2X2PA

The flavoprotein nrdi from bacillus cereus with the initially semiquinone fmn cofactor in an intermediate radiation reduced state
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
117
structure length
117
Chain Sequence
MLVAYDSMTGNVKRFIHKLNMPAVQIDEDLVIDEDFILITYTTGFGNVPERVLDFLERNNEKLKGVSASGNRNWGDMFGASADKISTKYEVPIVSKFELSGTNNDVEYFKERVREIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NRDI PROTEIN
publication title Tracking Flavin Conformations in Protein Crystal Structures with Raman Spectroscopy and Qm/Mm Calculations
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Flavoprotein
total genus 42
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07972 Flavodoxin_NdrI NrdI Flavodoxin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2x2pA00
3W77A 3OJWA 1QR2A 4XDGA 3GFSA 3HR4A 2KLBA 2Q9UA 3GAMA 4N65A 1NNI1 3OWHA 2AMJA 3F90A 2M6RA 4YALA 1V4BA 1OFVA 1XI2A 2FDXA 4QOFA 4S24A 4BMOB 1FVXA 3F2VA 2MWMA 4PU0A 5NLLA 2BZSA 4J8PA 4NLLA 1FLAA 3B6KA 1CZRA 4XDHA 1AKQA 1GG5A 1RLJA 3D7NA 3O73A 4LTNA 1YOBA 1D03A 3OX2A 3TE7A 5LLDA 1XT6A 3OJXA 1AHNA 2V5VA 1JA0A 2ARKA 2OYSA 2V5UA 1TIKA 1QHEA 2FZ5A 3OWXA 1CZLA 2Z9DA 1XYVA 1T0IA 5LJIA 4Y9RA 2FAXA 3EYWA 2B3DA 4QOHA 4GR9A 1CZNA 2XODA 3GFRA 5EA2A 1D4AA 4DIKA 1WSBA 2R97A 2A5LA 1QRDA 4FGJA 2V9CA 4QOEA 4DILA 1JA1A 2HPVA 2QX9A 1QBGA 3W78A 2M6SA 1AZLA 3HLYA 2N1MA 2D5IA 2X2PA 5FUQA 4LAFA 2Z9BA 4YQEA 5TGZA 4YAOA 1ZWLA 3R6WA 1KBOA 3JSXA 3NHSA 3KLBA 1FLDA 2OHIA 3LT5A 4QOJA 1CZOA 2QWXA 1FLNA 2F1OA 3K1YA 1YDGA 1RTTA 3NLLA 4FX2A 5B3KA 2X2OA 4D02A 3QFCA 4YAUA 2FLVA 4N9QA 4YAWA 1H66A 5BUCA 3P0RA 5F12A 4FGKA 2KQUA 1BVYF 1FUEA 4U7HA 3U7RA 4QOIA 4ZVKA 2RG1A 3ES9A 2ZKIA 3KEGA 5JROA 3GFQA 3ZHOA 5FX2A 5LVAA 5LBUA 3FVWA 2WC1A 3F6SA 1F4PA 1AKWA 1VMEA 2FX2A 2QX4A 4ZVMA 5LBTA 3KAPA 5ULLA 3OX3A 1FTGA 2QX6A 4Y9UA 2Q62A 4OXXA 3RPEA 2R96A 2XOEA 6NULA 1FLVA 1J9ZA 2MTBA 4C14A 3N3BC 2OHJA 3N3AC 1J9GA 2MOKA 5FA6A 2MT9A 4R81A 2QX8A 1YRHA 1X77A 3UXHA 4U7GA 4QOGA 4C0XA 1ZWKA 4FGLA 4C0WA 3ESZA 1CZKA 1FX1A 2GSWA 1AKVA 3O2NA 3U7IA 4GQIA 1BU5A 2BN4A 1YKGA 1AKRA 1I1OA 2Z98A 1DXOA 4DY4A 3SVLA 2BPOA 1YCHA 1H69A 3F6RA 3W79A 3TEMA 2HNAA 3K20A 2FVXA 3NHWA 4HS4A 4PTZA 2FZVA 2HNBA 1AG9A 1CZHA 4LTDA 1J8QA 5A4KA 3ESXA 4YAFA 3NHUA 3L9XA 1OBOA 1C7EA 1OBVA 3EDOA 3NHYA 1DX9A 1RCFA 1AKTA 3N39C 4Y7CA 4HEQA 2QMYA 3NHLA 4PTYA 3NHPA 1AKUA 5F51A 3B6IA 3L9WA 5F4BA 1TLLA 5B3LA 1SQSA 5LJLA 1E5DA 2QR2A 2W5UA 3W7AA 1SG0A 4U7FA 3QE2A 1WSWA 1CZUA 1C7FA 1B1CA 2BMVA 3QFRA 3LCMA 2Z9CA 3FW1A 3FNIA 1YCFA 5LMCA 1AMOA 3G5MA 1ZX1A 5EAIA 2FCRA 3NHRA 4ESEA 2QMZA 3B6MA 3NHFA 1KBQA 3UXEA 3KAQA 3HA2A 4NULA 4F8YA 3OVMA 4ZVLA 1J9EA 1XYYA 3B6JA 3NFRA 3ESYA 4BMPB 4M0CA 4ZVNA 1D04A 4C76A 4CF6A 4GI5A 1DXQA 2BF4A 4QODA 5NULA 1T5BA 4H6PA 4CETA 5EMNA 4LA4A 4LTMA 4N82A 1YCGA 4H2DA 3S2YA 3FX2A 3TZBA 3NHKA 2FOXA 3NHJA 3FJOA 3OX1A 1RLIA 2OHHA 4ICIA
chains in the Genus database with same CATH superfamily
3DGFC 4HL6A 4LOJA 1YJ8A 4DWOA 3DV2A 1W0KD 3PWKA 2PRKA 7MDHA 1KRXA 4DDKA 2CE7A 3TTWA 1R4NB 3ZU6A 4COOA 3FAKA 2B1QA 3ACDA 2RBGA 2EJBA 3CFYA 4NC9A 1Q1EA 3GFGA 3P2OA 4QTZA 1QVRA 5BSKA 3QPBA 4IRXA 3WYBA 8MHTA 1HE1C 4L0QA 2ZT8A 4AMUA 1IONA 1P17A 3UWMA 2BUCA 1ZJ6A 3OTGA 4XSHA 4CIVA 4CQNA 1US8A 4RSMA 4NZYA 1YZ3A 3SBOA 4JJGA 1Z6TA 4WZ6A 4TSFA 2CKDA 1YGPA 2MMCA 2J87A 2XTMA 4NMMA 4K86A 4LDPA 3Q11A 1QO0D 1X1DA 2HCFA 4YP7A 5T4FA 3JR7A 2WIFA 2NO9A 2QW1A 1MHPA 3CZ4A 3HDVA 4GP9A 1V7CA 3SYLA 4BNLA 4DLLA 4UM9D 1SA0B 3T7DA 4DCMA 5FOQA 1JEYB 8OHMA 3DHWC 1GTVA 1NMSA 1VXRA 3FUVA 1Y8CA 4WKNA 5IVIA 5UKDA 3THSA 4BJ3A 2WPDA 3R9XA 1NXPA 3OQVA 2A9KA 3ANXA 3T7JA 1E3WB 2DFNA 5ELLA 4Z9XA 1ECPA 2JK0A 4QPNA 2EX4A 2I7VA 2XXBA 2PJUA 1NBAA 2EKPA 4XLTA 4K6HA 4DV6B 3M6LA 1L7QA 1RIFA 2BM1A 2I03A 5D1HA 2NMVA 1X1CA 3PUYA 3A32A 4NICA 5KYKA 3SFZA 2OLKA 4PGHA 1YOBA 4UKDA 3F49S 5FHRA 1ZGJA 1G291 3DZDA 4A8TA 5AM3A 3ONFA 2CC2A 2GA8A 1P8JA 1VL2A 2PLRA 1CQZA 2WJVA 3HY6A 3I8OA 4L4UA 4G81A 4N47A 1E77A 3ESDA 1POXA 4FFLA 2J4FA 3ZNQA 1OOEA 3FHCB 1Z28A 4D57A 1QG4A 4R8SA 5EPOA 1EZZA 1OLXA 4G24A 5EJ2A 5FB3A 4AD8A 3VSDA 2JFOA 2PMFA 2Q1SA 5I51A 2QPOA 2RB4A 4U3JB 1PG2A 4I50F 4BPRA 4XWOA 3PDJA 2IPXA 1CS0B 1CZLA 2AKAB 3EXHA 3ILXA 1YA8A 3N59A 3DQQA 5DN6D 2VJCA 4JCOA 4LNUA 1IXRC 2FEXA 3VOTA 3OZEA 5L3SA 4QM6A 4DCVA 1NXQA 1LRJA 2PO5A 2QLTA 2OFFA 5HS4A 3FR8A 1DHTA 1DEAA 2O0HA 2Q1XA 3IMFA 5LPNA 1ZMTA 5ALKA 5MGBA 4QU9A 3TE6A 2HF8A 3IEXA 3JQRA 3JD3A 2VWGA 4QVKA 3ZD8A 2Q0XA 4RH3A 3SDBA 3EYWA 4N8DA 4WLOA 1E94E 2XVAA 4MV1A 1P0IA 3T4UA 5FPYA 1TO6A 3OTHA 5T3YA 3RWMB 5AJHA 1V5EA 2BE7A 1TKRA 2G25A 1R3DA 3A6ZA 3CO0S 2WU8A 4HO1X 5SYNA 2H5IA 4DB4A 1JKXA 3QPVA 1H8EA 1HL3A 1ZM2A 2XWSA 4WXMA 2W93A 2XI4A 4RVDA 5TB5A 3BE6A 3ZDFA 3LLUA 3WXMA 1WV0A 4G07A 1B6SA 3OLYA 2HEIA 1GZUA 1W29A 5IDWA 3DZHA 4KPUA 3T9BA 3ZW8A 3FGPA 4I1YA 4FOOA 1CUXA 1RXEA 3NBMA 4IQ8A 4XGIA 4LFCB 2J9YB 3EN0A 1NLZA 4RIIA 2YV3A 5FYQA 5T3UA 4QAQA 1I2MA 3EVGA 4QUGA 3ZGXA 2W98A 3JAWB 3R7LA 2RH8A 1OXMA 1X15A 1ZNQO 4IZIA 2D4HA 2FW7A 1CUBA 3NALA 1SCNE 4DF3A 3RTEA 4R51A 2G0AA 5ELMA 1Q6ZA 3L7CA 3WTBA 4I9FA 5C8XA 3AETB 1ZHFA 2EL7A 