3DVSX

Proteinase k by lb nanotmplate method after the second step of high dose on esrf id14-2 beamline
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Radiation damage in protein structural characterization by Synchrotron Radiation: State of the art and Nanotechnology-based perspective
rcsb
molecule tags Hydrolase
molecule keywords Proteinase K
total genus 99
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2008-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3dvsX00
2PMWB 1GA4A 3P5BA 5ARBA 1SUAA 4CFZA 1BJRE 3D43A 3VTAA 3CNQS 5FAXA 3GT4A 1NDQA 2IY9A 1GA6A 3GCXA 5I9SA 1A2QA 1NLUA 4KPGA 4OMCA 3WQBA 1ST3A 4NMXB 2HPZA 1P8JA 4ZARA 2PYZA 3DE2X 5AQEA 1GTJ1 1R6VA 4B5LA 3QFHA 1ZVJA 3WHIA 1GTL1 1Y3DE 1Y3CE 2P4EA 1KE1A 3T41A 4HX2A 2PKCA 4DJ5X 1R64A 5JXIA 2XTJA 3QMPA 2PWAA 1ZVKA 3DDZX 3F7OA 1TM5E 2Z30A 1R0RE 1S2NA 2DQKA 3LPAA 5AVKA 1SUEA 4OMDA 1PJ8A 4DWWA 1HT3A 5JXHA 4KG7A 3I30X 3A3OA 3A3NA 5JXJA 2SNIE 1WMFA 2W2MA 3F49S 5ARDA 1SCAA 4CFYA 1SBHA 1T1EA 3EE6A 1TM1E 1SIOA 2W2QA 3DYBA 1GA1A 3HJRA 3L1KA 4H6WA 4JP8A 1V6CA 4LVNA 5AVJA 1SELA 1OYVA 2SBTA 2W2PA 1IC6A 2X8JB 2Z2ZA 1S02A 3AFGA 4I0WB 2Z2XA 1KE2A 4AKTA 5ARCA 4LVOA 2E1PA 1UBNA 5CW1A 1SCNE 1SCDA 1TM7E 1GNSA 1BE6A 2QTWB 2WV7A 1WMDA 1GT91 1V5IA 1WVMA 2PRKA 3SICE 3DE0X 1SBCA 5SICE 1DUIA 3VYVA 2Z58A 3TI9A 5FBZA 3EIFA 3DE3X 1S01A 3DWEX 4H6VA 4DZTA 1TO1E 3WIUA 1AVTA 1YJCA 1SUBA 2X8JA 3DVRX 3VV2A 1TM4E 4RYDA 3SQOA 1Q5PA 1Y48E 1C9MA 1AK9A 1THMA 2WUVA 2Z2YA 2Z57A 3H42B 1PEKE 1Y3FE 1NDUA 5B1EA 5AMXA 4K8RB 1SBIA 1IAVA 3PTLA 4MZDA 4M1ZA 2WUWE 1SCJA 1GTG1 3OSZA 3DE6X 3I2YX 3Q40A 3GT3A 1YU6A 1MEEA 1WMEA 2W2NA 1LW6E 1OT5A 1PFGA 1TK2A 1P7WA 2IXTA 3GCWA 1SBNE 1TMGE 1DBIA 1Y4AE 2TECE 2ZRQA 3DW1X 3I34X 3PRKE 2XRMA 1JEAA 1KDYA 3VV3A 4Z2AA 1AF4A 1Y4DE 1BFKA 4J94A 1C3LA 3EDYA 2DUJA 1Y34E 1YJBA 1EA7A 2SECE 4NE9A 4AKSA 1AH2A 1XF1A 3ZXXA 5JXGA 4GI3A 1SUPA 1PTKA 1VSBA 5K7SA 1SIBE 1SH7A 1BE8A 1ST2A 2HD4A 3TI7A 1T1IA 1Y33E 3AJ8A 1Y3BE 4CG0A 1AQNA 1SPBS 1SBTA 3BPSA 2PWBA 2B6NA 3LPDA 1Y9ZA 2ID8A 3QTLA 2ST1A 1KDVA 1BH6A 3DE5X 1CNMA 1YJAA 2ZWOA 4KB5A 4OV6B 1OYOA 1P7VA 3AJ9A 2ID4A 3DVQX 3LPCA 2ZWPA 1AU9A 1GCIA 3BGOS 2GKOA 5B1DA 1EGQA 4H6XA 1KDZA 3VSBA 1SIUA 3VHQA 4HVLA 1WSDA 3I37X 1CSEE 1TM3E 5FFNA 3LXUX 1AV7A 1SCBA 1TECE 1TO2E 2DP4E 2V8BA 3DW3X 1SUCA 1GNVA 3A3PA 2PQ2A 4ZOQI 3TECE 4FONA 1C9NA 3F7MA 3Q5GA 2Z56A 3UNXA 3WIVA 4WOBA 4C3VA 2SICE 1SVNA 1BFUA 1Y1KE 3DE7X 4BWGA 1C9JA 3CO0S 2G4VA 1SN7A 3DE1X 1SUDA 4WOCA 3DVSX 4NE7A 2WWTA 3ZXYA 4YN3A 3DE4X 3D9QX 1T1GA 1MPTA 2W2OA 3BX1A 4C3UA 5JMOA
chains in the Genus database with same CATH superfamily
1PX2A 2BMAA 4QWMA 2ZT6A 3PL1A 5F35A 4HEA6 4BO8A 2HHCA 4LOAA 2ZIZA 3KG2A 3ONDA 4PSKA 1WY7A 3OJOA 5FQNA 2NN3C 4B3JA 4EA8A 3Q15C 2XCSB 3I9V1 1P2VA 4IXNA 2HRQA 2HPZA 3VKFA 3AVVA 3CLRD 3I9V6 5LA6B 5HJ7A 2HYIC 1QSGA 2F00A 3N70A 2Y1LA 5A02A 2JI4A 5CH5A 1H69A 2OQ2A 3D6HA 1ECLA 1PR4A 4LPSA 1B6GA 1E64A 1BX3A 1FA9A 2EXXA 2QMEA 3D1JA 5C2JB 3CRRA 3H6GA 5JZOA 2CL7X 2VWHA 2NOAA 1T2DA 3NBQA 2QZ9A 4HB4A 2KSQA 5J5AA 1V4VA 3IAEA 3DOCA 4CMEC 1I6KA 4NBWA 5FIUA 1HMPA 4BHTA 4FYKA 1BG6A 1NM5C 4TWIA 3H2HA 3BTUA 3M6VA 1FSSA 3RC9A 1MZPA 1MAUA 3VR6D 3EZYA 1H0RA 2DBVO 4GKAA 3X2FA 5I3ZA 5HNKA 4PU0A 1E2EA 2VLIA 4I0WB 4K9PA 4FNOA 4YNBA 5ARCA 2ZT7A 2J30A 2AKYA 4ECAA 1BRTA 3WHKA 4EY5A 5K6RA 4OU4A 5DX8A 4UPDA 1GWNA 2XV1A 4R3WA 3BOSA 4YP6A 3DE0X 4UXJA 1Z0FA 2V97A 5JLAA 3ZY3A 2PRYA 2QD4A 4LYHA 2M2IA 3O7MA 2BHTA 1YJ5A 1VSQA 2B2CA 4BZZA 4Z0PA 2V3WA 2CNWD 1BS1A 2P0EA 1NVWQ 1KMNA 5EQTA 1WUIS 1PDWA 2WG1A 4ZI5A 4ETIA 2OAQ1 4MDEA 2VAPA 1IOLA 2GQ0A 1J2TA 2QM7A 3LL4A 3N8GA 5JWHA 2OGTA 4M9ZA 4HY3A 4GR9A 3RUCA 1ODKA 4ZQBA 2Y92A 1TX4B 1AD2A 1LNZA 1YQEA 3HDVA 2K87A 2CD7A 2X7XA 3GV0A 4O4IB 4WFIA 2Q3JA 2QMHA 2GD1O 5GWXA 3L6UA 3VR0A 2G76A 2NAPA 1O6BA 1LC0A 3C8UA 3EA4A 3GPDG 3OQ6A 4QDZA 5HUJA 5ALVA 3EPRA 1P31A 1XZIA 4KP7A 4H17A 3CONA 4DARA 2CY0A 3ZBPA 5COBA 2F3TA 2WKRA 2DQYA 1WZCA 2AG0A 5DGHA 5C1DA 1NRXA 2QX9A 1VKOA 2H0RA 2MSDB 3D7KA 3MEQA 1TYAE 1GQSA 2VPPA 3MLBA 3KUXA 4KPFC 4Y6QA 521PA 3VKGA 4EL0A 4NXMB 2GO1A 3EN0A 1GFIA 3VPDA 1PW7A 4AVYA 2HB6A 5I3CA 2DRIA 3RSZA 3K20A 3CNOA 4PTLA 4IS3A 4ZAFA 5TARA 2AZDA 2PSSA 1C5KA 3SAJA 2K2QB 5KQLA 1THGA 3CT6A 3HB0A 3H4MA 2FZKA 1SCBA 1QIDA 2P91A 3KOOA 4NBRA 4R81A 3ZQ6A 4X0EA 2B4TO 1Q2XA 4DLKA 4OQXA 4F7DA 4ZAGA 4OGWA 3SQLA 4R2WA 1K5PA 4ALMA 4BXOB 2RCYA 3K6SB 3BD8A 2R8EA 2Q5QA 3IQZA 2RGCA 3N2ZB 3FGNA 4DQ0A 3U19A 4JWTA 1CY1A 1JFRA 2ZRLA 4Q7MB 1VPWA 4P3YA 3NPMA 1XTPA 3I92A 3L8FA 4IXTA 4G4SO 4GPD1 5AKLA 2XDQB 4QQNA 5DTJA 5FO1A 3TLJA 5KYUB 4B3BA 1MC5A 1EUDB 2VOJA 3OCCA 4JP1A 3LLUA 3U4QB 2AR9A 3LWNA 4RH0A 3DAPA 1YB1A 3IEUA 3P9CA 2GPTA 3I52A 2ACVA 2HY7A 3JD0A 1NXSA 1SA0B 3IP8A 4ZT5A 2CC2A 4LC1A 4JELA 1YZGA 1GTL1 1N1MA 4Y2GA 2CXNA 4JC4A 4DCCA 1I1QB 1O54A 3Q0IA 2ZG6A 2P30A 4Z49A 3CNEA 4REMA 1JDVA 2JGKA 3CS3A 4WN3A 2C2WA 1WMAA 1E7RA 2W6ID 3TTXA 5CA1F 1DE0A 2BW0A 3K8ZA 1XELA 3HADA 2GK3A 3LP6A 2A78A 2P41A 5CHEA 1SC4A 3H6HA 3V4PB 4GDMA 1A9RA 2BEVB 3TQHA 3DCNA 4LF4B 2MOKA 3B3GA 4EY4A 3NOVA 4XE5A 2K7ZA 