4L3OA

Crystal structure of sirt2 in complex with the macrocyclic peptide s2il5
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
302
structure length
297
Chain Sequence
b'KERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGMIMGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent protein deacetylase sirtuin-2
publication title Structural Basis for Potent Inhibition of SIRT2 Deacetylase by a Macrocyclic Peptide Inducing Dynamic Structural Change
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 90
structure length 297
sequence length 302
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.-:
pdb deposition date 2013-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4l3oA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4l3oA01
2B4YA 1O96B 4JSRA 2FWNA 4BV3A 1M2KA 4QPZA 2FRDC 4RMGA 3LQ1A 1S7GA 5MGNA 4BVHA 1E3TA 3RIYA 3U3DA 4IAOA 4GP9A 1M2NA 4Y6LA 4KGDA 1Q1AA 4BN5A 4K9OA 4GM1A 2A1UA 5EJ6A 5FEMA 4BVEA 5K6TA 1EFVA 1PT9A 4RMJA 4ZZIA 4RJIA 4L2IA 5DEIA 5K3SA 2JI9A 3JWPA 2H2IA 4COKA 3GLTA 2H4FA 1PNOA 4KPUA 5BWNA 1YBHA 3ZGVA 3FLMA 3F6BX 1YTLA 2A1TR 1N0HA 4BV2A 1Y9DA 4JU8A 3JR3A 4F56A 2VJYA 4JU9A 4JUAA 4Q9DA 4UUAA 4MZXA 3CLSD 4K9KA 2QQFA 2Q5JA 1ICIA 4GM0A 1POXA 5EJ7A 3D4BA 4K9LA 2FSVC 1ZPDA 4FVTA 2AG1A 2H2HA 2IHUA 5DGTA 1YI0A 4MQ5A 1QPBA 2JI6A 2EZ8A 2Q5OA 1O97D 1U2DC 5EJ5A 2AG0A 2WVGA 4K9MA 2UZ1B 1YHZA 1DJLA 5EJ4A 4FZ3A 4FEGA 2VK1A 1Q17A 4UTXA 1OZHA 1PYDA 5K2OA 4Y6OA 1Q6ZA 4BN4A 4IF6A 4GM4A 2JI8A 3PDHA 1PVDA 5MF6A 2JLCA 1U31A 3F6EX 3IAEA 4I5IA 4UU7A 2DJIA 2NYRA 3CLTD 1SZDA 4BVGA 2C31A 5EJMA 3IAFA 4JUFA 1OZGA 4UU8A 1PNQA 2H2GA 3ZG6A 1Q14A 2H59A 1V5FA 2JI7A 3PKJA 4RMHA 1YI1A 3EA4A 4MPJA 2W93A 2WVAA 3FZNA 3HWX1 4QQ8A 2V3WA 4BUZA 1T9AA 4JUBA 2H2FA 1T9DA 1V5EA 2Q5LA 2PANA 2FN3A 1BFDA 4RMIA 4BVFA 2JLAA 3ZGOA 4HDAA 5EJAA 4UTRA 5MFZA 5FYQA 3CLRD 4UTZA 3GLUA 1JSCA 1U2GC 5MFPA 1MCZA 2IHTA 4QELA 2VK8A 1UPAA 4JUCA 1EFPA 1OZFA 3E9YA 4C7BA 2UZ1A 3OE1A 4GG1A 3D81A 3U31A 4V1CB 2EZ4A 1POWA 5AHKA 2JIBA 4JUDX 4D5GA 1T9BA 1YNOA 5EJ8A 4KXQA 2HJHA 1M2GA 2WVHA 3D7KA 2H2DA 2VBIA 4J16C 1UPCA 4K9QA 1UPBA 4MPPA 1NM5C 4J1TC 2Q27A 4G1CA 4V1CI 1U28C 1XLTC 3CF4G 1PO7A 2H4HA 4TWJA 2EZ9A 1PI3A 1YHYA 2OO5C 2VK4A 3EYAA 2VBFA 2OD9A 1SZCA 2Q28A 4GPEA 1J8FA 1M2JA 1Z8NA 4X3PA 2OORC 4C78A 4O8ZA 4ZP1A 4FEEA 5K6RA 2H4JA 2OD2A 1M2HA 1T9CA 4UTVA 4K9NA 4TWIA 1PTJC 4F4UA 3EY9A 4L3OA 4Y6QA 4K9PA 2EZTA 3GLRA 2EZUA 4R8MA 3RIGA 1HZZC 3FSJX 3PKIA 1D4OA 4X3OA 4JT9A 4UTNA 4V1CA 3CLUD 3HWWA 2FR8C 2PGOA 4HD8A 4RJKA 5D7NA 1V5GA 5DGDA 5EJ9A 1MA3A 2QQGA 2VBGA 1YC2A 3GLSA 2PGNA 4UUBA 4JD5A 2X7JA 2OD7A 4MPRA 2NXWA 3K35A 5IMSA 4BVBA 5BWOA 1OVMA 2Q5QA 1YC5A 4D5EA 4RJJA 1S5PA 2BRUC 4JT8A 4IG9A 5BWLA 2Q29A 2IHVA
chains in the Genus database with same CATH superfamily
4D57A 4UHDA 5AI8A 5CT6A 2R8OA 4CL0A 3GDOA 4N5HX 1WTAA 1RRCA 1M2KA 1LNQA 2PEYA 4LHEA 4XIGS 5LMZA 2IF2A 2A5LA 3KXDA 1WPQA 4J7UA 3NHYA 4Z9YA 5BV2P 1V2HE 3CW8X 5MGNA 2IW1A 4R98A 3FVWA 1F2UA 4WK6A 2G9NA 1A88A 2XUDA 4H18A 1DAPA 4OGWA 2DBRA 2XGOA 3RUPA 1DQZA 2FEOA 3WYNA 1MC8A 3P97A 1SWVA 3R3VA 5FQOA 4B9EA 2YJ3A 3I9OA 1VLMA 2ZVDA 3COPA 5A3SA 5DNVA 5E6UB 3HV0A 3O7MA 1RPAA 4GP9A 4WDRA 1RKXA 1FFYA 2WA2A 3GJ8A 1RJGA 1L0BA 1XDBA 4RIEA 4B74A 4TTIA 1E0DA 5AI0A 1H5NA 4BTEA 1COZA 1BWQA 4B4DA 1XDDA 3TNLA 1OVGA 2PVSA 2BBWA 1GFSA 4UM8B 3S5UA 5BNIA 6REQA 5E6RA 5JU6A 1ZJ6A 3BTOA 1D8AA 4GS5A 5L4LA 1EFCA 1PT9A 1U1FA 1PGNA 2HA4A 3H42B 1X39A 3O94A 5AKKA 4J1QA 2VSFA 2CNLA 3PJEA 1UBHS 5DEIA 4N8SA 2BGJA 4DT1A 1GPJA 1PR2A 2WKWA 1WHTA 2A84A 1XNRB 1XRLA 4LOKA 1T3ZA 3PRJA 3RHTA 3HB7A 4FFNA 3OE7A 1ZL2A 1KVTA 3KR9A 2JJ2A 4Y2RA 4NFLA 1S3FA 4GI5A 5JADA 3QHAA 4XJVA 5T6MA 3V7UA 5HS4A 2R6CA 4QGSA 4YMTA 3SEAA 1ENOA 4EABA 3F49S 4W8GA 3L7JA 1P39A 1YZVA 4J91A 2PRSA 4FDTA 3F6BX 2ISCA 2GAOA 2IT1A 3IIEA 1ELOA 5KYUA 4E70A 3TB6A 1YTLA 5FOUA 3TEMA 4DQLA 4CKCB 3LY9A 5SICE 1UMBA 1PZGA 3OZIA 4PGHA 1HLPA 2FPUA 5JISA 3AKCA 3LL4A 3PJGA 2VJYA 3UICA 1TO2E 1FUEA 1OE0A 2ZP1A 3MBKA 3F8SA 5C7LO 1MXFA 1OROA 2RK3A 1CERA 4IILA 4KSCA 3TR0A 2ENUA 1EP9A 4EWLA 1CTQA 4QVGA 5LU8A 5JS1A 3JPYA 3ONEA 4ZKDA 2DFNA 3F8WA 1OI4A 3CLSD 1A9XA 2Q8PA 1BMFA 1DBSA 5E1BA 1JKFA 1EGQA 1DXYA 4J0HA 1P19A 2LD4A 2RH4A 2UZ3A 4HGYA 1P9WA 1Q0SA 1P0IA 1BH2A 2QLBA 4DV3B 4CMGA 2RBGA 3D2BA 2QL7A 4PPQA 2WM3A 3UJ6A 4GRDA 4NOLA 3ESYA 3TLEA 5AVZA 2VTVA 2SKDA 4P83A 4WOPA 4DKXA 4G25A 3L8DA 5DGXA 1B0PA 4GYWA 1CLUA 4ZHQF 5DP1A 1MGPA 2CV0A 1YIAA 1NHWA 3AUAA 4PBSA 1B6RA 4J4TA 5F3WB 1N6KA 1CF9A 3JZIA 1HXHA 3GDGA 4L5CA 2A3NA 4XCXA 3TG2A 3HVRA 3Q2OA 1REQB 1E2NA 1EM6A 4CMKA 1T2DA 2KLBA 4N3NA 3PFGA 4PX2A 5L3QB 2CMKA 1GG8A 5DOZA 4F71A 2H9AA 3KR1A 2J9YB 5FWNA 1H3EA 1H6DA 3DLAA 1DG3A 3ENZA 5C1BA 1KMHB 3MCVA 3SBXA 1KFCB 1OT3A 1VG0B 1EQAA 2HDWA 4G4IA 1TEZA 3F67A 2QLLA 1NJSA 3TUZC 3DOUA 3E5NA 2JGAA 1CQPA 2FFQA 1VHLA 5FI5A 3EPHA 3GROA 2EGHA 3K92A 1KOFA 1M10A 1Z17A 3OICA 3EXHB 3U3KA 2JFXA 4NH0A 4AUKA 5I48A 5IS2A 3T7RA 3ICEA 1JLRA 5CD9A 4R7ZA 3GARA 3ASUA 1GYPA 1GGHA 4ADSG 4W7HA 3I01M 5BSTA 2VTEA 2JCGA 3I2JA 2EBFX 3KXPA 1V4VA 2Z9DA 3TIGA 3V3KA 1Z6QA 4L9SA 2AS0A 