2QTMA 1VGVA 1O95A 1VHTA 1NX6A 1YHZA 2IA5A 3DMTA 4XYBA 4MHSA 3I09A 5CVJA 4CCWA 1BJRE 3G2KA 3TNLA 4AMZA 4YRMA 4XX0A 4M6WA 1VPWA 4LF4B 2CLCX 2QXUA 1N2BA 3WQSB 4DHEA 1W2WB 3Q6NA 2E5LB 3RQIA 2C31A 3KLBA 3F78A 1C7QA 3COPA 4RL4A 4JC4A 5BRNA 3CU5A 2PV7A 4DXDA 4ZHQB 1UKAA 3IL2A 4MS1A 5DEOA 1LY1A 3ZKAA 1IYZA 1KYVA 3IXLA 1C3OA 2O3SA 1L5KA 2XHEA 4NAHA 3HZRA 3SR4A 2XEXA 1A5SB 1SKBA 2ZE7A 3MJDA 2VUTA 1NIJA 1BCSB 3OTQA 3GW8A 2EP5A 2X7XA 3FHOA 3NBAA 2JJ2D 3JVVA 3KSMA 3HGTA 3KZXA 5B3JC 1ZHHA 3S2IA 4GX0A 3Q15C 3UJ6A 5A3VA 4HNAB 1Y8RA 2Q1TA 3KYIB 4KXFB 1OILA 5CVVA 5B3KA 3D0KA 2FWRA 2X2OA 4US1R 5DMHA 3WLFA 1R4NA 1OCEA 2C59A 3VNRA 1T1RA 5LMUB 3HN7A 4A92A 3ZLBA 2KSQA 4MGZR 3LQ2A 4C0LA 2CV1A 1FDUA 1VKJA 2QJOA 4H1VA 2POCA 1SD2A 1HURA 1D5WA 1NW9B 3VSEA 3A6EA 3PPVA 4F4CA 4C6SA 3OZWA 3MWEA 3DHNA 1W0JA 2ZR0A 2ECFA 4WAUA 3HXMA 1U6KA 4DARA 5G0TA 1ZOIA 4O4LB 1R0ZA 4LJLA 3LL4A 4YDHB 5AOAA 1A3CA 4XFJA 5SZJA 4DQ0A 4JUCA 4QYTA 2EJVA 5HFNA 1BVYF 1Q50A 4HAZA 1UF9A 3G17A 3H0EA 4IMJB 4NK4A 1BWPA 2X42A 5K20A 2D6FA 2O19A 2GFHA 1ENZA 3ORHA 2O5RA 1UK6A 1U9IC 1N8TA 1UZUA 4YT5A 4RA9B 4UBIA 1XYGA 4DBVO 1T26A 2WTAA 5FUVA 1O5IA 4BMCA 1SA0A 1IEVA 3OLWA 3HB9A 5DVZA 1JEYA 1NU6A 2JD1A 3VAZA 1QXSA 1ZD4A 2VQDA 2REXB 3HVHA 3H1GA 2DQYA 1FTQA 1T3SA 1QGED 1ZXXA 3WZLA 1RE1A 2Q8NA 4OFBA 5LVAA 3D4LA 3PGKA 2XBMA 4BQRA 4JZKA 1APBA 4XX1A 1F4PA 3VSBA 1G8FA 2PT9A 2IVFA 4NFLA 3M5CA 4M9XA 3CWQA 1TGVA 1Q0SA 3ILHA 4WV3A 3KTOA 3VZDA 3IELA 3BMCB 3B7PA 2AX4A 2PMDA 4BNTA 3JQ6A 1KDZA 5F5XA 3FH0A 2AG6A 3K31A 2AR9A 1L8OA 1N3YA 3C45A 1Z2OX 2UVPB 3U7JA 2PHZA 1R8XA 5CNMA 3DF7A 2HPAA 4ZV4A 1DAMA 3P97A 1RWBA 4AWAA 2IFTA 4O59O 5CT9A 1FYWA 4RTOA 2I29A 4OHMA 2VJMB 4G4SO 3LQ4A 4U3JA 5LP1A 1HTTA 1CS4C 1TEZA 4OQZA 1D6MA 1CS0A 1N3IA 2ZIEA 3O1LA 2E82A 3OE4A 1E5QA 2D3TA 2C9ZA 3PXXA 3HR8A 2R6DA 2RAVA 3RGWS 5F4ZA 3W5VA 2FFJA 3LPMA 3PVCA 1I3NA 3JD4A 3F3SA 3OEED 5CFPA 2CLDX 4LHVA 4O2LA 4Q16A 1MX5A 3PRKE 3FPHA 5E7IA 1EUCB 4WEQA 3T9AA 3HVRA 1T9GR 4ZVOA 1ENPA 1P4RA 4C1NA 1Z6ZA 5B1EA 5KREA 1IG3A 4O2BF 1KARA 2XIJA 2ZU0C 3GFVA 4M46A 1KJZA 3IURA 4I8DA 4OH7A 1I0LA 4UCQA 5T8KA 4RH1A 4A6DA 1RBZA 4I7EA 5JAZA 4QOGA 5EVCA 1U2SA 3R0VA 4F2HA 1PJBA 1R00A 2VR1A 3UPTA 5AVVA 1SC6A 4H6VA 3IXMA 4ZVUA 1EB8A 1LU9A 4HJRA 5DOZA 2OHOA 3O4FA 3KJZA 4U5XA 1COWA 1QVWA 1VBKA 2C4VA 2VHXA 2VO1A 3G1TA 2OM2A 3NXSA 3U7IA 4GQIA 5CYGA 2RI1A 1MVOA 1AQJA 3NIGB 1UJ4A 4UTZA 4EDFA 2CFOA 5E1OA 5KNCD 3CVUA 2VPYA 3MERA 3PNMA 2OBXA 1RD4A 2V9ZA 1M6YA 3ZE8A 3CUSA 1DNPA 1P3JA 4OY3A 4IGIA 1MTZA 6REQB 1YA6A 1ZR4A 4QFMA 2W37A 4YFVA 3K2BA 3JAWA 4PR0A 2O52A 3ROKA 1A1SA 2VHEA 4M98A 1A7KA 1USWA 3PQEA 3RIEA 3PE6A 3VR5D 2Z3VA 4ZA2A 1E64A 3PXBA 3QU5A 1SXHA 3IOEA 4YROA 2FPGB 4AULA 4AECA 5F98A 3AETA 2AOWA 1TZCA 1XZAA 3UICA 4GE0A 3CJQA 4JU8A 3TSAA 2EDCA 2CB0A 4PO3X 5FEUA 2B0JA 4ZTBA 4IV0A 3PQ5A 1Z4PX 4LCBA 4EATA 1UBRS 1ZIOA 2D0IA 2GERA 1C3JA 2WHEA 2P9QA 3DEKA 4HTAA 3VZBA 4EKIA 1PBNA 2HQSA 1XCPA 2C9YA 4FHGA 4XIGS 1PT9A 4ZHQA 2XECA 1J8QA 2G80A 1NHWA 3L7OA 2B3TA 2H57A 4KGVA 4B73A 1FFBA 5CTJA 3W8RA 3DE4X 2ET6A 3AHHA 3QPWA 1L9KA 2QRLA 1U0JA 4FDAA 1Y6JA 3IP9A 1BCSA 1QHXA 1CQWA 1YB7A 2BBWA 5M2QA 5F1KA 3DV0B 3HKEB 4EY7A 3GX1A 4TMTA 5EXDA 3TX6A 1CE8B 2O0KA 1UK9A 3TGPA 1KJQA 1LQTA 1H2RS 3FZGA 1AKUA 1NV9A 3NORA 4HNAA 4RQTA 2D3WA 1Z47A 1Z0AA 2HDNB 2D2FA 3GT7A 4ENTA 4N3GA 2XD9A 1O6ZA 3OD1A 4Q3KA 3ZGLA 3H2JA 3LHSA 3N8NA 2WTUA 2H5JA 1B3BA 1RC0A 2GT1A 3CUEF 3MWDB 3NHZA 4NE9A 2FZ4A 5K01A 2WK1A 1SRQA 1N2XA 4C6TB 3O6VA 1NYRA 1Y1LA 2ZJ5A 1JMVA 3C5HA 4XA8A 2A3NA 2B1IA 3I6YA 4JLJA 2O1XA 3V55A 2RJ3A 4GZ5A 1WB5A 2PXAA 5CM9C 4F3RA 2IPLA 4ZTUB 1Y37A 4O4LA 4BCBA 3OECA 2FP3A 4RVOA 5LYJF 3N05A 3L1IA 3VH1A 5KPJA 2O2YA 1J7KA 1G5IA 4HNRA 4MUEA 3EOBI 4X65B 2VFAA 5DNAA 5JMPA 2EFCB 3RS8A 3EMVA 3VO8A 2VRNA 3TDNA 1FBTA 1JQ5A 1VHQA 3SZ3A 5A5GA 3CNEA 3EAFA 4IQFA 4RA9A 3WX0A 5KVVA 3OQMA 2ID8A 3RAJA 1R6AA 1JNXX 1SKYB 4Q66C 4XFKA 3K0AB 4YRRA 1R0XA 3GUHA 2G28A 3INTA 4EARA 3I2GA 3JQFC 2IHBA 3LGXA 3O4JA 3OHMA 1EXMA 3AZOA 4NEQA 3CTPA 1F3OA 4GBGA 2AS0A 4JVLA 2OLEA 2XUKA 5EAIA 1TC2A 3NM4A 4H7DA 5AXDA 3ZNNA 5CEFA 2F9LA 4L8YA 1XZBA 6LDHA 1E2GA 4B8YA 1N34B 4I2NA 4CLRB 3LW8A 3QFTA 2IJGX 4OHFA 4RCYA 3NKFA 2HC9A 4MICA 5D87A 1UMBB 5D5QA 3GVPA 1BO6A 1FRVA 2CJYA 2NAPA 2ZIVB 3BMCA 5H68A 4Y2HA 3O4RA 4KMSA 4ZJYA 3SYNA 5JPIA 4F6LA 1U9ZA 2OGTA 5B2FA 1U2TA 1YZNA 1NVXQ 4Z4EA 2HXGA 4DCCA 3KAQA 5IN4A 2JIQA 3IRVA 2UVPA 2ZYGA 2I2DA 2QX7A 3DDZX 2ZYRA 3U09A 1E7SA 3KQYA 4DCUA 5C7YA 5K4AA 3P0HA 4QEKA 1LPPA 5DCWA 4KH0A 2VJMA 4DMCA 3C3AA 2OYRA 2GZDA 3ONWA 3OIGA 4R6XA 4U6QA 2P90A 4X00A 1A0OA 4MV5A 5BRAA 1YB5A 1KERA 3KU4A 1H2BA 1VJ5A 5JZSA 2W2QA 4EUNA 1ZU4A 5FV7A 1L1FA 5JC8A 5KSWB 2HK8A 4LZJA 4JJZA 3WDMA 3CH4B 1GGVA 4P5PA 3OPQA 1AU9A 1O1YA 2VP5A 1ZVVA 1U6IA 2JLBA 5DLQC 1J1UA 3DE7X 3EGOA 3U19A 1KDPA 1YDEA 3PCTA 1EUCA 4WPGA 1MB9A 3IXQA 4B4OA 4BUZA 5DWVA 4LF6B 4TS3A 4OJKA 1K66A 3A6DA 1UAAA 5MGNA 2C2ZA 3A25A 2GZHA 4L5CA 2P69A 1TGYA 4TKVB 1HQYE 1JKIA 3AEUB 6YASA 1KZ4A 4YI5A 4YCCA 4KO4S 5JHHB 1LSUA 1WB4A 1LPOA 3BF7A 1Q17A 2IC5A 3FWPA 3NKLA 2NNWB 2JH3A 2R9VA 4Q00A 2C54A 3DKPA 1M2NA 1NJ2A 1EX1A 