2X2PA

The flavoprotein nrdi from bacillus cereus with the initially semiquinone fmn cofactor in an intermediate radiation reduced state
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
117
structure length
117
Chain Sequence
MLVAYDSMTGNVKRFIHKLNMPAVQIDEDLVIDEDFILITYTTGFGNVPERVLDFLERNNEKLKGVSASGNRNWGDMFGASADKISTKYEVPIVSKFELSGTNNDVEYFKERVREIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Flavoprotein
molecule keywords NRDI PROTEIN
publication title Tracking Flavin Conformations in Protein Crystal Structures with Raman Spectroscopy and Qm/Mm Calculations
pubmed doi rcsb
source organism Bacillus cereus
total genus 42
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07972 Flavodoxin_NdrI NrdI Flavodoxin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2x2pA00
1AMOA 1XI2A 3F6SA 2FDXA 4FGLA 2WC1A 2FOXA 4PTYA 4ZVMA 3TZBA 1H66A 2D5IA 3JSXA 1YCGA 5LBUA 2ARKA 3OX1A 4XDHA 3NFRA 1QR2A 3ESZA 1YRHA 3HR4A 1WSWA 1J9ZA 3U7RA 4GR9A 2QX4A 1RTTA 5NULA 4ESEA 3L9XA 1XT6A 5EA2A 1JA0A 1D04A 4C0XA 1DXOA 4M0CA 4ZVKA 3QE2A 2MWMA 4C14A 3KAPA 1D03A 4CF6A 2KQUA 4C0WA 2BMVA 3W79A 1AKVA 1CZLA 3P0RA 1YCHA 2FAXA 4BMOB 1ZX1A 2MOKA 1AZLA 1BVYF 1QHEA 3N3BC 5FA6A 1SG0A 1XYYA 2QWXA 4N65A 3RPEA 3O73A 1TLLA 2Q62A 2XOEA 4FGKA 1FUEA 3D7NA 1OFVA 1ZWLA 2BPOA 2V5UA 4U7FA 4QODA 3KEGA 1J9GA 3FJOA 1JA1A 4S24A 3F6RA 4YAUA 4R81A 4LTDA 4Y9UA 1D4AA 2OHJA 3NHKA 2N1MA 4D02A 4QOEA 2QX8A 2QMYA 1AHNA 1XYVA 3ES9A 1QBGA 4BMPB 2KLBA 3B6KA 3OX2A 2FVXA 1V4BA 2HNBA 4GI5A 1I1OA 4DY4A 3HA2A 5NLLA 4ICIA 1OBOA 3K1YA 3OJXA 3R6WA 1CZKA 3KLBA 5B3KA 1B1CA 2FZ5A 4XDGA 4N82A 5JROA 3OWHA 3GFRA 2BF4A 1FLAA 3L9WA 4J8PA 4H2DA 5F4BA 2QR2A 2V9CA 1AKQA 1C7EA 4NULA 2QX9A 5EAIA 3FNIA 2FZVA 3NHSA 4NLLA 2XODA 1DXQA 1YOBA 3NHFA 1CZHA 1F4PA 2QMZA 4Y7CA 1NNI1 1OBVA 4OXXA 3B6JA 2Z98A 1TIKA 5ULLA 3F90A 5BUCA 4QOIA 3B6IA 1AKTA 3B6MA 4LA4A 1J9EA 5LBTA 4FX2A 2FLVA 1T5BA 3ESXA 1FLNA 5FUQA 2R97A 5F51A 4U7HA 5LJLA 3W77A 2OHHA 3NLLA 4DIKA 4CETA 4QOGA 2ZKIA 2MT9A 4LTMA 4YAOA 3LCMA 1VMEA 3N3AC 1RCFA 5LMCA 2B3DA 4U7GA 1DX9A 2X2OA 2BN4A 3QFCA 3FVWA 4H6PA 3OVMA 5TGZA 5LLDA 1WSBA 3HLYA 3OJWA 5A4KA 3GFQA 2A5LA 2F1OA 4FGJA 5LVAA 4YAFA 2QX6A 3EDOA 3EYWA 1E5DA 1X77A 2AMJA 3U7IA 2V5VA 1BU5A 1KBOA 2FX2A 2W5UA 2Z9CA 5LJIA 3OX3A 1QRDA 4QOFA 1CZRA 3UXEA 1FLVA 4HS4A 4C76A 2R96A 1YDGA 3NHLA 4PU0A 1YKGA 2BZSA 3NHJA 1SQSA 5EMNA 5FX2A 1FTGA 2M6SA 3QFRA 4DILA 1C7FA 3LT5A 3NHUA 1AG9A 3SVLA 4GQIA 2RG1A 4QOHA 2OYSA 2Z9DA 1CZNA 1T0IA 3OWXA 1AKWA 2Z9BA 1H69A 4ZVLA 1J8QA 1GG5A 1RLJA 3KAQA 3FX2A 2X2PA 3UXHA 1CZOA 4YAWA 1FLDA 2Q9UA 4QOJA 3S2YA 1YCFA 3N39C 3GAMA 4LAFA 2HNAA 1FVXA 3ESYA 1AKUA 3W78A 3ZHOA 4YALA 4ZVNA 3W7AA 3NHWA 2MTBA 3TEMA 2HPVA 1CZUA 1AKRA 3G5MA 4PTZA 4LTNA 3FW1A 4N9QA 4Y9RA 3NHRA 5F12A 3O2NA 1ZWKA 2GSWA 1RLIA 2M6RA 3GFSA 4F8YA 3F2VA 4HEQA 3K20A 3NHPA 1FX1A 5B3LA 2FCRA 3TE7A 4YQEA 6NULA 3NHYA 1KBQA 2OHIA
chains in the Genus database with same CATH superfamily
4HSGA 2FQWA 4Q4AB 5JCOC 4CMBA 1MMFB 5CT6A 5A9RA 1XTUA 1RMQA 2XZTA 4G5GA 1OIWA 3FMOB 1B2RA 3IQHX 2CFTA 1BXGA 4FGLA 4FKMA 1R0SA 3FCEA 1WWKA 3IUNA 4D6PA 4DT1B 1G5FA 4EUFA 4F5EA 2AJTA 2Z2ZA 3D3WB 4I5FA 4L9WA 3SLKA 4HAUA 1M2OA 2Q3LA 4R16A 1XXHA 4GM4A 1XVTA 1WNTA 3TW8A 1H0RA 3EDCA 5ALQA 4LI0A 3UOAB 3SX0A 2FN4A 2NIPA 1FDRA 1QFZA 5KVQA 1V8DA 2FN8A 4X1IA 3OZGA 3O31A 1CY1A 3JSXA 3VNQA 3KEMA 4DGSA 1Z2AA 3H9CA 4ZCLA 1HZZA 3UUEA 4QGGA 3VO9A 2ARKA 3B20A 1N5JA 2C99A 2NUAB 5CJ2A 2IYTA 2ZRIA 2HF2A 2H4JA 2FMIA 2ICAA 2XWPA 3IUMA 3ACCA 3EG9B 3NBXX 2WD7B 2H0AA 4X3OA 1HURA 2ZCUA 5ECGC 5A9TA 4ZN6A 3HR4A 4N6GA 5J4KA 3I62A 2BFAA 1JJFA 3ER6A 2B1QA 3MOSA 3OEYA 4DW8A 1DQSA 5C1DA 2HW8A 1XZBA 4KL8S 1GILA 1E5VA 5JEDA 3BK1A 1QPGA 5TGTA 1NSTA 5EJAA 4EYSA 3EZ6A 5K8IA 1E3IA 4MDYA 1C1YA 1RNLA 1M6WA 2VAVA 2VJNA 4GR9A 5HDQA 3L1JA 1G42A 1TMYA 1XJWA 2MR6A 1M34A 1NOIA 4TT3A 3V3TA 5LP6C 2ACEA 1UC9A 3N59A 4AB1A 1L9KA 4KPEC 1B0UA 3LWDA 2ZUTA 1U0TA 1Z13A 3E18A 3SD7A 3DOEA 2VNIA 1CQJB 1YZNA 4G1VA 1RACA 2O3JA 5KU7A 4ZVKA 821PA 5SV2A 2H4YA 3W4JA 4KG7A 5K0EA 1JEEA 3KAPA 1GR0A 7ABPA 1IJEA 3BBLA 5KYNA 5IM4A 2PMKA 3GA7A 1Z4LA 3IURA 1J99A 2O0JA 1NVFA 4GMFA 3TOCA 4BVJA 1EXWA 1KSJA 2UYCA 1R0BA 3B9PA 2I7CA 5JCOA 2B9VA 3BMQA 1JDBB 4BBJA 3IUQA 4L02A 1OQAA 1KGSA 3ESCA 4QXOA 3GDHA 1Y1LA 5H3HA 2VXOA 3CLHA 3EVCA 2VTVA 2XTZA 1MJ5A 1WW8A 3EUFA 3B78A 4OJMX 4ZCSA 3WQQA 1JHOA 4RJ2A 4G0PA 4NNPA 3NMUF 1QHEA 4JLKA 2XTJA 4G07A 2A86A 1Q77A 2RG7A 1Y81A 4MXDA 4NC9A 4IV5A 3H42B 1L7AA 3BCHA 3LCJA 1RQLA 2A84A 3EGDB 4KNYA 1CVRA 4HMOA 2IYFA 1D1TA 4J0EA 3J81k 4JK3A 3RFCA 4Z8XA 1U1CA 5GJWC 4E15A 2ZRCA 5GMOA 1TDJA 1OGJA 2RBKA 3BQNB 4B76A 4NFYA 4CCYB 1IG0A 4BRWA 1JPNA 5EXPA 1QX3A 4J4TA 1XRLA 2AJ8A 1RQ7A 3TS1A 4JI7B 1SXJB 2WYUA 1FX0B 4E3WA 1PHPA 3SWWA 4PZUA 3UM9A 4UM8B 3IAUA 1BCSB 3KOZA 2CLHB 2XUKA 1WUYA 3MGKA 3WL4A 2EZ8A 1KWGA 4ZMRA 5K0GA 1TGYA 4QARA 5DASA 5IJ9A 2PMBA 4YMSA 3KEOA 2DWOA 1KHTA 1OI7A 3QVJA 1IVYA 2C5BA 4EKNB 1E2LA 4W63A 4BUZA 2QL9A 1E59A 1NLMA 1HFJA 4QODA 1YBFA 1AV7A 1KHHA 2CXSA 2JLSA 2EJBA 1EMDA 1KMNA 4B9EA 3MUFA 3GLHA 3P9PA 1NVXQ 3UMFA 1NJFA 1XAJA 4D0GA 2A9JA 