3HJFA 4M3NA 3O8OA 4S24A 3W5HA 1PW5A 3QMMA 4BQEA 1GNSA 1E6UA 5EA2A 3MTQA 4YRJA 1OFUX 1BCRB 1TVEA 1VKJA 3GZTB 4GPEA 2CEKA 3A37A 5EZYF 2QTLA 1KMMA 4LXTA 1U9IA 2WP8J 3QK7A 2QG9A 2ERCA 2C4VA 1QWOA 4WD3A 3I9OA 3E4CA 1J2UA 1N5OX 1ZQ9A 2NT3A 3KEMA 4HNHA 4RZQA 3CNBA 3DT6A 2DC1A 2P9TA 3OLXA 4P4SA 4HATA 4HP8A 1KOFA 3UW1A 3ZNOA 5EESA 1WEKA 3MCZA 4MI1A 4MGHA 5IEBA 1NR7A 1EAYA 2FYTA 2C04A 4MQ4A 4M99A 3T3MB 4JXZA 1CERA 4K9MA 4F9GA 4PTZA 1M2JA 1J24A 4TRJA 5IJ9A 1Y4UA 4QG7A 3R3UA 1YOVA 1VBKA 2RARA 2OCPA 1OLXA 3ETEA 1E9SA 3F4KA 4LXIA 1UKVY 4OBXA 4BOYA 4EMUA 3VAAA 5KUTA 4XYEA 3W8RA 4PO1A 3SJCA 3WLAA 1W2GA 1JIXA 1EUZA 3DG9A 7MHTA 1I10A 1WOMA 3C6ZA 2PZLA 4JWKA 3UKDA 3I9MA 4N40A 3EG9A 3R0VA 3U4AA 3IIIA 1MXFA 4GF5A 2HJHA 1DKQA 2PD4A 4NBNA 1LWNA 1TU4A 3N2IA 1K7SN 4BNHA 4YYZA 3IHLA 1PJSA 3NC0C 1QR6A 4JD5A 3UWDA 1XMSA 2IYYA 5E7IA 2VVTA 4OKSA 1ZO8A 3CSUA 2C4KA 3HO8A 4Y1EA 3BEDA 1V37A 2GXAA 3I05A 1UC9A 1KI6A 3NI2A 3C3WA 3DDUA 4BQPA 2P2NA 1ML3A 3HHPA 4QUEA 2OG2A 2VKTA 4D0LB 1C3VA 1ZOPA 1RJ9B 3DOEA 4TVBA 2W9XA 5CM2Z 2BGNA 2YJNA 5BT9A 4JV5B 1O6CA 3RVJA 3SE7A 2O8CA 3MLEA 1P9WA 4L8LA 4P86A 1OWOA 2YVLA 3K15A 1EUCA 3LUBA 3QBDA 2H16A 5E9JA 2P9JA 4YB8A 1G17A 3U1TA 2QAGC 1N2EA 1O95A 4B7ZA 3PQ8A 3GW8A 1S9HA 3FI0A 1QV7A 1L7MA 1W85B 4D43A 3W4KA 1U5BB 2Q5JA 5AXCA 5LWHA 2PUHA 3CE6A 1Q19A 3U13A 3G89A 4HB2A 3G9QA 2OZPA 2B2XA 3D59A 4A2QA 4AC9A 6REQB 2HPAA 4W1QA 3SM3A 4CM3A 3R74A 4PIPA 1TVKB 2XR1A 4U2DA 3MUFA 2B94A 1O6GA 5BVHA 1WLYA 3NATA 2JIZD 4TS1A 1D9ZA 2CXXA 1I1OA 2ZI3A 5CVTA 2HAEA 2C8LA 2B1IA 2HGSA 1TMYA 1DC5A 2ZS9A 2II6A 1EXNA 3KQHA 3DB2A 4C78A 1WETA 3OIYA 3HL0A 1KEEA 2F62A 4Q47A 3OLYA 5HQ3A 1THZA 5IANA 4ENVA 4CL2A 1WDWB 5IKEA 1ADYA 1O0CA 5AM3A 3I4CA 5GIOE 1G8FA 4DCJA 1C3JA 1UFVA 1NXTA 2PUTA 3R41A 2C2HA 4FBLA 2AX4A 4P98A 5GM1A 2R8OA 3K4QA 4RGYA 3FVVA 2GNPA 3T4PA 1PHPA 1WB5A 5K03A 2CF5A 1E9BA 4B4OA 3AY7A 1LJUA 5DE3A 621PA 4MB0A 4BGVA 5HM6A 1F1JA 5JSFA 1QCCA 3AOGA 4Z1OA 4XQ0A 5EHXA 1V3QE 5COQA 1DQZA 5IJXA 3RRYA 5EJAA 4GI1A 4EG4A 2BUBA 3SJUA 2EFHB 3GA0A 1PEKE 3LC0A 4WKBA 6ADHA 1PYGA 2YVQA 1RADA 4K6HA 1RHQA 2OXIA 5KX5A 4INPA 1L5MA 1UM9B 3FNHA 2A2ZA 4Q93A 3I2YX 5EKXA 1Z5GA 1MA3A 2GHRA 1WJGA 1ZIDA 4K40A 3Q9LA 2NLOA 3IUEA 3V2IA 3WK4A 1MQAA 2VDNB 4KQHA 2ZB2A 3SXJA 4WAUA 3ZHQA 2H9AA 4CUZA 5K09A 1AB5A 3AVUA 4O4HA 4MMXB 1JU9A 1R37A 3EOBI 1PR9A 1GRNA 2OBYA 3LV8A 2ZSAA 5KQSA 4NPCA 2I2XB 1RVV1 2B8JA 3D8NA 1FW6A 3PPXA 3HRKA 4YACA 5AOCA 3ZE0B 2IVFA 1QQBA 1Y81A 3QNMA 1X1TA 1JVSA 1JPJA 5KYXB 4S35A 3M81A 4Q15A 2XCUA 5DDIP 5BPHA 4LFBB 5HCIA 2GTHA 3JSAA 1O58A 2QNRA 3VPAA 1SXJC 4QWWA 4P08A 5C37A 3KYBA 3V1YA 3QOWA 4G8BA 4R2XA 3PC7A 4RA6A 4W6QA 4PICA 3UMYA 1G18A 3Q0TA 4Y0VA 4RIEA 3SHOA 1JJAA 4TYYA 4KNWA 1VRVA 3A26A 2OFFA 2X6TA 3UICA 2Y4NA 1VFPA 2A6PA 1HDEA 3GJ8A 4BBPA 1WABA 4E5NA 2V7WA 3ACCA 4K6CA 2VF8A 1G7RA 3HVRA 3NGMA 4MHSA 2VJOA 3JARA 3PDHA 1R10A 3WIVA 1N5KA 2V6MA 3LUHA 3LFHA 3Q7PA 1NULA 3BGVA 3F4LA 3R7WB 1EDZA 4FFNA 3AHCA 3D02A 2QOEA 1EIZA 4CL0A 1M1YE 2VK2A 4GRDA 4I4LA 1KVSA 4MVJM 4TS9A 3TBFA 4BVEA 5ARBA 1CUDA 4LFCB 2GZ1A 2O3QA 3EK2A 2GCPA 2GN4A 3PKZA 1U2EA 3PV0A 5TV2A 3E3LA 3IKMB 1MJ5A 3X1ZA 3QNUA 2JIRA 2F64A 2I6QA 3N3AC 3FX2A 1EBUA 3RKSA 4D8TA 4MA5A 4ZO4A 4DG5A 1X7XB 3I6QA 1U0FA 4JJ4A 4N54A 2WTMA 5K3EA 2A1TS 5GJBA 4XWTA 5F5LA 1TQHA 4M0LA 2YVKA 4MVJA 3RRZA 3RUFA 2HNKA 2I1VB 2JGNA 4Q34A 3KTFA 1VI6A 5FOSA 2B83A 5HQJA 1ZGJA 1L8AA 2PX2A 3N8KA 4MRMB 1CBUA 1ZI9A 4MLZA 4RADA 3RJ9A 3CGWA 2FJPA 5K0SA 2IFTA 3V97A 2AFRA 3WI7A 1IN6A 1R8SA 1TL7C 4ML3A 4MUAA 2XKJE 3KV1A 2D5AA 4BNFA 4DWJA 3THYA 3GF4A 2FG6C 4B9EA 2PUEA 4M7OA 3FWHA 1XRQA 2DR0A 5TMBA 3OAAA 1GKUB 4QGAA 4EENA 5BUQA 1T9GR 3UWPA 4UOEA 1L2TA 3LQKA 4NCKA 5HR5A 1XN4A 1ONPA 1R9JA 4IHAA 4ND6A 4PGGA 4B3CA 3RRJA 2CLCX 2RSLA 3L77A 2O3SA 1HQDA 2BHRA 1QVZA 1TJYA 3AUUA 1KKUA 5DH9A 4L50A 4KAAA 2ZRAA 4KQIA 2J0UA 4LQDA 4G0OA 5IAGA 3FHJA 3FZEA 3PPVA 1S89A 1VL8A 2FFJA 1TM4E 3HEMA 4FWBA 3Q6NA 3V7WA 4N3NA 4S2UA 4D97A 2ZE7A 5HBRA 4D3FA 2PUWA 5DMHA 1ZRHA 4HDMB 3B36A 1ZYUA 4ARSA 1KZ9A 4D81A 4J0DA 4FZJA 3FMFA 4JGIA 3TW0A 1H9CA 3AGPA 4BMNA 4KU4A 4ZVSA 3WJAA 5KNCH 3DDNA 2RG7A 4IMPA 1UJBA 2QD3A 3LW8A 4MAFA 4XQ9A 3GVXA 3IRVA 1ISMA 2X4IA 1Y8ZA 3HYTA 3HN6A 3MRVA 4MW5A 4TV9B 3RW9A 1JHVA 2JS7A 4AY4A 3QJ5A 2WK1A 4YCDA 3RS4A 3GMTA 1B00A 1WZEA 2YXBA 5A71A 2ATVA 2ORED 5A7GA 4FE4A 2B36A 2CJYA 5DYGA 4EYGA 1II8B 3ZGXA 2AQKA 1AGNA 2MSWA 3H5AA 4L9WA 3OFND 1JKXA 2A1UB 3UCEA 5CVVA 3WA7A 4DR3B 4EO7A 1QFYA 2C29D 3E1KA 3QVSA 4G23A 1WIWA 2QN9A 4TZ6A 3HVHA 4YRIA 3CJQA 1EGQA 3KE8A 4L27A 5G53C 5B1DA 1T3SA 2IDMA 8GPBA 1YB4A 2CHVA 2V1UA 2O3RA 1GPDG 2CNKA 2ODPA 2DP4E 1U02A 3K53A 1SUCA 4TTQA 2FRDA 2Y99A 5LKAA 3AKZA 3L02A 4G5FA 2QX4A 3GCGA 2I6UA 2OLJA 2VK1A 3NONA 4WCFB 3G9TA 3UK0A 1M76A 4OQEA 4QTUB 1N8TA 1ZOLA 1PBNA 3HN7A 4G8JA 3SQXA 4Z8YA 4NYJR 4Z9FA 4MS1B 5K3FB 4MQFA 2WHEA 1HYQA 4C6TB 3L79A 1E1LA 1UR5A 2M6SA 2YDXA 4H1UA 3BXHA 5JTUA 3ZCQA 3GVIA 4OHOA 4YAUA 4PYIA 5IVPA 4A6XA 3U0VA 1ORDA 1YHYA 5LYJA 1QM5A 4X24A 4MUYA 3A10A 4REOA 2J07A 5JNWA 3ABZA 2PVCA 4RU1A 2CVPA 3WX0A 4ZODA 2R00C 2SKCA 1W48A 