3DVSX

Proteinase k by lb nanotmplate method after the second step of high dose on esrf id14-2 beamline
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Radiation damage in protein structural characterization by Synchrotron Radiation: State of the art and Nanotechnology-based perspective
rcsb
molecule tags Hydrolase
molecule keywords Proteinase K
total genus 99
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2008-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3dvsX00
2E1PA 3VYVA 3HJRA 5ARCA 2Z2YA 3GCWA 3I30X 1CNMA 1DBIA 3AFGA 2Z30A 2QTWB 3I34X 3QFHA 3LPDA 3LXUX 2W2OA 3DVQX 3P5BA 4OMCA 5AVKA 3EE6A 2P4EA 5SICE 2ID4A 2DP4E 2PQ2A 4M1ZA 1KE1A 1OYOA 1NDQA 1ST3A 1WMEA 4NE7A 3WQBA 3Q5GA 1C3LA 1GTG1 1HT3A 1T1GA 3D9QX 5AMXA 1GA4A 4LVNA 4WOBA 3TI9A 5JXJA 1SCAA 4KG7A 4Z2AA 2Z2XA 2Z57A 1TECE 1Y3FE 1SIBE 1YU6A 3F7OA 4BWGA 1WSDA 1SH7A 2XTJA 4H6WA 1YJBA 1GA6A 3DVRX 3DE4X 1S02A 2IY9A 1C9NA 3WIUA 1AV7A 5AQEA 3BGOS 1THMA 1R64A 2W2NA 2V8BA 4RYDA 1BJRE 4MZDA 4CG0A 4GI3A 3AJ9A 3VHQA 4ZOQI 1A2QA 4DWWA 1SVNA 1TM5E 3TECE 4AKTA 1R6VA 4YN3A 1TM1E 5ARBA 4ZARA 1Y3DE 2SBTA 4KB5A 1SBTA 1KDZA 1AH2A 2GKOA 1T1IA 2PWBA 1IAVA 1Y3CE 1AK9A 1C9JA 1SUCA 3GT4A 4OV6B 1SUEA 5B1DA 1KE2A 1P8JA 2ZRQA 2WV7A 1MPTA 3DDZX 2Z58A 1ST2A 1SUBA 1P7WA 1Y1KE 1ZVKA 1WMFA 2ST1A 1GT91 4FONA 3L1KA 3ZXXA 5B1EA 1UBNA 1TM4E 3GT3A 1SBNE 2W2MA 3QMPA 1Y4DE 5FAXA 3A3NA 4OMDA 3AJ8A 3VV3A 4B5LA 2IXTA 5CW1A 1SCDA 1GNVA 3CO0S 5K7SA 2SICE 1GNSA 1GTJ1 1Y9ZA 2PRKA 1KDVA 1BFKA 3UNXA 3PRKE 1Y33E 4JP8A 1PFGA 1SUPA 1SCBA 3EDYA 3TI7A 3QTLA 3BPSA 1NLUA 4J94A 3T41A 3WHIA 1GCIA 1OT5A 1BE6A 4CFYA 1SIUA 1T1EA 4C3VA 1SUAA 2DUJA 2G4VA 3DE7X 1SN7A 3VSBA 1JEAA 2PWAA 3DYBA 1BE8A 3EIFA 3LPAA 4DZTA 2WUVA 3DE0X 1LW6E 3DVSX 3LPCA 4H6VA 1GTL1 4WOCA 1SELA 1DUIA 4C3UA 1SCJA 1MEEA 1WMDA 1EGQA 3F7MA 3BX1A 1TMGE 4DJ5X 1Y4AE 2PYZA 1SBHA 3DW3X 1PEKE 1V5IA 3DWEX 1BFUA 1PTKA 1Y48E 