2OBMA 4Y1RA 1SZCA 4CUJA 4DKXA 4ZAWA 2X40A 4AS1A 7MHTA 3TTTA 4URWR 1QGYA 2A88A 4ZT4A 4ACBA 4EEKA 3NQ41 2QT9A 4UEJA 2DTEA 5BVGA 3A31A 1EM6A 4B6RA 4RMIA 3DKRA 4KPYA 4H7HA 4UUBA 1WHSB 2HJWA 2JH9A 2M6LA 1B8NA 2GN1A 2UUAB 2E21A 3ZGYA 2VDLB 4I2NA 2OHJA 1E79D 1IZZA 1PJLA 3QOWA 2Z2XA 3QWBA 4O29A 2FXVA 2IU0A 1F2UA 2FW7A 2JIZA 2JANA 2QAGA 2AN5A 2CHQA 2YHIB 3H9BA 2RJNA 4LBVA 4US0R 4B2YA 2VTBA 4YJGA 2HO4A 1CPYA 2VJMB 3E1SA 5JSYA 3WNQA 4ENTA 4FYVA 1E32A 2J3MA 5AQ1A 2R8ZA 4Q7JB 3F6EX 3QMMA 3KQKA 1YSCA 3PHHA 4WKBA 2ZS9A 2VYCA 3P5BA 2VHTA 4Y3UA 2EHDA 1DIOB 5DXAA 5BR1A 3DL0A 4AUKA 3BGVA 2WWTA 1V4BA 3ROZA 4JJKA 4DY4A 3U4CA 1FYXA 2XZPA 3EXHA 1NFFA 3JWGA 4DC1A 4TQ9A 1Q1QA 5GQSA 1JFFB 2J48A 2HJHA 5ILQA 1BXRA 2GILA 4QDTA 2YBEA 1T8TA 3QVMA 3L8FA 3GFVA 4L2IA 2Y1GA 4QELA 3GPLA 4JI0B 2GXUA 3AUTA 5BPFA 3C3YA 1E2JA 2OGWA 4PGHA 3UOWA 1WLSA 2AC4A 3LJKA 4MR7B 3LDGA 1GU1A 2JLUA 4MVJF 1P3JA 1CV2A 1EI9A 2EFGA 2ONZA 1UPTA 1DHTA 2ADOA 2JEOA 1H1TA 2Z43A 4N8EA 3ZE9A 1KMMA 4H31A 3T1YB 4HF7A 3H9JA 4FCCA 5E4YA 3WRWA 2FJPA 1MP0A 1N8NA 2B82A 2IGTA 1SIWA 2WPDD 2ZYVX 3DKPA 4Q9IA 1PJZA 3BZUA 4ZEXA 3DBHA 4NBKA 1J0EA 4WBNA 1JEOA 4XUDA 2PAFA 5HHTA 2EL7A 3NHSA 3DZBA 4IH9A 5CFRA 2Z1MA 3E70C 2BWJA 2ZS8A 3Q87B 4I3GA 1I6KA 1IL0A 2NQ2C 1YCDA 1RS0A 5KX5B 5I5EA 5CYPA 1FFAA 1K5PA 1VKOA 1GFWA 1LK7A 2IP4A 3FYSA 2O5RA 4MUFA 3KSUA 4PGGA 3HABA 1CY4A 4DUGD 5IJXA 1O97D 1KTIA 1RM3A 1FK8A 1T25A 2A1TS 1VL1A 4KQ9A 4PRYA 5EHXA 5ED4A 2FR8C 3V9PA 1JI3A 1GPKA 1UXHA 3K4PA 1CYDA 4LE2A 3CZRA 5LYJF 4U1RA 5EKUA 4H16A 3GIDA 1XZEA 2YN2A 1O58A 3O38A 3A7EA 2GM3A 1NIPA 3BIWA 2P2NA 1WOMA 1ZRNA 2FEMA 2PEZA 3H3XA 3DHNA 3HXTA 4OMDA 5AKGA 2DBVO 2XECA 2XLCA 5K6AA 3B8EA 4LA4A 3MJ4A 2ZR9A 1UOEA 4RL4A 4DLKA 3OEEA 2YBDA 2XYHA 4MWSA 4BLWA 1T8PA 3ID6C 3FCUB 4KN8A 4FYMA 1UBJS 3LC1O 2AUTA 2C2HA 4FMBB 2PR7A 3RLIA 3RSSA 3H6HA 3TL6A 3E9CA 3GUHA 1OLXB 2QZPA 3EXIA 3IH5A 5IK2D 5JAOA 1LCIA 1O87A 2EFEB 1RU3A 1V7QA 2AV6A 4GP6A 4KI0A 1MOSA 4BDSA 1BXKA 3FGNA 3NOQA 4FS3A 2ZE7A 3A2NA 4CMEC 1TCBA 1KVRA 2X1HA 1FZQA 3B6EA 4HOYA 1OFIA 1M7BA 3GMSA 2VYND 5FL7D 2XT9A 3UAGA 3IKTA 1KPHA 3MFYA 1F1BA 5AP9A 1SZDA 1Z7BA 2AOXA 4UCQA 2JFVA 1NURA 3UMBA 1ZGAA 2CMGA 2IYSA 4WACA 2O6HA 3BL8A 1I7DA 4JB3A 2WJVA 3V8MA 5C32A 2WOJA 3IUJA 5ALSA 1TTHA 2FUNB 3QBEA 3AHJA 3T9AA 1YWGO 4OI0A 3TVYA 1B0ZA 2FPRA 3C8UA 3D7KA 3L0PA 4JH0A 4BRZA 4IXTA 1L4GA 5EIAA 5B30A 1EFDN 3KOYA 1CYEA 4WJKB 1KJQA 3KD2A 2BN4A 5IZ4A 4I66A 4PPQA 4JNCA 5DM4A 2BKAA 1I32A 1FDWA 1OA0A 1F5NA 3DV0A 4HDKB 1T3GA 5T8KC 3R7BA 3HG7A 3K0HA 3CZ4A 8MHTA 3MTGA 1TPYA 2BT4A 3G8CA 3EVFA 3AY6A 1WPQA 2X41A 1T0BA 4IR7A 2HA2A 4EENA 4TUYF 3MMNA 1K0FA 3F46A 3PA6A 3SXUB 2H2IA 4MIKA 3DFUA 2JDID 2CD9A 4JOQA 4RMHA 1EE1A 1KR5A 3I01M 4BO6A 1XCGB 4UU1A 1YGPA 2Y67A 3B7GA 4G0YA 2AGVA 4KTVE 2NZYA 2F1IA 3ZWPA 1Z7EA 4EJSA 2I6XA 1LDNA 1V8PA 1Z4MA 3ONDA 4MPJA 4WRRA 4D8TA 5BXQC 2JKVA 4G36A 2HCFA 3USZA 1Z2DA 3ZE0B 5JDIC 4MROA 1LV8A 4WPGA 3O91A 4GF5A 5ICGA 3ECCA 5CNKA 1WXEA 3TJRA 1IWOA 4ZIRB 3WB2A 3ZQUA 2V74B 1J0DA 1MOPA 1CUBA 2CE7A 4WW0A 3AESB 2FU5C 4FGUA 5JARA 4F38A 2QW8A 2AMJA 1R9GA 5CH3A 3KPWA 2YNMD 5AW2A 3AVUA 4ZDKA 1VHLA 4PLWA 1G3MA 4X24A 5AJWA 4D8YA 1P6QA 2CSXA 5AKLA 1HLPA 4Q7EA 1AHHA 1EA7A 2IYXA 2IZOA 1KBOA 4EF5A 2ERYA 2QUZA 4PFKA 1IBCA 4QUJA 1TVCA 4MAMA 5C8DA 2WD9A 1J42A 2O2YA 4OHVA 4QDUA 3T9FA 1K3FA 5EE1A 4CRWB 5DNWA 2JLAA 1H3FA 5JRZA 1ZBQA 1LXCA 5C5IA 2Z4SA 3TDKA 4AC9A 5LU8A 3LGXA 4OBXA 3ASYA 5LYJB 1EJBA 1K89A 3C87A 4CDNA 3O0DA 4X60A 3CWZA 4HS4A 4UUAA 4X7MA 3W1EA 3OT5A 1I7PA 1RHKA 3FCCA 4GECA 2NTVA 2ZCVA 4X54A 3CLUD 1XCOA 4P4TA 4RVGA 1CUDA 2QN9A 1R16A 3AOEC 4OGKA 4X45A 3RTEA 2ECOA 1G3QA 3OE7A 4YJ3F 3VZSA 3WZLA 1A5TA 1NBHA 1TKBA 1SEVA 4MR8B 1OCEA 2B2NA 2R00A 2QN1A 3GVHA 4CU5A 5AUOB 4Y7DA 2OLEA 3EIXA 4CE6A 2HA0A 3OURA 4ETIA 2XGSA 4U2EA 1F0NA 3I2GA 1FTGA 5EMNA 4R9SA 3T1NA 1TMKA 4YYZA 5HJ5A 5I9LA 2VHYA 2FSFA 1IY8A 1L4KA 2A5FA 3V48A 4TMKA 1E94E 1E4EB 1YRBA 4XKJA 1W2GA 1YB4A 2QR3A 4XCXA 1DKMA 3C1AA 5C3UA 3I2YX 2FSVA 4GWGA 3X44A 4EKGA 1BS2A 2GAJA 4H17A 2R68A 3WYFA 4PV7A 3QVTA 3P19A 4PC6A 2VZ0A 3RSLA 3VOAA 1XPRA 3NRCA 5T41A 2RH8A 2ZETA 3LO5A 3PQ4A 1AKWA 1Y9ZA 3T95A 1G2OA 3PCXA 1H8HA 1WMFA 3M49A 4G1UC 4LCJA 2R1ZA 3RH0A 4ALJA 3KVNA 4RELA 3ABIA 5A6SB 4XFKA 4OIFA 5L3QA 5IF9A 1R6AA 2VAXA 3D1LA 3MJDA 4F4JA 2RBEA 3ZD6A 1SB8A 3T06B 2VJLA 2V0GA 1F3OA 1QDUA 2D8MA 2VDRB 3AUYA 4G6ZA 1GL3A 3B9QA 2OG1A 4KHZA 1DRWA 1QR6A 5AK6A 3U80A 2FPUA 1HDGO 4BGVA 4LCEA 3DBRA 2AEFA 4YRRA 3VZBA 4A0HA 2NP7A 3R77A 4PAQA 1RI2A 4XYBA 4FHGA 3VR2D 5LUAA 1QFSA 1XMQB 6REQB 3BMXA 3EE6A 4TUYB 1XZPA 3NJRA 2KBFA 2IU4A 3L6DA 1UOPA 1VKZA 1VL0A 4URZR 4ZALA 3URMA 1BJKA 5A02A 4BGIA 4FFNA 2JAPA 5E0KB 1DBSA 4S1VA 4X91A 4LY6A 3DL4A 2HK6A 4UUPA 4DYVA 1RWKA 3BFJA 2N75A 3JYQA 1BOOA 3U9SA 3O8CA 4R7ZA 1IPFA 4Z9XA 3RYIA 4RA9B 1L4UA 1R8YA 1DG3A 2IBSA 2TECE 1DTWA 3KJHA 3UG7A 2XOKA 3HU2A 1Y3BE 3GEEA 4LHWA 4LYAA 5KVAA 2O0KA 4UEWA 5BNWA 3F6YA 2GCOA 2PRJA 1MEJA 4Q4CA 1YS7A 3O2SB 1BA3A 1WPGA 1PFYA 3GP5A 3RRNA 4MKRA 4MRRA 4GLLA 2O8CA 3VI4B 4QOSA 4K1XA 4MRMA 3X1YA 4CDMA 1GKUB 4UDYX 1X0VA 3KWLA 2QOEA 3OJLA 1LUAA 3EQ8A 4XRRA 1KMCA 