2VP0A 3SYTA 4DG5A 2ZSIA 5BUQA 2CBXA 1FU8A 3QE4A 3MPOA 1LBTA 1L7OA 3QEKA 4UVHA 2WPNA 1ZN8A 3I2YX 4DJAA 3PV0A 2EERA 2FOXA 2GEFA 2R6HA 3FJOA 4IUDS 2AOXA 2ZEJA 5C37A 2BCGY 3CLRD 5CYFA 1K5DA 1ZP6A 3IA7A 4W63A 3TW6A 4KSYA 2YN0A 5BSVA 1CRZA 5KYGA 6REQA 4H17A 1P2FA 4E12A 3LQRA 5EP1A 5CCEA 3LYAA 3QSYA 5CVEA 5ILGA 4B4KA 5LOVF 5KVAA 2C3MA 2SKDA 1IPHA 1X9HA 1E1YA 3EAGA 1NE7A 3EZ9A 3FWNA 1EQ2A 4IEEA 5L3VA 2FPGA 4H7HA 2R8ZA 4XLLA 3C7CB 1Q1QA 3TD6A 3EDCA 4IKPA 2QRKA 2MR6A 4ENVA 3D2BA 5A4IS 1HA3A 3E7DA 2IZ7A 3JCZA 2AMJA 1XK7A 1SKUA 1H6BA 2VT3A 2RHJA 3N0XA 3IALA 1H2EA 1IN7A 1MAUA 1G38A 1EK5A 4MMXB 4FVTA 3FXAA 5CLHA 3I45A 4TQGA 4C7MA 3KALA 5JXIA 1WUIS 5JTUA 1V8DA 1PHPA 3MJSA 3LWDA 4TVOA 1HNWB 4XIFA 2PU5A 5IXJA 2Y0PA 4A26A 1N2CE 3EDYA 2PX4A 2WNSA 3FVVA 3K9WA 2DJIA 2I3AA 4L8FA 3SNHA 3ZQ4A 1Y3AA 4FT2A 1FNNA 1C30B 3DV0A 1OFTA 3HKEA 3R3JA 2BZSA 1CE8A 4KWHA 5JD3A 2NZWA 3TLXA 1WB9A 3I61A 1BX1A 3HCRA 3UXMA 2HA7A 1G3RA 1RLJA 3L6EA 3LHIA 4MJXA 1A04A 1JXAA 1JU9A 2ZJYA 4RDHA 1J8YF 1OWPA 4KBFA 3MWDA 4YRPA 1E3JA 4F91B 2I91A 2WVHA 2Q5OA 3VI4B 4C6TA 3QVWA 3ASZA 4EENA 1MG0A 4COKA 3P0EA 3QA3E 5LLDA 1L4KA 3OFSA 5JNLA 1Z2CA 2CNWA 3BMXA 3GF4A 4QYMA 4WKCA 5IULC 2PZJA 1DV1A 5M34A 2O2ZA 3CJRA 5C5DA 4K40A 5TV2A 1D2EA 1QYRA 3LC7O 3EH1A 2JGFA 5IARA 5BXQC 2PRJA 4TVBA 2NP6A 4UATA 5F3RA 4AUMA 5FADA 1M2HA 1JPNA 1NRWA 3K96A 2Q3CA 4JI5B 4CM9A 4X90A 1I1NA 3OM8A 4HGNA 3GPBA 3AY7A 1X38A 3ENQA 4BO2A 5D6OA 2WI8A 1GUZA 4MPRA 3B5JA 3L8CA 3HXQA 3K0AA 2NN3C 4K8OA 2J48A 3FYDA 3HFGA 4ABTA 1HYBA 3VOBA 4CFZA 3TRFA 3GLGE 2G76A 4FFBB 2FGJA 4JX8A 5B12A 2HXSA 1OGYA 1LKZA 1DAIA 3PJDA 5LIRA 3RS5A 3ZX5A 3TZ6A 4G97A 1U4SA 4WL0A 2Z09A 3MOSA 4CLRA 2EX1A 3T52A 4BB9A 1KWKA 1NKTA 1UMBA 2OSBA 3LKBA 4JIGA 2MCFA 3VSCA 1SOWA 3KQOA 2PDAA 3D3JA 2XXAB 5EJ9A 2XODA 3CF0A 1PW5A 3UV3A 4IICA 4X44A 5HM8A 4I4NA 1U5AA 1UBNA 1GNQA 3KTFA 4LECA 3AP1A 2HBQA 1LDBA 4MGIR 4MRNA 3U49A 4MW5A 3HTXA 1BS9A 4RKEA 2JCYA 2C20A 2J4DA 3UHPA 4BLTA 1T0UA 5J58A 1TMKA 5FL3A 1X6VA 4M21A 5BPFA 1K6IA 5FWNA 2D0PB 4G25A 4KXNA 3BXGA 1YKSA 3CZCA 1DC7A 4ADSG 3PSAA 4IMIB 5TT0A 2RC5A 3HA7A 1JYSA 2VHYA 3EASA 2GILA 4JLKA 4N3NA 2YXNA 3AM1A 4XX0B 3D3WB 3HM9A 3GRFA 1Z25A 1M2VB 2NPOA 4GX1A 2P6MA 1Q1BA 2W0SA 2R8XA 4LZWA 3L06A 1G6HA 3TR0A 4RVUA 1N8KA 3M6IA 1QPGA 5EP2A 5JLAA 4CIDA 3L7BA 4HQ0A 3CSUA 3CJTA 4YQEA 4TSFD 4YUAA 3BXEA 1XU9A 1OT5A 3TZEA 4XJVA 4TKVA 5H16A 4RHUA 3AEUA 2VF2A 1A8HA 3CCBA 5LR6A 4NG4A 3QQPA 1I2AA 3KR0A 1G7CA 3UUWA 3K5PA 3S27A 2YWJA 5F9FA 4W5WA 3IQWA 1L3IA 3A28A 5LNK6 1GNTA 3WG9A 5HJ5A 1C9KA 4GXTA 2IYYA 4UZSA 3G6KA 2EWMA 4EAAA 2IYOA 5EXTA 4PRLA 4ALKA 3REQB 1GQQA 3WLSA 2PWPA 2NTEA 3KZVA 4XI9A 1HE5A 2QW8A 3WGUA 1PJQA 3VTAA 4KN8A 1CEEA 4ZEOA 4LBWA 1NBIA 3EIWA 4FFNA 1XCOA 1PJ2A 4PYRA 1FFSA 5TC4A 3TR5A 1T0HB 2CD7A 2IX9A 2OV1A 4HVLA 2WYVA 3QLJA 4ZVPA 2BZ0A 2FWIA 2IS2A 1VDZA 1XV5A 2FLVA 2XVYA 4BKMA 3QEOA 4FOTA 1X9IA 2KHZA 4JQZA 4M37A 2P0EA 2ZVQX 1HC7A 3K7EA 4MARA 5B2EA 3ITEA 5DRYA 4C3VA 3RO7A 2V6IA 2BE9A 1UZAA 3GRUA 4GR5A 4L74A 4NYIQ 1EFDN 1W581 3MD0A 4L4ZA 1M2KA 2ODTX 3KNZA 3AV3A 1F48A 5EMLA 1X8JA 4GLBA 1QTNA 4ACBA 1OXBB 3L8GA 4TQUS 3SJCA 1QCYA 2A84A 2AMYA 2IOFK 3RWOA 4NBUA 2GJAA 1HLPA 4FMCB 1SVLA 4G0PA 5GMOA 5BSMA 3VJKA 2GN4A 5E1DA 2DFDA 3F8WA 4OXRA 5LP6F 3MINB 3NC0C 2G1AA 1DKUA 3O82A 4DN6A 3EA0A 4D8VA 4CV2A 1UOOA 1XZIA 4KQFA 1FL9A 4EG8A 2N46A 3ABOB 1C30A 2X4GA 1D8AA 2NM0A 3C3MA 1RNLA 2VWQA 4KNVA 5IJAA 3E48A 3OBIA 2PX2A 1JE0A 1N5LA 3AZPA 4NU8X 1UP4A 1Y9AA 4W9NA 3ZTYA 2FMTA 2JAUA 4V0RA 2O23A 4CDRA 1RYFA 2QX4A 5IJWA 1N36B 4LOLA 4F3TA 4YUVA 1GCUA 2Z1MA 4Z1MA 1L1QA 3OKCA 4KXQA 2OXEA 1D0SA 2MDTA 2VJQA 4ZRMA 3RHZA 1VSBA 1OI4A 1R0KA 1JH8A 3EQZA 1H8ED 4PSUA 3K9CA 1Q7BA 3KAPA 5K7SA 2GZ1A 3OFNA 2ZI9A 2BEWB 1E62A 2PBLA 1UKVY 4N1AA 4B6PA 2P91A 4E2YA 3FMGA 4YNBA 2XTZA 4M9QA 1GQOA 3N2NA 4LZZA 2GWRA 2O7VA 2XZDA 5KDDA 2WG2A 4DA4A 3WAKA 1VHLA 4TZKA 3Q7PA 3UMRA 4RZUA 4DZTA 2XLBA 1D7OA 1Z4JA 3CRMA 4A8JB 1B41A 1FU7A 3BC1A 4GMXA 3CE9A 3KKEA 3L1HA 4HLUC 5KYNA 4JYAB 4M8NE 5LXTF 4BBJA 5CDSA 1KYQA 3HB4X 5JS6A 1O95D 2XMBA 1NN0A 3I9FA 4K6KA 3GMSA 1ATZA 2AXNA 4DCPA 4FFBA 2G07A 3ZG6A 5DM70 2GWHA 3RT1A 1U28A 2BW0A 4UEWA 4S0ZA 4F8EA 3N2YA 2ZVDA 5ER9A 1HETA 4HMQA 4OIMA 4ALJA 1AS2A 1Z73A 3ZWVA 1UEXC 2XWPA 1TYZA 2C9MA 4BQPA 2K6GA 5JBIA 4AQ7A 1KF0A 1A5BB 2GN9A 3U0VA 3TB4A 4E46A 3RB8A 3PPIA 4I81A 4PLVA 3HV0A 3VAYA 5HWSA 3L7LA 1JHPA 1ZWKA 3GAFA 2XXAA 5K1ZA 2AVDA 1YR8A 1AHHA 1KJWA 4J4HA 2GZ2A 1ZGAA 2YZGA 3MNFA 4CRWB 3LUHA 4E5NA 3KWFA 1JIUA 4U6NA 2C7GA 3FWYA 3HCOA 4NBKA 5JUWA 3U7FB 3VPGA 3AVTA 5ECWA 5A62A 2B61A 1WCXA 1QORA 1DPGA 4WLFA 3B53X 3DCJA 2WSYB 4R54A 2BM0A 3JYPA 1TO2E 2HSWA 4NBSA 3B8EA 3L6RA 4RNCA 3UKOA 1N32B 1TAQA 3JZFA 3EXAA 2HV9A 1DIAA 2GUGA 4ZJZA 2ZITA 1ADCA 5FO0A 2P7HA 1XF9A 1Y1QA 4RJLA 3G0HA 1WSAA 1OBFO 3A2LA 3DDSA 3RCBA 2LWIA 3G9UA 3E58A 4QPDA 3D3WA 3CPSA 1QCZA 1K06A 1B2RA 1JQ3A 2JLSA 1M2VA 4WHMA 5CGZA 3S2SA 3UJBA 4IIHA 2NU9B 2BDUA 2HNAA 2VK8A 2FOIA 4OGGA 3FCAA 2V3CC 4PX5A 5LZ4A 1GL6A 1YAJA 3CEJA 1SKMA 3QFFA 1I4DD 2VUHB 3ESBA 4JHLA 4ISCA 1KIMA 3COWA 3S2ZA 3V4OA 2OA0A 4I08A 3PDCA 4WK6A 4TZ6A 1FU4A 1S5PA 