4NE9A 1CSEE 4NMXB 1TM3E 5FBZA 1C9MA 3Q40A 5JXHA 2PMWB 3F49S 3WIVA 3OSZA 1V6CA 2WWTA 1TK2A 1Y34E 3I2YX 3VV2A 1PJ8A 1SUDA 2W2PA 3DE2X 1KDYA 4H6XA 4CFZA 1BH6A 1Q5PA 1VSBA 3PTLA 3SQOA 5AVJA 3SICE 2Z56A 2SNIE 3I37X 1EA7A 1S2NA 1AVTA 2B6NA 2XRMA 2ZWOA 3D43A 4K8RB 1IC6A 2W2QA 1R0RE 5JXGA 2WUWE 1OYVA 2SECE 1AQNA 4I0WB 1S01A 3DE3X 2X8JA 4LVOA 2HPZA 1TO2E 1Y3BE 1GA1A 3H42B 1NDUA 2X8JB 4KPGA 2PKCA 3VTAA 1XF1A 2HD4A 3DE1X 1SBIA 1TM7E 5FFNA 2ZWPA 1P7VA 4AKSA 1TO1E 3DE5X 1SCNE 1SPBS 1YJAA 1WVMA 3A3PA 2ID8A 3ZXYA 2TECE 2Z2ZA 3CNQS 4HX2A 1ZVJA 1SIOA 1SBCA 3DW1X 5I9SA 4HVLA 5JXIA 3DE6X 5JMOA 5ARDA 3A3OA 1YJCA 2DQKA 3GCXA 1AF4A 1AU9A
chains in the Genus database with same CATH superfamily
1ZIYA 4J7XA 2WQ6A 4RV9A 5IJWA 4Q03A 3IMCA 3RIMA 3LUPA 1F6BA 3OQ1A 1QGDA 1WKCA 4PYKA 4R1TA 5FFFA 2HRBA 1XMXA 1JKXA 2WVJA 4PWZA 2GEKA 4J0IA 5K0SA 1GAJA 5ESWA 1TMKA 5IF3A 3DC7A 4O5OA 1GRRA 5JNVA 4PCAA 4UHJA 2XB2A 4TLBA 4W1QA 1G2OA 2B92A 3MTBA 4FHZA 3L1IA 1QP0A 2ZKIA 3HXPA 3LTNC 4KSBA 4LQDA 4UU7A 4V0QA 2Z2XA 4E21A 4UEKA 1BNCA 4N4AA 1NXQA 1LLUA 4FMDB 2WF8A 1T0IA 1ZXBA 3A36A 2Z3WA 2XXAB 4PLFA 1P7YA 1MO5A 3HB0A 4ZICA 3QV2A 4P4TA 4RK1A 1A8QA 1J00A 4TXLA 2R7KA 5I7WA 4MPTA 1Q83A 4MINA 4IBOA 1FF9A 2QYHA 4ZOCA 3V48A 1AKQA 2R44A 5JS7A 2ATIA 3KHSA 2PBRA 2VDMB 3UT5A 2QUHA 4I50A 1CEEA 1H3NA 3D0RA 3P9NA 1SUCA 4U5XA 4ZDJA 4RPIA 3AKCA 3COSA 3O21A 5JQGF 4PSUA 1Y81A 2G1JA 4NOKA 2NSLA 4ERXA 2ZUFA 1KETA 2FSVA 4R1SA 4D56A 1E6WA 1PJLA 2A9RA 3FSJX 4QA9A 3SF0A 5HRAA 1O6BA 2EFYA 2OD9A 2Y1EA 4MUEA 3I9MA 4J07A 3R5JA 2A5DA 3MYRA 3QU9A 3UGKA 4DKXA 4IFIA 4P22A 1N3YA 4PBRA 2DPYA 3FUTA 1QVZA 1QP8A 4MEBA 3H9GA 1OH7A 2Z8XA 1ODFA 4FD2A 4WKPA 5HKLA 3DBOB 4BKRA 3DHVA 1QHHB 1CFZA 2P8SA 4OHRA 3TI7A 4P5EA 2Q0HA 3OZBA 4KTVE 3ELDA 2FDCA 3TRHA 1UZUA 5K3EA 2AA3A 1PV1A 4ZOBA 2PSDA 4YV0A 5EHNA 4QUIA 4ENTA 1NYLA 2D2VA 4IZIA 3DEIA 5LZ8A 2LNDA 5FRDA 4C4SA 2ZRCA 1G8YA 1ESDA 2C4HA 3AF2A 