3TKAA 2CW5A 3VR5H 4MMYB 4CV3A 4CT4B 1CHNA 4KVFA 4EL0A 4MICA 2RHJA 1VRCA 2C3YA 5FPYA 1YH3A 4N5LA 3E15A 4K8RB 3QVUA 3WGTA 2AYYA 4P3OA 3EWSA 1YJXA 3TTXA 3H99A 3IAS1 3JQ8B 1R9MA 1EQ2A 1EFAA 1J1UA 1TF5A 5DEOA 3AKDA 2ZBRA 2PHZA 3M5WA 2ATIA 1IU9A 2G6BA 3GVCA 4QUHA 4YCJA 2X9NA 3OF2A 4YP1A 1WTAA 2VSNA 2X0DA 5D3MB 1JJIA 3FD8A 3K5HA 4KWCA 1Y5MA 2EBHX 2G6TA 4LHYA 3VI3B 1OH7A 3P4YA 2OHIA 4P4UA 1EINA 1DFIA 3ITNA 4M46A 4WFIA 4KDCA 4LDPA 1U3UA 3F6SA 3KV1A 5IARA 3MTAA 2Q1UA 4BPRA 2OY0A 4BMSA 2QL6A 2C4UA 3RKSA 3ZLTA 4ME6A 3ZIAD 4YJ3B 4HQLA 3CB4A 1CS0A 3O21A 4BNJA 1BKSB 1L5QA 2ZRNA 5BSKA 2A9QA 4MKIA 4DRXB 5C37A 1CRQA 3H86A 3BRWA 4LY9A 1YB2A 4R1MA 3SSNA 3ZQKA 4AZ0B 1MVLA 5DGTA 1USWA 2D5IA 2YUTA 3A9UA 3AFNA 2R87A 1JVSA 5THXA 2O3RA 4XQGA 2HTEA 1XF9A 4N39A 6ADHA 1DJPA 2XNCA 3R9IA 3KJIA 1ZMRA 4RZQA 4DC0A 2C9MA 1T9GS 3D4BA 5KJEA 5FPHA 3D0KA 4QKQA 5LD2C 3Q6IA 5KMGA 2J0UB 4IBOA 2JGIA 2RD2A 2VI5A 3FNGA 4OSPA 3OZCA 4AURA 4OYHA 2WRZA 4PCLA 2BFWA 3ISJA 4ZQIA 1E0KA 1M2VA 3OOEA 5JCZA 5KCMA 4G86A 4RZUA 1AQUA 4K6CA 2G8LA 4OJTA 1NXWA 1H0HA 4HWRA 2PSHA 4OG2A 3LWNA 2GYUA 1PR1A 3SX2A 1BJRE 2LPMA 2QG9A 4OM8A 5CUQA 2VL7A 5AM4A 5EY5B 3REQA 1XJCA 4HDMB 5ARDA 2UAGA 3M1LA 3ZI4A 1DUSA 1OOEA 1U2TA 1VJDA 3FDZA 4M8NE 2Z8YA 4C0XA 1E20A 4MLPA 5FWDA 4D74A 2F55A 2GM4A 1L3IA 4XIGS 1YE8A 3TMKA 1T91A 2HR1A 2D4AA 3FDIA 1G8MA 1KYIA 1D03A 4PRKA 2QENA 1KJJA 2BR4A 4G41A 1DAFA 3TD6A 3KQHA 5LU9A 1NG1A 3Q7RA 1V8OA 2P91A 3ELYA 4PC1A 1MC8A 1G291 1P5JA 3L43A 4XVCA 1UXJA 5H9VA 2XDAA 3OIFA 4YO7A 4IAOA 3TLEA 4NVRA 4P98A 4XEHA 5GP1A 5TJ9A 3HXQA 3KU4A 4EO7A 1RDFA 4CLOA 1NLUA 3JQFA 4A5SA 5DHAA 3L6RA 2G0NA 3TUJC 5G3ZA 2FPGA 4PZDA 5IFLA 2VA8A 4IQ4A 1FS6A 2PMCA 1TLFA 3EBOA 5BR7A 4QU5A 1VE1A 3UFXA 1YIOA 3VR6A 4FC7A 2DAPA 4WUVA 3WLNA 3JWEA 1N2JA 4F6RB 3B85A 1FSPA 2OZVA 1LZKA 1VPDA 3FY4A 2VP5A 5IDWA 3E5HA 1C8KA 4ZC1A 1A9XA 2HMVA 3PDIA 4BX9A 3ODGA 4KLAA 5L3RA 4YCAA 4BLUA 2INGX 1QBKC 4LGYA 2Y92A 2V0CA 1JAXA 2YVQA 1TQ2A 1L5KA 5I7OA 3QXCA 3SN6A 3PF8A 4P93A 1E3SA 2J3KA 2XUDA 3X2EA 2ZWAA 3SYKA 1KZ7B 3SQWA 1AO3A 1JHAA 1UEXC 1XEWY 1Y5LA 2QE7D 5SZHB 5KQLA 3LXUX 1ZUD1 1FXSA 3KEGA 3OZSA 5FWYB 2CL7X 2BONA 2GEDA 3PWZA 5EIWA 3TD2A 4EG1A 3K9LA 1P2SA 4EY8A 4NXNB 5EQJB 5CB0A 5YASA 3F71A 3T0IA 5IYZB 1R7RA 1LI5A 4K5QA 2WVGA 5JYEA 1X80B 3E53A 1Z5GA 5DH9A 1ND6A 1FJ2A 1J2JA 5ALOA 3DEYX 3PSHA 3RF6A 4EGCB 2P9YA 4LTDA 2IZ0A 3JQGB 4P6VF 5JZVA 2CXUA 1UBEA 2IOYA 1ZKDA 2XEDA 4UXIA 4F6LA 2HO5A 1DDIA 2FQYA 4HC4A 3K05A 1D4OA 1YKSA 4C29A 1UM9B 4W82A 4N18A 3QUTA 1SUWA 1XMPA 4KODA 1W5EA 3L6BA 4HGYA 3VR4A 4YAKA 1YZHA 2QTMA 1AXGA 3CCCA 1T6NA 2MSDB 2Z83A 3INRA 4D02A 1U2DC 1ZZGA 1LJLA 1PBTA 2IVFA 3N8NA 5FTMA 4GZLA 3HNOA 2OLJA 3TLMA 2Q4OA 3V2UA 2OFXA 3ZWVA 1YK1A 1EWRA 3ES9A 3Q5EA 2PGAA 1PKEA 1U0EA 1Q3KA 2BEJA 2BY4A 2GM5A 2Q0SA 3CZAA 2BBOA 4XQ9A 3OUTA 2IYUA 2Q1TA 3C1UA 1YD7A 1XKXA 2YFHA 3M81A 5B2FA 2OAQ1 2JEYA 5DRYA 3TCNA 1TF2A 1IMOA 2HRBA 3IIEA 4RZXA 4ZQGA 1KC1A 4EEXA 5EJGA 5JXGA 3V6MA 2H9AA 4RFVA 5TVGA 1ODFA 3K92A 2C8JA 3C7KA 2JZCA 2JI9A 2R6ZA 2AL7A 4U8GA 3BGSA 5IVDA 1MB0A 2HRQA 3GRKA 3NUGA 1KZYC 1QANA 2HIGA 2Q5HA 1VMAA 3VDRA 1VMKA 2ENUA 4R51A 4LF7B 3DR3A 2PFSA 2IP2A 3HKCB 5C5DA 1N2SA 1QIEA 4E5PA 2XZDA 2B4YA 4BV3A 1PQUA 3ZE1B 5JZ9A 1Q1GA 4X3PA 2QSJA 2F3QA 4V2IA 1FRNA 1RXEA 2VRCA 4WNAA 2RCNA 2EWWA 4PO8A 1V5FA 2X0IA 3LS2A 3V1YA 2FPLA 4J8PA 2J7PA 4UHKA 3LW8A 5BSUA 1WXHA 2P2ZA 3ANSA 3DOFA 1V16B 4XCQA 4ALIA 2NU6A 4Z3KA 5K4GA 1BS9A 3G5UA 5J2TA 4LYHA 2QR2A 4FR5A 5TQ0A 3JAWA 4LHXA 1G20E 1S5PA 4PANA 3WR5A 1EWTA 3IDSA 1UPUA 4TROA 5EWLB 4WJZA 3E6AA 4GVLA 4MMXB 3C85A 1JQAA 3TZKA 3Q7SA 1L5OA 3L8DA 3HMKA 2VJDA 1UC5B 1JU3A 4IH4A 4ATNA 4N12A 5DNCA 3VOSA 2VJBA 2ZRJA 4CLRA 2R7KA 2EJUA 1SG9A 2NNLD 2Z8XA 4HLCA 3CNOA 2AI2A 3CVJA 1KY4A 4XW2A 4Y7CA 2DLCX 1HY3A 3OU6A 1WB5A 5TY0A 3CF0A 4RD6A 1J1ZA 1ULBA 2ZTLA 2VSFA 3Q0TA 1MGOA 2IL1A 4A0QA 1XKTA 2AA3A 3ZDAA 4ZCPA 1B0PA 1SOAA 4Q3OA 4KACA 1R0XA 2FWIA 3CRNA 3ZWDA 2I76A 1P9NA 1IHOA 4DL9A 2QT1A 4BMDA 1YC2A 3NOOA 3RVLA 4HQ6A 1JIVA 2WJGA 1DZIA 2AZMA 2GCPA 3H2HA 1PJCA 3WYGA 3SSOA 4O4HB 4HDCA 1RRMA 4UCWA 4A0SA 4DJDC 2OM2A 4Z0NA 1EWKA 1T0PA 2KWIA 4BTEA 1N9ZA 1WCIA 1ZCAA 3PVCA 4M0FA 5M29A 1X8KA 4PQYA 2BTQA 2ADFA 2HHAA 3N0VA 4YYEA 2X3YA 1Q57A 4GEGA 1NWCA 2H1FA 4QPPA 4TTIA 3IBSA 4BNIA 4B3GA 4LYYA 3A6PC 4Q47A 3ASZA 5HA5A 3D7SA 2Q9BA 1OKKA 4NYMR 4B35A 1FMFA 3I3SR 4OHXA 1VHDA 2AJDA 2BGUA 3UYKA 2R9VA 3R20A 3UJBA 5L53A 1IE3A 2R5FA 1OI4A 2WHPB 3NDJA 4E5MA 5LQCA 4PSVA 5FH9A 1Y5NA 2NAPA 3AEQB 5BWNA 5CU7A 4EVQA 3HE3A 1I4WA 3CCFA 3DZIA 2HLDD 2QAIA 1T5IA 5B1SA 5SICE 2UZ0A 1EEXB 5HF8A 1G4HA 4HY3A 4J91A 4YAOA 4LN1A 4RANA 4RDHA 3DDUA 3RVRA 3O8RA 4Q21A 5DNVA 1USUA 4X20A 3LLCA 3JR3A 4OL9A 3JXEA 2IBTA 5I7UA 1RAIA 2CVHA 2DPGA 5E1MA 2V8OA 2O7SA 3QKUA 4NI5A 2GUWA 1EK0A 4W99A 3QVGB 1T36B 1QHHA 3OZFA 2X6QA 5HVNA 1DX9A 1CUIA 2HQOA 1FYVA 2BGWA 1DWQA 1T15A 2CNBA 3RHFA 3OT1B 3RW9A 1XZNA 3VPFA 1BMTA 2DFKB 3G1TA 4JOBA 5SZKB 1B3BA 2V7PA 1O5OA 3GZNA 1R4MA 1CJBA 1O97C 1C8BA 1HV8A 2RHOA 4XYGA 3U40A 3VVBA 5HKOA 4TV9A 3VPGA 3WVNA 1YU9A 1NRIA 2XNDD 4CL8A 1PLLA 2PSEA 3GGDA 5H1YA 4ML3A 1FVOA 2G17A 