4UE6A 4ZMSA 4JQCA 1C14A 2FW7A 1WHSB 4U2KA 2GBGA 2EARA 1RRFA 3W5CA 3NHZA 2Z6VA 4N76A 2F4VB 4JH0A 2GILA 2VEDA 3T7IA 5CDFE 2PUVA 2WU8A 4EY7A 2HFKA 2QEQA 3VVMA 3R24A 2QV7A 2XCIA 5D84A 5DIFA 1ILEA 1W46A 1FVHA 2IHUA 5HZMA 4ARZB 3AOEC 5TRTA 2C5GA 2WIFA 1VA4A 2PT7A 2IIVA 2H5LA 2DFTA 4BFVA 1ZESA 5AUPB 2JI6A 2YV1A 4P31A 1E1DA 3ZVNA 1EFLA 2HQSA 4I4TA 4K8OA 2ZYIA 2OGZA 4HDSA 4C29A 3KETA 4Q39A 3GLIA 1OXXK 1QQ7A 1XBTA 3OX2A 3QU5A 4KXUA 2YNMA 1QTRA 2LIPA 4S05A 4OLJA 3N2KB 1QRAA 5AW6A 4X97A 1Z25A 1HDGO 3TK1A 4OHCA 4Y1RB 1Z15A 4UM7A 5BOVA 4Y2SA 4WPGA 2Z9BA 1JQJC 1FW8A 2I6XA 1WD5A 1B8OA 2WIGA 3CLRC 1ZDMA 3GNLA 3LC1O 1DVRA 1BDIA 2GPJA 3C87A 2FZVA 3UJCA 2QYTA 2XQKA 3PTLA 5DWQA 1KR5A 3KKLA 5F1OA 4YGXB 4JUAA 2XF8A 1PFQA 3GT3A 1EP1B 2NO7A 3EFBA 4ZPXA 1A5TA 2FSFA 1A76A 1PFGA 4IXDA 4BVLA 2P4HX 3BBLA 3PPYA 3TLKA 1V7CA 2DY1A 2YXDA 5DGTA 4IOKA 3F1KA 5FI3A 2XRMA 4TQGA 5E9AA 1RPZA 3DTVA 4LHXA 2PUGA 4KNYA 1Q7CA 4CF4A 5A3JA 2J32A 5SYAA 4MW9A 3RHTA 4MW0A 2V58A 1NU8A 4CRWB 4DV1B 1EVLA 5DNYB 2YWJA 5KKAA 1A27A 4QUJA 1U5CA 3TS1A 2UZ0A 4J1NA 3B3FA 4NQZA 4KIGA 1RTKA 3W5AA 5ALZA 3O47A 1MQ9A 1UPXA 2A94A 2JLYA 1NVTA 2X0NA 1CP2A 3DVQX 1T2AA 3WQQA 3OZRA 3T8YA 3L4KA 2H7CA 2IX3A 1DCTA 2XGGA 3Q9UA 3P94A 3BCUA 2AOUA 1RAIA 1Z36A 4GO1A 3TB6A 1R4NB 1XEXA 3VNQA 2NIPA 1R9MA 5IKOA 5KX5B 4TV8B 1U9JA 4OHWA 3QX9A 2Z56A 2YWCA 4TL7A 4DB4A 2EQ5A 1HV8A 4CFSA 1DTEA 3KZCA 5JQGB 4FFBA 1ZSYA 2Z5LA 3F1LA 3MIZA 4EJ6A 5HOQA 1L4YA 2OG1A 1R0YA 1LK5A 3O83A 3K0FA 2J3MA 2WKSA 4JB0A 1NMQA 3KKKA 1ZFNA 2Z8XA 3UK1A 2WT4A 4KIUA 3AI7A 1UAYA 3PQ3A 1S7GA 1VP3A 2A9QA 1CE8A 1QG6A 5EVCA 4TZ0A 2BFEA 5CBPA 3TRHA 1OBFO 3LDAA 1I3CA 2V9ZA 2G9UA 5EJ5A 4CMKA 1ZM7A 3UH1A 4RHTA 4E5MA 2J08A 3D1LA 3T5TA 5L4SA 4ACBA 4JYZA 3BHMA 3D0RA 3QBEA 1E5QA 2OHOA 2ZJ3A 1KP2A 2O7VA 3LUJA 1FPQA 2C20A 1HGXA 2RGXA 3KEOA 4DWWA 3CRZA 1AURA 4FZ3A 2UDPA 2OYCA 3JVEA 4NXNB 1YASA 1U3WA 4AJNA 2XXBA 3QA3E 4FIDA 4R51A 4RACA 5KTRA 1ULBA 5IZCC 1OZGA 3FDZA 1N2GA 1EEXB 1ZM2A 3VU3A 2ENUA 1PT5A 4X8MA 1DFGA 5K1ZA 4BLQA 4JFAA 5CLHA 1WXFA 1KFKB 1Z39A 4Q9IA 4CF5A 1TF7A 2HXYA 1KU0A 5BQXA 5SYNA 1OGIA 2WSSA 5L45A 3F97A 1ZCBA 4FW9A 5LOVB 1T0BA 2FEWB 4JNKA 4ALLA 3IH5A 2EFYA 4MQBA 4E03A 1WSWA 4YRLA 3SEZA 1VA5A 3TM4A 1DUIA 1HE3A 3AQIA 2IU6A 3IV7A 4HLUA 4KJZA 1AN9A 4N8EA 1ZNXA 2RAFA 3EDCA 1S01A 2L2QA 3CH4B 3F98A 3RS5A 4CODB 2EKLA 1HQKA 1JFSA 2IYSA 3GLGA 1TKBA 2KWIA 3SYKA 4NU6A 1HL3A 4RHUA 2QHXA 1MIOB 2HH9A 4L3OA 1HM5A 1P7CA 2QVGA 1E0SA 2PX5A 4HMQA 3ZIAD 3ADCA 5KPJA 1G8SA 1P72A 3GRVA 2OHJA 5EIXA 3T4UA 2HTFA 2IXTA 5AI6A 3OM9A 1MC1A 2ZI4A 5GZ1A 3KSAC 1TM2A 2TECE 2VF4X 4X61A 4ADSG 4UUQA 1IM5A 3GJ4A 1VCMA 1VRWA 1RZUA 2VSOA 4WOPA 1U6KA 4JSYA 4WLVA 3ZZNA 3ZDEA 4CPDA 1M2NA 3BE6A 2MTBA 2YYYA 4COKA 2QE6A 2WAAA 2QTVA 5GGXA 1WMSA 3O3NB 4MWCA 4PXYA 1K5HA 4RK6A 2WWFA 3O9MA 2WIDA 4PPYA 4UTVA 5I4CA 2PSHA 4GLOA 3ROPA 2GXQA 3W8NA 1A4XA 4EG5A 3IHWA 5B53A 2ZETA 1AGPA 2QE7A 2FFQA 3C4QA 1EX7A 1KJQA 3K92A 2PZMA 2WW8A 3EFOB 3PQ6A 5ALIA 5THXA 3SYNA 4MJXA 3WL8A 4GR5A 2EKQA 3O2SB 1SZDA 1Z0JA 4RS4A 4WNAA 3E7DA 5JD4A 1JPVA 1VLJA 2DJIA 4MV4A 2WD9A 1TO2E 1G0OA 1PKXA 1Y7LA 2OZKA 1X1RA 2YZ2A 1YU9A 2QSJA 1LFDB 2YJTD 1P3DA 1CHDA 4X1KA 3THRA 3ZHUA 1P4GA 3DOFA 5BMVA 1ZMXA 2ODWA 2YY6A 1VLZA 2D4HA 4U2GA 2IV3A 5T4HA 3IDQA 2AB0A 3DVAB 4UCFA 5C1PA 1OH6A 1CS0A 4QRDA 2V45A 2GNOA 1ZINA 3VR6A 4IJ6A 3DYIA 2IBSA 4G25A 1QKIA 1RXYA 1JTVA 1D09A 4DA8A 1IHPA 2ODBA 1EH5A 2FZ5A 4HNGA 3DOJA 4R0VA 3LK6A 3A2LA 5JRJA 1AS3A 5TQ2B 1OR8A 1GXSB 1ST3A 4C6SA 1JFVA 4YRGA 2MHCA 2PYZA 2GDJA 3C48A 2Q07A 4JQSA 3AHJA 1F2VA 4JJIA 3GRKA 3C3MA 1C3EA 1UXIA 3OJFA 3CEMA 1NXQA 4YMTA 2Q50A 3MWEB 1NBHA 1FLAA 3LKZA 3BCRA 1ODIA 1ZVKA 1LQ2A 2IYUA 1OLUA 5LBUA 2X7JA 4XAQA 4X1IB 1A4RA 1YVDA 3TXAA 2QI9F 3OHMA 3C4VA 3JWPA 1QWSA 4KIFA 5EZYA 2Z4RA 3DF9A 2C9BA 1L7QA 2VJBA 5EJ2A 3HJNA 3CBGA 4ZO6A 5HSGA 4TTRA 3TIFA 1N78A 5KYKA 1IK6A 5BOSB 5TS3A 4EW6A 3ROFA 1ZBQA 1ZPDA 4L2IA 4HNVA 1NSYA 5AESA 2WE8A 1GUFA 3M34A 4YT4A 1J2YA 3A6PC 3Q3VA 2XNKA 4LHWA 1BD3A 4BP1A 3H7AA 4LXGA 1QTNA 1DWUA 3M6WA 4I5FA 1N75A 4TKLA 1O8CA 4NU8X 3NCTA 1IBSA 4L6IA 3TLCA 2JZNA 3QIAA 3ROKA 2AN3A 5DEOA 2VZ8A 5B1HA 2XADA 1X0XA 2P2DA 3DOUA 3TLYA 4BU1A 4LJ6A 1LV8A 3F6RA 4HZUA 4PSCA 5DYWA 2COUA 5CVDA 2ASVA 1FTGA 1JHPA 1K2VN 4K0RA 1QXSA 1EGHA 3G0CA 1MB4A 3PUJA 1I7PA 3WJ1A 5IZ4A 2XXAB 5KAPA 1AUPA 2W4MA 1GTG1 1AO3A 2V0CA 2WBLC 1I5EA 3DE6X 2XPCA 3D5QA 2C3YA 4NFLA 5L6LB 3V8NA 1JVBA 5JPDA 1R74A 3I6YA 4HQ0A 4FGJA 1EFHA 4RJJA 2BD0A 2GT1A 2P2CA 1T6BY 3IUJA 3LCVB 3LY9A 3IYLW 1Y4DE 4LDAA 4CKCA 4YMHA 3K96A 3EDYA 1K97A 3VZBA 1U0RA 1AZTA 1QIEA 2DFLA 3NXSA 4RGQA 1JI0A 3AH8A 4JLKA 4K9LA 1RHJA 4BQQA 3PNBA 4HWTA 3U37A 3GD5A 5F7ZA 3ZXIA 1G9XA 1EX9A 1B8PA 2ZUVA 3IKVA 3K2BA 4IH9A 2Q0XA 4FHDA 2C59A 3AU9A 3LPDA 4ZQHA 1NNSA 5HDQA 4XWWA 5KVCA 1V16B 3PQDA 2QN6A 1L4GA 1MGPA 2YV3A 2DFKB 4GFDA 3KK0A 4Q3LA 4X6XA 4XDYA 5CX1B 4AJPA 4EMSA 1XTVA 3C4JA 1YFKA 3LXXA 1QHGA 1M73E 2FZEA 2IYPA 2VEOA 1RHUA 1XWWA 3O4FA 4MVXA 2DUNA 1FNNA 2ZTHA 1VL6A 3N2GA 4TSFD 3ZX5A 3WLEA 1B16A 4IIEA 1NVFA 4D9JA 5A5FA 2QYSA 3GU3A 4QSMA 3WOVA 3V2HA 