3U4HA 4MB6A 2YY5A 2IXGA 4A15A 3X0DA 2RKOA 4MVJD 4RHTA 2EZTA 4UTRA 5JDCA 4U6SA 4ZMSA 2ZANA 2H5JA 4Y6QA 1M1NA 3TTVA 1JG3A 2IF0A 5J23A 3V1MA 1DP4A 4PHTA 1F0YA 1Q11A 2VXCA 4LJ4A 4D9JA 1KZ7B 3P2JA 1X1SA 2YASA 4P0TA 3OIFA 3G0GA 2ZBRA 2F3SA 4FXPA 1Z7WA 2WJWA 2WUWE 1C1DB 1VMEA 4Q1BA 1WO8A 1M7GA 4TN1A 4XGRA 3T9FA 2OC9A 1UODA 3T3DA 2CDCA 4GM0A 4MYDA 3QHAA 1ISRA 1X3LA 1KPGA 1D3AA 5E1OA 2QORA 4GLOA 3E3NA 3NKLA 3EIOA 3X43A 1J7JA 4W8HA 2F8LA 4M87A 5GJCA 2J3JA 4KE8A 3NTVA 3DVAB 6PFKA 1R9MA 2Y1LA 1UXIA 5TMEA 1XKQA 2L82A 2JJYA 2X9NA 4FE3A 1P18A 2F9FA 2AI1A 4U3JB 4Y18A 5EJAA 4BO2A 5AESA 3PWZA 4RVSA 1D0IA 2QE7D 4X6UA 3DOJA 1PLLA 3GUVA 1E3LA 2I1VB 4RLQA 5EZYB 1NASA 3TSYA 5LKAA 1E2LA 1EWQA 2ZKLA 3CNHA 4NC9A 2OVBA 1C7QA 2KHZA 4HDQB 4JLMA 4LN1A 1K8RA 1ST3A 1XLVA 3MOSA 4HLUC 2VHTA 3KFVA 1A5TA 3VDRA 1JIQA 3KTAA 2JS7A 2AMVA 2GCNA 2XZTA 2FQXA 3H99A 4MIKA 3IERA 2FP3A 2OCDA 5JRDS 1UEJA 3GJ5A 4KNWA 1WSDA 3HADA 3F8TA 2X0DA 3VO9A 2EP5A 3FB4A 1JDJA 4C88A 1PW7A 3X1DA 3BWVA 5KCMA 3L7DA 3WIUA 3DFUA 3I3OA 1TYCA 8AT1A 3A7EA 2NTYC 3BDIA 3QMVA 2FAXA 1CY0A 1WOMA 1ONPA 2ZJAA 4HQRA 1JVNA 3WISA 4E6EA 4JVOA 2J6BA 1YQTA 3ZI4A 5BNZA 2RGEA 4BO8A 5BR1A 4MWGA 3K2EA 2Y0EA 1QAOA 1NVXQ 3E4CA 3VC2A 2O8CB 1YNOA 2P2SA 3J81k 3AVYA 4UCXA 3ENNA 2YFYA 1TVKB 1MV8A 4MR9B 2W9XA 3FTEA 1NUHA 2KI5A 1IHUA 3HP4A 1YBMA 4IHJF 1M73E 5A6SB 3ICWA 4XGKA 5BRJA 1WG8A 3OZSA 3R7FA 3ZXXA 2BEUA 2G5PA 2Y68A 3FF1A 1WNFA 4D6XA 4WCFA 5BWNA 3PGMA 3Q5DA 4HAZA 1MB0A 1XROA 2OOSA 4FFPA 4RM3A 2NP6A 1WCXA 2XUZA 1LLDA 2JJ1A 1AUVA 2FPLA 2PTGA 1SVLA 1Z5ZA 2VC2B 5SYNA 4U7WA 5HJ7A 1OF1A 2FQ1A 5EIOA 3R77A 1PL0A 2GZMA 3DPIA 3GDHA 4WXEA 1MB9A 3BPSA 1R7RA 3WHIA 4YRIA 1OWPA 2HMAA 3FDZB 3G89A 2IYOA 1PHPA 1VYHA 1AN0A 3MWYW 4K3UA 4WBNF 5I9LA 5J4HA 3EUAA 2VHQA 1RBZA 2D0PB 5KTTA 4L8WB 1ISMA 2XVAA 1OAOA 2HMWA 5F78A 3VYTB 5LYYA 4P32A 4K40A 1P1RA 1QLWA 3LLUA 3NTOA 3KM0A 3L6DA 1XDSA 3TZQA 2QBYA 3ZHSA 