3DVSX

Proteinase k by lb nanotmplate method after the second step of high dose on esrf id14-2 beamline
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Radiation damage in protein structural characterization by Synchrotron Radiation: State of the art and Nanotechnology-based perspective
rcsb
molecule tags Hydrolase
total genus 99
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2008-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3dvsX00
1YJAA 4WOBA 3QTLA 3BPSA 3LPDA 3DE2X 1YU6A 1Y4DE 1XF1A 1TMGE 1HT3A 1ST2A 1PEKE 1NDQA 1AVTA 4DWWA 2TECE 1Y3FE 2PRKA 3UNXA 1Y48E 3D43A 2ZWPA 1P7VA 2SNIE 1Y3DE 1NDUA 5ARDA 1SCDA 2Z58A 2WUVA 1IC6A 2ID4A 1OYVA 2V8BA 1TM5E 1YJCA 2PWAA 1TK2A 2WUWE 3DE0X 3WIUA 1TM1E 2XTJA 4Z2AA 1SBIA 1CSEE 4KG7A 1C9JA 1BFUA 4C3UA 1S2NA 4CG0A 4HVLA 5FBZA 3AFGA 3L1KA 4OMDA 1WSDA 3WIVA 1AV7A 1C3LA 1A2QA 5CW1A 2Z2ZA 1GA1A 1SH7A 1Q5PA 1NLUA 3PRKE 2HD4A 1T1IA 1KE1A 4NMXB 1GCIA 1R64A 4K8RB 1SBNE 2QTWB 5JMOA 3QFHA 3SQOA 1SUEA 3ZXYA 1GTL1 1BJRE 2W2QA 1TM3E 1SPBS 1WVMA 1Y1KE 3VV2A 1SBCA 1VSBA 1EA7A 1THMA 1DBIA 1ZVJA 2W2OA 1MEEA 3DW3X 3DYBA 4NE7A 1V5IA 3CNQS 1TM7E 3BX1A 2WV7A 1GT91 1SCBA 2SECE 2Z30A 3DWEX 1SELA 1KE2A 2PWBA 3PTLA 2PMWB 1SVNA 4H6VA 1PTKA 1C9MA 1YJBA 1BH6A 4AKSA 4RYDA 1EGQA 2GKOA 3GT4A 2DP4E 1PFGA 4DZTA 2WWTA 2XRMA 1Y33E 4OMCA 1GNVA 1Y4AE 3I2YX 4NE9A 3DVSX 3I34X 4J94A 2W2MA 4YN3A 4CFYA 2Z57A 1TO1E 5AVKA 4M1ZA 4HX2A 4BWGA 2P4EA 2W2NA 3ZXXA 3DE5X 3TI9A 3LXUX 3DVQX 4CFZA 1AF4A 1OT5A 3WHIA 2G4VA 3SICE 2E1PA 1SBHA 1BE8A 3VTAA 3VSBA 2SBTA 5JXJA 2PYZA 3H42B 5FFNA 5I9SA 1SCAA 2IXTA 1LW6E 2DUJA 4H6XA 2W2PA 4DJ5X 3I30X 1TO2E 4LVOA 3F7OA 5JXGA 4GI3A 1BE6A 5JXHA 3EIFA 3T41A 5B1EA 2PQ2A 3GT3A 1BFKA 1SBTA 1UBNA 4WOCA 1R6VA 5AVJA 1AH2A 1GNSA 1DUIA 3TI7A 1WMEA 3AJ8A 3LPCA 5AQEA 2ST1A 1AK9A 3DE1X 1WMFA 3Q40A 1SIUA 1KDZA 3QMPA 1WMDA 3HJRA 3DE4X 5K7SA 2ID8A 3TECE 4FONA 4KPGA 1JEAA 1ZVKA 4MZDA 3EE6A 4ZOQI 5B1DA 1V6CA 2Z2XA 1OYOA 1KDVA 2Z2YA 1AU9A 3WQBA 5AMXA 2SICE 4AKTA 1T1EA 3GCWA 5JXIA 3EDYA 1GA4A 1GTJ1 1Y3CE 1Y34E 1P8JA 1GA6A 1SUBA 4LVNA 3DE3X 1SIBE 1P7WA 1Y3BE 4H6WA 5ARCA 1SCJA 1C9NA 2ZRQA 3F7MA 3VV3A 1KDYA 1MPTA 3F49S 3D9QX 1GTG1 4JP8A 5FAXA 1S02A 1SUCA 3LPAA 1TECE 3BGOS 1T1GA 2PKCA 1ST3A 3CO0S 1SIOA 3Q5GA 2Z56A 3VYVA 2ZWOA 2B6NA 2DQKA 4I0WB 3A3NA 5ARBA 2X8JA 2X8JB 1AQNA 3DDZX 3I37X 1R0RE 4C3VA 3DW1X 4OV6B 1SCNE 2IY9A 2HPZA 3AJ9A 1PJ8A 4KB5A 1SN7A 1TM4E 1CNMA 1SUAA 4B5LA 1SUDA 3DVRX 5SICE 1IAVA 3P5BA 3DE7X 3VHQA 3A3PA 1Y9ZA 3A3OA 4ZARA 1SUPA 3DE6X 3OSZA 3GCXA 1S01A
chains in the Genus database with same CATH superfamily
1NVWQ 4TYYA 1G5PA 4NH4A 1JNXX 4PYOA 1VB3A 3KQHA 2VFAA 3RUDA 4H77A 4KVAA 1B2LA 3LOQA 3H9JA 4GX0A 1RQ2A 1GPDG 4H15A 1G20B 1VE5A 2AZMA 4DSNA 5KPDA 4NECA 5TQ0B 4NMLA 2ON6A 1KF0A 3E2IA 1UFVA 1HQKA 1LJUA 3OZUA 2V7QD 2XYHA 5B64A 1P6UA 1CUAA 1DJPA 2O20A 2OAEA 2QPAA 2I3BA 4OG2A 2H1OA 1ODLA 1TF2A 2C5BA 2DHCA 2C4WA 3AR8A 4PZAA 4XPZA 5E9JA 5EJ6A 2NQ2C 4LWZA 2GARA 4RIGA 1U98A 5BRNA 4BY9E 1QGDA 3SXPA 3CXUA 3HCPA 4EKGA 4E88A 3O7WA 4ZD6A 3AHCA 1YI1A 2MOKA 1NXXA 2X0NA 3EIHA 5EIEA 3EW7A 1Y3FE 2PSFA 2SKDA 4E4TA 1YTUA 3DTVB 3SPXA 2B1GA 2D5AA 3IJEB 2P3LA 3HCFA 3V3KA 4J0EA 4J1TA 5JEDA 1YS1X 2R66A 3CR3C 3H9BA 1K92A 1FSPA 2RHJA 4W8GA 4B84A 1PUXA 3ZUGA 4FLEA 1I30A 2OZPA 2PBFA 1SC9A 1H3EA 2OCIA 2VN8A 1UPBA 2WFAA 1W94A 3CIOA 3EIXA 2GKSA 13PKA 3EXHA 4PGHA 5JQGF 4TL7A 1OI4A 4JITA 2WSBA 1N25A 2ZYVX 2CFSA 3F5MA 4HX9A 2W2TA 4ABYA 1JEYB 2ZI3A 1HSZA 3ZDBA 4OBEA 3DEYX 2NO1A 2LCIA 2ZCVA 1J90A 3QU7A 1K88A 1KZ9A 2QG6A 1Z4JA 2XQFA 3D3NA 3GUUA 2QP4A 4G0XA 2I6XA 4BFTA 1G5FA 3AG6A 4YXFA 3N87A 3A6JA 1HOTA 4UVGA 1FJ2A 5LYJA 1UC8A 2G1AA 2P2YA 1IPHA 3ZDYB 4XKJA 5I8PA 4GOND 1LC0A 2I3ZA 2YXLA 3MAGA 1VMIA 3S81A 2WAAA 3WRXA 3I64A 4JP5A 4F4IA 1G5TA 3W9UA 3T5DA 2BF4A 4BX0A 3IQFA 1OGIA 2R5FA 3FRJA 1KEKA 1SBIA 4PYNA 1NBWB 1S7GA 3E7WA 4RVCA 4F2WA 1V41E 3FUVA 1B0UA 4HH4A 2W98A 3NDBB 5C5IA 1PWZA 4YMLA 4EL5A 1WOYA 4BNGA 4D79A 5BQ5A 4PSKA 3WFZA 4QUJA 1D4OA 2IYSA 3P8ZA 1S2NA 2QLTA 4ZEXA 3ZW7A 1NC3A 4IOKA 4W1QA 3DV9A 4XM0A 2V6JA 5BW5A 1CQJA 1QYIA 4WLUA 3UY4A 1ZUHA 1II9A 1J4AA 1TAGA 2Q1SA 1YZKA 2TRSB 1ISGA 4GG1A 3S27A 4M53A 1PKEA 5FUQA 4WMLA 2H7XA 1C3VA 1DKNA 5K51A 1DO2A 3PQ8A 1ZN8A 4I99A 4P08A 2ZIWB 2AE1A 2E3JA 3A3YA 4RPHA 4Y0VA 2GEUA 4O08A 1H85A 4GMKA 3BYZA 4QYIB 3STWA 4DAEA 2IH2A 1WEKA 4O4HA 4URXR 1N9GB 1M2KA 2I1WA 1A3CA 1ISSA 2I80A 3E7DA 1JU3A 5GAJA 2ZDHA 2XMCA 3ZY3A 4BFWA 3G5MA 2QP3A 4Y2YA 1NBEA 5DXFA 5AKYA 4JI0B 4QE3A 3SVLA 1K3FA 2VDWB 1YB1A 4M89A 2ESRA 3CTMA 4MH0R 1Q1ZA 2HUNA 5KSYA 4KQIA 1C80A 1DT5A 1NYLA 2CYAA 4UBKA 3SQOA 2CNWD 4IX9A 2IE8A 2OGUA 1KJIA 3B82A 1CRWG 4Y2TA 3IOEA 3HN7A 1FQWA 1INLA 3T3DA 1LBQA 1V3QE 2W6ZA 2JCYA 5AK6A 1AT1A 1KQOA 1B8PA 1P1FA 3RRMA 4Z7QB 1KJQA 1NVFA 2HCJB 4Q3CA 5BPHA 3DQZA 3BJEA 5GM1A 1XVUA 3G8AA 5F7XA 3QKWA 1PHPA 4QDKA 2B34A 2I7DA 1VCNA 1SBCA 1Y8QA 5DCWA 1ICIA 3TR5A 3K53A 2H2HA 1D4ZA 3OU7A 1WSBA 2NZUG 3A4MA 1D9XA 3E9YA 4DMKA 4LYYA 4MWCA 3N05A 2QVLA 2RHOA 1V4BA 2B0CA 2ZIGA 5J5VA 3ROKA 1MOSA 3EC1A 4H31A 5IF3A 3IKJA 2FZLA 1GLNA 