1SKAA 1UJ6A 1FNMA 4B32A 2DZDA 2ISSD 4F3YA 5E6UA 1AK2A 3M70A 2OV8A 1B26A 4OHUA 1V4NA 3FUWA 3P19A 3DNMA 1DPGA 2GOYA 4LAFA 1RQGA 2VK1A 5D8DA 3D5EA 2QMHA 3KYIB 3BREA 4YCSA 1M1NB 1DAOA 2C07A 1E9CA 4D4LA 4DCVA 1RHUA 3V8EA 2FEPA 1KFEB 4ZQBA 1H8EA 1ZD9A 3A4TA 5MN5A 3PC8C 3DMNA 4NZZA 4P7JA 1KWGA 4HAIA 1TD9A 1A4RA 2EBUA 3DO5A 5DM0A 5AM4A 5K2OA 3LL7A 3DT6A 4JVMA 1Q6ZA 2CHUA 1RM5A 3R8XA 1RRPA 4O2RA 1P74A 1T0HB 3T99A 4CMEA 3E82A 4FIDA 2F3UA 1UDBA 3FNEA 2O06A 3OOSA 4KV9A 2PZ8A 1LLFA 3PC4A 4QVKA 3QVJA 1U3UA 1K98A 1KARA 2I29A 1R6UA 2C77A 2WUFA 2ZSEA 4CT0A 3OZWA 4LYGA 4KUEA 4KE6A 5FV7A 2GCIA 4FFWA 1UPFA 5I4CA 2ZYTX 3TFWA 2YY7A 3BL8A 3R6DA 1G18A 1Z5OA 2WM9B 1V6CA 3EFBA 4GWGA 5F73A 4BAZA 4BIIA 4TMTA 3ZPXA 3JXEA 4CKCA 1PQYA 1XZQA 2H1LA 3GRPA 5EZQA 3FMIA 4IRMA 4O1MA 2DJIA 3SE7A 3UHFA 3IVXA 3T94A 1U0EA 2TMYA 2H8GA 4EI8A 1P2TA 4IJ6A 2ADOA 5EJMA 5CTJA 1EMDA 1KPHA 3T5GA 4TYNA 2F7SA 5GIPE 2BBSA 5CEJA 1VJ0A 2KS6A 5DK4A 3G2LA 3TIXB 1M6NA 3OU2A 4F9EA 5BUCA 4KN9S 3QG1A 1TK3A 1Q14A 1N8NA 3IEKA 3NKVA 4YJ3B 1CXZA 3URMA 5LOVB 2C8JA 4L72A 4DLZA 1EFRA 4L7QA 2ZTMA 2XIQA 3L1IA 3KUXA 2IV7A 1E3EA 3RFFA 3KQTA 4K86A 3HXPA 5IAAA 4Y1RB 4GPD1 1P62B 1GNSA 3UWKA 1T0BA 2RJOA 2J6IA 2A0FA 3PKJA 3CSUA 3NATA 3HA7A 1CR6A 3DEAA 3D64A 2IFTA 4HGZA 3FPAA 4MUEA 2JJMA 4QQNA 4KLCA 4XPZA 2CW5A 1JIIA 1SBTA 3UPDA 1V1JA 1REQA 4QQ8A 1GQQA 2PSEA 1GAQA 1PR9A 4FLFA 2XNDD 1FTSA 3FUVA 3ZN2A 3H9QA 5L3QA 2KX7A 3LBAA 3QW4B 1L7DA 2ATEA 3ONFA 5CD1A 4B4VA 2CZQA 1SBZA 5AVTA 4JI0B 3D4PA 4BY9E 1KMHA 5LZ8A 4HJXA 3W05A 1ZH0A 4AO6A 3F1LA 2R8BA 3T0GA 5F3DA 2VSQA 3HN6A 3ELBA 3GJTA 2O3QA 4N0QA 4KTTE 4UQOA 1A9YA 3D0OA 1ZBDA 2CK3A 3EXHA 3MK31 3UQZA 3WGJA 5HYVA 4XQGA 1HSOA 1QGAA 1XZHA 1KEKA 3PFCA 4KWEA 4MA0A 3WA6A 1UC9A 2EERA 3ZWBA 2RHOA 3VR2D 1ANKA 3L18A 4HG2A 5JC1A 1KMNA 1IY1A 3MA0A 1STOA 4YALA 2Q3CA 2I87A 3U62A 4EB0A 1OMOA 5IAOA 4KPYA 3OD1A 4I1PA 4M83A 1T1SA 5L3RA 2O8CB 4TMYA 4FJ2A 5DOVA 2Q07A 1U11A 3MGGA 8LDHA 5C9ZA 4JI4B 3GH1A 1SUCA 4GP6A 4RLHA 2OSVA 2R7LA 3AIMA 4FGSA 4GOND 3IBGA 3NHWA 1JG7A 2IEZA 5CDHA 2VSXA 3QU2A 2VT6A 3I2YX 4YMVA 3U7IA 2FZKA 1UIRA 3P20A 1XZMA 2JIBA 4KMRA 1EIWA 2C92A 3Q7PA 3OE4A 3T7DA 1Y3HA 2QUHA 3GEHA 5JQGF 1JQ5A 2CB0A 4XM1A 3WLEA 1ZUD1 4E09A 2A86A 5FV4A 1NUPA 1E0AA 5D85A 4A0FA 2R85A 2AFIB 3LZDA 1SBNE 3BF8A 3QWHA 5GGXA 4UQLA 3UJCA 3HFJA 2HJHA 1CIVA 4XWTA 3T4PA 4OMCA 4RF4A 1X1AA 2AR7A 10MHA 4OI0A 3WK7A 1Y1SA 2G9RA 2OBBA 2Q6KA 4MW9A 2VVTA 1K6IA 3W5SA 2P9ZA 1QFSA 1SBQA 3PQDA 5CNIA 4DG8A 4Z99A 4C4RA 3E2IA 1O6FA 2CEKA 3AHFA 4EZEA 4OATA 5ALEA 1RXVA 2G5CA 3H99A 1EDOA 5JE8A 2GFIA 1MBZA 4KFCA 2QJOA 4AXXA 3O92A 4J76A 4D80A 4QL3A 3HJHA 2B25A 4BMCA 4E0BA 3A1FA 3PEWA 4FWBA 4GNRA 5ALQA 1DAMA 2XHEA 1G59A 2RJNA 1RAFA 2EFEB 2I1WA 2Z08A 3QEOA 4PTZA 3MFYA 3P2YA 4PQFA 2L17A 2PAAA 2WHEA 4Y6GB 4D3ZA 3E23A 5HSGA 3CUWA 5JZBA 2F9MA 4M0PA 1N2SA 2AEFA 1K5GA 3UOAB 4OQ4A 4Z7OB 3WK5A 2BKAA 5BSFA 3VAYA 2G1JA 2QTLA 4DNPA 5KQPA 4YJ3A 3CPEA 2C9CA 2V7PA 2CYCA 3B5EA 1SPXA 1PL6A 1ZS9A 2HV9A 5LP6F 1O94C 4Y1RA 1AA9A 1R6VA 2O52A 2B34A 2R62A 2XCRB 2VP6A 4U9UA 1ZD2P 3LUAA 4J0CA 4CMIA 3UA4A 2V96A 5KPDA 4X8LA 2C42A 2ZCJA 1ZGZA 1KYWA 1FNBA 1DB3A 4HEHA 3A6ZA 4PTLA 4D0SA 4KYUA 2VP0A 3L8HA 1YZTA 4Z4HA 1WZIA 3FJOA 3MUFA 2JFPA 2VYVA 1TUGA 4XGIA 1P7PA 3DUWA 3TE6A 3HXOA 4WFJA 2XOKD 4F4JA 2GCPA 1YJ8A 2RKWA 3LP8A 4FEEA 4OXQA 4CLXA 1XRJA 4KH1A 3S28A 3ACCA 3N0WA 4II7A 4Q3AA 3RJTA 3TPFA 1DJNA 5EWLB 4E7OA 4L3WA 5K6RA 4IHQA 5F4BA 1T34A 4BPRA 4YDSA 1SD2A 1XHEA 2V7WA 4NMHA 1HT3A 3MUEA 4KQ6A 4I46A 4MUMA 4YRLA 2H1IA 1HDEA 1T9CA 3RSSA 3HJUA 1U9CA 4P54A 3ZS9A 1LPSA 4NG4A 1YTUA 1T8SA 2DFVA 2HB6A 1MU0A 2F43B 2Q1UA 5CA0F 5KU7A 2HIGA 5F1KA 5BY2A 1J1IA 1QAQA 1TAQA 2LCFA 3T1TA 2ID7A 1JH8A 4E13A 4E3ZA 2NSHA 1IL0A 3H19A 4M1ZA 2O8CA 1GJRA 3W7AA 5DNYB 3LF2A 5DWQA 2EZUA 4M7RA 3KQSA 1M33A 4MR8B 4CTMA 5JTUA 4P0PB 3PX3A 2WMOB 2J48A 4S3MA 4G5HA 3SKXA 3FSJX 2XITA 2I7DA 1SCAA 2IS1A 3PLNA 1D4OA 2Y0EA 3ZI0A 3VNSA 2E4AA 1M83A 3IV6A 2I8CA 1E4VA 2NNLD 1OLXB 4BNJA 1EQUA 1WQ1R 3IBFA 4BVAA 4F5DA 1HT0A 2RGBA 4YLEA 2G9ZA 3SBOA 1EJBA 4RS4A 1ZVQA 3MWDB 4POAA 5K8TA 1C29B 1UEXC 1PL7A 2ZKLA 4M6WB 2W71A 2D7CA 1OGYA 2G08A 5HUHA 4YDRA 3PEYA 3KXKA 2GCNA 2BELA 2PFKA 1R18A 4IJQA 2PNJA 3KPVA 1AQLA 1G5QA 1ZH2A 5T6BA 1N6IA 1Q92A 5FTWA 4F85A 3DKIA 2FUNB 3DE1X 5EJ9A 3F46A 1ZM4A 4KREA 4UULA 4DIFA 2MMCA 3HDJA 1YRHA 2H8KA 3B89A 1YC2A 1X1CA 1WBJB 3PA6A 3DTVD 2XB8A 4HX9A 5J23A 3O95A 3HCOA 5BSEA 1YD7A 3WYCA 1KI8A 3THSA 3TXAA 2G04A 4FMCB 5LIRA 2GEJA 3BWVA 2QGFA 1CU1A 4Q9IA 1JRLA 1IHUA 4GXRA 3JQDA 1L7MA 1L1RA 2NU7B 3LPCA 4JODA 5AJUA 4CHGA 1JT2A 1RJ9B 1KEPA 2AUNA 2PZKA 3O93A 4NPCA 5T4EA 3EFEA 3ZE9A 4CM1A 4ND8B 3OQHA 3Q8XB 4O33A 1TECE 2QX8A 1C0PA 2R86A 1U99A 4C08A 1RKVA 2PRYA 1VCOA 1CZNA 5B3JC 3UB4A 1V8FA 4JBYA 3O26A 3KYJB 3A32A 1WDKA 2BSXA 5GONF 2I7XA 2NQTA 4ZXPA 3SLGA 3O3NB 3W90A 4FD3A 4GMXA 1OFHA 2HSJA 1Z0KA 5ESXA 2NUTB 3F8TA 5JSYA 1P7VA 1E94E 1GG2A 2JHCA 3G17A 2LCQA 1QIGA 4IICA 1O94D 5F1YA 4N3GA 4NDAA 4OXKA 3A6GA 4PZEA 2JRCA 4HVLA 3RVNA 2ZQZA 5IHPA 1OKKA 3QEAZ 3T1HB 4RK6A 1A9TA 2XYHA 2E85A 1B1CA 1XZAA 2VKTA 1LBTA 1OC2A 