4DQUA 4YHHB 3DGFC 4ODIA 1BFUA 1K5HA 3EGXA 5G3ZA 1RRPA 4P84A 5JAHA 5JQGA 3ACCA 4O3MA 3TKYA 4UEQA 3KR1A 3COWA 1SCUA 4M0MA 1I01A 1QBKC 4CM8A 3BSSA 2DTDA 2JHFA 3PR3A 2A5LA 3UIEA 3DZKA 1XZFA 4BECA 2FPSA 3TSCA 4ZI2A 4CLOA 2AGVA 5TMPA 2BKEA 3FCOA 4KDRA 3BFPA 2A1IA 2PLAA 2G25A 4J7AA 3PU6A 1BE1A 4RKQA 2XWBF 1Z5GA 2C9DA 1SOUA 3N86A 4UQPA 5D00A 3T34A 4DM7A 2HFKA 1QIEA 1SA0A 3EZNA 5HUHA 2E4WA 4N18A 4P86A 2CY0A 2W6JA 5JROA 5SZJA 2XWPA 3OZAA 3TTWA 1T34A 5FKJA 3AERA 2ACEA 1DEXA 2W98A 5DF1A 5F2KA 1RVDA 2GT1A 3K2QA 5ALGA 1SD1A 4Q3CA 1FFEA 4OUDA 4QOJA 4P3OA 5G4KB 1DBIA 2GX6A 4JK3A 5CM8B 3LBAA 1RZUA 3R7DA 2A33A 3GW8A 1V8ZA 1NVBA 3HBAA 5IKEA 3OWXA 3OF3A 2ZB8A 4IX1A 1TIKA 1JU3A 4H3KB 4ER7A 2R7LA 2WZDA 2C7PA 2LDBA 3K3PA 2DU8A 2FUNB 1G18A 4NOJA 3BORA 2MINB 2Q50A 2BJHA 2XMCA 5LKRA 4URZR 2OZLB 4J0GA 4BWGA 3RT9A 4B3BA 1J0BA 3EA5A 3EPPA 1VLHA 4F38A 5I7HA 2YC2C 3OA0A 4RULA 1L8QA 2VQFB 1JA1A 3SLKA 1JI3A 2PBZA 2OAQ1 2IEYA 1ZCFA 3MQ2A 4UDXX 4EEZA 5GTDA 1XQXA 3CRNA 1JRLA 6LDHA 3FNQA 4QREA 4EG1A 3LY9A 1XZIA 1LQUA 3RU9A 3GARA 4LX8A 4KLCA 1ZC4A 3WNVA 1XTVA 1UF9A 2VWGA 3PQEA 1ITZA 1EE2A 3UJ6A 2O1WA 1XRQA 1SVOA 3DHYA 1OFTA 1PZFA 2JBAA 3U3KA 3UJBA 3H9UA 1MG0A 2WAOA 3P2YA 3QBDA 4WZAE 1HDXA 3V46A 1R6AA 2K5UA 3UXMA 3X1WA 2XOXA 4A5OA 2MIIA 1NNUA 3SBOA 4QQNA 2JKZA 1MXFA 3RTEA 2O54A 3DLTA 4HMQA 4QL3A 5HBRA 5L7YA 4YV2A 2J9FB 1A5SB 1M6HA 2B7BA 3UPDA 5T64A 1DWOA 3OH8A 4I14A 4AIRA 2ZJ5A 4C05A 3E2MA 4LTMA 2QX8A 4MVJF 4YRAA 2OB2A 1N2ZA 1XHLA 2QRPA 3P20A 1Q2UA 4YGYA 3THXB 4YCJA 1S8FA 4JA0A 1CQXA 3QXCA 4WCDA 3QUSA 2JGMA 1HYHA 3TCXB 4GYJA 4BNNA 1PK8A 3BH6A 2CHUA 4PANA 1RXIA 1HDYA 1YH3A 3WLJA 1WUHS 5KSPA 3V80A 2AUTA 1EH5A 3RTGA 5DLQC 4GWGA 3V8QA 1W4BA 3IPRA 4OXIA 1YE3A 2V5AA 4KWCA 1MX3A 2JIPA 4IL5A 2DKFA 2ZJYA 4EO4A 3QKIA 4JSYA 1WBJB 3OBBA 2NU8A 3RRJA 1T43A 4PPNA 5SZKB 1YVUA 4MJLA 2COEA 4TYYA 1DJPA 2Q4OA 1DU4A 3OLCX 5DXAA 4IMIB 4OVKA 1NI3A 2QV0A 4WY5A 