2X2PA

The flavoprotein nrdi from bacillus cereus with the initially semiquinone fmn cofactor in an intermediate radiation reduced state
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
117
structure length
117
Chain Sequence
MLVAYDSMTGNVKRFIHKLNMPAVQIDEDLVIDEDFILITYTTGFGNVPERVLDFLERNNEKLKGVSASGNRNWGDMFGASADKISTKYEVPIVSKFELSGTNNDVEYFKERVREIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NRDI PROTEIN
publication title Tracking Flavin Conformations in Protein Crystal Structures with Raman Spectroscopy and Qm/Mm Calculations
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Flavoprotein
total genus 42
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07972 Flavodoxin_NdrI NrdI Flavodoxin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2x2pA00
5LBTA 3W7AA 1J9ZA 4BMOB 4ZVMA 2OHJA 1CZOA 1FVXA 4C14A 1D03A 3KAPA 3OJWA 4H6PA 2FCRA 3OJXA 3W78A 2X2OA 3LT5A 1CZKA 1H69A 2RG1A 4Y9UA 5LLDA 5FUQA 3W79A 1CZNA 3W77A 4M0CA 2QWXA 4N82A 3NFRA 5B3KA 5F51A 4PTZA 4PU0A 1YCHA 1BU5A 1T0IA 3QFCA 1CZRA 3NHFA 4BMPB 3F90A 4LTMA 3KAQA 4Y9RA 2QX4A 5EA2A 4DIKA 2QR2A 3GAMA 1C7FA 3GFSA 4OXXA 3JSXA 4QOEA 1QRDA 3L9WA 2AMJA 1NNI1 2OHHA 1FLNA 1ZWLA 3O73A 4XDGA 1AKVA 4CF6A 3ZHOA 1FUEA 2Z9DA 2MTBA 1KBOA 1JA1A 1AMOA 3KLBA 3OVMA 4U7FA 4N65A 3OWXA 2OHIA 5A4KA 3HR4A 4GI5A 4LAFA 3G5MA 4FGKA 2Z9BA 2QX6A 1QHEA 4NULA 5NULA 4FGJA 3FX2A 4FGLA 2ARKA 3R6WA 2BZSA 3NHLA 4HS4A 5B3LA 3OX1A 2Q62A 2V5VA 4S24A 4QOJA 4YALA 2B3DA 5FA6A 2M6RA 3ESXA 1J9GA 4Y7CA 3NHKA 1DXQA 3K20A 1C7EA 3B6IA 1AZLA 4YAUA 1VMEA 1RCFA 4QODA 1WSBA 3EYWA 4F8YA 1KBQA 1BVYF 3ESYA 3QFRA 1D04A 2BPOA 1TLLA 1CZHA 2HPVA 1FLAA 2V9CA 4C0WA 2N1MA 1T5BA 4XDHA 5NLLA 6NULA 1YRHA 1D4AA 5LVAA 1JA0A 1AKRA 3NLLA 1YKGA 1AG9A 3ESZA 1GG5A 4N9QA 4FX2A 3B6MA 2BMVA 1FTGA 3ES9A 5F12A 4LA4A 2R97A 3QE2A 1I1OA 2WC1A 2FZVA 3TE7A 1H66A 5LJLA 4YAWA 3TZBA 2KQUA 2HNAA 1RTTA 3UXHA 2FLVA 2Z98A 3NHPA 1E5DA 1FLDA 2ZKIA 3D7NA 4QOFA 4C0XA 4NLLA 2HNBA 3NHYA 2KLBA 5F4BA 2A5LA 4D02A 2MOKA 2FAXA 4R81A 4HEQA 5LJIA 3L9XA 4GQIA 3HA2A 2FOXA 4C76A 1SQSA 4U7GA 1TIKA 2MWMA 1OFVA 5LMCA 1CZUA 2FX2A 4ZVLA 1YOBA 3F2VA 2V5UA 3TEMA 3B6JA 2XOEA 3KEGA 4ICIA 4QOIA 2Z9CA 5JROA 2QX8A 1XYVA 1OBVA 5FX2A 2QX9A 1DXOA 4ESEA 1YDGA 3LCMA 1FX1A 1CZLA 4LTNA 1QBGA 1AKTA 2W5UA 1AKQA 2R96A 1AHNA 2BF4A 3GFRA 1X77A 2GSWA 3HLYA 3SVLA 3NHWA 3FVWA 1XYYA 3U7IA 4ZVKA 4GR9A 2Q9UA 4ZVNA 5LBUA 3FW1A 3F6SA 5TGZA 3S2YA 2FVXA 3N3BC 4J8PA 3NHJA 3N39C 1OBOA 3FJOA 1YCFA 3GFQA 2FZ5A 1RLJA 3N3AC 3K1YA 3EDOA 3NHRA 3UXEA 1XI2A 2QMYA 4YAFA 2F1OA 1ZWKA 4QOGA 4LTDA 3F6RA 2QMZA 4DILA 3OX2A 3OWHA 3NHSA 1AKWA 1ZX1A 4DY4A 1B1CA 1DX9A 1SG0A 2D5IA 4U7HA 1WSWA 1XT6A 1RLIA 4YAOA 1AKUA 4QOHA 2M6SA 2MT9A 1V4BA 4H2DA 5BUCA 5EAIA 2XODA 3O2NA 2BN4A 3RPEA 3P0RA 4PTYA 2X2PA 1QR2A 4YQEA 3NHUA 3B6KA 2FDXA 2OYSA 3OX3A 5ULLA 4CETA 3U7RA 1FLVA 3FNIA 5EMNA 1YCGA 1J9EA 1J8QA 1F4PA
chains in the Genus database with same CATH superfamily
5AUQA 3EIWA 4L57A 3MFQA 2ATEA 2FYTA 3PWZA 8ADHA 1J4AA 1SCKA 2PNFA 4V38A 5FAKA 5J2TF 3N58A 4RJKA 1U0RA 3BWVA 1ABEA 4WLVA 3ER8A 1IMOA 1GNTA 1SBCA 1X15A 1Z82A 3BM5A 2H2DA 4GYJA 4TWJA 3PJDA 1ULTA 2ZSEA 1XL0A 3GP3A 1D2GA 4MKGA 3NATA 1JKXA 3R3XA 1TYAE 5CDGA 1YCDA 3FJ1A 1OTYA 4G5OA 2YZNA 4HVTA 4DQXA 1R50A 4X60A 4B82A 3QF4B 1M2GA 1J09A 3TI7A 4ZCRA 3EF3A 2XV1A 5BUQA 3CPEA 1RKQA 2EIXA 2J3MA 3LDAA 4ID9A 3W5SA 1A9QA 1D2EA 5AUPB 5KOHA 3SHQA 2ZIFA 1NSFA 3UK1A 4K9PA 1UM9B 3PDUA 3FZNA 3HEAA 4IEIA 3TI9A 2BI4A 1XN4A 2BR4A 2XXAB 3FYCA 3KOWA 1T5TA 1KFCB 3W04A 1EFHA 3G7NA 1G66A 2NSJA 1PP4A 1ZGZA 2HLNA 4V3CA 1L4HA 2GF2A 3WB0A 2BFBB 4JFAA 2XCRB 4XM2A 1L7VC 4WOPA 4JOQA 3W79A 3WADA 1FY2A 4GMGA 3P4UA 3RYHB 3GCDA 1G8YA 2O3SA 5AM3A 4IJUA 4DV7B 4KXUA 3EPLA 2QWXA 4Y2VA 4NU8X 2E4AA 4UHFA 2WEKA 3K1JA 3MQ4A 3BFPA 3QITA 3DZFA 2XF8A 5JATA 5CFOA 2WIKA 4LF7B 2G08A 2YXDA 3OHMA 1KVQA 2B98A 3O0DA 5G0UA 4QZVA 3OQBA 4IPTA 2O8DA 3M81A 1ZU5A 2ID9A 3GRUA 1UK8A 1W6RA 1O96B 1P9WA 5D3MA 4NG4A 2MSKA 1DB3A 3RNOA 3ZY4A 3K8OE 4HBGA 1Y3FE 3DXZA 4H16A 4JLAA 4IDNA 1AE1A 1I32A 5IK2D 1NNEA 5ETJA 1MHTA 5IVIA 3C74A 5EMLA 5CB4F 3SC4A 4E21A 1W49A 1B8PA 2WJYA 4J07A 5JAHA 4DLXA 1TKAA 2ZREA 4C6RA 4Y6GB 5E2AA 3E2MA 2MINA 3ICWA 4P33A 1TVMA 2D7JA 5E2IA 2Q5OA 2ZZNA 1KL7A 4AXXA 4BWYA 1VP9A 2ZQYA 1JNXX 2EBHX 5HFJA 1SHZA 3GJ4A 3SR4A 5M7EA 3UMGA 2ZEJA 4UULA 2ZTMA 4HDRB 1R15A 2WWXA 3HM9A 1FYEA 3G9TA 3NVAA 4XPIB 5A5DA 1ZOSA 4RDHA 2XWJI 2EZTA 1JRLA 1IZ7A 3AB7A 4QOEA 4WIAA 2DCUA 2WOOA 4MCIA 4QPNA 5JFTA 5JMTA 4J91A 4LCEA 5G02A 1W2HA 2GETA 4V2IA 5TT0A 5BP7A 1K2WA 2IXFA 3DMDA 4UBJA 2WSYB 4GWKA 2H5LA 4UPDA 5GM1A 1QCCA 1IM2A 1YBVA 4HD8A 5FOQA 1PW7A 1QZUA 3KHKA 5JH7B 4LVNA 9LDTA 4OP3A 1RAEA 2XOKA 1DBIA 2VK4A 3KR0A 3UJ9A 2QZPA 1WV1A 1D3AA 1JHQA 2R47A 5ALSA 1CWUA 2PO5A 3IDOA 4PAWA 5GJVC 3RBVA 1HDZA 2EF1A 5TS3A 3DE7X 5HIMA 4BNDA 1K4YA 1DV2A 2ZDGA 1XFAA 2L42A 4OHUA 4MRMB 4RVFA 1YQGA 3ZJYA 3ZYZA 3G2NA 4M53A 2J7KA 1KY3A 4ND5A 2QVYX 1NTRA 3D0RA 3IELA 3RODA 1Y9DA 4WXRA 4HS9A 4D3DA 2FEWB 1KAOA 3A25A 3H9UA 4I1OA 3F3MA 2CNWD 3URKA 2WVJA 4Z8YA 2GGSA 4ESOA 3N2IA 2FP4A 2PX8A 2RHWA 3IDZA 2Z9BA 1Y8ZA 