3NH9A 3WIEA 3ZEAA 4BYMA 1CUVA 1HL3A 4MUKA 4CM3A 4PONA 3PHJA 1CBUA 1KE2A 1P5HA 4KWIA 1VJ1A 2ODTX 3GLGA 1TZCA 1GAEO 2PH1A 2PUTA 3B89A 1KA9H 3NT2A 3ZWKA 2OD2A 1JJBA 1WUHS 2VZLA 2XRFA 5LQSA 4POOA 2FEOA 5GM1A 3E7DA 4YEDA 3KXDA 1RIIA 3N0WA 2ODNA 2V6IA 3PNLA 4OP3A 4AMBA 1A1VA 1CNFA 1QF9A 2QRKA 3TTSA 3A3KA 3JYLA 3ZHBA 2Z4TA 1GU0A 1BWRA 3MOGA 2ZIVB 1ICEA 3JQ7A 3R3HA 4FOOA 4HGRA 4IIFA 4J16C 1CR4A 5EP4A 3RDPA 5HKKD 1N36B 1NBEA 1NJ2A 2ZB8A 3B1ZA 2AIRA 3E3MA 3ETJA 1X1CA 3H7IA 3DMHA 3QWAA 3WIOA 3OPXA 4F9FA 1E8NA 1XX6A 2HJVA 2IU6A 1FSZA 3R9KA 1S1CA 2AK3A 3HCEA 4OJQA 4OQ4A 1FQKA 5EUMA 2NSJA 3GJ4A 3M5PA 4EGFA 2BUBA 3RJZA 1LU9A 3GGGA 5HXAA 2RI0A 4IDQA 3MWEB 2FX2A 4CXMA 1P9OA 1PFWA 2XDQB 2B6HA 1BC5A 2VCYA 3GPCA 4LVCA 1KH3A 4WUTA 3UGKA 4ZCIA 3IE1A 1W7AA 1DAOA 2WJ6A 1YJBA 3P2EA 4JASB 1LGYA 3E2PA 4B43A 5K1ZA 5FAKA 5ERYA 3HDTA 2X58A 2C4TA 3G9ZA 3QZUA 5LC1A 1ML3A 1I4OA 1ZH2A 2HSGA 4HWKA 1N8TA 4WV3A 3TM5A 3LC7O 2ZKLA 4I4IA 3VM6A 3WK9A 3SF8A 1XOIA 3IS3A 1A7JA 2IYLD 2Z04A 4CMKA 1N2XA 3BEDA 2VLBA 2RB4A 3GMIA 5FPPA 6LDHA 5JNTA 4HQNA 2DEUA 4CM5A 2EQBA 2CHFA 3EZLA 4ZDJA 3AI2A 5A06A 2YASA 3HFGA 2PLRA 5AW3A 1V3QE 2JIOA 3HP7A 2IXFA 5AQEA 1UQUA 2BZSA 1G5IA 1RCTE 3TF5A 2IIVA 4WBXC 4MDFA 4GMHA 1S3SA 2O2JA 4MEAA 2BW0A 2ZR0A 4QUGA 5EJIA 4C0KA 4KUEA 4IJ6A 1KH2A 3C6YA 4E14A 2B7CA 4QU0A 5B3JC 5DI9A 3BH0A 2I4TA 3RC7A 1ORRA 1O03A 4N0DA 5L3ZA 2G08A 2SHKA 4RLFA 2YRXA 1T5DX 1XMSA 5EMLA 3RFFA 4BEVA 5ICEA 4B3DA 3V4SA 3K5IA 4KMRA 4NCJA 4B33A 2DTDA 6AT1A 1ZLYA 3HYRA 3KS9A 1JMYA 3GEPA 4M88A 3GP8A 1BYUA 1SRRA 4CIVA 3MJTA 1ICIA 4PC3A 5U1PA 1P2VA 2XB8A 1DDGA 3B5EA 3J7TA 5JFGA 4G0NA 3FLMA 2OBXA 1V1MB 3SKVA 4GRIA 3MILA 3KC2A 4HYQA 3SR3A 2RK3A 1FSSA 1L3BA 1H69A 1G8PA 3NH6A 1GNLA 5JBIA 4A15A 2H1WA 3BGIA 1V11B 2C5LA 2G9VA 3PHIA 4U2KA 3T5MA 5KYGA 3TK1A 4ZKDA 1HGXA 1OFGA 4QUBA 2YNMC 3UJ3X 1F48A 1LVHA 3KD3A 5EUQB 2O5VA 1ATZA 1PNVA 1SK8A 3D59A 2NVOA 1B74A 1ODKA 5FA8A 1B6GA 1NLZA 2QL5A 3AWIA 1BS1A 2YKGA 4BX2A 4DCVA 3UH0A 4CR6A 3ZEIA 3LCCA 2BTEA 2QTTA 4FEGA 2QUKA 1OFUA 2COUA 1TMGE 3BD9A 4NMXB 4QOJA 4TWIA 1RLMA 5TQ2B 4Q3DA 5BSMA 5I4IA 3IQXA 5A71A 2XSZD 3W5CA 1XQVA 2OCXA 1ZA2A 4L5BA 4E09A 2UUCB 4UUQA 1VGQA 3KDPA 3TIGA 4EYKA 4PAGA 2A1UA 1WW3A 5EWJA 4DABA 1AKUA 1A9ZA 1GHTA 1NYLA 1WZEA 3HB7A 3L1UA 3D0QA 2MYNA 5ITWA 2JGEA 1H4SA 4XFDA 5EWMA 4KR0A 1HRKA 1MO5A 1PKXA 1U8CB 3MCWA 4U2DA 4IILA 2NZJA 5GZ6A 5IUJC 1R74A 1UWCA 2E4WA 1AKRA 1P4SA 2PVCA 4ER6A 2A94A 2AG1A 4YV0A 2DR2A 4LI3X 2IPNA 4O33A 5CXUA 5IPFA 5DISB 2ZJFA 1NUHA 1M6HA 1Z6PA 1J2YA 3N9IA 4H60A 5ECWA 4B3XA 4EECA 3AV0B 3AO0B 5A5GA 3GARA 3ZHRA 5A5FA 1A9YA 3G9XA 1A1SA 4J2HA 4TMTA 3EZNA 5DIFA 5J40A 3SC4A 3BXGA 3M6XA 3L7KA 4BX3A 1P6UA 3NTRA 4C7OA 4ZQFA 2MSWA 4EYEA 2DMRA 4FW8A 5I5GA 3TNFA 2JCYA 3WLSA 4O8CA 3UWMA 1ZCZA 3I45A 3TG2A 2C2WA 1C4OA 5IM4F 4LX0A 4WH0A 3GLFA 3GOHA 3I9OA 4JJZA 1UF9A 1YQEA 1Z38A 3GJ6A 3QI2A 1E6CA 5ICCA 1R6UA 4YCNA 3I42A 2J3LA 2IOFA 2MSNA 2ST1A 4KRGA 4XVQA 3L7MA 4PICA 2IU3A 1QE3A 3G2JA 2OO5A 2ZSKA 2FPPB 2B8EA 2BGNA 3R5HA 1PG2A 4PBSA 4R68A 1F6WA 3T7JA 3IHWA 3U49A 4G4SO 4UE2A 1UQTA 3EGXB 2PBZA 3NUQA 3ISTA 4FFWA 3BTUA 4B8YA 4B8ZA 1KKUA 1VKRA 4AIIA 2ROQA 4FJ2A 1NNLA 1X8JA 3T99A 3FZQA 4HDRB 4M9SA 1BMFD 1SMKA 3TNDA 1IXYA 1IZ7A 2C07A 2WC1A 3KQVA 4HGPA 1EP1B 5SZJA 1T2DA 1HDRA 2VF7A 1M5RA 2IY7A 1SFRA 1GZ4A 1XKLA 3C6ZA 3DZKA 1PJSA 3GUZA 2N1BA 2HF7A 3FYCA 3NDPA 3PFHA 4IQ0A 4UNIA 3X43A 3HFRA 4YRFA 4RHFA 3TZBA 1ZESA 1JZQA 3KSDO 5HCUA 3BA1A 4CQLA 5JZBA 2VJPA 1ORHA 1X9IA 1OFUX 1PT9A 1W48A 4NBSA 5IMBA 1MAVA 3EEQA 3QXSA 4M8SA 4XDHA 3VAAA 5ITSA 5KYXB 5K0NA 1KOGA 5BV7A 1GD1O 1C3OA 2ZBVA 2ALJA 4FTWA 3SHTA 3M5DA 1M76A 1V25A 3UB3A 1FIUA 1A0OA 3Q6MA 3R7FA 4E5SA 3ZI0A 5KOHB 5FOVA 1I51A 4WY8A 5E38A 2YQ5A 2HF8A 2YY6A 1GFSA 3BRSA 3AR9A 1E2UA 1CCWA 4RPLA 1ECPA 2QD3A 3G59A 2X0KA 4ZYVA 2I54A 3X1KA 5DRTA 1H22A 1RTTA 2CXTA 1G98A 3KUCA 4H18A 1RZ3A 4KYIB 3HKBB 1ZR4A 1XP8A 3OZAA 3AEYA 3GJ8A 4JEMA 3FSRA 1IOVA 4QBGB 3VR4H 3SZGA 4MTCA 3W4KA 4F4DA 4F93B 1C0LA 2HOQA 3HA7A 1QAOA 5E8JA 2HGSA 1M2OB 1POXA 4ASUA 4KQ2A 3TW8B 2TMDA 2VHEA 4O6VA 3U5TA 3TW6A 1BU8A 3UCFA 3F5MA 1LI7A 1HTTA 2A30A 1XRPA 5CT8A 3UJ8A 3VZRA 1KVQA 1NJ6A 3L0BA 5FF9A 4DARA 4X1IB 4EY7A 1E6UA 3QLVA 2UU9B 3V7FA 3C3MA 4TM7A 4BXOA 1PNOA 3FMGA 3LLUA 4OYLA 1U0SY 2NZUG 3BC1A 4RF3A 3TTUA 2IDZA 2OBBA 1RBMA 2B8WA 4ZGWA 3NTUA 1JKIA 3MWFA 3FCOA 1CT9A 3GVXA 2J3DA 3IQDB 3GFBA 5KNBD 4FE3A 2HMUA 3GRVA 3UN1A 3ZBTA 4CUZA 5A0VA 3WK4A 1SGWA 4ZOLA 3RVMA 2X9VA 1W93A 3STYA 1X1TA 5K0JA 3K0BA 3K8ZA 2AMFA 1NE2A 3SPXA 2ZRBA 4HX2A 4BS9A 1SM4A 1A4IA 1M34B 3J81A 1U0JA 3LOQA 4P80A 2CVPA 1FXWA 4EPTA 4LJSA 3ISVA 4QT0A 3CR3C 4KPUA 4GW3A 2Z30A 2ZTHA 4QZVA 4QYIA 3CXRA 4CIXA 4L9AA 2FFAA 1ULUA 4JC4A 2Q5EA 3WLOA 4B2IA 4YY3B 3ZDFA 2ENWA 4GX0A 3S2FA 4C3ZA 4ER3A 1P1BA 2O2IA 3K6KA 1C4KA 4E30A 1U3FA 3NZEA 3LO8A 4NAHA 1QRSA 1VYVA 1XN1A 1YRWA 3TQOA 1KRXA 2EERA 1UC8A 4AG6A 1YQWA 1Z4IA 2VOEA 4IKPA 3HNPA 4QQ8A 1U9ZA 2PJZA 4M1ZA 2DWCA 2DR0A 4PCUA 2GWHA 3C48A 1L1EA 4UMVA 2VAWA 3CKYA 3A70A 4I55A 5DBIA 3BXXA 5EMKA 5GV7A 2XCLA 5COBA 2R66A 5HM8A 2O3SA 1RP7A 2RIPA 2E85A 1T5LA 4G0QA 2E89A 4NCIA 