2PGJA 3HYTA 4FSDA 5BMVF 5JDCA 3L0SA 3U6KA 3QXCA 1F7UA 3HUFA 3HFRA 2VPWA 1YUMA 3KKZA 4OQEA 4D8YA 5DW3A 1LDNA 1SCKA 3EXFB 1RZVA 2RB4A 3ILVA 5EP4A 5EWLA 1YOVB 1MQ9A 4GQBA 3VU0A 2BCGY 4ERXA 4LFBB 3B9QA 4TYQA 7REQB 3LS2A 1OLSB 4IRXA 5D5HA 2VYNA 4ZZ1A 4KQXA 3NUZA 2KBEA 2HIAA 4JJZA 3V97A 4AK9A 3ZHTA 1ECGA 2Z5VA 4QOEA 2QPLA 2PUWA 4L3VA 3REGA 1WB6A 5EHNA 2F43A 1SQSA 3TSOA 2DERA 4Y2SA 4PNZA 5LQSA 1X8KA 2G71A 3EWAA 2AFVA 1DSSG 1WZNA 3LI2A 3DR3A 4HB4A 1JQ3A 4OYYA 5DBHX 3EZ7A 1DIAA 1SVNA 2I22A 4M98A 1H0RA 2HLDD 2HJ9A 3EQZA 4KGDA 2ZTUA 1OREA 3C4VA 1ISGA 4RETA 4Z9BA 1M5TA 1N1MA 1DUVG 2C9YA 2H0QA 2AEEA 2HQ1A 3OO1A 3RK1A 4K1XA 2Q3LA 2ZSJA 4BN5A 3L7CA 2EKPA 3OAAA 3RVRA 3PLAE 1YBVA 2JF0A 2OB1A 3OFKA 2H7VA 3ZGNA 2OGSA 5FTNA 2YS7A 5HVNA 4ZQCB 5EZYF 2HSWA 2JC3A 3NC0C 1M1YB 4BVEA 3LRTA 1BCSB 1BN7A 1OLXA 3JY6A 4MTLA 4ZZIA 4NBKA 5B58T 4B31A 4RJIA 1PJ8A 1MC1A 2C95A 4U63A 2HJRA 3RASA 4QYSA 3P9ZA 1CS0B 4AIIA 3IYLW 3MWDA 1ZWKA 4EA7A 4M6WA 2AB0A 3QTTA 2A0UA 3UJHA 3FHCB 1YKGA 1UMDB 3I30X 2RMKA 3QWIA 4OXYA 4HGOA 3TZCA 4UXIA 3B3FA 2Y1CA 1G20B 4DXAA 1SHLA 3FFBA 3RKUA 4AO8A 1OI3A 3ZVNA 3IP8A 4RE5A 1J7KA 1RJDA 2PL3A 2UZIR 1YZQA 5CU7A 1QB7A 3PFHA 1A77A 2PZEA 1OJ7A 3BCSA 3ENKA 4LOJA 1ILWA 4EAAA 5B4VA 1D7OA 2BMEA 1MG5A 2VF5X 2WC1A 3A04A 3GDWA 4DCNA 4F56A 1OPXA 3IVMA 1T0PA 3Q40A 1LEHA 3VH3A 5G0TA 1MF7A 3MTJA 3QOXA 5JMPA 3KOWA 4ZOCA 3DB2A 3GGDA 1R4ZA 4U7FA 2GPWA 4XB6B 5HDBB 4JVLA 4ZVRA 4E6EA 1U9ZA 2NU7A 2VJKA 1FX1A 3AEZA 1T24A 4OAPA 1Z73A 5LZ5A 3ZDZB 1RJ9A 1YQGA 2Q99A 4LCBA 5BW4A 4MWCA 4ZCQA 1ICIA 3UA3A 2PH3A 3CWCA 3I2KA 5BQXA 4YJ2A 3OH8A 1RIFA 4IFIA 4ND8A 3LGXA 1O1YA 4BX8A 5JCJA 3K70B 3X43A 4LPKA 4HNRA 1LTKA 2EBWA 4LZJA 3FB1A 3PDJA 3F2IA 2GJ9A 4FYVA 4J0FA 1EUQA 2Q3HA 4WADA 4BN0A 2XXAB 5MHTA 2XB2A 4ZVTA 3E7PA 4FVTA 1ISPA 2XV1A 2NUTA 2XQGA 2GPSA 4ENUA 1UDWA 1SU8A 3V8QA 5DTIA 1Z08A 1I9GA 3CKLA 3NR2A 4Q3EA 4DBVO 2AG1A 4C3UA 1UKAA 5HF9A 4EHFA 1KI6B 3L8FA 4HPXB 3KT0A 3OIWA 2O1EA 1ZU4A 4JC5A 2L18A 1J90A 2QX7A 3D0QA 3JQ8A 4HF7A 4LYAA 4HB2A 2FK7A 3R24A 4BFCA 4A15A 3DAOA 4HX5A 2O5EA 2WSMA 4L8FA 3MJRA 1RNLA 1UJNA 2OWDA 2ZS9A 3CH7A 3MLEA 1YOVA 4M21A 4WZZA 4AF6A 1D6NA 1AKYA 1P2FA 1OLSA 4PQEA 3F90A 4W5JA 3QVWA 1DIHA 1ZAYA 1UC5B 3DDOA 3VOAA 5CX4A 3MUOA 1IUPA 2BJWA 2Z5LA 1WB5A 1MD9A 3VRHA 5J2UF 4JBGA 4K6GA 4LJSA 2ZTSA 4OFXA 3RUAA 1E66A 1L8LA 3HO1A 1BMQA 2DKNA 3IXLA 3DAPA 1Z37A 2MINB 3N58A 1OWMA 1US8B 3HQ4O 4QICA 5CA0B 4TWAA 1AUVA 4D8TA 1UAGA 4BRWA 4DCGA 3DEZA 3RWBA 2D74A 1QGED 2Y2VA 2WU8A 2CL0X 4TRJA 5AKYA 1LPPA 1SBHA 1DJLA 2E4ZA 4AJ4A 4CI0B 4DA7A 2I2XB 3O47A 4YI5A 3ND7A 4DYHA 3TNJA 4DC0A 5BYKA 3H18A 5AJVB 4WEOA 5HOEA 1ZI9A 5AXCA 2DBVO 4F9GA 1XRNA 1Q19A 2PSJA 4MP6A 1QRDA 4HADA 4WDQA 3X1WA 5CGQB 3L1KA 3ML1A 1YB5A 2HWKA 2YFHA 3OIDA 2WJAA 4FMDF 1KDVA 4C4OA 5B7NA 3QFHA 4EO9A 3VMFA 2ZZKA 3OHMA 3BSFA 3GZNB 1BCSA 4NOKA 4O1HA 1Z63A 2YZ2A 2JZNA 5EA2A 5T4BA 5CA1B 1MO5A 3C85A 3UT5A 1IIRA 2IW3A 4UBIA 3T6KA 4AKSA 4ZPJA 4FCCA 4GLJA 5LXTB 1WMAA 2GN1A 1R37A 1CS0A 2J46A 5ERXA 3MTBA 2WW8A 4GI1A 3WWOA 1GADO 2QE6A 1SEPA 1CDDA 1CQWA 5COBA 3KVOA 1UMDA 1RRGA 1NQXA 3EASA 3MJDA 3IS3A 1IHDA 4D4KA 4RPKA 1JEQB 3JVUA 4R16A 1G20A 3CRNA 2EEPA 5T41A 5BV8A 1KC1A 1A27A 1Z2PX 3ABIA 3LT0A 1PV1A 4TYPA 4KXVA 3WY9A 3IBTA 4KXXA 1P2GA 3CR7A 2VXOA 5CB4F 3AVXA 2VJAA 4R05A 3BMOB 4PC3A 1L8OA 3K73O 4G5XA 4LVOA 1W49A 4DLKA 4NFSA 3K9HA 2QZSA 2QXUA 4UQPA 5EPEA 1GRRA 2NV2B 4F3CA 1N57A 4DN6A 1P77A 3B6MA 3H5IA 1IU9A 3WE7A 3DZBA 1JEJA 1VYHA 2XT9A 3RC8A 1NG9A 3IAXA 4BO5A 3K9QO 4W1PA 5THQA 3E9EA 3EVBA 3TQRA 1U7TA 4MAMA 3ZU5A 3HR4A 1VHWA 1R0XA 2APJA 4QBFA 1QQAA 1W9MA 1VCMA 4N12A 1NTOA 1ZM7A 4PBRA 4QDJA 4U2BA 2XXAA 3S2SA 1RYYA 3CURA 5AVOA 2F1RA 2CF5A 1DJQA 2AJTA 2ZWVA 2CD9A 3HJRA 2AHRA 3JR7A 1QCCA 3L4SO 1DX9A 5FNZA 2B6HA 3AHHA 5GZ6A 3ELUA 1JW9B 4WKOA 3V4VB 4NJMB 4BFZA 5DWDA 4C4YA 1E58A 1KZ1A 2ZIGA 2D0OB 2X0DA 4DR7B 1UBNA 4Q4AB 4BJ1A 3H9UA 1VKNA 3K1YA 4CJXA 3V8MA 3M1LA 1JMYA 1NVWQ 2JLAA 2B5VA 1NUTA 3AKDA 4QXAA 5KC8A 2RD2A 3OJXA 4UMDA 2UVDA 2QTRA 3NWBA 3GP8A 5ITVA 3T38A 4D25A 3SC4A 2JBHA 3NONA 3RU9A 1HMPA 3GCZA 4JEIA 1H8HA 4CEJA 3IP6A 1YU6A 5MFZA 4UNNA 4MUGA 5K1ZA 1YZ3A 2DUNA 3HKCB 4L4SA 2I7CA 3NALA 4BLTA 2XBLA 3GCWA 4RFVA 4Q4JB 2DH6A 4LX8A 3FD8A 1AB6A 3GLUA 1JSCA 1KJNA 4M1SA 4OHBA 1UJBA 4B40A 1Y6RA 3DDSA 1AVTA 1IUKA 2MINA 1PWXA 1US8A 1VIMA 1N25A 1TVKB 1W4ZA 2WIJA 3VR4H 3J81k 3CNEA 1KS2A 5GZ1A 5IZCA 2EP5A 1GGNA 1R5OA 1RYBA 3MJHA 3S8MA 3ZXYA 3SICE 2BUBA 2VT2A 2CLFB 1XAHA 3JQFC 4HGRA 3AETB 4XOIA 2HCBA 2ZB3A 2B7LA 3DFMA 3PFWO 2C5LA 2P35A 4J1SA 4JP3A 4W9RA 1E8MA 1MRSA 5CLGA 5U9CA 1QANA 2WR8A 4ZVPA 4D43A 3OJCA 1L5VA 2ZB8A 3D8RA 9ATCA 2KYRA 3LW8A 1UMKA 1P3JA 4ML3A 3M34A 1HFWA 4RNCA 5BSVA 3BBLA 4RVNA 1NKTA 3VOBA 1U8CB 3GZNA 4N0DA 4GX1A 3MT8A 5CA1A 2CNDA 3LWBA 5CXUA 4LFAB 1U1CA 2Q5EA 4MLDA 5HNKA 1W1IA 4JSYA 4A8JB 3LCMA 3HY6A 3RFVA 2FR8A 4DNQA 3DPSA 5A3QA 2DPMA 2IA5A 4MVJM 4W5QA 2HQOA 3L1HA 4Q1EA 4R41A 3ZY4A 3SI7A 4A23A 1YCDA 4YHBA 3PEUA 1NU6A 2NZVG 4N40A 2CUNA 2R4TA 3WLJA 2QG4A 2ZZMA 3HSSA 4Y9TA 5CLLA 4JX9A 1JEQA 2VAWA 1Q0UA 1E0JA 1CNEA 4C5CA 4LYFA 1ZR2A 3LT2A 1LKZA 3ZZ1A 