1NXQA 2QN9A 4RCZA 2A86A 2PFGA 1KMHA 3LFUA 5KOJB 2ZR9A 3B9BA 2A5GA 1LSOA 2WLTA 2WAXA 1O57A 4PCUA 5AK6A 1J2RA 1TJYA 4CEIA 1X7WB 3WKBA 1T8UA 2ZRAA 2I87A 1YS9A 1C3OB 1FRNA 1BU8A 3I2YX 4DJAA 1XQ1A 4PGGA 1DTSA 1X1SA 1UXIA 2Y9MB 4LNUA 1TZBA 2IP2A 2QYOA 3A6FA 3DZBA 5B1IA 2WF9A 1BDJA 3EVAA 4HDQB 1JXQA 3VU8A 4CG0A 2OB2A 2WKQA 4JLKA 4AZSA 2O8CA 3B2NA 4RVOA 4E2XA 3NONA 1O97D 1FP2A 1FMJA 3RHSA 5AW3A 1TZCA 3JVVA 4HLCA 4EMUA 3I2FA 3V4VB 1NBOA 3OD1A 1J7JA 1FRZA 4R1NA 3WGHA 4DV6B 3GB9A 2VWGA 1L5YA 3LVQE 1OZ0A 2EDCA 4J1TC 2BFEB 3O8DA 2E6UX 3PUYA 5AKLA 1POXA 2AQKA 3MTQA 3PTZA 1QXSA 3Q8KA 5KQSA 4MVJP 1KAGA 1LPSA 1RWBA 5KCMA 5ITWA 3PWSA 2RAPA 5JIBA 1GPKA 2IYQA 5A9SB 2GLTA 3KTOA 1NMZA 1P6XA 3EGDB 4REOA 4EZEA 5EUCA 4RTNA 1SUIA 5D8DA 4ZYYA 4Z4EA 4ENQA 4YX9A 1SUBA 1UK6A 1IBLB 3ICEA 2QB5A 3THXA 3A9VA 4LYDA 2XMBA 4N6OA 4FOTA 4KL8S 3TTTA 2GN8A 3VU9B 4CMAA 1G9SA 2XQKA 1T1IA 3FB1A 3UMJA 3A2KA 2CE7A 3ZHRA 2ECOA 2YJ4A 1SRQA 4EGFA 1SCAA 2PZAA 2GXUA 3NTLA 3EVEA 4L5BA 4YNBA 2V7EA 3WL8A 1YJ5A 2IXDA 1QE5A 4IGKA 4DWJA 1K4KA 4EYSA 2FFRA 5KTNA 1SOMA 3K5HA 1Z6AA 3PSHA 3LPMA 4A27A 4BO9A 3SSAA 1NSYA 3B5IA 3UC9A 4B84A 2OPBA 5EGSA 1U6IA 3PNYA 1XRLA 3HVKA 3SMVA 3H5OA 1GPJA 3EWSA 1VZ2A 2PGLA 3I09A 1TUIA 3EPKA 1NF9A 1W47A 1LJ8A 5C1IA 1RQRA 4LEIA 2DT8A 1QH0A 2BISA 3BGWA 5J2TA 3ROPA 5BV8A 3JQAA 2DUUA 4IH1A 4TSFD 4PZLA 3LF1A 2QUIA 1JQEA 4HH1A 4OHYA 4YCDA 4I14A 4MTLA 4N12A 3AHDA 3TJZA 3T3NA 1DAMA 4M1OA 3TLBA 3ZI7A 3WK6A 1ZMRA 2JFFA 4RZQA 3OKAA 3KFXA 1R6VA 4PZCA 4Z0PA 1CNMA 2XA2A 4FX2A 3PTAA 1NXVA 3S2UA 2HA0A 2VRCD 4AN1A 3T0GA 3KHSA 1V11B 3WJ1A 4B2IA 4ZWNA 3TVTA 3IQZA 2MSCB 2YMMA 2Z08A 3IXQA 4H4CA 3TJRA 2GBIA 4E4TA 5K6AA 4R16A 3ND8A 1XAHA 2HXYA 3KJGA 3QE2A 3EQ8A 5BWBA 3U13A 2X6TA 4GMDA 5E6SB 4HNTA 2WT9A 1NNUA 1FZQA 4LOAA 4J75A 4WVFA 4MV9A 2FZVA 4EJSC 1L4GA 2VJDA 2IPMA 3COPA 1KDVA 3FCUB 5E4TA 3GJYA 4UPEA 3K8ZA 3O03A 4EO9A 3LYUA 1QOZA 1R16A 1Y48E 1PNQA 1H2AS 4G8CA 3QLVC 2NXCA 2OQ2A 3M6XA 1Z13A 2YS6A 3N74A 5BORA 3DBHA 4M46A 2KQUA 3TOSA 3ICCA 4EYOA 3ILSA 1OH7A 2ADOA 1OR8A 2G5CA 2QTRA 2WD9A 3WKDA 5C7YA 3H4TA 4DSAA 1BFDA 4DEVA 4BLPA 4YPOA 3GMIA 1DKOA 3HN7A 5K8JB 2HY7A 3C3YA 2A3NA 1Z4NA 1Z56C 1ORVA 2HCFA 3DBVO 4QOFA 2I8CA 3I2JA 5CGZA 3WFIA 5L95A 1DTEA 1XTTA 2GI4A 2WAMA 4URWR 3U81A 3N0XA 4HDKB 2ZB8A 1ABFA 3HO8A 2W0SA 4K6CA 1LNZA 2AQHA 3CW2A 2J5XA 4IUBS 2RC6A 2XUOA 3WLOA 5M29A 2GK4A 4HZGA 4U2FA 3UJBA 2ST1A 4URHA 5CB4A 1GGFA 4X3CA 3T12A 1FYDA 1JG4A 4I19A 2GM4A 3DJFA 4Q21A 1RPAA 4F4DA 1KMCA 2ADMA 2ZSHA 3I9FA 4KOAA 5FJIA 3T9EA 4AM8A 2QNIA 3P52A 3AJ9A 3O38A 4LS3A 4D8VA 1NW3A 2TSYB 3PPXA 4P3NA 4UMEA 4ZHQA 1LQTA 4TKUB 5ICCA 3LXRA 1Q44A 2MR6A 3DE4X 4WFQA 4D8YA 3MLAA 2ZSJA 5ERGB 4TKVA 4MUKA 5LZ9A 1RQ7A 4Q7EA 2BEWB 2V0NA 4YMUA 5KVVA 4MGZR 2GO1A 1GCGA 2X5KO 2IJGX 2VCYA 4I36A 3EGVA 3OFKA 4C6HA 3LY7A 3PC4A 3KEGA 1GEEA 1EWKA 1FPQA 3RRMA 2FW0A 1FQOA 1T9GR 2ZRDA 4I46A 1HC7A 3H17A 1WE2A 2QRGA 4LC9A 1KQNA 3VPXA 2AL7A 5DP2A 2AF4C 3FVTA 3SS7X 1NFRA 1AJEA 4PLTA 4TTQA 1OC4A 2GLXA 3R5HA 1MF7A 5ABPA 2OAQ1 4FFOA 5DISB 1Z7YA 3IQGX 4Y2HA 5ALLA 5IK2A 3ZHUA 1DQZA 1E9AA 3MCWA 5FWDA 1II8B 2YJZA 4TMFA 3OQHA 3PHHA 5JFGA 3SKXA 4G5RA 3R3UA 2PTGA 2XOXA 2OO5A 4BUZA 2VJMA 4D44A 4ENTA 4RETA 3KETA 3AUYA 4YBZA 1JVBA 4Q5IA 3GT4A 4QFMA 3L1KA 2FPIA 3HY6A 1YZNA 1ZI8A 1EM8B 3GUYA 5EQJB 3FDXA 5CITA 5K0EA 1O6CA 3BXOA 1E94E 3FPKA 3G2PA 1Z4LA 2J9GA 1OH6A 2WHEA 2XSZA 2VR1A 1OXBB 1P4SA 3E6AA 1EESA 4HQKA 4LRYA 3I3SR 4D9EA 3T1OA 2G88A 1C1DA 3I9LA 3H9CA 5LQSA 2VJKA 5LBUA 4U9IS 3HDTA 4K0RA 1MAHA 4L27A 1EWRA 3CZRA 3Q87B 1GTMA 4G1UC 1MQ9A 3DZIA 3Q7PA 2X14A 1K0UA 4GG1A 2J0QA 2Q1TA 3H84A 3DE2X 1EFRD 3TRFA 4F06A 1I10A 3K09C 3SGLA 4R31A 1SBNE 3R0JA 5C8YA 2PX3A 3W9YA 1HDXA 3B5JA 1FUYB 4DRZA 2AFIE 4ZA2A 1WHTA 1ISGA 2WUWE 3H83A 2JIOA 4JUFA 1TZMA 1XLVA 2H06A 2HA7A 3N39C 4U6QA 2FRVA 1EPUA 4B7ZA 2E5LB 4DLAA 3WGYA 1K6MA 3EOAI 4DAEA 4EQZA 2H9YA 4MR8B 2XR1A 3ECCA 2EZ4A 2ACEA 1U9ZA 4O4HF 4EIWA 1EUCB 4U2CA 2JLBA 5JYEA 3AFIA 1N2CB 3DBRA 3KQWA 2VPYA 4CIYA 2ZI3A 3FPFA 3MTBA 1OU4A 4MITA 2CNWA 4H18A 4PY2A 2XUHA 2XE6A 2CCJA 5HIIA 3WZ2A 3AJDA 3T06B 4NCJA 1LFAA 4QELA 4NBNA 2OCPA 3SF8B 5IAOA 1EGHA 2HGZA 2P3QA 3HHEA 5DYGA 2YMLA 5GONB 1UJNA 3FIUA 4B2PA 2O4CA 3PYLA 4Q00A 1PJAA 5TJHA 1E6KA 3P9NA 3K92A 3EZXA 1NXWA 3DO6A 4ALLA 1MC4A 1WU8A 3HBMA 1NX6A 2D1YA 3BAZA 1WLSA 4C7BA 4DILA 1QONA 2R5WA 2B94A 5EHNA 3VSCA 3UMMA 4ZQFA 3IRVA 2FUEA 2FXIA 4YRSA 4JI4B 3B85A 2ASEA 1XEXA 2G1PA 4QDJA 3PJFA 2ENUA 1KZ6A 3A4IA 1UJ4A 1SG0A 2GN4A 2XCQA 2CXRA 2E4ZA 3IQXA 1U3CA 5FTKA 2AOUB 4U7HA 3GP8A 2A4KA 1F0KA 3QU5A 4TYWA 1SKYB 1RLIA 3E5MA 1MNAA 1KYZA 5ES4B 4RTLA 1PN3A 3CCCA 3R3ZA 2BGNA 3ZNPA 3JWHA 3PGXA 1Y6JA 3LT4A 4M9SA 4RK5A 2D2VA 2D4AA 4TTIA 3T4PA 2CDAA 3C3EA 3NAGA 3TSCA 3VAYA 2FW6A 2C1ZA 4D43A 1NSTA 1A9SA 1UWVA 1H2EA 5BUCA 3PJGA 5A0FA 4I4IA 1AURA 3FFAA 3RVDA 2EP7A 3STHA 1GZ6A 1RP1A 5KEIA 2PK3A 4OX9Y 1SKQA 3CKYA 1CK4A 3BB3A 1J0EA 4Z9FA 4CKBB 2UUBB 1WCYA 3RPEA 5DM4A 5AKXA 5COAA 3ZKAA 5DGTA 1G6OA 1U0NA 3DAGA 1CS0A 4WH0A 5CA1F 2DCMA 1TF2A 4NENB 4ARZA 1XRRA 5E1OA 1RJWA 3WYDA 1HF3A 2AG1A 2AMVA 2H4FA 2P0EA 4M54A 5KVSA 2GBGA 3OX3A 