3G6KA 2VHTA 1Q17A 3SBOA 2M32A 2ANCA 4PZEA 4UPEA 3MGBA 3W1WA 1XTQA 3ZEIA 2QAIA 5EP4A 1PU2A 3DONA 4RQBA 1W4ZA 2CLEB 4MGIR 2FPPB 2O2JA 4NU0A 4KOEC 2ZQYA 3KCQA 5HX7A 1OFVA 1GQ2A 4ZP1A 4AUKA 4AUMA 1ZJZA 4ZJPA 2P67A 3IBCA 4FUTA 2HYDA 4YC7A 4A8JB 3K8YA 5LSAA 1EWTA 1RI1A 2CXTA 3W2TA 2GPBA 1NW6A 5E3HA 1JE0A 2EWMA 3DMTC 4JB2A 4ZAVA 5K6AA 1MKYA 2O23A 1J39A 1YQDA 2H9IA 4JFRA 5HF6A 4Y1GA 1CU1A 2J59A 3DQPA 1GAJA 1NBEA 4E07A 3S40A 3OJEA 5BN1A 3WMGA 4IH4A 1OLSB 2C2GA 5HGXA 1Y8CA 5JD6A 2XSZA 4GBMA 3ABOB 2GESA 3GL9A 2PNFA 3OPYI 4DQLA 1NASA 4NFSA 4YROA 1LC3A 3UXYA 1PE0A 4OXXA 3CUSA 3QE4A 4M0DA 5DBOA 4DA4A 3JASA 3RRXA 4BKOA 1N5IA 4W4TA 4I1SA 3JVIA 5AM1A 3WGNA 3WRXA 1OB5A 1ZD9A 1S2LA 1ZD4A 2PANA 4G3XA 3BILA 3VPSA 2RGGA 1XD8A 4KZPA 5HZKA 4P0QB 4OLAA 1ZK3A 3COVA 4WACA 5COAA 3VPHA 3QPDA 2ZJFA 3SNKA 4J0QA 3LQ4A 1C4OA 3KJGA 3CA8A 3LHIA 4M6WA 4A1FA 4BVFA 4AMVA 5JAMA 1RAEA 5AJHA 5K0GA 3H2BA 1C8LA 2JBHA 4M8IA 3AP3A 3U4DA 3M6IA 1C9YA 2DSNA 5CYGA 3JQ9A 3EEIA 2ZUFA 4D0RA 3C39A 5K0EA 4CMGA 2I66A 2HR1A 2V8OA 2PM8A 3M1LA 4HDRA 5B5SA 2JFWA 3U7IA 1QF6A 2XGSA 4XUGB 5CU7A 4B4DA 3OOWA 4F3NA 5AR1A 3SIRA 3TXYA 5GTDA 1VHDA 1WR8A 5K8LA 1GAXA 1FJHA 3ZCRA 4MLCA 4JS0A 1EVZA 4P3XA 3QVGB 1K63A 4PQFA 2HMUA 3ONWA 3RHZA 5JADA 1G20A 1N5RA 3R23A 5LOVA 3CT4A 1YB5A 1KH3A 1IB0A 1QHHB 2LKDA 3I0ZA 3RYCB 1Z63A 2ENWA 3SSMA 4F97A 1LW7A 3QP9A 5HF9A 2XE6A 3D8UA 3MAJA 3NHWA 4MV3A 4OFZA 5H80A 4C01A 3QG5A 3UMJA 5I9NA 1JIIA 5G0UA 3DEAA 3LW7A 4D8YA 3U17A 1CETA 1JXOA 4G85A 5A4IS 1NQOA 2O57A 3WIOA 8MHTA 3A6FA 5LA6F 4Y6SA 5F33A 4BO7A 1BXZA 3WSVA 4CLHA 1PUIA 4QQFA 3EJWA 4I1YA 4FGWA 2BUCA 4YXFA 4BKMA 3MAGA 4Q48A 1HKHA 2GB4A 3BQ9A 3H18A 5IC4A 1I2CA 3KPJA 2G9QA 4D7AA 4L08A 3HV0A 3ICCA 1A97A 2BMFA 5I7EA 1Z35A 3ECCA 1YT5A 5L7TA 4AP6A 3VHQA 1I80A 1IBRA 1BCSB 1NSTA 3DQZA 5KYVA 5DO9A 2DLNA 2I9PA 2B4KA 5DYIA 5FL7A 4YUYA 4NL4H 2RJOA 2BOVA 2NWQA 3A1VA 1H05A 3FJ1A 4YT5A 4AQ7A 4MTCA 4LYDA 3ERCA 1YKFA 2Q29A 1KY5A 3TN7A 4KQWA 4H60A 4YAJA 1QHSA 2VDUE 3MBIA 2QJWA 2E21A 1DJQA 1E1CB 2HCBA 2WMOB 2WQ7A 4QOFA 4CEJB 2NTNA 3D9QX 1V3UA 2COKA 4FFRA 5EGNA 5JVDB 5FWXB 3G9XA 4HTFB 1RRVA 2VSNA 3GBVA 2IHBA 4OOFA 2IPNA 4HF7A 4NH4A 1L6IA 5FOUA 4LOKA 2AW3A 3R9WA 3RAFC 4IJWA 2PKQP 3HA7A 4CI0B 2QZJA 2P9CA 2RJNA 1DQYA 2OHFA 2JZCA 4KBGA 1AQUA 2MYTA 4Q4LA 2FAXA 4WL0A 5KC8A 2WU0A 4I1OA 2AX3A 1TLLA 2XMCA 2GERA 2OP1A 4DWOA 2B5OA 2Y1DA 2IW1A 1C1DA 1QOPB 3DEHA 2E82A 1WQ1R 2XNSA 3HFRA 3PR1A 3OZBA 4C87A 1CQIA 1PNOA 2XBLA 2CXRA 3IJPA 1ZVMA 4RIFA 4C4YA 4NFYA 1XLVA 1CKEA 2H4JA 1KEZA 5KYWB 3CY6A 3A9VA 4RGVA 1NDHA 1N33B 1E7MA 2L42A 3UV6A 4DIBA 2DPXA 3OMXA 1ZUWA 3GPLA 2JI9A 3F3KA 5LQCA 1W19A 3I09A 2Y0DA 3U7EB 3W5BA 2IT1A 2QL9A 2D5BA 4H3KB 3ISVA 3WRYA 3VHXB 4OYLA 1UFQA 2WJ6A 1R0XA 4M2LA 3V33A 5HPYB 4FOOA 1KXJA 2RHGB 3U1BA 1L7EA 4INZA 4UW9A 1EGMB 2XSZD 4K6OA 3GVCA 4R9SA 4KQ1A 3J81A 1QYVA 2XECA 5HCNA 1DXQA 2ZEJA 3UVEA 4KPUA 3I12A 2F3PA 2JDIA 1GV1A 5I45A 4JHLA 4M88A 4H1VA 1GXSA 4LPKA 1JSLA 3KQTA 1IN5A 2NPIA 3EY4A 3EZNA 2NVUA 1JEJA 3HUTA 2WMNB 2RGUA 3OICA 1KQNA 1QPGA 3B7GA 3ENQA 3JQ7B 3RQIA 4FX2A 4CF7A 1LNSA 5AJXA 1J2JA 1EFVB 3TTUA 4BX0A 5DSXA 4EA6A 3EGDB 3TQRA 3KLOA 3WDMA 2Q4OA 4HX9A 1GZVA 5K45A 1FDVA 1XZDA 2IL1A 3QVLA 2QMZA 2Y0EA 5DF1A 1OUMA 2NACA 1L7DA 5DBGA 3O2QB 4L4SA 5H83A 3S70A 4EB3A 4QU9A 1I01A 4PC6A 3K0CA 5BYBA 1Q1BA 2JFGA 1A77A 2P6PA 4M4SA 4I1PA 1SA0A 4LMBA 3MNFA 4EUSA 2QAGA 4DMRA 2WD7A 4V3CA 5IT5A 3BMNB 4XPIB 3WGIA 3C41J 2VRCA 2ZSJA 1L4UA 3JR7A 4IAOA 5ALGA 5EJGA 5FWYB 4EG0A 3HDQA 5K0NA 1M8JA 3HBNA 2G77B 1ODFA 2B20A 2BAGA 4BJHB 1E6WA 2ILTA 3FE2A 4X7RA 1J8MF 2C4MA 3BMOA 4WW0A 4O2LA 1K1EA 3OMWA 2WFLA 1FS5A 3G2OA 3AHGA 1OLOA 5HHTA 3OKCA 4D92A 1AE1A 4ZVRA 2FR0A 3S2YA 2QROA 1FUUA 8AT1A 3VU8A 2X2PA 2E4UA 1F6DA 4JIGA 3LVQE 4XRGA 4X65B 1TO6A 2WIAA 4JL8A 3NIFB 4BDSA 1ZGAA 3WYGA 3V9AA 1Z8NA 4RTSA 2JF0A 3ENKA 5KSOA 1X92A 4RIHA 3CF6R 1W8IA 1D6SA 4YQZA 4PAGA 2QZPA 3GXOA 1X94A 3LP8A 1L4NA 3M5DA 2O5EA 1PJ2A 2YJZA 1VSUA 5FD8A 4Q1VA 2WF8A 4QGGA 1V5WA 1J0DA 3FDFA 3QU4A 2QUKA 3W1VA 2HL6A 5CDSA 2NQ8A 2YFKA 5KTPA 1V3VA 5HMMA 2WI8A 3GEGA 4PHTA 1PR3A 2OLKA 4G0ZA 1R1DA 2XGMA 4BLTA 8ATCA 4LHEA 4TTJA 3W7BA 1ZD2P 4AP9A 1FYVA 1KE1A 4L4ZA 1T5SA 3E61A 3NHPA 3O4JA 3AV0B 1U65A 1S8AA 1IU9A 1GT6A 2Q8PA 1GEGA 1A1SA 3AESA 3GGDA 2PLRA 3IXQA 3HU2A 3VDRA 4TUYB 1J99A 2JGDB 1TJPB 2NNWB 1ZN2A 4BQFA 1SCAA 3G49A 4KACA 1G4HA 1DG9A 1HYEA 3V9PA 4TLCA 2J9FB 2R7NA 2QP3A 1N6KA 1NR5A 1P5ZB 4XOUA 1ZI8A 1Z0UA 3KOYA 5H4GA 1H4TA 3OJLA 5B58T 1Q20A 3H8WA 2AGVA 4EKIA 4L8WB 3RC7A 3F6CA 1SCNE 1T36B 2G5CA 2HQBA 2P2YA 2PA3A 2VYVA 4HI0E 5H16A 1OAOA 3SEFA 3FTPA 1OY1A 2YN2A 2WV7A 2NYUA 1N1EA 4RMHA 1VJGA 3ZJ4A 3LX8A 2IPXA 1PD1A 1BWQA 5LU9A 2BGIA 2CKDA 1ND5A 2Q6LA 3ED5A 3JYLA 2A5JA 4F5YA 2AC4A 3DA8A 2ETVA 2A86A 1E66A 5H3HA 2WYWA 1KRXA 1SUBA 2D3TA 1SCIA 2O52A 3OLWA 3OI7A 4ZJYA 4H35A 5ITZB 4P92A 2B4RO 4B1FA 2UZ4A 4Q1AA 4DIMA 4TVOA 4OHXA 1BA3A 1KZYC 3Q3JB 1BXGA 1P18A 1V7QA 2A30A 2VDRB 3GAMA 4M0PA 4PFSA 2GEKA 4UU7A 4B3IA 3ZHYA 3I72A 3ZXUB 5B57C 5KMGB 4DTCA 4LRSB 4NAHA 4C4OA 3QWFA 5LDGA 4CMIB 1F8YA 3IVRA 1IUOA 5LLSA 