3Q88A 1K6XA 3UK2A 1ZCJA 3OKPA 4LGVA 2MYNA 2VBFA 3GJQA 4TTJA 5CDHA 1E9BA 2OQRA 1KC3A 1M3SA 1LWNA 1OBCA 3OAAD 4N3CA 1HKHA 2COEA 4OJYA 3TOZA 4F7DA 4LV6A 3ILXA 1TD1A 2KWIA 3RVRA 4CM9A 3EC7A 1XEAA 3D5TA 1Z7YA 4LQLA 2GD2A 3UMJA 1OGJA 2J9GA 3OQIA 3WKEA 1JALA 3IPLA 5B1DA 2YN2A 3QVGA 4GLBA 1K27A 3DF9A 3GB9A 5TQ0B 3R40A 2H1CA 3V1LA 2FX2A 4A82A 1P0QA 1S3SA 2HDOA 3BRQA 4AP9A 1UPBA 2OC9A 3ZKWA 2OLKA 3A4VA 1Y6GA 2XMRA 1NYQA 2I3DA 3CLHA 4A91A 3T7KA 1IZ7A 5CBPB 2G1AA 3NHSA 4R2KA 3U4GA 3VR5D 3TRIA 3G8CA 3HEBA 1MAUA 2F43A 3PC8A 4RZQA 1Z6ZA 1X1RA 4LG1A 3T7AA 1TEXA 1L7AA 3DDNA 3TOSA 3VZQA 3LGSA 1ZH2A 3LW8A 3AP3A 3TOCA 4CYMA 1SQGA 4BO9A 2P7IA 1WW3A 4IQ0A 2GUWA 3L82B 3R5JA 5I5GA 1FLVA 4JGBA 2C4TA 2C58A 2O9JA 2UYOA 2XAAA 3EH2A 4J1NA 3DLCA 4YRCA 5THQA 4OGKA 4OK3A 2O7SA 1P7PA 1JHZA 1H9BA 4GH5A 3U81A 3G0OA 4F85A 1IPHA 4L9AA 1A50B 1P1BA 4E31A 5BOSB 2DHRA 2IYSA 1BD3A 4B3BA 1WCXA 5E1OA 1ORTA 1U0OC 2VRCD 1VFNA 4PSCA 4L28A 4RK5A 1B00A 4Q1BA 2FV8A 3UHPA 3ZJ5A 5MHTA 2WWFA 1P19A 1SUBA 1XYGA 1CQXA 1JHUA 3D0RA 3EHEA 3PFIA 2JRLA 3C3EA 1CXZA 3I76A 1O5TA 3QF4B 1M6WA 2VK2A 4G67A 3LTNC 4CPDA 1HDGO 2VRNA 4UQLA 3WNBA 3E9NA 1ZGAA 1G63A 4LTMA 2A7QA 3BK1A 1FRFS 4I1OA 1W4AA 5A5EA 1KJWA 2JH3A 4E5VA 2KLHA 5I7WA 1C7JA 1GGEA 3ANMA 2ZIXA 4GRDA 2K4MA 2V74B 4TVOA 5D01A 4BL5A 1CUDA 3BTSA 4IH9A 3L92A 1QAOA 1T91A 2I8LA 3A6EA 2HNAA 3B38A 3LDHA 3LNTA 2XF8A 5CA0F 2ZUTA 4EYEA 1WW8A 2J0QA 2Y2VA 1JEQA 5E2IA 1Y7IA 2LUOA 4H3SA 3WY9A 3EXAA 1QX4A 2NO4A 1H0RA 3G2MA 4EY7A 4ZDJA 3JAWA 4M46A 5KX5A 3V42A 3LRTA 1RI4A 1QGED 3G68A 3AYZB 4DCGA 2BGUA 3DXFA 4M3NA 4OSOA 1WE2A 4MW7A 4OI0A 1ZK0A 1IHPA 4G1CA 1PJ8A 2ZJAA 1P18A 2X6TA 3HKEA 3QBTA 4FSDA 4X92A 1GU1A 1CJTC 3TTWA 3ISJA 4BPRA 4BMNA 2ZJ6A 3O0DA 1RDFA 1GQRA 5DMXA 2I6FA 1K4KA 2X4IA 3CZMA 3KKZA 4O4LA 2E18A 2V3VA 1M75A 1TXGA 4MUIA 5AICA 2QRLA 3QKTA 4NG5A 4OJNA 5LQKA 4S04A 5ALMA 1YRAA 2B99A 3TIVA 1P7CA 3BAFA 4F3RA 4ICIA 4LNUA 2QAJA 3EEYA 1U7HA 1ISPA 2CVHA 3H5IA 2JZCA 2WTUA 2QE7A 2UKDA 4QU0A 4HYTA 4OI1A 5TPZD 1FFEA 4WK2B 2GCPA 2J4FA 5FOVA 4YQZA 3OY2A 5ERXA 2O0MA 3WGKA 1TYAE 4MYUA 2YRXA 1W581 4X44A 2AFRA 3WISA 4EHIA 2PKYX 3SYTA 5IG2A 1P4RA 3NDJA 5I9SA 1KU6A 3EZLA 1TPZA 2QQ5A 2L0XA 5EAIA 3OQJA 1CDZA 1J9EA 1H42A 2BI7A 3KHTA 3S2IA 1K3UB 5FBVB 3WZLA 3L4JA 1NQWA 4QE3A 5JD4A 1ZVQA 2QAGA 5AVKA 4IQFA 2FG5A 3DV0B 