1LRKA 3BXOA 1PQYA 3W8EA 2CNWA 4D41A 4DEYA 3D2LA 3WGGA 3K53A 3AHFA 3KM0A 2I5PO 4JFAA 1SHLA 1E7QA 3H19A 3IVXA 4O5AA 3W04A 5HPYB 1XQWA 3LSYA 5IDYA 2DCUA 1N33B 4GRAA 2YC4C 1NI4B 4G5RA 2PVPA 4AO6A 2C94A 1WU7A 1X7XB 1JR3A 2JJYA 3RRXA 5BWMA 3J80A 1TQ6A 4H7JA 2QROA 2HPAA 4HZGA 1ZD8A 5U4XA 3LT1A 2I9KA 3HWX1 2HLPA 2REOA 3FWZA 3QBDA 4MWEA 3JD4A 3AR5A 1AT1A 4B34A 4LYGA 1SWVA 2AC7A 1XEFA 3D7MA 3DLIA 3LQ2A 4QOEA 3UHJA 4HT3B 4H7DA 4UM9B 1ISJA 5MFPA 5IJ9B 4AJOA 3I0MA 1RRGA 3DFFA 3QUQA 4CG0A 1OZAA 2HU2A 4N6OA 1QO0A 1E3WB 2K5UA 5JCJD 4B7XA 2DXIA 4MPRA 3LUBA 1M7HA 2CDCA 3PIDA 3QOXA 3QV2A 3ZHTA 5E3HA 3VPDA 2ZJ8A 5AVYA 2NUBA 2REBA 1WDWB 3JASA 3GLHB 2WMYA 3PLNA 2FMFA 2Q4TA 4WVLA 4B74A 4IIJB 1LDYA 1H2YA 1C1XA 1CUEA 5DYNA 4G85A 3E5RA 1A88A 3DEAA 4K3UA 2D1TA 1PJQA 3GXBA 1SOWA 2NT3A 4YJKA 4HH1A 4OPMA 2FZLA 4TS4A 1NUUA 1KYWA 4ZVTA 3TLBA 3WGQA 1C4XA 4CL3A 5BVGB 2VPXA 5JSZA 5G1OA 3WLFA 3Q7EA 4HI0E 4GPTA 3R7AA 4BO3A 4KR6A 3ZVRA 2RJOA 3KQPA 3NDBB 3WLKX 4JAVC 1OR8A 3E05A 3RM3A 3A6GA 1E2BA 1MT0A 4LS3A 4M99A 4QWMA 4I46A 1QTRA 4U3JB 1D0VA 2J9XB 1YNOA 4JROA 5T67A 2QAGB 1O1YA 3AEZA 4KLCA 4PSKA 4PG8A 5FI1B 5BR4A 2CSUA 4E13A 4UFPA 3LP6A 2FOLA 4M1YA 3GCXA 2AN4A 4Y1EA 3UCEA 1EWQA 4KMSA 3O93A 2R86A 2PDAA 2XMZA 2JI7A 4ZU6X 2FEKA 3IIMA 4Y2HA 3Q85A 4ZO7A 3A1CA 2A35A 3EFHA 1BGXT 4WLNA 5CBKA 1DXQA 2W6ID 1EX1A 2ZYIA 2J59A 3VKUA 1J5PA 4MP6A 5EJ6A 1OLSA 2E1RA 1ULTA 3O47A 4DV6B 4F4CA 3EXHB 3ZC3A 2IF0A 1VZ2A 4UAJA 3VNSA 3OQMA 2UUPA 5LB2A 3A2KA 2XYPA 2H5IA 3KJQA 3ZDCA 4JT9A 3L1VA 2O5CA 4CFSA 1B76A 3ORHA 4L2IB 4TS1A 4X66B 4J3FA 2OP1A 2A6PA 2X2FA 4HRXA 4JL6A 2WMNB 3M70A 2LCQA 3OY2A 1EFPB 1Q11A 4AZWA 1O5TA 4IDAA 4Z7OB 3UW1A 1DQZA 1XD2A 3OPNA 4KUHA 2D1SA 3ZWCA 3E9YA 4Y6SA 1VHQA 5IG2A 4RIEA 1CY8A 2X7XA 2BFDB 1K88A 4QQNA 2H1RA 3G0IA 1XGKA 5IRCD 2UZ1A 2ABWA 2ZZNA 3DBHB 2P9QA 4WBNB 3BJRA 5DHSA 4FUTA 1P29A 2VRWA 4CZ2A 1UJ4A 2R97A 3MQFA 3E3NA 3WRYC 2YJ6A 1E9BA 1KEPA 4IMIB 5F52A 3UAWA 2X8LA 2I1WA 5GM2A 3UQYS 3CUKA 5H80A 1KAHA 4TTQA 2IWRA 3SYNA 3THWB 1EHCA 2I55A 2ZRHA 4IZHA 1YO6A 3GPBA 1F51E 5CM9C 5HX7A 1COWD 3EZ7A 1FQJA 3GJ5A 5HIIA 3W77A 1XZKA 4HZUB 3RS0A 4P33A 4MV4A 3A27A 1QH0A 1U1DA 5IAKA 4AJHA 1J06A 2GN6A 1TU3A 1JMVA 1JHMA 1UPBA 3KQTA 4QOGA 3THSA 5G53C 3FIUA 2P41A 2ZJ5A 4Q1BA 3WAGA 3OCZA 1K0UA 2C54A 2FN7A 3AP3A 2Y99A 4XJVA 4KNVA 5LKRA 4L76A 3MTDA 3CNEA 4RV5A 2X2EA 1M8PA 1SCIA 1Z39A 2JGJA 4PZ9A 3JVVA 3E7WA 3LGSA 3Q9UA 1UJ5A 1SQ0A 2G04A 3C15C 5KNDA 1NR1A 2FXIA 2Y1EA 3VKHA 3WICA 4M21A 4QUKA 3NNSA 4YJ2A 1P1CA 2FQXA 1ONOA 1W25A 4DQLA 4P3PA 4YIKA 5CVJA 3M6IA 1EM8B 4WK0B 3UATA 3R74A 2GEUA 3AYZB 1QIIA 2R8XA 4QICA 3PSAA 5C8VA 1K3UB 4P0PB 1JZSA 1QFMA 4DN6A 5LLDA 1C1DA 2QTZA 3FCSB 3OF3A 4RBNA 4EDHA 5B2ZA 2OECA 2QMOA 1LV7A 4L3OA 1JECA 5IFKA 4PFJA 2YHAA 1XZIA 3AZOA 5JPDA 3LHFA 4IINA 3TXXA 2BGTA 4JODA 4LPKA 5JNVA 2IYYA 4N3CA 5ALUA 2G1UA 2FW9A 3AK4A 1A8SA 7YASA 3AI3A 1Y1PA 3IEIA 4O25A 1JYFA 1NJ8A 3NATA 1X2EA 4O63O 4AAYA 1YQGA 1FRVA 1YZFA 3CG4A 5BSFA 1IQ0A 2ZANA 4TLEA 2CLSA 3T7TA 2EWVA 4ZZIA 3C8MA 4MVJM 3D6HA 2HGZA 2ZM5A 3KJNA 3DMRA 4AUNA 1GOTA 3CT4A 3R5JA 1AF7A 4P53A 2A9OA 2GM9A 4PIPA 4BJ1A 4NH0A 5EYPA 3ANLA 5KTTA 2CXXA 5HK8A 4G0WA 3H1GA 1KIAA 5KSYA 1JFRA 1FFHA 2P2YA 3EVGA 2FQ1A 3OICA 4M9QA 4OTZA 5EHNA 1SC1A 5F21A 2IPOA 3PFGA 4MJXA 4QO8A 3IPRA 3SNHA 4E2XA 4CLXA 4BC1A 3INTA 4JI1B 2R6HA 2RK4A 3DV0B 2PUGA 2A59A 1O6ZA 2VDQB 1Z07A 4BC0A 3FFXA 1EFVA 2BGRA 4D9HA 4PTLA 3I4LA 1QRDA 2ZUSA 4R4JA 3PQ5A 3RAEC 4F04A 3G49A 1D8TA 2W8BA 5EXXA 2JIRA 1NQXA 1I13A 2CXOA 2OXEA 5D2CA 5FNZA 2NUTB 4NYIQ 3IEMA 4GM1A 1F6DA 2NXJA 3S27A 3T6KA 3T3PB 5JSKA 1YR2A 3DXXA 5JNWA 3U16A 1F9EA 2QVYX 4R71A 1PFQA 3PLAE 1QIDA 1AV6A 3HRIA 1T2VA 3CXUA 4MUBA 4MHOA 5IBRA 1PW5A 1W76A 1ZG3A 2ZB4A 4NDZA 4KQKA 1Z0ZA 4JY7A 2IQ5A 1ZICA 5T64A 4I8DA 1M2NA 5AUNB 2JJ2A 3WGVA 4DWWA 4MIOA 2H4XA 4ZT3A 3X0DA 3EOBI 4WA8A 4IP0A 4OX9B 3IBCA 3A04A 3DQPA 1SBTA 1M54A 1NL3A 1I2CA 2PV0A 2BM8A 4LE1A 3QWFA 4WY2A 2DRIA 4EMUA 2YN0A 3LP5A 5BMVA 2CJFA 2YRWA 1RTKA 2OCKA 4G5QA 3A06A 4GXRA 4U0KA 5L4SA 2GERA 3MXOA 5CXXA 1T5HX 1YA6A 4RY9A 3HJTA 1LVUA 1N6NA 4EFKA 1X9GA 5G2OA 3SU8A 3TAHA 2J6IA 3MLAA 4DZZA 4CMIA 4V1CB 4S05A 1K7FB 3ELUA 3KALA 2FFHA 3D5QA 2WD8A 3BIXA 3IQIX 4X8HA 1A82A 2CCJA 2GYVA 3RLFA 4D2IA 1MB2A 2QXTA 4UNRA 1N2EA 5IU6A 1L7EA 2HK8A 4KPGA 4E0BA 3PWKA 1SKBA 2YZKA 4Z2YA 5JNUA 2V8BA 1AUPA 4BAGA 1V4VA 3IEVA 1JHPA 3NO4A 3IHLA 4X00A 5JMWA 3UMVA 1E3QA 2GK3A 1KNQA 1U9JA 1KE1A 2Q3MA 5C7OO 5AOBA 6Q21A 2Z6AA 2JH3A 3GLUA 1AGXA 4E70A 3LHDA 3MIIA 3MG9A 4DLSA 1QYCA 1ISIA 2QRJA 5CD9A 1XDZA 2FEAA 3NBUA 3OE4A 1KAOA 8ADHA 1YUMA 5JZSA 2GZSA 5DLQC 4N3AA 3FUVA 2LGJA 1ZMOA 3QXGA 4ZI5A 1JAYA 1T2AA 1UINA 2HRRA 3FHJA 3N8GA 3PI7A 3RS7A 4DJAA 4DR3B 5ALMA 3C3WA 3IAM6 2GN0A 1MPTA 2PKWA 2PPVA 2VEDA 2ZI7A 3RUFA 3W78A 3ZD9A 1YIDA 3SYRA 3OE1A 4Y2VA 3WDKA 4D9EA 2I4NA 1TM4E 5C1OA 1H5QA 3C3AA 4EFNA 4ZJUA 2FMUA 1JWLA 1JDSA 2JLVA 2Z1DA 3CUWA 1CEQA 1R0ZA 2YVLA 4J7CA 5CA1B 5EMJA 2XQIA 2YDYA 1Y6RA 5JFTA 2D5LA 1EK1A 1AKNA 1Y3FE 4ARCA 1QVVA 1DAEA 4EPYA 1FFBA 4H7FA 3CNLA 4L4SA 1N6KA 3KKEA 3H2KA 3WV5A 5H3LA 5L3QB 4AMYA 1JZTA 1IDN1 1W96A 2BFCA 2D2XA 