4IOLA 3EVNA 1QONA 3K1JA 3D4BA 1AKEA 2DKNA 2OPHA 3SCZA 5B3LA 5EEHA 4XUCA 1ZJJA 2A67A 1I7NA 1LLFA 3KQKA 3PUVA 2R66A 1REQB 4N48A 3NASA 3IERA 1S3GA 3E0QA 1ISRA 1ONOA 4F04A 4E94A 3PS9A 2VAWA 3NHUA 1JZTA 4FDAA 2CVZA 5LYJF 4D98A 3W6ZA 1KFJB 2G3YA 3AFHA 3PT9A 4ISCA 1NA5A 4FFDA 1TYZA 2GBLA 3AZOA 4HN9A 3E9RA 2ZATA 3GDFA 1E2NA 1OFGA 1V9CA 4WZBE 4AYTA 1U6JA 2BDTA 4IQ4A 5IJ0B 3PWTA 2C83A 4XQCA 1XEAA 4QECA 5EE1A 1MT3A 4IGFA 3PQ4A 2NU8B 2P1ZA 1HEYA 4I2VA 2JDID 1LDBA 1GL7A 1IPFA 1PNRA 2VCYA 3ZWMA 4YRSA 5CIYA 4IDNA 3BGIA 4HPJB 5JSYA 5LQJA 1VE1A 3K32A 4R1LA 2NU9A 3M5WA 4P3OA 2XIQA 4TV9F 5H4HA 5K3SA 5HUHA 3CISA 1E9AA 2AN9A 3ADOA 3KAKA 1C1YA 1NW5A 1KXZA 2H11A 1NVMB 4TSRA 4WXYB 4AX4A 4A82A 5CMLA 4BZXA 1X9HA 3DB1A 4K87A 2XX3A 3H5TA 1XMIA 4CLRB 4BQOA 2PBLA 5AOAA 1VLMA 4IXMA 4PBTA 4X66B 2V6BA 2YIMA 2X23A 1JIVA 2XE8A 3K2IA 1FVXA 1J00A 4I55B 3UK6A 1HLGA 3QEMB 1RYHA 3QLJA 1VDZA 3IPCA 1DZ3A 1P2DA 1V47A 2JVIA 4X85A 2JJ2D 3STUA 3M4YA 1N9GB 5J4KA 1R12A 4RAQA 4G0MA 3JS5A 2IS6A 4LBWA 2I33A 1P5JA 2VAXA 1SZPA 3TWOA 5GP1A 1R4AA 2QM0A 4DMGA 3SC6A 1KVRA 3FBWA 1HEUA 4BLUA 5JDCC 1VGQA 4RPKA 5DI3A 4FYXA 4DT1B 2AI3A 1N2BA 3KT6A 4YJKA 3D81A 1P9RA 4BNIA 5JVDA 1VZ2A 3RSCA 1RI3A 3EPPA 4BFYA 4GNKA 2QPOA 1I14A 2X6QA 3OTIA 2XMPA 5KYXA 1CVRA 4Y2QA 3HVJA 1XKQA 2CZQA 2H65A 4RE6A 5TSDA 1BWSA 1L8XA 1BN7A 4OK6A 1JQAA 4ZOBA 4E13A 1IVSA 2E1PA 1EIWA 4LX0A 2EFGA 1Z4LA 1E1NA 4HEQA 2CNNA 1BS9A 2ZT5A 1W4CA 2H9YA 3PFHA 2HF7A 4GSLA 1NRIA 3PEUA 3FETA 1F60A 4M1KA 3AF0A 4Q4AB 4UHKA 1M3SA 4EABA 2IS2A 1HDIA 2C0CA 4R69A 1PVOA 3EXEB 3STHA 1MQSA 3BZWA 4GX2A 5EFOA 3K0SA 3MSCA 2YZNA 3ZJYA 4P7KA 2F3RA 4DZTA 4BLWA 3JD4A 5ESRA 2GDZA 2X8JA 2FOLA 4D4GA 1N1GA 4RM3A 2ZTSA 5AIAA 5CDTA 6PFKA 3PXGA 5AW8A 2QRVB 3DL0A 1X1BA 1J8YF 3C24A 4OXNA 2A9FA 1U3UA 4JUDX 2Z57A 3BD9A 4N7JA 1Y3FE 4IRXA 3EZ7A 4D57A 2YV2A 4K8RB 4R16A 4Y2TA 3U56A 1PG2A 3Q87B 2HMTA 3HMKA 4H1TA 2W70A 2HQ1A 4JBIA 2ZVQX 3JZAA 4EZEA 4OH1A 5FULA 1YXMA 2GS9A 2R7KA 3ID6C 2OY0A 3WFIA 2P40A 4S1NA 3O0DA 4CLDA 4BEBA 2HADA 2EEZA 1N2SA 1E2LA 4R1OA 1FNCA 4IMJB 3PUWA 1OGJA 1KDYA 5LUAA 3M6MD 2AXNA 1BFKA 5B2EA 5KJFA 4KMSA 1OCEA 3RC8A 3B1JA 2N0SA 4NE9A 1FYEA 2YOHA 3N5CA 4YRAA 1O6ZA 3BK1A 1EWVA 1YIAA 4HWGA 1GGVA 2REBA 3ZYCA 1W88B 4Q9HA 1BRMA 2PT9A 1A5BB 1ISHA 3FPSA 3NOQA 4C22A 2YL2A 3FCEA 1GUBA 3IKLA 4JJ7A 2NSYA 4PNPA 1ZSVA 3QTLA 3RV4A 3SHTA 4QX6A 4XYGA 4B45A 3U48A 4BO6A 3HB9A 1XA0A 1C1XB 4RKWA 5FNZA 4Z53A 4DV4B 1IXKA 3QKSA 4NULA 4P9NA 2QN3A 1M0EA 5D7NA 4Q9NA 2ZBRA 2FE1A 4N3BA 3C3XA 2J6HA 1GSOA 4KDRA 4N8DA 4CM1A 4H18A 4JT2A 2FUG6 1Q0HA 1ZU4A 2QL6A 1W4AA 5F7JA 4O1HA 3A6DA 1E2UA 1OKKD 1QHYA 1QU3A 4Q05A 3G2QA 1HY3A 1NUQA 2ISQA 3OCJA 5DGXA 1NMXA 3GUHA 4DYHA 2K7FA 3OF5A 4F2HA 3U5TA 1Z3CA 1EVEA 1K8RA 1NYQA 3KELA 4WBNA 3W2HA 1NN1A 5G1NA 1DX4A 1OYWA 1QCDA 2Z3WA 4MWSA 5K8TA 2R8ZA 4Q6WA 3LF1A 4EA7A 4UCQA 1R9GA 3LM8A 5TQ0A 4O25A 1RYEA 4ZREA 5CFMA 2RHOA 3KEFA 4LZWA 4R5MA 4B3SB 5E6RB 1KSJA 5DMXA 4DR4B 1A5SB 4ME6A 1I7QB 4RTNA 3LQ1A 4GG1A 1LI4A 3DHWC 3KVRA 3UOWA 3GLFB 2FN4A 1KAGA 1E2PA 3H86A 2FWAA 5AHWA 4OUDB 1ADBA 2IV7A 3ZLJA 2EG5A 2X4DA 4BFCA 3BICA 4WN9A 3HDYA 4OU5A 3V1KA 4AQDA 3GPBA 5T41A 4CDRA 3N0WA 2JAXA 1ZR4A 1I5OA 2DQ4A 4HK4A 3N8HA 4ZV7A 3D5TA 5LC1A 4AZ0A 4BP9A 5JXHA 4V0NA 2OFOA 3IIMA 3Q85A 4TL8A 2R6FA 2Q6OA 3U60B 1SBHA 4PZAA 4EKNB 3LA8A 3FCSB 3G82C 3BAZA 5C8YF 2FEOA 3TX6A 4DREA 3HJRA 4D0GA 1JYSA 3FB4A 3OEWA 3A1SA 2EWWA 4E5VA 2JBAB 2NVOA 5I7WA 2O8NA 1MZVA 2C9MA 1F5NA 4WNCA 4WV3A 1IHUA 1SOUA 1SCUB 3FI9A 3RJ5A 1WB4A 2YHSA 4V0RA 1X7WB 3DAGA 4KK3A 3B82A 3CUTA 3SX2A 2MT9A 2PGIA 1A69A 2FR1A 5A05A 3G59A 2WSBA 2AZTA 3BTSA 4M1SA 1DPGA 4MO9A 4DIKA 5A2QA 3SLKA 1VLVA 3MLAA 5EMHA 2EJTA 1Z0KA 3PQ2A 1PR5A 3LE8A 2VJAA 4V2UA 4IKOA 3VO1A 4CT4B 2CLKB 4H6VA 2OO5A 1TO1E 3TQQA 3EIQA 4TUYA 4PCUA 1IJEA 4KGXA 1MC8A 1KPIA 1ENOA 1YAHA 2Z2YA 4I1IA 4BNNA 2ZYTX 4GBGA 3T9FA 3DUFB 1PG5A 1TJNA 5B30A 1IDN1 3BA1A 3BKWA 4JL5A 1CZNA 3Q40A 4MXDA 1ULSA 4AP5A 4F6RB 1XROA 3I04M 5A6SB 1KMIY 2UAGA 3L8ZA 4JLNA 4MMZB 3TL6A 1JHQA 2XOKD 4J0KA 3WL6A 1USIA 1BC5A 4PZLA 5LQRA 2PZBA 4JEUA 4D0SA 1XTKA 3VMFA 4OX9B 1MRSA 1CNEA 3ICWA 1S3FA 4FLMA 1UC4B 3Q2KA 1WHSA 2YICA 3OX3A 4PC7A 4AWBA 4FK8A 2PX0A 4TMKA 3H9JA 1KAHA 1JXMA 3TAHA 5IVIA 1DT5A 3VYWA 2GD0A 1W4RA 1QGYA 1CUFA 1SOAA 3F96A 3BQNB 1PS9A 1OYOA 3OP4A 1PT6A 2VUUA 1GCIA 2HV9A 3WB0A 3JD3A 2WAMA 3WMEA 1IULA 2EX4A 2XZTA 4EUFA 1PDOA 7MDHA 2YV4A 1QOZA 4DQDA 2DBRA 1ZA2A 2A9JA 4LJKA 1H9BA 1FX0B 1SUWA 3CTMA 3DZKA 1N6PA 1JE1A 3JRWA 3H5WA 3FGOA 4JOSA 3G2LA 3F74A 4RH1A 2BKEA 3WHLA 2G88A 2VH5R 1M1XB 5D85A 2IF2A 2QJOA 3FR8A 5AO9A 3THXA 3VBEA 4W63A 5KQPA 2V7XA 3KL4A 4QBKA 3LBAA 2A9KA 2YINC 2AJBA 2QKYA 5D86A 4NP6A 4AWXA 1SVSA 3AUTA 1CYEA 4DBLC 4RK1A 5JAOA 2BI8A 3LGAA 1ZWKA 1DT3A 1PZXA 1Q0UA 1ORIA 3QVJA 4EHKA 4YQEA 4EFKA 4HNAB 4LNUB 2XQVA 3LA6A 4RGBA 3W77A 1YDGA 3WQHA 1Z4IA 4B5LA 1L7RA 3AI1A 5DYTA 5GAJA 1Y3DE 2BZ0A 2F1IA 2LV8A 1H85A 4QAQA 4TUYF 2VZLA 2ZJ6A 4G9BA 4LDRA 5EGSA 1FVFA 1DC7A 2AOXA 2ON6A 3QIVA 4JP3A 3OAAD 2NU9B 2CDAA 3B70A 5J1TB 2YCLA 3UAGA 3TH5A 5TGTA 1E2FA 4IGAA 4UNRA 1NYTA 