1ZIOA 2JGKA 4EFKA 3RSOA 1KDTA 4CR7A 5DM70 2XCRB 2ZLBA 1BS9A 1KEUA 2O8DB 4JBLA 4YUWA 4IZHA 1M1UA 1MB9A 5JSZB 1NW3A 2OHXA 1B6TA 1EDDA 3OHSX 2HYIC 1U1CA 3EX7C 1RR6A 1Q57A 3OPYI 3QWBA 3HRHA 2PWYA 5IJWA 3A1NA 4GBJA 4DIDA 3RRMA 4RVCA 5IABA 4ZDKA 1GKYA 2OZPA 3HFJA 3CNOA 1LLDA 3IQDB 3OF3A 2H4HA 4NU5A 2BDEA 2JH8A 4JITA 4YQYA 1DRJA 4UBIA 4UZSA 4N0DA 3SC2B 3UM9A 3WGGA 3SI7A 3HBMA 1MCZA 3IOBA 1BKYA 1OASA 1O94A 3RR2A 3DMFA 5ECYA 2BONA 2VDJA 4ZOBA 1SPBS 1MU0A 4CDGA 1KZGB 4WMLA 4YUYA 1ZD5A 2V03A 3C5CA 4DW8A 3ANTA 4IHJF 3PQ4A 4FYVA 3CW2A 4PR3A 2H4FA 1LLCA 4W7IA 3RFFA 3QA3E 5LMCA 2BEUB 2GN9A 4G5HA 2NU6B 4ZJPA 2QP9X 3ILYA 2ATEA 3N53A 5EHNA 5EQTA 1XNQB 1BDHA 1FXSA 3EQ9A 4FT4A 4IX1A 4MVJM 3AHFA 4N40A 2AN4A 3FMPB 2GPTA 2O7NA 2Y67A 3RSQA 4BNHA 4WY2A 4RTQA 4OQLA 3ZX4A 5JH7B 1WCIA 4LF7B 2G9UA 1S3IA 2O7QA 2P11A 2XADA 1NT2A 3FOBA 2Q2WA 3QU4A 2CJYA 2G0NA 3P27A 4L76A 4QPCA 2AR9A 3NPMA 4D44A 5ALQA 2CV2A 4NCAA 4FCTA 3REQB 3WAKA 2Q50A 3M5WA 3RUIA 4ENTA 4PZ0A 1BXGA 2R00A 4FX5A 3H4MA 5KKAA 4DSAA 1ZEJA 3DTNA 3AY7A 1LRLA 1ZYUA 2VHZA 3AKEA 4GVXA 4I4CA 4OMCA 5BUZA 1OWPA 1W4LA 3ED5A 3AI1A 3HO6A 3ZWWA 1RYBA 3OZRA 1OD6A 1WXDA 1USWA 3HKCB 4C7OB 2OGUA 4WPGA 3ZCXA 2AZXA 1OSNA 1U0EA 5BN3B 4KACA 3BXGA 3OMWA 5P21A 2C5SA 3G2LA 4KDCA 5LOVA 4N5LA 4RPLA 3K4HA 1Q0UA 5BT8A 5CX1B 1J09A 3HJNA 1EVZA 1LPMA 1GPYA 3ZR4B 4CLXA 2AN3A 1RTKA 1QJ4A 3FPGA 5I7VA 1QYRA 1EX9A 1K08A 4P4LA 1TC2A 2OP0A 2JI7A 3DMRA 3MWDB 2DKFA 4OQQA 3WZMA 4MCJA 1M5RA 4BKOA 3GVPA 5LZ2A 1QH9A 3HPQA 3MRVA 1ZINA 5BNIA 3JQ9C 4P80A 3K96A 4FW9A 4GIBA 4EG4A 3KBOA 1BFUA 3A9UA 1KNQA 1NF3A 1EUZA 2ZYTX 3M83A 3N0WA 3R77A 4J0CA 3SYLA 3WHLA 3GV0A 5LA6A 1B0PA 1RC0A 3H5NA 5B2FA 1VB3A 2C3MA 1FVFA 2FSGA 3L8YA 4J03A 4RGBA 4LDPA 1S6YA 2C29D 3OMXA 1R4NA 2CL0X 4RL4A 1EHCA 2VH2A 4D8XA 1RWWA 5AYVA 1S2MA 4J7AA 4AO6A 1K98A 1JDVA 4GWKA 3MM4A 4RLQA 1THZA 4ZREA 1C9MA 3SZGA 3VR2A 2C9ZA 2P6UA 4MRMB 1K8XB 1FA9A 1YQQA 2E2WA 2LCIA 3D6UA 4V0NA 1X7WA 4OY3A 3W06A 3ZQUA 4JX8A 2ZP1A 3IQEA 5AVSA 2V45A 4DXDA 1E4EB 3NC1C 4UMDA 4CCSA 2RFLA 4YWHA 1UINA 3C4QA 3U3KA 3SIWA 5FWDA 3KTOA 2O07A 2QQFA 3M34A 4HTAA 1ESEA 3FRHA 4C0WA 4CKXA 3K1ZA 3NXSA 5J2UB 2CBGA 2W2LD 1PDOA 4M1ZA 3UMGA 3GLRA 2HU5A 4I5FA 3OPMA 4BGIA 2CF6A 3HVHA 4URVR 3C45A 1XTKA 2AH5A 2YXBA 2J3KA 3O94A 4MLZA 3UA3A 1L5MA 3S81A 2VPWA 2C4KA 1R6DA 2PL1A 4PC2A 