2WUVA 3G23A 4ZOEA 3B6IA 4MUIA 1QPGA 2DOKA 4BAGA 1CRPA 1Y9EA 3L2OB 1RHKA 2JIMA 1I3NA 2UV8A 4B48A 2WWYA 3PSAA 3ZWKA 1N2CE 3BMOA 2R2GA 3HMQA 8OHMA 3NPAA 3H17A 1U9IA 1ML3A 1A9SA 3HRIA 3O31A 3GLKA 4RADA 5LBIA 4A5OA 2G17A 3K31A 3KTDA 2GJSA 3DHWC 1XHLA 3NNNA 1N6LA 1SVLA 4EFKA 5A2QA 1H9CA 4NCJA 4RY0A 4YMSA 3OCCA 1YQEA 4UCXA 4JBLA 4DJDC 4KE7A 2A92A 3P9SA 3AFGA 2OO5C 3BMCB 2ZSUA 1HE1C 3ZU2A 3GUUA 5E2BA 2ZBFA 3PC7A 4NNJA 2YWRA 1EVKA 3W04A 1APBA 3VJLA 1C7FA 2DKFA 2RGXA 4RX1A 4PWZA 1DG9A 3NC1C 4JDPA 3Q1LA 3SD7A 1Y3IA 3SHQA 4ETMA 4B5LA 4L6IA 1CPYA 3C3PA 1XKXA 1ZW1A 2PZJA 4LYHA 3QFRA 4EUNA 2HRBA 5JWHA 2FJUA 1NZDA 3R4CA 5IJ0B 3C45A 5ILOA 1GZDA 3UGTA 2GD2A 4XLTA 2OO3A 4IX9A 2HUPA 3HLKA 4C21A 4NJMA 4FX2A 5IT9A 1A9ZA 3SSNA 4AYTA 2AF3C 2EJBA 3N39C 3TDKA 2HR1A 3WJAA 2V7UA 1ZUHA 2BGGA 4FQ5A 5KVSA 3CEJA 3TOVA 4B3SB 5JCZA 1X87A 2R87A 3JWGA 2FSFA 5GWXA 2Q1XA 1ZZGA 4A8PA 4R2KA 3L46A 4R1NA 4CMIB 1OU0A 1LRKA 2B1JA 4HNGA 4NEQA 2XJ4A 5C5CA 5H3HA 2R68A 4TPKA 2B20A 1YZLA 3CF0A 3U3RA 3UOWA 5JIBA 5SYAA 3ID6C 1TKAA 1XWIA 2QL9A 1NG1A 2PR2A 1IZ7A 3A25A 3WIUA 3HKCA 5KYGA 4TZ6A 4QYMA 2Y1DA 4Q4JA 3WAJA 3C5EA 3NYRA 5J4KA 1AKTA 4QU9A 2WTBA 2FPSA 4I1RA 2XGJA 1IEXA 1XU9A 4R3UC 2IYAA 4GRIA 2JLXA 3SJZA 1FSSA 4A36A 3ADDA 1L5WA 3WNCA 1G9SA 1DCFA 1T4GA 2BZSA 3V33A 3WOVA 4OKNA 3AETA 4H3KB 1FTQA 5IU6A 2WZBA 1FA9A 2I65A 3ZJ4A 2FE1A 5JCOA 1UBRS 2B99A 3CF6R 1FP7A 3MTIA 3NAMA 4B43A 3E8MA 4QX6A 5JXWA 1SAYA 2EL9A 3DYIA 5DI9A 4NV1A 4EGFA 3FCYA 4CNBA 2R47A 4JLSA 1PS9A 4ENVA 2CN1A 4EYSA 2V0CA 5AICA 4CCWA 1E92A 1N2CA 4EI9A 1C80A 4R31A 5BRJA 1OR8A 3NTLA 1F8FA 4A8JA 1EVYA 2MYPA 3CRQA 4BNNA 4UVHA 1NW8A 2HX1A 3WWZA 2Q46A 2BDTA 1IXYA 3KZOA 4HCJA 1MAWA 2OC4A 3ROPA 2R3SA 4DQKA 5JEDA 1SC1A 4YREA 1L1QA 5LWQA 2QZJA 3FDXA 3FNQA 3V48A 3ZE7A 3C41J 1USKA 1L4KA 1VYUA 1DJOA 1T9GR 2IPNA 1ND5A 1XLUA 3ROXA 4YXFA 5I47A 3IE1A 4MR9B 2XA9A 3BB1A 1RI1A 3WXMA 3GJRA 3HR7A 3SQXA 1WW2A 2GBFA 3CZQA 3KAPA 4XH9B 2QAGA 1C0KA 1Y7LA 2VG8A 3P26A 4XJXA 5C5DA 5BQPA 4ZT4A 1E7SA 1THMA 1XD9A 1N9KA 5IASA 1CB7A 3EK2A 4C3OB 5IXYA 2RH8A 4UVDA 5LFAA 2A9RA 4EK9A 1C9MA 2RGAA 2BP7B 4U8HA 1NVVQ 4D9IA 4IH4A 5TJHA 4YJGB 1QU2A 4EI2A 1AG9A 1BE1A 3LSTA 1P29A 4D6YA 2RHDA 2D06A 4JGBA 2FOLA 1I6KA 1GXSB 3BMCA 5BWOA 3Q3GE 3QTBA 4RHEA 4YAKA 5LQAA 4EW2A 1KZHA 5P21A 6NULA 5EJ2A 1A7AA 5K0NA 4A73A 1VSTA 1RCUA 3ENWA 4QPCA 2N3ZA 1PFUA 1P1FA 2GN9A 3LX8A 5J58A 4X84A 5HA5A 3AHDA 3KZXA 3MT7A 2DJ5A 2IIVA 2N0SA 3E3MA 2GA9A 3UXYA 2PBZA 2Y1XA 3AKZA 1GA4A 5IJXA 4J07A 1ZMXA 1V47A 5LNK6 1BDMA 4NMWA 1XZCA 1TGYA 1HRKA 1R9GA 2HJGA 2RGYA 4TN1A 1J23A 1U8YA 4DEVA 4I9GA 4DMLA 2PIDA 4NH4A 4NFHA 1OZAA 2B6NA 2CJXA 4GWKA 4LRWA 3TGWA 5A02A 3OE5A 4E5PA 3FMPB 4HWOA 1ES9A 4FC6A 1QZ3A 4QWMA 4CGYA 2R44A 3PGA1 5KHOC 3OF2A 1FLNA 3A2NA 4G85A 4PQRA 4W1QA 1YFZA 1I8TA 3E81A 4X0EA 1RBYA 4X97A 5F4ZA 5ULLA 4MMYB 2OXTA 4HDKA 1XQ1A 3U5ZB 3ELYA 4IF4A 3REQB 4XRGA 4DCPA 5K03A 4KNYA 1NVTA 2XEDA 2BONA 2C5SA 4I55B 2R751 2P9BA 4N5NA 4WBNF 3OLQA 2G76A 3K9WA 1X14A 2P2SA 2JJ1A 2EX1A 4HWGA 5IEBA 1FTGA 5KNCH 2R7AA 3FZGA 3PGXA 3TVTA 1F8GA 1E5VA 3UJ9A 2IBSA 2QJRA 3ETHA 4ONEA 1Z07A 4BLUA 1VIDA 1DZIA 1O9GA 1XO1A 2IC5A 2EJCA 2QE7A 1UC4B 2WIDA 1JLKA 4BFXA 2WJ4A 3DL2A 3G9TA 3ZBQA 4RCVA 3S8YA 1EFTA 3O6VA 3PLRA 3LD9A 5CDSA 2GTIA 3KBOA 1E64A 2QXYA 4LYJA 3EEIA 1QCDA 3Q7IA 1YE8A 4Z4FA 3ADPA 1GQSA 1IPFA 2XOXA 3ME5A 3LUBA 1B43A 3ZWPA 2WB2A 5EXPA 5DHUA 1KJ9A 5EGSA 4KYIB 3ZWOA 1AZLA 1TMKA 3OD5A 3OWOA 4GBGA 4ZI3A 3I37X 4FNMA 4UBOA 3GD5A 4KC0A 3ET5A 3X2SA 3UWSA 2LZ0A 3AUTA 4FUTA 5HPYB 5KMGB 3CB2A 2COEA 4C0QC 1X94A 5EMMA 3VHQA 5G1NA 1H6AA 3O9MA 3SYLA 1KJWA 2W2LA 2DY0A 2EIXA 4TVSA 3HCFA 5EHQA 4MI9A 4QNNA 4C5AA 3AIOA 3KLNA 4DCUA 4YMHA 4MW0A 2ONZA 1YSCA 2C8LA 3EPJA 2B37A 1NP7A 1ZGHA 2ZDGA 3G49A 4DBLC 1HQDA 1JMVA 3R6LA 4LMPA 4Q7KA 5BWBA 1SD5A 1TI7A 1DINA 1O2DA 5IVDA 5D3KA 2L0XA 3LG2A 1U8XX 4HJRA 3A3PA 2MCFA 2BTEA 4X61A 4PRYA 4UFNA 2DMRA 1R6BX 3A06A 4LE0A 1J20A 1E79D 1RQRA 3BD6A 4B5KA 4BLVA 4YUZA 2CV1A 2NVWA 2GZDA 3EFOB 2IZ1A 1UEIA 3COWA 3VHLB 4XDHA 3NIDB 3OIUA 3O8LA 2BP7A 5I9NA 3N75A 4X85A 2HMTA 3AH8A 2PQ0A 3B60A 1DHRA 4X3CA 4YJGA 4ZEVA 6CHYA 3R09A 4BO2A 1EU1A 1G8FA 1HE8B 2ZXUA 1CJCA 3EVAA 3MRXA 4WNCA 1ZJ5A 2EEZA 1Y3AA 1YCFA 1RXYA 3MAJA 3OHPA 3PI7A 3TXYA 3ZWXA 3T9EA 4E5MA 2XQFA 3BKXA 4G0XA 4HQ0A 4XQ9A 3ZDQA 1KBQA 3QU7A 4UEKA 1GNRA 2DFLA 3CU5A 1Z2DA 2O1WA 1E4YA 9MHTA 2P9QA 1ORIA 3T3EA 2GQ0A 2QUBA 4LF6B 5GJCA 2J5KA 3M3DA 3GY0A 4B6SA 5M2QA 1PU2A 4DGQA 4JJ4A 2O6HA 4XDGA 1ZBQA 2QZ4A 4JXXA 1G5TA 2HREA 1ISRA 2DQ4A 3W3AD 1KEEB 4HR7A 2PJUA 1ECFA 1ODFA 3UMFA 5ADVA 1Z26A 4HAOA 4HEQA 3QFCA 1YIOA 1WOMA 1G6OA 2HHCA 2VWQA 4MYSA 3QKRB 2L69A 1U3TA 5AJZA 4O4JF 3SEZA 3O3CA 1CG6A 1TXGA 3IVCA 5DV9A 1UKBA 5G02A 4C7JA 1C14A 1RQNA 1ZX1A 2AIRA 4PSAA 4F46A 2P6RA 1XTTA 5A0TA 3REQA 4DMHA 2FEAA 3E0XA 1NXQA 1D1SA 2YV3A 2YYSA 3DBHB 3TZBA 3HCCA 4LZOA 5I7EA 1WW8A 4I55A 4ZK6A 4J6FA 2IUEA 5D6NA 3CX6A 3T1NA 1XU4A 3ZV7A 3O4HA 5A3RA 1BX0A 2Y4OA 2HCFA 2IU6A 2YJ6A 4DIDA 4DLLA 1SCQA 4YP9A 3CINA 3B1WA 2YZGA 4KQIA 4S0ZA 2XUIA 3T61A 3U4DA 1WKCA 2P5TB 3S1SA 2G5PA 2QTNA 1U6JA 1SU7A 4WQMA 4ZQHA 