3OPVA 1NOIA 5JCZA 4CW7A 3BD7A 3JQFC 4CQMB 3L6BA 3NTRA 4W99A 4NMHA 2CNBA 1XJCA 5IH3A 3E3MA 4PBSA 3D8BA 1KZ4A 5IVKA 3HRHA 4UFNA 2WVHA 1ORTA 1GGMA 1YQ9A 2GKSA 2PVSA 1S0UA 5BY2A 1RM0A 4R6WA 4P4UA 1GDHA 1N9GA 3O91A 3NBMA 5CA1B 1DG3A 3NHJA 1SC3A 2I1WA 2JI7A 3Q3GE 3LT5A 1YBHA 2JC3A 4I55A 4CKWA 5JCOA 1IY9A 4RDIA 2R25B 2XY4A 2GZ3A 3CVYA 3BF8A 5L51A 3IE2A 5LP6B 1PL8A 2X1HA 1L7VC 4EECA 4FP9A 2FPOA 2ZBDA 3ZN2A 2Q2OA 4AG3A 5BN5B 2ARKA 4EPVA 1H1LB 3EB9A 2N9UA 3KU1A 3UGTA 3HVUA 2DFNA 2JATA 4CETA 1A8IA 3RHSA 3OQ1A 4EA9A 2QRMA 2YN4A 4OXYA 4RABA 4YREA 1QFZA 2C92A 1SURA 1KFEB 1HL7A 4I1VA 5TEWA 1CE8B 2JNWA 2X5XA 2GJ4A 1Q1AA 2C4UA 4EJ0A 3L9WA 4QJ3A 3O1LA 1Q22A 2CJPA 1ELOA 4X60A 3SHQA 4E2FA 2O2SA 5KB3A 1GPLA 1Z2DA 4EGAA 4BX8A 1TK3A 3STXA 4YDSA 2X40A 4PGFA 4EUNA 2Y27A 4IZ6A 3SFZA 3PJFA 4OQYA 4FFLA 4LQLA 5FA8A 3LOPA 1KAMA 2QRGA 5AXBA 3NZEA 2HRCA 3HCEA 4E51A 5ESXA 5IDVA 1Z12A 3K9WA 3W9SA 2YZMA 4IZOA 5ICGA 1Y6GA 4D44A 4GYJA 1AQIA 3EXEA 3S7TA 4UU0A 1GPBA 2R6DA 1Y82A 3EZFA 4N7RA 4RV5A 5B1IA 4RBNA 4OAOA 3UO8B 4ZZ3A 2ETXA 4UNSA 4QKQA 2HPHA 2W58A 2AXQA 3GFRA 3DZ8A 3MQ2A 2BEKA 5KCZA 1XJ5A 3AWDA 3UM9A 1N77A 3AHDA 4L95C 1CEEA 3AOEA 4YRBA 3D8HA 1QZZA 3PIRA 3E3OA 3QXCA 4TKVB 1Z16A 5K51A 3W8FA 4EYSA 3PRYA 1KEVA 4G5RA 1OI3A 2FUEA 1E3JA 4J43A 4PR3A 4URZR 3RNLA 1U8FO 2W4IA 1NN3A 4M0KA 5C4MA 2P75A 4GD3Q 3X44A 3CVXA 3WFJA 4YN3A 4GP7A 2QTHA 2VR1A 4MX8A 5BV0A 3D3WA 3F67A 2E7ZA 3PHLA 1GUDA 1XWIA 5KYNA 5ELXA 3LSYA 1E32A 3NC1C 4W1PA 2CFTA 3EH2A 2TMYA 3LC2O 1P2BA 4KO3S 4IDBA 3PFFA 1HH4A 3A6LA 5ALDA 5JH7B 1K5GA 2Y76A 4KSYA 3UZUA 5ED0A 1OV4A 2P6OA 3EVAA 4FE7A 1WCIA 1EVQA 3EQ7A 4ZRMA 3STTA 5I8ZA 2IKQA 1PDVA 4OA8A 1ORVA 4XGIA 3WA6A 2PH5A 3ITNA 2QN2A 3M6AA 1PR6A 3EVEA 3D7NA 1W6RA 2CFRA 2VT2A 5CD9A 2Z30A 2WWYA 4QPPA 5AVYA 1IIRA 1XQYA 3RGGA 4BQNA 3NBXX 4DLXA 2PH1A 1ESDA 3K70C 2BFBA 4QIHA 3K8OE 4KQ2A 1S6YA 3MJRA 3QVVA 4NYMR 1LF5A 1ARZA 2NX2A 1J6UA 3PQ5A 4OM8A 3ZHTA 3WGUA 2PUCA 3MUNA 5NULA 5IK2D 3OZIA 4CM7A 3K70D 2WWXA 5C1IA 4ZGGA 2R0QC 4P4GA 3SJBA 2ZYVX 3DBRB 1P0QA 2J3LA 3W9YA 3CE9A 1FTWA 1G3QA 3LYUA 1PJRA 3PX3A 3GCDA 4P3PA 4RH3A 2BGTA 4MS3A 1F1BA 1YQWA 3SG0A 3TI9A 5FH9A 4JGGA 2MWMA 1V45E 4YAEA 1KIMA 3I62A 3IMCA 4L8VA 1EKXA 3HXTA 3HC7A 5DNUA 4MPRA 1WDLA 1XNJA 5DULA 4BNDB 2FSVC 5A62A 2YY7A 1MLDA 1U94A 3FNFA 1DAOA 5CTAA 4YBRA 4YJ2B 1F14A 1IAVA 1NVUQ 1RSZA 3T0GA 4KKXB 2GCNA 1X9GA 3W2EA 1TIKA 2BVNA 4M54A 1BOFA 3FSEA 4LJLA 5F76A 3TIXB 3GX1A 4CLEA 3DOIA 4YRCA 2AI1A 1T91A 4RNCA 4Q6BA 1AV6A 2NUPB 2XCQA 3ECAA 1N2IA 2PZGA 4TYPA 3N8DA 2PUDA 4H0FA 1PJAA 1TQ4A 1TQ6A 1UBLS 1Z75A 1Z62A 3DTVD 4DGQA 4OQDA 5I7OA 2QDXA 2X5KO 1WPRA 1NJ2A 2DUJA 1G8YA 1CY8A 2PZKA 4IUDS 1YMUA 3UHFA 3MB5A 1NURA 4MWDA 1ISPA 2X8AA 3CSSA 2YYSA 4DCTA 2OK8A 2DXIA 4A27A 5B64A 4FOTA 5B12A 3H83A 4A8TA 2OEPA 2OT3B 4CG0A 1QFXA 4KBYA 5KYYB 3K0KA 2ATEA 3ONNA 4IW3B 3C7KA 2QBYB 2O8DA 5JRZA 1D0IA 1EX1A 1C7FA 2HHAA 3NAQA 3M33A 3R0ZA 2EX0A 4V0ME 5KOYA 1CDZA 3LECA 4BCBA 4LK2A 4R68A 4DLZA 3LYAA 2VLBA 5AW4A 1L8OA 4MV0A 1C7IA 2WIKA 1EP9A 3W3AH 2YNMD 3PGMA 3TD9A 2VPYA 4P4TA 3ER8A 3G2JA 1RPJA 4N5HX 1YDEA 4AY2A 1L8QA 2I78A 1QIIA 4MUMA 4XWGA 1DQNA 4PWZA 3OZXA 3TQOA 2H7VA 2XQIA 4F3KA 4O63O 3UUEA 4KO2S 5TT1A 2QT1A 3U81A 4OMFG 4DJAA 5KNCD 3C7TA 2VJDA 2WWTA 2ZBEA 3OPYB 4HNSA 4IPTA 4XB2A 1DV2A 3W6OA 3I39X 1UBRS 5CR9A 2PSDA 4AZTA 1CEXA 5EJ6A 1LBTA 2FN3A 4ZKDA 4QFBA 2IJGX 2IQIA 5K7SA 1LDEA 4ZZIA 4NMXB 1P8JA 2C8JA 3UAZA 2P62A 3PIDA 2PMFA 4GC5A 1PZHA 4G37A 1A98A 1T9CA 2ODAA 4MW4A 5IG2A 5K99A 4LWZA 2XUHA 2VUSA 2Q1UA 5ISMA 1ZLYA 3PUXA 2LP4Y 4M1OA 5BNWA 3VGJA 3COZA 2GHTA 3LAWA 3EPHA 4RD4A 1JLRA 4M7RA 4UOZA 5LMCA 4Q4CA 1T6XA 1FVOA 1XMVA 3HVIA 3SOPA 4Z3KA 3EC1A 2EG9A 3CB2A 3FTDA 1E3QA 2VJNA 4WK6A 4DMUB 1A71A 1T1EA 3C6YA 3NANA 4L8FA 3WRVA 4MYHA 3CNHA 4JVSB 2WP0A 5LKRA 2B30A 2W6IA 3FHLA 5HIKA 1IH8A 2P0AA 1HG0A 1XB2A 3NVMB 3OCYA 3NBUA 4II7A 3V8EA 3THXB 4XI9A 1NVDA 1RMTA 4CV0A 1N34B 4DJJA 3FMOB 1KNXA 2X4LA 3R3JA 2C0PA 3VAZA 1QZTA 1BDBA 4EMBA 2I62A 4IR7A 3ZD9A 1KSHA 1E1MA 1I1HA 4BVBA 1VIMA 1F48A 2GFQA 2WIBA 5AI5A 2JJYA 3N2GB 1H5QA 4M0UA 3TCNA 4E3WA 4KQ6A 3GG9A 3DMHA 5IKMA 4PX3A 1MJGM 4B6GA 3WXBA 1BKYA 1M2VB 5T57A 3E23A 2F1OA 3T9CA 4D1YA 4S04A 3DBLB 1TU3A 1P6XA 1HFWA 2J5XA 2AC7A 2ZAIA 3IMGA 3WWCA 1ZM9A 1ZUD1 2H2GA 3OFNA 4PSAA 4GDFA 3LK7A 2D74A 1RYNA 2VQDA 2V6JA 4G5OA 1GKIA 4KYTA 4MKZA 1SCJA 3NR2A 5DHAA 4RCVA 3NPAA 1X8LA 1ZEJA 4D02A 4ZHQA 1IBKB 1UDBA 2GGSA 4QTYA 4E4TA 1TUEA 4XIGS 3AUXA 5EUCA 1ZQ1A 3ND7A 3DV0A 4XZ3A 1T34A 1F17A 1UT8A 2BFWA 2ZQ5A 3G9UA 1HI9A 4YECA 1QYWA 1YTLA 1U8UA 3Q7TA 2I1QA 2J6CA 2EV9A 3NOOA 1AUOA 4AKSA 1T35A 2POQX 5AVTA 4JKIA 2OQVA 3SFTA 2WJAA 5LQSA 4JU8A 5E8JA 5B2FA 1J25A 2W98A 1N5JA 3CX7A 3IOMA 3R6WA 3G7UA 5NLLA 2HZBA 5C81A 1WDTA 2C57A 2F1JA 4MPTA 4QDUA 5EHQA 5BN5A 3UGJA 1JQLB 5FUQA 4JI3B 4PYKA 4ECEA 3AX6A 2RH5A 5C46F 4NABA 2X19A 2PMBA 3E0XA 1KYQA 3I9NA 2EW8A 3ZV3A 4PRZA 1K7XB 3KQUA 5FJIA 3K2EA 1GSIA 4RMIA 2PQ2A 3PC3A 4FHGA 2FVYA 2Y8EA 1CTQA 4KRFA 3V32A 3B51X 1SXIA 2ZJAA 4OQZA 4QJ5A 1QP8A 2FOIA 1M2WA 2VJMB 4WKCA 4X45A 3DHVA 8ABPA 3HYSA 4LZNA 1GZ5A 