4FNAA 4NMLA 3ROEA 4X3OA 1O89A 1RWNA 3TKYA 3SM3A 4UBKA 1GZ3A 4BYGA 3W6OA 1WLYA 4RKYA 1PZFA 1V7CA 2JD1A 4GL4A 1U5BA 1V8BA 3WGVA 5BV1A 3WL3A 3IESA 2BFFB 4Z54A 2RI6A 3DEYX 1NBME 4JJ7A 3AG6A 3DHYA 4DA6A 3E8XA 4F5DA 4BEWA 2X2PA 1ML4A 2RJ3A 1GZSA 2HN9A 4OHOA 4PLTA 4E5MA 5KTOA 3Q0TA 3ZGZA 2B25A 1KZ1A 2Z58A 1AHHA 4RIHA 2FPXA 5GWXA 3WYGA 1KBOA 4KTTE 4MMZB 1G1MA 1Z4NA 2AFIE 1R6UA 3X3HA 4EA9A 5K0LA 5KTSA 1T8RA 5LDDC 3FTEA 3R6WA 1INLA 1TM1E 3ONNA 4IFEA 2V4MA 5FV7A 3WV5A 2XAUA 5J2TB 3U37A 1KE2A 4AY6A 4HGZA 1JIJA 2WUDA 5JMTA 1WABA 2XKJE 1LJUA 4LW8A 1JG3A 3N70A 4UM5A 1CFJA 4ONEA 3GDGA 1RAHA 2OXIA 3B2EA 4BLQA 2YNMD 4BKPA 1J22A 1RM3A 4B83A 1IZ9A 4AJPA 1C8BA 3K53A 4LPSA 1ULTA 4MVCA 5AVTA 2HMWA 3QU9A 1GTZA 1WUHS 2HO4A 4IGEA 2CHUA 3D43A 3TTTA 2WQ6A 5G0TA 2Z8YA 1JWBB 1U7XA 3DZHA 3C8ZA 3MCZA 1MG5A 1YR6A 5J3JA 4H17A 5ESRA 1KEPA 1J06A 4TM7A 4KWIA 1KFEB 1PO7A 2IXDA 1X13A 4A9AA 5AW2A 1Z73A 3O83A 3MINB 1PI3A 3JQGA 3FUVA 5EA2A 1WMEA 4CMIA 1Q44A 1U0SY 4LC0A 3WKAA 4I1VA 4ARAA 2P1RA 2GHTA 4LJ7A 4NZ9A 2BKVA 4Y9DA 4YRFA 1U0NA 1ECPA 4D79A 3AJAA 4KVGA 5M5BA 3HLKA 1SAYA 4FLMA 5JCXA 2QRHA 1CR6A 1K9VF 1SCDA 3PP8A 3AXTA 4KFTA 2PMKA 4O4JB 4MB0A 1KMHB 1U7ZA 3L1HA 2BISA 1YZYA 1BE8A 1VA4A 1LX7A 1DCKA 3LJKA 3RIEA 4TKUB 3ONDA 3S1AB 4QGHA 1JEYB 3CLTC 4U7GA 1XA3A 3V46A 2B8WA 3IUEA 3VR0A 3OC0A 1PL8A 2OENG 2ZBPA 4UTXA 1MC8A 4IDGA 3OFJA 4MWSA 4OI4A 4YP5A 4BLTA 4BV8A 3DVQX 2WWWA 1P81A 2VKTA 1W36D 4QXAA 2B3TA 3DH0A 4J1TC 2ZWAA 1PS9A 5KMGA 1Z35A 2OBFA 4BO0A 3PLNA 4BY9E 3O4GA 4EBBA 1GV0A 5J63A 1L7RA 1T8YA 2BSAA 3QENA 3WLEA 2B8EA 3LC1O 2XV1A 4IXMA 3BA6A 4QDZA 2YXLA 2F62A 3FPKA 2H92A 4PZ9A 2WYWA 3BFPA 3VJLA 2VDWB 3NXKA 1QGAA 1W88A 3B1WA 4AIIA 4KEAA 2OECA 3EYAA 3KOWA 4GW3A 1P5FA 5FR1A 1F2TA 4EJMA 4JWKA 5IH3A 4PY2A 2QWXA 4Q05A 4KPYA 1L4HA 1VHQA 4ZQHA 3I5YA 4AQYB 3OT5A 3VHXA 3RS7A 5EIEA 3AR5A 1EVJA 1TJ5A 2DP4E 2Y6UA 5SZHB 1RE1A 4RE6A 2H2IA 3ZV6A 4KH1A 2NYUA 3ZCSA 1SKBA 2IXBA 1WQ4A 1D1SA 1HE4A 3BWMA 3LCVB 4FZJA 4ND8A 4P86A 4YJGB 3W8NA 4EUFA 2D2VA 4ALKA 5FDFA 4NBRA 1QP0A 4EPTA 4BBAA 1E2JA 4X20B 2CC2A 4IIGA 2WMNB 3LRPA 4I55F 3G85A 3MSCA 3S7ZA 5KI6A 4XI9A 4I6JA 1B3BA 3ETJA 5C3MA 1GKLA 3T5TA 1UEXC 2J0VA 3H3FA 4QJBA 1Z2OX 4CUJA 1NW6A 1Y9EA 1ZGGA 3O3CA 4G9BA 4U2EA 1TIBA 2YYYA 1AU9A 2E4YA 4UU7A 4HBZA 3L41A 4ZOAA 3QVUA 4JL8A 4AL4A 5LN1A 5L7TA 