3DVSX

Proteinase k by lb nanotmplate method after the second step of high dose on esrf id14-2 beamline
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Radiation damage in protein structural characterization by Synchrotron Radiation: State of the art and Nanotechnology-based perspective
rcsb
molecule tags Hydrolase
total genus 99
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2008-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3dvsX00
3I37X 3GT3A 1EA7A 1OT5A 1NLUA 3DE1X 2WV7A 5AMXA 5FAXA 1Y4DE 1WMEA 4OMCA 5SICE 4M1ZA 2DUJA 4Z2AA 1Y34E 2X8JB 2PWAA 1ST2A 2G4VA 3F49S 5AVJA 1SBHA 4HVLA 1YJCA 1C9NA 1EGQA 1TM3E 2ST1A 1Y4AE 5JMOA 3CO0S 1XF1A 1TM4E 3TI7A 4BWGA 1YU6A 2XTJA 3QMPA 3I30X 3DE0X 1SBTA 2IXTA 1TO2E 1AVTA 1WMFA 2SICE 4ZARA 4MZDA 3VV2A 1WVMA 1GA1A 2W2MA 3VYVA 1AH2A 4KPGA 1SIOA 1C3LA 3EDYA 2X8JA 2PRKA 5I9SA 4DZTA 3Q40A 4NE7A 1GNVA 2TECE 5AQEA 3LPAA 4ZOQI 1SUDA 3I2YX 1VSBA 3A3NA 2W2PA 1Y33E 1DBIA 1SBNE 2Z2XA 2P4EA 1R64A 3GCWA 1SCJA 4JP8A 3DE3X 4J94A 3HJRA 3DW1X 4KG7A 3VTAA 1AQNA 1SPBS 2Z56A 4AKTA 1SIUA 2SECE 2PQ2A 1S02A 4DJ5X 2ZRQA 4RYDA 4CFYA 5FBZA 3TI9A 2SNIE 3DW3X 2Z58A 1SCDA 3DWEX 1KDZA 3D9QX 1P7WA 1KDYA 4KB5A 1AF4A 1OYVA 3VHQA 1GA6A 1ZVKA 1SBCA 2XRMA 3WHIA 4LVOA 1C9MA 3TECE 2ID4A 1Y3DE 4C3VA 3BGOS 2Z30A 5B1EA 1SN7A 3I34X 1NDUA 3GCXA 3H42B 3F7MA 1TM7E 3BPSA 5ARDA 3P5BA 3EE6A 1UBNA 2E1PA 4WOBA 3ZXYA 2B6NA 1V6CA 2QTWB 2DQKA 1GTJ1 1YJAA 1SUCA 1THMA 1AK9A 1BH6A 4NMXB 2ZWPA 3DYBA 1TM1E 1GA4A 3DE7X 4H6XA 1SUEA 2PWBA 2PKCA 1GTL1 1Q5PA 4CFZA 1P7VA 2PYZA 1T1IA 1Y1KE 1CNMA 4I0WB 2W2NA 3AJ8A 4DWWA 3DE6X 1SCBA 3AJ9A 1Y3CE 3BX1A 3DE2X 2DP4E 4LVNA 4C3UA 3A3OA 1GCIA 1PFGA 1T1GA 3SICE 4YN3A 1TO1E 3DDZX 1TMGE 1Y3BE 1KDVA 1AV7A 3AFGA 3DVQX 3PRKE 4H6VA 3F7OA 3QFHA 1AU9A 1BE8A 1S01A 1S2NA 5JXGA 1Y3FE 4NE9A 2V8BA 3DVSX 1TK2A 2SBTA 4GI3A 3LPCA 3DVRX 5B1DA 3OSZA 3LXUX 1SCAA 4WOCA 3UNXA 3CNQS 3D43A 3WIVA 1GNSA 4CG0A 4OV6B 1JEAA 3PTLA 1WMDA 3A3PA 1KE1A 1GT91 1A2QA 1V5IA 2Z2YA 1SIBE 2ID8A 2HPZA 1SBIA 1SVNA 5JXHA 1TECE 1Y48E 1NDQA 4OMDA 1BFUA 4H6WA 3DE4X 3ZXXA 2W2OA 1C9JA 1GTG1 3WIUA 2Z57A 5CW1A 2Z2ZA 1PTKA 1R0RE 5FFNA 1IC6A 5JXIA 2HD4A 4K8RB 1DUIA 3VV3A 2WUVA 3DE5X 1CSEE 2PMWB 5K7SA 1PJ8A 2IY9A 3EIFA 1YJBA 1IAVA 4B5LA 5ARCA 1ZVJA 1KE2A 1Y9ZA 3SQOA 1OYOA 1MEEA 3VSBA 1P8JA 3GT4A 1SUPA 1LW6E 5AVKA 1BE6A 2W2QA 2GKOA 2WUWE 5JXJA 4AKSA 1SUBA 2WWTA 1ST3A 1R6VA 3WQBA 1WSDA 4HX2A 3T41A 1HT3A 2ZWOA 1BFKA 1SELA 5ARBA 1SCNE 1SUAA 3QTLA 1BJRE 3LPDA 4FONA 3L1KA 1SH7A 3Q5GA 1TM5E 1PEKE 1MPTA 1T1EA
chains in the Genus database with same CATH superfamily
2IUTA 4MDHA 2BHSA 1C4KA 2LKDA 1UBEA 2ZAGA 3OZWA 4L51A 2OFFA 4TRRA 1M75A 3DE1X 4MQBA 4RKQA 1X1EA 4Y18A 4U7FA 1RXEA 1W87A 1MIOA 5CURA 1L7XA 4MIOA 1EJ0A 4HNTA 1Z16A 3KOWA 3PB3A 3VPAA 4MW4A 4RVSA 5TS3A 1CVRA 3H5OA 1WMEA 3PUKA 1RWXA 2NWQA 3R5TA 1NW4A 4RVUA 3RIMA 4XUEA 1KARA 1Y34E 1UDWA 2B98A 2O7RA 3WSVA 4QOEA 5IDQA 1VE5A 5REQB 4URFA 3GLFE 3DMYA 4JL6A 5KTRA 4LDAA 4C3ZA 2OC9A 5JPCA 1E1CB 2CXHA 1X13A 2A8YA 4DQLA 4IR7A 3F49S 4RM3A 4DIEA 5AVZA 1PE0A 4FINA 4BPBA 1SBHA 3LZ6A 3R3HA 1QHXA 5KTYA 3G2LA 3D2LA 3GOHA 4BRWA 1UQTA 3ANSA 2A0KA 3QEJA 3RRFA 5CT5A 4WOKA 1OXBB 4KITB 2XZTA 4I4TA 3ZZ1A 3GFVA 4FGUA 4R2JA 4UCFA 3W5SA 2EZUA 4N41A 2FX3A 3ND9A 2ST1A 1QAMA 2WKPA 2ZE6A 2HU2A 1AX9A 4KZPA 5ALUA 3P2OA 5P21A 3QLEA 4B3JA 2ZYHA 4KVGA 3GO4A 3C3EA 5HA5A 1SD5A 1NULA 1PCXA 1GGKA 2CXTA 3SK0A 2JJYA 3KJHA 4F2HA 2Q1WA 2MIIA 2ZS8A 4QXOA 3E18A 1ULHA 3AM3A 2GJ8A 1UFQA 5FRDA 3TO5A 3USES 2NTNA 1BGWA 1JHYA 4HEHA 1VMDA 2ZT7A 1FTWA 3AM1A 3TJZA 4CIBA 4RH0A 5A06A 2W93A 1GSIA 2CLCX 3S0JA 1V0JA 3ZE6A 3FFXA 1CU1A 3A1TA 3HMKA 4XSVA 1QP8A 3DAPA 4MVJM 4XX0A 1QKIA 1II9A 2P30A 2QS9A 5HR5A 1GPDG 3EDQA 3L0OA 4K9OA 3RJTA 4WFIA 4MZDA 4RHEA 1TFRA 1ZOSA 4F4DA 4YDQA 1YJ8A 3CWZA 2UVPA 4LN1A 4NK5A 1MH9A 2GM5A 3Q9NA 3GWGA 5DHSA 4DM4A 3L8ZA 2VWQA 1BO6A 4A4DA 2J9XB 3JYNA 5KTMA 2FUG6 3EDYA 4R05A 3CNNA 4LTNA 2QLMA 5HQJA 2OV3A 1IK4A 3LLMA 2HJRA 2KMLA 5DNUA 5ALXA 3CEMA 1KK0A 1F12A 4ZU1X 1JEQA 2ZJ0A 4OKIA 1DOZA 1SVIA 1X74A 4CDNA 3QXHA 4HFJA 3DKRA 1Z37A 4K6KA 5HIMA 5G0VA 1XZLA 3W0LB 3AOGA 1V3UA 2VL7A 3HKEB 3M5PA 3CVWA 3LO5A 1H2WA 3AF2A 4BMXA 3ESXA 3T5PA 4BNDB 2WQZA 2HWXA 1NBMD 3IVXA 3QU9A 1HSZA 1JPVA 3CVJA 5KC9A 5B2EA 4O29A 1BE1A 3OZTA 1P1CA 4PPGA 3AERB 4UHDA 4C7BA 3ZDBA 3AZOA 3WYBA 4P8RA 2FR1A 1FP7A 4BQEA 5JD6A 1MOPA 2XCOA 1QIIA 4Z9FA 4IPTA 5IM4F 5JNTA 4EHIA 1B2RA 3M4XA 4QXRA 3IVAA 1QGDA 1CUZA 4ENVA 2OFWA 2VUSA 3TFQA 3F3SA 3OEHA 1K8XB 5BSEA 1TLLA 3AUAA 3CVOA 2P4EA 5DTJA 2ZTVA 3PJRA 1TVEA 1DO0A 1K5GA 3HYCA 4MLCA 4Q9AA 2DYKA 2ONJA 4IXNA 4YY3B 1XKLA 3C0KA 3ZV4A 1PZXA 1MJNA 1CQJB 1VPEA 2QX4A 5M5BA 1H1TA 4YQFA 4DA0A 4O33A 2FDCA 2WICA 2BFFB 3CUTA 1P74A 1HUQA 721PA 1KP9A 2Z98A 3CX8A 5HJ5A 3SWWA 1DG3A 4BMOB 3CRNA 4FGJA 1MG5A 4O4HF 1W52X 2SECE 4WH0A 3W4KA 3VDNB 2V98A 5KMGB 2CFRA 2ZRMA 4P4GA 4QUJA 3WFIA 4NU5A 1PR6A 3L5KA 4EPYA 5DN6A 5DP2A 3NXKA 1JIKA 1VHDA 2C78A 3JQFC 1YRYE 4KOEC 1FXWA 2J6IA 7AT1A 4AZ3A 3VZRA 1KGDA 2EKBA 4D26A 4XUCA 4TSFD 5ICFA 1YVUA 4LXQA 2I2BA 4LX0A 5FWAA 