1Z0ZA 2P7IA 4INZA 3UJ7A 3QKUA 4JOBA 1SN7A 1DLJA 1VYUA 5T4EA 2IUUA 2UZ0A 4U7JA 5BN1A 4LYHA 4OLAA 3M3HA 2VPIA 4NECA 1F8UA 2Q3EA 4CHTA 5FUBA 4WXPA 2IV7A 4BAZA 5A4KA 3U7GA 4PPYA 2J8ZA 1XUOA 4FKMA 2VYQA 4URYR 4TS1A 1VJ0A 4XWWA 2PJRA 3N74A 3L9XA 5KJCA 1BSVA 2ZJOA 1RMYA 1H2WA 2H85A 3NRJA 1Z5UA 4HXYA 2W70A 3TEJA 4CNBA 2IXAA 2WMNB 4FIDA 4DIMA 1SCDA 1PUJA 2NZXA 2QMYA 3NHLA 3G0IA 5D5HA 4NMLA 4I55F 3RUIA 3PQ3A 4ER7A 3REQA 4Q3DA 3RC9A 4F38A 1EP1B 3NIBA 2WUWE 2WZCA 4WOKA 5IK2A 1AN0A 1QB8A 1E1CB 1GGKA 5D3MB 1R6VA 4B83A 5B3LA 5B7QA 1W5SA 3LPNA 1E2BA 4Q4AB 1BE6A 1NV8A 3O75A 4Y2VA 4URZR 1IPEA 1LWOA 1H6CA 4G5XA 4ZWNA 1RXIA 5FDFA 4GH5A 3EPRA 2XB4A 2QR2A 1ZFNA 4RVNA 3AHDA 2FPIB 1E4VA 2ZS7A 2KX7A 3LLCA 4YCDA 5BW8A 3ZHCA 5D6NA 4V03A 1D2NA 3QWIA 2C61A 1M6HA 3IHLA 3TIVA 1C1HA 3ZE0B 3BN3A 2EW2A 4KAJA 1GL3A 2W2NA 4L28A 1LBHA 3INRA 2O2JA 3VM6A 2IDMA 4YIHA 2AZDA 5C1OA 3OCCA 1KR2A 1YMUA 1SUIA 3FUXA 4N0QA 4N3CA 2L82A 4ZEWA 2EX0A 3UYKA 5K2OA 1PZXA 2H9YA 3PE3A 1IXKA 1TECE 3DB2A 3RKRA 3BXXA 3PEVA 4DV2B 2O5EA 2QJRA 2V6GA 1QVVA 3MINA 4H3HB 4YRKA 1OT3A 2F43B 1PV1A 2J5BA 3EMKA 3KOMA 4UTOA 5AOVA 1MVNA 3JQDA 4DQKA 2RHTA 2H06A 4BFXA 1NNUA 4URWR 3IBCA 4P36A 4M2LA 3DXFA 3ZN2A 4FUTA 1T10A 5HA5A 2JK1A 3Q6IA 4EYOA 4ZDKA 4AURA 4RFLA 2SNIE 3ABQB 1G7TA 4MDEA 3K2EA 2JD0A 3MCZA 3E6AA 3Q87B 2QTLA 4IOLA 1YJXA 1FRQA 4M7PA 1MAAA 3VHRA 1UXJA 3G9XA 5GONB 3TSOA 1NOIA 2W2XA 1COWD 4HDNB 2QIPA 3UMFA 3NVDA 1TAHA 1IJBA 3PNKA 4D97A 3VA7A 2I7DA 1OI7A 1S89A 2BJVA 4EB3A 4ARCA 1YR9A 3QBDA 3O9MA 3ISTA 4D4GA 2BEWA 2XNJA 3IODA 1F17A 3DHVA 3NUQA 3L40A 3ND8A 2HK7A 3CUUA 4LQDA 3RRBA 2H1HA 2QQGA 3D0QA 1I33A 1TVCA 1YQGA 1NPDA 1XAIA 2X86A 1KE1A 1R6XA 4BVHA 4B44A 2BRUA 4GDFA 4IQGA 5ALXA 3UOAB 1MB0A 1OZFA 1KJIA 2WILA 3PD7A 1E98A 5JDCA 1O6CA 3TKLA 3E2MA 3T3HA 1VIAA 4FILA 3WLOA 4A8JA 1JG1A 3CKMA 1JHOA 1QDLB 3A1EA 3V32A 3EIUA 3GELA 1W36D 1VSUA 1XZFA 5K4GA 2EARA 2IE8A 3QEMB 2A1UB 3OIYA 4MUIA 5KUTA 3L0CA 1ODJA 1Q14A 2TECE 2X40A 2YCLA 3THWB 4BX8A 1JG2A 1FK8A 3WLPA 3WWYA 3U3RA 4JSTA 4ND6A 3H6HA 2ZYUX 3ROZA 2Y93A 4YGYA 5EMNA 3EEBA 4CKEB 4EYKA 1W4BA 3K0FB 2YR0A 1V4NA 2IEAA 2YX1A 3BJRA 4EUEA 4RLQA 2XJ4A 4II3A 2WUFA 4Q4HB 4W5NA 3CRNA 4I5EA 3E7XA 3TCKA 3DVLA 4JB0A 5DF1A 4HOYA 2YFHA 2XGGA 3B5EA 3H0CA 5CK4A 1P3Y1 4L73A 2PX6A 4J1TA 4BB0A 4FD2A 4YQFA 4IHQA 2P9TA 1HSOA 2OE2A 1VOTA 2E37A 3ENZA 1RPAA 4X6YA 3I62A 3M4NA 1CJTC 4EGJA 1KXZA 1OTXA 1PWEA 3D7LA 4N39A 4RMGA 3ZU5A 2FMUA 2XQKA 3KZKA 3QPDA 3QTTA 4JODA 2G71A 4U2EA 2QD2A 3G59A 4M4SA 3HVUA 3B3QA 4B2IA 5KEIA 2MYPA 2I80A 1U8AA 4JL8A 4OH1A 1LLQA 3GUUA 4UFOA 4ZP1A 4B6RA 5KC9A 2JCGA 1V96A 1LLFA 4C1BA 1N1MA 4YAGA 5A3JA 4ZI7F 2IOYA 5K3CA 4K9LA 1GGJA 1QB7A 2ZIAA 4BKRA 4HLNA 2UZ1B 4S1OA 2O54A 2QLBA 2AUNA 4PN3A 4I99A 1QK4A 2H7XA 3PF9A 4HH3C 2FWAA 1M2JA 4NYJR 2O2IA 2NU9A 3R8FA 2C2OA 2WBLC 4AN0A 5AW7A 1KAMA 1M66A 3VPHA 3K0KA 5DP2A 1V7ZA 2JCBA 3BBLA 1LS6A 3QWBA 4CIXA 3LOQA 4RSGA 1XRSB 3F90A 2AXEA 3HCAA 3VDQA 3JATB 2C7PA 2WJPA 4AX8A 1OZHA 1Z6PA 1VKOA 1EDBA 2LDXA 3IAAA 4LXXA 1GRVA 5A5DA 2CYCA 5EHZA 2OAQ1 1GQYA 3OLXA 2DWCA 4IW3B 1L5FA 1J6UA 3FSGA 4DJEC 1KZYC 3LH5A 5KYXA 2EEZA 3D0OA 2QT0A 1PQWA 3L4SO 2P77A 3C98A 4Y1EA 5E6RB 4BWGA 4BZPA 1PZHA 1SCUB 3E35A 4E15A 4RJKA 2Q4DA 3RIHA 4DLZA 5EJ5A 2WYIA 2Z2IA 3PICA 4Z3KA 3NTQA 1ILWA 4BVEA 5ITWA 4MHTA 1LDNA 2Q8QA 4HH4A 4PU0A 2Q7DA 2R7NA 4BWFB 1KSGA 5LA6A 5BMOA 2PCJA 4EUFA 4FHDA 1P19A 4AKSA 2VWPA 1Q83A 1LSOA 1A5TA 3M7IA 4IXWA 4C21A 4HQLA 4UFNA 1E1CA 1EP9A 4YRTA 5D3MA 5DYIA 4IVQA 1RWNA 5IYZF 4EPYA 3BERA 5KWIA 1SPBS 4LF5B 4Q4AA 2IYAA 3ZWNA 5EVJA 4WN3A 5IVDA 4FHEA 4YMWA 4A91A 5G4LA 5REQB 1JDSA 3TBKA 3E05A 4BFTA 3CN9A 1OU0A 3TTYA 2FPIA 2C77A 4ISBA 1GCIA 3FVQA 5MN6A 1TL7C 3BRCA 1ZVQA 3SHQA 3K2IA 1YQDA 1AOXA 4FN5A 5L53A 1N2HA 1L4BA 1T3HA 3E9EA 2RGRA 5LBIA 2IYSA 1JQBA 2Z8YM 3PJRA 3WY9A 3RTGA 2JH9A 1R0RE 2VHJA 1T15A 1LK0A 4FFPA 3SFTA 3QUCA 2HPZA 2V5AA 2WFAA 3SPXA 5EIBC 1XYVA 4G5RA 3U9LA 2F43A 2BY4A 2HREA 4R2XA 4TXJA 1MNQA 1HRDA 1P1BA 1K7XB 5C5IA 3ZZ1A 3V46A 5BWNA 2IZOA 4FFVA 4NONA 1D2RA 4BFSA 4ZOLB 3H6GA 2XYPA 4J4TA 1QH1B 3EVZA 1CYDA 1FSZA 2O7QA 2CXPA 4DCSA 4ME6A 3F97A 5HFJA 4NOJA 3R3HA 5GONA 1GG2A 2QLFA 2F48A 2XYVA 4HDNA 3I3SR 1HMPA 4V0LA 5B1DA 2WA1A 3T9FA 2OB1A 3EGWA 1O0SA 3F4LA 1SVOA 3BHMA 4BVJA 1I9GA 2R97A 4DL9A 2MYUA 5F3DA 1I8TA 5AHOA 2WUVA 2VPQA 4G0YA 2LVBA 3VPCA 1N9KA 3NCHA 2A9QA 1YBMA 4HX2A 5DNWA 2OCYC 2CNLA 1OXVA 2X9GA 3DXXA 4MYCA 2QG6A 2GUWA 1CIVA 3FNGA 4QYSA 5I7UA 2GBPA 1XWFA 2FE4A 2Y1LA 3N7TA 3DWEX 3HDTA 5EE5B 1IQRA 2A0UA 5FP0A 3ERCA 1KE2A 4L4YA 4MUMA 5ED4A 5U4XA 4Q7EA 1DAHA 5ERXA 5KMGB 3AI3A 2H9AA 2V0CA 3QEMA 4Q47A 2A1UA 3T3NA 3AHJA 4JI1B 3OZUA 4ZGGA 1AXGA 1N2GA 2H1RA 7REQB 3ZDBA 3LQFA 4MB6A 3THWA 4DAOA 3RVNA 1U4OA 3MMSA 2JAOA 2ROQA 3BWMA 1AH2A 1MVLA 2OOKA 3GZTB 2GCGA 3KL4A 5AM0A 2LW7A 3ZWQA 4CKEA 1OLSB 1OXUA 2FETA 3K0FA 1RZ3A 3L5OA 3N87A 1I2DA 4Q3LA 4PIVA 4Q1VA 2JGLA 4YJ2B 5FOSA 4G84A 3GEMA 4Q4HA 4AN4A 1C4XA 3WTCA 1X2EA 4C0HA 2NXCA 4O4IF 4R2KA 4RC9A 3RC3A 4AJ9A 3N0VA 5JEDA 2BBSA 2WF5A 4HVTA 4NMHA 1MCZA 1H0HA 1GKIA 4MP8A 3LFHA 5TVGA 4LJ6A 3PKIA 2VEOA 2RHBA 2PQMA 4BB5A 1FTYA 