5TR9A 2MHCA 2H2HA 1WULS 2YNMC 5JTUA 4KIJA 5J1TB 1F7UA 4YHBA 2HD4A 3HXQA 1IJFA 4MR9B 4QU8A 1ZNWA 4TLLB 1F2UA 3SZMA 4KZPA 1JQKA 4XPIB 3DZIA 1QHGA 5DN6D 2G0AA 4HDMB 3ORSA 4DV3B 4J0HA 1JUDA 2FLKA 2Q99A 2AUMA 1KERA 2GAAA 1U81A 3A4YA 3AFIA 4JOSA 4PBSA 2PMEA 5L3QB 4EHBA 3K9QO 1SIOA 4DMRA 4X64B 5CM8B 5CLLA 2ORIA 4GP6A 4LRQA 3A4MA 3C6BA 5LP6F 1RT9A 1BO6A 1X9HA 3W3ZB 2J30A 1E2GA 1QS0A 1P3JA 2OYRA 3I0ZA 3KJGA 2J67A 4YCDA 2CVPA 4ZAWA 4RVDA 3RC3A 5EJEA 5CGZA 2QG9A 3AT1A 3U4DA 5KKNB 3QU7A 1SUFA 1R9GA 3GUYA 4KQHA 4RX1A 2VT3A 2BFBB 3LWNA 2X0KA 3MN1A 4TSFD 4GOMD 5I7UA 1GNVA 2MSEB 2RIPA 3ROXA 1ZSNA 4KPEC 1RQ2A 3BZWA 5AVJA 2B34A 4XGNA 2P6MA 2BTOA 4F8JA 4I9NA 1IHOA 4UNPA 3L1VA 2VBGA 3OQ1A 3EIXA 4LXQA 2F1JA 1UFRA 1DQZA 3UANA 3OJOA 1RHQA 9MHTA 2ZUVA 1ZW1A 1FJHA 5LZ5A 3OTOB 4UVHA 3CS3A 3PPXA 3AF5A 2D0IA 4DWOA 2R1TA 5DXJA 3VDNB 1BWQA 1Z12A 3QOYA 3FCCA 1W85B 3TBKA 3U7GA 4UMFA 3VYVA 4IWNA 2Y66A 3NTXA 1VECA 5F2OA 3IC5A 3MD9A 4G4IA 2G9NA 3FXAA 4JBYA 4GKAA 1QQAA 3PXEA 1Z4OA 3EISA 4Q9IA 1HH4A 1R4MB 4Q01A 3FCAA 1KZYC 2P9HA 1OFGA 3R44A 2DETA 1LLUA 3TW8A 2DWOA 2GPWA 3PUYA 4WOCA 5DGCA 4U6NA 1YQGA 2I6QA 3N2LA 3UICA 1OLXB 2BH9A 2BFDB 5LB4A 5HCIA 2P5SA 4TYMA 3IMGA 3M2TA 1TTTA 4PLCA 1WO8A 4MO9A 5BUSA 4K6CA 1SVLA 4NMHA 3QE2A 4H6VA 1IY2A 1W2HA 3W2FA 5M2QA 3L7AA 2VH1A 3IR6A 2WYHA 3NUZA 4CFSA 1G5FA 5IJ0B 4XQ0A 2YC4C 3PE3A 3TL3A 3PNVA 4MJ3A 1QLJA 3BAZA 3BJMA 3OU7A 2FEOA 3V1TC 1XPUA 2QN6A 1Z0UA 3Q9LA 5GPBA 2HQRA 4MEAA 3OEED 1ZA2A 1UANA 2XTAA 4Q3EA 4OK6A 3ENZA 2P9TA 4R9VA 1XPOA 3RVPA 4DG8A 3IAS6 4GPIB 3KOMA 5F33A 3RU7A 2IHJA 2CSXA 4NOKA 5HILA 1L0BA 1YS9A 1Z6QA 3R3WA 3TLMA 4D9NA 5T41A 5HKKA 4UCXA 1L5SA 4EJ6A 5TDHA 1ZVKA 2WVHA 4MW4A 3K9HA 1IU9A 3DONA 2C88A 2YHAA 1ISSA 1QHFA 4HUQB 4QQKA 2PUEA 2YXDA 2FDRA 2JKYA 3OURA 5F3RA 3RYCA 2QRKA 4Q9HA 4A2CA 6NULA 2Q1YA 3OLZA 4I50B 1M33A 4YI3A 1JXQA 1E77A 4IUBS 3VYWA 2XT0A 4EQZA 1C3EA 4ZGBA 3TZ6A 1RWQA 2QXYA 3FBWA 5LQMA 1MC5A 4JQSA 3ON5A 1VSUA 2XJ4A 3GEDA 3WLKX 1SZPA 2ZIUB 3JVDA 3PK0A 1TC1A 1XROA 2BR4A 4DQ0A 2AYXA 5A0FA 4ZHQA 4ZVOA 5J2UF 1E1KA 4MZXA 4BDTA 2QTWB 2ZUBA 4E33A 5HS4A 4Q3DA 3UMVA 1AK9A 5LP1A 2MYTA 1NBHA 3IDAA 4N5DA 2VYVD 3UXYA 4O2AA 1L5GB 4C3UA 4CFZA 4DSOA 1G5TA 1XVAA 5HFJA 3OEYA 4KLRA 5F7ZA 4WLEA 3SC4A 1XU9A 4DN6A 1RWXA 3ELDA 4MI1A 2XOKA 3CB2A 4HGNA 1YJ5A 4CMAA 3FTCA 2FH5B 