4H9GA 4M1TA 5CT8A 5LL6P 3Q8KA 5KJEA 3P20A 5KNBA 4L72A 5D01A 2W93A 1M8FA 2Y67A 3AJRA 4FC6A 1CLEA 1ZRMA 2O7RA 2HBQA 2ZOSA 3WLOA 3E7PA 1W52X 4ZRNA 5JSZA 1ICIA 1ZK1A 1M8PA 1Y1LA 4UCWA 2IY8A 1GITA 3HEBA 2IPAB 1Z0DA 4MH0R 4Q7EA 4UAUA 5FNVF 2ZIWB 1Z37A 1TVCA 3C6BA 4JHXA 4GH5A 4MVJD 2F43A 5JXIA 3BIJA 3HFSA 3M6FA 4B3XA 4DA9A 3FUUA 4JLDA 3OIGA 5K0FA 3ZZTA 4BO9A 1JFTA 2GPSA 4GRAA 4IFTA 2IBTA 3GEBA 4R8LA 1E1RA 3V8PA 4Z4HA 2GBIA 4CU2A 4A2WA 5BSGA 1ULTA 1ZXLA 3B7PA 1Y6ZA 2A4MA 2FE4A 2JVKA 3AK4A 4BWFB 4TKVA 1NN5A 2BBWA 2NZWA 5TGDA 2BFPA 2R4QA 3AJAA 4DBZA 5FUVA 4LS3A 4XLZA 2UXBB 4IUBS 2IYEA 3FLAA 3LYLA 4IQ8A 4MOWA 2YQZA 2DBYA 1ODCA 1VOTA 3IPAA 1NHWA 3BK7A 1MF7A 3KZXA 4HWKA 3ZI7A 3F46A 3KUKA 4UU8A 1QS0A 3AHHA 4LHVA 3SS7X 3GJQA 2RHBA 4B43A 5KOIA 3FRIA 1GTVA 1V8OA 1Y1SA 5DYNA 3TOXA 4B84A 1PAUA 2QVXX 3OJXA 3A32A 1PEAA 1X7DA 3WISA 1YRLA 3NO4A 3OF3A 4II2A 4U7JA 4BO3A 2ZK7A 2XE7A 2OV2A 2ZAGA 3I1FA 3KEGA 1YA6A 3CM0A 4MR7A 1PSZA 5BW4A 1L4BA 1TAGA 2FU5C 1EDEA 2QQFA 2ZSUA 2X3UA 1KZ6A 4MQEA 2J3EA 4UTXA 4ZVNA 2YQ4A 4DV7B 4HGPA 3IA2A 5FYQA 2PK3A 3MG9A 1KYTA 1Z2NX 2UVPA 3R7BA 2PXHA 4AW9A 4YCBA 5K0ZA 3FGPA 3K09C 1YFJA 1FZQA 3T9DA 4BN5A 1XCGB 4MGZR 5E8RA 3NH9A 1T2UA 3V8RA 1TPYA 1OIWA 5PNTA 3WKCA 2ZU6A 4XD7D 1YR1A 1K0UA 1BH2A 5GJVC 2W0SA 4K9QA 3DHYA 3AEQA 4EF6A 4ZYLA 4YQYA 3AM4A 1SZJG 3N3BC 4MGYR 1XU4A 3L1VA 3MBKA 1ST2A 221PA 1QCYA 2B99A 2BHSA 1W1WA 2VRNA 3AL3A 5KDLA 2Z6QA 1FSPA 2CMHA 2QVZX 3NVAA 2OXEA 4EOGA 3UYLA 3UQZA 4A2CA 1UQUA 2E4XA 4XEUA 1TJ3A 1YJAA 3V1UA 4JBGA 4JC0A 2ZSDA 4BKUA 2JJ2A 1KTIA 3FNGA 1CJUC 1F06A 1RXWA 2NNLD 2EZTA 2EKPA 1YUMA 3DC7A 3QMWA 2WPDA 4NC9A 1KDZA 2H1CA 1TMOA 2HRZA 5I7AA 4DLUA 5DWVA 1FU8A 1ZICA 5CPFA 1NF3A 3CN7A 3HP1A 2AOWA 3MJHA 4H4DA 4IDFA 1P44A 1R8JA 1DAKA 3SC2A 3SK0A 1AMOA 2PYIA 4TKUB 2EZ8A 4J7CA 5JISA 3O9ZA 4AY5A 1WBJB 2H3HA 2WINI 3HHEA 2DT8A 5F7XA 5BURA 3N6RA 2C0QA 1A8SA 2WUGA 2YUIA 1PWXA 3D6TB 2JGAA 5AI4A 3WLSA 5BN4B 4E21A 4EHFA 5LXTA 4LYEA 2G25A 1EFRA 1N2XA 1MHPA 2PGXA 1ORRA 1UKYA 3WL4A 3PZBA 2IUFA 3WB9A 1PP4A 2R4UA 3TKAA 2RIPA 2VBCA 4BVKA 5LOVF 1JAYA 4AB1A 3ZVMA 2IEYA 3OFSA 4LV5B 3UTCA 2BJHA 5C1OA 2H5JA 2AFVA 4V1CA 1J7JA 4CL8A 2HJGA 4U2EA 4WLOA 3C70A 3WLKX 4C76A 1J5EB 1MHTA 1KOGA 1Y42X 3KBOA 3ZLUA 4KVZA 2H31A 1P2SA 2JJ1D 1L3BA 4E14A 4F06A 1VYHA 3FROA 3KLBA 3TEJA 1RQNA 3H3JA 3MT7A 3SEAA 3TR6A 3EYAA 3GJXC 3HXMA 1AKQA 1SUEA 4W6ZA 1ZS9A 1ZSNA 3IR5A 4GPAA 3UKJA 4F9EA 2NO9A 3Q8MA 4MK4A 1HO3A 5E7MA 1CJCA 3U31A 3M3PA 2ZUDA 3VA7A 3EE6A 4V3BA 1R00A 5CDYA 2O50A 1K3UB 4YK7A 4ZIRA 1YR3A 2CE7A 1GNTA 3TNJA 3G3EA 4C0AC 1E99A 3GGJA 3HY3A 5FFMA 2OFWA 1MH1A 1Y5IA 3OKAA 4HOYA 2OD2A 3WGYA 1IWPB 1E2IA 1ZLXA 3C3YA 3CU5A 1QGZA 4FI3F 4K9KA 1SOVA 2ZSIA 4MHOA 1RQGA 2G8LA 5IDQA 4WEOA 1L5GB 3UXHA 2Z6AA 2VNSA 3AFMA 3G13A 1O4VA 2HXSA 3IBGA 5DHRA 1ZIOA 3X0DA 4R83A 4CCWA 1B1CA 1K8YB 5DBEX 4BN4A 4AYXA 5AJYA 3VDXA 5M04A 2UYQA 2NUAA 3L0DA 3E8XA 2NVBA 4HZGA 3SFVA 3W2FA 4M9QA 5JARA 3KSBC 3UKOA 2BRUC 3RYFA 1V1RB 5AYVA 3C6XA 2XTAA 5AHOA 4JKOA 1UWCA 3N0XA 3SF8A 7AT1A 2MMCA 4D5GA 4BBZA 4CGYA 2AR7A 1ZEMA 3H11A 4O4LA 5TDHA 2G7ZA 2PRSA 3CLTC 4J0EA 4DHWA 5JNSA 2L82A 4CJXA 1FP6A 1NJ8A 1RLMA 1T4CA 2IA5A 2FQQA 4GYWA 1DBIA 1TEVA 2GETA 1XZQA 3OQNA 2O8EA 2BUAA 3OQJA 1O87A 1W5TA 5ANRB 1ZG3A 3M1IA 2RHTA 1JHUA 1MO6A 4GUDA 3KOUA 2PWZA 1EU1A 1M34A 1R16A 3QBJA 1M2VA 4U0JA 3P9IA 4OHUA 2RAVA 1T1IA 1RJDA 2YOGA 3S2UA 4EYQA 2QP9X 3ZV4A 4EY8A 3BRSA 2DYKA 5D3ZA 2PPLA 3O4HA 4U63A 5KSPA 1OAOC 4DY6A 4EB0A 5EXDA 3A4LA 2ZCJA 2HOQA 5FWAA 3G5MA 1M83A 3ORHA 4ZYXA 3HN2A 3FG9A 1TXGA 1N0UA 3ELWA 3LD9A 4WFQA 2BGMA 4WFJA 5HIAA 2QZ4A 3AYXB 3I5YA 1U99A 3BYZA 3C8ZA 3QWIA 4KYVA 4D4IA 3RSLA 1XCBA 2FX5A 2J1LA 1VKHA 1JNYA 4D2IA 3A9RA 3VO2A 1K3FA 5HRUA 2HCFA 4L76A 1D1TA 3S81A 4KO4S 3VZPA 2QRHA 1JIJA 5CJ2A 4MINA 5K0BA 2QVLA 3D64A 1U1FA 4KIWA 1QB8A 4BQSA 4BEJA 5LMUB 1QG0A 4ZRDA 4WOKA 4Q3DA 1UBSB 1DRJA 4PC1A 2W6CX 2R5WA 4FEYA 2H1WA 3W9BA 1UXGA 2CV2A 1NVVQ 4MLPA 5D3KA 3WNCA 4C3ZA 4MKXA 1W36D 1PWHA 1NWHA 3L93A 3ZY6A 1XEXB 1GP2A 3QXGA 5FAXA 1EYZA 3AF5A 5FBLB 4FZ5A 4QQRA 4ZOLF 2V03A 3BEOA 2VPZA 4M55A 3TZCA 3VVLA 5I7HA 4PQRA 4LJ4A 2BGWA 2XB6A 3MWDA 2L0XA 2Q5LA 1GPNA 1BD4A 3ICVA 3WHIA 5TNXA 1UPUA 1H2EA 3M82A 3OKPA 1GNRA 4DGSA 3RARA 1OH5A 4CMIA 1B0UA 3K0FB 4QSHA 4QJIA 1KJIA 3ENZA 1X1CA 2H07A 4E5SA 2ZPTX 1DOAA 1A95A 1RYYA 2QX7A 5JD3A 1B23P 1UBGA 2FKAA 5LQAA 1XMQB 3C0KA 2VRCD 4GI5A 3TFWA 1HYGA 1G0NA 2XDQA 3DKIA 4XDZA 4EFLA 1REQA 1R6BX 2HCJB 3KRTA 1UBKS 3PVSA 3ETLA 1X42A 5LQDA 1KU6A 1PX0A 4UZFA 4XH9B 4ND8B 5BQPA 1OYVA 3EA5A 5CB6A 1AHPA 3BRWD 4EBBA 1U8YA 4YJFA 1CX9B 3BCSA 3O5AA 4G9GA 4KX3A 5B2ZA 2FG7C 3RE1A 1SCDA 1MB9A 1EZZA 2B34A 2Q6TA 3G2IA 3ILSA 4POAA 5IT0A 4C0JA 5IJ0A 4YMUA 4I55F 5CAEA 1IQ0A 4U8HA 1NI5A 3SBXA 5IAAA 3PTZA 4BWYA 2YRFA 3E7XA 1XEWY 2KS6A 1C50A 1FRFS 2WQZA 1HKUA 4KAXA 1VI5A 4KIJA 1DTWA 2BM0A 2W6OA 3BERA 1RE0A 3SNHA 4DAEA 3DTTA 1VG0B 2W6NA 3GY0A 1BVHA 2ZR8A 4QLOA 3MINB 1VBFA 4J7AA 4XX0A 4GR4A 3I2JA 2ZI6A 2N42A 3OEEA 3BE8A 1QIJA 5BYKA 5JJLA 1FYXA 3DMYA 3QEJA 3CVWA 121PA 1KQ3A 2YYAA 1PJ3A 3KS9A 1JLMA 1GSAA 