3DOOA 5IT4A 3Q4GA 1ZISA 3NDPA 3RQSA 1BN6A 4NU8X 2P75A 3NBUA 4YY3B 2E37A 2C7RA 3V7WA 2BGWA 1ZFNA 3PHGA 5EY5B 1RKUA 2H4WA 4DA6A 2HJWA 3SWWA 5TNXA 3NIBA 4DZTA 1G8PA 1AF7A 1L4BA 4LOLA 1ZGBA 3T06B 3VUEA 3KJNA 4IUBS 4L95C 1FSFA 4IF6A 4Q9AA 2OGTA 1JDUA 1H4QA 3IDOA 2VF2A 2VUTA 4KLRA 3O4GA 3RC1A 1N9GB 3MTGA 4HAUA 3BIOA 3PFNA 3U4MA 1QG4A 2FG5A 2R9VA 2IZ0A 3CLHA 3OLVA 1F2VA 2JI8A 4YJ2F 1EFHA 4C2BA 2P2GA 4A0RA 4JC8A 1CD5A 4HSEA 1R2QA 1IG0A 3H84A 1E1RD 1V6AA 5CTAA 5D87A 3H5TA 3QPCA 5BQ5A 3TVYA 2PD3A 2FJ0A 2PA0A 5JSQA 1O95A 2EF0A 2J9FB 1M6WA 3BFVA 5K0LA 1UBCA 3EEYA 1ZRNA 1Y9ZA 4WHMA 4MINA 5FFMA 4QGBA 1P2BA 2JH8A 1CFZA 2NYRA 3CRZA 3DQPA 1XKLA 3OZSA 2OVFA 2C84A 3LUJA 3O3MB 3WGKA 3EC7A 3EFOA 3IAFA 4AKIA 2ZRIA 1QTQA 1FPMA 1G9TA 3A1SA 5HRCA 1HZJA 3W3ZB 4M99A 1XLTA 5CXQA 4EJMA 3T4UA 3ZGYA 4MJXA 1EEXB 1T1EA 3ROZA 5K0SA 1KXZA 3KNZA 1XXHB 2C20A 4PZAA 4WKCA 4EGQA 2BTQB 4GXQA 1SB9A 3UBMA 5A7HA 3KLPX 4HNQA 4XVQA 2NOAA 4QRDA 2GCEA 2O50A 2FETA 3ND9A 4IQ0A 4PRZA 1U8TA 2IYPA 1JIJA 1WZEA 4QAQA 1V8DA 2BTOA 5DGHA 5BYJA 5LD2B 4A03A 2CFSA 3IUMA 3MMZA 3O9VA 4RVFA 4LK3A 2ZAYA 3ETJA 3OO0A 3PEFA 3AEUB 4N3CA 1DWOA 1VLHA 1W2WB 4BS9A 4TMVA 1YI1A 3RM3A 1NI3A 5LJIA 2QN2A 4OJKA 4M0UA 4MTCA 5EIHA 4AY6A 4AJEA 4EMTA 4ZOBA 1M8FA 3OM9A 2ANCA 4M9ZA 2GKGA 1GRQA 5F9MA 4JQZA 4BUZA 1R27A 1ZG3A 2WSYB 4PO9A 4ENWA 1FFCA 3OZVA 4CE6A 3KP1A 2MSEB 2VYCA 4C2UA 3GGJA 1KEEA 1EGVB 2J5XA 1QWSA 2YRFA 1NATA 4TTQA 4D0GA 5BSRA 4JI1B 1YMUA 1YWGO 4EELA 1IM5A 1Z5PA 4G09A 4HDAA 3L93A 3NTQA 3QKRA 4PZLA 3FPLA 4TS3A 1KO4A 4X71A 4XM0A 4QA9A 5H68A 1JJAA 1SD1A 2Y1EA 2AOXA 1MRNA 4HWSA 5AK0A 1IRXA 1D0IA 3FETA 3DBHA 3H4IA 4TMXA 2O59A 1V2GA 1SUPA 2Q2QA 4NZYA 3FDFA 4WBNB 5CM8B 1XTQA 3BD8A 3S40A 4DGSA 4J43A 5FX2A 1DNPA 2OG1A 3MMXA 3PJFA 3R5HA 4ERNA 4HYEA 4YRZA 4OEHA 1JJFA 1QS0B 8ATCA 1J2RA 1H23A 2X2FA 5JPDA 4L0MA 2C2ZA 3PC6A 5E8RA 1KYVA 1E69A 1J25A 4QECA 1GUFA 1T0JB 3NDJA 4LXXA 5FWDA 4Q7QA 4ZT6A 2GPNA 1CP2A 2QHXA 4TLLB 4WVLA 1CVIA 1FLVA 4YPFA 3ONVA 4M49A 3KJFA 2G9UA 1CNMA 2VH1A 4RKYA 1JTFA 4KU4A 4NS4A 2QD4A 3D8HA 5GMOA 1QVWA 1NSTA 2QTGA 5F7JA 4K28A 4OLJA 4B17A 4CMEC 2BWJA 5EIWA 4UEQA 1I0ZA 2P90A 4CZ2A 4FZJA 4EPWA 5C5IA 2NSJA 1Q0TA 3HDQA 4EY7A 3TR6A 2I2WA 4O5OA 2HK6A 1Y81A 2NU8B 1IY0A 1OI7A 2ZM6B 1VECA 1N9GA 2FMUA 3R3WA 4PS1A 3FZQA 1ARZA 1UK9A 4U2DA 5FUMA 4C2TA 2D3TA 1JFLA 2SCUB 2JGEA 4YAJA 3M89A 1XTUA 5BV7A 2VJOA 3TOXA 5K01A 4BMYA 1TT7A 4IHAA 4C4AA 2YXPX 5A3JA 1XTSA 4L5BA 2C98A 3FTCA 4H3SA 3RG8A 1TLLA 1UPBA 4MPPA 5BNWA 3UWDA 3W5UA 2J9FA 2JANA 4ARCA 4AYWA 4MV9A 1T5OA 1ZAKA 1BU5A 5F7ZA 3FTDA 1E2LA 1IBSA 1XJ5A 4FINA 4FX5A 1JLSA 1RHJA 4V39A 3C1UA 3PDCA 5AW0A 3T5MA 4N7BA 4ND3A 5FJJA 4MQFA 5DYTA 3ZBUA 4TSKA 5C8XA 5D1NA 4NEHB 5CT9A 3F96A 1KZ4A 2HEGA 3B8EA 1FNNA 1QIIA 3NANA 3CCCA 4QYIB 4Y3UA 2QN6A 1VB3A 2JAOA 5JY6A 1VXRA 2ZULA 1CCWA 1U6KA 3TZLA 5KOJB 4FHFA 3M4ZA 4BFSA 5IDQA 1XXHA 4YBZA 2YXDA 4NLLA 5K20A 3EYAA 3KJIA 4JB8A 4QOHA 2DSTA 2MSLA 2VBFA 4P5DA 2HLPA 2IYUA 1IOZA 3LBHA 4RPCA 4JLWA 3PHIA 2QNIA 1C4WA 3N9IA 3ANMA 4HZGA 4MQLA 2JJ8A 4JR0A 4TT3A 1JB1A 4JITA 1MEJA 2ZQYA 4D9KA 4HWPA 3AEUA 3D6FA 3KSMA 4Y2VA 4ENSA 5ENDA 1CRLA 3ZZMA 2ZRPA 5AIBA 2HFKA 1P5RA 2OORC 4TLAA 4MI1A 5JAOA 1PK7A 3IPCA 1GUYA 4G8CA 3NRJA 3JVDA 1VRCA 1Z35A 3QVXA 3L0PA 4R8VA 4UASA 5D01A 2VN8A 3A3KA 4D3YA 3G79A 4MW6A 4UJ3A 2CZGA 4QDXA 1TTPB 3PUXA 1C5KA 2OGZA 3WGYA 3AL3A 2FSGA 3ZR4B 1OH6A 2DTEA 3U1TA 1C4KA 3EXHC 2JLBA 2HT1A 3LT1A 2MSDB 3U26A 3BDIA 3FVTA 1XRRA 3CISA 1B14A 1QTRA 2V55B 4ZAGA 5J3JA 4A0GA 3P0RA 2HBQA 1VKHA 1CUHA 4IEFB 2DPGA 4K9DA 5G3ZA 1Y1PA 4AG5A 3EN0A 3PITA 4MV6A 3EAQA 4ESEA 3TRIA 4R1SA 4TWIA 1XRPA 1UXHA 1IHYA 1Q7TA 3IQXA 4UZSA 4EF4A 3A2KA 4K05A 1I3KA 1QJCA 2B4RO 4WBNA 4CQMB 4FEYA 4P32A 1G42A 4M4SA 1H0HA 2VJDA 2HF8A 1WZUA 1QS0A 1J0BA 4KRXA 1W36B 4REMA 2GPAA 4KP7A 3M5DA 3ZQ4A 2HQBA 1U0LA 5CYPA 4GKBA 3RIGA 1RABA 5EPUA 3VZQA 4M8SA 4AG3A 1GZ6A 1EE1A 1OIXA 1QAOA 1Y8ZA 1UP6A 2C59A 2G4VA 5LZ9A 4MIYA 4DWVA 5KYTA 1HLFA 5KAMA 4CDMA 5K7SA 1EFVB 1J6UA 1ZKMA 1K2VN 1E63A 1XVLA 2F6RA 5DYNA 1ZXXA 4BRUA 5F9FA 2NUAB 3BGOS 5BXYA 2PQ6A 4WOJA 1F14A 1C9JA 2B3TA 5KVAA 3GD7A 4RJKA 2P62A 4PNHA 1XAIA 2AN9A 5I9BA 5F2EA 4LFCB 3G0OA 4GPTA 5CPBA 2NU8A 5B12A 1PJ2A 1VJGA 1W0KA 3LGAA 3WAGA 3HKEB 2XMCA 3ULKA 1SG0A 1B0AA 4C0XA 4IJWA 2VRCD 2SCUA 4BLSA 1GTJ1 1XLVA 2EQBA 4XFKA 3WLIA 1NVGA 5DHTA 3DMDA 1A4IA 4LE2A 3SX0A 2VDKB 4E30A 3VTAA 4FFDA 2HIMA 3BWYA 2Z3ZA 4F1WA 1E6MA 4ATNA 1C7IA 4LVCA 4MHSA 4MWGA 2IS6A 4IOLA 3A1CA 3TCKA 4EFMA 4ETIA 3QG5A 1OLOA 1G63A 4JD5A 2C5HA 1XCOA 3RHFA 1A2QA 3D5QA 4K40A 1R0CA 5CG1A 1OU4A 4DPKA 4WINA 2X6RA 2X0IA 4QYIA 1Y8AA 3HJBA 5TQ2B 4PQGA 4ZN6A 4NARA 4PG4A 4J7AA 3ZLTA 5IWCA 1Z15A 1MAAA 2ZYWX 3C7AA 4I08A 2ZW9A 3X1JA 4BNFA 1QG6A 5KOJA 1OWOA 3F6YA 1GUBA 1N5DA 1I3MA 2ICAA 3ESDA 3FUUA 3DL0A 1PUXA 3K35A 1L4GA 1T3LA 4XTCS 5GV8A 2OENG 1ODLA 1JECA 3VXKA 2D2XA 3SIRA 2V0NA 3R3ZA 4NZPA 4RE6A 4AY2A 5A62A 3QBJA 3F9RA 4UOZA 4BQFA 5EFOA 4BVKA 3SLRA 4RTKA 4PBTA 4IG9A 4D9GA 4EM6A 2HA2A 3IE2A 3C3BA 3HBLA 5EZ6B 4ZAZA 5FL7D 2CFTA 2P79A 5JYCA 4WJKB 1OX4B 3PBKA 1K8YB 4C0LA 4DJAA 4G56A 3BK1A 1KU0A 1TCBA 