3BDAA 5B4TA 2HB6A 2O2JA 4FZ3A 3WHKA 4W6ZA 3WYBA 4DUPA 3ESZA 5HDBB 4EJSB 9GPBA 5J4HA 4YJKA 1OLUB 3M2TA 4X8HA 3E61A 5I7OA 4Z3KA 1KO4A 4BVLA 1SCBA 4JN6B 4US2R 1D1TA 3FDZA 2PUCA 1FXWF 1YJ5A 1YZYA 2CMKA 4NBKA 3DWEX 5L4NA 4JBYA 1RI5A 5C8YA 1V7CA 3Q5DA 3PLRA 1U11A 2D5LA 2X23A 1MJGA 3DAPA 4KO4S 5FO0A 3NBYC 5JZOA 1SVWA 5K45A 2IQ5A 4UUQA 3LT2A 1OFUX 3A9TA 4KLNA 1Z8FA 2YY6A 1R27A 1HTBA 1JPNA 4N7BA 4YONB 1UQTA 4A5SA 2OORC 3HYTA 4QPJC 1W0CA 1A27A 3EZ6A 4LK2A 2NIPA 2P6MA 5JSHA 4IMRA 5FTWA 2QM0A 5D1HA 5EHZA 1MZPA 4U7FA 3JVEA 3RIHA 4WHMA 3U4QA 4KACA 3ONNA 2ZS7A 2FETA 2Y6UA 4ZYYA 3PFFA 5FJJA 4J6EA 5JMTA 2RK6A 1X94A 3EAGA 2B92A 1ZKDA 2OC9A 3CU5A 4WGGA 3BXGA 1TIKA 2IDZA 3FMFA 3SJBA 3TD2A 3OKPA 4OQDA 3SDBA 1OX4B 2NQTA 4KXNA 1CF4A 1P9OA 2VCYA 3R76A 4PM4A 4MWOA 1GYRA 1BYUA 1E77A 1VHJA 2AUMA 1L8AA 1GQFA 1NYQA 2JIBA 3HVHA 5TF0A 1MJGM 5HFAA 1FC0A 3W5SA 3H8WA 2IVZA 1I51A 2COKA 1IEWA 1LPOA 1GPLA 3LWDA 5AXCA 2CMHA 3T0IA 1ZEMA 4YH1A 1DV1A 3HCBA 3HHPA 4OHFA 5IEJA 1U63A 1Q74A 5BSWA 4HYYA 3RU7A 1XAHA 1YZHA 3I1FA 2D2IA 3KG2A 1YRWA 3DBRA 4D45A 4F45A 2QMYA 2O8FA 3W34A 3R5KA 1NMQA 2H4YA 1DO0A 5BWNA 4UTNA 2FX2A 4HGZA 1V1MA 3MTQA 3ZXUB 1FMCA 2VKTA 4C7OA 4RCZA 3DVQX 1O94C 1R9JA 1F0PA 1ZD1A 4XB2A 2J3LA 2G4VA 1EH5A 4G5HA 4IFEA 4UEQA 4BE9A 1E7QA 3MCAA 4YP7A 2XYGA 2JFOA 2CB9A 2I67A 3G5AA 4KDFA 3M1AA 3VO8A 1B6TA 3NJ8A 4NZYA 1P1IA 2C7OA 4AKGA 4LRWA 1XDBA 2HREA 3RRJA 1LDYA 3L8MA 4NZMA 5IC5A 3VSBA 3ABZA 5A4IS 3AZOA 4PV7A 4US1R 4V0RA 1AXEA 2SBTA 3K9HA 3MQ4A 4KEAA 2G36A 2I34A 2ZANA 2OM2A 4J1SA 3MWJA 3H42B 2HCTA 5FFNA 1YZTA 2MJLA 4JJ4A 5TPWB 1F6BA 5C0OE 4EY6A 4X3PA 1VMAA 1M1YB 1YWGO 2VUTA 3E7XA 3ECAA 3JRNA 4IYRA 4LEIA 1RMQA 3DLCA 1PYDA 5JBQA 2R8PA 3LKVA 2FF7A 4J07A 1VECA 4NYMQ 3X2SA 4O4HF 4MS4A 2DQSA 3MWDB 2H0RA 3NEAA 4XX0B 4F4UA 2XVAA 4LJRA 4RPGA 5C1BA 3F4LA 3WWOA 2R0QC 4TRJA 2JLAA 3GFGA 2FY8A 2DSNA 2VEOA 3MA0A 4IXDA 2QWXA 1UBLS 5TRTA 4L4ZA 3WB9A 1GUBA 4GI3A 4D9FA 3I9KA 1W4AA 4QD3A 3LCJA 4UVEA 5AJYA 1RWXA 4Z5XA 2GPSA 1XJQA 2MYUA 5JC1A 2X3FA 1IOVA 1WY7A 3OZFA 4HQKA 1AMOA 5LQCA 3OIDA 4N8EA 1WM1A 1DDGA 2C98A 2X4IA 3C1AA 2H3HA 4E7PA 4G1BA 4LDAA 4ZVUA 1U9JA 2C5AA 3NYWA 4N82A 3RV4A 3QWBA 4DLYA 5LQRA 4HKTA 1YR7A 1VLMA 1JIKA 4AMBA 3E3NA 4J6FA 5JFGA 2XGJA 3ZHOA 2PYDA 3ETJA 4I1OA 3SVZA 3T95A 3VM6A 1O87A 4YPFA 4B6FA 5C4IA 3PU6A 2GN9A 2JFNA 2OKCA 3L1VA 3PG5A 5KJEA 5IZ4A 4IGFA 1NSYA 2UZ4A 1Z38A 2GJ9A 4E7OA 1PRYA 1CK4A 1UDXA 4RA9B 4LF6B 3QU4A 2QTVA 5AOVA 1GTZA 2BGIA 1WOMA 2YXEA 3LT4A 4JR1A 1L4YA 2IW3A 4IRXA 2G1KA 4HVTA 3TO5A 3O94A 2MSNA 1U3GA 2ZQ5A 3LY8A 4ON9A 2OBYA 3G7UA 3TPCA 2J46A 1S0UA 3I39X 3OU6A 4E6EA 3NV7A 3UUGA 4FDUA 4K3UA 4BLVA 4AI6A 4O2BB 3GQVA 1EX6A 3QMPA 3MOGA 5HIMA 1BS2A 1TQ6A 5BOVA 4DYVA 3CSDA 2HU2A 4HN2A 3N6XA 3VI3B 3KAJA 4MMZB 2UZ3A 1T6NA 4ZTUB 2QX8A 4I50B 3OQPA 3IMFA 4BB9A 1I4EB 2HX1A 5EN4A 1G18A 1PZGA 2F9LA 2G25A 1T2EA 2JHAA 2OD9A 4R1QA 4Y2SA 1I2MA 1USKA 4LMPA 4RVUA 3ZWDA 3VZDA 5HQ3A 3KB2A 3K5HA 4MO9A 4Q1AA 4YJHB 4OX9Y 2GD6A 5F3DA 1TRHA 2OAGA 2W6JA 4IDHA 4LHYA 5ESWA 3TOVA 3VX3A 1I6LA 2TMYA 4FILA 3OECA 4EFMA 4DEXA 1RHJA 3CNOA 1RD4A 3GAFA 3CF6R 1USGA 3SU8A 4HP8A 3KQMA 2NZ2A 1UBOS 2JK1A 3NDRA 3NHSA 5CXUA 2JAHA 3L1JA 3TLZA 2QROA 3L40A 3MMSA 3T7DA 1U1FA 1ZZGA 4B80A 2LTAA 2CNBA 2INGX 4NICA 4XFDA 3TUJC 3RVDA 2FLWA 3EHDA 5IC6A 4FWBA 2QRKA 1ISHA 3F73A 3WGNA 5LPNA 3LVFO 2ZTLA 2QSZA 3HWX1 4XH9B 4YFVA 2G28A 2P5SA 3WLJA 1PP4A 2VSNA 5LBIA 5FULA 4CLOA 3I92A 2A0KA 4DHWA 3E5MA 4E07A 4MINA 3FCUB 3DCJA 2Y9PB 5ALZA 5AUQA 1QHSA 1F7VA 2GAFA 2ZTSA 1YBAA 1Z3CA 2X3YA 4U2CA 4HH3C 1KYXA 1PBNA 1VPVA 5KYUB 3MJ4A 4OLHA 4WFIA 5EXSA 4QM7A 3HCWA 2IGBA 4ZOEA 3INNA 3PLNA 4ZK6A 1SIWA 3SEAA 2ZLBA 5C9ZA 4KHPB 5CB6A 1TQ4A 4J91A 5C8VA 2OAQ1 1Y8ZA 3RHZA 4BMSA 1XG5A 4R2XA 4EPTA 3UUFA 3SE7A 3OZCA 4J4BA 3DBHB 2BM8A 2ZRJA 4F38A 4B9EA 2Q21A 4DR5B 1G60A 1N78A 3HB5X 1UR5A 1GTG1 2PRJA 4MR7A 4ND2A 4TLEA 3RM3A 3UMBA 3GLIB 4C76A 3AIKA 3MHTA 2BHSA 2R4QA 1T1GA 1JXAA 3L0BA 3ZG6A 1ST3A 3C0KA 3FWPA 3BD8A 4BFLA 1G3UA 2QX4A 2GFQA 5EXXA 4KJZA 3VSAA 3AESA 4PYKA 5IFLA 4EQ6B 3VYVA 5JFTA 5JSZA 2OM6A 4NU6A 5CJJA 2XHZA 1J8FA 2GPAA 2Q6IA 3CNBA 4GI7A 2ORYA 4BO5A 5CG2A 1PR3A 1TA0A 3EVFA 1UFKA 2A9FA 1VIVA 4C08A 4X94A 5LB4A 4UUPA 3VHRA 4BQPA 1P80A 3AB7A 1TVKB 5KVCA 1Y89A 4L8FA 1R0RE 5K3DA 2FZKA 5KOJA 1L3BA 3CIFA 3SP1A 1G20E 1JBEA 2XDQB 3MVEA 3H1GA 4UU8A 5A4KA 2RAVA 4FCTA 1LSOA 5IULC 4AY2A 4MV5A 2J0QA 2JAOA 4IV5A 3LX5A 4LDQA 4RLQA 1G63A 1XD2A 2I9PA 4LPSA 4C0WA 2VYVD 5AJUA 3PEYA 2H3EA 4ZVVA 3PE6A 2OO5C 1DIBA 4XQEA 2GM4A 1PNRA 4DCNA 4RMHA 1BDIA 2VNJA 3F3KA 5DYWA 4KGXA 3DD5A 4KR9A 4EEKA 2ZULA 2E6UX 3S8YA 3JWEA 3IIMA 4U8HA 4FR2A 2HF9A 4IQFA 3SZ3A 3HCRA 3P5BA 4JJKA 4KKVA 4JV5B 1OFVA 3W6OA 5FNVA 3OC6A 5IYZA 3U6BA 1GV1A 4TS1A 2FSPA 2HV9A 2VF4X 3GMTA 3QPWA 1I4DD 1SUPA 1MF7A 5IJAA 5DULA 2KPOA 5EHXA 3E8XA 3DE6X 3Q7IA 2QTLA 2DKFA 3OSZA 3F1LA 4C2TA 2BKLA 1V2GA 3DT9A 5FBKA 2PMEA 2ZB3A 3GZNA 3H65A 4ZKDA 1Z7GA 1W25A 1T0HB 1LLFA 4MGYR 3RS8A 5KTMA 5GADl 4N12A 3DE2X 5CMLA 1WZCA 2CL6X 4XVQA 1Q1NA 1XF1A 5ICGA 5EIOA 3I9V1 5AH0A 4YHBA 5ALNA 1N3BA 5KNCD 