2Y0EA 5ULLA 2I62A 2AWOA 1GYQA 1GQYA 1Z6YA 4Y3UA 4DE5A 2C57A 1Z39A 3AYXB 4PRLA 2IVZA 5IPFA 1KWKA 3PQ4A 4PHHA 2O2IA 2F62A 5IC6A 1PNVA 4P3YA 4GUAA 3BQMB 1XZQA 3W1VA 3TRDA 4PBSA 1GVNB 1DX4A 4DR5B 1SKMA 1EFLA 1EVLA 2O7QA 5D1HA 1X2BA 5AQEA 1GHTA 5KQRA 3EBOA 2VJNA 5L6LB 1AKNA 1ITZA 3AESB 5EKUA 3SIXA 4CI0B 2VC2B 3AUXA 2VIIA 5DTIA 3TLYA 4BLUA 5AOCA 2A5YB 4YXFA 2R7LA 1MZVA 3QUSA 3VR0A 4DRYA 3QENA 5KWIA 4TSFA 4DXAA 3RFFA 2ZSAA 4AJKA 1U1GA 3WQSB 2VRNA 3CRVA 1CUAA 2WTNA 3WNDA 1QK4A 3K35A 4Z5XA 1X7ZA 3THSA 5HWSA 2H5IA 3IIJA 4PYOA 4B32A 3THWB 2Z6AA 4D3XA 4J0GA 2GHRA 5KYKA 1EUDB 3ACDA 1A96A 1J8FA 1MORA 2JGDA 1E1MA 2C4VA 4OYYA 4CYMA 4AWXA 2A6PA 1GU0A 4YPVA 2IH2A 2VRCA 4GLFA 2OP0A 2E0IA 3LP6A 3W8FA 1P1BA 2ZVJA 4C14A 5U1PA 1C9DB 2XMGA 4BE7B 1WW2A 1YI8A 2HEIA 4PBRA 1OGJA 2ZB3A 1D03A 3I0ZA 4IHJB 3VR6H 4AKIA 5HQ3B 5JAPA 4MX8A 4FC7A 2FWAA 2W6MA 4PONA 5BNZA 1M0EA 3BFKA 3TZLA 4B4OA 4JQCA 5F1KA 4ARBA 1DT3A 2ZBQA 3Q3GE 4PGAA 3GJ0A 2D1SA 3MRVA 5DX8A 5JMOA 3Q5GA 1AU9A 3UW1A 1X74A 1XXHA 5DBIA 5CLFA 2EG9A 3OO0A 3PC8C 3S99A 2WVAA 5CHEA 5LLDA 1CZNA 3E05A 2LD4A 2WM9B 3BL8A 1MC8A 4Q7MB 1AUXA 3W77A 4RA6A 1XDSA 2PKRA 4M0CA 1QX3A 2BSAA 4OMCA 5EKXA 4A0FA 1Z4JA 3E9EA 3RJ5A 2HO4A 3IT1A 4W8HA 4N3CA 3NXSA 1KH1A 1OCEA 2CSUA 2NZJA 4UTOA 5F1YA 1H22A 5JCXA 4YIKA 3GEHA 2CUZA 4CRWB 1Q3KA 1SAYA 2VLBA 2AK3A 3E2PA 1C5KA 1NN0A 3W5CA 4JQOA 2IS1A 3E22A 1EQUA 1T8YA 3A3PA 5EZQA 5FT9A 3RUHA 2ZRBA 4O8ZA 4JI7B 5AW0A 2H4WA 2H2FA 2O1SA 3DT9A 3ZDYB 3DR5A 2CEKA 4OQEA 3MT8A 2AT1A 4QUKA 1Y7IA 2AJCA 1KJNA 4N6GA 4WESA 1N6RA 3QLJA 3VO9A 3OI7A 4BNNA 1ZG3A 4F7DA 4OKIA 2AR0A 2HF7A 1GP2A 4FYKA 3CNQS 4RGVA 1B42A 3K6JA 3CUWA 3SZRA 4CKEB 3VR6D 1KJJA 4D1YA 4MI1A 1SN7A 2QRJA 3FOWA 3TUZC 5AJXA 1RRPA 1Z2NX 4AF6A 1LVHA 3RS3A 4DIKA 5M34A 5CMLA 5KTTA 2FFHA 4ED9A 3V4PB 1UUFA 3M34A 3ZWPA 3JSXA 3EIUA 4JP2A 1ZJYA 3I9KA 1N2EA 1PW5A 3NT4A 1Y8RB 3OCCA 5JG7A 4I3HA 4EDHA 1ZWLA 4IDCA 2EHDA 3EW7A 3Q8XB 1B2LA 2XVXA 5B7NA 3FWYA 1C0KA 5JANA 4CMKA 3UENA 4BEBA 3PNMA 4C06A 4RDXA 3SG0A 2P5YA 1X9GA 2PZJA 4GI3A 2ZM6B 1PV4A 5F2OA 4OH1A 2A78A 3QG5A 2AX3A 2ORED 4MAMA 5AI4A 4HO1X 3SI7A 4J3FA 1NV9A 1XQWA 2A88A 4OHRA 2J46A 3I6YA 5BOVA 3WDLA 5JFOA 3QWHA 1FUEA 4BKPA 5HJ7A 3KJZA 2XXAA 4HRVA 1HFJA 4CCYB 3DE0X 4CJXA 3F9CA 3MZ0A 1OD6A 1D4ZA 1E2KA 3PFFA 3V97A 3KWJA 2CL0X 2X22A 1UZNA 2V74B 1I7NA 4MWEA 5A3VA 3RUIA 1T5HX 2A1UB 1CUHA 2AUNA 3OZFA 1KDRA 1SCJA 2XDAA 3QQPA 5DCLA 1H93A 4JA2A 4NFHA 2ZI7A 4WTOA 4XYGA 5GVRA 3RVRA 3HB5X 3RYHA 3AVUA 1O58A 1INLA 3LXXA 2GHQA 2V4MA 2W58A 4B3GA 1YDMA 3U5ZB 3ANYB 1G3UA 3DF9A 3BVPA 3KQKA 1N5LA 2OFFA 4V0LA 4AN0A 4GE3A 4F97A 1YZTA 1SU7A 1RWVA 1REQB 2Z57A 3HXKA 4OMUA 4DA6A 4EAQA 5BSHA 4B3RB 1DDIA 2JAPA 4YCJA 5K3EA 3E9YA 4FGJA 3ZJ4A 2JRLA 2W4MA 1J2TA 3Q7SA 3QY9A 5JBQA 1T4BA 1DELA 3FHOA 4J6EA 3DFUA 2HQRA 1R88A 3LVBA 4NE7A 4PZZA 5FOVA 3SEQA 1HOXA 1CFZA 1NUAA 1AHPA 5IDVA 1Z07A 1PG5A 3E0XA 3ILHA 3IV7A 1FS4A 3GGSA 4P4NA 2V9ZA 4LV8B 2X0EA 3FDFA 3R3SA 3SBXA 2G25A 1V0JA 1EFRA 4ARCA 1B8VA 3MWDB 2ISSD 4MA0A 1KE2A 5LLTA 1EJ6A 4XGRA 1ZJ4A 3KZNA 4MICA 1E6LA 4GBJA 2XUDA 1XA0A 2MYTA 2JFNA 3T7DA 1U2ZA 3PE6A 1GYPA 1RLOA 1ZL2A 3M6AA 3PGJA 4FDAA 2J59A 4JXXA 1VHTA 4TLDA 3TBHA 1TC1A 3QX8A 3NYWA 3WL6A 3NHKA 3A1NA 5JH7A 2HF9A 2QGFA 3DDHA 3VO2A 3K20A 4KTTE 4FYMA 1Y5IA 3WBBA 4IWYA 2QVXX 1UWCA 2WU8A 3HSSA 2TYSB 1VIDA 1L7NA 3BD7A 4F3YA 4EY6A 4RHXA 3R24A 1J97A 1ZAKA 2D7CA 2WFZA 1RCFA 4RLQA 2K2QB 4FUTA 4GSYA 4W5RA 2FFQA 5K8TA 2DH5A 3U7FB 4KB5A 4YR7A 5CDUA 4MRMA 2PJZA 3O7MA 4UXHA 5IASA 3EYWA 3U19A 3AVTA 1FPMA 3C5EA 3PGKA 5I48A 1P81A 1K7YA 4CKCA 2ZR0A 1O8BA 2OQIA 1AF7A 1IB0A 5JWRA 2VBIA 1ML4A 2BPOA 1OI7A 3GNLA 3JD2A 1UBHS 4WMLA 4ZCSA 4D41A 2M32A 2EEPA 3U49A 3X43A 5IKPA 4ND3A 2DFVA 3K4PA 1YK1A 1B1AA 1VSTA 1U8ZA 1NF8A 2X5NA 1NRJB 1TB4A 3OOHA 4R01A 4RKQA 3TTWA 4DHWA 5ILOA 821PA 3MELA 5K3FB 3K2EA 1BX0A 2P1RA 3L4SO 1WXDA 2I3ZA 1D1PA 1S7CA 5EWJB 4UZEA 3CVUA 2F2TA 1SA0B 1L5QA 1AQLA 4K05A 4I8XA 4S1PA 5E9WA 4WEOA 3GT0A 4G0VA 2CC2A 2J09A 4PYNA 2WJ4A 4OXIA 4QDXA 5LVAA 2ZTHA 4BAUA 3ASZA 1C3OA 4BRZA 2WM2A 4YO7A 5DLDA 4WADA 5GOTA 3FHJA 4K6FA 2Y67A 1GN8A 3ESZA 3HR7A 4ID3A 4UC0A 3BJIC 1G6HA 4MYTA 3H2GA 4EG3A 2PMCA 2GPJA 3PR2B 4LJAA 1GG5A 1RTKA 4UDNA 4B6OA 4WBNF 1WY7A 1B15A 5IULC 1R4NB 3BK1A 4KOEC 3DO5A 3JYPA 1NBAA 3F49S 5CB8A 2Z8YA 1SXPA 2Z2KA 1XCPA 2RHLA 2XTMA 1KNQA 1MIOA 1WIWA 3DDUA 4S35A 1LH0A 1DKNA 3OH8A 3WMEA 5JCPA 4M2LA 2BFEA 4NSNA 2ZOSA 4AX8A 3FR7A 4G4GA 2CVFA 2P2NA 3KPJA 3GEDA 4CMHA 2AMLA 3CJTA 1T15A 3JWGA 1YA4A 4BO2A 3RG2A 1DVRA 1ATZA 1SC3A 1M1XB 1NVBA 2H1FA 1J8MF 5T3UA 1P4JA 1ZRMA 5JDIC 2J48A 3IP7A 1YZHA 5AKYA 1H66A 2C07A 2YIVX 3EGDA 5AOAA 4YWHA 4YRIA 1Q7CA 2XCSB 4KHPB 1Q0SA 5I5GA 1U8EA 3WYEA 2QORA 5DHQA 3E7FA 1OI3A 3IP9A 3UK6A 3R5KA 1YMQA 5TPZA 2N47A 1QG4A 3GH1A 1XWIA 4TMYA 4X1YB 4BNJA 1AMUA 1VLZA 4GOOD 1LI5A 1A5AB 1QOPB 1VSQA 4M0DA 4GH5A 4DEXA 1Y8AA 5BSWA 4UOZA 4H6VA 2O07A 3S2FA 3LX5A 4BHTA 1T24A 1XAGA 2HK8A 2Z1NA 3HG7A 2GEKA 3P0IA 2D7DA 3OZIA 3RAJA 3LLSA 2ZYAA 5ADVA 1M1ZA 4GX2A 1ADBA 3LL7A 1RXEA 3JQBA 4HK4A 5IH7A 2IS4A 1F0PA 3FVQA 3OTQA 1B2RA 4A8HA 1RHRA 4F92B 3DG9A 4DARA 4B44A 5KVCA 