2XNSA 4ZCQA 2UZIR 5BW4A 1PS9A 4FQ7A 3GP5A 1GD1O 2J46A 2J9ZB 3JRNA 1SCQA 3HU3A 2ZIZA 3S5UA 5HOQA 2JKVA 2O48X 2R87A 1L6RA 3RS7A 3O94A 2YV2A 3ZJUA 3UJ3X 4RIHA 4D80A 4LMPA 2GPJA 4EVRA 4WZZA 2OGWA 2QL5A 3EUFA 3PLNA 1K5GA 1X87A 4RTKA 4LF8B 2A14A 2XZTA 4YAUA 2CNWD 3EIEA 2PTGA 1N5KA 1EFKA 2DF8A 2DUJA 2QL7A 2W6NA 2H0AA 3B82A 4QHSA 3OEWA 3L1VA 3RSSA 4LDQA 4E13A 2DHQA 5DSZA 4DQLA 3LJKA 4BFVA 4PHCA 4UMEA 4BIIA 1PR1A 4PHHA 4UNQA 3TXAA 2C57A 4BLUA 3JATA 2XA9A 4CM9D 2HA3A 2XZLA 3R75A 2Y6VA 1T9KA 2YJ4A 2YZNA 3GVIA 3QXGA 1K68A 1RJEA 4IS2A 4NG5A 2JEOA 4EEXA 4P80A 1E3SA 2SKEA 3MM4A 1PJTA 2F4NA 1YRYE 3L6UA 4QOIA 2ZYHA 3LUFA 3ASVA 4JJ6A 2HTEA 2WHQA 2XQFA 3GFOA 5E6RA 1Y6GA 1SCUA 3GEPA 3QLEA 1NWCA 1EHIA 1PK8A 2V8OA 3QELB 1D6NA 1UP7A 2NX2A 4KIFA 5F1OA 1HFWA 4M3NA 4NJEB 2Q9CA 1VL8A 2PX3A 2C42A 3DYIA 1EK0A 1KS2A 1SU8A 3NRBA 1GYPA 3D59A 4OTZA 5DNDA 2B8WA 1PG0A 1RAEA 3ZU2A 2E6UX 3B1KA 5FPQA 5HEKA 1IBCA 2VDLB 4XVQA 2Y0CA 1YSCA 3D7KA 5FAKA 1U7WA 2VF8A 2OAP1 2AG8A 2J9XB 1P4AA 4K9MA 1R0YA 1A27A 1E1DA 5FULA 4ZC1A 4FGSA 4W8OA 4YMHA 1W6RA 3E2PA 4YO8A 5REQA 1VPLA 3GA5A 4D92A 3AP2A 3F0TA 4RYLA 2JIZA 3JQBA 3RVSA 5FR2A 1GFIA 4WKBA 2QDXA 3E53A 4ZQFA 4ZAFA 3BSFA 1LZLA 1W35A 4JDUA 1DX4A 1OWLA 4FNOA 1ZUHA 3QG5A 3OU2A 3PXDA 1NM5C 4LSZA 4WT7A 3ZY3A 1UBMS 1UPFA 2C4HA 2E0IA 1N1DA 3M1AA 1MB4A 2P8SA 1GLNA 1QU3A 2BT4A 1TJYA 2RJOA 4ZOBA 5ERYA 2RGCA 2R2AA 4LJ4A 4ENUA 4EKEA 1GDHA 4MKRA 2I22A 3NOVA 2A1TR 3LM8A 4GZMA 4UARA 3P9SA 5CCBA 3WYNA 1M1XB 2X2EA 3FPKA 4IY1A 3SR0A 5TQJA 2NYVA 2VJAA 4FE7A 4BP1A 3OFVA 2PMKA 1JTEA 1PVDA 3R0IA 5THQA 4PWYA 3VVLA 5L95A 2GAFA 3C4JA 1MHTA 2SBTA 2C7QA 1NONA 3L4KA 2YNMC 4AN1A 1SKAA 4ZOLA 3P9XA 1NQUA 3PGLA 4RPLA 1QH1A 4R1MA 5BQFA 4LRSB 3URMA 2AOTB 3NBYC 1P0MA 3FTEA 3NU1A 4PAWA 1T91A 5C1IA 5CYPA 1MZVA 4G0OA 4TYNA 4GC5A 4PPFA 2P11A 1LW7A 1WA5A 2J5XA 2ORED 3B2NA 3RJ9A 1ZK3A 1A8IA 1ZA2A 2JFPA 2Y1DA 3KUCA 1FP6A 4PZUA 5H02A 1P6XA 5IZCA 2QTNA 5GADl 2X0KA 2WIAA 3QP9A 1S8NA 2QN3A 1J8MF 3A9SA 1B26A 4U0KA 4UEOA 4AKTA 3PGJA 3UV6A 2VSXA 5CR9A 1NR7A 1AZWA 3C6QA 3QF7A 1HM5A 4ZU3A 4ARSA 1DWPA 4LPKA 4PF1A 1DJOA 1KDTA 1PGJA 2LKDA 1YKFA 2VXOA 5KMGA 2F8SA 1TTTA 1DBVO 3A1CA 3EWSA 2C2MA 3D64A 4ZT3A 5I4CA 3TIFA 7REQA 1T2AA 3A2KA 4QATA 3TR6A 1FXWF 2BFOA 1D2AA 2IITA 3A3NA 2FB9A 3K20A 3OBBA 5EPEA 3S99A 3VFDA 1EFCA 2ZI3A 1R8JA 1YHNA 3L8FA 2NQ2C 2JI9A 2XMRA 3DAPA 4IXDA 1F8XA 1MJ5A 3K6KA 5KVQA 1P8AA 2KYRA 1NP7A 1OLSA 3AF5A 4N7JA 4PYNA 4QDJA 3M5WA 4ZREA 3RU2A 3SEQA 4OU4A 1SQ6A 5AVZA 4YJ2A 2O8BB 3AJRA 1YZFA 2YASA 3SGLA 1KZHA 3KSDO 5TIIA 4GQAA 3AHGA 3A9RA 4S1TA 3VUEA 1B0PA 2I1QA 1NVTA 2DJ5A 4D56A 3BK2A 1I3KA 3CUVA 4IVPA 2WWRA 3KFLA 1KJYA 1N0VC 4QRHA 4QVIA 3ZYCA 3P2YA 4EO4A 3J80A 1J24A 1TCCA 1XTTA 2A30A 2XKJE 3V1TC 4ZYZA 3DTYA 3DV9A 3PHJA 3WYCA 1CEQA 4P3NA 1T3ZA 3CLHA 4JJEA 3HYSA 1JHXA 4GG1A 3IV9A 1KH3A 1UODA 2IIBA 4IIUA 4C5BA 3BGVA 4G9GA 4DPLA 1X74A 4ZD6A 5I47A 1RWQA 3U4QB 1Q0TA 3O74A 2ZR7A 3GLHE 2WWTA 3M81A 4NZOA 2OYCA 5A6VA 5KYVA 5CFRA 4QJ4A 3W7VA 4KSCA 4XVHA 4BX9A 3BJIC 1ZH6A 1VHWA 3SXJA 3I9V1 1DJLA 2VBFA 4GICA 5C8YB 1XCBA 4LDNA 2PKXA 2QXYA 3CLUD 3OFND 5JE8A 4J2HA 1NMEA 5KAPA 1Z18A 1T5OA 3DFZA 2X8LA 1G8HA 3M5PA 4MHOA 2ONCA 3B9BA 2G9ZA 1UR5A 4TXLA 2WUGA 1B1CA 1GKLA 4HXEB 3FBWA 1E6MA 1T2VA 2JFZA 1TM1E 3VVBA 1VLJA 5DGTA 3ECAA 2AJBA 1DB3A 1BFDA 3CXRA 3GH3A 3CBQA 3FHJA 4JJFA 4IO1A 1SXJE 3A2NA 3I0MA 5BNZA 2C95A 3QMMA 4UVDA 1FPMA 2L0XA 4X1KB 1K7SN 2Z57A 4XD2A 1ZC3A 2CV2A 1UXHA 5IXYA 3DEAA 1ZK0A 2WNIA 4QUAA 3QELA 5AICA 2PS9A 1ESEA 4R0VA 3ZIDA 1OY1A 4NJEA 3EMBA 3LNCA 4HG2A 4WE3A 4MPJA 5AKGA 2P5SA 4Q03A 5I7RA 5FI0B 3O3OB 3LKZA 5KSYA 3VJRA 3LWBA 2Q0SA 1U2RA 3NTVA 4QU0A 1ESMA 4YO7A 3Q9NA 5AUNB 1JZSA 2ZIUB 1N9ZA 4EECA 1JDBC 4MIEA 5K2MA 3K9GA 3GN2A 3W2HA 3BE5A 4QO8A 4OHRA 1KJJA 1P1CA 4KWEA 5GQSA 4J0QA 5IMSA 2DTXA 1SKQA 3S40A 3TLCA 2OBFA 3QUQA 4X3CA 3FLAA 1II0A 2HWUA 3DAOA 4RGBA 2NUAB 2YTZA 3AK4A 2PJDA 1O89A 2B7CA 2COKA 3DJYA 3KD3A 4ITUA 2BFDB 4ZRDA 5FPHA 4QD3A 1ZD8A 1T5LA 3DONA 4BL5A 1GOTA 1NF8A 4MMYB 4ESOA 1UK8A 2VS1A 4XIYA 4WDRA 1ESNA 2HPHA 2X2FA 2I9PA 4D5GA 1RPZA 4RKYA 1L0BA 3AONB 3RTDA 5IHPA 4ZI2A 3BZWA 3DBIA 3ADPA 3AKCA 3JVEA 5CCDA 2W2VA 1SUBA 2G5PA 3P9ZA 3NANA 1MH1A 4KACA 3QV1A 4ND1A 3W4JA 2DBYA 1IVSA 4BRSA 1A5ZA 1FS5A 2Z2YA 3LC1O 4UUPA 4X1OA 1E6UA 1XBTA 3NT4A 5EZQA 1T34A 1Z33A 2ZAGA 4X84A 3I01A 4YB8A 4BV2A 3MB8A 5KDLA 2YIDA 1TD9A 5DLPA 3MGGA 3GEGA 2VK2A 4O0LA 4AJEA 4CMKA 4V0SA 1G8PA 2ZJ7A 1YJ5A 2JKZA 3EA5A 2UZ4A 5IJ9B 3A9VA 1MRZA 4J0FA 4AJHA 4P0PB 5B4VA 1BX0A 5GV8A 1EXDA 5LD2C 2AOTA 1CDEA 3LGAA 4RCZA 2IHZA 1EVQA 1GPJA 3DOJA 4ILEA 4K1XA 1UPUA 4QQRA 5J5VA 3V2IA 4RDXA 3OEYA 2H1FA 3V80A 3VU1A 4GD3Q 1BQEA 4EJFA 1WZUA 4J0CA 4PFQA 1M5TA 3H2KA 3FSJX 4W82A 2H07A 3HSSA 4B43A 2OO5A 3WP0A 1FFEA 5ITZB 4MZDA 3RTCA 1WMSA 4IVNA 1B8VA 1T1JA 2IUTA 4W6QA 4ZVRA 4C01A 3WGZA 4LX0A 5IK2D 3T7IA 1WDKA 4ZYVA 2AXQA 3FHTA 3IP5A 4ZV9A 2JI6A 1D0VA 1NC3A 2WM9B 1U3VA 3FTDA 4UZFA 1MZPA 1J0CA 3OO1A 3HEAA 4ZCPA 1Q12A 3N2IA 2B4YA 2C2XA 4HAUA 2ZE8A 5A4FS 5JJIA 1DPFA 2ATVA 2H00A 3OU6A 1KOLA 1OTYA 3DTVB 3PFBA 4YV0A 1X92A 3M6FA 3AOGA 4YRJA 4YRBA 5DBHX 2WD7B 