1ZGGA 4ZEWA 5JC8A 2ORIA 1FFDA 3IDZA 1P1RA 1OJLA 2V7TA 1M2VB 1WE2A 2XW6A 4QDOA 1D4FA 4YXWA 3VHQA 1GA6A 2PSSA 4ZJYA 1FLNA 2CNBA 5H9WA 1EUQA 3HBNA 3GA0A 2Q5HA 1H1LA 3AB8A 3JQCA 5EJ8A 1OH8A 2BFEA 1E58A 2EERA 4NQZA 5KX5B 1P5JA 2IHKA 4DBVO 2DR3A 3VDXA 1OZFA 4IIUA 1HRKA 1O2DA 3X2SA 3E9CA 2HJWA 1PQWA 2V59A 3K96A 1P4SA 1FMJA 2Q2QA 1TW3A 2XQJA 2HDHA 2LRHA 4JLKA 3O9ZA 2JFWA 1U8CB 3AJAA 4C3VA 1AQ6A 2IIBA 5AJTA 3BGOS 5GGYA 1KO8A 4DYHA 3L1JA 2QSYA 4MEJA 1R5NA 2NVWA 4YC7A 3ZC3A 4TLMB 2LDXA 1CVIA 4HH0A 2HQRA 4YACA 3A6FA 2QIPA 4CG2A 2AYYA 3PQFA 3QVMA 3JQ9C 2W0MA 3HCAA 3L7DA 4U7GA 1RPAA 4JQYA 2GJ4A 3O47A 4ER7A 3O0TA 4FCVA 2RGCA 1RRKA 3U7QB 4QSHA 3WK8A 2B83A 1N8TA 5AW7A 5JCPA 4FHCA 1ADYA 5LQUA 1RFGE 1PV4A 1REQB 3Q8MA 1JIXA 1GTRA 1PL6A 2UYOA 3OVMA 1A7UA 3NOOA 4H6PA 8ADHA 4FU0A 3IDAA 4J0JA 3RJ5A 1DAGA 1UBNA 3LE8A 1TMKA 3NIBA 4K6FA 1E69A 1RSZA 1KEZA 4WOBA 4NJEB 1D2RA 4N5NA 2BKLA 4C4YA 3KUDA 1E6EA 2XQKA 1FNDA 4OB6A 3ZHCA 4D4HA 3MM4A 5E2IA 4WBNA 4QJ4A 1OC2A 4DCOA 1SUCA 4EVRA 4ZXFA 2UUAB 1KPIA 2G67A 1EK6A 4AB1A 4R0NA 3TZ6A 1K08A 1K4KA 1QE3A 3UJ3X 1O87A 3ROFA 1ZRMA 3WGUA 5FOXA 3CLVA 2R5NA 4G0XA 4DCVA 3I6QA 4Q3OA 5BXYA 3N6VA 4GF5A 1OXVA 1KZ4A 2V5UA 2PRZA 3N70A 3T38A 5EPUA 5U4XA 1CEQA 1VCHA 2IP1A 1SUEA 1G60A 2G0AA 2JHGA 4KRGA 3UMBA 5C1DA 1L5LA 5HKBA 2IXAA 4K46A 2HRDA 4LNHA 5AI8A 4DRXB 3H84A 3A3YA 1RJ9A 1EUDB 2YICA 3IQEA 4RE6A 5FPYA 4EKNB 4GD3Q 4G0WA 3VHXB 1BDIA 3VOSA 3RU9A 3U44A 3AOEA 4EHFA 2ONKA 1GKLA 2FG6C 2AOWA 1Q7TA 1QQ6A 2GZ3A 2XT0A 3PWZA 2W6CX 2HR1A 3ZCRA 4AL4A 4EBBA 3DHYA 1RC0A 1BFDA 4Z6KA 2IS6A 4DDTA 1CLEA 1E89A 3W2GA 3MTDA 1J33A 4ERNA 1IOWA 2GUGA 3FIUA 1YGPA 2E4WA 3BWVA 4WIAA 3OJWA 5EIBD 2C7PA 4RMJA 2W2NA 2A9JA 1IRIA 2RCYA 4E03A 3JWIA 2BW0A 3IKLA 1LVHA 1W4CA 2ACWA 4IVPA 4NBVA 4B82A 3D6MA 1N6OA 4IHJA 3P2EA 1Z5VA 4IY1A 3IAHA 3SYNA 3NU1A 1T5DX 2R87A 4NYJQ 1IEQA 2EP8A 5AI5A 4YYEA 1JHRA 4QPZA 1WPRA 1ZL2A 2C1XA 4TWRA 4C20A 1A2KC 2ZT5A 5KJEA 3MPUA 1O57A 4RDXA 3LUGA 1MD9A 1T9ZA 2HU5A 2IP2A 2AF3C 2IE0A 3OY2A 4AIRA 3ZLTA 4EJFA 4Y1RA 1ZY2A 1TO1E 3M6XA 1NRWA 1Q11A 2GLTA 1CZUA 5JE8A 4JI3B 3W2HA 4HFNA 5KO2A 3IMEA 4GPAA 4OHOA 2ZRCA 4PY2A 1RTKA 1XQ9A 4PNZA 5DISB 3ZLBA 5KVQA 1HURA 4BP1A 4H77A 1KYQA 2VYCA 3G49A 4H6VA 4AZVA 4BN5A 2A3NA 3F7OA 4HAXA 1ZH0A 2GCPA 5CAEA 4D3YA 1ZH4A 1ONOA 5C81A 4L0QA 5J4VA 1TL7C 3TBFA 3WTBA 4HAWA 1Z33A 4I3HA 4UCXA 4R9SA 5DHTA 2OXCA 4QATA 2REBA 3FY4A 4X0EA 2I91A 5IPFA 3PEUA 2AJBA 4DMGA 1F9EA 2O6HA 1P7CA 2HCBA 4W6ZA 2DQ4A 2XVYA 2GZAA 1AB6A 1GZ5A 1PKEA 5FV4A 4QRDA 3GZ4A 3W9SA 1T5IA 1MW8X 4E5DA 1F0PA 1SK8A 2WWRA 3MGBA 4S1OA 2EXXA 5G53C 2OV6A 3G5LA 2QPOA 3JAWB 4J1TA 1KRHA 2CK3D 5IJXA 1TXGA 4HMPA 2O7VA 2AIRA 1ZXLA 1BNCA 2R9VA 1N0HA 4J4HA 4MR9B 5FHRA 4ASUD 2XITA 4O2AA 4V3CA 2C2KA 1U0FA 1QHHB 3NXSA 1D8TA 4I08A 1DJNA 1USWA 1GG2A 3LYLA 4O1IA 2A33A 4KR9A 3TSOA 3Q8XB 5JBIA 2G4LA 2UDPA 1BEZA 3BIFA 5EXXA 4FYVA 1QJ4A 4IOKA 3SXPA 1PYGA 4IDHA 1K63A 2LP4Y 3IIEA 5IFLA 4XYLA 2DUWA 5KJ6A 3B9PA 1WQ4A 4FZVA 1E4YA 2PLAA 1QQ5A 4GRIA 3KOOA 3EZXA 4CDMA 4CYMA 3G0CA 3K35A 4PN3A 3BK1A 1E2QA 1KP2A 1YZNA 2FB9A 4UHKA 3T3MB 3ABSB 1N33B 1NJ2A 3IJPA 2Y76A 4DS3A 1AHNA 2DR0A 2P3QA 3PCXA 5DXJA 3DQQA 2QR2A 4IG9A 2FJPA 1S89A 1RP7A 4QRIA 4QOJA 7MHTA 3KQVA 3H2GA 4GYKA 2FLWA 4N3AA 1DWPA 1ZLYA 1M8JA 4Y2UA 3RODA 1PJCA 3TW4A 3IILA 5L6LB 2HBQA 4XIJA 2B1GA 4MK4A 4G65A 4JC0A 1V3TA 2IU4A 1WW8A 5LYYA 1FVFA 2W71A 3EFOA 3T1HB 3FHLA 5KEIA 1RI4A 4PWYA 2F59A 3GUUA 4NAHA 4IDEA 4KPYA 3K5IA 1QHIA 3MWJA 2NU6B 1BWSA 4FVTA 1PZFA 4W8HA 4GOND 1JR3A 3B6EA 3BGWA 3EC2A 1VPDA 3CINA 3K0AB 4U63A 5DX0A 1BGXT 2JGIA 3FLMA 5DNDA 4RVOA 4BVHA 2C3MA 4BQFA 1KQFA 4BNNA 1Q0TA 2FK7A 3RJ9A 4RQTA 3T0GA 2E37A 2TMGA 1KMMA 4RHCA 5J59A 2FPSA 3R7BA 3HCNA 2HDWA 1DINA 5LDGA 1PTKA 1PGPA 4GO1A 3B13B 1R0RE 4AZWA 4DWWA 3Q12A 3N59A 2WUFA 4JBHA 4PO9A 1X9IA 4G0VA 1E2EA 1JJBA 3O83A 3KQKA 3JAMA 3GLTA 4GOJA 4AX8A 2RKBA 4WCFA 2IS2A 1G16A 3GNTA 1CSEE 3G0OA 3UV3A 1ONSA 1Z35A 3O9VA 4JJAA 3ELWA 3RGWS 4CMKA 2VPXA 3IOYA 5DCLA 5DNYB 4B5KA 1LPMA 3L18A 2VATA 5A5DA 3DAYA 3PF8A 1PJ8A 2GMWA 2HWKA 4RDHA 2XBMA 4PF1A 3WAKA 1HKHA 3VO9A 2CFSA 1JT2A 1A96A 4QXMA 2QN7A 3SC2A 3WP1B 2WWGA 4OHBA 3DYIA 5B1HA 4L8YA 3PQ2A 3PRYA 1FS4A 3HKDA 1YHYA 2QUAA 3OP4A 1FZQA 1PU2A 4HB3A 5AVWA 4A8JC 1DRVA 4BUJA 4ZICA 2Q5IA 1S0UA 4Y2XA 1G5IA 4J1QA 5FV7A 5BOSB 5BVGB 4ACBA 3TGPA 3IR6A 5IF3A 3LA8A 1Y63A 3E9ZA 1V5EA 3M4NA 1GU0A 2G36A 4K40A 3B5EA 3ZVNA 2UZ1A 3AL3A 4R6XA 4ZT5A 3DDCA 1KAOA 5J47A 5LFAA 2QL5A 2GKOA 3A28A 4MAAA 4DB2A 4RK6A 2ATVA 1Y98A 1GPKA 2B36A 2FWAA 5BQ5A 2O8NA 2YJNA 4BQOA 4L72A 1CUGA 5AP9A 2IX9A 2XLCA 3RU7A 4AKSA 1IY2A 1N7HA 2MHCA 4RJ2A 2PIDA 2ZAIA 4CKYA 4R68A 3TQOA 4MI3A 3H17A 1VL0A 1OFVA 1TU0A 4D9NA 2V45A 1N2GA 2QNRA 5C4IA 3CIOA 1G8GA 2OBBA 3O4FA 3ELBA 4HSGA 2YV2A 4RXUA 2W6ID 3WLFA 1A8IA 4QG7A 4I1PA 4BASA 4Z2YA 4NZMA 1VYHA 4ARZB 4R2LA 1HT3A 2WSBA 2RH4A 3PHIA 4B80A 2J09A 4HVCA 5K0CA 1EFLA 1EE9A 3PR1A 3A9WA 2ZJAA 2YXDA 4IV5A 1WCIA 1AT1A 2IK8A 5D5HA 4BV8A 3O8BA 1QBGA 2XUHA 4IWXA 3U4AA 3ONNA 4YMWA 1RU3A 2ZITA 1B15A 4HQOA 4XSGA 3O4VA 4IFTA 1GTZA 1I01A 3TLBA 