1J2YA 2QR2A 4MUKA 1IK6A 2OSBA 1XZBA 2FSHA 4X0EA 1GTSA 3A6PC 4NH0A 2SCUA 1IK4A 4OI2A 1KY3A 2BMEA 1J8YF 1V45E 4PYJA 4QGSA 3SR0A 5IVHA 2Z6QA 1YQ9A 2KM1A 5K20A 5IXSA 1IWPB 2X3FA 3ZBQA 3AEQB 1YA4A 1G38A 1RM4A 5FO0A 1XZJA 1XDBA 1WOMA 1Q1BA 2FR0A 3Q6MA 4XD7D 3LSTA 4P4TA 2PK3A 3FNEA 1B8OA 4OBWA 1RWOA 2O1XA 4K9RA 3ACBA 3PGXA 4C0XA 3U7FB 1FRQA 3Q8KA 8MHTA 3C7CB 1DC5A 4GRAA 1UKVY 3WK8A 3T1HB 4ZAFA 2QHXA 4NJOA 3D59A 3H0EA 1YR1A 1HT1E 1Y9ZA 2YRWA 1E1CA 2VJLA 4N5HX 4Q93A 1UAAA 4K81B 2NU9B 1CEEA 2VF7A 1BSVA 1TFRA 2IZ6A 3QBVA 4AURA 4HNHA 4A15A 3IAXA 1XXHE 1YZGA 4NEQA 4JBNA 1CUUA 1OROA 2JDIA 3FA2A 4G81A 1Y5RA 3RUHA 3FVWA 4MVJG 3DFKA 3PZBA 4BTEA 5F7OA 2EKQA 4CIWA 2X7HA 5COQA 5DCYA 3EPHA 1KEZA 3DCJA 2CK3A 4ZGGA 3SBXA 5THXA 4RADA 5DTQA 3MT8A 1ZUNA 1R18A 1O6GA 3PC6A 1AUVA 1AGPA 1V6SA 4A0GA 3SN6A 4TTQA 1ATZA 1Z6TA 4CODB 5HW0A 4WCDA 3DP7A 1DC8A 4M89A 1DKUA 4QUDA 4TOIA 5EEGA 1H9CA 2R6ZA 4W82A 4AMUA 4IF4A 1CY1A 2HH9A 1NJ5A 1NVKA 4JLKA 2H6EA 1C4XA 1UMCB 1M2VB 3I4LA 1T3HA 2QROA 1UP6A 3FB4A 2GI4A 3OE4A 4UOQA 4LOLA 5MN5A 1GRCA 4MVJD 4O25A 2H2GA 1BXZA 3F3SA 1AHPA 4NEHB 1DBWA 3VR6A 5M7EA 4LF4B 3L9XA 4WCFA 1VMEA 2J3LA 2PXHA 3AKCA 3VPDA 1FFSA 4X6LA 4EO9A 3TGLA 1YR8A 1Y8AA 1ZICA 5CP8A 3U5TA 1TW2A 4FFBA 4YJDA 5FPYA 4RWEA 3BTUA 1OU4A 3SOPA 1IL0A 2I2FA 1YUBA 1Z29A 1R6VA 2JARA 5BN1A 4L57A 1D6MA 1WUTA 2Q0SA 3WMRA 1MD9A 4FHEA 5ARDA 5NLLA 1ANKA 1WCV1 2V6MA 2CW5A 3MJTA 1I9CA 2BGRA 2HPHA 1BROA 2VTVA 4N82A 1M6HA 4RD2A 4TL6A 3UMSA 3Q0EA 5C46F 1JSCA 1ZAYA 3CE9A 1IN8A 1CTQA 3PNOA 4XWWA 3SHFA 4NI5A 2LNDA 2O06A 4MITA 4B09A 3KYBA 1AQJA 3LVQE 3W6NA 3GFSA 2AFIB 3RT7A 2H2DA 5C34B 2P8SA 4C6TA 4EDHA 2CGEA 3H1TA 1UDRA 1VKRA 1FXWF 2KI5A 2LPMA 3AHDA 4BQIA 3GEMA 4ZAGA 3T7EA 4CKEB 1T2FA 3W77A 4B0PA 5IZCC 5LIPA 3FKJA 1GPDG 2VWQA 2BBTA 4HF7A 1BMDA 3KTDA 1WUKS 3CGGA 4FOSA 4M9XA 4PAMA 4RU1A 3EG9A 4LE2A 5DV9A 3A11A 4MAAA 3RC2A 1FIUA 1EK1A 3FSEA 3KFVA 2QRZA 3HDVA 2IYUA 4JVLA 4LWOA 3WK5A 5I7OA 2VHCA 2X14A 3P2YA 5JCJA 2NAFA 2Q4DA 1G4AE 3HGQA 3NIBA 4R2IA 521PA 1PQ4A 2A35A 4EUSA 5C51B 2OK8A 2ZYRA 4RVGA 3VKHA 3KUCA 4LISA 1ZD1A 1UEJA 2ONYA 2C5HA 2HZBA 2YHSA 3I23A 1AS0A 2P62A 3UAZA 5BMVA 4TMWA 1RRGA 2H54A 3AV0B 1XDDA 3LPLA 4PVDA 5A7HA 2HWKA 3B6MA 4A5SA 3NI2A 3I01M 3Q3GE 4Y98A 4G37A 2ANBA 3MJRA 1FLDA 3DZKA 1CQWA 1ZLYA 4CNQA 1JECA 5CFNA 4XWYA 4B31A 4NH4A 