2R6R1 3K9NA 1ZWKA 2PXHA 2M6RA 4K9PA 1GL9B 1T4CA 4NS1A 4BN4A 2VZEA 3T7CA 1UPAA 2NV0A 2Q21A 3QXXA 4OQDA 5FADA 1ZH8A 3OPMA 3ZGXA 3GAAA 3QEMA 4F8YA 1A5ZA 1DCMA 1I10A 2GEVA 4QGBA 2QORA 3DBRB 2UVPA 3I8SA 3L06A 2WU1A 1F9AA 3HDYA 3SJZA 1QHNA 4DA8A 5A4DA 5B3LA 5KTSA 1FDSA 3H4IA 2F1JA 1TYDE 4GE0A 3C39A 2GF9A 1A97A 4OP1A 1DKOA 2I1LA 2JFXA 4YQEA 3NHAA 3QW4B 4M7WA 4ZCQA 3L0CA 2I3ZA 1BEZA 4IDCA 4EI8A 4YLYA 4FVTA 2QBYB 6NULA 5FP0A 2ZRLA 4D9BA 4TYNA 4IMPA 1PSWA 4PLGA 1OU4A 4AJ2A 3U60B 1GLVA 1YS9A 4D99A 4CQNA 4JLOA 2E55A 2GTIA 4QEZA 4KR2A 2EF0A 2VP2A 4D0SA 1EG7A 3LCVB 3FOEC 1Q83A 5DTEA 3Q2IA 4ENUA 4KKVA 2I1QA 4Q7QA 1GPBA 4AXXA 5DLYA 5J5CA 1TK9A 2FH5B 2O8CB 4EQZA 2HNKA 1MZVA 4PTYA 1FU4A 3JS5A 3QQ5A 2GHTA 4ZEOA 1YVRA 2AE2A 5BP7A 1ZH0A 3HL4A 4PS1A 1PE0A 4D3ZA 3LRXA 5JV5A 4G0VA 3AI7A 4B46A 3PWTA 5LA6B 5E9QA 4OQNA 2ZRKA 1DPFA 1HFKA 3DUWA 5D3KA 1NSYA 4QULA 3L7IA 4V24A 4FSDA 1SJ9A 3BERA 4D4IA 2BEUB 3IVMA 1B00A 3C6BA 1XA0A 4W5TA 1ZU4A 3HXOA 1ZCFA 2CL0X 3UJ7A 5J43A 3OCWA 2PFKA 1HR0B 5GJVC 4HK4A 3KQOA 1ZD1A 1OZHA 3JD1A 3K1AA 3GL9A 1SVUA 1S01A 1X7ZA 4EX7A 2X1MA 1IBLB 2QF7A 4LRUA 1PIWA 3GLTA 1G55A 3CH6A 3EVDA 1LSJA 2LIPA 1FBTA 4AKEA 2Z0MA 5B7GA 1R5NA 1XHLA 1TNDA 5CA0A 2PK3A 4LGVA 1VLVA 2NLOA 2X5XA 3KKQA 4LZWA 4PG7A 5ALDA 3TSWA 2N0SA 3FA2A 2Q9CA 1UBOS 4GP7A 5LQKA 4KXQA 1FRFS 5SY4A 4N01A 1GZ3A 3ZCQA 3NUZA 4BTLA 1CUXA 1UBCA 2IXGA 3LF2A 2YS7A 5AKYA 1BHO1 4PYIA 3WJ7A 4JUBA 5B55A 1YCHA 2FHSA 4WXRA 3R76A 3B36A 3GD5A 4JQYA 2EIHA 4MKXA 2IE8A 1R3UA 4OBEA 3EFOA 2I67A 3B5IA 4RZHA 2XB4A 3A6EA 3RVDA 1WY5A 1TEHA 4L8VA 5K4HA 2WTBA 4X84A 4MYCA 1M1YE 2P6NA 3M2PA 1N8SA 2ZYWX 4UVIA 2ZDHA 1FYFA 3PXGA 3HUFA 3S8EA 1W1WA 4P3YA 2DFPA 4X9XA 3SMQA 3VKFA 1WF3A 2EOAA 4B48A 2Q5QA 3QPBA 2BGJA 3FDZB 4ZO4A 4DMMA 2I71A 1TLTA 4CODB 4P4SB 3W8RA 4DCUA 5DXFA 1GQYA 4ITUA 4DQXA 3FAKA 5CVEA 3M4JA 3WBJA 4CTOA 2Y1OA 2BE9A 5J2TF 5I51A 4W5QA 1QRAA 1SXPA 2HYDA 2REQA 4ERXA 1P0IA 3R23A 3B52X 4FE4A 4RL6A 5H81A 1P1IA 3N7UA 2ZBUA 2I7XA 3W9BA 4C7KA 1FC0A 4R1PA 1QGOA 1IEQA 3ZUPA 3W6NA 1OYOA 1I9GA 3FJOA 1TZ2A 5BSTA 4CLOB 1QHXA 1M67A 1JIUA 4FMCF 4HNRA 5J5AA 4C89A 3P94A 1M33A 1D5WA 1OI2A 5LOVA 1MUUA 2FPGB 1P4JA 2UVDA 1FFGA 2VKQA 2M2IA 4RY2A 3BFXA 1Q22A 2AHRA 3N6VA 3ZH2A 4H1VA 1ND5A 3S99A 3UFXB 4H0FA 2EEPA 2PS9A 4EGSA 3I1IA 2ONYA 3BHJA 1IK6A 4Q1EA 3M89A 4C3UA 3WGYA 4CL0A 5IDQA 2VH2A 4OKSA 4FFDA 2OFPA 5H83A 1KS2A 4HXFB 4AF7A 4PF1A 2FPOA 5CLGA 1VP3A 2O8BB 3JRXA 1D4AA 5AO9A 3RYCA 1GRCA 4BZXA 1G8KA 4W9MC 2P5YA 5ARBA 2BDTA 4TLLB 1E58A 4TYWA 4UAUA 1XNQB 1ITZA 1WKVA 3BJZA 4GBMA 3PUWA 4MV5A 3SVTA 3HCCA 4G9GA 2RGNA 2H0RA 2H2AA 1QZZA 3K9QO 5BW6B 4YX9A 2ZZKA 2Y77A 2OCLA 4BFTA 3U09A 2PX3A 3AZQA 1CJKC 4UTRA 3X1XA 2ZUFA 2B4TO 4RQTA 1KDPA 3K30A 3PICA 3NRJA 4EHHA 1PG5A 2BH2A 3LUPA 4QNNA 4IOMA 2VP3A 3DVSX 4UHEA 3GA5A 4Y6RA 5FQOA 3D4NA 2QJFA 5AVQA 1NMEA 2ZYRA 2OHXA 2XT0A 3IA2A 2NPFA 3SHOA 3CU5A 4FDUA 4A0GA 1RWMA 5GZ3A 4MWOA 4B4UA 3A9WA 4DDUA 4EG6A 1ZKMA 2DBYA 2C8LA 2VCHA 4IFIA 1NW6A 3CM0A 3DKVA 1MV8A 1OHHA 3OECA 2K2QB 2XDYA 1IHYA 1Q5PA 2ZQ5A 5FLXA 4KDFA 4JMPA 5J9FA 3O4RA 2NYVA 4HNSA 3DH0A 1V43A 5KNDH 1CEYA 3VJMA 1IY2A 4ZCRA 1U7TA 2HQSA 2FQQA 3R9XA 2WEKA 3WGOA 4CBVA 1IQPA 3KYJB 4KQ6A 4L74A 3DAPA 4MVJG 2GTPA 1Q91A 3DDNA 5KVCA 2JHPA 3GC6A 4Q3CA 5IJAA 2FUKA 4N3NA 4NULA 3U6BA 2YVUA 2Y0CA 4NBWA 4YA6A 4NS4A 2H52A 4UHHA 1KPIA 2DUJA 1RWQA 1PG0A 2R47A 4H1HA 4NLLA 2YJTD 3V1UA 5FD8A 4BQOA 4RY8A 2IE0A 1KYQA 1FMJA 3BGOS 3A4VA 3KOWA 4BMVA 3JQRA 4LJ4A 4TV9F 4BQNA 1L7DA 5B1EA 1VI2A 2D7CA 4EHJA 1C3EA 3AONB 2WG0A 4GU5A 1T9DA 1CZHA 1CG6A 2TYSB 4UDXX 2A8YA 1CB0A 5FQNA 5H5JA 3D8NA 1CR0A 2DWUA 3OSZA 4H7PA 1P75A 3GD7A 4EGQA 2CLCX 2QGNA 2QVBA 5FNVA 3WNZA 4B3FX 4DG9A 1UXIA 3CE6A 4GNKA 4PNZA 2POQX 1F3LA 4RADA 4AK9A 3HMQA 4YDHB 4C08A 3LP8A 1TA4A 1NA5A 1UOQA 3IVCA 3OJ0A 2NO0A 1QB8A 1RJDA 1TYCA 3T61A 4KIFA 4G97A 5JANA 4WNAB 1RMTA 3AKEA 1VCMA 2NYRA 3EISA 4O4JB 2ON6A 4HCJA 4Q03A 5KZMB 2VYVD 2NU6B 1SELA 5J2TB 4FGSA 2Y1CA 5TQ0B 1YJQA 3JAWB 2IX9A 4RK0A 1M2FA 3KWJA 2WVAA 4HADA 2ZYGA 1TEZA 2Q07A 4Q16A 3ND9A 3RVKA 2E9SA 2OV6A 4TYPA 2VPZA 3I76A 3TAXA 3ORYA 1KI3A 1MRSA 3CWQA 3Q6NA 4FMCB 2WZQA 3L93A 1OX4A 4R6WA 1ID8A 1ECLA 1PZGA 1BH2A 2GDZA 3VU9B 1K66A 2J1LA 2AOVA 2GZ3A 2R7NA 3H8SA 4I1RA 2CK3A 3IP6A 2PT9A 2GEFA 1F8XA 2VWPA 1J5EB 2SNIE 5IT4A 3CVVA 1PGOA 1YZ3A 4BO2A 4EEZA 5JNLA 5GINE 1FRQA 4JLPA 1MQ9A 1CUJA 1QRUA 4R1OA 2FEWB 2CFOA 2FZGA 5K8UA 4DVJA 5F1PA 4JI8B 4B0OA 5HF5A 2GPSA 1GTSA 3BB4A 5IDXA 5C53B 2WB2A 1ISFA 3Q11A 3SBEA 2CFCA 4IQFA 1UZMA 2HWXA 3PXDA 3R0VA 4YB8A 3TSOA 4QTTB 2A1IA 3LDUA 1ZD9A 4QQKA 4F1WA 4AKGA 3ROGA 1WCIB 3TLXA 1EGMB 3ZDYB 1EAMA 4EH1A 2BTQB 3HJGA 4G89A 2FDCA 2D1FA 2J30A 4JBLA 1QB7A 4ZK6A 2F3TA 1YL6A 5AMXA 4PZZA 3GT0A 5TGZA 3V34A 3NC4A 1U8UA 3I32A 4XOIA 3GH3A 4W6ZA 5AW9A 1NZJA 1AQLA 1E1NA 1KERA 1R0RE 3ODPA 2J6BA 3PNKA 3NYRA 5IULC 2G72A 1XQ1A 2Q2WA 8LDHA 4FN5A 4KFCA 2DY1A 2VDWA 5F7JA 1JLKA 3UB2A 4AZSA 3ZZ1A 4J94A 4W5NA 1VOTA 3CUSA 4L7QA 1JQBA 2GF0A 1Z0AA 1U3CA 3OLCX 2AYXA 4MW7A 5J1TB 2WT8A 1IQRA 3V80A 3PQEA 3V8NA 5AT1A 4C05A 5L45A 4PQFA 3I2HA 1B0AA 2FWRA 5T6MA 1JPJA 3SLGA 1XRSB 1OWMA 