4PU0A 2RAPA 3BFXA 4F3RA 2Q2OA 3LPMA 2EJTA 3IT0A 4TS1A 1ZDMA 2EX0A 3R0XA 1SXHA 2A4KA 2W4QA 4FWBA 1R4MB 1ZG3A 5EVJA 1UZMA 4BV9A 2P65A 1ACMA 3HWRA 3QG5A 4NX2A 2GNOA 5F4ZA 2H4FA 2XE4A 3A7DA 1EA5A 4MRMB 1JLLA 4RCYA 3H9QA 4KE6A 4LV5B 1PZGA 3IE1A 1DU4A 1PWYE 1Q6ZA 2OR3A 1C81A 1GYRA 2WTMA 3O8LA 3VC7A 3WMFA 2FPIB 1P6UA 4LHXA 3TJRA 4YRJA 5MN5A 2VXCA 3VX4A 2CLEB 4F06A 4RGQA 4BFTA 3SDZA 1E7RA 3K5PA 3ZU3A 1ZUHA 2ORED 3OHSX 4MYTA 1QRUA 2KI5A 5K3EA 2HCRA 2B1RA 3DMTC 2DWUA 3EQ9A 2PS0A 3AG5A 3Q3GE 1B1CA 3PLNA 4J0GA 4KQFA 4Z9XA 1ZK0A 2OQIA 2GK7A 2JJMA 2QP3A 4OY3A 3UCXA 4AP5A 1DKOA 2GF0A 4NAVA 4ZOLA 1SBYA 5KSYA 3PFGA 3IUMA 4JLUA 3CVYA 1ACLA 3QF4A 3UYKA 2FPKA 2H9IA 4B7AA 1U9JA 1DBWA 3CUEF 1WCWA 4GE0A 4DLWA 1M8FA 4V03A 2D1QA 4X1KB 3IESA 5BUSA 3IEVA 2IYLD 4D44A 1YE8A 1K3UB 1MV5A 1SCUA 4C2UA 1XTBA 4FOTA 4CR8A 3OICA 3KYIB 3N6XA 3L7MA 2NPIA 3S5UA 4JL5A 3AONB 1TYAE 3CPJB 1SAYA 1GGVA 3H6HA 1N2ZA 3GN2A 4IBOA 2OWDA 2YZ7A 3HP1A 3PHLA 5AFSA 5TPZA 2R7KA 3U7HB 1U5BB 2XHEA 3NOXA 3NALA 4A73A 1GUFA 1U0LA 2YZNA 1FUIA 1L7RA 1AS3A 4KE7A 1Q2UA 1SHLA 5TJHA 1E1LA 4DCSA 4OF4A 3KALA 2ZS7A 4UHEA 1PL0A 3HKCA 1E9AA 2K6GA 3KL2A 1DJQA 3P2JA 1T6NA 1F14A 4FKBA 1TNDA 4IL5A 4TRMA 3QPAA 3IQDB 3RVBA 1ZGCA 3O93A 5LP6F 4N5DA 1Q0LA 3ETCA 3QUBA 1ILWA 1AHHA 1KS2A 2RG7A 2ZRNA 3D8NA 4NAUA 3V1TC 5CB4A 3PXUA 1Y81A 3T4EA 3NEAA 1FL9A 4BFZA 5E7MA 3DV2A 3OMXA 5E4JA 1WL8A 1VKRA 3V2HA 3I8OA 4UUBA 1UEIA 2BBSA 1ESNA 4Y1FA 4HN2A 4Y6PA 2ZJ5A 5HVNA 1KI8A 1LV7A 1N7GA 3OOEA 2AR0A 3CE6A 2O5RA 3N0XA 4GH5A 2ZSEA 3O2JA 1Z26A 4IMIB 4JR0A 4P93A 4R69A 1ZIDA 4DABA 3EWSA 1U7ZA 1NQVA 4ZTUB 4P2BA 1W4LA 4WT7A 4MV7A 1D1TA 3FR7A 3TINA 3C3JA 3WWYA 1WS6A 2I2XB 5JCJD 3I09A 3CE9A 5CA0F 3VU9B 2P79A 2MINA 4M86A 2PU7A 1MB0A 3L7IA 3LGSA 3MWLA 3R6TA 3U3MA 3L8CA 3OBIA 1RYEA 3I2YX 2F62A 3EX7C 4O4LB 2JJ2A 1BN6A 1QUFA 3EDRA 3AI3A 10MHA 1QWSA 2PPLA 5TJ9A 1BEUB 1GR1A 1Q74A 1SC6A 2N0SA 5EI5A 1OD6A 2C7VA 4BNZA 3UAXA 1A4XA 1F6WA 3ISVA 3SF0A 4MMZB 2A5GA 3KLMX 1B8UA 1H2RS 4B9AA 5AVXA 2PZGA 4OOEA 2QVGA 2BCEA 4PZ0A 5FNVF 4B6GA 1KFBB 1XTJA 1ZUIA 4OPMA 3EWAA 2DFLA 2JFVA 1GEEA 2Z5GA 4KBYA 4MYDA 4MJ3A 3E6AA 4JOCA 1V8DA 4PONA 1Z5OA 3MEQA 3PUIA 2ZI9A 4HS4A 4OBWA 4F8JA 3JQAD 4X66B 2QG9A 2QQ0A 5HF5A 4DA6A 4ZIRA 3PX7A 3BH0A 3CTMA 3EEYA 4XRGA 2VTDA 2WWXA 4KYVA 2FI1A 3PNVA 6CHYA 3A14A 5F35A 5FBZA 1MQ8B 4OUDA 3UJHA 1CY2A 1I2AA 1JJVA 1SCDA 2FWNA 3A7EA 5J43A 1CDEA 1ZLXA 3RTBA 1P7WA 2OCDA 2B9EA 3DULA 5HG0A 2GWHA 1SB8A 3BORA 1OYVA 1IBCA 5IU6A 3RAFC 1KZ9A 3DBHA 3CR8A 2JW5A 3CUWA 2XOKD 2ZWIA 3IULA 4YCBA 1MZVA 1EWYA 1ZD3A 2HHLA 4FE7A 5FI3A 5AD1A 1FJ2A 1Q0ZA 1U1EA 3L0ZA 3LKBA 3QE3A 4I9UA 4PPNA 3DLBA 4D74A 3EJWA 4JCCA 3BD8A 1W5FA 2Q6IA 3IR5A 4G5OA 4ZMSA 2G6TA 4TVKA 2PS9A 3H1BA 2PL3A 3PKZA 1CQZA 4NYMQ 1LSOA 1BKYA 1OFGA 2CUKA 3EPPA 3EZ2A 4IIYA 2H59A 4MIEA 4BMYA 1QVVA 2O0HA 4CF7A 2O8BA 1HNNA 2X77A 4P3OA 4PBSA 5CNMA 1L4MA 4F3YA 3VAYA 3SF8A 1LPNA 2YVUA 4IXTA 4IM7A 1ZOLA 2OCGA 1B6GA 2BM9A 1H9AA 1GUZA 4KN9S 8ATCA 1JWBB 1MO6A 4ZALA 4RIGA 2HMVA 2H1CA 4X7PA 3CVUA 5B1EA 1GTVA 4BVFA 4I4CA 3ECCA 5F7JA 1YBAA 3LDGA 1DV1A 3FN4A 4LBZA 2FCRA 2JAQA 4ZYZA 1RI1A 2RHLA 1VSUA 2QPAA 3THYA 5K2MA 3WB1A 1RRMA 4XAQA 5CLIA 2VFAA 1N4DA 5AKEA 4B4WA 1B6TA 2A58A 4X1IB 4WZBE 3IUSA 1R16A 5EPOA 1R0XA 5JAUA 3MA0A 4LQDA 3TPZA 3T1NA 4CLRA 3SXJA 4GQBA 1EUCA 2HCJB 4S1WA 4WAUA 5ALLA 5DULA 5LMUB 2GYWA 2HK6A 3U4IA 1JHVA 1QZZA 1XAHA 1IOVA 1TAHA 1CDDA 3DG9A 3LIIA 3U9SA 4EZBA 1NJSA 5FIUA 1V7PC 2YUIA 3OLYA 3NWEA 5K3OA 2P2NA 1FW6A 4P33A 2BHRA 3AHFA 2HYIC 3IAM6 3RG2A 2YV3A 4R1TA 4YAWA 3B3AA 2YMQA 2IHVA 2WHQA 3HO1A 4FUQA 2ZYAA 3I1FA 4QEZA 2YJ3A 1AMOA 1TM1E 3LM8A 1J0CA 4Q6WA 3C7AA 3G2QA 2R1VA 3GDHA 4E2XA 4E94A 1CJKC 5DASA 3DLCA 2ERXA 2YOFA 1ML4A 5DV9A 4UEQA 1ZFNA 4KP7A 4OAPA 3VNSA 4B17A 3QHQA 2NSLA 4IMRA 4NULA 1PJAA 2WYIA 3WLAA 1S4QA 2CXQA 4IDNA 1LNSA 3VYRB 4A6EA 4EMBA 4BCDA 3TKLA 4HNUA 1I14A 3CIFA 1V2GA 2ZJ1A 4GYJA 2J9YB 2VCYA 4WZZA 4EG4A 1LC3A 4G5YA 2YVKA 1KERA 2VKTA 1L9XA 4TOIA 4CHGA 3EXHC 4ZHSA 1TT5A 4EWLA 1M66A 5GADl 2ZQZA 4Q9HA 4ARSA 3R3ZA 1PGJA 4QDTA 3WDMA 1SY7A 2D5LA 2GJKA 3A9CA 1TVKB 4L95C 4LQ4A 2PZLA 3WGGA 5IXJA 3EG9B 4JLSA 4Z53A 4I0WB 2B21A 3I6YA 5KCMA 2O9JA 1XRQA 1MG0A 5ELLA 2AUMA 1JIUA 3HDVA 3GBVA 4QBHA 1VKOA 3KM0A 5ALZA 3RSSA 4DJFC 2WY2D 3MHTA 4U7WA 2WLTA 3D31A 3CH5A 5EWJA 4TYYA 3NP9A 3N7TA 3VNVA 1TK9A 4E5VA 2OBMA 2W2KB 2B8JA 4JBNA 2CJYA 5EZYB 1UZUA 5ESRA 3R9XB 5EZ6B 421PA 4BGDA 1O4WA 2EGGA 3QI2A 1GPUA 1QHNA 3FMPB 3OZBA 2X6TA 1GCIA 1T8SA 4D4GA 5IT5A 5EMNA 2AH5A 4ER0A 4B8ZA 1WKCA 2DLCX 4OB7A 3BEOA 1TMGE 4KQ9A 4TS4A 2QENA 2H7CA 2X9LA 3CLRD 5KKAA 4RQAA 3DBRA 3AEKA 1IAQA 4OH1A 3RBAA 3ZGZA 2JD1A 1CKEA 4MH0R 5AYVA 1T5SA 1KYWA 3BMQA 4M0KA 5CH8A 1D0SA 1PJRA 3K92A 1GQFA 2PJZA 1FX0B 1T9GR 5H68A 3CRVA 2RHMA 4COOA 3TTYA 1EG7A 1TKBA 1GUDA 5K8VA 4K0RA 4PSCA 1AU9A 2YR0A 3V8BA 4LJLA 4CLOB 2LIPA 2QE7D 3K0FB 2ORVA 3KWFA 2QMZA 1CRZA 1O89A 2WAAA 3KTDA 4IDFA 1RQ2A 1NVXQ 2FR0A 2V8BA 3DVSX 3ZW9A 2UYHA 4DV1B 4L4UA 2QUHA 4E70A 1ZESA 2VG8A 5JLAA 2AW5A 1XU7A 3DVRX 3BWBA 2EFGA 1E2GA 3QUQA 4WKPA 1Z5WA 2WHEA 2NTEA 2H65A 