2BY4A 4HUQB 4AF6A 2GUGA 2EWWA 5TR9A 5E38A 3LDUA 5ILOA 1FXWF 1KPIA 5CA0F 3T3NA 1E2KA 3QLJA 4I7EA 3W9UA 1KO4A 3GELA 4ND8B 2FV8A 1C8KA 2AD1A 3MMXA 2QLBA 1EG7A 5HJ5A 3MELA 4D25A 1ZHHA 3H9CA 3IMGA 2FR0A 3WP1B 1COWD 2ZWPA 3PF9A 4O1HA 1KAEA 3D54D 3A3PA 2QB5A 1RRGA 5DI3A 1MTZA 4X00A 5EZYF 5JDIC 4MQ5A 4GKKB 3LW7A 3U80A 3HXMA 5BOSB 1T25A 1TZ2A 2WHRA 4MOWA 2RGDA 2R6JA 1A82A 2RGGA 3RYFB 1RP1A 1JFFB 2V7WA 3D3QA 3FIUA 3ORRA 4R9VA 1REQA 3M9LA 2FVXA 2NPIA 3YASA 2Z2YA 1EP9A 3DZJA 3FVQA 2FJUA 4BZWA 2BDUA 2J0EA 3MOIA 1L2TA 2Z30A 4E6PA 2X0NA 1I3NA 3IIIA 3QWBA 4YS6A 2C2BA 2ZE8A 3RFCA 3ITEA 5AVKA 2YFQA 2I2CA 1SB8A 4W5QA 3KFLA 3ZDDA 3N2ZB 1ZOSA 4AJOA 2I4NA 2XKAA 3E9DA 4KLRA 4RE5A 5ILGA 3DV2A 4A1FA 1UKVY 2D8AA 3ZE2B 4ZHSA 3UMMA 1H2FA 4BZQA 4OBWA 2W6NA 1MHTA 2HO5A 2ZJ8A 4FDMA 1U80A 4M37A 4KO2S 4XLTA 5BT9A 5AVZA 1G3IA 3W9SA 4URHA 4K03A 2BW0A 4J4BA 4L8GA 1DMRA 1S02A 3H5OA 1Q7CA 3GMTA 4JBWA 4LOJA 2O14A 2ZI5A 1P0FA 3C74A 2H16A 4ESVA 4NU5A 4BBPA 2O0JA 3W3AD 3K5HA 1JPNA 3WQQA 4TV8B 4DLVA 3EBOA 1NW6A 1FFWA 5LJLA 5IKPA 1EJ6A 2A1UB 3CEJA 3IP3A 2D1RA 1L7BA 1NGSA 3GJSA 3MMPA 2QMOA 2VJOA 1MH9A 3RB8A 5BWOA 5DIFA 3LT1A 1Y3HA 1NQOA 1JEQA 4LSZA 5CYFA 1HDRA 1NBMD 2BF4A 1Y7PA 2RC5A 3AU8A 4F8EA 1NY6A 3IE0A 3QKRA 4MWEA 4LJ5A 4O4IB 2OXRA 1DTWB 1PD1A 2Z09A 3E22B 4N0QA 4IH1A 1U31A 4N7BA 3WNBA 3QX8A 2NV6A 4OB6A 4A0GA 3KVYA 4W5NA 1BZYA 1DAPA 1KSJA 1WLYA 2EYQA 2O2SA 5I6DA 1W36C 3USES 3GZ4A 1GHTA 1EHIA 1Z0FA 2PRKA 3ELWA 1J70A 1N0WA 3L4BC 4YWJA 2CT8A 1VJ0A 3TL2A 3UBMA 1BXRA 3CBQA 4FQ5A 4CMAA 5F7XA 3BQNB 3NTUA 2HDWA 1J1ZA 3D5TA 3FSRA 4C7VA 3RWBA 2VP6A 1Z0DA 2HJWA 2FHPA 3RD5A 4WGFA 4GRAA 3ZDRA 1OV4A 2X9VA 4B3FX 1NG9A 2J0SA 1GARA 4Q47A 1G66A 3DKPA 2JG3A 2X4DA 3LO5A 4O2RA 4R2WA 2X6RA 4LZOA 1A9PA 1O97D 1O9BA 1OBHA 1LTKA 3B9RA 3D5QA 4FFVA 3UOAB 4NFSA 4QTTB 4A8TA 4ZHQB 2G7ZA 5LPNA 1E77A 4PG6A 3AOEA 3VR4A 1G0NA 3KC2A 4H3VA 1F7UA 3THSA 5E6SA 5FPHA 1KJ8A 