4FJ0A 4RJIA 3IPXA 4R2LA 3K0KA 1A04A 3GAZA 4G26A 4IDAA 2PD6A 3QYFA 1VBMA 1FRZA 4GECA 1C80A 1TUBA 3IAEA 2B1JA 3M9WA 1RQXA 4Q9NA 3OPNA 4PHFA 2XVYA 4HX9A 4EHJA 2EWMA 4OFBA 6ABPA 3TMKA 2QUHA 3H2BA 5KYTA 4UATA 1CY6A 4WOBA 3B7WA 4FWIB 4CU2A 3OWOA 4NHEA 3NYIA 1U2GC 4D1YA 4Y6PA 4HSGA 4HAWA 3JVUA 2OCYC 2H16A 2A86A 2JIZA 5L40A 2C2XA 2Z9BA 3E27A 3JWJA 4UTOA 1T3SA 4BJ3A 2OMKA 3E7WA 3DDUA 2YJZA 3CJTA 3G6WA 4LGMA 1J0CA 1VJ1A 3H99A 3I6QA 1Z8FA 4MPRA 1SG0A 5ILQA 1DHTA 1SVKA 5IZ4A 2J3DA 2DGDA 1NHWA 4QXMA 4ZPXA 5JBIA 2PM8A 2BDTA 1OI3A 3UF0A 2MIIA 2WT8A 1NE2A 1O58A 4YP7A 4NYMQ 3GPLA 3V8RA 1OFHA 2ZR8A 4I8IA 4YLGA 1C9NA 4OGGA 1A8HA 1F4PA 3ZHYA 1MB0A 3BHMA 3EH1A 4CLOB 3LUBA 2E6KA 2YX1A 1QR2A 2X1HA 1OA1A 3CXRA 5T8KC 1NLZA 4GOJA 4GL2A 2IWRA 2W6QA 1QDUA 5I3CA 1O6CA 1UAYA 1XZMA 2W6PA 2JRCA 3G1UA 3GGGA 4CQJA 1DFHA 2IGBA 2CMKA 4JCCA 4ZCQA 5BSVA 1M0EA 3T6KA 4B3JA 1PV4A 2UVPA 2Q29A 3A9CA 1XWWA 4IGAA 4TTVA 4JL6A 5L7WA 3LGAA 1VYVA 3RF7A 4LBYA 1OFUA 2AA3A 1S3FA 2QY6A 3LVFO 2FCRA 1HUQA 2IGTA 4Q7EA 1DT3A 1A7AA 1DUVG 3VJRA 5CJ2A 3DZGA 4AQDA 1U1EA 5ALGA 2D1QA 4WK4B 1JJBA 3DWIA 3A58B 3E61A 1QB8A 2QX6A 4I1YA 3HXOA 3DV9A 3FMOB 2BM0A 4YAOA 4UVGA 3DMNA 2X5JO 5BN4A 2G70A 4KVAA 2P4SA 1GNLA 4NDAA 1FNNA 4JYPA 2JCVA 1O9BA 5FULA 5KVQA 3ZH9B 3KQLA 1XRNA 1UFKA 1Y5NA 4PPGA 5H9WA 3DSRA 1NSTA 4UU8A 1ZNQO 3GA0A 4M7WA 5DI9A 4FK8A 5IAEA 2J0UB 2RH9B 4PX5A 4RHFA 4F1JA 2W2KB 1CUEA 4EKYA 2YIJA 3TI7A 3TEJA 1JG7A 5AW4A 3EPJA 5FUMA 5HK9A 4EARA 2HB6A 4MPPA 3EOZA 2C20A 2WUEA 4Q1AA 1UT5A 4RZIA 3AL3A 2BFOA 1H6CA 3BD6A 2UZ4A 1WDKA 3QEJA 4DQLA 4GRIA 1E8NA 3BIWA 1K5PA 1DJNA 3W2IA 1G21E 1NMZA 3I62A 3F2VA 2W2QA 5GV8A 4LOHA 3PIDA 1H4SA 2ZRDA 2BGJA 3WLNA 2C1EA 4DUYB 1YL7A 3AF2A 2P0EA 4H4CA 1U2ZA 5EIHA 1G7CA 4YRQA 1CRQA 1T4GA 1GG8A 2AE1A 2C2OA 2EDCA 2FW7A 2OFOA 2R86A 4MB6A 1DL5A 5KWEA 2J5QA 4JSRA 5JYEA 2JFPA 4RNCA 4TS3A 1SURA 3H5WA 2ZG6A 3FDIA 3QOXA 1JHXA 1QG4A 2BR5A 1UBSB 2CKDA 2PX8A 1UK7A 2WYUA 2IYWA 3L1IA 1Z75A 1KFCB 1SU7A 4HWGA 3IEUA 1IXYA 3P9KA 3VH2A 4QGAA 1HYQA 5KYWB 2V4ZA 9LDTA 2Y1GA 1ULSA 2OZEA 2OORA 3L6OO 4HAZA 3CEAA 1HTTA 4F96A 2ZBFA 2CWWA 3CVJA 5CEJA 2QGNA 3W5IA 3CNBA 3EGVA 3B1JA 4PAWA 3RNOA 2FPPB 1RXYA 2PLWA 5CBPA 5HIJA 5FUQA 5IVKA 3KALA 4X6XA 4A6DA 1LSOA 1X7YA 3N5CA 1WZIA 4FSXA 1VRVA 3FWYA 1GSIA 2QVXX 3PFWO 1AY0A 5F2KA 3VR6H 2HHLA 1C8KA 