4JI8B 1CUBA 1TMGE 4CU2A 4IUBS 4UHHA 3KJQA 4CM6A 4KK3A 3ZV4A 1P7PA 4EKNB 2BMDA 4ZAVA 2WNSA 2Y0BA 1E3TA 1ZKMA 2WM8A 1E61A 2HA6A 5MGBA 1NDQA 2YTZA 4ZMBA 1U0SY 1U4OA 3IC5A 3QNMA 3VYUB 3FTEA 3RS0A 1EK1A 1QK5A 1FTQA 2IK8A 5BSMA 1JXQA 3LSYA 5HIKA 2R65A 3T1TA 4J3NA 4LNHA 3VKHA 3AR6A 4JUAA 5AWFC 4C78A 5J1SB 3IDZA 6ADHA 2NXJA 2DT5A 3KKPA 5JSQA 4OJMX 2Q4OA 4HDMB 3IYLW 1NULA 1IN6A 1R4MA 3DLHA 3RKSA 3T5AA 1FYEA 2C84A 1RPNA 2VJCA 3K9GA 2H9IA 4I1YA 1QF6A 1ULAA 1DWUA 3FNGA 1H9BA 3K2BA 3COSA 5EY5B 1KRHA 4LUCA 4BFZA 5GP1A 5FAKA 2BV3A 1U2RA 2PUEA 2E85A 5IBRA 4LY0A 1U4NA 1B0PA 5TC4A 4AIRA 1H9AA 4J0KA 1L4KA 1SCDA 4P7BA 2J0SA 3OMLA 1Q0HA 3TS1A 1C3EA 4CQMA 3CUYA 4ZVQA 5IXYA 2GBCA 2XOKA 3OD5A 1IAQA 2E5LB 3O8CA 3NHPA 4RKEA 4C4ZA 3AUFA 3QYAA 1U3TA 2WVGA 1TF5A 3GN2A 1OXVA 821PA 5IDXA 5IMSA 4YGXB 1NG9A 3NT2A 5BUSA 4PBSA 3UJ6A 2WFLA 4C29A 1NFFA 4JJEA 5JH7A 3QUAA 2RHLA 3WNQA 4F5DA 1A4RA 2X14A 1RYBA 2XQVA 4Q1VA 3IUQA 5AKIA 5ERGB 4TMTA 5K0SA 4Q82A 1H1DA 5IDWA 2JLZA 3D5EA 3QLTA 2WWGA 1NXVA 1KOJA 4KW7A 2XD4A 4PNZA 4MYUA 2XJ4A 1J2JA 1FYVA 3E82A 4DDMA 1UPAA 1C8KA 3KU4A 3F6EX 5ALMA 4JI7B 4KJXA 4HZUA 1UEIA 3WSVA 4M49A 1D0IA 3BD6A 2FI1A 4YAFA 4A2CA 4KG7A 2X1VA 2YQ4A 3EB9A 5C3UA 4CNBA 2QSYA 3OFNA 2BFBA 2MYNA 1E2GA 4G1EB 3BHMA 4OHPA 2EFDB 3ZHTA 1XEWX 5TPZA 3CRNA 2CZQA 2K2WA 2VATA 2WU4A 2Q4EA 2Z3VA 4ZVSA 1JS1X 3MFYA 4MQBA 5GV8A 3H7AA 2IA5A 1LTHR 2O3SA 3LP5A 3MTAA 2DPLA 3K94A 1KEWA 3IAEA 1C4WA 1KOLA 4QT4A 4XJXA 2OLJA 5CXSA 3U9LA 1R3DA 5KX5B 4BLQA 5MGNA 2A67A 3MC1A 1U1GA 4ENTA 1IB6A 4RJTA 1EFAA 4KN6A 2PUBA 1GP2A 3CZ4A 3L5OA 2ERXA 3UJDA 4G0UA 5ER6A 1C5KA 4TQUS 2EHDA 4Y2GA 1JIUA 3BGSA 2GN2A 1GQRA 2VAXA 5PGMA 3ZCXA 4EK9A 1QIDA 3HKEB 4EI2A 1NKVA 5K6AC 2JFUA 2A57A 3RAPR 3VPHA 2B1RA 2ZJYA 4CMHA 1LK0A 3REFA 2I8AA 2CFIA 4PHCA 4BLTA 3GXBA 4HZIA 4HSGA 1K5GA 2YFQA 3LL7A 5LB2A 3ZS8A 5BOSA 3I9NA 3DFIA 3KHKA 1U2EA 1SHLA 4HDAA 3GLGA 4GPAA 1QHNA 2FFBA 1M5RA 2FCAA 5BWMA 1E3DA 2JJ8A 2YNMD 2YWHA 3FROA 3GRZA 4QUAA 5F12A 4LRSB 1CB7A 3WLEA 4BGIA 3QUSA 4N0MA 1HE5A 3T3GA 1AKWA 5BQ3A 2XCUA 2OHVA 2D0DA 2A7QA 4U0KA 5DOZA 3DYBA 1CEEA 4LRXA 3JSXA 4NWIA 3EZLA 3QHAA 5JRDS 2QTFA 1PJCA 3GD5A 3M3HA 5A7GA 4K88A 1V5IA 2D1RA 3GFRA 4CIYA 5JE8A 3T7CA 1IK6A 2PUAA 3N8IA 1LJ8A 2L69A 1NJ8A 2JBHA 4H7IA 1I4LD 2B4QA 3P0IA 4IG4A 3RSHA 3DA8A 1OIXA 1XD8A 1JE0A 1U1DA 5EGSA 4XWWA 2I6QA 3MGCA 1BHJA 1QG4A 2H1FA 4JJ7A 4MW2A 3AUSA 4CNQA 1AJEA 3NAQA 3T7EA 1W48A 1C2YA 4H7KA 1XA3A 2X5JO 2PZLA 2O07A 5CLQA 2BUAA 4EHJA 1ZM3A 3NIDB 2HLPA 2VJQA 2IPLA 4KGDA 4OAOA 1KZGB 5LUBA 4D0LB 4RF5A 5BR1A 4OB8A 3P71T 3QBVA 5DHSA 3DMFA 3Q7TA 5AVYA 3AB3A 1TL7C 3JAKB 4MO2A 4KIWA 1HYGA 5KYGA 1EHCA 1ZL2A 3OT1A 2E4YA 4WXPA 5CTAA 2H4JA 1VI6A 1EQUA 1Z36A 3HWSA 1A71A 1ORRA 5DBHX 2X13A 2I4RA 1XNQB 3WIOA 3C8MA 2GXAA 1YBFA 3IO3A 1CXZA 1WV1A 1PGQA 2B82A 2ZYTX 1N6LA 2ATIA 1DAKA 3IPLA 2W6IA 3VPAA 3KTFA 4R5HA 1UKBA 4R7TA 4DIUA 2FJ0A 2ZRFA 1YR9A 2QZSA 4WZAB 3ZLUA 1TU4A 1JAHA 1BA3A 4ACAA 1NXWA 4YRLA 4D9JA 4GQAA 3MT8A 3H19A 3N2NA 3MS7A 3U44A 1M34B 3GRRA 3NLLA 1Z5NA 3LKZA 4UFPA 2KWIA 4I4LA 4DARA 3ZBPA 2FJUA 2HMVA 5ALSA 1HDRA 5G4LA 4DNPA 4UE2A 1YA6A 4OHUA 1HL3A 4D41A 5B6PA 5DNUA 3TKYA 1ATZA 1E79D 1UIMA 2A0UA 4MW9A 4C6SA 5AVQA 4JBWA 5JH7F 5TB5A 3BWYA 3EEOA 3ECCA 4M9RA 3UK1A 2AN5A 1NURA 1F0NA 4Z8XA 4KXLA 4GWGA 1P0CA 5ALXA 1LH0A 3HDYA 2AOWA 4UEJA 1G3IA 1YL5A 1DRKA 2J0VA 2J7PD 3WGLA 4YRMA 4JXJA 1WY5A 2GPBA 2UYYA 3OQMA 3IQDB 3SI7A 2X40A 5JCPA 1Z7BA 5IT0A 4BFVA 4EKYA 4MK4A 1UM9A 2NYAA 3BGDA 2AW5A 1A77A 1FQJA 4J43A 1EUDB 4X91A 3MWLA 2V7UA 5TVGA 2Y1OA 3Q7PA 4MPPA 4RNCA 5EJFA 4F2DA 1TYDE 1Z5VA 5J2UA 2ODAA 1ONSA 1BE8A 3J80A 3QTTA 1DFGA 1A98A 1J07A 1PVVA 5LMCA 2NPIA 4M38A 5AP9A 1Z6XA 3ASUA 3QX7A 4KYIB 1M8JA 2WB4A 3QOWA 2ZUUA 3I1IA 4OBBA 5AJHA 3HKDA 4BO9A 1LA2A 1P9RA 2RH4A 3CVJA 4HWKA 3X43A 3HEAA 5HZGA 3FLEA 1XVVA 1MC1A 5B1HA 4OBXA 2OY0A 2ZXFA 4AY3A 1AKYA 4MGKR 1WMAA 4WCFB 3D31A 3FVTA 5IBCA 1ETHA 1T9HA 5K3FA 1O96B 2YJGA 4P53A 3L7DA 3ZDQA 4MMYB 5GQSA 3UPTA 5HRAA 1RI1A 2EIXA 2FPPA 5LBTA 3TEJA 5KIAA 1N2BA 2I03A 3FGOA 4BVGA 4YMVA 1G6HA 1K9VF 4BRZA 2KE5A 2RD2A 3PL5A 2GB4A 1KBQA 1XMPA 1YS4A 1FDVA 1KOFA 2VDJA 3O4IA 3BHJA 2QS9A 4FFSA 3RODA 3SIWA 4A92A 5ENDA 2WB2A 2PQ2A 3NHUA 3FPAA 3S55A 5AUOB 3NHFA 1AG9A 1J24A 3DMTC 3PIIA 3EYWA 3QXGA 1P1KA 4L8LA 3ELUA 4OMUA 4EW6A 5KTKA 2G70A 1VLVA 5HKKD 2B35A 1YQWA 5AVJA 2QAGC 2ILTA 4UOZA 2G04A 2VHVA 2NT3A 4R3UC 3I53A 1K0UA 1F06A 2NUPA 3A11A 3B7GA 3IVXA 1AOXA 3AEZA 3SHOA 2IXGA 3KKMA 3ZU6A 1MD9A 3P19A 2AS0A 4PLZA 4ZQFA 2YCBA 4E13A 4GPBA 1H4VB 4QLOA 1QFZA 4F2PA 2I9KA 3TQSA 2WFMA 3GB9A 2AOUB 3WG9A 2WKQA 3H9EO 5EERA 1B3BA 3NYIA 2BGKA 2QZZA 3GVCA 5E0KB 4GLOA 5C53B 4D4HA 1UKEA 1N3YA 3FJYA 5LP6C 2YJTD 4D4KA 4XIFA 4Q02A 2PXXA 5ALHA 4DRXA 5A4FS 3QXSA 1JJFA 1JLRA 2Z5VA 3PBKA 2FSIA 3UA3A 1B00A 2CXNA 1HE3A 2VH2A 4YXWD 2H7CA 4KU4A 3VGPA 4ZOLB 3KZKA 1X7YB 3U3JA 4Z4FA 3R1IA 3I09A 3RVKA 2WE7A 4IQGA 2AK3A 3WGZA 2BFAA 3ELBA 4FSHA 2R2AA 1T36A 3KWJA 1QKJA 2AOTB 3DXFA 3IAAA 2QTZA 2FOXA 1OFUA 1U3DA 3I6IA 4BAZA 3H1AA 4L28A 3HBLA 1LFDB 4B43A 3MIIA 2ZAOA 3A4IA 1NASA 2QUJA 