1U0RA 3LC7O 2FMXA 1JHVA 2ZS7A 4K05A 4BIIA 1GGNA 4BMPB 2CCGA 5EHZA 3K94A 2FMKA 3IPXA 4PPGA 3BRSA 5D2CA 2M1ZA 1CQJB 3RBXA 1N2GA 16PKA 4TS4A 5HK9A 3PQ8A 4B76A 2P9YA 2A3RA 1HK7A 3B6JA 1KEWA 4AZ3B 3NX4A 1RAAA 3OCVA 3Q1KA 5CT8A 4W1PA 2AE1A 5BSVA 1F8XA 1S2GA 2QA5A 3NHSA 2O06A 4TXMA 4BFZA 5C4MA 1ORIA 3IAHA 1O9HA 3R5FA 5C3UA 3SIXA 5JH7F 1SWVA 4R1PA 3VH1A 2Q5JA 3TIGA 1ZNZA 3O4JA 5LLTA 1LC3A 2ODWA 5K4HA 2C7BA 1CS0B 3B8EA 2MHCA 4RE6A 3DCIA 5KYUA 5WRFA 2Q2VA 1CF2O 2X76A 2ZB7A 4UZEA 4AJEA 3DVQX 1R0BA 3E9ZA 5DXFA 1T5TA 3AIOA 4R84A 1IWPB 2QDKA 1U0HC 4JLBA 4RK4A 4OHPA 3SKVA 1C80A 4OB8A 4BQOA 2JLVA 1JHDA 3FCCA 3QU4A 5TC4A 3MINA 4DV6B 4Q3AA 3HSSA 3NKFA 4K9LA 4CMGA 4ARCA 3RUAA 4G0PA 3Q12A 2QEQA 3GAMA 2INGX 2XMZA 4O2BA 1AV6A 3OX3A 1JHAA 1R6DA 3ACBA 2NUTB 2YWHA 2OESA 3VHQA 4HXGA 3HB5X 2ISCA 4R1NA 2B30A 1U04A 4YV7A 3QFRA 1M1XB 2GM3A 2ZT7A 1QV9A 5BVGB 3WWOA 1USUA 3VPBA 2OCGA 4DLYA 1ZHOA 1JR4A 1I5EA 4KRYA 1F6DA 3GVPA 4KMMA 3L1HA 2ZK7A 2FXVA 2OGZA 3P2OA 3QJ5A 1KGSA 2Z83A 1L7MA 4YT5A 1Q84A 1UMCA 3AUFA 4ZK2A 1TVMA 2O1XA 4AZVA 1I4TD 2YR0A 2ZJ0A 1AGNA 2FEKA 1QZZA 1VDZA 3D64A 3NFYA 3K30A 3T06B 2XVZA 4BRZA 4DLBA 1EFPB 1YMQA 2VJAA 3IKVA 3BMNA 5CW1A 3WGTA 2XB4A 4AY4A 3AWDA 5LP6B 1Y6FA 4IQGA 3U1TA 4V2IA 1ULTA 4B8ZA 3VZRA 1LPNA 4MKIA 2WSSD 1I6MA 3Q7SA 5DI3B 1RXSA 2NVUB 1AQYA 3L1VA 2H6EA 2HM7A 1DKNA 3C8HA 3DGEC 2IYNA 3DT8A 3EGDB 3JWPA 4JB0A 4OKSA 1BH2A 4YLEA 1W9HA 5FT9A 1X1CA 3GRKA 2H54A 3A9CA 5JY1A 4BN4A 4MQEB 4NECA 4HQNA 4J29A 2W6IA 5E7QA 1YBFA 3CU5A 2P9CA 4X9XA 5AI0A 4I50B 5DN9A 3L9WA 1I0LA 3M2PA 3RVOA 3JPYA 3AIKA 4HG2A 1VE3A 2ETXA 3FDIA 1QV6A 1VSQA 1OZ0A 3O31A 1UDAA 4UM9B 5C1OA 3KKZA 4BASA 2R8YA 3AM1A 1CJCA 1XTIA 3CN7A 3H8VA 3B1KA 2UXCB 4X6XA 3HM9A 1KQNA 1NJ6A 4D81A 4XOUA 3INNA 4J16A 4XM2A 3NBFA 4ATNA 2BR3A 4D6YA 4F5YA 4L95C 5HGJA 4YWHA 2GZ2A 1YFKA 3WWZA 5KSZA 2YTZA 4A4DA 5JO0A 2HHJA 2DWQA 3GJYA 4HH3C 1FB5A 1UIMA 4QGBA 4GQIA 4TX1A 