3L2OB 5AXAA 2OHFA 1PD0A 4K26A 3L4BA 2IF0A 3KKMA 5JDIC 2ZAIA 4QBHA 5BVHB 5CYPA 4CQLA 1W46A 4MCAA 2JH9A 3KPUA 4YRRA 3RSZA 4F3TA 3IQHX 1MQ9A 1XZGA 9ATCA 2DBRA 4NOJA 3B8EA 3VKUA 5BOSA 1LPPA 1AJEA 3K8QA 1IY8A 1TUIA 4YXWD 1HV8A 4MVJE 1TTQB 3UAYA 3BB1A 4ZOLB 2JAWA 2B7CA 5D3QA 5TF4A 1QO0D 3U7QA 3ZE1B 2HJ9A 3VHLB 4F11A 3PJEA 4YV0A 3AESB 1APBA 3VZPA 1CZLA 1VGVA 3PL5A 1O57A 3LYLA 3QF4A 3RW9A 3DLHA 3UQYS 5DYYA 4B4VA 1KZ6A 1TJPB 2EHDA 2JFYA 1R6AA 2DBVO 2PO7A 2Q0XA 3U3RA 3V8BA 1DAGA 1QUEA 1RQ7A 3TLGB 3G2HA 4YMTA 2AJCA 3GJ5A 1FDVA 2GLUA 3R3HA 4V3CA 4FC6A 3PJFA 1QQ6A 1R8XA 3TSCA 1ZM4A 1Y42X 4ABYA 2WWYA 2HT1A 1DNPA 2XODA 1XQYA 4KAFA 5AK3A 3B3QA 1UKBA 3P2KA 1MP0A 1AMUA 4KIUA 1NNSA 2QV7A 4KBGA 1J2JA 4H9GA 5E8JA 5L51A 4MH0R 3O1IC 1KEWA 4QBKA 2C82A 3TZLA 2BZGA 1P72A 3H2ZA 1VRWA 2OCPA 5SYAA 4NXNB 2W5UA 4OXNA 5K8CA 1XTVA 2H29A 2YHIA 3V1NA 1RM5A 4DREA 1Z68A 3H9UA 3OKAA 4ND1A 2Z5FA 3EXIA 3PL1A 3PUVA 2G8LA 1B8VA 3V80A 5DTRA 1WWKA 2FGKA 3ZD9A 4EY5A 1HSOA 1VTKA 5U1PA 4M8KA 4N0EA 4Q4LA 4P2BA 1YUNA 5GY7A 3UCEA 3JZFA 3ZBTA 1MMFB 2ILVA 2SKEA 3I4FA 4ETMA 1V3UA 4LZJA 3RT1A 3VKVA 1OBHA 2IEYA 2XB2A 5HIAA 1FTYA 1Y9JA 4BMDA 3D3KA 3C8HA 4O59O 5K05A 1L4FA 4LRYA 3R5TA 1IBKB 4EVSA 5DHQA 2XRMA 2QKYA 2LGJA 4ARSA 5JSQA 1DHRA 4GG1A 4NNOA 3ZD6A 1UJCA 1DQRA 5F52A 3ZJYA 3WYAA 3HJFA 1T2AA 3T54A 4ZVRA 5EE9A 4ARUA 4ZZIA 1Z39A 3U4QA 3NONA 1U0LA 1RI2A 3RSGA 1SKMA 4J9VA 1NTRA 5A7GA 4K8OA 4AJIA 3O8CA 4G85A 4IOKA 3AEYA 2EZ9A 3EF1A 3I9MA 4PO9A 4ZQBA 1JH8A 2AZMA 4QL3A 4FE7A 3SKVA 1NP7A 1XEXB 4NDNE 2IYOA 3WKBA 4F5EA 5LMNB 1M10A 3KU1A 3QNMA 2BBSA 3OCCA 4IOJA 2Z5LA 3NORA 4RM3A 4RMGA 4Y2GA 3TR5A 2Q6KA 4CTMA 4IQ4A 3WV4A 2C5EA 2DJ5A 2FFAA 2WF7A 4I08A 1C3LA 1Q92A 1KSGA 1RZRA 1E62A 3S29A 1S89A 3BICA 3A6LA 4PR0A 2OV6A 1QHYA 4XEUA 3SCZA 3RVKA 1NRXA 3UV7A 2SNIE 1H8EA 4BUZA 1O4VA 3DV0A 5GOZA 1L7QA 2O8DA 3WP0A 2VJPA 1DKLA 3HZHA 5A05A 3B7PA 1FCJA 4L50A 1LSJA 1U0BB 1XXHB 1W36B 1A9ZA 1FNCA 3JAKA 4HNAB 3C3CA 3H8SA 2BKLA 3WQRA 1CVLA 1I6MA 1X8KA 5I7AA 4YPOA 1E2MA 3A6ZA 4J43A 5EP4A 1EFLA 4EHDA 4RIIA 2ZTLA 3JASB 3OWXA 4N4AA 2UUBB 4I1UA 5HYVA 1M1NA 2AJTA 4FOLA 5KYGA 3U44B 3A4IA 1MXHA 4I1RA 3ASUA 2OVBA 3SC2A 3AUXA 1B6GA 3ESYA 2V65A 3E9CA 3GBVA 3PNQA 1A7KA 4WZAE 1N6KA 3PHBE 4QEZA 2D5AA 1Y5IA 4Y9RA 4AXBA 4C7BA 3ETDA 4S1VA 2PUGA 2NSYA 5C8YA 4F6LA 2A6PA 2V7GA 