5BN1A 2C5EA 1FP6A 2AFIE 3K1YA 1R4NB 4NRDA 2GEBA 4LQLA 3I42A 1JDUA 5KAMA 4YCJA 3IQHX 5EFZA 3AL3A 1E18A 1OJ7A 4PX5A 3ZGYA 4W7IA 5IDVA 2C8KA 4MLCA 3WIDA 1HE4A 3HDQA 1ULUA 4G4SP 2WF8A 4OD0A 4TYQA 2QPLA 5BT9A 1P1HA 2AB0A 4RETA 4YRGA 2F3PA 4YRCA 3V9AA 1YCHA 5JDCC 2BMFA 2OHOA 1ZRSA 3UXHA 4ER5A 5C3MA 4QEKA 3OKCA 5DN6A 2JJ2A 3T38A 2VPXA 4Y2JA 4C9BA 1R0BA 3U7RA 3OQOA 4FBLA 3IOBA 2OOKA 4B3JA 1NLMA 4EF4A 3TMYA 1FRZA 3W8DA 2H5IA 3W78A 4NCNA 4WKPA 1V3TA 4LVUA 3BBPA 4CT0A 5EG5A 3IQGX 1UODA 1KBZA 4K6MA 5AI0A 2P4UA 1JALA 1LQUA 1PEAA 2OUIA 2FUKA 3HWRA 5L6LB 5IVHA 3MMNA 3P0EA 1Y34E 2HMWA 4RY8A 4WNAB 4QEDA 4BKOA 3ZOZA 1VL6A 2FDXA 9LDBA 5ILOA 1SO8A 4KLRA 3K70C 1UJMA 2TSYB 4WRRA 5HJ5A 2FMHA 4FHEA 1S9DA 3DOFA 4TRMA 1YU9A 3ED5A 1FRVA 1NUAA 2IY7A 4BFCA 4YJGB 3V8VA 4AZWA 4UAVA 5CLHA 1ZGAA 4BE4A 4GYKA 3SQWA 5FWXB 7REQB 1N2CA 5FI0B 4JU8A 2ZJOA 4MEAA 1Q7EA 1SCUA 2VA8A 4GH5A 4C0SA 3GOQA 3ZHVA 5B58T 1FFEA 1OZFA 1GSOA 4HMQA 2I6TA 1PX2A 4M1OA 4NZ9A 1E7RA 2Y93A 4J90A 2Z8XA 1T24A 3T54A 1UOQA 2RC5A 4FCWA 5J2UF 2JZNA 4ZAGA 1MPTA 3HS3A 3PNSA 1FDOA 5DDIP 2IY8A 3KS9A 2P6NA 2A33A 2FAXA 2EF0A 3GA0A 3A6DA 3OD1A 1SXIA 4MUFA 1SXJB 1YB2A 1IM8A 3EY4A 1T2CA 1IRIA 3NWJA 4IJWA 2GYVA 4K0RA 3RLFA 2MSDB 4X20B 2HQRA 4HUJA 5H4HA 5SV2A 1F4PA 4PRZA 4PZ9A 4L72A 5TX7A 5CTJA 4DCOA 3L4KA 3K2EA 2QTNA 4Y9DA 1K06A 5EA2A 3FUXA 2CCJA 4KE6A 3Q5GA 1B26A 2YHBA 3KUKA 4LOKA 1EESA 1PDOA 2Z56A 5HM6A 2PY6A 2YIJA 3U26A 4D8UA 4ZYVA 3L4BA 2Y4OA 1IHYA 4MUYA 4YMSA 4FK8A 4O8ZA 3NZEA 3PPIA 1QF7A 2FQXA 5BN3B 1LKZA 1I3OA 4IJ5A 3H4MA 4XAQA 3VRHA 4G5XA 3P94A 1WKBA 3HJBA 1M72A 1DMRA 1Y6RA 1H6BA 2POQX 4AWAA 1AHNA 1ODKA 2CHUA 3K20A 4HOYA 3K15A 4Q9DA 1NNEA 4A8PA 3MHPA 3OWHA 3O8RA 1XK6A 1L8XA 1P60A 1TC2A 2CGEA 2QV7A 2VYQA 4BO0A 1QGUA 4GRAA 5B55A 1E94E 5HRCA 5DLYA 4WFJA 2V7PA 4MS3B 3PNMA 3MGGA 4R7ZA 5DX1A 5BVGB 1XHEA 3O7MA 3UMYA 1MAUA 1MDFA 1P18A 2FXVA 4HGNA 4S05A 1O9BA 2BP7A 1LDGA 2POCA 4PZCA 1HT1E 1ETUA 4HTFA 1YDGA 3JPWA 3WLPA 3EA5A 1Z39A 4N54A 2KQUA 1G21A 4I6JA 1NVMB 2XNDA 4L5BA 4CPDA 2XNKA 2Q0HA 4X7RA 1KFEB 3SLGA 3V1NA 3FLAA 1VKNA 2V3VA 3CR8A 3LC7O 4LOIA 4NH0A 5A7HA 2OG2A 2XUHA 3PTZA 1BOFA 1X8XA 1LV7A 3DVRX 3BREA 2JFZA 3DBLB 3N58A 3PICA 3TVYA 1COWA 2H2WA 1LBIA 3EQ6A 1KOGA 3VHQA 3DWGA 4LOAA 2A0XA 2A0WA 4KQGA 3RFCA 3C14C 3BSWA 3A58B 4NV3A 4DKJA 1ILEA 4LZLA 2IQIA 2VQ6A 1P33A 1WSWA 1SR8A 3WICA 2D1FA 2JD2A 2WABA 1HG0A 2NSYA 4IKPA 4BYMA 2Q99A 1A50B 4DSOA 3U56A 4ETMA 3QE9Y 2YVLA 2DHQA 5K8VA 2ZJ8A 1P4SA 4RJLA 1IN1A 2ZJ2A 3CLTD 2PEZA 1XA4A 3R6TA 1YR2A 3KVNA 3GFQA 5LA6B 5EZ5A 2NTYC 3IAUA 2IUUA 2NUAB 3VDNB 2QTAA 3LX8A 3VU9A 4GDFA 2PUFA 2A1TS 3WTBA 2G08A 3PVCA 3NTVA 4UNIA 5DTMA 2VDMB 2JIQA 4NF2A 5JR3A 1UPXA 2PMBA 3H3XA 4TL9A 4BNZA 4EG8A 2WQ6A 3NPAA 2BLLA 3UAOA 1E60A 1W34A 4ARZB 2VZ8A 1J8DA 4IIFA 4RSRA 3H3JA 1ZR2A 1TAUA 2IF2A 4M0KA 3L7JA 3OUTA 3C45A 4PCVA 2PL3A 1YC5A 3UICA 3UJ3X 2BUCA 2C9YA 2DYKA 2QRLA 3RLIA 3VHXB 1FRNA 4C5AA 4BXOA 1GUAA 3D7MA 4AUMA 4DWWA 1YBVA 4DIDA 1RQRA 2FMKA 4OH7A 1Z4PX 3OIVA 3QUTA 4WN9A 5AHXA 3MCTA 2C07A 2G3YA 5LQAA 2PT9A 3MQ2A 5HOEA 2QR3A 4QVIA 5AI5A 5JNSA 2Q8PA 3MN1A 2JCSA 2ZDQA 2NVUB 4XASA 4BJ5A 2PXCA 2UZAA 2ZIEA 4LZJA 4HYTA 1KVRA 1RKQA 4KN8A 1Q83A 4S35A 4BX8A 4DA0A 1I10A 1OAOC 3UHAA 2ZT8A 1T4CA 3IBFA 2AEMA 2ZKIA 5E7IA 3RS4A 1QCZA 5CRIA 5EP1A 3VKWA 1QJCA 4XOUA 2CJXA 2WV9A 1SVUA 2CE7A 1A8UA 1VIDA 5J4VA 2HC9A 2WUVA 1OSNA 4CCYB 3DGFC 2PZFA 2OYRA 2XBMA 2OXRA 2P1ZA 2IUSA 2OV3A 1JIJA 2ZTMA 1G5RA 3B6KA 4ZMSA 4JQSA 5BYKA 2YN0A 5C35A 4G0PA 4RTPA 4XGKA 1XAIA 1XU7A 2H8KA 4QUBA 3ZX4A 3AY3A 1F2DA 4ASUD 1G7RA 2O3TA 4ALJA 3U4GA 5I7VA 1JJIA 2YHUA 1C7EA 4ISCA 2OZLB 1ZCAA 4ZV7A 2PVPA 1D04A 2E82A 4O1HA 3QSGA 3C3WA 4UBLA 3NBFA 1RRFA 3FVVA 2E37A 1CTQA 3GG2A 4TKVA 4PN3A 1ODFA 1EQ2A 3SJCA 2VP0A 3AF1A 3S1LA 2ODNA 1JHQA 1ZONA 4OGLA 3GC6A 2QE7A 2VWHA 1M1XB 1IB0A 3EIOA 1TAHA 1FLVA 3OA0A 1ZITA 4K9MA 2H7YA 1QO0D 1D0SA 3AETB 4KI0A 2IGTA 5TF4A 3VVCA 4EMTA 4UARA 5CEJA 3ZCVA 4OA8A 3VPGA 5F9HA 5LZ7A 5BUZA 2GEFA 2FQQA 4DLZA 2AD5A 2OHHA 2VXCA 3KD3A 3ZZUA 1O5TA 2BFNA 1HY3A 2GPNA 3M7IA 2C3YA 1JDBB 1U02A 2G8NA 2VP6A 3R0VA 4EMBA 5LD2C 1NAIA 2FLKA 2BR3A 4AO8A 5KAPA 1H2XA 1NT4A 1W0JA 4W7HA 1EK5A 3ZQ6A 1VPTA 1ANKA 1KIMA 3CUTA 4JBXA 1U2TA 3U49A 5J23A 4RJIA 1HNNA 2LVBA 4V1CA 1KVSA 3W2HA 2AEFA 2AVNA 2FRDC 3RVLA 2CUNA 2O2SA 5KNLA 421PA 1GA1A 2IZ0A 4GZ6A 4PRKA 3VAZA 1Q50A 1Y7LA 5CT9A 4DWOA 3TLEA 3ZXIA 1GDDA 4PTYA 1EXDA 4F2GA 2AR0A 1AZLA 5I01A 2CF5A 2XDAA 3JYNA 4WNIA 4HT3B 4I1VA 3A1VA 3IDSA 1JDJA 1YF3A 4MJXA 1A8SA 5HR5A 1SUEA 4KTTE 3ZXYA 5J58A 5ALTA 3R3ZA 2RMKA 2HHJA 2WZDA 3VTKA 5IASA 2CJWB 3D0QA 4HXYA 4Y1GA 1XXHB 3A06A 4S24A 1GPBA 1ZI9A 2JAXA 4URFA 3KEFA 4Q66C 1I7LA 2GN0A 2ZI7A 4RPIA 3BQNB 3E4CA 3TTTA 4B4OA 4CUJA 2HQSA 4P80A 3GYGA 4LPKA 5B3JA 4D1YA 3DPUA 2F1RA 1X3SA 5JQWA 4R40A 5KKAA 1YACA 1QHHA 4MV7A 3VR2A 1DBIA 4HR7A 1ZVJA 2VWPA 2WKRA 3QPCA 1NSTA 1ZGZA 3O1HB 3DKRA 5AXBA 2QXYA 3SBXA 2R6CA 3DW3X 1Z4MA 2E6KA 3K6RA 1V16A 3NT5A 4DCPA 2QUBA 4Z7OB 2PSEA 1G8PA 3ECSA 3EFEA 5EIFA 1DXYA 3UXYA 4B3TB 4G0QA 2AL7A 2BFPA 4I9NA 5AOCA 3RRFA 4C6TB 3CVUA 1C4KA 