5AKEA 1X3SA 1HSOA 4GNKA 4NCXA 4R81A 4WXHA 1AZSC 4MO9A 5FBRB 5I8ZA 3RO7A 3T1NA 3T41A 1W8IA 2WW8A 4TWRA 1RZVA 3N76A 4A3SA 2WAYA 2WZDA 2E1RA 1N75A 3L6DA 3DR3A 4C9BA 3FUVA 4KU4A 1TT7A 1U1IA 1SQSA 5FKJA 3TL2A 2O52A 2QA5A 3ENQA 3L3BA 4JBGA 4XRRA 1WRBA 2J9XB 4Y1FA 1E20A 2XE7A 3PEVA 4NRDA 5C4MA 3D0OA 3Q9SA 5IF9A 4JLSA 3H13A 4OXKA 4RENA 2RIPA 3MIZA 3TOVA 2YWRA 5GWXA 4MP8A 4D0SA 3GA7A 1Z0UA 1WF6A 3U9LA 3F7NA 1RYDA 4FFMA 5DTMA 1BVRA 1SY7A 1V11A 1GCAA 3CZ5A 3TH5A 3RVBA 4BZXA 2YIJA 1EBUA 1KH3A 3LP8A 2OCKA 4ZARA 4WLFA 1EXMA 1NMYA 2I66A 3EH2A 3L5OA 5TX7A 1M6VB 1P3JA 1RAFA 3U0BA 3PUXA 1OAOA 3AONB 4GLBA 1MENA 2NZWA 1KIAA 2RD2A 5TRTA 3ANLA 3G8DA 1MVLA 3MRXA 4XIJA 2I4IA 3H8VA 1GTG1 3CE9A 2GO7A 2ZUDA 5F9FA 1L7DA 2C9DA 2C4UA 1P0IA 3X44A 2P6NA 2L19A 4ZGGA 2H07A 1YB1A 2HA5A 4DA0A 2Q5EA 3ICOA 4GP9A 5ALMA 5LUAA 2CNDA 2ONCA 1NT2A 2UYCA 3TVYA 2OTCA 2RH5A 1W5SA 3VR6A 4DR7B 4LJYA 3CRMA 4NP6A 4F9GA 4EYKA 5DYNA 4D80A 1WOMA 4K6MA 5AK3A 3VJMA 3KKMA 2BFNA 4A2PA 1J8VA 3C4VA 3LJKA 5ESRA 3ZZTA 3GLFB 2FDRA 1FQWA 1ECBA 1VBNA 2O14A 2FUNB 1EEHA 2Q6KA 1Q19A 2R79A 3O83A 3NEYA 1C8KA 3LFTA 1IVNA 3S7ZA 2I6GA 2CF6A 8ABPA 1K8YB 2G0NA 2ZYRA 2CLKB 4NX2A 1UBJS 2XNCA 3SKVA 1PGNA 3IUPA 3F6SA 1KVTA 3LUAA 3OZGA 6Q21A 5C9ZA 5DMXA 1B76A 2W2QA 3CEPB 1NDQA 4FE3A 2G80A 4M7OA 2JF0A 1L5MA 1QYDA 4TKUA 1DC4A 1NFQA 3A6HA 4OI1A 4CIAA 2X4IA 4FHZA 2P79A 2XUJA 1M5TA 5KTRA 3ZBQA 4AS3A 3KOZA 2OC4A 3LI2A 4OXQA 3C7KA 1I30A 3D6TB 3COSA 1MDFA 2PEYA 1NVTA 2DQKA 3GT3A 3FJOA 4KE7A 3MMNA 2YFHA 2PJRA 3D6UA 3VYWA 4YUZA 1DAPA 4HFRA 4WEQA 5FWNA 4WCFA 1ZM4A 3SJUA 5ITZB 4IIJB 1KU0A 2JHFA 2JLQA 4KMRA 1E0DA 3B82A 5DBFA 1XI2A 5DW0A 1E32A 1NF3A 5HF8A 3EFOB 1V3UA 4H27A 1VE5A 2YJTD 4KYIB 2JKZA 1Z88A 4TTTS 1ST3A 2P6PA 3NXKA 1ZA1A 3DMHA 1P2BA 3F6RA 5D1NA 1PEKE 1RXSA 3RKRA 1MAWA 3JXEA 3V7UA 4AZ3B 1C3JA 4OHWA 2B34A 1II8A 2WKSA 5FL7D 2F3TA 3BPSA 2XW6A 2FPLA 3P9XA 1JP7A 1R7RA 2RKBA 4AQDA 4LF5B 4ZDJA 3F6PA 4FDTA 2IP4A 2WWHA 4B1FA 2G9RA 4N0QA 2HR1A 3N87A 2AN3A 1EM8A 1EMDA 2C88A 1O8CA 4JJ8A 5AQ1A 4QGSA 2O20A 3NRJA 4AB1A 2FSIA 2QG9A 1BMTA 5T64A 2PVPA 1Q50A 1M74A 4JY7A 1JHPA 2HWYA 4PXSA 2D1FA 3Q7QA 5AM5A 1YZ3A 2AMFA 3MIIA 3K0FB 2QPLA 3GCGA 3ZCUA 1H6CA 2DWCA 3AIKA 4G9GA 4IJKA 1R1DA 3WLQA 4XDYA 1MB3A 5IDWA 3ZCQA 3K0CC 2XI4A 1XZFA 4QRIA 1PWXA 2WU0A 3VZCA 4TV9F 3EPJA 5F23A 1XCLA 5E2BA 4WBNA 1TNDA 4PG4A 4KRFA 2WIDA 3QTLA 3GPLA 3D43A 2Q0QA 1RYMA 3EXIB 1G41A 3TLXA 2HF2A 1FU7A 1XEAA 4BZZA 3FPJA 3EXEB 4L5YA 1I4WA 5FPTA 4MYRA 4YRRA 3FHCB 2PAAA 3PT5A 4KEAA 1SO8A 1N6PA 3HB0A 4KXQA 4OUKX 4CT0A 4KXXA 2BBSA 1Y1RA 1JEOA 1YRAA 3IMEA 1S8OA 5AJWA 1MX5A 4KAAA 1Z7BA 3G88A 5EP2A 2A0YA 4JYMA 1PJSA 1N2CA 1FUIA 3UV7A 2FOIA 4B0PA 3GVXA 5LOVF 4NJEA 3LP5A 1CSEE 3VKWA 4RNDB 1TGYA 2F48A 2I2DA 5GP1A 3VSDA 5A03A 1IJFA 3PP8A 4AJOA 3THYB 4B8YA 2FQ1A 3ST7A 4CKZA 2FWJA 1F6DA 2DY1A 5BVHB 1BJTA 3FMIA 3NJRA 2GM3A 2IZOA 2HK6A 4UAJA 4AMVA 4Z0HO 2ZCUA 4J7UA 5FD8A 3ORYA 1K7SN 2RGEA 2NN3C 2PD4A 2BGWA 5EY5B 4NEHB 1BWSA 4Q02A 3CC8A 4HNHA 1SJ9A 2UZ1B 4FMDB 3IEKA 3LIIA 3ABIA 3OURA 3PNVA 3ZXYA 2VWQA 2H5JA 1MTZA 4TRJA 3RC7A 3F1LA 3ABQB 4Z8XA 4UUBA 1U1DA 4TLCA 4ESHA 2XJ4A 4C04A 3NM4A 2B0JA 4UXJA 3QJYA 1V7CA 2FR8C 2JRCA 3BMCA 5FOSA 3PI6A 4DLVA 5CXQA 3COVA 4OP2A 2IL1A 3P9YA 5DHRA 4O3MA 1Y9ZA 4DMLA 1GGKA 3HU2A 1LA2A 3QPAA 2PH7A 4BP9A 3C45A 1ZMBA 3LOQA 3I6ZA 1ARZA 1FNCA 4PQEA 4DUPA 2P8SA 4BTLA 3ELBA 2PT6A 1UH5A 2AYZA 2GX6A 2Y76A 4OMFG 4U2DA 2VOEA 1B3BA 1BX1A 1MH9A 1BMDA 2YXNA 3OJXA 4JKOA 2RHJA 4WLEA 2BEVB 3B38A 2JAHA 4XGQA 3K9QO 4ZTZB 3L7LA 5HKBA 4ABTA 1PYDA 5H5JA 3ROFA 4C01A 1IRIA 4CKBA 3G23A 2Z58A 2H59A 2VRWA 1U0LA 2VNAA 3LCCA 5ADUS 2FPUA 1D1SA 2UUOA 1IULA 2O1EA 1SU6A 1WQ3A 4NENA 2ZPAA 3NT2A 5AOBA 2IHTA 4I4TF 2GXSA 3IUEA 2QE7D 3BD8A 2IYLD 3NFRA 1I2AA 5BN3B 1NVDA 3WWYA 4QREA 2PUEA 4EJSB 4GI1A 1L1QA 5C8DA 3ELUA 4ZT2A 4ZGBA 4UNNA 4WY8A 2R84A 1FNSA 5JI3E 5EJ7A 5LKAA 3A1FA 1T9GS 1YZFA 4XGKA 2J3KA 5IG2A 1NZDA 4RZSA 4N6NA 4QQNA 4UNRA 1WDTA 3MCUA 1NI3A 1NBIA 5F35A 3C5CA 3V33A 4PWZA 2JVKA 2Q1WA 5TGDA 1FFXB 4WX2B 3D3EA 1ZI9A 3BRWD 3L8YA 3CLVA 3UAWA 1X1CA 4F5YA 2O2JA 4AZWA 5HZKA 2C95A 3B5EA 4C7KA 3IKVA 3OKCA 3SYLA 4Z3OA 2Y77A 1ZK1A 3THWA 4NZPA 1J49A 2QQGA 5CVCA 1EUDA 4LF8B 2VN8A 4DZRA 1ONPA 2H8GA 3O73A 3PIIA 4NNOA 4A4DA 3LBAA 5IXYA 2VPTA 3EDMA 3H65A 3K4QA 1YVPA 1DCTA 1GCIA 3CVXA 2FPSA 4XIIA 1IL0A 2JKVA 1ADFA 1HURA 4IHJA 3WGQA 4E5PA 5K8UA 5HQ3A 1U3GA 4Y2RA 3MRSA 4NV0A 4W99A 5L3RA 4R0VA 4X65B 1J00A 1CVIA 3UT6A 4CMCA 5LNK6 1OFUX 4M1KA 1W87A 3L0IB 4UTPA 4Y0AA 4G01B 5BWCA 2Z4TA 4KHZA 1VG9B 2ZYWX 3G2MA 4G0XA 4GGMX 4LI0A 5TNXA 3ZD8A 4IIGA 4I3GA 5FBZA 1KR5A 2VVTA 2JD2A 1U9CA 2JD1A 3OMWA 1ZI6A 5AKJA 4RA9B 2OHIA 5CJJA 2B61A 5CYFA 3PRHA 3CJQA 5DGDA 5TVKA 3EQ6A 1P6UA 2R60A 4AKTA 3NVMB 3P97A 3IVAA 3KUUA 4GKKB 4DRXB 1Q0QA 1XQYA 1LBTA 2EBUA 2PZKA 1O5TA 3EEQA 3LWZA 2H9AA 2OHVA 4B4UA 1ZJWA 2BZGA 4FI3C 1P2DA 1FMTA 4G26A 5FR2A 2WE7A 5F77A 4XVHA 3RCBA 2VP2A 5DRTA 2ZJ2A 4CV1A 2AV6A 1I0LA 3I4CA 2BZSA 2Q4DA 1H0HA 2PU5A 2PV7A 2B1JA 4PG7A 3W8EA 3ZKWB 3R8FA 4HDSB 4URVR 1D2HA 2QM7A 4HKTA 4CKEA 4EHIA 5DK6A 1H23A 3B8EA 1X1RA 2YV5A 2PTHA 4Q05A 4MGHA 