4FS8A 1NVBA 1SK9A 1X7XB 2XYGA 3FKSD 4DUYB 1CYEA 1GAQA 1QCDA 5CNJA 3SJBA 5K01A 3RC2A 2IW3A 4KVFA 1GN9A 2Y9MB 3AK4A 1GFWA 3IHWA 4K9KA 4H16A 4C0XA 3LX5A 5CU7A 4DRZA 3M83A 2P8JA 1EK5A 2HU7A 4JQCA 3SKXA 4OXKA 2LVBA 4RD0A 3VMMA 3FR8A 2ZREA 3FOWA 1U9CA 1QVRA 4B4KA 1RS0A 3GJ0A 2IYFA 3VAZA 3EF0A 3M3PA 3MWGA 5LQNA 2C92A 3PTLA 5DXAA 2BE9A 5C46F 5EUCA 1L1QA 3FOCA 3U4DA 5DYIA 1CIPA 3VTFA 1J1UA 2BFBB 2Q5FA 3L7AA 3D1VA 3OPYI 3PC7A 4O0LA 1FNCA 5AIBA 4BZWA 4TV9F 4HOYA 1T4MA 1JIQA 4TVBA 5LL6P 1OA1A 5DE3A 5IKEA 3EY4A 3QKUA 5HYVA 1A2QA 5FNZA 1EFRD 3TW0A 2QYHA 2R7AA 1JGTA 1ZD9A 3MD0A 4V0KA 3AUJB 3E7FA 2JLZA 1T6BY 1COWA 3LYAA 3D2BA 1T6YA 2XY4A 1KI9A 1M2HA 4KWCA 5F3DA 2ZRPA 4O3MA 3VNQA 4BO4A 2JFQA 1VA4A 4IFBA 2XNJA 2RIRA 1ZIXA 3L6RA 4C4XA 1XXLA 1PTJC 2LNDA 3B48A 4DC1A 1VL1A 2J3HA 2XOXA 5AW0A 2AWOA 1RFLA 1X70A 3OT1A 5IYZF 4MEBA 5CT6A 3ZDRA 5C7LO 1R6DA 2AXQA 2R3SA 4QPPA 4PYIA 4WUVA 3L41A 2FQ1A 4GNKA 2NYUA 2XTNA 4IIEA 4M22A 5LP6C 2FOLA 1N5LA 4W1RA 1LSSA 4RA9A 5JQGA 4XA8A 1P8AA 4JK3A 1A7JA 1R5JA 4TMVA 4DLUA 2HFKA 1R50A 1M8GA 1QS0A 1RIFA 2BFCB 2G9RA 2XQIA 3LT4A 3RRMA 4EB3A 4UQOA 4JI2B 3JRNA 3MINB 3J7TA 3PEFA 4XYEA 2HD4A 3LX4A 1DUIA 4PWZA 2WUVA 1WUJS 1HE5A 1WZNA 4L6IA 1S7CA 3U48A 4HDAA 3T5MA 1K98A 2NLOA 4IIXA 3H18A 3HM9A 1L5VA 1R66A 1S3GA 2OECA 1L3IA 1IPEA 2L42A 4ON9A 4IJKA 4LE1A 1LQTA 3NRCA 4IDDA 1T9KA 4YA6A 1F9AA 5FTMA 5EY5B 2PQMA 4AUKA 1HH4A 4EPXA 3O2SB 1C0LA 3QF7A 3FPEA 5F9MA 2CLHB 1L7MA 3IYLW 4JLMA 3WHPA 5DN9A 4QUBA 4QC2A 2J9RA 2NZ2A 3I42A 1T35A 5IZCA 2FZVA 4XFDA 2RBKA 1H2AS 3B6IA 1Y8QB 1MC4A 1E6CA 1MJGM 3ADOA 5AM4A 1KE2A 4KNVA 2FUEA 3Q9LA 4ZYWA 3MMPA 2ZBFA 4GBJA 2EU8A 1E9RA 1XOIA 4ZAXA 4EARA 3QSYA 3WFZA 2B20A 2BFWA 1PNOA 3EVNA 3HB4X 5TR9A 4O25A 3R75A 4BS9A 1YZVA 2G07A 2WPDA 1YCGA 5BNZA 1OLXA 4FDAA 4R2HA 3D6UA 1UPXA 3F5MA 3CISA 4EY3A 2GN4A 5KYWA 4L5YA 2D8AA 2WUWE 1RJEA 3KB6A 4NBTA 1T3TA 3V2IA 4RNDB 2H07A 3GEGA 3LWZA 3QWFA 4U9UA 3SM9A 2IE8A 3C5WP 1BG6A 2GYVA 1ECLA 1DUSA 3HDTA 4HNQA 2ZJ2A 3RSFA 3C6QA 4JI7B 3O84A 2WFLB 3CZ9A 4KFUA 4A0GA 4TMXA 3RV3A 4B3DA 1M0WA 4LJSA 3DEAA 3DSRA 2QT0A 4EMTA 2C31A 1JFTA 4NABA 1T36A 3NH6A 1CUYA 4J3FA 2VBCA 5LNK6 1H6DA 2OO5C 2X5NA 3QJYA 1ZN9A 4GX5A 2AI2A 1NF2A 1V47A 3NTOA 1QB7A 3GLGB 1D2MA 5ED4A 1MVOA 1Q1EA 1CZKA 1QC5A 4YRNA 2YRXA 4L22A 3VR4D 2PH7A 1UBLS 1YC5A 2R5FA 3D5QA 3PFIA 4FZ5A 2EGHA 3LFTA 3SU8A 3TOZA 1OX4B 1YMUA 4F97A 1OTYA 1XJWA 4HT3B 5FUXA 4F6RA 1EZZA 1I5RA 2IV3A 2BELA 4OA5A 1AF7A 1T1EA 3ABIA 1R4NA 1BXGB 1XNHA 1Z2DA 3PYXA 3NRBA 2OV4A 4MB0A 5IBQA 1VPWA 2JCGA 3L82B 5IVDA 1F0NA 1CQIA 2ZBEA 4M8IA 5IDWA 4FEGA 2B8WA 5TE9A 1OT5A 3UKDA 1WZEA 2B7CA 3GA7A 3IDSA 3B89A 3JYHA 3O8NA 2WD7A 5JNVA 5ECYA 4ECAA 3B6ZA 3HR7A 2WWVD 3AO0B 2QE6A 3ILXA 1VYUA 5IJ0A 5EMKA 3WIDA 4OH7A 5FLEX 1U0OC 2M98A 3BIXA 3MN1A 4IWNA 1N8NA 1VKHA 2VS1A 2Q3DA 3LP6A 3RK1A 1XB2A 3UWDA 2BCJQ 3HDJA 3O8QB 3ONWA 5DSTA 4YP0A 2CNDA 4J29A 2PE5A 2D62A 2VQDA 1ST2A 2VQ3A 4NECA 1YCHA 5GGXA 4ZYYA 2G4VA 2Q6KA 5KYUA 3J7AC 2PJDA 2RARA 4KREA 3H5IA 2C9CA 3NDJA 2AC4A 3FBWA 3M4JA 4ZGWA 1Z07A 2QAGB 2PUCA 2AZXA 1L5HB 3MUOA 2FMTA 3EGDA 1GILA 4ZYUA 1RJWA 3LYUA 1O08A 2XKAA 4WQMA 4OKNA 4FMDF 1DZ3A 3FTCA 1JBQA 3KQLA 1VI6A 3FRHA 2JIZD 1JN0A 3D4BA 3NT2A 3KVYA 3VDRA 5JMOA 3O4IA 5L3ZA 2OD7A 3DWIA 4DWVA 4TLLB 5E95A 1W48A 3HVUA 4X95A 4WLFA 3ZU2A 4BWGA 2ZBVA 4GVPA 3EQ2A 1LDNA 3QVKA 4YUXA 4JGBA 3IJRA 3DE0X 2O57A 1Q21A 3KTAA 2OVBA 4G8JA 4J0IA 2COUA 3H5TA 4MR7A 4NPCA 5LA6F 4CM1A 2GERA 1GIAA 4JJ6A 2ZBRA 5IC4A 1V7ZA 1C7JA 1X1QA 1ECPA 3JYOA 2I71A 4HKTA 3WZLA 2P7HA 2XR1A 3E0QA 1U8EA 1M8KA 2RI6A 3GLRA 3UAZA 3R1IA 4BO0A 2JGRA 5SYMA 1P9RA 3T7CA 4CM8B 1QCCA 1C3OA 3PL1A 5ALTA 2ZXUA 2ESRA 3BIOA 4INPA 1LX6A 2XE7A 1GL7A 1PEDA 3QFCA 1UZNA 3VYVA 4RTRA 1W85B 4M9QA 1JKXA 3DM9B 5I4CA 4MWOA 5G02A 2VK1A 3BFKA 1K97A 3ASVA 1C3LA 4WVFA 1W1UA 1E77A 4AQDA 1R15A 4B2YA 1O5IA 2NVBA 2G9VA 3H6KA 1UDRA 3QELA 16PKA 2ZJ6A 4BFLA 4EFKA 3WKEA 4Y67A 1HLGA 1D2HA 3IDFA 4J0KA 5B4UA 3WGJA 1ECJA 2J7KA 4DXAA 2YWRA 5IJAA 2ISCA 2ZEJA 4MQLA 1SVLA 2GN8A 2Z8XA 4OREX 1CE8A 1F2TB 2PKQP 3ESRA 5E6UA 4MI1A 1PT8A 1A27A 1MVLA 1RWMA 3VNBA 2TECE 1ZISA 1U9IC 2WIAA 1H2BA 5M3BA 3BWMA 3UBTA 2I6SA 1HDCA 4GMGA 2FN3A 3T3NA 3GYGA 1QO0A 3UGKA 4BMDA 1X19A 3PA8A 4Z8YA 1IUPA 2C0CA 4MR8A 1A8HA 3THSA 2VJNA 4Q66C 4QG3A 1L2TA 2YJ4A 3PKIA 1VJ5A 2NU9A 3JY6A 2Z08A 3IBYA 2H2AA 3A4NA 1N92A 4DSNA 3K09C 4G8DA 4XIYA 1KHTA 5T4BA 4MVJD 5ERGB 2W6JD 1LSJA 3DL0A 4MW1A 1KFKB 3C3XA 4ZCMA 1TMOA 3KV1A 2PGOA 4OVKA 5DTEA 3O75A 3RCBA 2I33A 4QSMA 2ICAA 4F5ZA 5TXGA 1Y4SA 4S3MA 4KACA 1EDEA 4W5WA 5EIXA 1VMAA 1LB1B 4DADA 5DHPA 4LSMA 1ND5A 3IAAA 5A6VA 4AP9A 3MWDA 3ZCVA 2H9AA 5I4BA 1RQLA 3KQQA 4JEIA 3PXXA 3WXMA 2VJMB 1J06A 3D0OA 3I01A 4PYJA 4C78A 4UREA 3N1UA 2IWHA 2OBYA 2B4RO 4HQLA 5EIBC 4J91A 1EWVA 3LC2O 1F1BA 1LVUA 3ICCA 5G1OA 1OWMA 1P2DA 2G0NA 4TTIA 4WZAB 5C1BA 4ZVKA 1HV8A 2BDEA 2PMCA 1FNBA 1JEDA 4TUYF 5E6SB 3VHRA 4R8RA 3NVAA 1IZ8A 5BMVA 1M6EX 2QIOA 1QHGA 2CF6A 1D4OA 4AAYA 2PSEA 5CBKA 1KDZA 3K32A 2DT5A 4DR3B 1SVKA 1YWGO 5K4GA 1K7XB 1ZONA 3CN9A 3LAWA 3LBIA 4O02B 3FCSB 5B3JA 4GKKB 3RABA 