4G0WA 3OI7A 1HQCA 1Z0SA 3D02A 4KV7A 5FOUA 4RZHA 4KWTA 4BRSA 1NXPA 5HJ2A 2JHGA 4OBXA 8OHMA 3DFMA 1YSCA 2J41A 4AW9A 3EOAI 2Z2ZA 2ODPA 3KB8A 4F2GA 1E2IA 1P9OA 5F33A 5DP2A 3UJ8A 3WADA 3ZCRA 4N48A 4HFNA 3RIYA 4N5MA 3L7BA 2B1QA 3TUJC 5C5CA 1YOBA 4IJVA 2IS1A 5CH5A 4DMFA 1QH0A 3VZDA 5HQJA 2JGIA 1ZEMA 3SIWA 1B6SA 3CSDA 3N05A 2E6KA 4I46A 1CIJA 1GSOA 1N2CB 3E4DA 1T35A 1PR5A 5CB0A 2RGAA 4GOMD 5JJ5A 5K0ZA 1PR4A 1GO2A 2BP7A 1RRVA 5GM2A 4C2UA 1OREA 1MV5A 2NTNA 2B8TA 4AD8A 3ZYCA 1DRVA 5CLJA 3I04M 1JQEA 1EFAA 5EMHA 3W1VA 1C3LA 2I6TA 4HSGA 4OXXA 1QFSA 3T5CA 4YMHA 4MULA 2IYAA 3C5CA 5DT2A 1EFKA 1TKRA 1U3TA 5HMMA 4EOGA 3JQGA 3PIDA 3MAAC 2X9GA 3DXXA 4KK3A 3HJNA 4CM1A 1AMOA 4OH7A 3P9RA 1N2HA 2A78A 2H1HA 1ZYUA 1TYAE 2J31A 3FKQA 3D2AA 4G0ZA 3FYUC 3JYNA 2IRWA 1IM2A 3PUWA 4HH0A 4OQMA 2D2FA 4UNNA 5FUBA 4ARIA 3OUZA 1H22A 5ED0A 1U9YA 4NZYA 2ECOA 3OMLA 2E37A 2VHJA 4P7KA 1MAWA 2C7GA 2H7VA 3H5LA 5E6SB 4D6PA 1ZGHA 1Y3DE 1TI7A 4FZ5A 3DL0A 3EGVA 3JD1A 4ZHQA 2VF8A 2XLCA 3MS7A 5JXIA 5F3WB 2ZIUB 3RT1A 1OH8A 5CVCA 3H9JA 3U4AA 1TTQB 1CQIA 2D5BA 1IUPA 1Z26A 2G4CA 4L5YA 4C03A 3NHWA 1ZVKA 2Q1WA 3HCNA 4H6PA 1XG5A 3GU3A 3J80A 1Z36A 1XWFA 1OI3A 3FN4A 3IEUA 3MJHA 4PWYA 2Q5FA 2IELA 2ZDGA 4GMKA 1FTYA 1ZJ5A 2YWBA 2NAPA 4RMNA 2I2AA 3W8FA 4C5AA 1LI4A 3VM6A 1K89A 4KWHA 4QPDA 3GP5A 1M6YA 3TJRA 2O19A 1PRYA 2QGZA 5AVSA 5CD9A 1I51A 3GOQA 3G2OA 3U9LA 1Z4PX 5KMGA 2QNIA 3MGCA 2ZTVA 3F6EX 2I3BA 2IBMA 3PJRA 3F8SA 4CKBA 1YRQA 3MK31 4JQZA 3DA8A 1X1DA 5LBTA 3ZV3A 1JG7A 2CLLB 3LC0A 4P3YA 3FJYA 4ZHQF 2XV1A 3L01A 3EIXA 3T12A 4GRDA 2ZUBA 3PQ3A 9ABPA 3VGPA 4I8IA 1N6PA 4XVHA 1JYSA 4RVFA 1C4KA 5D5HA 4D8XA 3WAGA 3G7SA 4QEZA 2OO5A 1ISFA 5IT5A 2ZYAA 1RABA 5I9MA 4B3GA 3HMQA 3L7OA 4F9GA 5DNWA 5EAIA 2RI0A 3D3NA 3OT1A 3HCRA 1WF3A 1AVTA 4N40A 3VKGA 2OR3A 4N5LA 1C1DA 1XTBA 4Q01A 4XIFA 4C6RA 5K0FA 4H59A 3UA4A 4DLRA 3EXAA 4UEJA 1S01A 2H0AA 2IA5A 2WQ7A 3R9XB 1XZHA 1II8B 1Z88A 2II6A 