5BT8A 2JHPA 2PS3A 2WAXA 1JN0A 5EESA 3UMVA 5KWJA 4GVLA 1GTRA 2REQB 4DLSA 1CCWA 3QEMB 4LDJA 3KWMA 1ZC4A 1XU4A 4OUDB 3FHLA 4KQFA 1JHMA 1XKTA 3ABQB 3GUHA 3KPWA 4ZVLA 3S2UA 1KWGA 3IEPA 1RFLA 2EZ8A 1SVNA 1PQ4A 3C3XA 3V3TA 3ETDA 4XFJA 3GRUA 4PR3A 3Q2IA 1JIVA 1LLCA 4P35A 2JFGA 4CHGA 1LK5A 4GOMD 1ECGA 1JLLB 1TE2A 4RGQA 4DTIA 1QAOA 2H1WA 3JU3A 4LJSA 1KNQA 2FMUA 2Z1DA 1M1UA 3A2NA 3R0JA 3DOUA 1AC5A 3NH9A 4MYHA 4UDYX 4P4SA 1ODTC 3M5WA 1C1HA 3DG9A 2BMWA 4M9UA 4UOQA 2R8EA 4YUXA 4J29A 2FWRA 2OD7A 3RPEA 2Q3JA 1JR4A 2P4SA 2P62A 3L5KA 3LS2A 2VAPA 1ZI8A 2IIVA 4A0QA 1EG7A 4G09A 5FQNA 4ZDJA 3PHJA 3VBCA 1Y80A 2NOAA 1F1BA 1HDXA 4L4XA 1GTMA 4NIMA 2VT2A 5KC8A 3E05A 1ENYA 4RQTA 1N6RA 3R3UA 3CLHA 2EYUA 4RBNA 3OA2A 5F7JA 4XXHA 3UAGA 3TJRA 3QKUA 2HDHA 4YJ3A 1SD5A 1LW7A 5GJCA 2BDUA 2R8XA 3JVDA 1J09A 3OE4A 3HO6A 4HGRA 1QV9A 4NZZA 1TZBA 1XVAA 2X5NA 2O0MA 3VOBA 4MUBA 5KOHB 2DQZA 4QNMA 2QUHA 3I34X 2CLKB 4JX9A 1DEOA 2BEUB 4J94A 4M0MA 2B8NA 3FWKA 4Q7JB 2IYVA 2ZIXB 1TPYA 3IERA 2NVOA 4IO0A 4DJDC 2O19A 2E87A 3LVQE 1BCRB 1TJNA 4M1ZA 1TNDA 2IBTA 1L8QA 4ZI7B 3O8QB 2J9YB 2GZMA 4ZQGA 1ZN7A 3PXDA 4CR7A 1JMVA 2R3SA 4ZDKA 3DR5A 4E3WA 2DECA 1CERA 1MX3A 4ARBA 4LC1A 1Z56C 5JVDB 1FYDA 1JE1A 1VE3A 1WVIA 4JKYA 1EBUA 4J2TA 4LY6A 5B7PA 2DRIA 1UWVA 1G0NA 5CLFA 3HSYA 3U61B 2NYUA 2QLLA 1GOTA 3PUKA 5LQNA 4JFRA 1N0HA 4HDKA 2HYIC 1A7UA 1JTEA 3FMIA 4Q48A 5DLPA 3CZQA 1Z6YA 4S1WA 3ROZA 1TQ8A 3EZ2A 4LHZA 5CPBA 4NCXA 1YHYA 5FEMA 5J4KA 1FJGB 3FHTA 1Q0LA 4KRXA 4CEIA 5F1YA 3MUEA 3LK6A 2H1SA 4OF4A 1OWOA 1U2DC 3VNSA 5E6SB 1KXJA 3SSMA 2DFKB 1HKUA 1BQEA 3HBJA 4Z9YA 2QU8A 1L4FA 1OH8A 4XB6B 1VDZA 1GKLA 3B9RA 4BQIA 1EVKA 5C52B 2CDAA 2ZR9A 4NEHB 4WCDA 2XYRA 4E0BA 2AZTA 1U0OC 5I6DA 2CUZA 1OZHA 4QDOA 3MYYA 1KQFA 2Q8NA 1DWOA 4XQGA 4AG5A 4QWMA 2HWXA 2WOJA 2F1OA 3THWB 1C0EA 2G0AA 5CLJA 5JSFA 3H11B 4PONA 4HPJB 5IU6A 3NX4A 2WHEA 3U0VA 1XMIA 4WDQA 4NBSA 4E5YA 2O5EA 2WVAA 4YDSA 1ZJZA 1Z07A 5JXGA 1EB8A 1QJ4A 4KR7A 4TWBA 3DLPX 1Y1LA 4JZYA 4EDFA 3GT3A 4LJYA 2ECPA 4P31A 5GTDA 1X77A 1Y6JA 5AW3A 4IVNA 1BFKA 3DOEA 2VA9A 4KFUA 3RYHA 4W82A 1LI4A 1Y1TA 5AI9A 5DX0A 1GG2A 2YWBA 3QH4A 4MSUA 4ZO9A 1KA9H 3B78A 4BLOA 1DAPA 3WFIA 2E4WA 1DKPA 1WMEA 2O4UX 1K4MA 2WI8A 2YL2A 1Q21A 1WRBA 1XZ8A 4HN4B 4K05A 1T3LA 4JJ6A 2X0DA 4EPVA 5KJ1A 4KQ1A 2X0KA 1QZTA 1A7KA 4MDFA 1KZ1A 2VYCA 2X76A 1WULS 3KAKA 1U6JA 2QZ4A 4F6CA 2Z5LA 2DLDA 2W6CX 3EPRA 2HAEA 2RGNA 2EL9A 4B4VA 4HRYA 5HDQA 1OGYA 2IYEA 3EWNA 3GUZA 3S0JA 3WGGA 4B2YA 2X6RA 5B7GA 4D26A 5TXGA 1SURA 3Q40A 5AO9A 5I7HA 5JIBA 1QYCA 1PJ3A 1Z2NX 4ZT7A 3I3SR 2Q2QA 5EKDA 1X0VA 3QX8A 3K9FC 2Q5EA 1OAKA 1YR6A 3HE3A 1B2RA 4MCJA 3BXHA 2WM3A 2NTEA 4FIZA 4F4HA 2BM9A 4MRMA 2XB9A 3SZGA 2BE7A 1QYVA 2VC2B 2VVTA 3KOWA 4FFNA 1T1JA 3W4JA 1DRJA 1E2DA 1VL8A 2CYBA 1DPFA 3CZMA 4FONA 4OOEA 2E7ZA 4M4SA 2JHGA 4PZLA 1I1NA 1EUCA 1W85A 2QGZA 5DE3A 1MENA 3WA6A 3DNPA 4EJMA 1Q15A 4GI5A 1WVGA 1RYYA 4BTVA 4D8TA 4U7TB 5FWAA 2ZZMA 1IULA 1U1IA 4UNNA 4M7OA 4BFSA 3V1YA 1RYFA 1MU0A 3PKJA 3IP3A 2DLCX 1DZIA 3QVLA 1BMFD 2FMIA 3TG2A 8LDHA 4GC5A 3KKOA 1IQ0A 4R9RA 4RIIA 3F4BA 3TQQA 3AVXA 2Z2XA 4JYAB 2GETA 2DQ4A 2ZYSA 4CEHA 2JFVA 3WQSB 5AMXA 1EDEA 3ABOB 4BQOA 4UTZA 1A9YA 4M9CA 3HSSA 1JYEA 4XRRA 1SXGA 4H0FA 4L16A 3W9BA 5JXIA 2PMCA 1GTJ1 5ICMA 1UBGA 3NEJA 4QSHA 2TYSB 5K01A 3WB2A 4B3XA 5M2QA 3PHIA 2F67A 4FEEA 3CLSD 3LBHA 4QQKA 4X41A 2YOFA 2RB4A 4TSKA 3OZ7A 2VK4A 1ONNA 3GGPA 4C88A 3IQEA 2G63A 1Y5NA 4WVFA 5CK4A 2I2FA 3OPNA 4YWJA 1TT5B 3KEQA 4BDTA 3BZBA 4GOXA 4BMPB 1VZ3A 3BIFA 4YMWA 3E18A 4KSCA 1OA0A 3G7SA 4CL8A 3HLYA 2RSLA 1KAEA 2GERA 1T9GS 2DBRA 2PZEA 2CXOA 2JARA 2XHEA 3ZJVA 1W0KD 3ICQB 3W79A 3CN9A 2JANA 4H6WA 1KEEA 2O0JA 4DUYB 2LV8A 3QY0A 1DMSA 4EA8A 3H16A 4MPTA 1XLTA 1M7GA 2ODBA 2UUBB 4BTEA 2PMFA 4UJ3A 1JQAA 4QBHA 3MINB 1RIIA 3TWOA 3RS5A 4Z0HO 4IJVA 3BMQB 3PRJA 5JUWA 1HM5A 2ZBRA 1XZLA 3LC1O 1VGRA 3IXMA 2XF2A 1R6DA 4U02A 2JAPA 1CUXA 5AT1A 1X0XA 2BF7A 2OV6A 3K7EA 5FAXA 3KQUA 4MB2A 5KKCA 4U7WA 2CVZA 3A8TA 1U28C 3BGWA 5EZYA 4L6AA 3RS7A 2ZSDA 3MWGA 3VSEA 1LWNA 4V0ME 4E15A 3MYRA 5JLAA 4YT5A 1ZJYA 5EXDA 1WCV1 2BHRA 2P41A 2PMDA 3ASYA 6LDHA 3LYAA 2W2KB 5G0VA 2GHIA 3JQBC 3OJWA 3FCEA 3AQIA 1O77A 4GP6A 1D2MA 3KJEA 3P9XA 5ILQA 4QGGA 2D2FA 3SSAA 3L0DA 3H99A 4PLPA 1JKJA 1EB9A 1FLAA 1KH2A 1OHHA 1YR8A 3RRZA 4AJ4A 3FYSA 4BKPA 2GCOB 4LG1A 5IZCA 1Z0FA 3IIJA 4TWIA 3W5UA 4YYEA 4HHEA 1JL3A 1F8XA 1KZHA 3UMGA 1E3QA 2RH9B 4HF7A 4ZU1X 1DUSA 1P75A 3RUAA 2G40A 2A4KA 3THXB 3S3TA 1Z0UA 1FJXA 1QYWA 4MW1A 1ODSA 1Z6PA 3C7DB 1SXJD 4WVLA 4CF7A 2HA0A 3BT7A 3WWEA 1MO2A 1FQKA 5T6BA 3ZLBA 1JHVA 3QF4A 3ZE9A 2QX6A 3FHOA 4MA5A 1VG0B 1TM4E 1WW2A 3QY9A 5LLTA 2AI3A 3FOEC 4CVNA 3T1VA 5AK3A 3V8QA 3TDKA 2VHEA 3VUEA 2OHFA 2OXFA 2O0HA 3TQTA 4BQSA 1G41A 1OZGA 2VPPA 1EHIA 1PJLA 5JSUA 1N2OA 4UM7A 4XLZA 5LQKA 2B20A 3ZV7A 4Q00A 4GP9A 1NX9A 4RV4A 1ZOOA 3V00A 1XCOA 4FFWA 3QU5A 1ACMA 3JRWA 3WLMA 1KAGA 5B6JA 1PCXA 3IO5A 4LWOA 1N8TA 3G6WA 5IAEA 5KWSA 3ROGA 2P1DA 2XBLA 3V42A 1QPBA 4YJFA 3WK8A 4C20A 4FHDA 3PUZA 2JGFA 5KS2A 4R3WA 5TMDA 3QV1A 4UREA 1N33B 2Y4NA 4XVCA 3U7JA 4ZZ0A 1E9BA 3A9VA 5FIUA 4AM8A 