1VRCA 1UM9B 4WL0A 1HQCA 1XXHA 5HIKA 1Z36A 1HZJA 4N6OA 3A0UA 4Q3KA 1XMOB 2YHIB 1N2JA 3IERA 3CMMA 4LNUA 2IYAA 1CDZA 3II6X 4E2FA 4P1ZA 4MV3A 1PUIA 2CVOA 2PGIA 2Y1GA 5FI1B 3ZZTA 1P7YA 4Y8VA 4I1YA 2G6BA 2H3EA 4OLFA 3TW8B 4AYWA 2XUOA 2FMUA 4HF7A 5AJHA 2XXAA 2VUHB 4X64B 4LWZA 2PZMA 4KN5A 3KCNA 4ZCSA 4QM7A 2VJKA 1I8TA 3GRFA 1QP7A 4YB8A 5JAIA 3VR4H 1TA9A 4RHTA 3MFYA 4YAFA 5A3RA 1WIWA 2VOEA 4MV5A 3RJMA 3ZV6A 4E14A 2VSNA 5BMOA 1NVAA 2FZCA 1W88A 3DPIA 4WVLA 5H16A 1AKWA 4CV1A 4B2PA 1QTRA 2GBCA 1FBTA 1FSGA 3HZHA 4KO1S 2FVXA 5M34A 4QOGA 1JLRA 1TM7E 2PM8A 2C07A 1O9GA 4O1MA 1NF9A 3B12A 4LZWA 5NULA 2VJOA 1D0VA 3ZHVA 5HSGA 3PQ8A 3ACCA 1Z63A 3TKAA 4LKOA 4LOAA 1JBKA 2V3WA 4QULA 3V9AA 1YDWA 4UU0A 1W5TA 1CQWA 4YRAA 1E6LA 1V6CA 3BGIA 5ADWA 2XXJA 2X8WA 4IYRA 5LU9A 4RPJA 3QHPA 3DCYA 3E9RA 4ZHQB 3PFHA 4LBWA 4ZO4A 4YJGB 3C8UA 4R40A 3VSCA 5JVDB 4FPXA 2WM8A 1BH6A 1PR0A 5JDCA 3JQFA 2EATA 1G7CA 1PEYA 2LE0A 3CV3A 3KFXA 4FFSA 5ED0A 4C0SA 3HABA 3NRJA 4HFRA 4OJTA 4V0NA 2WHPA 5FOUA 3W5VA 4FGWA 4HGRA 5F73A 5J2UB 1HDIA 3PNYA 2W90A 4A8TA 4G07A 5CM9C 4KZKA 2HLDD 4Y1EA 5HUJA 3KQHA 2E21A 4RSGA 1LU9A 1M3SA 3ROEA 3ZKWA 5IULC 2XDQB 2GHQA 5E6RB 1SR8A 2GHTA 3CKLA 2MT9A 4XGNA 3IC5A 5J63A 4UPVA 5J3JA 1LLCA 4ZAZA 1T9HA 3H87A 4R2MA 2A5FA 3CW2A 2QRNA 4LY3A 3C1TA 4PYOA 4XGQA 3LQFA 1FY2A 2O8CB 1HDYA 1DQSA 2VK2A 2E4VA 1OHHD 1P7VA 2J3DA 3E5MA 4J76A 2G1AA 4JLNA 4XWYA 1CEEA 5AOAA 1LF5A 1OLOA 3R23A 4OM7A 5DT2A 5I7OA 5LD2B 1Y1KE 5GJBA 5CA1F 4R8MA 1CNMA 1W0JD 4ZREA 4PGAA 1DLJA 1C5KA 1J0XO 1L4GA 3ZDFA 1XZIA 3UM9A 4BTVA 2ON6A 4OLJA 2ZWAA 1AS0A 3BMCA 2EW2A 1K5PA 2CUTA 4QDKA 1PX2A 5C1IA 1JE0A 2W22A 2YIVX 2G28A 2YWCA 3WG9A 2FW0A 4CKWB 2JFBA 2ZBUA 1YDEA 3AHEA 4QPCA 4URHA 5MFPA 5JH7F 3OX1A 4GL2A 1MN6A 3DOHA 4ZQCB 5C8XA 1UFVA 1PFGA 1JQLB 2FEWB 2JS7A 4IZOA 4EVIA 3FVTA 3I62A 1VGVA 5DGIA 2ZE5A 2QWXA 1DX9A 3W1EA 2V6JA 3WO0A 1I3CA 2NW6A 3OMLA 4HDNA 1PHPA 3F9RA 4GYYA 4L8FA 5L3VA 4ZCQA 4HDRB 2VHWA 4KO2S 3HQ4O 1DMSA 1XP5A 3FPBA 4BGUA 3GLUA 4UTNA 1X1CA 4EHDA 2FN9A 1W35A 3ETLA 5I9NA 5K6TA 4F0JA 4OK3A 4KR2A 5LQCA 4JT4A 3QVVA 1A8QA 2UUPA 3EARA 1YR9A 3FOAA 1T3ZA 3IQFA 3QKSA 4M7WA 4JA0A 2WE7A 1OIVA 5HXAA 1WZUA 3FJYA 2F1OA 2DPLA 1OUMA 3AGQA 3E2MA 5C52B 1NUPA 2CHQA 2I2AA 3BEDA 3GR6A 3CZAA 1EJ2A 4YRIA 1XFDA 4ZT7A 1Y3FE 3BG5A 1QRAA 3R6WA 4NE9A 4NF2A 4ZQIA 1DP4A 2WJPA 3JALB 1DKRA 2PKEA 3OC0A 2OB2A 4RACA 2CVQA 2YV5A 4K5QA 4DLSA 1RBYA 2RHRA 3ZHYA 1M73E 4CJXA 2V9PA 3GNQA 4UATA 2PUVA 1XQVA 2X0EA 5JJCA 4FX2A 1DL5A 4LHWA 4I2VA 3EHDA 1SHZA 1AK1A 2ZW9A 3MT8A 1C3VA 2XYQA 4IQ8A 4CCYA 5A4AA 2Q1UA 1CUWA 5CM2Z 1EIZA 2PMKA 2YNMA 2X41A 5SYNA 5CDSA 4MVJH 1ANKA 3T34A 1EXDA 1C14A 5DKFA 2NYAA 1PS0A 5B64A 1BCRA 1GAXA 1S1MA 3ZLUA 1DBPA 3CEHA 5LOVA 1QRTA 2O8FB 1SXPA 4LA4A 5G1PA 4WEQA 2PFSA 2WD8A 3BL5A 3QLTA 3JWEA 2VDRB 3OCYA 4IV8A 2DXIA 3DA8A 1ISFA 2CJXA 4KQIA 4PFJA 4MITA 4XPZA 2ZXFA 3HNPA 1YS9A 4U7JA 5CJPA 2ZR9A 3BHMA 1J23A 1VTKA 3R74A 3R44A 4L08A 3WDSA 2HO4A 5CNKA 5JZVA 3K1YA 1S2DA 2YJTD 3MJHA 3PFKA 3AHHA 2Y9PB 1GFZA 3HJUA 1N2CA 2HREA 2PUDA 1SQSA 2Q6OA 1YBMA 2JLBA 4S1NA 2AC7A 3ZIUA 2ZUUA 4QYWA 1C30A 4MVJG 4H7FA 3WWEA 4PGFA 5M29A 1QPBA 2QTLA 4JNCA 1MHPA 4H08A 1Q0SA 1WOYA 1QV6A 1YQEA 3HFSA 5JD3A 2KLHA 2Q8NA 4ZT3A 4B3HA 1F20A 4DY4A 3FFWA 4CM6A 4B6SA 1NAHA 1GHTA 1SXJE 2ZB2A 3HVIA 4H31A 1II8A 5GJVC 4OFZA 3LP8A 4YBRA 3ZK9A 1A4UA 1OLUA 2FPPA 4UUAA 1CZNA 2F1IA 4YMSA 4QNNA 4BQIA 3MUNA 4ND3A 4UFPA 3SC4A 2CFIA 1Y8AA 5JPDA 4X8HA 4LYYA 3ZV3A 2VRNA 3FUUA 1BHJA 1LFDB 5ALYA 4BNJA 3GFSA 3LC1O 4JEHA 3SX4A 2DRIA 3L7LA 4FMCB 3IH5A 3RI3A 2VF4X 2GBFA 3ETNA 2BONA 3LMKA 4B0PA 3HFJA 2I4NA 2E6UX 5C8YB 5ADHA 4PTLA 4UU8A 1D2AA 2FF5A 2C9YA 3V1UA 3N8HA 1AURA 4REQA 4GVLA 1JH8A 3V2UA 1WHTA 1OVGA 1GV1A 4RL4A 2BSXA 1ODIA 1G8FA 5K0FA 5LLDA 1V26A 5LUAA 1QFMA 4OXQA 1DO2A 2FZGA 3AVUA 1YS1X 1N6NA 2WF5A 2FN8A 2JCXA 3NBZC 3PGJA 4Q03A 5LM3A 2R97A 1E3EA 3FNBA 3P9XA 3Q2IA 2JLXA 3BMNB 4IIDA 3V34A 5K05A 1U0JA 3R7AA 2QX8A 4PG5A 2B69A 1V39A 5KWEA 5A05A 1EK0A 4E22A 4EUHA 3A6ZA 4ID3A 1UPTA 3G17A 3G5MA 2HCTA 3GGDA 2IEDA 4L9RA 3U7JA 4K6OA 4NARA 1I7SB 4OFBA 1JLHA 4N82A 1KFJB 1MJHA 3IUYA 4QEKA 2REXB 1E9VA 1N0VC 2PV0A 2VLBA 3CLUC 2FRXA 4OSEA 5IKXA 3PE4A 1QBKC 5IJWA 4NZ9A 4ALJA 1EP2B 4HP8A 2MYPA 2GEDA 2Y2VA 4ZV9A 5ADUS 2W2QA 3ZCTA 2CJPA 2MR5A 4NY1A 1NBEA 4UBNA 5JT1A 1GNLA 1VBKA 1G55A 1JSZA 2Z1NA 1Z22A 2IV7A 3BZBA 1EFPB 3B1KA 3MJTA 4A23A 2QSUA 3ROZA 5C1OA 4QGHA 4QZVA 5FFMA 4GSLA 2GESA 3CLTD 1V8PA 2FEXA 2OV1A 3C8DA 5F52A 1SUBA 4F04A 2PU5A 4NMHA 2Y1DA 2X0NA 1F8FA 3G0DA 3R5SA 4JFAA 4PTYA 3QVXA 3UJ9A 3OQOA 3I04A 3REOA 1U9ZA 4L0MA 6REQB 1KH3A 2J0QA 4XGRA 2YYYA 4N4AA 1KDTA 2H5EA 1DSSG 3OCUA 2GVDC 2VK4A 1W1IA 3LBYA 4NCJA 3QTLA 4FDLA 1JKJB 1CXZA 3F4LA 2KX7A 3G0IA 4FFWA 1DB3A 1P1HA 2JKVA 2QGNA 3PCTA 4N8DA 1JIVA 2Y1FA 4OP2A 3BXZA 4BRZA 4TZ6A 2FP4B 1TVMA 2XUQA 1VRVA 2OHOA 4NCNA 1LSUA 2D1RA 3SYRA 3BSWA 1ENYA 1CB7A 1NQAO 3GPCA 3TDKA 2XLBA 4J0DA 4D0NA 4D3XA 2Z3WA 2GOYA 3I37X 3FYSA 4A2WA 4RAOA 2HYDA 3K2BA 3C98A 2DECA 3E9DA 2XF2A 3HWSA 3IQHX 1SA0A 1Y5NA 3QFSA 4IRUB 5F5LA 2NO0A 4TKLA 2A3RA 1E8DA 2DGDA 