4V0QA 2GPSA 4K9NA 3T1TA 4DJ5X 2H65A 3Q41A 5I8WA 5C52B 4BGIA 2HQOA 2ICAA 1UKYA 4KLCA 4ZI5A 1LNSA 3RSQA 3HO1A 621PA 1G21E 2O8BA 5A4DA 2BFMA 3LUKA 4KFTA 5EJ8A 1V4BA 1SBIA 7AT1A 3RYHB 3FJ1A 5CH8A 3SM3A 4MI3A 3ZWCA 2ZWMA 2CFIA 5FR1A 4ZKEA 4OKNA 3SQWA 1MTOA 2MU1A 3PRJA 3O1HB 1NDUA 1VJGA 3NBKA 4L5BA 1FVXA 1F2TB 4PLFA 1TA0A 2JGIA 3MFYA 4JZYA 4J0DA 2E55A 2FN4A 3VOAA 1KVUA 2P6RA 1O6BA 1EYZA 3EFHA 4LPSA 1S3FA 1FFDA 1DV2A 1T5DX 5TMEA 5L6MB 4JUBA 3U4QA 1DKMA 1I10A 1SIOA 4ENPA 1CUYA 1FLAA 2D1YA 4KXMA 1L5NA 4X94A 4AJNA 3N2LA 4N54A 1J56A 1ZH2A 2NZ8A 3O26A 4LTNA 4ZT4A 3GUZA 3MWJA 3DEFA 3DVRX 3VI3B 1KAQA 1D03A 5C8YA 1TKAA 4KRFA 4RENA 4CFYA 3IDOA 5F2NA 3ZD6A 3KJNA 4YCNA 1WZNA 4KODA 4NYIR 821PA 5CDHA 3X3HA 4IGEA 1BX3A 1FB5A 1R18A 4QLBA 1CYEA 1E3DA 2BGLA 1DG3A 1H05A 1JSRA 4ETNA 4CEIB 4LJSA 3WJ2A 2JJQA 2QU8A 3KOYA 3CS3A 5CNKA 1AK9A 4N5MA 3V7WA 4TXMA 3Q10A 4X0EA 3RT7A 5CG2A 2ZUEA 4K9KA 3IP6A 3ZYZA 1VJTA 2HNKA 5ALFA 2FF7A 1T2DA 2O6LA 4QPCA 2I4IA 3NR2A 3GDGA 3GDWA 4MA4A 1ICEA 1ORIA 4RMHA 2W6IA 3SSOA 1N92A 2R4UA 4X1KA 2A5DA 1I2ZA 2DUMA 2R2GA 5GVRA 2WU0A 3MOGA 2NU6B 3UZUA 1AQUA 5I8ZA 3KJHA 5AKIA 4E5KA 1DAOA 3ZH2A 5LQNA 3V1LA 5JC1A 4JY7A 4J07A 4Q3NA 4PEVA 2GRAA 4LSWA 1KDRA 5ABPA 1I7QB 4DV7B 2O2GA 2FUNB 1E89A 2ZS9A 3CEHA 1QU2A 1P7ZA 1FIUA 1RYHA 2F6RA 2FUG1 1SVKA 3NM6B 1KETA 3OEHA 4FCTA 1IK6A 3EWIA 3LUCA 3EC1A 5K8VA 4TLEA 5EZYB 3E2IA 1WWKA 4B7UA 4EPXA 3H4TA 1URPA 2JAPA 1UFQA 1PFYA 1Q1ZA 3NBZC 4MQFB 1T6NA 2GI4A 4P22A 3EXIB 3G8AA 1DCTA 4MUKA 5A9RA 3JYOA 1ANKA 2HUPA 2VF4X 5ELXA 3R74A 3PUZA 2NUAA 3BHIA 4TRRA 2R6CA 1G59A 1DVRA 1U2GA 2BI7A 3FJYA 1DTEA 2ZOSA 4MI1A 4CMAA 1WSBA 4F04A 2BFDA 1U7HA 5F9MA 4Z7QB 1DWQA 2GCPA 3KVNA 5EHGA 2ZAOA 3SQNA 1PR9A 1AE1A 2XGMA 2OENG 3SD7A 1SIUA 3I9V6 3E9RA 4ML3A 3IS3A 4H16A 2HW8A 2BV3A 3QVGB 1QIDA 4LN1A 3HPRA 3BQNB 3UXYA 2PX0A 3NC1C 5AVQA 4OX9Y 3C1OA 4CGZA 2Y1XA 2QY9A 3DOEA 3LQ1A 3R77A 4OB7A 3B8HA 2Y2UA 1ZJWA 2GTHA 3EUAA 1DG9A 5LYJB 2E7ZA 4ZQGA 2V4UA 1KDYA 1DWOA 1VKNA 1Q7RA 2VH1A 3DOFA 3PK0A 1IHDA 3IUSA 4K05A 2PXCA 3TQCA 4BZXA 4KR3A 1QK3A 1YB1A 3BQMB 5I4KA 1XCJA 1OC2A 2BKEA 2QB5A 2EHDA 2D2IA 2XQGA 2ZIFA 3GFFA 4CTNA 2C29D 2H54A 2NW6A 4JB8A 3AO0B 3FSGD 3PXCX 2Q7OE 3COJA 2RHOA 1U3DA 3KKMA 1VLHA 3JD0A 2A6PA 4KG7A 5DE3A 3ZZMA 5L4NA 1XDUA 2PBFA 1UBFA 5C1DA 1CUDA 1NVMB 1D8TA 1A98A 1YRLA 2VYCA 2O1WA 2QJFA 4Q4DA 4RF4A 2MMGA 3TG8A 4JVNA 2GF0A 1TTQB 5CT4A 5IEJA 3W5DA 4NU6A 1T9DA 1XRPA 4BO1A 3KJGA 4TXNA 5ITZA 4B3CA 1PG5A 4PLZA 3SM9A 2V96A 2NV2B 3RF7A 1Y3IA 2X77A 4EL0A 5IAKA 3KOZA 1QFSA 1U2DC 3KOUA 1L7BA 2N47A 2R4QA 4OBEA 3RHTA 2AMFA 1YFLA 2ACWA 2WAMA 2Q3BA 1NYQA 1RQ2A 1P1FA 4HDQB 4TUYB 2UYHA 2V6JA 1JHAA 1KGSA 3GBPA 2O8VA 3QVTA 4YRLA 1SUWA 4D8UA 3RJMA 4RSRA 1IOWA 5KAMA 2J45A 5CXUA 2HF7A 4KE8A 4IEFB 4C2AA 8LDHA 4N5NA 2Q3HA 2BFBB 1BYIA 3DTVA 4LUCA 2DM6A 2V7PA 2EYQA 2IVZA 3V9AA 3ZIUA 5DNCA 4DR3B 1OI3A 4FEYA 2WD7A 2ZETA 2VHUA 3THYB 1LVGA 1QIMA 4HQNA 4YAWA 3SHVA 1ZUIA 3QJ5A 1UZMA 3S81A 2Z6UA 4FYPA 2MSCB 1D3AA 1ODKA 1N2IA 3ITNA 3PQCA 2DWPA 2KQUA 4KQHA 1CF9A 2V03A 3I64A 4OO3A 3WRYA 1IY8A 5JFOA 4QDTA 2YL2A 4MGKR 1IHPA 4S05A 4CEJB 1ZINA 1LFDB 2POQX 3RYHA 1T25A 2FSPA 1VKHA 1V8OA 4U5QA 2IW1A 3VDNB 5JATA 1G7RA 1NSFA 3H65A 1GCOA 1V3QE 2RG1A 3FTNA 1Q7EA 1Z5ZA 1RQ7A 2IXTA 3EGCA 3AZQA 2UUPA 4RK7A 2QD5A 1P0CA 1ZZEA 1F2TA 3BFJA 3WYEA 4AQDA 1YVEI 3SLKA 4CN9A 1CHNA 1SZJG 4WOBA 1Z62A 2QE7A 2QT1A 3PL5A 1PNVA 4G0WA 3KK0A 1TZKA 4LC1A 5AK4A 3BWEA 4P54A 2UUBB 5CX1B 1W93A 4D6YA 3EVEA 4HTFB 1CUVA 2FPSA 3LP5A 3GYBA 5I7AA 5J4YA 4NABA 5EQFA 3KAKA 1Z37A 2D1FA 4JXKA 4I4TB 3ECCA 4PAQA 1DIBA 2J0EA 1V5FA 4YPOA 4ZCTA 2FA9A 1JPUA 2V4ZA 3WGQA 4FW9A 4CEIA 3SXPA 4L9RA 3U2QA 3SU8A 2ABWA 1U1EA 3WA6A 2FN8A 3C3BA 4KZPA 4V1CB 2QM0A 2ZSEA 4AZSA 1NW7A 1P2DA 3UKJA 4NYMQ 1DFIA 1EJ6A 1YASA 5LOVB 2WJ4A 1LLDA 2HI0A 1C0IA 2YXLA 3DQZA 4WY8A 4M60A 1Y4SA 3LP8A 3MWFA 5EIHA 1L8AA 1ND6A 1YUMA 2NU6A 3KQTA 2HN9A 2YC2C 3WJ7A 4N5HX 1D2HA 1NLUA 1GYQA 3CWZA 3O03A 4INJA 1DDGA 2GPAA 4OI1A 3RPEA 1SBYA 4W5OA 1D1TA 5JQGF 1E6KA 1G6OA 1SVWA 1ZOSA 3LYUA 4NV1A 4DCNA 2WWYA 3QLUC 1GKYA 3K09C 4OK3A 1EUQA 4J76A 4YMVA 1KEVA 4UC0A 2VCHA 2WAAA 1UBUS 4H1HA 4JR1A 3A58B 3QFSA 1PJCA 2OBYA 4KUGA 3VSAA 4DR5B 4R81A 5EWJB 5KIAA 1RVDA 4N41A 5JCZA 5EZYA 5HW0A 3G2LA 2WUEA 2ZRFA 1H2AS 4CW7A 3K8ZA 2VSOA 3E27A 4MQFA 3IAEA 1X1RA 4KJXA 4PG4A 1N7JA 1PFVA 3EXIA 4FWBA 4QFDA 4V38A 4ZDWA 5KSPA 1B16A 3RNLA 3PKJA 5JS2A 5A7FA 5L51A 2BELA 3G23A 2IOQA 4INOA 4B0PA 3STWA 4KQMA 3T38A 4GKJB 3IC5A 2FMIA 2GSWA 1SU4A 4EGFA 5B1YA 3BTVA 3O2NA 1A9RA 1XRMA 1RWWA 5DBIA 2XCRB 5L7YA 1WXWA 3TG2A 1FJ2A 4PRYA 3E0QA 1MJGM 3EW9A 5E8RA 4TZTA 2I3BA 2WDPA 3GRPA 1X9GA 4PZZA 3VH2A 3ZDZB 4D46A 1FVHA 3HLKA 3FPLA 4MUXA 5YASA 4RBNA 2HA5A 2VJLA 1J0XO 5BQ3A 4R83A 3BSSA 4PX2A 2ZW9A 4FM9A 1TM7E 2OBLA 3QVGA 4RO0A 4GP6A 1Z0DA 2WOJA 4F9TA 3SN6A 2ZUFA 4M89A 2N9UA 3S68A 3W90A 3W2EA 2PS3A 5ALOA 2ZDHA 3W79A 4AJ2A 5LYJA 1E2IA 1H2XA 5ARBA 2C97A 4REMA 3U81A 3ZCVA 4XIIA 1XP5A 4TL8A 3SIXA 5AW2A 1L7VC 1RM4A 2V7UA 2IYTA 2FZVA 2C3UA 1O54A 1FXUA 2NO1A 3BWDD 3LIPA 3OA2A 5DSTA 5F7JA 4AMBA 2WMOB 2ACVA 3M6MD 4LTDA 2VRBA 3AR9A 2O1SA 