3HO1A 1FSFA 1UEJA 2Q62A 1Z8DA 2IDZA 3Q5EA 1YQDA 4JJ4A 3ZOZA 1JPUA 2BDTA 4P4SB 5AJHA 2AE1A 4TRNA 4XDZA 4Q01A 4B2YA 3UCXA 4IIBA 5GMOA 3KR9A 1M2OB 3RGGA 4CMIB 2FOLA 4XJVA 4NH0A 1G21B 2CLMB 4BX9A 3GO4A 1O7JA 3HVHA 1LBSA 5G41A 2AG8A 2AJLI 4R1UA 4M9UA 3G5UA 3RFXA 4F5WA 4Y7CA 4I7EA 1WR8A 4TV9A 3TZEA 3QKRB 2ZUVA 1A2KC 3ZV7A 1MB4A 2VLIA 3G79A 3HB7A 3JARB 4P7BA 3TGPA 4M0PA 1R3UA 3ZIUA 1DC6A 2D5CA 5EWMB 4CCYA 5DGHA 1OHHD 1XJ0A 1Y3CE 4QODA 1XCBA 1GLNA 1NDUA 2FG5A 3A4YA 3KO8A 4XGNA 3U3OA 2XWBF 4UFPA 2A1UA 2J3HA 4CKWA 1RE1A 3OEED 3E48A 3IAS1 1KJZA 1QCZA 1UJ5A 2OXFA 4RFSB 5LA6B 1A9OA 2CB0A 1Z74A 1NR5A 1WHSB 2O4UX 4IOMA 1PZNA 2QXYA 5FL7A 3S2EA 5LOVA 4G4SP 3L0YA 4S04A 4P92A 2GERA 4S1TA 3WLMA 2Z3VA 4TM8A 1R9JA 1EH5A 1OXMA 4RDCA 3OZCA 5D3ZA 3IO3A 4A7PA 5CM9C 4JNCA 4XDHA 3EOBI 3KG2A 2B25A 1U80A 1VE9A 4YAJA 3KQNA 2XA9A 3OM1A 1C9YA 2HMSA 2ZBPA 5HMMA 3LE8A 1NQOA 3I30X 1FMFA 1RZUA 4UFOA 1S0UA 2CYAA 3ETNA 4KRXA 3OZXA 3WL7A 3GPCA 1DE0A 4FCCA 3O90A 4AJPA 1OROA 4KSBA 3V9AA 5FV4A 2SBTA 3W3AH 1SB8A 4BLQA 2PH5A 2BYTA 3N70A 2UYHA 3LY5A 4GQAA 1TRHA 5HIJA 3V4LA 1IJBA 4M7PA 4Z86A 1YKGA 3OTIA 4B4DA 5FLXA 3AL0C 1MEJA 2UVQA 2XNHA 3QWBA 4KFRA 2FFAA 1LQ2A 1X92A 2WYUA 4MS3B 1I4EB 3QMMA 3Q6IA 1RZ3A 2H4JA 2GN9A 2WE8A 4P5EA 4A8PA 1ZAYA 2F4NA 2D54A 2R2AA 3HJGA 3MWDA 2X9GA 4BMXA 3DYVA 2P9YA 3B7PA 4LXIA 3EZGA 3VU3A 1CY0A 3TAXA 4AURA 3UWSA 2GXQA 1JI0A 2VJAA 2PS1A 3P45A 4QUJA 4EUHA 3N0VA 2OCYC 2GK6A 4H9GA 4RACA 1C0EA 1KIMA 1T2CA 3UB3A 3YASA 1PD1A 3QY0A 4DLTA 4KWIA 4JB8A 4N8SA 4NZ9A 2J31A 5GM2A 3FKJA 2Y71A 4JX9A 5FNZA 2ICAA 2YMQA 4KI7A 2IH5A 3KR2A 2EAUA 3D2CA 3AUAA 2IDMA 3GGCA 3WYNA 4B3BA 5KYXB 3TJMA 1K98A 2GTIA 4DQDA 5I5EA 1PWHA 2QMHA 4Z7QB 1R5NA 3SSMA 4X64B 3IPCA 4Y2QA 2YW9A 2PFSA 2R2GA 3EVZA 3WY9A 2D13A 2DFTA 4BMZA 4HT3B 4IDEA 2IS2A 3TZBA 1M8PA 4KLAA 3A6DA 5C34B 2O2ZA 1BJKA 1FU4A 1MRSA 4JI3B 4IGAA 4D4IA 3EZ9A 3FF4A 4K7JA 4WUVA 4N3GA 2A5JA 4XPZA 3CIFA 3CWQA 2CLEB 1AUPA 1U1FA 2ZKIA 5DHSA 5L7TA 1XTSA 4JEMA 5CVTA 4HH0A 3PXGA 2OOSA 1LV7A 1VBMA 1XV5A 2F00A 2FSFA 4K03A 1A04A 3LQQA 4H59A 1WZUA 1WMAA 2FKAA 3G9XA 4P22A 5K3FA 2YOGA 3U44B 1QPBA 3RVLA 2HJHA 1FDUA 5EWJA 5KUTA 3M6WA 3ENWA 3G0OA 9ABPA 4DQ0A 4IDAA 4GYWA 4B74A 3HH8A 3WAJA 1CRQA 2WSSD 1RXCA 2ODWA 5HQJA 3HBLA 5DW3A 4ITVA 4LFCB 2X6RA 1Z0FA 4JI1B 4CM4B 1FQKA 1PFVA 3AK4A 1OIVA 2YY7A 4MVJD 4XVQA 4ENVA 4TT8A 4C76A 4YRFA 2C97A 4RJLA 4W5OA 4AP5A 3RT9A 3RANA 3BHJA 2CXNA 3MAAC 4QHTA 5YASA 3OZVA 1RPNA 2BSXA 1I51A 1JG2A 4L0DA 5T41A 3VMMA 4AZVA 3NJ8A 3P2OA 2WAAA 1DDOA 2ZR7A 3LUKA 4L02A 4IGEA 3ET4A 2JZOA 4PZYA 1R4NA 3GRRA 4A26A 3WWZA 3PEWA 3MQFA 3OLVA 3VFDA 1NE2A 4KYUA 3DQQA 4OLAA 3ORFA 2YHIA 1NVKA 4Y30A 4MUAA 1P0FA 3AP3A 5CGQB 3UJ7A 3PT9A 5K8VA 3CH6A 4R41A 2VDMB 4OJYA 4DEYA 2NUAB 4R83A 1H6BA 2XTNA 3M5PA 4IEEA 4RORA 1ZFNA 1B74A 2QE7A 2YNMD 2JCXA 3DL7A 4URFA 3HCAA 3R3YA 3LGSA 5CD9A 3OPNA 3MJSA 3T3OA 2PPLA 1QYWA 3CVOA 3T38A 1QS0B 4TQ9A 3Q11A 1JHRA 1U8CB 2Y1DA 3HQ4O 3QPCA 4L8YA 1X8XA 1ZUNB 5BQPA 1QP7A 5BQ5A 1GFWA 4EY5A 3HJRA 3TD2A 3RRZA 3BMXA 2PU7A 5LU9A 4P80A 2ID8A 4RMNA 2PX2A 4MDYA 4YJFB 2CVPA 4MUYA 3X1YA 4D8WA 4EFLA 5F3WB 1FTNA 3R7BA 1HT2E 3CNLA 3O5AA 3DVAB 3PHIA 4IZOA 4Q7LA 1WZIA 3BMOB 2CUTA 3ONDA 3RIGA 4P54A 1H0SA 3D6MA 2FUKA 1JMKC 3BRWA 1LWOA 4KXNA 5EE5B 3THOA 4AG3A 1DI0A 4QBGB 4RZIA 5IJ0B 1KFKB 3WDKA 1NQUA 2FX5A 3CUUA 5A2QA 1PR5A 4NWIA 5CNKA 2DBQA 2ODTX 3AG6A 4LY3A 4Q1EA 3A4MA 2G0TA 3FVWA 3CPHA 2OGSA 1Q16A 4WFKA 1YR9A 1SHKA 4M0KA 4KUGA 4PVCA 5DBHX 4Q9NA 5FO0A 4CMGA 2POCA 3QXJA 4ENPA 1KORA 1D2MA 1DXHA 2H4YA 3DTTA 3AR2A 1E64A 4HPJB 5DX0A 2XGJA 2B83A 5FHRA 3N2GB 1DCFA 1UQRA 1T4CB 1TTHA 2YYAA 4RVHA 3WAKA 4B3HA 1YL6A 4RZ2A 3S2YA 3UT0A 5FWYB 4M9XA 1Y33E 3LCRA 4FHFA 1F5NA 4OBXA 1SD1A 3EGXB 4C22A 4OPMA 4CMJA 3QKIA 4WJKB 1N36B 2IDKA 3NHJA 4ISCA 3VR2D 5BURA 1B8NA 3GRFA 4BS9A 1WUHS 3CSUA 3E84A 5AKKA 1NJ2A 3N6RA 2IHJA 3BQNB 4FYHA 1KRXA 1M2WA 1YCFA 5DXAA 3MWYW 4DPMA 1N77A 1E9DA 1JQBA 1VDZA 1HQCA 3T7RA 1HYQA 3ADOA 4G0QA 4PS0A 3U09A 4JT9A 1IZZA 1J2EA 1G3IA 2B1RA 4MLDA 1RU3A 2EBWA 4FYJA 1YI0A 5E6RB 5K8LA 4US0R 2QMUA 2RI6A 5JDCA 1Z5WA 3AQ4A 4CG1A 5DRYA 1KPGA 1PL6A 1CUUA 2QMOA 1GT6A 3WS7A 5B7GA 4GXQA 3ZJTA 3C7DB 3TFQA 3UA3A 3OU2A 4JLOA 3KUCA 4ABYA 5BPFA 2PUBA 1CQXA 1V2HE 4W1PA 3S5JA 3ZR4B 1WF3A 4DB4A 2EFEB 5C80A 3D54D 3NHSA 5AVTA 3FOBA 3PNLA 1W5FA 1YGPA 3BWXA 1ECGA 4LMAA 3QFHA 3MHTA 4DY4A 4R8MA 4X61A 3EGIA 1F0YA 3E9CA 4QTZA 4NPCA 3ETGA 1BXRB 5CDFE 1WSWA 3IIIA 1G8KA 3JQ9C 5EZ6B 2QLNA 3GLFA 1DEAA 4JJKA 4ENRA 3R9WA 3FOCA 2EWVA 1T9AA 3KXLA 2JKYA 2Y2UA 4MJLA 2GN2A 2GKGA 2WSIA 4IV5A 2GR9A 1P45A 4HYTA 5CM8B 5CUQA 4RS4A 5IUKC 4BNKA 2H31A 3FI0A 2C99A 4AUKA 5BSGA 2P6MA 1T91A 1MB0A 3PZRA 2H11A 3QW2A 5DBGA 3O4RA 4TVKA 1U9IC 1MFPA 4H2DA 5I7SA 1FP1D 5LYJB 1NBMD 1JDTA 2NT3A 3C8DA 4OOFA 5E9AA 3WYFA 2H3EA 3DKKA 1N1GA 2OA0A 3K0AA 3FUTA 3ZWXA 3HVRA 1ND6A 1OHHA 3QIAA 4D4KA 5BWNA 2V6MA 4J0CA 3M5DA 4LBYA 1A9RA 3HCRA 4J2HA 4OHXA 1CE8A 2CF5A 2Y9PB 1CUGA 4K2HA 5B1EA 1CQZA 1NVVQ 2I1QA 1A7AA 3OEEA 4D3FA 1YHYA 2O3QA 3UCEA 1T1GA 2XYGA 4F9TA 1L7RA 4GQBA 1GZ4A 1VJ0A 1A3CA 1H85A 1RWXA 4G1EB 5CW1A 2ZETA 2Z2IA 4B4VA 