3JARB 2R60A 3E58A 3R3SA 3HJFA 3P9SA 4IV8A 4TTIA 3JY6A 2YS6A 1DADA 3FWNA 1KSGA 3H1FA 1FXSA 5FWYB 4ISBA 1HDCA 3OLVA 1R0WA 3GYBA 1EEXB 3EWIA 4I1IA 4UPVA 5EPUA 4YAUA 3EMVA 1TD1A 4UATA 1OPXA 1OZ0A 2R1TB 3AIOA 4N65A 3T99A 1L7MA 1NF3A 2VJYA 5AVVA 2HA3A 4RNDB 1G5QA 5IABA 2KM1A 3I83A 3KKNA 3AUXA 3OLWA 4JC8A 1PLKA 3UWDA 3ZQKA 4HQRA 2EARA 2HM7A 3IPYA 2C5HA 4GX5A 1E2FA 3LFTA 4O3MA 3D3WB 1AVTA 4RD0A 4LFAB 2NU6A 1J8YF 4B83A 4BNIA 3K72B 1ZSVA 2VXBA 2JB9A 5B57C 4G1CA 1RLMA 2FPRA 4YCAA 2JFPA 2RARA 3M8KA 4D74A 2A84A 2GBFA 2L19A 3I2FA 1JU9A 2KBFA 4JUBA 4AY4A 4B44A 4EGSA 1J0EA 2X8LA 2ZTUA 4FFPA 4P7JA 1QYXA 4EECA 4F97A 2PGJA 4FYJA 1VIYA 1FTYA 5TJ9A 5BMVA 3ERCA 2ZWPA 5I9IA 1I2AA 2XODA 1JHPA 3REOA 2XCRB 2B3DA 2FOIA 1V3VA 2I4LA 2PWPA 2QTRA 1VSTA 1IXRC 4V0KA 3KHUA 4YAEA 4Q39A 3RI3A 2R85A 3Q6IA 4RORA 1H05A 1AUVA 1N9KA 1RYHA 2AIRA 3R5FA 3NH6A 4OLBA 3CLKA 2WNIA 3BZUA 1IC6A 3DFKA 4JOBA 1M2NA 4ZJYA 4Z51A 4EO4A 4U5XA 5E6RB 5ITWA 3KNZA 4GR9A 2JGAA 3QRWA 1E3LA 1VG8A 4OB6A 1AKVA 1TM5E 4B76A 3BAFA 1QH1B 1HA3A 1K7YA 4QU0A 4JI5B 1ZM9A 3RDPA 2VJDA 3OWOA 3ZHQA 2A59A 1YZ3A 3ROMA 3U80A 4HBGA 1XDZA 3A26A 1DQYA 4DS3A 5A4AA 2AQIA 3GDOA 4GPTA 2JBAA 3ZZ0A 4I81A 4G5SA 3LC2O 2J8ZA 5HMLA 4YO7A 3IKMB 5LYJB 3TEFA 4YV7A 1TK2A 4TMVA 4UTOA 1VRWA 1SULA 4PLCA 3EG9B 3ND6A 3OIWA 1IJFA 2N42A 4I4NA 1HOXA 1NGSA 1JX6A 1RMYA 4X3CA 2GZHA 2Z4TA 5G0SA 1KI7A 1KWKA 1IWBB 3BB1A 2JLXA 4F3RA 5EZYF 2HF2A 1BDBA 3NHYA 4JB0A 1W46A 4B46A 1RWNA 5JNRA 3UB4A 1BFUA 4ZZIA 1YD7A 5F9FA 3VR5D 2P27A 4HYQA 4Q16A 3IRUA 2XB4A 2EBUA 3R2JA 3QJGA 3PD1A 4L8YA 3A05A 4W9NC 5F76A 1N0UA 1W7AA 1RHKA 3GEHA 3IKVA 4WDRA 5JANA 1BXRA 3WGOA 4WLFA 3BGVA 3HA3A 4UMVA 3VJLA 5BW4A 3EOZA 1X8KA 3E6AA 2O7NA 2QVYX 2W90A 3BQMB 3DDNA 5JECA 2R25B 5CG1A 3A6LA 2W8BA 2C7GA 4C4OA 3H2IA 3L92A 2F3UA 3GWZA 3MT7A 2LPMA 1RABA 3L7MA 2M1ZA 2I4IA 1XMJA 3RNLA 1TO6A 1VRVA 3RO7A 3JZDA 5IDQA 5EZ6B 1MV5A 3VZQA 2OB2A 4LISA 4UHDA 1OH6A 3H2KA 4FFMA 5EUQB 1ZO8A 2VSOA 3SF0A 1DKLA 2QIPA 1KSHA 1E4OA 2EFHB 1JFRA 1KP3A 3LLSA 3PQ3A 3DEZA 4NYMR 1LDBA 1T5LA 4GE0A 2Q5IA 5LKRA 1CUIA 1QGED 5K1ZA 4DLXA 1EDDA 3CURA 2QZ9A 3H2YA 4BWVA 4X1IA 2FDRA 2PS1A 3GH3A 4GX1A 2RAUA 1LDNA 1WHTB 3DFUA 3MWEB 4U63A 5JAZA 4G0WA 4L2IB 4YEDA 4MR9A 4TMFA 4EGAA 1Z5WA 2HRBA 3TZKA 3KD2A 1L7RA 1EFPA 3ZBTA 2ZR8A 2CHEA 1ZJ5A 4Y6RA 1WXDA 3DL2A 4OEHA 4Y6SA 3VDQA 5I5GA 1S2OA 3EDQA 4DY6A 2ZDGA 2QYHA 4G84A 1JDVA 4RPLA 5LCXA 3BXOA 2ZUEA 1DIOB 5T8KC 4G97A 5H5JA 1U2GC 4CM4A 3EQ8A 1F8YA 4PCAA 3PITA 1K75A 2Q3BA 3QVOA 1L1EA 4GGOA 1P81A 1H94A 1Y3IA 2D3WA 2Z30A 2C8VA 2PBRA 2Q1TA 5ALPA 1QHXA 1P0PA 1RQXA 2MIIA 2IYNA 4JELA 3W5HA 2ZG6A 4AF8A 4DWVA 1O4VA 4WK2B 4M1MA 4UC0A 4PC3A 2YRXA 5C8YB 4I3FA 5AM1A 3REQB 4PXAA 3OIFA 2D4HA 4PO8A 2J67A 4TTQA 3EA0A 2PHZA 1UC9A 4HNQA 1H4TA 2FPGB 1F38A 2HDWA 2QI9C 4KMOA 3QBEA 1K98A 3HDGA 3TSAA 4XPIA 5HPYB 3IDAA 4ESOA 1KORA 4L5YA 5TQ2B 4Y1RA 3G2LA 4GM1A 4OHMA 4DV0B 4IOLA 3N76A 2VWQA 1UPFA 4Q3AA 2B4AA 2OORA 3EGXB 5A2GA 5BMVF 1X14A 2WW8A 2NO7A 3HL0A 1APBA 4BAGA 3WDLA 3U19A 2XKAA 1GZUA 3WGMA 3MXOA 4II7A 2EKDA 3SY8A 1E92A 1MOQA 3U4QB 4D25A 3LBAA 3RGGA 1VJCA 5BN5A 5BRAA 1MG0A 1Z45A 3RASA 4GRDA 4GGPA 1JA0A 4RV5A 3KDPA 1S96A 4A3SA 1ZUWA 2EQBA 3K09C 2GCIA 3H86A 3LY7A 3QW2A 2ODTX 4JGIA 3D0RA 1MEJA 3KEGA 4IUDS 1SKUA 2P30A 2FNAA 1P44A 3I9MA 3OI7A 4I14A 2YFHA 3AR2A 3BVPA 3EA4A 1RYNA 1SBQA 4NC9A 1DNPA 4F5EA 5FLEX 4DJAA 4JOQA 4LCEA 3ENKA 2GDZA 2VJBA 3N7TA 2CNDA 2WICA 4NVRA 3CKKA 4PBTA 1KMIY 1PWXA 4OFBA 1SHTX 3EFHA 4BL5A 4E14A 2W5UA 1BE1A 3DBRB 1G98A 3OCJA 1WJGA 3UANA 4B2PA 4N8SA 2QMUA 4KK4A 3K9WA 4MV1A 1FVFA 3NWPA 3PFIA 3RSSA 4B0PA 2M1XA 5JCZA 5JYDA 4MLDA 4TXJA 5A5DA 4C7OB 1CUCA 2GQ0A 5EE5B 4CETA 4XRGA 3AOGA 4L95C 5BVHA 3EZFA 5KREA 1PL6A 1AUOA 1TB4A 5DBOA 4BX3A 3IPRA 4IIEA 1DC7A 1O94A 4YCSA 1SVOA 2ZUWA 1JECA 4DJEC 4DLTA 4Y0NA 5KPJA 1EWKA 3DMNA 3O8DA 4NFYA 2H4XA 3KB1A 5BV7A 1K6JA 1Q91A 2I3AA 3A1FA 3AM4A 4HNUA 3KE8A 4CM3A 4DVGA 1K8YB 3E9QA 1DE0A 3T3MB 3JQ7B 3SZUA 2HHAA 3WVNA 9LDTA 4X95A 3SC2A 4INAA 1LPPA 5KU7A 1VPWA 1IHDA 4YMUA 3RAJA 1W5BA 3GQBB 3WI7A 1AGNA 1I80A 4XR9A 4Z7NB 2IXTA 1T9AA 1LW6E 1YGYA 3FNHA 3LGAA 1L6IA 4PZDA 1M6YA 3U4HA 2HLDA 4HD8A 1I24A 2MR6A 4MIEA 5EAIA 5AW0A 4FS8A 1DBSA 4WZBE 2A5JA 2V54A 5E6UA 4F3YA 5L53A 4ZJZA 3JWIA 1XZMA 2R6DA 2XCSB 1OXMA 3VX4A 2PRIA 2W2XA 4PS1A 4UFOA 3UAVA 1P2UA 1FNBA 1OI3A 1JG3A 1LZKA 2J9GA 2ODWA 2BM1A 3F7OA 4G36A 1GGHA 4KUHA 5DASA 1MB0A 4TKMA 1W4LA 3L07A 4WECA 3UJBA 1GCAA 3HYRA 3OZVA 3B2NA 3MSXA 1WD5A 2PVCA 3NQ41 3T1YB 1KRWA 2NYVA 4DT1A 2UZIR 1DAMA 1SBTA 5DEIA 4PN7A 3F5DA 1XELA 2APJA 3IVAA 1YNOA 4H35A 4K0KB 2QJRA 2VRCA 4LQDA 3ROTA 1R0ZA 4MCIA 3TI7A 1E1MA 1LZLA 3FTFA 2BFCA 5K8CA 2WA2A 3CEHA 4MUAA 3V2IA 4EKEA 2O0KA 3TQCA 3FMOB 1AK9A 1R6XA 2FHSA 4XOIA 2WAOA 1O95D 4GQIA 1D6MA 2WD9A 4UNPA 1W52X 5C1OA 1D0VA 2Q07A 2WWFA 1H8EA 1N8SA 2DHEA 2DUNA 3UMMA 4KH1A 1DINA 4BGEA 1REQB 4MR8A 3UO8B 5L51A 4JAVC 3RT9A 3F2IA 1HF3A 1RAEA 1N75A 1WMDA 3PR1A 3QJ5A 4LTNA 3K35A 4X60A 3WK9A 3ZNOA 1TYAE 2ATVA 3FHJA 2D0PB 4MWBA 4TUYA 1AKTA 1QLJA 2B25A 1Q1BA 4GVPA 4P5DA 1X80B 1Z15A 5CD9A 1UEJA 