4WZBE 3RGWS 4FBMA 3W79A 1ENZA 1ZOIA 2J5BA 5DXJA 2P8JA 1M0WA 4U6QA 1SRRA 2QG9A 4MV7A 4B6QA 3PUYA 5HTOA 3QXXA 4LN1A 3KEMA 3WGNA 1JFRA 4WKGA 2RIRA 2XECA 1S7GA 3BZWA 3VSBA 3LYUA 1Q1ZA 4AN1A 2UDPA 1X19A 4M76B 1CEYA 2GDJA 4G2NA 3NBXX 4PPNA 3PT5A 1LDYA 4I50B 4MV8A 4Q01A 1M34E 1VSQA 4LBVA 1ZU5A 2WNIA 4N01A 4JI3B 3I5YA 2CUZA 2ZBVA 1GN9A 3AJAA 3U3DA 1JVNA 2CK3D 5DSZA 3BD9A 4IO1A 3NWEA 2J59A 4E07A 2VAPA 4LZAA 3HVJA 5HRUA 5IVKA 1W8DA 1I6LA 1T2UA 2ZIAA 4R8LA 2Z3VA 4YCNA 2XB4A 1QCZA 5HKBA 3M5PA 4HTAA 3GUYA 5BQFA 1LZKA 4CQMA 4P22A 3DWFA 1YA6A 4UPDA 2KBFA 3GFBA 1RE0A 1RAIA 2ZG6A 3IIJA 1B6SA 1FYWA 4BNLA 1DTWB 2G3YA 2NTNA 4IYJA 4HV4A 1XN1A 1IB0A 1EBBA 1KH3A 5EJ6A 1I7SB 2Z04A 1Z7YA 5CVUA 1O03A 5FEMA 3FHLA 1EFVA 3ZE6A 1JAZA 3NAQA 4RULA 1O4VA 4W8OA 1ZC4A 4KAXA 5FOWA 2XVAA 5BW8A 2PUGA 3F0TA 3JQ7B 2ENWA 3BGWA 2PZLA 3O8DA 5ICCA 1BKSB 1EZZA 1OX5A 1X1RA 1WUTA 3K7EA 3V4FA 5CDGA 1M0SA 2OQ2A 5I7VA 2ON6A 2ZYAA 3H04A 4G5YA 2CD7A 4QDKA 2VC2B 4BMXA 3HKEA 4P7BA 1CY8A 3CLKA 2BY4A 4ZWNA 5HJ2A 1ZRHA 1FE8A 1JLHA 4Z1MA 3NHUA 4HNUA 3CRVA 3AL2A 3PXCX 4OUDB 2JG3A 1SHJA 3FF1A 1SVOA 3IOBA 1NQ5A 2BHSA 4LE1A 1EGAA 3AV3A 4EJ2A 2QN7A 1R74A 5TJ9A 3V2IA 2GN0A 3WA7A 3L0IB 3UTCA 4YN3A 3CO0S 3GJ5A 4QD3A 1VG9B 3Q41A 1PKXA 1BVUA 4Q24A 2VR1A 4WZBA 1WXFA 1ZK0A 1Z45A 2OHIA 4R1QA 5IW8A 1VMDA 2RAVA 4D9CA 1PN3A 1Z6ZA 4MRMB 3WAKA 5H9VA 1B23P 2PPLA 4PG8A 2PJDA 3REOA 5JALA 4PO1A 2IS4A 3EVTA 2AKYA 1BH6A 2V74B 1T5BA 2WWWA 3U0VA 2A0YA 4O2AF 4BJ6A 3VGPA 3KJXA 5KNDH 3LPDA 4MGIR 2R5FA 1DEKA 3WHPA 3EOAI 4FS8A 4IIJF 2FR0A 1M7BA 2HH9A 2WWXA 2QV0A 2XGGA 1F6DA 4ARSA 5K0GA 2BMJA 3D7MA 1KNQA 4OMFG 4P7GA 1OD6A 1OX4A 3TCNA 3EH1A 3D6TB 2PWBA 1SKBA 3QV2A 2YWFA 3GFOA 2K2WA 3EBLA 4K7JA 5JDCC 3RSCA 1XI2A 1JU3A 5B1HA 1OYWA 3AT1A 2OQVA 1E9VA 2WE7A 1R4AA 3C5WP 1XJCA 2ZI3A 4O5AA 2D4HA 2JAWA 5AUNB 3DBOB 4UZEA 3JRXA 3BSYA 4G67A 5IVHA 1TTQB 3RF6A 1YJXA 1LFDB 4XDZA 1S4QA 1W581 1TA0A 4ZYLA 5IJWA 3QX3A 1QPBA 5I4BA 1NC3A 5TVKA 2YV2A 3L8YA 4ANFA 1ZMTA 1I7PA 3PGKA 2QD5A 4G1FA 4I50A 3F78A 3AY6A 2D62A 2GN8A 1S2MA 3I9V6 4KV7A 4PONA 2PT5A 4KJXA 5F2OA 1USWA 4U2EA 1XTIA 2NLOA 3AVOA 4HQKA 3BPSA 4HQOA 1COWA 5JO9A 4EKGA 1MC5A 5FPPA 1HYHA 4DM4A 2G4CA 4K9MA 4PPGA 1P4GA 4WOKA 2NUPB 3WLLA 2PKXA 4GI2A 3JPWA 2KI5A 2ORED 2ZR8A 3RV3A 2PLFA 1RQPA 1Z82A 4BO6A 1TIBA 4UTXA 3PDUA 3NH6A 1E9AA 4YDHB 2OBMA 1DTWA 2O8EB 4JI7B 3QIAA 4UAGA 1DG1G 1GQOA 2YVLA 3AF3A 1YJCA 3LVBA 4KDFA 2Y99A 4CV1A 4PXSA 3UWMA 4DDMA 2P4HX 1NKVA 2DBQA 5H16A 2CE7A 2BEJA 3SGLA 1EVIA 3UT6A 1CUBA 4M0EA 5EE9A 3UW1A 1ORWA 2NXEA 1PR4A 3JQ7A 4L5JA 4O4HF 4X7PA 4Q9JA 4JWKA 5LQDA 5IDVA 3BRQA 3I6ZA 3N8HA 4OBWA 1M2EA 1OGJA 1KP9A 3DMYA 3H2YA 4QREA 5DCLA 1E9DA 3CKYA 1EWVA 3CNLA 5FFFA 2YMLA 3QBEA 3TGLA 1M6YA 1HYQA 3MOGA 3PDHA 3HH8A 4NOMA 5EN4A 2ONJA 3RTCA 3TTUA 1NRJB 5D3ZA 5EIOA 1I36A 5DGCA 2B94A 3TW0A 4J2HA 4B2LA 4BMOB 2EQ5A 2ZTVA 3CEMA 4OUDA 3T35A 5IN4A 1CRZA 1QYXA 5K0CA 4Z5XA 3L40A 3VV2A 4J29A 1CE8A 3D59A 4LQ4A 3BEDA 3ILYA 1H69A 4JP8A 3TQOA 3ZNNA 4HGNA 3LVFO 4AMBA 121PA 3ZE1B 2GYWA 2OZLA 3OQOA 4P92A 2RHHA 4RPJA 4V38A 1BAPA 2VPXA 1SZDA 3SAJA 3G7NA 4BVGA 1I5RA 4XR9A 1N4AA 3RNLA 3IOCA 4RNDB 1JR4A 5JYEA 4H7DA 4J1TA 3NRCA 1F2DA 2I54A 5FKJA 1U28A 4MRMA 1PNQA 3WB2A 3I5XA 3HGQA 3BT7A 1RHRA 4QDUA 3X1MA 3TRKA 5J9FA 1JF8A 3SSOA 4PFQA 1R4NA 3TUIC 4M8KA 1U1GA 5BV1A 2K7ZA 1PBTA 2GEFA 2JI7A 1Q50A 3OZFA 3RS4A 5B58C 2XNJA 3D2LA 3FPCA 3C3XA 4EA6A 1ONOA 5LWHA 2GXSA 2Z6VA 4N5LA 3FUTA 3I64A 1SXJB 1ORDA 2BR5A 2NTJA 2X8WA 3EA4A 4MYHA 3OT4A 3DXXA 2O4UX 5MN6A 1P91A 1Z8HA 3MMSA 4EFDA 2GK4A 3U4IA 4WY2A 4EHIA 1RDFA 5I7UA 3QEJA 4FBLA 4PE5B 1NASA 3Q7EA 1C7EA 1T9DA 1O8CA 2JB9A 1JNYA 1MPTA 2Q5LA 3MT0A 3WYBA 4ARUA 5BURA 2QIOA 3BILA 4D4IA 4WJLA 1RU3A 1ZR4A 3ZGOA 3C7CB 4BZQA 4ZJUA 1A5ZA 5KJFA 4FWTA 1IN7A 1C9NA 4YRMA 5HTKA 4G0WA 4CMBA 2K2QB 5AW4A 3HXMA 1Z4IA 2E49A 2FB9A 3HLYA 2CKDA 1FB5A 1EVZA 4YPVA 2PRIA 3G9XA 3HB9A 4IJVA 3P9YA 3CJTA 4N8EA 1KRXA 3MM4A 4LGVA 4JJ6A 2DR3A 1J0AA 4OPMA 2B2NA 4RVOA 1NXXA 3GFSA 1FJXA 4HK4A 4UTZA 4RQAA 4CN8A 1I1QB 1N2JA 3P0IA 3T7EA 1PDOA 2Q7XA 4R2XA 1R15A 1RLJA 1AV7A 1S2OA 2VI5A 3GA0A 4MWSA 4X64B 2WG1A 4YRGA 3GEIA 4MVJD 1RLMA 2J0QA 2WWTA 5IARA 2CNKA 2OK7A 5DCWA 4MJ3A 1F12A 1EXMA 2E7ZA 3SHVA 4CTJA 4Z7QB 3A3NA 2YZ7A 1NUQA 3M6FA 2PSFA 1HC7A 1B16A 1BXZA 1FQKA 1DX6A 3VSEA 1WUYA 4R3NA 2O8EA 5HFJA 1OH7A 2OBLA 3PR1A 4F0JA 5GVSA 5ICEA 1IULA 1MFZA 3K6KA 3QEKA 4F72A 1X7GA 1SC6A 3VH2A 2MOKA 1AKRA 2WD7B 3NHMA 4LI3X 3VTKA 3QYAA 2NO6A 3IAHA 3P71T 4CKBA 2C5EA 5J63A 2YJTD 3EZ6A 3T7AA 3ZZ0A 1GL6A 3IR7A 4HVCA 3WL4A 1N2EA 3ZGZA 4ND4A 2YFQA 1NA5A 1VSUA 2RE8A 5DB4A 3D7KA 3N2KB 4I14A 1A8HA 1U0SY 4K6FA 1KZ7B 3DE7X 4OHRA 3G9ZA 4FFOA 3O7WA 2ACWA 3E05A 2R96A 4FSXA 5G40A 6AT1A 4KR0A 2R4UA 3WV4A 4IJKA 1RWPA 1MJ5A 4G1CA 4OQZA 2XCTB 3KHSA 1GAXA 1A5BB 2DULA 3NGMA 1BROA 3H86A 3P0EA 2BMAA 4R1TA 5B30A 5ICGA 1P6XA 4YDQA 1U7DA 2CDAA 3VQTA 5DDIP 4DJEC 5IFKA 5JJIA 2H3HA 2PSDA 4FFRA 2ZOSA 3NJ4A 3PHBE 5HCIA 3SC3A 3BWCA 3K70C 1O77A 5CT5A 1YHYA 5E0KB 1W46A 2V4ZA 1TM7E 5EE3A 4D9BA 2XCLA 3UZUA 1GTMA 1Y3CE 3C8DA 3TQFA 2WTMA 4UAVA 2BLLA 3EZYA 1I2CA 1TMGE 1NVDA 