3AKYA 3CEAA 3FCUB 3KJQA 3O1HB 4L1KA 1E2HA 5AMXA 4BNVA 1SOVA 3BSYA 3NX4A 3MWEA 3AKCA 3T7DA 2GBLC 4MS4B 5AM1A 4CL3A 1UK9A 1OBHA 2DWPA 4MS3B 4Y98A 2KW5A 4MJLA 4Q4JA 1N4AA 1Y5MA 3L05A 5KX5F 3F5SA 4HZUB 1GY8A 5IM4A 2WNSA 4M9ZA 4X45A 4NZNA 4S1PA 1UBUS 4A15A 2DH6A 4A8JA 1QIJA 4HO1X 3QK7A 4UVHA 4OXXA 2FX5A 1O03A 3HG7A 3KKPA 2PO7A 4Q4AB 3GGOA 3KT8A 4FCTA 2OOKA 1SOUA 3QG1A 4CKBA 3EXEA 7REQA 2FEPA 2BFDB 4QUGA 1NPDA 1G6OA 1Z4NA 4L4YA 4HX9A 3V3TA 2X1HA 4D4MA 3EZGA 3V97A 5L3SA 2ZRGA 1E1QD 4P31A 3SS7X 2FOIA 4XVHA 4ZC1A 3AXTA 1I7NA 1E9CA 5H81A 1IVYA 3UAYA 3M4YA 4FN4A 1NATA 5BYAA 2XRZA 1UBSB 3UQYS 5COBA 1VJ1A 2PG3A 3DT8A 3JV7A 1PUJA 1TM2A 4I55B 5CEJA 1JR4A 3GLIA 4Z7JA 1E1RD 1GQQA 2NQ8A 5MGBA 4RMGA 2C5HA 2AOUA 1RIIA 5CFLA 3Q7SA 5JAHA 4G1UC 1XF1A 1Q44A 2G09A 3L8FA 5A9SB 4RH3A 1FP1D 4RH1A 1T8RA 1TT7A 5FD8A 1HYEA 2QNBA 2R2GA 4L75A 4ND4A 1E1NA 2VT3A 5J5AA 2X14A 4MEAA 1OF1A 2HMAA 4G8BA 4RADA 2Q7OE 1Z4JA 4ADSG 3HKBA 3NIWA 2JH3A 1SBTA 1Z74A 2IXTA 4MDYA 3EWNA 4CM5A 2PTGA 1EDOA 1UKAA 2ODAA 1GU7A 3AINA 3CU5A 3EF3A 3NGLA 4XQ0A 3KX2A 3SZ3A 3TZKA 1B41A 1I2BA 1MFZA 2EW1A 1ODFA 2HOQA 4AWXA 2VYNA 4YCLA 5JNLA 3RK4A 5KOHA 4PAWA 3V1MA 2ONCA 1U9YA 1F7UA 3OIVA 3MJVA 1KJQA 1MW9X 3EEIA 3QVSA 4LHVA 2RG1A 2QN2A 3N58A 4FE4A 3W1WA 1AQYA 1V1RA 2GD1O 3C8MA 4KL8S 3DONA 4YCMA 3GG9A 1YZHA 3H1GA 3W90A 3R9IA 2ZIFA 1Y37A 3SJUA 2CDCA 4POAA 2GS9A 2VDWB 5EKUA 2WKWA 2X8JA 4L73A 1WDKA 3OCZA 4RQUA 5JWRA 1HI9A 5B12A 3UV7A 3C8HA 2W2TA 3CSDA 3A27A 5TQJA 1FTYA 3TJMA 3OQIB 3LOUA 1BHSA 3PLRA 1UJ5A 1ZAKA 1FA9A 1MOQA 1EVJA 2XYPA 2ZROA 3CWCA 1ZRNA 1XZFA 3CZQA 4UCWA 3GRAA 4D82A 2W42A 1HF3A 1KI6B 2CUZA 1Z75A 1QRRA 2P11A 2WIGA 1FNSA 2P0EA 1Y6JA 1ICEA 2J4FA 2APJA 3LDAA 4BXOB 3F6RA 3L6CA 3TFOA 1RHJA 4LJYA 4V1CA 4MULA 2Q9BA 4G41A 2P9ZA 4TQGA 5HF8A 2EAUA 2QY6A 3ZNQA 4CIYA 1Y33E 3DWFA 4X7MA 3K1ZA 4LK3A 1EHIA 1JAZA 5AM0A 3U2QA 3JQGA 3WRWA 4QWMA 1R64A 2ODQA 1T2CA 1U1FA 3EIXA 5E1MA 3H2YA 1VJGA 3BZUA 5DRTA 2YWGA 4EL0A 1B42A 2CL5A 1ZKDA 2PEYA 5KU1A 1Y1LA 4XZ3A 4JYPA 4ND8A 5FL7D 2ZU6A 3MQFA 3KUXA 3BFPA 4XWOA 5CCXA 3PIRA 4Y6GB 5IARA 4AKTA 1K92A 1J0DA 3SMQA 1DKNA 5C35A 3P2YA 3R6GA 1FX1A 1SEVA 1SCQA 1UOPA 3M9LA 4LZLA 2MSWA 4P53A 1GKKA 1YBVA 4CFYA 3LG2A 3NAGA 5AH0A 4DLLA 1X2BA 3G1WA 4UULA 5DHUA 4H4CA 2W70A 1DFIA 3K0KA 3GGGA 2YIMA 3VMFA 4X62B 3QKWA 2P4QA 2C5GA 4S35A 1FUYB 121PA 1U7UA 4IIJF 4EG0A 1DAMA 2GX6A 1SVUA 2ADOA 2G17A 1ZQ1A 3A9TA 3AR3A 3H9CA 3PNKA 3R5KA 4GW3A 4L4SA 1TZKA 4YS6A 3ZHRA 2DAPA 3CVXA 3R4VA 3D7MA 1NNUA 4MQUA 4ZQHA 1SBCA 3EC1A 4LDNA 5J5CA 3COWA 2ZE8A 3H4IA 3IEIA 1VHQA 4M83A 3CLRC 3WHIA 2GTPA 1PGOA 2PZ8A 3DC2A 1MEJA 4ILKA 4ENSA 5FPTA 2L0XA 1NRIA 3HYLA 3DPSA 3M6WA 3RUAA 4BKRA 1Z6QA 3PNQA 3EAQA 2I2DA 1D5CA 1ZCBA 1P9OA 3S29A 5JARA 3EIQA 5E4TA 2H29A 2JJ1A 1EBBA 5SV2A 1I3KA 1OY1A 4FR2A 2HA7A 2PYIA 3VJMA 4HATA 4OFWA 4Z4QA 2GJSA 1EFVB 3QOYA 3OD1A 1HETA 4IDPA 3OLVA 3MIZA 2JASA 4AY4A 4FN5A 4LDPA 2NYVA 2VDLB 4LZZA 3TIXB 3ZJVA 1UKBA 5CDFE 4UU1A 5HE8A 4MPJA 4BTEA 5DYTA 4KLRA 4E08A 5BNTA 4FT4A 3STYA 4MUNA 5DSZA 1BMDA 1F4PA 3OEEA 3K9FC 1RZRD 3O91A 3WWPA 1MT0A 3BPSA 3HWWA 4W6QA 5DWDA 3W8RA 4YRPA 5LYJB 3LTNC 4JP5A 4JBWA 1YL7A 2QVYX 3MBIA 5LZ5A 5C80A 4UOQA 4E2ZA 4BZQA 2BKAA 3CBGA 3LI2A 1J2YA 5KQRA 2QTWB 4BNIA 3LKZA 1UOQA 4DDMA 3PDHA 3S55A 2P1ZA 2C7GA 3LUHA 4R1SA 3SHFA 1A8UA 3AVOA 3PU6A 3HCBA 4JS0A 4ZAFA 3CX6A 3M1AA 4LC1A 1D6NA 3WC4A 2O19A 3OOHA 4HNGA 4ZCLA 4EGSA 1RAIA 4D2IA 3ZZNA 1GU1A 1CZLA 3VA7A 5JHGB 2D00A 4XQEA 4PSVA 3LGAA 1LTQA 4PC7A 2CCGA 4Y2TA 2W8BA 3DCNA 2AN9A 4TWJA 5K8LA 3DE7X 1KRWA 5ELXA 2BFOA 1CUBA 1J25A 2X6QA 2PWBA 2GRJA 4Q7KA 2BDUA 1GQRA 2NYRA 4RZUA 3UATA 1UINA 5C7YA 1N3IA 2RGBA 3OJXA 2BI8A 1UQUA 3H11A 3DOEA 1IM8A 5D1NA 2FF7A 3WLNA 5ILGA 2Q62A 1VM6A 2OL4A 2G72A 2R751 4JROA 1DAOA 1G7TA 1UUFA 1YH3A 2BMAA 2V9CA 2VNIA 1X80A 3R40A 5AK3A 1GKIA 5TMPA 2DSTA 4DV4B 3F6PA 4ZZ1A 4GVXA 2DETA 4CFZA 1F1JA 4U2EA 4WZBB 2DFVA 3UHFA 2YJ5A 5DCUA 1OH6A 4G1VA 1XD2B 5IJ9A 2FY8A 3B6JA 4AJPA 4UE6A 4O08A 2ZIXB 4BB5A 2WTAA 4XEUA 1BWPA 2O23A 4ATNA 2E82A 3QFRA 4BNFA 4DHEA 1XRPA 3K94A 3TQIA 4JT9A 4U2GA 3TLMA 2PMDA 1A5AB 3IS3A 4D4KA 3DTNA 3IR7A 3E22A 1KI4A 4RXMA 2BH9A 5KOIA 2YX1A 1MAAA 5H02A 3AF0A 3L6OO 4C3UA 1YJ5A 4KLNA 1UKVY 2Z04A 1T1GA 2C8KA 3GXBA 4NU0A 1BOFA 1N3BA 1P33A 3DZDA 3FVQA 5BORA 2VDQB 3SC6A 2I1QA 5HIIA 2GZDA 3Q7QA 2HC9A 5D3KA 5BSTA 3DEYX 4JBLA 4QIHA 4G4JA 2OBFA 1A98A 5DIZA 3CRMA 1JHMA 1FVOA 4Q34A 5K6AA 2CV2A 4LE2A 3EK2A 4MQMA 3OI7A 1H8ED 2N3ZA 2C97A 2BM8A 1UPBA 1GP2A 4MHSA 3G7UA 3O6VA 1OBOA 3FRIA 4B7CA 2P6OA 4QPNA 1PIWA 3N2IA 5DLPA 1WV1A 4JU9A 4B48A 3OQPA 4O4IA 4BDTA 3KO8A 4WBSA 3DL2A 4N3BA 4DSAA 3ME5A 3QE0A 4GI3A 4YDHB 3TIVA 4CIXA 2JGDA 3CONA 4CF4A 1NP7A 1L5KA 1JQEA 5JSFA 3ON5A 2WTXA 5AW6A 1I3LA 1XJCA 1VPTA 2IU6A 2PH5A 3CNBA 5A6SA 5I9MA 3MW8A 4LS3A 5HKAA 1NJ8A 3P0IA 3EXHA 2GAOA 3O90A 1U3FA 2Q3HA 4L0CA 4NVRA 3DOCA 4O1HA 3EN0A 2L82A 5CVEA 5E7QA 3INGA 2RK3A 3VU3A 5IX8A 1JDBB 2QMEA 3JASB 5AXCA 3TSAA 2CV1A 5ITZB 3T0FA 4TL9A 2EW8A 5JROA 3ZZ0A 4ZVMA 4PC1A 2C5FA 3CFYA 4HDKB 5KTNA 2XB2A 1BD4A 2IOYA 2QQ5A 5KINB 2DC1A 3ZHXA 