4BO7A 2OFWA 3F7MA 3W7AA 4QDKA 3WMEA 1H2HA 4DCSA 1N9KA 2BEUA 3UATA 9LDBA 3VR4H 5LD2C 2H3EA 3M3HA 1GN9A 4B3DA 4I4LA 3IQIX 3IYLW 5I6DA 2P30A 5B53A 5AW1A 1ZSYA 4RE5A 3F8WA 1HFKA 2QRQA 2FW1A 3TLKA 3ZHQA 2GLXA 5BSFA 2W00A 4YJFB 1YZTA 1EX1A 2XTJA 4KFCA 5DLPA 5JH7A 4F4UA 1Z8HA 4TV9F 3ML1A 1QZXA 1QCYA 2VFAA 1Y3AA 1P31A 3IDOA 4INZA 1GWNA 1O0BA 1B15A 4JYBA 4BX2A 4DGSA 1UZUA 3CURA 5IK2A 1CV2A 2QU8A 3NOXA 3AXSA 1T4CB 4DZTA 1DAHA 4FZ5A 4RO0A 3VYUB 3NTRA 1XZDA 2JI4A 3QH4A 1N6PA 2WTMA 4PYMA 3S5UA 3W8DA 2YKGA 1VL0A 2C83A 1T6XA 4QQRA 4C7OA 1F2VA 4DCVA 1AZSC 3NBMA 4DS3A 5K3EA 4IVQA 2WABA 1W6UA 3CV3A 5DASA 2IV2X 4LF9B 3HUUA 4RIGA 3EGXB 2I6TA 5BW4A 1XLUA 3T3NA 2PSFA 1F0KA 3GRKA 8GPBA 4M37A 2QLNA 3VR3D 1E66A 4JL5A 1JDSA 1W6RA 4JIMA 4L08A 1IY9A 4PLGA 5CX1A 4BGEA 4CQMA 3EPLA 1EA5A 4MKIA 4BQSA 3QFHA 2FMTA 4YLEA 1AHNA 1GPJA 1LVUA 4Q4AA 2PBFA 4YO7A 1W0JD 4V1CI 4GXTA 4ND5A 3P9ZA 3WWCA 4MUGA 1QVZA 3EMVA 2FW0A 3NDRA 4YFYA 3U31A 4PG5A 2F17A 4DJ5X 1TGYA 5H59A 1N2BA 2AG6A 3WBJA 4BO8A 3LO5A 2F4VB 1LKZA 3LX6A 5J59A 5ARBA 1YRQA 2B98A 5BYKA 3KQMA 1DXHA 4D42A 5JAUA 1X0VA 2W43A 3ND6A 4I1IA 1MUUA 3Q8LA 4G3XA 4ZVKA 1XQWA 1BD4A 2QTAA 4F71A 4R8KA 2IYTA 1RQGA 3A1WA 3CVUA 4QULA 1RQPA 2GN8A 5I8ZA 4EABA 1YZNA 2G77B 4D25A 2OUIA 2V5UA 4MRMA 1S7GA 2Y4NA 1A4RA 3H5AA 4FOPA 2QTTA 2RHOA 3TTXA 3PEWA 4P08A 1K1EA 1I2MA 4FLEA 1K4YA 1Z28A 1TM5E 3EY4A 3OQVA 5EP3A 3TQOA 3UWOA 3WNVA 2OO7A 1NTOA 5K3CA 4PWZA 1GG9A 1E4EA 1CS0A 2E4AA 1TAUA 4UU1A 2EW1A 3QWHA 3BILA 3GOHA 4MAFA 1F14A 1JT2A 3K09A 4MK4A 4OJTA 5FOXA 1OH7A 1QP4A 3O9MA 1WR8A 4RGVA 4YJ3B 4L27A 3KHUA 1MBZA 1Q50A 5F23A 4AMZA 3CWCA 2VSQA 5J2UA 3M89A 4ZVLA 3CEMA 3II6X 3OTGA 4K8RB 2IHUA 4GE0A 1F9EA 1P2SA 2IP1A 1XAHA 4IUCS 1BGVA 4YYEA 4BO5A 1GGHA 2A8YA 3MT0A 3NASA 5DX8A 4P0PB 2QN9A 1P8JA 4QDJA 3OQMA 1FBTA 1GZ5A 3AW9A 1LPAB 2FUNB 1GOTA 4QFBA 1ZIYA 3JS5A 1NN1A 1OIWA 4G36A 1PW5A 2GJ4A 3CUKA 2BFFA 2M1ZA 5AM2A 1YZKA 4UC0A 4E15A 4XOUA 5K01A 1JA0A 3NH9A 1XPJA 2OAQ1 2KW5A 4A8JA 3ZCTA 3EAGA 3R6GA 3KLMX 3KS9A 4IIJA 3ZW9A 1X7XA 4QSHA 4CI9A 3RKRA 2ETVA 2LRHA 3VC1A 2PSEA 4WKPA 4D9CA 1Y9AA 4NECA 4PGFA 3RPEA 1I32A 1MA0A 2FN3A 5TMEA 4IIBA 2FLVA 4YP0A 4CEHA 1C9EA 2PUJA 3WXBA 3PBKA 2A67A 3FAKA 1QFMA 3FPAA 2P4HX 1OXSC 3FKSA 3PVZA 3QE3A 5DBEX 1GV1A 1J70A 2VXYA 3E3LA 3M8KA 5ECGC 5FBRB 3MTQA 1TM7E 3ZNQA 3G6KA 5BVGB