3F5DA 4PE5B 2Z1DA 2CK3A 2P78A 3QHQA 5IBQA 4MVJH 5FEMA 1IVNA 1HO3A 3V34A 4AB1A 2ODEA 1X42A 2VIIA 2AQ8A 3F9CA 2JGEA 1GV1A 3LPCA 4HDMB 3RIXA 3RSCA 2QYHA 2GKOA 2JIDA 2G5GX 1DQYA 2GESA 2WJYA 3ESXA 4RHXA 2IBSA 1SULA 3DLBA 3HCWA 5CPBA 2F7SA 3EIQA 3CT4A 3NUZA 3WNQA 4EH1A 2FUG6 4YS6A 1ES9A 1AKTA 3PHHA 4AS3A 3VKWA 2BJWA 1ENYA 1TU3A 2LUOA 1J06A 2AFHE 3Q6MA 3KCNA 4RZHA 4XB6B 5FPKA 3OE7A 2R60A 1MOPA 2PQ0A 3K05A 3TL3A 1W0CA 4JLOA 1GZ3A 4QLOA 5BR7A 4DG8A 1VDMA 1OYVA 4TUYA 3UAXA 1WIWA 1TLLA 1BWQA 5JD6A 4HEJA 4JBWA 3HY3A 3H1BA 2RHHA 3O0DA 1WHSB 4Q7QA 1FYEA 2CUNA 3NYIA 2H2DA 2JIZD 4ZYXA 2IS6A 1PT8A 3OCVA 2BFBA 4IIBA 5AKEA 5EE9A 4DR1B 2HJ9A 1ZJ5A 5I6DA 3RE1A 1ZGBA 4ON9A 4U7FA 5DASA 3HXTA 3OC0A 5IBPA 5SICE 3H7AA 3WNZA 4EYGA 4BFWA 1UT6A 1ZKDA 3SJAA 2IBMA 2Q5CA 1QYDA 3AWDA 3TW0A 1RDFA 1ZESA 1GY8A 3D3KA 2XB9A 4BNVA 4EW6A 1MQ9A 3L6OO 3OA0A 3NFYA 3NUGA 3IQHX 5I9SA 4C7OB 5AOCA 2Z9CA 4CEJA 3ESQA 4BTVA 3QLVC 3HCBA 4WZBB 2PUEA 1F2DA 2FWMX 2GCOB 2PJZA 2ERXA 4JKOA 4RD4A 2VSNA 5GV7A 5K3FB 4QJ3A 1U0BB 3M3PA 1XZJA 1E6LA 1VE5A 3FWZA 3HN6A 3L6CA 4EPTA 1GKUB 4H3SA 1W76A 4DC1A 3RBXA 2P3QA 1Y0BA 3UKDA 4EZEA 1QRSA 1XFAA 1DQSA 3QOWA 2XGSA 1P2GA 1W5BA 3BIXA 4M0KA 3OJOA 3RSZA 4MKIA 3FOWA 5EHXA 2I1LA 5F7OA 4Z9YA 3U44B 2V7TA 4MYTA 1T5IA 4MUNA 1T8YA 1ACJA 4FN4A 3KLOA 4JKYA 4R0NA 3ICCA 3PG5A 2FPXA 1A72A 4JHXA 4U02A 5CX1A 2CVFA 4OM8A 4HTFA 2ZDQA 2WU4A 1W44A 4EOGA 3KXPA 3NEJA 3RVQA 3A6GA 1NN1A 3AIOA 3PYLA 4LDZA 3SF8B 3K2QA 1M7GA 3GIDA 3LPLA 2JDIA 3P9PA 2XXJA 4I4TA 4G63A 5IASA 3RYIB 2IS4A 3WB9A 1ETHA 1JLMA 4RYDA 4MR8B 4E0BA 3TMYA 5CM8B 1PT7A 3QHAA 1H0KA 3OJEA 4G6ZA 2KMLA 3PKZA 4CLEA 2RJNA 3CR3C 1NYLA 3AKEA 4V1CA 1A2BA 3L93A 3PUVA 5LOVA 1U2EA 3BJMA 2W90A 3KS9A 2YV5A 3WO0A 4X97A 2ZXEA 4IGKA 4WVFA 3DZCA 1WCYA 3LVFO 1DKPA 1HE2A 3U7HB 4J0HA 4L9AA 1XN4A 2QN8A 2PGDA 2M98A 2Q46A 2ZYTX 1OLUB 1XVUA 2F59A 2FR1A 4RMJA 1D04A 2BM9A 3C8DA 5EHQA 3WQHA 4KRGA 3OMLA 5IEBA 3KQLA 3HCCA 5HBRA 4JJ8A 5IVKA 1KRWA 2RARA 3VTFA 1UKCA 2HMWA 3EQ8A 1UM9B 2ZUWA 3U3DA 4AO6A 3CCFA 1XMXA 1W5AA 5AKYA 1BN7A 5DMXA 5ALNA 9LDTA 5EWJA 1Z4OA 5E1BA 3X2SA 5IT5A 4LRWA 2ZROA 1T2NA 3PSHA 1C14A 4U7TB 4AF6A 2QHXA 9GPBA 5KTKA 3ADDA 1DE0A 3L4BC 4C3ZA 2E5WA 4B3RB 2ZTLA 4HDOB 3OIVA 3R0XA 2H1WA 4EITA 1QR6A 3R9IA 3U13A 5CJJA 4NS4A 3QVSA 4IIEA 1WTAA 1Y9JA 2YOFA 5CHYA 1PFUA 1O8CA 5KU1A 3L8EA 1PJZA 4PV7A 2YQZA 4OL0A 1GT6A 2GHQA 4TQAA 3V4SA 1ZOOA 2OXFA 1P4JA 2XKAA 3IV7A 4DLKA 5BORA 2PGAA 2CL7X 5J3JA 1U2QA 1UBHS 1Q1GA 2XUDA 1PS0A 3M83A 3ZCXA 4B3DA 5A3SA 2YJTD 4BUCA 4PPGA 3ZHTA 4E5MA 3OF2A 4D74A 4YRNA 3T8YA 2AJDA 1YVUA 2AZTA 2ZG6A 1GPBA 3LBFA 2LZ0A 2CD9A 4AUNA 2MYNA 3QXXA 5ALYA 4N65A 3T5BA 3OM0A 1XAHA 5KYYA 2WP8J 1PEYA 1EMDA 3TOCA 5JAOA 2XT0A 3MT8A 5GTDA 4FBMA 4D5EA 1UJ6A 5CXXA 2GQ0A 1MJNA 3HJUA 3JVDA 3TINA 1ICIA 1UEIA 3MIZA 2BBTA 3TO5A 4AT1A 4CG2A 5LXTB 2O8FB 1D7AA 5K0GA 3G85A 2DHDA 1J23A 4HDMA 1A9ZA 1T8TA 3IILA 1EM8B 2VEDA 1V3VA 4UHJA 5TGTA 1XFDA 3PNLA 2LRHA 3R7DA 4WK0B 2PGJA 3DDUA 4FDLA 4UJ5A 2XT9A 3P0IA 4XD7A 4DEXA 3N6XA 2EZ8A 1D1QA 1G0OA 3K9BA 2QRUA 1MPTA 1HT0A 4HBGA 4EMUA 2FPPB 1QYWA 1X1EA 2QTCA 1XL1A 3O4IA 5AKLA 4BO9A 4C0BA 2CXHA 4XVCA 4E1VA 2V7GA 4YAEA 5K0CA 1WP4A 3C1AA 5A06A 1NNSA 3D7NA 4BO0A 3GNQA 2QP4A 4KQ1A 3RU3A 1WHSA 3VPXA 4PCLA 4OQEA 3ZD7A 3DZFA 3NAZA 4MEJA 4FHZA 1ZONA 1LBIA 4JOSA 4BRUA 3YASA 1Z88A 2Q0QA 3AQ4A 1J39A 1RT9A 4QULA 1R4MB 1RQRA 2EKZA 3B5IA 4HDCA 1I3MA 5INTA 4BJHB 2H1IA 5HNKA 3WL6A 2QR3A 1A2OA 5JAQA 5I7VA 2O57A 4CTOA 1MORA 2FU5C 1N6RA 5L7TA 4MR9B 3KE9A 1KWGA 1VJ1A 2TMDA 4C7OA 3GQVA 2ZUDA 2OC4A 1E66A 4WZBA 2RI0A 2GCOA 5JS1A 5K3FA 4OQDA 2HA4A 1GT91 1P7VA 3TSZA 4B31A 4BYMA 5K3OA 2E89A 1OD6A 3Q2OA 4UEJA 1SC9A 1LD3A 2LR0A 3ID6C 4K3UA 4TYPA 1RC1A 2XJ9A 3VZRA 1FFYA 4AUKA 1KMHB 1GLGA 1YQTA 1G20B 3L7DA 3ELWA 1IB6A 1J7JA 3UMJA 1I6MA 3U44A 3QX9A 4V1CI 3ZVMA 1I7NA 3TVYA 2GJSA 2XMZA 4GX5A 1MC1A 4ER3A 5JWRA 1FQOA 2FWJA 3RC2A 3U4GA 1X2BA 4M7OA 4Y6GB 3B1YA 1SCIA 1JPVA 2YWEA 2QF7A 4NENB 4Q24A 3KR9A 1TJPB 5CB8A 4TOIA 1JYFA 5EESA 3GRCA 5TSDA 3SF8A 4V2IA 4HRYA 2YVKA 4JLAA 5FJJA 3MK31 2C07A 4WD3A 1QHHB 1U7OA 1V2HE 3RYIA 2PUJA 3X43A 3FNFA 3OQ6A 2V8BA 1H42A 1OBHA 1UMKA 2DFVA 3A31A 4LCEA 1TAGA 3AFOA 4MR8A 4DG9A 1XA0A 10MHA 4B85A 4V3BA 3UJ8A 1AY0A 3PI6A 3ZWKA 1NQAO 1DAGA 1D6JA 4WECA 3GLIE 4OJQA 5EE0A 5IJXA 1JFFB 1I1HA 3O8OB 5HZHA 3NETA 4QDUA 4Z4FA 3M9WA 2VKQA 4GQBA 4EHLA 1XU7A 3WRVA 3GNTA 4ZYTA 1MOSA 2VDWB 1GPNA 1BEZA 2FGKA 4X95A 2BHRA 3A3YA 3MJRA 4OGKA 2ZUVA 1P9RA 2Z2KA 3GJ7A 5B1SA 4AF7A 5CFZA 2M6SA 1DAFA 1L5YA 1OLUA 1R66A 1G6KA 1T9ZA 3UUFA 3C4QA 2JAQA 3IUBA 4E21A 4TMFA 2MSNA 3NTUA 4MB0A 4GRIA 4JI6B 2QN9A 2WNHA 2BEVB 4IOKA 3FKQA 1G8JA 4PYJA 2A9RA 1OV4A 2VL7A 3DVQX 2QAGC 5A4JA 1UM9A 1GO2A 1RAAA 4Q21A 4AF8A 5GJVC 4AP6A 4R8KA 4EHAA 3DE3X 3HDHA 2JATA 1M83A 2PL9A 2QA5A 4RV4A 3GT0A 3I52A 5GZ6A 1CBUA 2XCTB 1WJGA 1SVNA 1XTBA 1ZJYA 2WV9A 2FQYA 3W3AA 4KCGA 4ZU1X 1MO3A 3T7CA 4E3WA 4IUCS 5BURA 3V4LA 2Y67A 4KLRA 3T9CA 4LMBA 3VHLB 4DJTA 1N1EA 3OQ1A 4AJJA 2EFGA 4XQEA 4YAIA 5JNWA 2W6MA 2ZR9A 3GLFB 1T8PA 1PR3A 2B5WA 1AQ6A 1KY2A 3UT0A 1ZM9A 2RGNC 3CPJB 4CXMA 1FFAA 1H0SA 1F0YA 2IYNA 