2YJGA 4FNAA 4Q1VA 1URPA 2QX4A 4R71A 3L05A 4EO4A 1A8SA 1AO0A 4Q7JB 1T1IA 4LC0A 1S01A 3NGXA 3SHFA 2GCGA 4CG0A 2AZXA 2V4MA 2W8ZA 1SXJA 3CBGA 1R1DA 3ZIAD 1Z8NA 1N36B 3KXLA 5FPHA 4URWR 2ALJA 4AMVA 3ZHUA 4R1LA 4LDPA 1GGFA 1Y5LA 3IP3A 3JZAA 1TQ2A 2XYRA 4B44A 1E7QA 3ZW7A 1P0CA 2GESA 3AB7A 1CB0A 3K0BA 2GA8A 3NI2A 4FE4A 4JS0A 1PFWA 1IJFA 1XPJA 4P98A 1CZHA 4BFTA 2PGDA 4XYLA 1B74A 3ZCXA 4R0NA 3M81A 5DLQC 1QX3A 5CNKA 1YCHA 3LBNA 2ACVA 1E3SA 4NULA 2E5LB 2O2EA 3N07A 4NYIR 3PRKE 2OXCA 3MW8A 2PX8A 4BNIA 1P8JA 3EZLA 4GC5A 4DG9A 1ZIDA 3PUJA 4UM5A 1M5RA 1G2IA 1KEWA 4DIUA 2DPXA 1ZNXA 3HVKA 4IVRA 1T9GS 2NXNA 3WL5A 3WVNA 4F4UA 1OYOA 2Q9CA 4GF5A 4G5FA 4D96A 2QL6A 2NMVA 2Y6VA 4RDIA 4XUEA 5FPTA 1MT0A 2O7NA 1FVHA 4L08A 1RI4A 3A6DA 1JR2A 3FHOA 4ZARA 1JL3A 3ZBPA 4ZDKA 2Y4NA 4D0LB 3IHLA 2VHEA 3L02A 4RL6A 4URZR 1Y8CA 4MV0A 5EMNA 5IVIA 4Y2PA 3CLTC 5JUWA 2GZRA 1EK6A 4XWWA 3QXGA 1Y34E 3WBBA 4AWXA 1RKBA 4JQOA 3RFTA 3W7BA 1V8ZA 4EQZA 2AYXA 2CF6A 5EUMA 1DVRA 4TTRA 3KPWA 3TL6A 3S8EA 3O8QB 2FR8C 2BGLA 3GUZA 1SZJG 1JYEA 3BXHA 1NX6A 3L7OA 3PL5A 4JN6B 1K8QA 2JJYA 3B12A 4WOBA 2WD7A 5FL3A 1QYDA 3TSWA 4KR3A 1OH5A 4OO3A 2CKMA 4C88A 4F60A 4IMJB 4RSRA 4K8OA 4KKXB 1UEJA 1NDHA 4WH0A 4LHXA 4MAAA 3WGGA 1QFYA 2QD3A 4IDDA 3PWZA 4OHZA 1G8SA 1X7XB 2DTDA 3BJMA 4MEBA 3EEFA 1T10A 1NQOA 3N2KA 4M1QA 4O3FA 2PKQP 2GSWA 4OLFA 4TLEA 1TCVA 1KIAA 3D9QX 1QRRA 2P9GA 3QVUA 1Q44A 4J75A 3QVOA 4DY4A 3HFSA 5JECA 4BKPA 5ALTA 3VYTB 4ACBA 1U9IC 2FCAA 2VCYA 3E03A 3TR5A 5FADA 4R8SA 1UADA 4JI2B 3HK2A 1WU8A 3S2ZA 2HSDA 5FIUA 3KZVA 3W2HA 4QBGB 2J0VA 3K6JA 3LHDA 2X7JA 2YDYA 5BMOA 1T6BY 4N5MA 4UE2A 2GZMA 3ZXXA 5AOCA 3BX1A 3RJ9A 1RC1A 5M3BA 2V54A 3IEMA 5DNAA 4Y0NA 1F17A 3JQQA 3CTPA 5BWCA 3R3YA 3EGDB 4KPEC 1JWBB 2ES4A 1U9JA 3BZBA 4L51A 1HMYA 5T64A 4ZIRB 5C1PA 3ZLJA 3KC2A 1NR1A 2ORYA 2AEMA 2Q5QA 4GAEA 4H6WA 4JJKA 4DWOA 2W6QA 1BYIA 2I3DA 2BZGA 2GJ8A 1XMVA 3LY7A 3WYDA 3V4ZA 3LK7A 4EY4A 3OTOB 4JT8A 5JSKA 1TM4E 5JNWA 1L7VC 2OT3B 2DWPA 4AUMA 4DLSA 4MQUA 4TXNA 2QJTA 5LLSA 3MUNA 5AW8A 2JFBA 4I2NA 1ACLA 1MEEA 4OHXA 2VRBA 1J07A 3NNDA 2HAEA 4OQLA 3D0RA 3WO0A 3AEXA 4HB3A 5BNFA 5KC9A 1O96B 2LIVA 1QIEA 3WK9A 4JSRA 4M86A 3ZCVA 3ZV3A 4Q02A 1NRXA 1QK4A 4WMLA 4ZVUA 4D6XA 3F6SA 3LA8A 1NFQA 3W5AA 5E38A 4RHYA 1YZKA 4XJTA 2CXUA 3L6BA 4CTOA 2O20A 4RMGA 2OAEA 4F2HA 2CY0A 1KTVA 1N5IA 4FCTA 2FVYA 1FW6A 4CL2A 4RD2A 1GYRA 2YVQA 1M74A 3OZUA 2FA9A 4S2EA 3IERA 3RS9A 1FSGA 2PGXA 1N2BA 3Q8LA 1JU9A 1NVVR 2O5RA 2XXBA 2WFAA 3GPDG 1Y4UA 4UDOA 4CT5A 5LYJB 2VAMA 1Q2XA 1NP6A 3HCRA 1QQBA 1KVUA 4YRSA 3C48A 4MUNA 3B1JA 1GGEA 3E48A 1DFHA 4RM3A 4ZOLF 3WMXA 2DUJA 2IKSA 3VUFA 4PN7A 4MMZB 1PP4A 5JCOC 4AJNA 4Z7JA 3NHJA 2OP1A 4FB4A 2FPIB 3PHJA 4PWYA 2Z09A 5AHXA 3AVPA 3WHKA 4BNYA 3OBBA 2CUKA 1J7JA 4L50A 2G9VA 4UU0A 2WT4A 4H77A 4RV4A 4Z0TA 4J16A 1W5FA 5IFLA 3D4IA 4PQYA 4M9CA 5A5GA 2C2OA 3UN1A 3CN9A 3CMCO 3GHYA 2MYTA 5E7JA 4PY2A 3CMMA 3FVRA 3LPAA 3VR3A 3WLKX 2ECPA 4A8JC 2HBYA 2WSLA 2QR2A 1XK6A 2KQUA 3O8QA 5FOSA 1YQDA 3ROQA 1ZJWA 5K3SA 3U81A 5IDWA 2A3RA 3V6MA 3U9SA 1SCDA 3ZU3A 1E2FA 3KUDA 5A5DA 3AIKA 3PUIA 5JEEA 2ST1A 2Q6IA 2QAJA 2W6OA 3C4JA 1I51A 1PVOA 3L8CA 5FTLA 2BSAA 4JUIA 4Z0HO 4K81B 4HEA6 1X7XA 4BQQA 1O5OA 4KGZA 5JVDA 2JRLA 3L06A 3I92A 1VM6A 3M82A 3K0HA 1YDMA 4B0PA 2M6LA 4DJJA 2H1OA 3I09A 3OA2A 1KKLA 2QAGC 4BB5A 4LV6A 2GPTA 1OFVA 2IIBA 4OA8A 1UBJS 3WNQA 1MW9X 5FT9A 4NL4H 4HP8A 3DSRA 3LDUA 3VO2A 5AKXA 4C87A 2EKZA 1EA7A 4ARAA 1E1QA 1NVFA 2KHZA 3MT9A 4GOJA 4OU4A 4RY9A 3GL9A 3GRRA 3GLVA 4B81A 1K4KA 1WCIB 4Q4HB 2F64A 1VE3A 3FIUA 1XDWA 2XQIA 5LC1A 2EYQA 3NAZA 1XHFA 3KDPA 1DAKA 2CNWD 3PEVA 2W2TA 4FYWA 4IDEA 1YE3A 3H2JA 4OAQA 4Y98A 2BGTA 3AHEA 1JFFB 4FTWA 2WM8A 4JT2A 2NYVA 4JXJA 2DPLA 1CJSA 2GF2A 3AONB 3PPYA 5IYZB 2R6R1 3EGDA 3HNRA 3R20A 4D3XA 4ZIRA 3GLIE 1Y7PA 1EWTA 2X0JA 1TKCA 3PXDA 1FFHA 1E7RA 4DMGA 3KUKA 4HLUA 2OZVA 5ERGB 2ODTX 1QYIA 3ZC3A 4EUKA 3PPXA 2NUBA 4MKGA 5CLJA 3WADA 4PG5A 1R6AA 3KETA 1S9DA 3DWGA 5ELLA 1QO7A 4YCMA 3S3TA 4HO1X 4OQMA 5FCDA 1C8BA 1W1UA 3HEBA 2AT1A 2MDTA 4NE7A 3PWSA 4MA5A 3ZX4A 3B6KA 4A1FA 1N6NA 1GDHA 3W2GA 1T6XA 2OEPA 2QT9A 1O96A 1MAHA 2Q5FA 4E5YA 4B3MB 3AUKA 3LXRA 2GFQA 3H87A 2B61A 1G6Q1 1ZDMA 5IC6A 3O82A 2EWMA 3G02A 5ALMA 3AYXB 2C82A 5DGTA 4FR5A 3HV2A 4RF2A 1SKUA 4IXMA 5C8DA 2QLMA 2P5UA 4NG5A 2J0SA 2W6PA 5I01A 3F4BA 5TT0A 4RWEA 3QVMA 1JTVA 3FBTA 5F1OA 3RABA 1Q11A 3FAZA 2MSNA 1XXLA 3WRVA 2JAXA 1TQ6A 2PYIA 3HU3A 1ST3A 2BKLA 1V0JA 3P96A 2AK2A 2C4HA 3M7IA 4PZPA 5LYJA 1OPRA 4K9RA 4E11A 4E6PA 5KYNA 1YFLA 5ICMA 5ENZA 1G3MA 5FULA 4K46A 2BF4A 3AVQA 4OQYA 2G5GX 4IR7A 3SE0A 3IIIA 2DWOA 1I1OA 1W2GA 3PC3A 1GKYA 2BN4A 1Q17A 1I4TD 4ROSA 2FPIA 4RZ3A 2HLNA 1B93A 2J0EA 4FT2A 4RO0A 3UK7A 1NJ6A 5CLIA 3V1YA 3C6YA 3LOPA 2G40A 2ZWMA 4JEHA 4YCBA 3TTSA 4OA5A 3GVCA 3SY8A 5DFAA 8AT1A 2ZE7A 1G4HA 4DV1B 2PX3A 3H5VA 1K8RA 2ERXA 3PGJA 4JXKA 4W4TA 1MDFA 2GN2A 2XMPA 3RUHA 3L07A 2P9CA 3W8RA 3PQ3A 3P4YA 5LMUB 2PUHA 3VKWA 4QKQA 5EMHA 1JKMA 3UJPA 1KAQA 4GM4A 5DTQA 3ZH9B 5LLDA 1EK0A 2A1TS 1JHRA 2OE2A 2O7QA 3SM9A 5C4IA 5FUQA 4CU2A 1X9HA 5K3OA 4DV7B 3UW3A 4C1BA 4D9MA 3UQYS 1TLTA 2UUAB 4YRCA 2WYHA 4OHYA 