1GGNA 3FHLA 4BEWA 4ZI2A 3S8EA 1SC6A 3KHUA 4QBIA 1AK9A 2NZ8A 5DULA 3EEYA 4NU5A 3SEAA 2GOYA 1ZBQA 4RC9A 1T36A 1WLYA 1QHGA 1XAJA 3QQ5A 1JR4A 1PL7A 4II7A 5FBWB 2JFGA 3NH9A 1SXJD 1Z6XA 4OB6A 5LQUA 2XGOA 3DDOA 3G59A 3ILXA 5EIWA 2OESA 3C48A 5FCDA 3SXJA 3WRYA 1GRVA 1P5JA 1QTRA 1YD7A 2GCIA 3LGXA 3VNSA 1RLMA 3WVNA 5K01A 3KELA 4Z4FA 3SS8A 2UYGA 1E3JA 3N05A 1ZJ5A 4AZ3A 1SURA 2P67A 2HJSA 4F3NA 2GFQA 5BV7A 4PNZA 5HBGA 1O5IA 3BA6A 1CB7A 1Y3HA 4K28A 1JS1X 1C8LA 2C5SA 2TMKA 2QM0A 1QLJA 4BEVA 3PJEA 1N9GB 3HE3A 1QRAA 5HE9A 5HKLA 1FP7A 3LT2A 2XZPA 1EX6A 2V1UA 2HIHA 4Q1DA 1FYFA 4OI0A 2OBLA 1JTFA 1Z3CA 1IHYA 3E9RA 5U9CA 3AF0A 4YMHA 3LRPA 1CRWG 3BRCA 4RHFA 2F64A 2G09A 4QQ8A 5FPSA 5ICFA 3ZU5A 5KO2A 2J1LA 4FXPA 1KI4A 1N2IA 1ZS9A 5CLJA 9LDBA 1YZVA 1V5IA 2ZRIA 3AMVA 3A37A 1BDBA 3GRCA 3K0FA 1PTJC 2BOVA 3LG2A 3LOPA 3DMRA 3OPXA 4NKRA 4R2HA 4YMVA 1BO6A 4UUPA 4O33A 1Z8HA 1Q0TA 3MGGA 4XQ9A 4X93A 1VFNA 3KLMX 4PR3A 1R0SA 2VCHA 1PGPA 3EXFB 2X76A 4ZI7F 1GPUA 1XN1A 4PXYA 4JR1A 5EJGA 3RVPA 5TDHA 3RVKA 4BV3A 3T7CA 1AQNA 5IWAB 1CUSA 1H69A 2PL5A 1IIBA 2ID7A 3LT0A 5IJ9B 2IKSA 1CF2O 3PQEA 2ETXA 3EXIA 1G3MA 2OK8A 4R1OA 4GYKA 4JDUA 4O1IA 4U0KA 1R00A 1UPTA 2QTTA 3EVNA 4CGYA 3S0JA 2C7PA 1BXZA 3L6RA 2PKXA 1C0LA 1C1YA 2X1LA 3GAFA 3WB1A 2CKDA 2FPPB 4N4AA 1J42A 2DFDA 4IBOA 4UHCA 3H42B 1G1AA 1APBA 2AVNA 2JFOA 4RH1A 5JHHB 4IMJB 1G5RA 2WYHA 3L2OB 4BJ6A 1ECLA 2NGRA 1HFEL 3Q2KA 4B09A 1ZVQA 3K6RA 3ZQUA 3AKEA 2EC5A 4YHHB 4FM9A 1VQ1A 4RLSA 3THYA 2GF0A 1P29A 5BVHA 5SY6A 4ZEWA 2PGXA 3GXOA 2H18A 2HRQA 1G5TA 3PQ6A 4OU5A 3X2EA 2CUNA 4AKSA 3K9HA 3K8YA 1IPHA 1L7MA 4MWOA 4QXQA 5IXSA 5JW6A 2ODPA 3FTNA 1P7WA 2CXHA 1B3RA 2WSSA 4KV9A 1W0CA 3I6MA 4CV2A 2W6ID 1Q7TA 3GLGB 1VYUA 4FDVA 4RIIA 3RIHA 4M38A 4Q66C 3RM3A 4F6CA 4ERNA 4MVJA 5HOEA 2UZ1A 4KWEA 3RI3A 2R7AA 3AEKB 3CS3A 5HZHA 1YFLA 1QWSA 3FZEA 4XSVA 1GTZA 3G49A 5ANRB 3EVGA 5CVJA 1C7FA 1K7FB 3PCXA 1OV6A 3OUZA 2JNWA 3FFTA 3U62A 3MC1A 1YL7A 2Y0PA 3LUDA 4ZDKA 1GPMA 4I8IA 2DYKA 1R12A 4JZYA 1SVIA 2FN3A 1BXGB 2W0MA 3D7SA 4HEJA 3OIWA 2BFFA 3R5SA 2H54A 1T5OA 1VLVA 3ORRA 2WI8A 2LNDA 1P39A 2C54A 3WAGA 4BFCA 4DLYA 5ILQA 1K8ZB 4X1IA 4BFXA 2YNMA 1TPYA 3AP2A 1JDZA 2K2WA 2GUGA 3MCVA 5E7JA 1TOAA 2Q1YA 4JJFA 2BEVA 1E3EA 2MTBA 4IIEA 4NHEA 2I6UA 3UK0A 3STTA 1BRTA 1YRQA 2FMHA 3Q3CA 4IG9A 1ZN8A 4I1IA 4M36A 3ZPXA 3HXTA 2PVSA 4MHTA 1YC5A 4J9VA 3ZZNA 3N6VA 2X41A 5IN4A 1AGPA 2I7CA 3WGTA 1J0CA 2QJFA 5EJEA 1RRFA 4Y2GA 2WUDA 3GEIA 2XZTA 3BXZA 2GYYA 1L8LA 2WA1A 1OW3B 2X5JO 1P1RA 3A2MA 3OWXA 1VIVA 4FEAA 4GMKA 4UCWA 5JWOA 4PYQA 3VDMA 2JGMA 4BXOB 4AMUA 3A10A 5ELMA 1KO4A 4G24A 1ORDA 2ZJAA 5TJ9A 1MEEA 2HF8A 5I01A 2P5TB 5L51A 1MUUA 4O5OA 2QX6A 1JE1A 2HU7A 3UV3A 3TZCA 3GLHA 2Q2OA 1I6MA 2IOQA 4PIPA 3TQTA 3ZCXA 4BASA 2I2XB 3GG9A 3R23A 4YLEA 5CCEA 3S40A 3WJ7A 2CY0A 1KDTA 4DBVO 4YFVA 1IN7A 1PZHA 5ALVA 3W5UA 1D09A 2EP8A 4LKOA 1J06A 3ACBA 2QK4A 4YWJA 2POQX 3ROGA 4E3WA 3JSAA 2DJIA 5KDDA 2WZQA 1CJSA 4R8LA 1NQTA 3RIEA 3WWDA 2BI8A 1YIAA 1KOFA 2QRUA 4LOIA 1PJBA 1RHMA 2WJ3A 1R0RE 5AI6A 4C7MA 1EZZA 3KTFA 3DVRX 3MUEA 4R8RA 4W9NA 3CX7A 1PYOA 3PKIA 1NMQA 4G56A 1GL7A 1FUUA 1DJLA 1MJFA 3QOFA 3OHSX 3QOWA 4F96A 4MPTA 3IDFA 1DKLA 3OIDA 3VR2A 3KZ1E 5EQFA 1PK8A 1P77A 1DKUA 1XZ8A 1ZICA 2O9JA 4TMWA 2QSJA 3DCYA 1IBRA 3E1KA 1ZC3A 3S5UA 2C00A 3WXBA 4QGGA 5FYDA 1DOAA 3QUQA 2ZANA 1M2HA 4YASA 3T5PA 3NPAA 2X7XA 3INGA 3OQPA 1S2DA 1DXQA 3TMKA 3IMFA 4YI3A 2D1RA 4E51A 2LCIA 3I5XA 4O0LA 3KKZA 3UWKA 2YX1A 1SVOA 1RBZA 1S96A 3JYOA 2PRZA 2ZJ0A 4RPCA 2Q4TA 4OK3A 4KX5A 5HK8A 4H7IA 3JYNA 4GICA 4CDRA 4C07A 5J4KA 3OM8A 3UOAB 2D6FA 2AJ8A 1NU6A 1F0NA 3RSFA 4DA7A 2IPAB 4BKUA 2LZ0A 4HGPA 4QKQA 4PLCA 4LECA 5H4GA 3PCRB 1Y8CA 4XOUA 4LCJA 3KKQA 3PWTA 4UM7A 2VJCA 4RA9A 3E0QA 5ENDA 2ZE8A 1QX4A 1R9NA 5EERA 4ASUA 4CF3A 1RPZA 3IULA 3NBZC 3V8NA 1CZHA 4R8SA 4D9NA 2ZBUA 1XIVA 2LXNA 2WICA 1U28A 1S2OA 4DRXA 3EXHB 4I1UA 3IKJA 4TXMA 1ZHOA 4QTXA 3IS3A 3RS5A 4MDEA 1UIMA 1VP3A 4Y6OA 4Z4QA 1BKSB 3VOBA 4D6PA 3KEMA 5FUMA 5JBNA 1Z5UA 2CVQA 3LBIA 3GX1A 3UNXA 3UGJA 1USWA 1V2GA 1YZKA 3IAM1 5P21A 2XKKA 4HGYA 4DJEC 3B1XA 3QJGA 4HDMA 2FSHA 3CIOA 1XMSA 3IJEB 5E1MA 1LX6A 3OA0A 2NO1A 5LWQA 2G40A 2B92A 4DNFA 2FF7A 4OLHA 4YP1A 1EFCA 4F04A 2GSDA 3LYAA 5GVSA 1NBMA 4JC5A 5IFKA 3FSEA 2CMFA 5DIFA 1Q15A 3ZU4A 3HDQA 2CGEA 1GPBA 3P26A 1A7JA 3LRTA 3S1AB 5AJYA 1BMFD 4RQUA 1GGVA 2C7VA 4Y67A 1ZITA 2XD9A 1VYVA 1Z0JA 4CMIA 3WICA 5CXUA 1CNEA 1P18A 2I2AA 4BO3A 1WZEA 3LLVA 1HE3A 4LIPD 2Q1SA 2XAAA 2LCQA 3A6PC 3OBBA 1UXHA 1ZH6A 1T6YA 3ESRA 2IEAA 1ZNYA 3G82C 3G2KA 3RVQA 4ZI7A 3OICA 1QHHB 3OKFA 1C30B 1T8PA 2O8EA 3T9BA 3L77A 3QKRA 3H1GA 1V9LA 4V3BA 3SFZA 3JARA 3RSOA 4L2IB 5UKDA 3NEAA 2R4TA 2KJQA 4LYYA 3NW9A 3ZHBA 2P2LA 2YCBA 5EWMA 4YRMA 1QGUA 2X40A 1SXJA 2Z3ZA 3NHZA 4XUCA 4HUQA 3AX6A 2XADA 4Q37A 2AI1A 3QNUA 3K4HA 3IP1A 1B0UA 3N2ZB 4Q48A 4RPKA 4WZBE 5DEOA 3A1TA 3UZUA 4UU1A 1R0BA 4HEA1 3QX9A 3UXHA 4LJ9A 1WHSA 2X9NA 4WBXC 1FLDA 4WOJA 4XCVA 1J23A 3T1QA 3U9TA 1ISFA 1SQ6A 2NXJA 5C1OA 3H3JA 1QFJA 1ICIA 3AOEC 4CFZA 3IQHX 1X1TA 2JI7A 3CLTC 3NM5A 5BRJA 3AHIA 2ZXEA 3QFTA 5LDHA 4JYPA 1UJMA 2ZS9A 3IV9A 3IEVA 2PSJA 4K40A 4QG7A 3IMGA 