5KO2A 3AH8A 4NQZA 1GZ6A 2JZCA 1EGHA 1TCAA 2YW2A 4HK4A 3ZGVA 2R62A 3C3PA 3RT9A 3NVAA 3D2CA 4RWEA 4DNOA 5ICGA 3CLRC 2ODPA 2XD4A 3OZBA 1MQAA 2QJWA 1GZ5A 3H5RA 1IHOA 3V3KA 4BC0A 5I9BA 1KVSA 3B12A 2GCEA 2R5WA 1KQPA 1Y34E 1YJAA 3A6FA 2AT1A 2V7VA 3CLVA 1T8UA 4IZ6A 1S4MA 3QVKA 4MULA 5DCYA 1NSYA 3REOA 5DHSA 2QR5A 5JZVA 2X8AA 3NIFB 3LUDA 1KO4A 3KPUA 4JEUA 2P9HA 2AD5A 4L6IA 5FORA 3F7NA 3UAZA 2F64A 2WUDA 4LRYA 5BN3B 3NHBA 1TTHA 1JX6A 1NKSA 1Z22A 2MSLA 3U3MA 5C35A 3N2GB 1TM5E 3PFKA 4H3KB 2W6ID 3MUNA 1C81A 2HU7A 4TS4A 2WRZA 5EEHA 5LXTA 1BOOA 4N49A 4Y0NA 2GK6A 2D54A 2A7XA 4YMIA 1KIFA 4NHEA 2O8FA 1NBME 3HYCA 2WJWA 1EM8A 1V8FA 1FP1D 3UEOA 5AKXA 1JH9A 1QO9A 4PICA 2D1QA 1LQUA 4PFJA 1L5GB 3USCS 5B53A 3DYBA 5ALVA 2YQ5A 4J0KA 1XROA 3RBZA 3IHTA 4GI3A 4B3FX 1QPBA 3L8HA 1GQSA 3BICA 1BDMA 3JQEA 4YFYA 5DH9A 2VNIA 2WE7A 3FVWA 4MITA 2FPPA 3RJTA 2Q3LA 4QZVA 4ID3A 5HE8A 1L4FA 1RHMA 1TT7A 1USIA 3L05A 4X1YB 1CR1A 2X5NA 2ADMA 2ZYSA 2YY6A 3IAUA 4LNHA 3DLAA 1JFVA 1PWHA 3I37X 3OPVA 4X63A 5JTTA 3LFTA 1NA5A 1VSQA 1PWZA 5BR4A 5DM4A 3RIMA 4DNFA 3JVIA 3LBAA 4O6VA 1C9YA 1Z5GA 3QX7A 3LQKA 3R5XA 5AM4A 3K70B 4P83A 2FQWA 3TXYA 1R4MA 1G16A 2QRMA 1RPNA 3VVMA 4EB6B 3JYLA 4L5IA 4EYSA 1FVFA 2CWDA 4ZYUA 3NGMA 5JNRA 1VI6A 4WRRA 3BB1A 4MR9A 4ZI7B 2VXYA 3KQMA 3HRIA 3E3OA 3HKDB 3INNA 1IDN1 4JT2A 5HSGA 3OI7A 4QGBA 3EG5A 2PMWB 3ANSA 1PR2A 5F2OA 4DR6B 2AN9A 4TKLA 1RKBA 1IM5A 1FNCA 1R3UA 1ONSA 1AF4A 3AVPA 1LBSA 3AFIA 1RWMA 3NH6A 4Q82A 2PYIA 3ND9A 5E0KB 2XMGA 5KKNB 2XA1A 3L8ZA 2AVNA 5CG1A 1A50B 4QG7A 3ZY2A 4B2LA 4C14A 2FZEA 1KMHA 3LT1A 4OK5A 2DCUA 1ZMRA 1G20A 3M5DA 3F47A 1K5PA 4D45A 5JV5A 1U3GA 2DETA 4XFDA 2QX8A 2BF7A 3CKLA 4O4LF 3BS4A 2AL7A 2VRWA 1K8RA 2QLNA 4PANA 2G1JA 3FKSD 3WNBA 1O6FA 4NENA 2XCQA 4F6CA 3U4MA 3TQTA 1AC5A 1GPMA 4RTQA 3AVYA 3DG9A 1LFAA 4CI0B 2C83A 1RP7A 2ONZA 2PO7A 3EUWA 4CVNA 1BS1A 1KH2A 1QOZA 1OBCA 5E38A 1ISIA 2PD6A 1QHHA 4A2QA 4ZOAA 2BHNA 2QZ9A 2XDAA 5CB4B 4L78A 2R8EA 1XE3A 2IW3A 3QA9A 4KB5A 3VOSA 4CQMB 5CGQB 3PZBA 3DYVA 3PL1A 4PXSA 3TOXA 2I4OA 5HTOA 1I0ZA 4QUJA 2PUGA 1JFFA 3I04M 3O8OA 4G85A 5FLYA 4A0HA 2QZPA 1ACMA 5JS7A 5IYZB 2FSVA 2HMUA 4MKFA 3I0NA 4BGUA 2DBZA 1N78A 4IIFA 2VNJA 2OKGA 5AOBA 4RY0A 2IU6A 1NG9A 3DTVD 3RRYA 4Q5IA 4E09A 4QHYA 1S2LA 4RTMA 2OKCA 1H69A 1OB2A 2J5QA 4U8GA 1LH0A 4ZHSA 5KTNA 5ALTA 2CUKA 1A95A 4NESA 1VMKA 1E6WA 1ZGGA 2FWNA 2BEVA 2VG8A 2ZQZA 3OMXA 4K9DA 1S2OA 1XVIA 3LBNA 1VZ2A 1I4TD 4MYUA 5C3UA 3U3JA 1U99A 4AWXA 3DNPA 4DCGA 5KTMA 3JU3A 2QZSA 5ITSA 1K1EA 2JLAA 3MS7A 1Q1AA 5A4AA 3EPPA 2N75A 3SF0A 3QI7A 5C5EA 1G9XA 3KPYA 5T41A 3WISA 2VZEA 4ETIA 2HGZA 3BE8A 4WLEA 3T61A 4QGSA 2ZM5A 2NTJA 2AEJA 5D01A 4EY8A 3GLFA 1IBKB 2QQEA 1OBVA 3EDOA 3H8WA 2ZGVA 2QE7D 3HCFA 3VC7A 1P9LA 4OEHA 2CT8A 5LC1A 2XTJA 4MSUA 4DPMA 2IEYA 4QBGB 5B6IA 3H5OA 3LL7A 3OC6A 4AG3A 1P18A 3DAYA 3DTTA 4RFVA 2FY8A 3EZ2A 3MXOA 3N5KA 4GPZA 4U2GA 2IH5A 4XOUA 3RSLA 3LF1A 1LPAB 1CX9B 3E8SA 1NXVA 1A71A 2FRDA 3HDJA 3I6BA 4NQRA 4EJSB 4NXMB 3OOWA 1VI5A 3X2EA 4Q1BA 4JITA 1BAPA 1K7EB 3RWBA 5B58T 4EHKA 5LJLA 5EJ4A 4RPGA 1Q3HA 2QPTA 4S2EA 5TVKA 2NUTB 1JT2A 1SQFA 1OI2A 3KJQA 3F1KA 3NNNA 2C4UA 2QYTA 2IX3A 1WSWA 4YDRA 3L2OB 2BIFA 4MYSA 3TNFA 1C4OA 1YULA 2P5UA 2QM3A 2AC4A 2QS9A 5GPBA 2C7VA 2BM8A 2XE8A 2PZFA 3N2GA 3TPCA 3ETHA 3I2HA 5DT2A 2VH2A 5D7BA 1NZFA 1R64A 1ZC4A 3LCMA 2YW9A 1QQTA 1JU3A 1T0BA 2IV3A 3L7MA 1QONA 4K2HA 3WYFA 4MZXA 3HMKA 1QCCA 3OZGA 1SAYA 1ZD9A 3IBSA 2AFIB 2NXJA 4PHFA 2IUFA 4Q7MB 1N0UA 2FQQA 1DO8A 4E7PA 5K0SA 5IF3A 3W6PA 1JR3E 2QNIA 2IXEA 1EAMA 3DXYA 2C3PA 4MK4A 3IEVA 2ZYWX 2J3DA 3VR6H 3HU5A 3B9PA 2R6FA 5FA5A 4X1YA 1C0LA 1MDFA 5CYOA 2Q2NA 2ENWA 3T41A 3T3PB 1IRXA 3B6MA 3PCRB 4A5OA 2GJ8A 3A3KA 1VA5A 2ZRLA 3JQ7B 1Y8ZA 1YZYA 1ZJJA 2PFGA 3QVXA 4TTPA 1T9CA 3VXKA 1IZ8A 5DN9A 1JBQA 3TW8B 2ZZNA 4R2WA 5DLDA 5ARDA 2PFSA 3EY4A 2ZJBA 1HFJA 5BYKA 1VRWA 1Z8FA 4WK4B 4X85A 1Z7YA 1QUEA 3W06A 2V7QA 3IKVA 4EB6A 4ZCIA 2A5GA 5KS2A 2IH2A 2J7PA 2CHVA 1Z7BA 2YWGA 1T24A 3B89A 2EKBA 4IFEA 4QO7A 3BT7A 4X60A 4ZI7A 2D5LA 2R7MA 3GMIA 1FFXB 3HKDA 4BX0A 3F96A 5CDTA 3TSCA 3ESYA 1D1PA 3DB1A 1Y5RA 2BR4A 3HFSA 1ADYA 2FJPA 2QVGA 1K0UA 3GUCA 2XYQA 3PJGA 1GZ7A 2O0JA 2PM8A 2RBEA 3UHJA 5JSZB 5K05A 2YYZA 4DYHA 2JHGA 1IZYA 2YVLA 1E8NA 1R5NA 3MJHA 5ALGA 4A4DA 2BF4A 1JIXA 3DMTC 3R3SA 4XYGA 3E5NA 1VL1A 5HMMA 1I4WA 2L42A 5DZSA 3ETCA 1PD1A 2EWWA 2JLRA 5TEVA 3WZ2A 1LI5A 1RYBA 4RANA 1PU2A 1AXEA 221PA 2OFWA 3CF2A 1JKJB 3EXEB 1WM1A 2V3WA 4D0LB 4Z7JA 4W9RA 4FS8A 1KORA 5LU9A 3P4UA 1EM6A 3QWAA 4FEEA 1NC1A 5MFZA 2RONA 4JEIA 4N82A 1KAOA 1UDXA 2YQ4A 3R24A 1P6QA 1ZH0A 1KQOA 1EK2A 1JTFA 4ZZ3A 4HZGA 2GD1O 1P7WA 3TLBA 4ED9A 1WY5A 5CB4A 4F92B 1GPDG 3G9QA 2M2IA 1JTVA 2FHSA 2OHFA 3VKFA 4CQMA 3PX7A 1WF3A 1XZKA 2FWBA 3OE7D 4KC0A 3W4IA 5FI5A 5JMWA 3OY2A 2RK6A 3T0GA 1H4TA 1M0WA 3EGXB 4IV5A 4MLCA 4GFDA 4M76B 4UHCA 4GBED 4OQFA 1UBSB 4U9IS 3BJEA 1Q0PA 5IYZA 1TCBA 4BNKA 1XJWA 1PGQA 3OKPA 3P26A 4UOEA 2A59A 2VNAA 3B78A 2EFJA 4MIYA 4YJ3B 4DJJA 1DLIA 3ZCRA 1BMDA 1LRLA 2HU2A 4XQ0A 2ZRGA 2ZTUA 1E9RA 4X24A 1XL0A 2B5VA 3EEIA 3WQQA 2V7BA 4P32A 4DBZA 2D2VA 3BMNB 2CBZA 3HR4A 3H2GA 2Q6IA 4RS3A 3IVMA 2JIPA