2XT6A 1LUAA 2ZIZA 1V3VA 2WZQA 2YVAA 2ZBRA 4FGZA 4A2WA 2XRZA 3HU5A 2DX7A 4ER0A 2CDRA 2HK9A 2XRMA 3FOZA 3LQ4A 3KOUA 4DMUB 1RBMA 4TMZA 2FQ1A 3C3MA 4HLDA 4HLNA 2KWIA 2JFNA 2RDMA 3EXG2 5T4HA 4AU1A 1WCIA 4Q4HA 4KO1S 3SHOA 2OECA 4TYMA 3UG7A 5LZ2A 4CEIB 3HZRA 4AZWA 1KL7A 3JYPA 3X2EA 3N2LA 2VP2A 2AG8A 3KOMA 1JR3E 5F5XA 1D04A 3RRBA 3FMFA 3NHZA 5KQMA 4IXNA 3DZHA 4NCNA 4YO7A 4ZCPA 2GLUA 1R0SA 1JFFA 4X5OA 1L5QA 5IYZA 2YIVX 2Z95A 4FWIB 4LZZA 3VC1A 3E7WA 3VHXB 2PQ2A 4OH7A 4F5WA 3AFMA 4IEIA 5U4XA 2ZJ5A 1V5FA 2H52A 1NQAO 1WUIS 4HH3C 4M0LA 1GU1A 1R0RE 1ZCJA 4AICA 4F06A 4QT4A 4XIIA 2HN9A 4M88A 5JXHA 1Z28A 4MVJG 1F6BA 1ZW6A 2P2ZA 3JASB 2HXYA 1DARA 4D82A 4H0CA 1JXMA 1MR3F 3M0EA 1TO1E 2A30A 3MTEA 4OOEA 4ZC8A 3DQQA 4RBNA 5CRIA 4BRSA 4FR0A 2PKYX 4DV4B 1BGXT 3K2QA 5DF1A 3PXUA 1BHSA 1C3OB 5L6MB 1ACMA 2XZDA 3KKMA 4UARA 4BFYA 5C46F 1MX9A 4LCEA 1GQFA 2H2FA 4B7AA 4YT8A 3KYCB 2B1RA 3T5TA 2X5JO 2QK4A 4ZYZA 4O4LB 2DHEA 3D2CA 1OXUA 2Q3FA 4H16A 4IVNA 4FFMA 4CIBA 1KNXA 4G5SA 5AK4A 5CYFA 5K3CA 3SC6A 5I3ZA 3FF4A 3STHA 4CLRB 1CY1A 3D6JA 3FWHA 2ZVJA 1FX0B 4R4JA 3K09A 2XAAA 3EARA 2MSKA 2PPVA 5GJWC 3HUTA 3GAZA 5FHRA 4RV9A 3WKEA 5FF9A 1TAUA 3DWEX 3Q9NA 3AM5A 1J22A 3PNYA 4R83A 1HDOA 4EKDA 5A03A 3INGA 1JA0A 4FDLA 1LBSA 1T5IA 4TSFD 4E1VA 3FVVA 3ESQA 1G41A 1OIVA 3EUFA 1G8MA 4MVJI 4PIVA 1G6HA 3WQBA 1D5WA 4QXRA 5BR7A 2R7MA 1U2PA 3WFJA 1AUOA 2CYAA 2NO7A 1VL5A 4GG1A 4GT1A 3ZE8A 2CMDA 4IEEA 2FXVA 3PD0A 1ZH8A 4B73A 1U0OC 1PFVA 4ZOQI 1XV5A 1XK7A 3FE2A 4IWYA 4MVWA 4OHOA 3VPBA 4YRPA 1IUOA 3ZIUA 2CXSA 1LQ2A 3GFPA 4JOCA 4KVAA 2PBFA 1XR3A 1LSOA 3D3QA 3MLBA 4OM8A 3SJCA 4JUDX 4UMVA 5LU9A 2Y0PA 3AEQA 3IHKA 3EGXB 3WJ7A 4UM7A 4D5GA 2BEVB 5KIAA 4AJLA 1G7RA 1QE3A 2QW0X 4K1LA 4RKQA 2Z6AA 1GKUB 2PTGA 2VH2A 3CSSA 2H3EA 1S3IA 2H1CA 3I45A 4L4UA 1AGNA 4M7OA 3OUZA 4KQMA 1CY6A 1KSJA 2W2LD 3VC2A 2HBZA 1G4AE 5EJ8A 1PFKA 4NCAA 2WVHA 1FFXB 1VJDA 1P17A 1R0BA 2COKA 3GK3A 3R6GA 1O95C 1CR1A 1NI4B 5BRAA 3U7HB 3I28A 3DAHA 3LX6A 3OPMA 4X9XA 1UK6A 5AK3A 2X5OA 2YWBA 2GBGA 3FCUB 4AECA 1YDFA 5AW1A 4BO7A 2ATIA 4LC9A 5KKNB 3RGGA 1P5HA 2I34A 3ZEIA 4OQXA 4YQYA 1ABBA 1C7JA 5JASA 1B2LA 4L78A 1SQ0A 1N2IA 3DVSX 2NT3A 3GELA 3IUJA 3ER8A 1TVCA 2PKQO 2XNDA 1XLTC 4ES6A 3A9CA 4I99A 3X1YA 2YHSA 5BVHB 1J9EA 1LS1A 4Q1CA 3CF4G 2PIAA 5DNDA 5AXAA 3MWKA 5C3UA 3E6AA 1RE1A 1NN0A 1XZKA 4FZVA 2EZ9A 3VZCA 4XWAA 5ESWA 3C5HA 2BFFB 1KP3A 2JGRA 3IQHX 1NRWA 3VHXA 3RHSA 5FWYB 3V3TA 5AP9A 3JS5A 2G1AA 4MCAA 4EB8A 4Q9LA 1R4MB 3GUHA 3H75A 1S1MA 4QC2A 1EGHA 2I2CA 3CM0A 1TA9A 2NVUB 1K75A 1NOJA 1P0MA 1UWCA 3QJYA 3UUEA 4EMUA 5A04A 3JASA 4H7EA 2FOIA 5TE9A 5H5JA 4BEWA 4OG2A 3WQSB 3VR2A 1X7DA 4BQRA 3E9DA 1J8FA 3DEJA 1WULS 3C87A 1M2JA 2GZHA 2W6NA 5BOVA 2WFZA 5TT1A 2P6UA 3PUKA 1C3OA 4J0GA 2B78A 3HCDA 5C0OE 3O8RA 3OLWA 5KOHB 4H7PA 4ROTA 3OJWA 2YFYA 4I3HA 4NV3A 5DYGA 3QOYA 2B8WA 3AZOA 1LF5A 1RLTA 2XQVA 4O4LA 2ZBEA 1AURA 2BKVA 2NTVA 3ZLUA 3DHNA 3OJOA 4ER7A 1UCFA 4UM9D 2OCAA 1L5RA 2OXRA 3ICOA 1KJYA 2GN4A 3TRDA 4YRDA 1S96A 2WAYA 1NQTA 3E53A 3UAWA 4CLRA 2JLUA 4Z54A 1JSXA 1FX0A 1BCRB 1EG2A 2RSLA 3RS5A 4F7DA 4M1YA 1SIWA 1DO0A 4L8WB 1XMPA 4K9NA 2NWQA 1KH1A 3NTUA 5CB0A 1V26A 3FCXA 1G1AA 5ARCA 3IP7A 5TPWB 3I6QA 4KIUA 3QUSA 3HEMA 3ZJTA 3LLMA 5EWJB 4BZZA 3LUGA 3UAXA 4EG4A 1GPBA 2AN3A 3PUVA 1W6RA 1JDPA 3AFIA 1HO3A 5KNBD 2EKDA 1HI9A 1J99A 5K99A 5FI1B 2FPOA 5KS2A 1Z56C 4YS6A 2UVPA 2C7OA 1MQ8B 3FPBA 3PR3A 1WP4A 4V0ME 2JA2A 2DUUA 2FMKA 3B70A 2A5GA 3DTVB 1GFZA 3DDCA 2CXXA 3PVCA 2NACA 4CTNA 1M6VA 4LF9B 2ESRA 1U81A 3MG9A 1ZMBA 3HGMA 2Z8YA 5F7OA 1CQXA 5DM4A 1XZDA 1FDOA 4TS9A 2BE7A 1ZK4A 2BH9A 4DVJA 1PQ4A 1XZ8A 2VHCA 2NZJA 1T91A 3HFGA 2OV4A 3HWWA 3MERA 1QIHA 4L2IB 2PUJA 5G4LA 3MXOA 1W5TA 4B34A 1LU9A 1R16A 2EQAA 2V4UA 1Z83A 2XE7A 2V8OA 1LWNA 4NJEB 1BG6A 4HD8A 1ABEA 3R40A 3MCWA 4OL0A 4XQCA 4QTUB 3EGXA 1NV9A 3BUSA 2BEVA 2PO5A 2R6AA 1KJIA 1P1HA 3TIFA 3EVZA 4IIUA 4OSOA 1EX7A 4XFDA 3IBYA 5T3YA 4CLEA 3KOZA 1NAHA 4ZAFA 4C01A 4P3XA 4YP0A 4NAVA 4O29A 4AVYA 1FFXA 1Q2UA 4QPPA 2JHGA 3ETCA 1NI4A 4KLZA 1FVOA 1HNNA 4YAIA 5C8YF 5I6DA 4JQYA 3IELA 2VL7A 1TF2A 2RGEA 2QDKA 2ZJ0A 2YIDA 3MS7A 4R2JA 4US0R 1KGSA 3KS9A 1AGRA 2D7JA 3Q87B 5B2ZA 2RHTA 4UUBA 1OXSC 3H2HA 3IEXA 3HN2A 3FPGA 1T8YA 4X6YA 3WIEA 4KI0A 1A7UA 3UYKA 1FQOA 4TKUB 5AHOA 5CCDA 4BNTA 3A3YA 2KPOA 4XUCA 4DJFC 1BDHA 4F3TA 1X7WB 2WLSA 3B51X 1ZEMA 2OZKA 5BVHA 5ALZA 4DYDA 3FFXA 2Q3DA 2XOKA 4BB6A 3AVTA 1ZKDA 3F5FA 1Z12A 3Q12A 4TX1A 1E9RA 1JHOA 2WYOA 1IATA 5GP1A 3GH3A 1A5AB 4JWTA 3ZWQA 1FYDA 3ZV6A 1KZGB 2RKBA 4INPA 2PKRA 2BFFA 3GB9A 1KA9H 5LD2C 4MV4A 4JVSB 1T2EA 2GNOA 3GRCA 1J8YF 4G4JA 1MORA 4I81A 5AK6A 5HF6A 5TVGA 1UDRA 4XSHA 4RTMA 2V03A 2C4UA 2NPOA 2JGFA 2NVUA 1T25A 4H7FA 4RPLA 1YS6A 1N0UA 2XUKA 1MC4A 1XFAA 4DA4A 4CLOB 5IJAA 5E7IA 3OZXA 1DJMA 2FEXA 1EG7A 1HQYE 3AR3A 3OPQA 1J2UA 4FMBB 2GPBA 2OYRA 4KQGA 3ND6A 1N2GA 4OBBA 4M38A 4ZVLA 4BV3A 2X2OA 2B3DA 3LFHA 3T5BA 4C6RA 4V0MA 2VOEA 2YQZA 4ZANA 3B3AA 3F5MA 1M7HA 3H3XA 3RROA 3RVBA 1H0SA 1AKMA 2PBRA 3FRHA 4MYDA 2YMQA 1T4DA 1KHTA 3M49A 3IAAA 1NV8A 4N0MA 1TOAA 4NATA 3T34A 1D9ZA 2CFIA 2ZTLA 1BCRA 4TV9F 1MB9A 3RSZA 3R0VA 3RWMB 1E3MA