2MOKA 3TK1A 2FAXA 4WHMA 3G0HA 3GU3A 1A77A 3OM0A 4MRRA 4MZDA 5ARCA 3K9FC 3DNFA 4Y6LA 4G07A 2O8VA 4ZOCA 4LHXA 4L3WA 4X6XA 3Q0IA 4P1ZA 1OWPA 3NDJA 3V7FA 4YJGB 4DCMA 4WOKA 5IC5A 1SKUA 2FOXA 3P0FA 1XMQB 1AN0A 1Y6QA 3T4XA 1QSGA 1H0RA 1WCWA 2JBWA 1B6GA 4PAQA 1Z75A 2D5BA 4INOA 1PT7A 2PWZA 3ER6A 1NJ8A 1O5OA 3KE9A 3LTNC 3U7GA 2HDOA 3ROZA 1QUFA 3MFYA 3O9VA 2JLXA 1Y5MA 2BDEA 1XZCA 2PJDA 4L07A 2CDBA 3UMCA 2Q50A 2Z43A 2X4LA 2VDQB 4D56A 3ZCTA 5CT8A 3FLEA 1CJKC 1V1MA 2W7TA 2X19A 1O95C 3C3PA 3EISA 3SBDA 1PQPA 3LX4A 5IT9A 2BM8A 1W9HA 3W2TA 3ZLTA 3JD3A 4ILKA 4E12A 1COZA 4WLOA 3VZSA 2IZ6A 3WRVA 2VZ8A 1MVOA 2ESRA 3C6QA 2JLVA 1L4LA 2PZBA 4L5CA 4UD2A 3TQOA 4B35A 5EHXA 1SIOA 3RIXA 1H3NA 2A58A 5IKEA 1QO9A 4BNUA 4Q3BA 3QZUA 1PI3A 2YJ5A 4UUAA 2JGKA 5CAEB 1XVUA 5ADHA 5HCUA 1U04A 5AMXA 3T9CA 1DFHA 1EG7A 5EP3A 3RSSA 2B3TA 2UZ3A 1C81A 3MJDA 2V7WA 3FUXA 4WOBA 1QBGA 1RMQA 2W5UA 4S0ZA 1XDGA 3H0EA 1EX9A 3N2EA 1YZUA 3WBKA 4Z9AA 2XPCA 3EIHA 3PFCA 2AK2A 4RELA 4I55F 5FULA 3LAWA 4KR3A 1G59A 1RQ2A 1LSUA 4O4LF 3AVXA 3NBMA 2DQSA 2BFOA 3D3KA 1KPHA 2C2HA 3D6VA 3M1YA 1GZHB 5EXTA 2G70A 2A7QA 1QG0A 1S9DA 1W88B 3DZJA 3KXDA 4ZANA 3UMRA 1T6ZA 4BLVA 3NBXX 2ZB7A 5IEJA 2P75A 1DC3A 1TM1E 1P2GA 3IVCA 4MQBA 2Z0MA 3P2EA 3VV2A 4GX5A 4EQ6B 5CBPB 1XZEA 3U9SA 4G5HA 3ZWAA 4N1AA 1CQIA 2C2OA 3CW9A 2V3VA 2JASA 4TL6A 4PSDA 2VQDA 1KQPA 2CNOA 5DM1A 1E6UA 2NNWB 3O1HB 1UJBA 4MV3A 2XMQA 1X13A 2FVXA 4C4XA 5M3BA 2NVOA 4J8PA 3OX4A 2JGRA 1GN9A 1PSZA 2GWRA 2ODAA 3A0RB 4R0NA 4M83A 2Q0HA 5ED0A 4ZVOA 5BW8A 3U61B 4KN9S 2FVYA 2WLSA 2YZ2A 1WVIA 4YRAA 4RIHA 4EHFA 3IOEA 1PT9A 4RKRA 4Y9SA 5K4AA 3VTKA 2IVFA 2QN8A 4BNIA 5DT9A 5HDQA 2NUAA 4LYJA 4MAFA 3O4VA 1JHOA 5KS2A 1YS2X 4L7VA 1TRKA 3D4BA 1E99A 3KZVA 4FOLA 2GH1A 5HKOA 1CEXA 3O3CA 1Z5GA 4YT5A 1QS0A 4WUTA 3AGQA 2H1VA 1ZOLA 2XCLA 3QGMA 4A1FA 4DJTA 5HGJA 3Q72A 5EWLA 4HNVA 4R9SA 4XTCS 3AZQA 3FM9A 2NQ8A 5B37A 1QGED 1JFTA 1TJ3A 1X7HA 5JY1A 4P93A 1ZN2A 3OC0A 4UDXX 4KKVA 1NR1A 1MQ8B 1Q84A 1DJOA 1PQUA 1XJQA 1FDIA 3BMOA 2XUGA 3D0KA 3DVAA 4KLRA 2UUPA 3AG5A 4X5OA 5J2UB 4Y6PA 4LRQA 2P2CA 1XKLA 4ZAXA 1I24A 1EVJA 3COYA 4D8UA 5EXDA 2ZIVB 4NYMQ 3OLZA 4FT2A 2FDCA 1LDNA 3C39A 3L05A 3R40A 1T2VA 4YAOA 5D00A 6PFKA 3VPBA 2XDYA 1I9GA 3HB1A 3GUHA 5AVQA 2YZ7A 3PDWA 5DBOA 3UUGA 4QBTA 1FJXA 1I94B 4M87A 5A05A 3THRA 4MRSA 2ONZA 1HYEA 3IHTA 4YTEA 4B83A 1TO1E 2ANBA 5CDTA 1P91A 2WSMA 2JI9A 5CX4A 3N2GA 3WQHA 1U2GC 3ZJ5A 1L5HB 1T4CA 1QCYA 2YMPA 4LRSB 3ENZA 1K63A 1XZMA 3RC1A 3ADBA 4L9SA 2DHRA 5EXEA 3AY6A 2YVKA 3GUCA 1A4RA 1DTWB 3EGXA 5AR1A 5CVVA 3DHWC 2WFMA 2DWUA 1GUFA 3ZCSA 3O2JA 3LX6A 3PNKA 1D1QA 2Q3EA 4X7BA 3V46A 1DHTA 2R68A 3NFYA 3EAGA 3Q7TA 1T9DA 3L41A 1T3ZA 4LYAA 3NHUA 2ATVA 2BR5A 1E9VA 4PGMA 4Y2PA 3HXPA 1ZLYA 3TUJC 1UP7A 2EKPA 1SCUA 3B6KA 1N33B 3K5WA 3OFVA 2G63A 4DUZB 2ZJOA 3HP1A 4JUAA 3KYDB 3O82A 5IT0A 4F12A 1D5CA 3PUVA 4F2DA 2JG3A 4KQMA 1N32B 2PL3A 3D4IA 4G89A 4INZA 1CT9A 1W59A 1PBNA 4FIZA 3BBLA 4IUYA 5E6RA 3SJAA 2XY4A 5F2NA 1ENOA 2PGAA 3VHXB 3HSKA 2BHRA 4D4LA 3RVNA 3CXUA 3EIFA 1W36C 1FOEB 4J9UE 3F5MA 4L7QA 5GY7A 2BGMA 3DB2A 2IC5A 5C2JB 3GLQA 7ABPA 5EIFA 2CLIB 2H85A 4YH1A 3L0BA 3I05A 2QX7A 1SZDA 2ETVA 4RK1A 2GZ2A 5FPPA 4I9HA 1J24A 4DR4B 1B8UA 2K5UA 5CB6A 4HJXA 1N25A 3AEZA 3MLEA 3PB3A 5FQNA 1M2NA 1Z47A 4OP1A 4N01A 2CWWA 1MV5A 4N7JA 3T3MB 4UMDA 2F4VB 4JFRA 4C3VA 5J5VA 2GBLA 2RG7A 3BE6A 1JH9A 4NS4A 4AECA 3O91A 4D9FA 4ZDIA 1ZD3A 5AESA 1BMFA 2P77A 3NU1A 4NDNE 2QVZX 4OHOA 3ETLA 1TUBA 3AJAA 4BN0A 5J23A 2P1DA 1UXKA 3FNFA 4NICA 3LDUA 3LPCA 3GGPA 3R7NA 3E9NA 1STOA 2GD2A 3NH6A 3HB4X 1N1MA 4LKRA 2ZB4A 3R3HA 4DCGA 5THKA 3BWEA 3C1AA 2VUUA 1JHDA 3AJEA 1LLUA 1ZD8A 5F33A 5JV5A 4LQDA 5HEKA 5I7HA 3V2UA 1RLTA 3PDCA 3VGPA 4C89A 3ZJVA 1E5LA 2PSSA 3A1VA 1E5XA 4RK7A 3ZDRA 3IDSA 3VPCA 3BE5A 1X80A 2QVCA 1RHJA 1UT5A 3M6LA 4U3JB 5CXSA 2ISCA 2AKYA 2VHTA 4X85A 4S1NA 3KVVA 4MZXA 3S28A 1NVAA 3VYUB 2XUIA 4L95C 3X1MA 4F2GA 3AO0B 3SDBA 1KVRA 3R7SA 3MSCA 5JJ5A 3BD6A 1VG8A 4PRKA 4UM9B 3NTRA 3OQIB 2ZYIA 4IDGA 1EK6A 5IYZF 2CJPA 4ZIRB 5B3KA 5BVGB 2VSOA 2C9CA 4TL8A 1LNQA 4C2UA 1W5EA 2GTHA 2HZBA 4QC2A 3BZWA 2P3SA 1ZUIA 5DNUA 4DCCA 4RV4A 1W1IA 3OF5A 1CHNA 5DVZA 4QATA 4Q3CA 3H8JA 3ZIAD 1NBHA 5IT5A 1N6IA 1TADA 2B4TO 1X8LA 3U80A 4DLZA 2CHFA 3C0KA 4UTVA 4MPRA 1NW9B 2CJFA 1X9HA 2GZDA 2ORIA 2WJHA 3HN6A 3MHPA 4TYQA 3VZBA 4BPRA 4I55A 2WG2A 4ZRNA 1V7PC 4O4LA 3KAQA 4F3TA 1N3LA 4GX0A 2QX4A 3FR8A 4LJ6A 3EFBA 4O6VA 2ZRGA 5BO5A 4IRXA 4YRZA 4BUJA 3R2JA 2IRWA 1NOKA 1TXGA 1L2TA 2I3DA 1F51E 3VC1A 2W48A 1ETHA 2C8JA 3BIXA 4JJ6A 4ZOQI 3ZDXB 5F1PA 1X70A 2JBHA 2O3TA 2VPIA 4OK5A 4NC9A 2O8BB 2O0KA 3HL4A 5HTOA 3EC7A 4OH7A 1Z3IX 2OG2A 1A72A 2OOKA 4GS5A 3RJ9A 1EE1A 3C8HA 4HR7A 4CLEA 3QG1A 2B1IA 5ALEA 2H57A 2WT4A 4B3MB 4KWHA 4MDFA 3ZW7A 1OWOA 1AK2A 3UHPA 3QBVA 3EXFA 4HNSA 5FFNA 3BE8A 1TF7A 4XJTA 5EKTA 3URMA 2BFCB 4EG7A 2PY6A 2H1LA 1VPEA 3C3BA 3SYKA 1UPUA 5IJ9A 2H2GA 3OPVA 4LRTB 2PKWA 2HD4A 5EL0A 3GGOA 4EX6A 3U4MA 3DPSA 4YQZA 4TLLB 3O8QA 4X7RA 3VR3D 4R9UC 3M83A 4J4TA 4V2UA 1MX9A 4LG1A 3RC3A 5ALNA 3A9SA 2QLJA 3EN0A 3GLUA 1KMQA 3BUSA 4FFLA 4GPD1 4J7AA 5PNTA 3TLGB 4J6FA 3UJ3X 421PA 3QSYA 2JZNA 