1OIXA 1R6VA 4HRYA 4TKUA 3OESA 3U4AA 1G38A 1H2ZA 4DXDA 3Q12A 5KHAA 3WYAA 2VDMB 4LZNA 5AM5A 4YDQA 3GLIA 1NXQA 1S2MA 4S1PA 2RKOA 4DLPA 5LKAA 3D6AA 1QIJA 1TJ3A 2O4CA 3AUSA 1GQSA 1GEEA 1U0LA 4NEHB 4M0DA 4UBLA 1E63A 3LY5A 4JQZA 5EGSA 1WS6A 2YOFA 1UKVY 3IOCA 2GEJA 1ADCA 2D7JA 3TO5A 1OH6A 1R4MB 3I3OA 4GOKA 4DUZB 13PKA 3TI7A 3ZVLA 2AXEA 3DE2X 3A1EA 4H08A 4O2AA 4TV9B 4LE0A 1ZOLA 3X1ZA 2D2VA 4R9VA 1GT91 1R4NA 3ESBA 5HMMA 5T3YA 3RIXA 4F86A 1ISGA 2P7IA 1NFQA 5ALYA 1EUYA 1S2NA 2GCGA 1PJAA 2VBCA 4PNHA 3PX7A 3Q7TA 1EIWA 3L0DA 3P26A 2PXCA 1KOLA 5T5QA 4QHTA 3GLGB 3EX7C 1QX4A 4L28A 3U3OA 3KKMA 1EESA 1XN4A 2GXSA 1SVNA 1XTIA 2EBUA 3IULA 2W6PA 3HBFA 3HVIA 5BQXA 5HBRA 1BE6A 1PZXA 4YP9A 4XFJA 1UFRA 3BWCA 3D3JA 3GEHA 2VUTA 4FDTA 5JBQA 3PXXA 1RADA 1NN1A 3COJA 5JE8A 1QU3A 5LFAA 1L7PA 2Z09A 3DP9A 3KJGA 4IIUA 5IVIA 2VF5X 2XMDA 3TPZA 3P9ZA 4Y67A 1QP7A 3DAHA 4OLFA 4KHPB 2R84A 1WTCA 1I2AA 4YS6A 4FE7A 3JYHA 3SFZA 3U44A 5KHOC 1KO5A 1AUQA 4HH4A 4Z1MD 1SQSA 2J9RA 2XR1A 4YUVA 1PR3A 1FU7A 1JQDA 2ZJBA 2Y2UA 3O8BA 4JJ4A 5JD5A 3WMWA 3LM8A 3ADCA 3ITKA 1MX9A 1N0UA 4ZAYA 3H9EO 3RFVA 1Q84A 1ZC3A 4K05A 4L8LA 1GTL1 5JYBA 2YQZA 3RG8A 1NXXA 2WIDA 4NWIA 4N49A 2PCLA 1ZDMA 3HDQA 4LECA 4GQIA 4NHOA 3C8ZA 4EB0A 3TSCA 3AF5A 1H2XA 1XTJA 4LRQA 1PZMA 2E4VA 1BWPA 1A9OA 1ZSNA 3AUAA 5CYFA 2CLEB 2B4RO 1UEJA 4BKUA 4BGDA 4IDEA 4NFSA 3SF8B 2B0JA 4AKTA 2Z9BA 2VSXA 1XR3A 3KZOA 4YVFA 2XRYA 4J49A 4ZVLA 4LZLA 3MMZA 2QMQA 2WUWE 5BN3A 3DT8A 2VS1A 3RYTC 1PEDA 4M6WA 3HJFA 2DPYA 4D92A 3ROKA 1W49A 3MJVA 4AY5A 1UBHS 3IKVA 3I6IA 1TYZA 1G8YA 1GNTA 2VSOA 4DSNA 1G18A 3HY6A 3MMSA 2AX4A 1HSOA 1PV2A 3F74A 1IY1A 3WLTA 4ZOBA 4XA8A 4A1OA 1KKMA 1HYBA 4ARBA 1AE1A 5ICSA 2AD1A 4L4RA 3F7NA 3WL5A 2R3SA 3KT3A 2FRXA 3ZCUA 2EP5A 2WFZA 2UYQA 4Y2YA 5GVRA 4EB3A 2L17A 4FGWA 4I08A 2GBPA 2D00A 4IY1A 4X65B 4Y2JA 3AXSA 1E9RA 1LBQA 2ZBPA 4W8GA 2P4UA 4Y2GA 2P3SA 4BX8A 3ELWA 3UOGA 2AFIE 5IP5A 3AFIA 4C5CA 3P2OA 4ABTA 4WN3A 3PWSA 4QVIA 4J4BA 2GBLC 3PXEA 4M1OA 1L1RA 4BNYA 1E9DA 1SXGA 3CKMA 1I4DD 3KLPX 4BWYA 2OKCA 1RRCA 5I4BA 2A0WA 1E6LA 1ISHA 1EFRD 5C0OE 1L5WA 1OI3A 5GV8A 3KBOA 3G2LA 3PPIA 4I4CA 1FSFA 5H3CA 4E12A 4YRBA 1V45E 4WESA 2O3QA 1QGDA 3JALA 3NDIA 3SQNA 1FUKA 2GD6A 2MINB 2MDTA 4R7TA 5KIAA 5DW0A 1YFJA 4Z7NB 1CQIB 3DKKA 1B14A 1EDOA 2GSWA 3MLEA 3QVVA 1RLIA 4NAUA 4BO9A 2H9IA 1RPAA 1RI5A 1TF7A 2YIJA 3EGWA 1ECCA 1N1GA 3HBMA 5EFOA 1OY1A 1DAHA 3VPXA 4KMOA 1FP2A 1RBYA 1VHTA 4AJ4A 2P0EA 4C01A 4YMLA 4KE9A 2PMDA 2CFSA 1LJ8A 1JKFA 2XUFA 2AZTA 3CRW1 2GVDC 3FE2A 4GRDA 1O5IA 4GZMA 1K5GA 4IHJB 4BNZA 3RC1A 2A1UB 3L05A 4UXHA 2Q49A 5EWJB 2GKOA 3PKZA 3F73A 3CUYA 2ZAOA 3C3JA 1U8XX 4OH7A 4YAGA 5K3BA 5H7XA 2RIRA 2OYRA 4GLFA 4DR4B 1SUIA 1QNFA 4KXMA 2EJTA 4M89A 1L0BA 2Z57A 4QTXA 1BIFA 2YIVX 4LHZA 4M1SA 5SY6A 1GPMA 3W2EA 4BUCA 4ZOLF 3EIQA 4CLDA 1PJ8A 2FRVA 1BE0A 3QU2A 1YS6A 3DNFA 2FKNA 2PWPA 1FXWF 1V6SA 2H7CA 1U28C 1E2QA 1PUIA 2IOHA 2RMKA 1WG8A 1EDDA 4E5YA 4BFUA 3BQ9A 3FPFA 4QGAA 1NX9A 3MBOA 4KW7A 5KQMA 4EJ6A 3TFOA 2HZ7A 2IIQA 5DM0A 3SI7A 3UJCA 4C7OB 4UPDA 5F1YA 3CX6A 1EP9A 4W6QA 2XKKA 5CB8A 1H66A 1U4NA 2OOKA 5KSPA 3ZE8A 4DBLC 3KQWA 4ZYWA 3GRYA 4TLAA 2HFKA 2GBLA 3LFHA 3OEHD 1N25A 1WM1A 3FJYA 4RVOA 1E0JA 1JHXA 2ZTMA 3NDRA 4Q3NA 3WLHA 4Y2PA 2FZEA 1B1AA 1IZ0A 1YRQA 4HGOA 2I7TA 3EQZA 1VJTA 2PU5A 3I72A 1EK5A 2AQ8A 3IPYA 4I55F 1N6PA 4RULA 3AVQA 4RAOA 4ETNA 1JE0A 4WK6A 4L6AA 5KYUB 3LMKA 3T4PA 2V9PA 1XVLA 4KGZA 4E46A 2C5FA 2CVOA 4TVOA 4A8JA 3YASA 3ROPA 3T5TA 3PVZA 4OHCA 1ZK4A 1RWNA 4QO7A 4WBSA 3TLCA 3JRWA 5HIAA 5IT0A 1N2OA 3CEAA 2BGLA 1JA0A 1DT5A 5BV1A 3S3TA 2HIHA 3EODA 1L7QA 2B0CA 3A9SA 2IHUA 1B15A 2EZUA 2NX2A 3OQ1A 3LW7A 2DHRA 2YICA 3VDNB 2CJXA 4XQEA 4RQAA 2YCLA 3CRMA 4XYMA 3A9CA 3GGCA 5CFNA 3T7IA 3H16A 5MGNA 1GNSA 2GZMA 3P8ZA 4ER0A 1EKXA 1XLVA 1W4CA 3NM4A 3U4GA 3UMSA 2ZSBA 2XWJI 4EI9A 4MLZA 1T2FA 2ZYSA 3DMPA 1G6OA 3U3XA 3SIWA 4YJFA 4Q7MB 3P0RA 3BTVA 5ERXA 5AYVA 1LDEA 1OIVA 2GCEA 2ZT6A 1KFCB 4ARSA 1O2DA 1C8VB 4YONB 3ZDEA 5FOSA 5JDCA 3W90A 2AJBA 4UMEA 2O7QA 2K7FA 1Z2EA 1Z5VA 2VTBB 1BCRA 2R4QA 3M4XA 1Z12A 4O5OA 4RQBA 1TD1A 3KKOA 1E2PA 2Z5LA 5CYGA 5TLSA 5CEFA 4YPVA 2FNAA 2FVYA 2KYRA 2Q62A 2HSZA 2OK8A 4W1RA 2IPLA 3ZY4A 1Z08A 4UVEA 1GXSA 1HE2A 1V96A 3BMNA 1KNXA 3GH1A 2QAJA 2JRCA 4FGKA 4BLVA 3GEDA 2BH9A 2IEDA 1RAEA 1XRNA 3DF9A 1FUEA 3M3HA 3D0OA 4DLVA 4DTCA 3QFFA 1JBKA 1T5TA 1L5MA 2C20A 3F8TA 3M4ZA 3I04M 1U04A 1KVTA 1G6HA 1YL7A 3EIUA 3FVVA 3QH4A 4DCGA 1BZYA 1ZH6A 3IGFA 3UF0A 4FHZA 5G0UA 4PO9A 4A0RA 2FRDC 4MGYR 1UDRA 1DO8A 3HZZA 1IPEA 4WAUA 2Q3FA 1CIPA 4WZBB 1H93A 4JEHA 3QBJA 1Z0UA 4PAWA 4C5AA 1ORDA 2V7EA 2VXYA 2OE2A 1C9MA 1MC4A 1XTPA 2CVFA 3C4VA 5KB3A 2QP3A 5KQGA 3JQAD 3OA2A 4RDCA 5HS6A 2Z5GA 3F6RA 4D8WA 2PUCA 1SCBA 4M36A 2OZLB 4YAUA 4DLZA 5AK0A 4TZTA 1W4BA 3F9CA 1PDWA 1F20A 1YUBA 4MB2A 5G0SA 5LQUA 3WDSA 3LT0A 4B6FA 4CM8A 3MRTA 4RGQA 4IDDA 1E0AA 1PR6A 4MKGA 2WICA 2HCJB 1TJ4A 3EA4A 4BLRA 2ZIEA 2G07A 2O1WA 2PS3A 5B37A 4MGZR 5FWXA 2Q2VA 1U1GA 4GQBA 5D00A 3HN6A 2QYHA 4NL4H 4XUCA 4QJ5A 5IXSA 4HFRA 4EY3A 2W00A 2QX8A 3D5TA 5HKBA 1U0BB 1R9NA 3AU8A 1HOXA 3KAJA 2X19A 1GKKA 4BMPB 1U4OA 2H3EA 2P75A 1V39A 2A7QA 