2XHZA 4PRLA 3ZWYA 5ERXA 4N7JA 3D6AA 1IK6A 5EXEA 3FPCA 4MWGA 4D8TA 5AW9A 5JALA 1OAOA 1S3IA 4CV0A 1T0HB 1JG3A 2CXNA 1AKUA 4DA8A 1N75A 1IHOA 4NENB 2F90A 1P44A 3QEMB 5LQKA 1RYHA 2C4KA 1NJFA 3JWPA 5FBVB 2X3UA 3KQNA 4D9CA 2OXTA 3B9QA 2VT7A 1W75A 3L2OB 3L7YA 3OWXA 4YUWA 2X0RA 3K2EA 4P7GA 5CCEA 2Z9BA 1O6CA 2I99A 3WDLA 5E38A 2DF8A 2DUNA 4G5RA 5T3YA 3RDPA 2H7VA 2O8EB 4BIIA 3U7FB 1N78A 4TTJA 2O8DB 3D3WB 1AD2A 4WJZA 1RC1A 4QHSA 1H0KA 1M6VA 1SKQA 2R66A 5ALNA 3IKVA 4ED9A 4HQFA 4BWVA 3BA6A 3VR3A 1L7NA 2J6BA 2G70A 4D46A 2C82A 2PH3A 1GRVA 2IZZA 5KTSA 3GPDG 1UR5A 2PGLA 3MGAA 4HNAB 3KVNA 3LHSA 4J7XA 3FDZB 5K4AA 3TIGA 4F2GA 4DIKA 3A2KA 2QZSA 2ZRBA 2YDYA 1DT5A 1JAXA 4FWIB 5JO0A 4HADA 4L5CA 1XG5A 3HHEA 5EXPA 4HD8A 4J2OA 2QAJA 2IDMA 2Z9CA 4N3NA 3DZCA 1NLYA 3RUCA 3WIUA 2EJVA 2HF7A 2ZCJA 1RCUA 1OX5A 2ZJZA 2QYTA 4NV1A 1JR6A 1UT8A 3CLKA 1V16A 2BT4A 2O2CA 3GUYA 2Z2ZA 5LBTA 2QUZA 4F5YA 3BBPA 3ILSA 4R4JA 2ZB8A 2HX1A 4TXNA 4KQ1A 1YULA 5GM1A 3EPLA 3FWZA 1WPXA 3SS8A 1NSTA 1Y3IA 3UC5A 4DAEA 1DTWB 2ODEA 5BN4A 3FMGA 1YA6A 3A1UA 1NW9B 2PMWB 3F3MA 4NJMA 5D5QA 1HG0A 1YZYA 2P27A 5CHEA 2NVUA 1QR2A 1XP8A 4JLDA 4BB0A 2VAMA 2V7VA 1D07A 3NBQA 1WUTA 2B0JA 2DPYA 3V4PB 2BGJA 3WLHA 4FBGA 1CTQA 1JSRA 1NVKA 1EFHA 1HDEA 2BL4A 4INOA 4OJKA 5JRZA 4IP0A 2GTHA 4YHBA 4GT1A 1MIOB 3O4GA 1V8ZA 1L6IA 3GARA 3OJOA 3K5HA 4YMIA 4S24A 5DWQA 5K3CA 4E5KA 1XX6A 3UK0A 3D5EA 3ZS8A 4Q7LA 3GZNA 1U5AA 1FXUA 1Z4KA 1TCBA 1ZK2A 2QN1A 2VHJA 5ALMA 5JZSA 4DV3B 1ADJA 1PW5A 1WZIA 1H6CA 3IHLA 1QGED 5FX2A 4W5QA 1WETA 1QH1A 1T0IA 1Y7PA 2Z0MA 2XMDA 3UWPA 3GEIA 1EWTA 4H7JA 4UQLA 3MTAA 3K3PA 1JXMA 4TLCA 2FZ4A 4NEHB 5HWSA 1IPHA 3NIDB 1GGHA 5BWOA 5JXJA 4Z4FA 3UMVA 3DEJA 3PHJA 2ZIEA 2D59A 2O3JA 3PZRA 4YGXB 4JYBA 4DG5A 1PTJA 1RWNA 4NCHA 1XD8A 2OLKA 3CJTA 5TF4A 3SDSA 4EEXA 2EHDA 2VO1A 4WPGA 4WFQA 4RGVA 4HHEA 1X1AA 4FX5A 1TA0A 1X7YB 2YZMA 5BV1A 1ZIYA 4CN8A 1YVPA 2GXQA 3ENQA 3IUQA 4GSKA 4MUAA 1JI0A 1V4VA 4LOHA 3FPLA 4LMPA 4M8NE 1WBJB 4BNGA 4Q7MB 1NXVA 3SEZA 4UNQA 1SUAA 2P1RA 3SHQA 3BJMA 1ORRA 1NG9A 2BISA 3LPDA 4O6VA 4JBGA 2H63A 4LFBB 3NHZA 3QNMA 1Z0IA 5C9ZA 4DSUA 4D6PA 2O7QA 3IMGA 4X7BA 2BH2A 4I2NA 4YV1A 9GPBA 1PQPA 1EA7A 2C4WA 1IEWA 3G0BA 1FDVA 2H7XA 3CPSA 2AN3A 4TKZA 2AG6A 2CHGA 3GMDA 1LK5A 4UTOA 4XX0B 2H17A 3KHKA 1FRFS 1MNAA 4CMCA 2XVAA 3CZ5A 2C77A 1Z3CA 1V11B 3WP0A 4M7PA 1K66A 3F5FA 3FLBA 2QOEA 3O1IC 2PLFA 3GG2A 4N1AA 2UVPB 2ZAYA 3IVMA 3GNSA 3UK6A 1GLNA 1NFRA 5K3DA 8MHTA 3JAKB 3AR8A 3WE7A 5T41A 3HYTA 4Z2AA 4HVTA 3KSRA 3OHMA 4HEA1 4KQWA 4TLBA 1T9CA 4HXYA 5CR9A 2V7QD 3L4BC 2OGUA 2NTYC 5E4FA 5SZJA 3VO1A 3GGSA 4DWOA 3AFIA 1ZM9A 4A91A 1L8LA 4EP1A 2PJRA 3TLYA 2VP2A 3MGGA 3HB0A 5FNVA 1JEQB 3UT5A 3RVQA 3RASA 4OQDA 1I4LD 3EW7A 4YQEA 1SPXA 1MAUA 1EWRA 2BZ1A 1QZTA 1QV7A 3ICOA 1NG1A 1A9PA 1PR3A 2GVNA 4BN4A 3GELA 2YCLA 3WIBA 3GUCA 2CVHA 1U04A 3L02A 2HI0A 2PUBA 4Z4HA 1YJCA 2P6RA 1LJUA 2W6OA 3FSRA 3LRPA 1V4NA 3HXMA 1HTWA 5L7TA 4P7FA 2BJWA 1OAKA 3C7KA 3DAFA 3K8YA 3GD7A 3V8PA 5F21A 3WGHA 2OORA 3E3NA 3C1UA 3LOQA 1X92A 3OU2A 5M04A 3HXOA 2I7DA 3PJEA 3D6JA 4AUNA 1ENOA 2O7SA 5KWVA 2B1QA 2C9MA 1YU6A 1RWVA 2LR0A 3I23A 4ABYA 3I30X 3C1AA 3QA3E 1SG0A 4G84A 8ABPA 2P9GA 2BF4A 5AESA 1CEXA 3GNLA 3O8RA 1NMEA 1NBMA 2FFHA 1WP4A 3HRHA 3VNUA 2OENG 4FFLA 2OM2A 1BA3A 3MT7A 4BQQA 4JP3A 3GGPA 2P4UA 1AK2A 2IS1A 4RK4A 4BTLA 1XTUA 4ZARA 2BYTA 3QLUC 2QLFA 4HGYA 2CNWA 1YNSA 4KXFB 2ZPTX 5DTQA 5I9TA 5FR1A 4OYHA 2IEAA 5LZ2A 2AVDA 2PMBA 2R4TA 1KPHA 4JHLA 4NTZA 1NXQA 2PKXA 4URZR 1QSGA 5HRCA 3EPKA 1S7GA 4N0DA 1AH2A 3BWCA 1QCYA 5H3CA 4CF6A 1ZM3A 2V1XA 2EWMA 1SULA 4U39A 3S1AA 3HACA 4YRDA 1AN9A 1P18A 3IDOA 2OD2A 2UYGA 5DNCA 2WK1A 3U49A 4G0YA 2GM9A 3VPHA 4ZT6A 3VDMA 4JXXA 3SBXA 5IAJA 3ND5A 4JGGA 3PVZA 1KAHA 1VJTA 4TYPA 1H1LB 2H2IA 3DXZA 5K8TA 1RYNA 1R6BX 3ESYA 4KNYA 1OGJA 2NO5A 2TMYA 4ZVSA 2JBAA 2WVAA 2ZZKA 1X86B 3Q85A 3X3HA 5HBRA 5FAKA 2YWFA 3RU3A 2N42A 4BEJA 4NDAA 4PCLA 4QO7A 1FLDA 5K8IA 1WDMA 5EZYF 2VKQA 3ZXSA 2FH5B 3PDJA 4TSFA 1CFJA 1YE5A 4YRFA 1EWKA 3TNYA 2HHCA 4QBGB 4AXBA 3QX3A 2CSXA 1VDZA 1D4AA 3IVRA 4RENA 3THWB 3V1YA 3DC7A 5ABPA 2JAHA 3K6SB 2FPUA 5TARA 4BBJA 2OHXA 3OJEA 2WFMA 3N2KB 1CEYA 1ZIOA 3TE6A 3GCWA 4JODA 1J9EA 4AROA 4U5QA 4DM7A 5AOCA 3GP8A 1DRWA 4R1OA 3PPVA 3RS8A 2GNPA 4B45A 4DXHA 4A36A 4Q9JA 4LWOA 3T3EA 4EB8A 2QM3A 4YMLA 2NADA 4YRLA 2ATEA 4LZOA 2ZULA 3TTVA 3OQJA 1DAPA 4MGKR 3A1FA 2P91A 4C3OB 4DQKA 1J5PA 3L3BA 5EWMB 5BV0A 2YS7A 1RAFA 3EJ6A 3LT2A 5BV8A 1GQOA 4P36A 4RYDA 5DEOA 1U90A 4JYMA 3KQSA 1PW7A 1VG0B 4OJYA 2VNKA 3EZFA 3ILHA 3Q9UA 1P80A 5DBGA 3T5TA 1KMCA 4BBZA 1TU3A 1JR2A 1NHWA 4OXYA 4YTEA 1SHTX 2OBNA 1FYEA 4WXEA 3V4VB 2CXSA 4MGHA 3DXXA 2NMVA 4LK2A 1W46A 3NYQA 4II3A 3VH1A 3WL6A 4WTOA 3VO2A 4DJEC 2JVIA 5CCDA 4C0BA 4CR7A 3KSAC 2M6RA 4P3NA 3FMOB 5D84A 4P5PA 2ZSBA 4P4TA 2ZYIA 3SBDA 1SZJG 3P4UA 4HAYA 1BDJA 4XW2A 4R3NA 4EJMA 1Q16A 4E32A 4HNHA 4QU8A 2NPFA 2RJ3A 4N03A 1UOEA 3KEFA 4BDSA 3U44B 1U9IA 1VJRA 2VJDA 3NASA 3A06A 2A59A 3NCTA 4BKOA 2JIOA 2RI0A 3SX2A 1X7ZA 5JWOA 3RJZA 4OP1A 4CLDA 1E9FA 1CF9A 2FJ0A 2VEOA 2Z30A 3TAUA 3EXFA 2I03A 2XRFA 4W4TA 3DLIA 4GI7A 