5BRAA 1H2XA 3TW8A 1WUIS 2JFVA 4U7JA 3PNBA 1N3BA 5I7WA 4DV1B 4GI5A 1WSDA 1D0VA 3EA5A 3P4XA 1UM8A 1N5OX 5A4AA 4FZJA 5BUZA 5JSZB 1U63A 4UTZA 4EJFA 2FWIA 3T8YA 1UT8A 3GV0A 3T3EA 5L45A 4FHGA 2R8EA 4CIWA 1E7WA 2I4NA 3X1ZA 3PEFA 3SYTA 2EKDA 3IAAA 5JNLA 4NJOA 1YB6A 1L9KA 2GYWA 2QM8A 1GR0A 2ZDHA 3FNBA 4FN4A 2IX9A 4ZQHA 4BKOA 3I9NA 3I5MA 2VH5R 4IQ4A 3GLGA 2EZ8A 3LYHA 5JMPA 1OSNA 3VH1A 4AY3A 1FMCA 4YRCA 4IXWA 3OX1A 1HE5A 2RHOA 1GDTA 2PKEA 2XQFA 3QBJA 5IS2A 1ZD9A 3SPXA 1YIDA 1P1JA 4GOKA 2BRUA 1F38A 2VHXA 4G1CA 4IWXA 2ZIUB 3HBAA 4Y1EA 5I7FA 4YJ2B 3NALA 2QTMA 1SVSA 3BBPA 3BF7A 1W73A 2BM9A 2QZJA 4PZAA 5CJ2A 4P3KA 3CB4A 1I33A 2G9UA 4WQMA 2R1ZA 5IABA 1UDBA 3OWOA 1MO2A 4GR4A 1W35A 3UPUA 4P38A 1W5AA 3CR8A 1IUPA 2AFVA 2NZYA 3H9JA 4HX2A 1T0UA 1NONA 2X77A 4MJ3A 3SZUA 3T5TA 1B93A 3AINA 4N0MA 4FYVA 3LU1A 2AFIB 3G8BA 1SEVA 4CIXA 6AT1A 1JEEA 3KEQA 4J0EA 4JVNA 2WIJA 4NAHA 3Q8LA 2OGUA 2A9OA 2FQYA 2JC3A 3B9QA 4YT8A 1FC0A 4INPA 1UKEA 5LBIA 2B4RO 5TS2A 3HCCA 3M9LA 5GIPE 3T1VA 5B36A 2Q0SA 1I3KA 1JSXA 2DETA 3ERCA 3DHNA 4IS3A 3KSZO 2VDKB 4UW9A 2GJ4A 3IPLA 1LD3A 2Z6UA 3UJNA 3ZGYA 2JGIA 2WNIA 3HFJA 3UT5A 4B3FX 3UJAA 1TO6A 2DPMA 4QXRA 1NTOA 5BR7A 4BXOA 221PA 1SC1A 2AN5A 5FI3A 1QP8A 2WHXA 3M6UA 5B5SA 8GPBA 2P4UA 2IT1A 1JPVA 3TX2A 1E63A 4BNYA 3ISVA 4BQSA 1DEXA 2MCFA 5K6AC 3D3NA 1Z4OA 1LK7A 3CTPA 1G5QA 3FETA 3FZQA 3WLHA 3ADDA 1P1KA 1ORWA 2IUYA 3G6KA 3TCNA 3OIUA 4KW7A 1ACMA 1VGQA 1SCBA 2AOWA 2DQZA 1G9TA 2GAAA 2W8BA 3E3NA 3GPDG 3RHFA 4O08A 3MGBA 4HNGA 3AERB 4IO0A 1Z12A 2AG6A 2FETA 2PZLA 4G09A 4YB8A 3RFTA 1W581 3OOYA 3CVJA 3WE7A 2ZYUX 3AUJB 4RSMA 4XXHA 2GJSA 2A7XA 1NXOA 2W43A 2OUIA 5K0NA 3W2GA 3K6SA 4PG5A 3TKLA 1W4ZA 1J90A 3O8BA 1Q1ZA 1U7OA 3DV9A 1CU1A 5CYPA 3SQLA 2FPGA 5REQB 1P72A 5ALPA 4ATNA 5EJ4A 5KNBA 4PZ0A 3EQ2A 3MJ4A 3HCOA 5C51B 3B3AA 2Z2JA 1HQYE 4O02B 1CERA 3JY6A 3IKTA 1QV6A 4JR2A 1GSHA 1L8XA 3ZVMA 4G5XA 2OBNA 1F9AA 2VF8A 5LZ8A 3MEQA 5T6BA 3FWPA 4WJLA 2C8VA 5D7NA 1ZNQO 2DERA 2IIVA 5KTYA 3LHSA 1XWWA 5CD1A 2A9KA 4TX1A 2PCJA 3VBEA 1AKEA 1GPAA 3AT1A 3I45A 3EDYA 3T7KA 2H0QA 1D2RA 2AKEA 4PX3A 1EFVA 4DMRA 1RHQA 5LJLA 3ND7A 2CE2X 4BTEA 2H8KA 2IELA 3EEIA 3H11B 3L8FA 4O2LA 4EVSA 5MGNA 4PRZA 3WBJA 3TXXA 3K70B 1TECE 2ZW9A 1FJGB 4CFYA 4RGBA 4ZO6A 2A1TR 5SYAA 1JSLA 1L3BA 4X54A 5IYZA 5HJ2A 3FLAA 3N0WA 5EP4A 1HZZA 1RAHA 1ECJA 4FYYA 2ZUUA 4MVXA 4XH9B 2X42A 2KLBA 5L4NA 2AXNA 2C4MA 3F96A 3G3EA 4GIBA 1OF1A 5F4BA 3ZK9A 5J2UF 4MTCA 4HOYA 1H8HD 3EXHA 5ES3A 1I6WA 4BX0A 4KLZA 3AF4A 3PIDA 2Q49A 1ULBA 3OT5A 4LV5B 5HF9A 1C7JA 3STYA 3OCVA 1FSSA 3ABOB 1VKOA 3LPNA 4QHYA 5B7QA 3CBGA 3DOEA 4AKEA 1HK7A 4JEHA 2FZGA 4LJLA 1V8PA 3P5SA 4Q82A 1YA6A 3CINA 2WDPA 1S8AA 3EMBA 3NBYC 1Q83A 2HLPA 2I7TA 4KKXB 1MU0A 3EAFA 4GW3A 1TIKA 2IYSA 4MWBA 1V7ZA 3JQGB 4J49A 1V8ZA 3UGKA 4E5MA 1COWD 2YL2A 2WYOA 5LZ5A 3GELA 4E03A 2OO5C 2XMZA 4A92A 2QUKA 2VQSA 1CXZA 3ETDA 1JV2B 2YJNA 5BXYA 1B16A 4RW0A 4WXPA 2OBYA 2DPHA 5F7OA 1X7GA 4OB8A 2NP6A 3X3HA 3CO0S 3B8HA 1UK9A 3MT0A 3DA8A 4OXRA 1DQSA 4QOIA 1UBOS 2P7IA 4GZLA 3MJTA 2HO5A 2BW0A 1VBFA 2QE6A 3AR4A 3OM9A 4KXWA 6LDHA 1K06A 3G5AA 3UXYA 3AGPA 4DCNA 4A03A 5FPKA 5KOIA 1WMDA 2PWPA 3O47A 3TBKA 4CN9A 4ESEA 4OBBA 3ZIAA 4QTYA 4LK3A 2FEAA 3H5TA 1H2WA 4BP8A 3V4SA 3EGCA 3HPQA 3MJHA 1CZLA 3I76A 5FUBA 4DHEA 3VR4H 4GOXA 1N2HA 3SN6A 5J4YA 3HXOA 1XTUA 3MILA 2ZTLA 1E0KA 4ECAA 2VHCA 2W2KA 1BQ4A 3OUTA 4UM9D 4M6WA 3BDAA 1NN1A 3L43A 2CJXA 4X3PA 1AHNA 1SM4A 2QG6A 2VUIB 2H1WA 3GFFA 4FYIA 3W6OA 5FWAA 4QOSA 2JLUA 1D2CA 4H1TA 3DOHA 2PZ8A 3HLYA 4CV0A 2QI9F 1FYVA 1ZPDA 3VNQA 4F6RA 1RXVA 1ZHFA 4LF4B 3NHWA 4B73A 1OA0A 4PGHA 5G1OA 3U7IA 2OFWA 3ZBTA 2N42A 3DEJA 5I4KA 3SX0A 2EATA 2L18A 1VM6A 2AHRA 4FHDA 4ZVNA 5DN6D 5FTNA 3SHVA 3FOZA 4YJGA 1JXOA 2ILVA 5IUJC 4CL8A 3ZYCA 3UJPA 4FWBA 4LZJA 2Q0XA 4KSCA 4KO8A 4PV7A 3V8PA 2HSEA 4U6NA 1TM4E 4WERA 4C5CA 2PRJA 1JR3E 4P2GA 4JENA 4V1CI 3TSOA 4DPLA 2PX5A 5L40A 5L3QB 1XNJA 4BNLA 4WKBA 3FPEA 2IXAA 4RD4A 4LHVA 5A4JA 1OYYA 1VL6A 3DOIA 3IPAA 4KVZA 1OV4A 2WWWA 3VR3A 4F3KA 3TZHA 1E59A 4N9WA 3LBNA 1A4IA 3HR8A 3SU8A 2JATA 1X0XA 5EXXA 2IPLA 2J67A 5AXCA 2Z8XA 3VR4D 1KYTA 1QK3A 2QY6A 3RLIA 2GA9A 3ZU6A 4F1WA 3HMKA 4KXYA 1UZMA 1O97C 5DNDA 1U65A 4MRAA 3PC6A 2TRSB 5AVOA 3NHRA 1L7PA 4HUTA 1K75A 3IALA 2CHUA 1C4OA 3HJAA 3P20A 1P2SA 3QEKA 2VJBA 1VZ3A 4YAFA 4JZKA 5BMVB 3LTEA 1JDNA 1ZZEA 3OEYA 2P1ZA 4OGKA 5BY2A 1G20B 4V0ME 1XPJA 1EBFA 3I2IA 4PX2A 4IXNA 2G5TA 3FSRA 4ZYVA 4I2VA 1EI9A 4RQAA 1OZAA 5L7WA 2WUGA 2NVBA 4QDKA 3MGKA 4JLNA 3F1KA 4AMYA 1YE3A 4FYPA 3JYQA 4BX8A 4LDZA 3WLJA 4ACAA 1YFKA 3AYZB 4XYLA 1YGYA 4YJDA 2V5AA 5C81A 3SQXA 1KY5A 4CNBA 1G16A 1KC1A 4PE5B 4DCJA 1Z63A 1CRZA 1XDBA 4HGOA 5FFFA 1YB5A 3Q4GA 2PS9A 5JLJA 2H00A 1SD2A 3DW3X 3ZDEA 5A5EA 1HETA 1KTVA 1XQ9A 2YWDA 1X7DA 2QVGA 1FA9A 1PK9A 2FMTA 6CHYA 1M3SA 2O0LA 5KTMA 3QVMA 1M6YA 3PQ5A 1EQ2A 4BKRA 3IEMA 1LI7A 1ISSA 2FHSA 4NOMA 4IP0A 1I3OA 1RADA 4K6HA 2GZMA 2VHYA 5IKOA 2MU1A 2CL7X 3FPLA 1QFSA 3QE3A 5C8ZA 2Q5IA 5BOSA 4AYWA 1PDVA 4NU6A 5IAGA 3VR5D 2R25B 3HRKA 4GZ6A 4M9CA 1YVUA 3JU3A 5A9RA 3KYIB 1QVRA 1DG3A 5DE3A 1SVKA 2A1IA 1ESZA 3Q3HA 1EAYA 4Q47A 4QJIA 2IYOA 2QQ5A 5DXFA