3BIFA 1GM5A 4X7RA 2I3BA 2F9LA 1BO6A 4F7DA 3HCBA 3J7AC 3GXOA 1W73A 4CGYA 3EVBA 1YS1X 1Z74A 2P4SA 2X1LA 4I55B 3NPMA 5CX1A 2CNLA 3F3KA 5C7LO 1FTSA 1JXAA 3T3NA 2LZ0A 3HKEA 2IP1A 3QHAA 5JO9A 2JFGA 4AKHA 5NLLA 3NYQA 1JFLA 3CA8A 3HP4A 2C97A 4K81B 5HQ3A 1RRKA 2DQYA 2C4MA 3DXFA 2P69A 1DXYA 1CDDA 1N2CB 2ZUEA 1DE0A 3FF1A 3VBEA 1QVRA 3F49S 3WQSB 5B3KA 2C61A 2A78A 1C0EA 3BSYA 1ADJA 3MINB 3VYTB 3U1BA 4LJLA 2YJ4A 1LBHA 3A3NA 4JZYA 1L4LA 3JV7A 3OWHA 4C30A 1NLFA 1C50A 1FUYB 1G8HA 1OD6A 2VEOA 5TJHA 4TKVB 3D4PA 2FRDA 1N5MA 1OYWA 3BWBA 2ID8A 4OAOA 3ZPXA 2JLXA 2WABA 1XYGA 3FTFA 4C4XA 1SO8A 4PWYA 4E5NA 1E2HA 1M1ZA 1MNQA 1QHGA 1N0VC 1Q0PA 3BH7A 2JAHA 1DFGA 1WD7A 3PQDA 4FSHA 3ZHYA 1M2EA 4BNUA 1DBQA 1JIJA 1NPDA 2RAFA 3G1UA 3LL4A 3OPQA 4AP9A 2KMLA 1C7EA 1NMYA 2RAPA 4YJ2F 5I7VA 3T4EA 3BHNA 3PXBA 4H0NA 2J5RA 2JFBA 1N6RA 3W9SA 4I36A 5BOVA 1NMSA 1CEEA 4HLUA 2JZNA 1Y8CA 3KOXA 4D4MA 2G5PA 2X4LA 4PINA 5J2UA 2W9XA 4EKYA 4JL5A 2V1XA 2JHGA 5ECDA 3LQQA 5E7JA 4HDNA 4M9RA 3JASB 3EWIA 1QC5A 2H4ZA 1WQ4A 2C4NA 1L4BA 4TYQA 4UBMA 1H3EA 4UNPA 1N7IA 1C1XB 1GZUA 3LYLA 4EG5A 5FYDA 1NQTA 4O2RA 2W43A 1OBVA 3BQMB 2EW8A 4MGKR 1WXFA 1UL1X 4OXXA 2XEXA 4OU4A 2RC6A 2UUOA 3B6JA 4MQEA 4CF4A 3F96A 2V97A 1RYZA 1S02A 3CH7A 5JSZB 5KOYA 4EA9A 4X7PA 3DDCA 1L7OA 4UEOA 3ETEA 2ZJ2A 4MW4A 2GETA 4IZ6A 2E1PA 3B6IA 4UHFA 1LLUA 2YVKA 5DOVA 3B6MA 3EIOA 1S7CA 3OIYA 3ROFA 4FW9A 2EZTA 4R9NA 1WCWA 2G7MC 3VPAA 3RAFC 4C2AA 2BCJQ 2C9BA 1J33A 5H82A 2JBWA 1ZLXA 4KO2S 5K3FB 2OFFA 1UKZA 1ZVKA 2HPHA 4R3WA 1S2OA 4RK5A 2W6OA 3STUA 5K7SA 1D2AA 3H5WA 1T9AA 2QX7A 2YIMA 3KZNA 3PNPA 1U7ZA 3NHMA 4ALMA 3R6DA 5K3EA 1WMAA 4Y30A 1T3SA 1OLSB 3DP7A 2NZVG 3KKPA 1TVKB 3W9YA 1EA5A 4F4IA 2GPJA 1E9SA 5D5PA 3DL7A 1WF6A 4N7BA 2F64A 4FT4A 5J47A 1BH6A 1X1QA 1DAIA 2FSIA 1DADA 1FTWA 3W2TA 1GPWB 3IQFA 1T8SA 2F4NA 2ZJYA 4UJ5A 4WK4B 1SXQA 4OGWA 3PTLA 1K1EA 2PUHA 1VCIA 3IUBA 1V3TA 3LDAA 1EP3B 4TV8F 1YKFA 1P3Y1 3MBIA 3N3AC 1EZZA 2QQ5A 4RH3A 1CDEA 3A6KA 4IFBA 4TL7A 4YGYA 4A36A 2ZI6A 3D54D 4UTXA 1JIQA 1IXSB 4FHDA 4INPA 3TE6A 5HW0A 3T0GA 4H6XA 2I3GA 3IC5A 1G7RA 1W52X 1XD8A 4L8YA 5JVDF 2DY0A 2UZ1B 2PA3A 4HJXA 3STXA 2CL5A 1Z7WA 4PGFA 3ER8A 1NKVA 5CCBA 1FFCA 1LZLA 3C3DA 1NR5A 2EQ5A 3K8YA 3UK0A 3ZU2A 3RS2A 5CDYA 4MA0A 3TSZA 1E62A 4RJLA 2TRSB 3E82A 3V7NA 3OTOB 4F97A 2ZSHA 3EJ6A 1CUUA 1Y6ZA 1G3IA 2SICE 3GRFA 4L9SA 1U5BA 1R3DA 3C3PA 5GAJA 3LBFA 1WW2A 4UD2A 1FTNA 3QJYA 2ZUUA 2GGSA 4QBIA 5A4KA 4CIAA 1SIOA 1K68A 3CX7A 3LQRA 4YMIA 3CKLA 2IHKA 2EV9A 5AJUA 1GVHA 1HRDA 2AD5A 2LP4Y 2IVZA 3IRUA 4MEBA 4Q3AA 4FKBA 3AEUA 4TXJA 3S2GA 3SIPA 1S9DA 4K9RA 1KQNA 4WD3A 2I6UA 1NR7A 2ERXA 2QRHA 1SBCA 3RWOA 1P7ZA 4MS1A 4WXHA 1NX6A 3NJ8A 3EDOA 2GMWA 5IBPA 2I6QA 2Q4DA 1YDEA 2XMCA 3VJLA 1U63A 3EYWA 1YS2X 3BAFA 3IPXA 4TRMA 2K6GA 3G9QA 2QUJA 4YJ2B 2YWCA 4J0DA 3WADA 2P1RA 3OQPA 1E3JA 3ZV6A 1WX1A 4NG4A 5FOUA 3E81A 4MW6A 3Q0EA 4HN4B 4YRLA 4HB2A 1Y1RA 2LE0A 2NU7B 1QCYA 4DF3A 1PWXA 2H48A 4FSXA 2Z9CA 2JGRA 2WFLB 4HAZA 1Z0IA 4IKEA 2ZJOA 3CEPB 4LMAA 1HDCA 1TU4A 1U11A 2V45A 4J0IA 1NONA 2XGMA 1U65A 4I1SA 4PLHA 1MG5A 4PVDA 2VJCA 1JNXX 3DZDA 2NXWA 1ONBA 1XG5A 4JITA 5DWQA 3X2FA 3FI0A 2BUCA 5TB5A 3STVA 2XVZA 1K2VN 2HN9A 1G8FA 4LG1A 3GFTA 4NJMA 2BJHA 1ENOA 4JLMA 5KDLA 1D6JA 4NONA 3KFVA 5F4ZA 3D2AA 4PU0A 4EG3A 4S2UA 1VHJA 2TS1A 4EZIA 5HRAA 3NV7A 4UTPA 2C2BA 3DG9A 2CV0A 2WU0A 4LRWA 3MSXA 5EYPB 2VQFB 1B8PA 4TMZA 3AFGA 2ZRAA 2RI6A 2X8JA 3LYHA 3IE0A 1P1JA 1I8TA 1C9KA 1YAJA 2D0IA 3BILA 3TZ6A 3OOYA 4R84A 3HKDA 3G7SA 2AI1A 3G6WA 3NIWA 2BC9A 3GEGA 4X85A 1M0SA 1ZS9A 2I78A 1C81A 1RZUA 1UBNA 2AT1A 5TF0A 2AKEA 2QTFA 5F35A 4DILA 4EW1A 2NT4A 3FUTA 3NHUA 1MIOA 2HADA 2WHEA 1XF1A 4JC8A 1R27A 1EFVB 1FQWA 2Z5VA 1R6BX 3G0DA 4G23A 1D4FA 1LF5A 1V41E 3OCCA 5DKFA 2V4ZA 3I28A 3KUXA 3TLGA 4FT2A 3ZQ6A 1DCTA 1TE2A 5A1TA 3IERA 3PB3A 5DVZA 3OWXA 3SFVA 1PBNA 4LZJA 4WFQA 3JVDA 4GVXA 1DX6A 4Q1AA 3GEIA 2DKFA 1Y3AA 4PR0A 4TV8B 5D85A 4ZO8A 2WU4A 4KPFC 3JZDA 3G13A 2W0MA 4ARIA 5B1DA 1RKQA 2J32A 4L72A 3P0HA 4M1TA 1WLYA 3BF7A 3T3DA 2CXQA 3DWIA 4N1AA 5JSFA 5LMZA 3ROMA 5WRFA 2JW5A 3KB8A 4PM4A 1OXXK 2RSLA 1KO8A 5JVDB 4DLAA 1QXSA 1QM5A 2W2NA 4Q1CA 2J8ZA 2WJ3A 5D3ZA 1QGUA 4CG1A 5KTOA 3R7WB 4TTPA 2WSMA 2D2EA 4JLNA 3D1JA 1QOZA 3VH3A 3ZQJA 1U8FO 5JFOA 3GQBA 5FORA 1LWOA 1FNMA 4UXJA 3V1MA 1SKMA 3TJZA 2N47A 4XGQA 4GLBA 1E1DA 4PFQA 3Q2OA 4LAFA 2QLFA 4CMIB 4ENVA 5ITZA 2IITA 1U9CA 1RYHA 3MT8A 1IUKA 5JZOA 5DLDA 3MXTA 4NJOA 1NN0A 3JU3A 3HS3A 5E6RB 1GRQA 3C16C 3L3BA 4QJ4A 1E1RA 2WTUA 1JRLA 3ZDQA 4XAQA 5DYTA 3H4VA 1JG3A 1C9NA 1PJ3A 4QT4A 1XA4A 4IDNA 2WTXA 1AS0A 4NX2A 3KR0A 1U6JA 5DN9A 4FYXA 1YZGA 5BV2P 2ETXA 2H54A 1I2ZA 1J7KA 1U80A 5DTQA 1O54A 1K7XB 3EYAA 2F9MA 3O2NA 2PX0A 3JTEA 1FP4A 2E4AA 4QL3A 3DE5X 5EE9A 3T1TA 1AB6A 4B6JA 3GFSA 4RHYA 2CXHA 5CA0F 3K31A 3DEJA 2PSJA 3LFUA 3VGPA 3HDHA 4JYZA 2J7KA 3D5EA 4AZTA 1QOQB 3K20A 3QEKA 1U2PA 2HMAA 5CG1A 2WWXA 1PW7A 4B3MB 2E2WA 1ELOA 3AHEA 1ANKA 1L5HA 3ANYB 3SZOA 3MAJA 1H23A 3ZZTA 4B3JA 3G85A 3QU5A 2D7DA 2WQ6A 1VC2A 3LX8A 1JR6A 3PF9A 1O96B 1HXHA 2EU8A 3I9V1 1PCXA 4YCMA 5AVSA 4IM7A 2H51A 2HTFA 5ADUS 1LPAB 2ZI5A 1M2HA 5FDFA 2CLIB 1LVGA 1XNJA 1C0PA