5JFOA 4H60A 4X84A 3PHGA 4P3YA 3FYCA 1UFRA 3E0QA 4KPEC 4A0GA 1P1BA 1X1DA 1E2MA 1C8BA 2AN4A 2IUYA 4NAVA 3V7WA 5JAOA 3WY9A 3GROA 3WL8A 2XXAA 4KQWA 1U0RA 3QKIA 1KZ4A 2XKKA 1S3FA 1PSZA 1D03A 2G77B 3PDCA 3P20A 5JZMA 3M6MD 4NYIQ 4NJMA 3NIFB 4MV9A 2I2AA 4UU0A 2OG1A 2XUIA 3GJ6A 5B1YA 1WUTA 1C41A 3DLBA 5LR6A 3BA1A 2QW0X 3B6JA 1KDVA 2GN6A 2HBZA 3CMMA 1NFRA 4ER3A 2ETXA 3E2MA 1GUYA 2W2LA 2DWCA 4JI3B 4FEGA 3IEKA 4J0HA 1A5AB 3F9RA 3D4IA 1HZZC 2FPXA 3RE1A 4BGUA 1VCOA 2QNBA 2YBEA 4EHBA 1MIHA 3NDIA 4PNHA 4M60A 4NV1A 1J1ZA 1S89A 1Z47A 2QR2A 1GRCA 1UMDB 3NUGA 4QXQA 1H0RA 1QQTA 5I4CA 1Z8DA 2G9UA 2WM2A 3OEHA 3NI2A 1DQSA 1BOOA 2QW1A 3HU3A 3VJKA 3LU1A 4HAXA 3K0SA 1K1EA 2OFPA 1CULC 1YKSA 3G7NA 3GUVA 3HKBA 3LDAA 3DF7A 2A4MA 4H4DA 3CZAA 4B4DA 4B6JA 1PR5A 3AVQA 4GEGA 2O0LA 3ACCA 3G0CA 3VR1A 2YMQA 2B6HA 3UGQA 4DNXA 2HNBA 7ABPA 2CMGA 4KQXA 1HPLA 2IYQA 3L6CA 4NZNA 1WXGA 2BFFB 3TFOA 1Y3BE 1T4GA 4Y8VA 5GPBA 1BCSA 3BCRA 5A4JA 3UJ8A 1YFKA 2QM7A 1NW6A 4J7AA 1I8TA 2I1VB 2R7MA 4LNUA 4YMIA 1LRLA 5FA5A 1WDLA 3TLBA 3PPYA 5CDSA 1G5IA 2EJWA 1ARZA 4HS9A 3FAKA 4RZIA 1A76A 1COZA 3EXAA 2UVPB 3ZHCA 1T4DA 4UXHA 2IYAA 3CW2A 3N5KA 1A5TA 4C3ZA 3UGTA 3STUA 2PL1A 3D9QX 3OTOB 5DVZA 1TYZA 3GP8A 1MVNA 2RGUA 2YJNA 4GKKB 3TYXA 3ZIAD 3LPAA 1U2ZA 2P91A 3GPIA 3HFRA 3MJCA 4KFRA 5LQSA 3ZGXA 4BNFA 4CMJA 2ISCA 4ZQCB 3H6GA 1IY0A 1RXEA 2ONYA 3PVSA 2WJPA 4JEIA 1RHMA 1H1LA 3F0TA 5FL7D 1YA8A 3T7RA 3V4ZA 2HDOA 1GN9A 4TKLA 2CXTA 5IAOA 4BP3A 2JJYA 1GAJA 2GHRA 5EKSA 4BNLA 5ULLA 3KB6A 1EINA 3ZEAA 3A1EA 4CDMA 2AMLA 4YRRA 2VI5A 1GXSB 2NT4A 4V39A 2FQ1A 3VYTB 3WGQA 5BSEA 3AG5A 1R0LA 1P2VA 1MABA 2H92A 1QB8A 4LV6A 3B38A 5DMHA 3N7UA 3QGMA 4GI1A 2X8JA 3QXCA 4UVDA 1BKYA 1ZJWA 2XVMA 3DUFA 4N03A 3ZHZA 1P6XA 2QVBA 4RH0A 2VF5X 1DBPA 1UQUA 1ZMBA 5BY2A 1OUMA 3DEHA 3E7FA 3OJCA 5E38A 2IEAA 2O52A 1MPXA 4WTOA 5LZ9A 2YHAA 3A1NA 1ZD3A 4F0JA 4E30A 1NV8A 1TQHA 1VHWA 4HDQB 2EW8A 2QOEA 2JPDA 2C99A 3O47A 4X1OA 3HXQA 2NNLD 1ESMA 1SWWA 2PEYA 1G8KA 1RAAA 2WIBA 4TXLA 4Y1EA 5JS7A 1L4GA 4F4CA 4N7JA 5JQGB 4AO7A 3ZD8A 4FYIA 3B36A 3G68A 1Q7TA 1DTWA 2OO5A 1R9MA 2W9XA 4FTWA 1MRNA 3G85A 2VNHA 5D00A 4I8XA 4K5QA 5B2ZA 1TJ3A 2HPVA 3WMXA 2XGMA 2GF0A 4G89A 3IAM6 4BB5A 3MJTA 1J8MF 2JI9A 1YGPA 4HGPA 4I1SA 3OMXA 1IBCA 4PHFA 5FNVB 3TTXA 5IYZB 3CKYA 4Y9TA 1HYQA 3TOXA 4D43A 4F72A 4J3FA 3ADDA 5THKA 1ULTA 1F12A 1ZSNA 2QAJA 3U4DA 1QBGA 4FMDF 1TEVA 3PUHA 3V1MA 4V24A 1YJAA 2GTPA 3BH6A 2PCLA 3WSWA 4W5OA 4XJVA 1NQXA 3SCZA 2GILA 5KYKA 2HK9A 5HGXA 3OZSA 2ZE8A 3OTIA 3FOBA 4OYLA 3R7NA 5B1SA 3ELYA 1PS9A 1DKQA 1QO9A 1Y4DE 1ZP6A 2JGJA 4FGWA 4MI9A 4PZUA 3NRCA 5EWMB 5CBPA 3TSCA 1TEXA 3P9PA 2CDCA 2ZYGA 1HFJA 1E66A 3H84A 4ZKEA 1OWLA 4UDNA 3VC7A 4BATA 4D0SA 2B8JA 5CAEA 1Q0TA 2OT3B 2G06A 1VFPA 4FWTA 2D13A 1XZGA 1MH1A 1MMFB 2EATA 2Y6VA 2OOSA 3K8YA 4XQ0A 5K3AA 7MDHA 4ZYZA 1FFXA 1GAEO 1NJGA 3GJTA 4B6SA 2QG4A 4JUDX 4EF5A 2QEQA 3WNZA 1RE0A 1GCGA 2G9QA 1ECJA 2ZROA 2PUHA 3IULA 1JYSA 3LH5A 2ZVJA 1OIVA 1N1EA 1NI4B 1W9MA 3EUAA 3N74A 2RJNA 4PEVA 4RK7A 1PQYA 4TMYA 4ZZ1A 1PZFA 2AKYA 1E6UA 4ERNA 3JD2A 2PCJA 1FS4A 1Y48E 4U2KA 3JD0A 3JWHA 3IUBA 3LDUA 2DTDA 4YP0A 4C03A 1A2OA 3FSRA 3N2KB 4AZSA 1POXA 1Z9BA 3GLTA 3CN7A 2FEXA 3CX6A 5AKKA 2VTDA 4FFRA 1FSZA 5B3LA 1GDTA 4ZOCA 4BU0A 2YFYA 4IZ6A 1YXMA 1RLUA 4ER7A 4ZVOA 1Y6FA 1FDSA 4DG8A 4MV4A 3HJTA 3AR3A 3MMPA 4MVXA 1CR2A 1UBMS 3F3YA 4GMHA 4QPZA 2J07A 1EPUA 4HCJA 3ZD9A 4EMUA 6ABPA 3ICCA 3PC6A 2EQAA 2FSSA 4EG4A 4KREA 3WRWA 3LE8A 1C1XB 2ADFA 2V7EA 1OYVA 4WESB 3AU8A 4RD6A 3E9ZA 3RKRA 1QRTA 1KY4A 2VDQB 2Z0MA 1UK9A 2W2VA 5K0CA 1ZMRA 2IIBA 1N2JA 5CFPA 1IBSA 3F6YA 1MNQA 1RKXA 4WKNA 3RUEA 1D4AA 1BX3A 2MU1A 1RPJA 1SA0B 2QLFA 2QYOA 4RSHA 1G42A 3JX9A 5CA1B 3CX8A 2JIRA 3I0ZA 2XMQA 3RQSA 2W7TA 5G02A 3IX7A 4KBGA 4D92A 2AOVA 3BL6A 2JGMA 1A7AA 3JR7A 1TA4A 4LX0A 2FFQA 3N3AC 1CD5A 3UMSA 3P27A 4P84A 4E70A 2YY7A 4DC0A 4HDSA 3WQQA 3EEQA 4AZ3B 1NQWA 2XXBA 5BNZA 2HF8A 4RANA 5FUYA 3NKLA 3MIZA 4RF2A 4ZCRA 4KR6A 4LZPA 1NW4A 5ALFA 3WDKA 1DCTA 2D06A 1DEHA 1XFDA 2NWQA 1I4WA 2NYRA 5EHIA 3RYTC 1DXHA 3D5QA 4L57A 2O8EB 4BZWA 1I7DA 2VXYA 1KRXA 4I5FA 2BEKA 5A5VA 1EWVA 1YB6A 3E1SA 1R0SA 4H2DA 1N2EA 4LYDA 4OI2A 4CG0A 5JWOA 5JY1A 4JLBA 1YIOA 1E0DA 4ZCTA 5K8JB 3C85A 2HNAA 3A10A 2JIPA 5FBZA 5AW2A 3TZQA 4QHTA 2FPSA 4R05A 3G0IA 3H1PA 1PKXA 1NOJA 3A4LA 1AZWA 1BXZA 3EGCA 4WOPA 2OV8A 1F0KA 5C7OO 1C9EA 1QG2A 1E5VA 2ROQA 4XJTA 1N6KA 3UCEA 2ZCJA 5JD6A 3QG1A 3ET4A 3GNSA 1T4BA 2V5VA 2VK1A 3AKEA 1C3LA 2BJVA 2YYSA 3ILXA 4JJFA 5CW1A 4AJOA 1JH9A 2VIIA 5H83A 4QYXA 3NBUA 3L84A 1JKXA 5K2MA 3TL6A 3D8RA 5CFQA 5IJ9B 1YRLA 3Q10A 3AVVA 1U2PA 1GTSA 4J0JA 2VJMB 1CZUA 1LGYA 3FW1A 1LQTA 1ZGBA 3GAMA 4XQCA 3FE2A 1GCIA 4K8RB 1IN5A 5DP2A 3W5BA 4K87A 5LJLA 2WJZB 5IN4A 3BE4A 4YPOA 1F51E 1N5KA 1V71A 2D7CA 2I78A 2O23A 5K99A 1AMNA 3FPJA 3VFDA 3TGLA 2C5LA 1FE8A 1PZMA 4TX1A 2FPWA 2QMEA 4HBZA 4YDHB 4EX6A 3SLRA 3PKZA 1NUPA 2WU0A 2ADOA 4JASB 3HP1A 1EP3B 5K6AA 3FR8A 4MGIR 3VSCA 4QAJA 3RFTA 1GADO 1NNUA 5F77A 4IMPA 5DI3A 3JATA 3WK5A 2DB3A 3I01A 3ODGA 3ZE1B 3A4NA 3LGXA 4R83A 2WQ7A 5BR7A 5T67A 2XT6A 3H04A 5FWNA 5EWJA 4E33A 