3CXRA 3WYFA 4CQNA 2P3QA 1G2IA 4IJKA 2W8ZA 1TMGE 4KMOA 9MHTA 2H7XA 2I6GA 1LY1A 4OREX 4BMZA 3L2OB 2FF7A 4KR3A 3TLEA 1CRPA 2P3SA 3ZBTA 3GXBA 1KO5A 1XLUA 4Y6OA 1O5TA 3AFOA 4OSPA 3C98A 1EE1A 1PSWA 5JHGB 4JLJA 1G7TA 4DM7A 1V3TA 2PVPA 1EMDA 5L4NA 3M8KA 4YFVA 3PENA 2O5RA 5AVWA 2GEBA 4X3OA 3H1BA 4J3NA 3Q5EA 5FEUA 3FZYA 2I4OA 3G9ZA 3OECA 5T8KC 5JS7A 1BDHA 3G1UA 4R9NA 1FX1A 3ZE1B 4CHGA 2I4IA 1CF4A 5BNFA 1LBHA 1JHRA 2WJIA 1JAIA 4FDVA 5AFSA 1D03A 2QD5A 2CW5A 3LUAA 3SQMA 1OI4A 2PJUA 1G20E 4TKMA 3GLRA 1T3LA 1Y37A 3G17A 2RGBA 4FONA 3NCHA 4DL9A 4F93B 3QXHA 2DOKA 5SV2A 1U7OA 3JQAD 3IOYA 1ABFA 1NJ5A 2Q5EA 4LRQA 1WUTA 3VR4A 4TQAA 3LUKA 1DJNA 3LU1A 3IEPA 2H51A 1AKNA 1I7DA 2ROQA 1OJ7A 1E6KA 1ZVQA 1VFNA 3MD9A 3OU2A 3N58A 4RKFA 4DG8A 3HU5A 3JQDA 3V2GA 4CWAA 2YW2A 2H59A 1Z9BA 3ZTYA 3U7JA 1KI6B 4E33A 2F59A 3ZWQA 3EXFB 4B5KA 4HVTA 2OCYC 3AVPA 2GUWA 2ZSFA 3SMVA 3T3GA 3RGWS 2OOKA 1LU9A 4FYJA 4NDZA 2IUEA 2PKCA 4QFDA 3SR0A 2WNSA 5PGMA 4YJHB 1VL1A 5TX7A 3OTHA 3RYHA 4YV7A 1QH8A 1QRUA 5FOTA 1R0RE 2XVAA 3K3PA 2BM1A 1DADA 1UJ6A 2CXQA 2XYGA 2XUQA 1B7GO 3CWCA 5CVCA 2J9XB 4NESA 3M4ZA 4H3SA 4NECA 2LR0A 4LGMA 4DCSA 1OFIA 5DM2A 2O4CA 1FMJA 4MW1A 1D4ZA 4BLOA 5JYEA 1X7YA 3GEEA 3K6SA 5JNTA 2VK4A 3T4XA 1NUHA 4EM6A 4EHIA 3VVBA 2CBGA 3VI3B 2FCRA 2AJCA 1KDOA 2FOXA 3QF4A 5JUWA 1GT91 2B4QA 4F12A 2FQYA 3QW4B 5ALYA 4DW8A 1Y98A 1WG8A 3U61B 2FFAA 3OC0A 1Y6QA 2HF8A 2QT9A 2C03A 4F4DA 4ESVA 4H1HA 5AKIA 5T3YA 2J5RA 1I13A 2V7BA 2Q3LA 5HG0A 4KLCA 3HLTA 2VHZA 3W8DA 2ES4A 1RJWA 2HU8A 3RCBA 1UM8A 1H6DA 2F9FA 4NBSA 2X0JA 2AXEA 4MJ3A 1RFGE 4C30A 2E6UX 5I9MA 3USES 4B0PA 4IVQA 1MV5A 1T0HB 1GJRA 3DP7A 2WKWA 3E48A 3KKQA 1EJ2A 4F38A 1E3WA 2O19A 1PGOA 2YZ7A 4GVLA 1RQ7A 1G2OA 1V41E 2DJ5A 4JXJA 4EY6A 3EDOA 1G9TA 3GRAA 3L8DA 4BC0A 1QFMA 1RDFA 3T3HA 3NRJA 4FN4A 1E1KA 3UC5A 3ZVLA 1WVGA 3K71B 3D0KA 3TTWA 1NQXA 3L05A 5K6TA 5KKCA 4FMCF 1Y34E 2ZYHA 1WW8A 3F5MA 4TROA 3CZMA 4ER7A 5I47A 3X1MA 3OT5A 1YKSA 3N0RA 3GT0A 1U3TA 1V1MA 1YUNA 2AMYA 2AZ4A 3PFKA 3SMQA 1D1SA 4IIYA 2PLFA 2VWPA 4CTNA 3TPFA 5I5EA 5JZBA 3M9LA 3C3PA 4B3FX 2ST1A 3DH0A 5I4IA 3H2IA 3S3TA 5EE3A 4HYQA 5BWBA 4S3MA 3AZPA 2HT6A 3NBZC 1T9AA 5IHPA 1JWLA 4C89A 2NSDA 1YE3A 2J7KA 3NYIA 3R44A 1FFXB 3I76A 4HLUC 4BRWA 3HM9A 3W5UA 5DM60 5D7BA 3OQIB 4J29A 1CUUA 2XUKA 1Z6GA 1HQYE 1NXOA 1KVUA 3GGCA 3SDZA 4O08A 5GV7A 1P3Y1 3RU9A 4DIUA 2QN8A 3DZJA 4OFXA 5AXAA 1O95C 5TS2A 4OGLA 5IT4A 3D6UA 1YO6A 4MPDA 1QUEA 5J59A 3KSMA 2DFVA 3GVPA 4JUFA 1SK8A 3QU2A 4MS4B 1W9MA 5JAHA 5MGNA 2JEZA 3GO4A 4ERXA 3FFTA 5EIBD 1U3CA 2I29A 4KE9A 1MD9A 1SHZA 1UEXC 5D1HA 4PX9A 4QJBA 3TZLA 3W5JA 5KWSA 2BFNA 3QA9A 1GLNA 3NJ4A 3PB3A 3GRFA 3S1AB 4O6VA 4TSFA 4GLLA 4XB1A 1RLIA 1PS0A 3JAKB 1E2QA 4O33A 1M6WA 3OD1A 1FQKA 3OBIA 4GICA 2GASA 4YLEA 1QH1B 3SQNA 3DR3A 4QZVA 4B31A 3K5PA 4JJ8A 4K7JA 1J2RA 3PPIA 3E05A 5HFJA 1HURA 4BASA 1CVIA 2B7CA 2FCAA 1YIOA 2VYND 3JYHA 3K8QA 3LO5A 1I0IA 1JALA 2RHMA 2IYFA 2WFZA 1VTKA 3PLNA 3Q3EA 4FYYA 3T5MA 1WOYA 3A0UA 1F4LA 1XZPA 3AM3A 3NDRA 3U9SA 3WLJA 1SQFA 1OD6A 1ZXBA 4HDNB 1LPAB 5FOVA 4EPTA 3ZDBA 1M2HA 3L6OO 5EWMA 5BQOA 1HK7A 4UCXA 1GPWB 1V6CA 2GD2A 2JLBA 3U9LA 3EAFA 3W9UA 3W06A 3ZNPA 2I7XA 1Z2CA 2RMKA 4RQAA 3FOBA 1E7YA 1OZHA 2Z2XA 1AF7A 1CR6A 1JBKA 2G0AA 2ZTVA 1IYZA 4B79A 3OTQA 2ID7A 1DG1G 3I6ZA 1IN8A 2W83A 4LYGA 2HO4A 3ZGVA 1W9HA 2PRKA 2OHGA 3FB1A 3VTZA 2VDJA 1I51A 1PT9A 2DY0A 2D8AA 2VTKA 3HNOA 3OFVA 4XSVA 2XZLA 3SC4A 2QTMA 2CWWA 5BSMA 3NGXA 4CL3A 4JT9A 2XF2A 3A0RB 4R2KA 4P81A 2WM9B 5BWMA 2VDLB 1DAPA 3A04A 2R8XA 2FVXA 1RWBA 4LF6B 2EKDA 3N07A 5MHTA 2OB1A 3AR4A 3ZWVA 4UARA 2CXUA 3I2KA 1EB9A 1V4BA 4RZ2A 2AR0A 4ZGBA 1J20A 2PRJA 2ZBVA 4CUKA 3FPHA 5EL0A 3T5GA 3QVMA 5DLDA 3S2SA 5LIPA 5EC8A 1IUKA 3V1MA 1AXEA 3FFBA 3NT2A 3LC7O 2I3BA 4G63A 3IMEA 4FDTA 4ND8A 4Z2AA 2JANA 4B6EA 2ZYAA 4Y2RA 3QBTA 2VTBB 1X1DA 1ZJYA 4OJNA 4AG5A 2DLCX 1ATZA 2XUPA 5HQ3B 2GD6A 2WFAA 3DM5A 3SVTA 3DVAA 4I50A 1QP4A 1Z4PX 2OO7A 1KJ8A 1GQYA 4BNYA 3D8TA 3K72B 2OCGA 1TW2A 5HKKD 2HTEA 1A9XB 2E4VA 2BISA 2YIDA 3AKYA 3ELUA 3R5SA 4PLWA 4QELA 3PX2A 4QYWA 4RHYA 3RSFA 3RYTC 3TLGA 4OLBA 4NOJA 5L95A 1LBQA 1BU5A 2Z1NA 3P9SA 3ITEA 5DOVA 1PNTA 2B21A 3NHLA 4FDLA 4LMAA 5EWJA 3ROEA 2A3RA 4DTIA 4KYUA 5KBYA 3HP4A 5AM5A 1B42A 4UNNA 1TM3E 3KUDA 5EE5B 1N6OA 1EFPA 4QYXA 3T5DA 2F9MA 3C3AA 3MVEA 3FD8A 2O9JA 3O4IA 4ANFA 1XT6A 2FUG1 2HUNA 1DMRA 2RGWA 4I50F 1ZJ4A 4ITVA 3F73A 1QVVA 4G5YA 4W7SA 2FMXA 3EZLA 5J2TF 2ZUEA 3HR4A 2IGBA 2QTAA 2P4UA 2VJCA 5DM1A 4RPGA 1UKAA 3VH3A 1MIHA 2YVAA 3M83A 3CC8A 1SXJE 1E2KA 2XYHA 3EZ2A 3EGEA 4MP8A 1ZUNA 4HGNA 5CURA 5B3JA 4DFDA 3EISA 3A9SA 3VH4A 5DHQA 2PV0A 2G6TA 3KL2A 1O03A 1U0SY 1Y6RA 3AW9A 1IZ0A 1GQQA 4IYRA 2Q49A 3FNIA 3CSDA 3OT1A 4ABTA 2A88A 4KDCA 1TKAA 5C34B 4L16A 4F1KA 1L4LA 3NHFA 2FZGA 1XNGA 1PRYA 3TVDA 4CR7A 5MGBA 4YUWA 1DV1A 1NUSA 5H9VA 5DBIA 3UHPA 5FL3A 4HGYA 4W8OA 4RVOA 3T7EA 3TSCA 4U00A 2Z3VA 1DIBA 4LCBA 5C4GB 1Z8FA 3IE1A 3WRWA 5M2QA 2Q2VA 3OQVA 2XT0A 3KBBA 3KD2A 1D2EA 3IB3A 4N0QA 4PEVA 4ZO7A 4EYEA 4ENWA 4ZI7B 3PTAA 4IIVA 5GIPE 4D9MA 3ZW7A 3C14C 2OKGA 4MB2A 2EF0A 4BL5A 4KGVA 1QRRA 3KQPA 4OLFA 1C9DB