1IH8A 1IM2A 4U2DA 3G7SA 3K09A 3OTWA 2J45A 5JNWA 1NKTA 1UAGA 4FMPA 4BAUA 1C2YA 4OK6A 3KSUA 3EZ7A 1N5DA 1NUUA 4IHJB 1GT6A 2F8LA 2ZRAA 3GFRA 2CDNA 4WI1A 4X6XA 3REQA 5HUHA 1TGYA 2IQ5A 3COPA 1R6TA 3O2QB 4YJ2A 4R6WA 3FJOA 2AS0A 2FFAA 3LHFA 4JVNA 4EI7A 5CXQA 2E1PA 3EB9A 3NH9A 2C61A 3KDPA 4UPDA 4R41A 3RYIA 4RSRA 3BXHA 3ZXYA 2AN4A 4HLUC 3R8CA 3DBLA 3C16C 4Y1RB 4B7UA 2QTHA 3KB8A 3ORQA 2VTEA 3S4YA 4G63A 1MP0A 2HV8A 4EIWA 1ISJA 2QI9F 4FKZA 4L57A 3OFKA 3N7UA 4E11A 4OI1A 2FSIA 2J59A 2UYCA 1EI9A 2Q21A 2BIFA 3ZJ4A 5D3MB 2H2HA 2WVGA 3B7GA 1ZCJA 4RF3A 2BGUA 2AR7A 1GA4A 2QROA 2X6RA 3ANLA 3F8TA 1I32A 4JJGA 3MAGA 3T7IA 4CPDA 4POOA 4AN1A 4PW0A 2JIPA 5ENDA 4D9KA 3G8YA 2YWHA 3QWHA 4KTVE 3FPSA 4UFOA 5D8DA 4BCCA 4C0KA 4X97A 5ADVA 2BLLA 2Y05A 2MSCB 3BRQA 3OO0A 4FFOA 1N2HA 4IF4A 5MDHA 4FBMA 2RK6A 5K8UA 4ARIA 1LRKA 3E0XA 1YQDA 3QVLA 1WW2A 3GJSA 4RLHA 1YS4A 2CF5A 3FAKA 3GIDA 4TV9A 5TV2A 4OHUA 1RLMA 4L8GA 3MRXA 1VPVA 3SE7A 2Q5CA 1FU7A 5T5QA 3QVGA 3P2KA 1N7IA 3LNCA 2NM0A 4JJKA 3HGTA 3OETA 1EQ2A 4F96A 2CD7A 4M60A 2AZMA 4O2AB 4TYWA 4BAZA 4BNWA 5AXDA 3H2KA 3NB0A 4N7MA 2YJZA 3AIKA 3BS4A 4YLYA 2JGLA 2OKCA 1RQNA 2BSQA 5PNTA 1Z5ZA 4U6SA 4RWZA 3F3KA 1WHSA 4J4BA 1YRBA 4DIDA 3K9LA 2OCKA 2YQZA 4NYIQ 4YI3A 2B8EA 3TXAA 5LLSA 1M67A 3EUAA 3HI6A 3KJXA 3D0RA 4RHFA 1MXFA 1LDGA 4G36A 1GGEA 1U0HC 4LI3X 3LXXA 3AQ4A 3DF7A 1K27A 3SP1A 1IJKA 4YO7A 5L51A 1W94A 3PXEA 4ASUA 1BVRA 4FSXA 5CXUA 3OHPA 4RLFA 1B2LA 2JHCA 3WL7A 3HCPA 1BSVA 3P9IA 3MLEA 1V71A 2JNWA 3KV3O 3T3HA 2RHTA 3IODA 4B4OA 4NBSA 4AJIA 4UTPA 3EPJA 1DADA 4GFDA 2GD0A 4Q47A 4YJKA 3VJLA 1NT2A 4UEJA 4JH0A 3RPEA 4S05A 1R6XA 2ODTX 4ENRA 4RUKA 4HDCA 5ESDA 4R1PA 2H2WA 1FTQA 1OYWA 1CUEA 3UHPA 3IOEA 4FOPA 5KTOA 2J5XA 2IKQA 2QRVA 5CDUA 3UJ6A 2XQGA 3EASA 1UXIA 1C9EA 2PRIA 3TCXB 2WYWA 5HDQA 4FFMA 5EJ6A 4G2NA 5BQ3A 2YBDA 4PZAA 2QZJA 4U3JA 3FDFA 2V1UA 2WG2A 2BGMA 3G79A 2R1ZA 2JGFA 4GRAA 4KI0A 4QBKA 2HHAA 5EHGA 4DBLE 1Z5PA 3SE0A 3ICEA 2MYTA 1A7AA 1MAWA 4GPZA 2HADA 2WWWA 3AESA 4XVUA 4WCDA 1U28C 2WJHA 4Q7QA 3NYWA 4DLVA 3EG5A 2HRRA 1MO2A 2CGEA 1ATIA 2V5AA 3P9ZA 3TSZA 1DX6A 3F97A 1Y3HA 2FOXA 4QAQA 4WCFB 3ZE1B 3W3AD 4DA7A 1H6BA 2NZUG 4HWPA 4TRJA 2XQVA 4CMAA 1U63A 5CPBA 1P1KA 1XTIA 4BQRA 3IQIX 4UJ5A 5C8VA 1A4IA 1NFQA 5EE0A 1AUXA 2BR5A 3ZWMA 1DJLA 3NTUA 3KB1A 1UANA 1T2FA 1EX1A 4IXWA 4H3VA 2H1RA 1Q0UA 2AB0A 4M53A 1Y1QA 3AHIA 5AO9A 4KJZA 3SC2B 4AJ4A 3CF6R 1KL7A 1XTPA 2FEAA 3G89A 5LUBA 4TQUS 1JHZA 5D2CA 3UMFA 2X2OA 2CCJA 3E61A 3HKDB 1JJIA 5FA8A 4LJ5A 4HS9A 5H7XA 1KI3A 2W2XA 3FPAA 1NZJA 2WRZA 1FS6A 5KWJA 2YVAA 4E1VA 4RZXA 2B2CA 2WZCA 3F6YA 2WU1A 3ZU4A 1C7EA 2EP5A 2OAEA 4D8WA 3VR5D 2UU9B 4P3KA 1U2SA 3GFBA 4H0FA 2UZ1B 4Z7NB 2JFUA 2C94A 1KZYC 1U1IA 2YL2A 3NAMA 1H8HD 4LCBA 1SVNA 4V0RA 5DTIA 5FUBA 2A9VA 2CXPA 3M1LA 3VU9A 2CHUA 1Y48E 1UBTS 3HB5X 3LHKA 1CERA 4LQLA 4WCVA 1P3Y1 2HNKA 3LLVA 1VG9B 4H35A 4A8HA 3ZXXA 5WRFA 1DC4A 1I80A 2A57A 2W7TA 4CZ2A 1GQ2A 4EO7A 1YVEI 4CEIA 1MC5A 1LCIA 1AQIA 1UMDA 2O2HA 2MSKA 3CZPA 2NUPB 2Z57A 2DCMA 3DKIA 4V0OA 1IBRA 3WYAA 3L0BA 2ZBQA 3VI3B 5DTRA 3HP7A 5ALQA 3LFHA 4DCMA 4AY6A 3CA8A 1X7DA 3NHJA 4NICA 1L7VC 3BD9A 1MABB 2XB6A 3H3XA 3WYGA 5JS8A 4EATA 1PS9A 3PPYA 2IF0A 2W6MA 3P2IA 1KH2A 3KOXA 4I4NA 1P2VA 1NT4A 2CV0A 1PJSA 4G0UA 5A0TA 2QSJA 3ODPA 2IXEA 4TYMA 2E5FA 2OGTA 3GH1A 3A1CA 3WB9A 1EXVA 3KOMA 1XAJA 1HLPA 3K73O 4UVDA 3ROTA 5EXTA 4C7OA 3GT0A 1FLAA 4CDRA 2WJAA 2IY9A 1BROA 1RLTA 4PYQA 4YRCA 3AR9A 1IBMB 2W6IA 5TQVA 4NBLA 3FYDA 4N01A 3ZGOA 3EW9A 4RJKA 4LDJA 5JMPA 4CQMB 2X4GA 4BOYA 3FOEC 2C8VA 3JPWA 3LO8A 3Q3CA 1B8VA 5A3SA 1FUEA 1L5ZA 2NO4A 2QRGA 5F76A 1JLLB 1US8A 4YP5A 1VLJA 1OYOA 1R8XA 2IY7A 4GU5A 4XJVA 1O95D 1EAYA 3U56A 2GXAA 2EGUA 3DAHA 1P8JA 3LY9A 3ZI0A 2WILA 2BMWA 4PQRA 2XMSA 3GT4A 4FUTA 4JJFA 5LQRA 1QIFA 1EXMA 1DQRA 5CB8A 1JHQA 1YD7A 3P45A 5AVKA 3WNBA 1I0LA 4C0HA 4HTFA 3NHKA 5DBFA 1W5EA 2REQA 4RD6A 3RTDA 4UM9B 1OILA 1XZNA 1I7DA 4WEOA 3SHOA 4GGMX 1IHXA 1VG1A 4G56A 1A1SA 5IMSA 1K0FA 3QE2A 3R5HA 3OC6A 2KBEA 1NTOA 3SY8A 3AHDA 2X1MA 3C5VA 4CLHA 2WWTA 1DS6A 2AI1A 9MHTA 1ST3A 2COKA 4E6EA 3WQBA 1FP2A 1IIBA 2QV0A 3SEAA 2R48A 4KI7A 3WKBA 3VGPA 1C8BA 1I6LA 1RCTE 4O2BA 3WLTA 1VL5A 3ZKAA 1GL9B 2DLNA 5BSVA 2ZDQA 1SCUB 4M1MA 2AEEA 4M55A 2G9UA 4LHEA 4LVCA 1OWOA 2E6KA 3TUJC 1Z7WA 3JR3A 1ZO8A 3GC6A 5E7JA 1JQKA 4Z4GA 1TC2A 1E1YA 3L1KA 1PK8A 3WV4A 1E3SA 1K5HA 3KOZA 3IP9A 1E6UA 3Q5GA 3AVWA 5A7HA 4QQNA 3WA6A 2QLNA 1PGNA 4YJDA 3OX2A 1YR2A 1D4ZA 1TIBA 1J39A 2ZP1A 3A4LA 3GMIA 3AW8A 1WU8A 2ZXEA 3SQXA 1YQWA 1EUYA 4DT1A 2HLPA 3D3KA 3TBKA 1T6ZA 5TDHA 4KV9A 2IYPA 1ID1A 2Z6VA 1T3SA 4LJ9A 2O07A 1H2FA 3GDWA 3HKCB 1OFTA 3D6NB 2SKCA 2EBFX 2F3TA 4EHKA 2P2LA 4EYQA 3HZZA 4QNMA 4EI2A 1CZOA 2A0UA 5CT4A 1RBQA 2Q3FA 2Z2IA 3ICWA 3LLCA 4J2TA 4MRAA 3SGLA 2BZGA 1XCPA 2JGMA 3LF1A 4BO6A 1QFZA 5CB4B 5CLGA 1LPPA 2PWPA 2WG0A 4Q6BA 4G0OA 1L8QA 3AB3A 3GN1A 1HMYA 3V8QA 4EY6A 4IGKA 4OAQA 2IX3A 1TFUA 5CD1A 1QX3A 4NOJA 4JJ7A 1L3CA 2W00A 3WXBA 3UKOA 1YA4A 3QKIA 4YRTA 4WKBA 3QRWA 3H5WA 1YQGA 1KAMA 4JR1A 2AJ8A 4QOSA 3FA2A 2QG6A 3V4SA 1GGNA 3I9OA 4ABTA 5HQ3A 4MGYR 4XM2A 1QH9A 2J3LA