5ELMA 4W9MC 3O3CA 1SB8A 2NXEA 1TTTA 4IHAA 3O8NA 3MUFA 1E1DA 2BFDA 3KXPA 4NJEA 3CNEA 4KAJA 4E2YA 4NE7A 5CT8A 2I7XA 5TT1A 3UAZA 3UJ7A 5JROA 1PI3A 2GK3A 5TQVA 3T35A 5HXAA 4Q01A 2P68A 4GSLA 3HXTA 1T1SA 2HCRA 3NBMA 4HWPA 4YRJA 5JPDA 3GV0A 4K9PA 2JA1A 5DYTA 2RGYA 4GICA 4CEJA 1YZGA 4V3BA 3S5UA 4PICA 3HJUA 5LIPA 1KYIA 4RZ2A 5AVSA 3TDMA 1PNTA 3L06A 4R6WA 4EM6A 1US8A 3PNYA 3PTLA 3QX9A 1U3VA 4Y7DA 4B7CA 4U0JA 3DP9A 3OICA 1NW9B 1DQRA 3PK0A 1UK6A 1WSAA 3I01M 3VU8A 5BORA 1BH6A 1YUNA 3EXEA 4YCDA 1MB2A 5KJFA 1VBNA 3K5WA 4GYYA 4NMHA 5MHTA 1KNXA 3HDHA 5J5CA 4GBGA 4DREA 1QFJA 3C2QA 2ZI9A 1M5UA 1V8OA 4TL8A 3EPKA 1WB9A 3N53A 1KS2A 3TLJA 3UFBA 4ITUA 2WMDA 1M2VA 3F6PA 2H1IA 4GWKA 2AMVA 2ISQA 2Y0DA 3GFBA 3A7EA 4JS0A 2IP4A 1MA3A 3D54D 3GGJA 4QBFA 4OK5A 4U2BA 3C1OA 2WA1A 3UW1A 5EJ4A 1DAGA 2HJ9A 2ZJ1A 3OCZA 1RRGA 2LWIA 5E3HA 1Y33E 2ZCUA 1CU1A 1ORDA 4MKRA 5DFAA 1NBMA 4F11A 1VZ2A 5B7QA 4RXUA 5J2TA 3U44B 1TU3A 2J30A 3E8SA 1UQRA 4Q3NA 1ZBQA 1LNZA 1XRSB 3UWPA 3CUEF 5DLDA 4QXOA 1H9CA 3I04A 5E2IA 3WO1A 3BF8A 4OM8A 3WE7A 1A9SA 1QLHA 3ORSA 4W4TA 4A6DA 3GAAA 1NKTA 4MQEA 1NY5A 4RF3A 5F3WB 3S7ZA 1L7DA 2P4EA 2PUJA 3GEDA 4XYMA 3W8NA 4C1NA 5JAUA 1G6KA 2TMDA 4M8SA 2O6LA 4I55A 4J0DA 1WXWA 1YB5A 3U39A 5IAAA 1JG6A 5E9AA 1K7EB 2YJ5A 1FU7A 3JQAB 3TI9A 3NRJA 3DOCA 4DUGA 3F47A 3AU9A 3K0AA 2DHDA 3WV5A 3WK4A 3OY2A 4E4RA 2F4VB 1IVYA 3K16A 3VKFA 2DFVA 3O93A 1L5FA 4PYJA 4L51A 2OCDA 2BC9A 1UJ5A 3D7NA 3M5DA 4DIBA 1RBQA 2IHJA 3WADA 3A9UA 3L0IB 1TVEA 2CL0X 3LTNC 4DGSA 2YV3A 4I9HA 1P4RA 1Z6QA 2GXSA 3I04M 1I7QB 1XTPA 3S28A 1A1SA 2R1UA 4RWEA 5ECGC 5FPKA 1W2WB 4DDUA 1GAXA 3L0YA 3E0XA 4KXVA 1ZISA 3G2OA 5CDYA 2CNLA 4TWJA 2VK8A 2JVKA 5AICA 3G0BA 3I9FA 1G5HA 2F9FA 3NDPA 3WWZA 3EPPA 1ECBA 5DNYB 3KYCA 2RJ3A 4MQ4A 1K7SN 5LP1A 4LXQA 2W2PA 3GGOA 3SMQA 2J3QA 1LBEA 1U0EA 1OKKA 1ZWKA 1GITA 1RACA 3MNFA 4CLRA 4D9HA 1E9EA 1PTJC 1TADA 2C92A 3TR6A 2WIFA 2M2IA 4N40A 4HVCA 2BGTA 1T5IA 2O8NA 3I32A 1TKAA 3RK4A 16PKA 1NVEA 1U7ZA 3G1WA 4AXXA 1ZVVA 2YV4A 1OJLA 2C03A 2ENUA 3LT5A 4DSTA 4TKUB 4ZRNA 4R1OA 1TUBA 4S1OA 1XTSA 1E9FA 1IOLA 1JR3A 4NXNB 4GECA 2W48A 4QBGB 4YO8A 3SK0A 3I5XA 4ESVA 3V4FA 3SXJA 3HZOA 3PDWA 1YKFA 1V26A 4RCVA 3A9WA 3DMTA 3QUCA 4O4IB 1E4EA 4R2LA 3MTGA 1GKKA 4RDCA 1J06A 4XUGB 1N77A 1WDWB 4EELA 2QAGA 3WKDA 2FPKA 2NUPB 5JBIA 2MR5A 4JLPA 4MROA 4QREA 1DIHA 4WEOA 5LXTA 2PSJA 4UD6A 1ZEJA 1AO3A 2C3MA 1X7ZB 3CRVA 2WY2D 4ZRMA 3K5PA 2Z2JA 1WXFA 4MB6A 4YUAA 1QCDA 2PQ0A 5KYNA 4N76A 1JTVA 3VYSB 1OFHA 2NAFA 3DVAA 1M73E 2A88A 3HVJA 1QF9A 4AD8A 4YV2A 4IVQA 3EQ2A 1QTIA 4OGFA 1PZNA 1LWOA 3DBOB 3G5TA 4EZEA 3ZV5A 3G8BA 1Z28A 4XVUA 4M0DA 4KGVA 1OLSB 2IPMA 4PLGA 2WJ4A 5LP6A 2IV7A 4Z9XA 4DC1A 1VCIA 1GL6A 2P69A 4NPCA 2BTQB 1XZAA 3B60A 1EA5A 4HJRA 3ZEIA 2GD1O 2QD4A 1YULA 2IL1A 1T36B 3EAFA 3GJQA 1BFDA 3GZ4A 4XD7A 5GY7A 1SRQA 4YY3B 1KS9A 2VHZA 4AT1A 3M4YA 2VCHA 4PF1A 1E3EA 3JXEA 4HAUA 4M8KA 4G1MB 1J5PA 4KPGA 2B8TA 4MTLA 4N5LA 2RAFA 4TOIA 4TTTS 2A9KA 4GBJA 1AY0A 2YXDA 3GIWA 3WGIA 2BYTA 2KJQA 1I5EA 3EE6A 2IVFA 5CNKA 5AI4A 5I48A 5AM4A 2GCNA 4P9NA 4JYZA 4O6VA 3KSMA 4HNSA 3MS4A 4WLOA 5C4GB 5DNCA 4P7FA 5JEEA 1BYIA 1V1JA 3AVOA 4U7GA 5I45A 3K0HA 4DA4A 1GZHB 3V8BA 3U5TA 1XSEA 3W0LB 3ETNA 1Y5LA 3I76A 3BOSA 1U9IC 3EZYA 1FF9A 5JDCA 1KQGA 1C30A 1F3LA 2W8ZA 3E15A 4M0CA 2YWGA 1XNGA 2H31A 4Q4AB 2VS1A 5EQTA 1ZHHA 3ZWCA 1LS6A 5DIFA 1U5CA 3O6VA 1IZYA 4ZO6A 2WD8A 2QT0A 5G4KA 3AUUA 3I0NA 4JI4B 2IP1A 1FP4A 1WXEA 3B1FA 3FRIA 3RUIA 5K0LA 4LJAA 2ZIVB 3I2HA 1XQXA 4FOSA 4BQNA 5KHOC 4M7WA 4TYMA 4MDHA 5CXQA 3OBBA 1QYRA 4P8RA 2ZUVA 3LHKA 4CCAA 1OR8A 3BHNA 1S8NA 5D3ZA 1L8LA 2ZVDA 4G65A 4UTVA 1JYFA 5EINA 2W6JD 3KOYA 4NEQA 2OVFA 4AJ2A 2BFEA 2Y71A 1A9XB 4PANA 4WW0A 221PA 3F6RA 3GRCA 4PTZA 4MV3A 5H3LA 1N2CB 1XGKA 5JZVA 4TLAA 1XKLA 4A4DA 4K9QA 1QR2A 3EDOA 5EJ8A 2X1LA 3BRWA 4RMGA 6NULA 4JUFA 4NESA 4ABTA 3U09A 2FRXA 3OJLA 3F7MA 3I6MA 3KIPA 5BO5A 1G7TA 1Q3TA 1HLDA 4Q4DA 5HOQA 3F49S 2IOYA 2CY0A 2FX5A 5IKXA 1BRMA 1WIWA 4V38A 1N5MA 3KDSE 1R5JA 5CFRA 1JT9A 5BV1A 3RWOA 3Q0IA 2JLCA 3IHKA 4D9KA 4EPYA 2QMZA 2I2BA 2MMCA 3NALA 2OMKA 3DZJA 4QDTA 3SBDA 4CM1A 2C2KA 2C9BA 4PSAA 3R5XA 2CBGA 4IH9A 4CKZA 1P29A 4WCFC 1TZKA 2IH4A 2ZAIA 2ZBFA 3TX2A 1KL7A 4UUNA 4G1VA 3EPLA 4JD5A 3BBLA 4Y9RA 2NU8B 1JHYA 2WOOA 4RQUA 2EGHA 4IDQA 1E1CA 3V33A 3BWVA 2JD1A 2FQWA 3O0DA 1XWIA 2AJLI 3B70A 1Q0ZA 4QECA 1SOMA 3R3XA 3SZRA 4JIMA 1BQ3A 2XDWA 4I0WB 5IAGA 2E2WA 1VKHA 1SAYA 3A3NA 3BKXA 2CWWA 4I7EA 4HXGA 4AXBA 3OETA 3Q0TA 2FZWA 4XCVA 3UGKA 4M83A 1TUGA 1E6EA 1J20A 3U9SA 1ZK2A 4KRFA 3KRTA 4G4JA 3RC2A 3GIDA 4Z3DA 3EFBA 2AMYA 1XVTA 4RXTA 2VAVA 4W5JA 3UJNA 3IB3A 4KX5A 3KYJB 2J3EA 2QRMA 3C5EA 2OHJA 4R9NA 3FNRA 3UWOA 1JDNA 4EHLA 4KB5A 5KQRA 2O7SA 5CH3A 1YASA 3W9YA 1FFCA 2CHQA 2WPDA 4HTFB 3I8SA 3AGPA 1M2OB 1L4HA 1G21B 1XQ6A 1L5OA 2OFWA 3MF4A 4N0QA 4TXMA 3UMRA 2P40A 1PDVA 3FNIA 3HCDA 3ZI7A 3AVUA 2PZAA 4NEGA 3FNEA 4MQFA 2QVXX 1LX7A 2GPJA 5LXTF 2P9QA 1DCMA 1XZNA 5I9MA 5GONA 4D9CA 2QBYB 4K6HA 1YZLA 3EQZA 1ZVMA 2B78A 4G3XA 4WLNA 2YYYA 4YBRA 4L9AA 4ZV4A 2WR8A 3NPMA 4DSAA 3QKSB 2GYYA 3TBKA 2ZSJA 4MW6A 1NI5A 4ZVTA