4HB4A 5E1DA 2HXSA 2J46A 4HUQA 5F4BA 3RCBA 1Z73A 1J2EA 5D86A 4D9GA 5L3RA 4DR1B 1X13A 4PXAA 2VTEA 3WI7A 5LQNA 1BMFD 3P71T 1PT6A 1JXOA 1M1NB 4J1NA 2WICA 4FYPA 3NXKA 4DQKA 5C3MA 1LRLA 4HVLA 3SQXA 3GJZA 2HI0A 1YQQA 4BVLA 4IIGA 4EHNA 4PC7A 1TADA 4G5HA 4LMRA 4UMFA 4CIXA 2HCRA 3IA7A 2MYTA 2ZUEA 4BBJA 4L3WA 2WMOB 5IUKC 2GBCA 1XV5A 4PIPA 4IWNA 2PX4A 4N3CA 1IOLA 4MDYA 1W5BA 2JEOA 4KYTA 4U9HS 3JQFC 3UG7A 3W5AA 3DT6A 1WL8A 1G98A 1RYMA 1NJGA 2BZ0A 1L5MA 2O5VA 4XOIA 1PGJA 5F5LA 2BONA 3SC2A 1PWEA 4E15A 2ZUDA 1P2DA 2QTAA 2G9UA 4DNOA 2VHUA 1O3YA 3MGBA 2Z98A 3H6HA 2CDRA 4IJUA 2GFIA 4MV9A 2R6AA 4P3KA 3U61B 4L7VA 1P8AA 1Z3CA 3GRZA 3TLJA 1IWBB 2V8BA 3ONWA 3MCAA 2A1TS 2P6PA 2VRWA 3AL2A 3I2GA 4KI0A 4L6AA 4BKUA 3ZDAA 5FWXA 4LJSA 3AVWA 2XT6A 2ZIVB 4MYSA 1JPUA 1DKQA 4W9RA 4NG5A 3WGKA 4KZKA 1XDUA 3OPMA 4BYGA 1IJFA 1E9AA 5A0VA 2VUIB 4UUBA 2HGSA 1NT2A 2P3LA 1G4HA 4PQGA 1S6YA 2BEWA 3EIUA 5KJFA 3G2HA 1PUIA 3STVA 3UQZA 4BKPA 2GBPA 1NNSA 1SBNE 4WAUA 1E7SA 3BBLA 2BEVA 3ND7A 5ECDA 5DGTA 4KPFC 4GO1A 4OJNA 2IYFA 3S70A 1Q0TA 3L7CA 1EUDB 2GPYA 1BRMA 3AV3A 4CDRA 3VZPA 1CP2A 3HV0A 4JX8A 2FSVC 2YWFA 3QLUC 1KY4A 1NMQA 1Q77A 3CM0A 3OMXA 2H7XA 5FPYA 1IPFA 2JBHA 1RBMA 1B7GO 3H8JA 4OQ4A 5B1HA 1MT0A 1U2RA 3VUFA 1GGHA 2IUEA 3BHJA 4M8KA 1Z16A 2D4HA 1JTFA 3VZSA 4IM7A 1YDHA 1NM5A 1UP4A 1SXJE 1U2QA 2GXUA 2H1SA 2VL7A 3CIOA 3LPAA 3TE6A 1YL7A 2PS9A 5ESDA 2HAEA 2ZCUA 1U3UA 1NJ8A 2ZFUA 3V6MA 3ET5A 4BP3A 3GZNA 2XGSA 4MRMA 2ECPA 4UE2A 3VH3A 3O1IC 4C0AC 2VXYA 2K4MA 2BI4A 4DC0A 1JG4A 2RHTA 4BZXA 4ESEA 2V98A 3AFNA 1T3HA 5CFRA 5LM3A 2B9VA 5IF9A 1KZ4A 4QRDA 1JFRA 5G53C 3BRWA 3L77A 3EUFA 4C0WA 2ZRPA 4YMIA 2I1LA 4O2AF 4ABTA 2GXAA 4B3TB 2G06A 3QSGA 3BWYA 2O3UA 2X40A 3FNHA 1T0JB 4L2IA 4EABA 4CIYA 3GN2A 5KHLB 4LEIA 1OBVA 5JHHB 3B51X 2P5TB 4CL8A 1Y1RA 4CKCB 4WKNA 2F4NA 1GSIA 3JWIA 4NK5A 3MWGA 1QFMA 5L4NA 4PLPA 3ONDA 2EP7A 3NPAA 1Q1QA 5TGTA 4AG3A 1BHJA 1XK6A 4AG5A 1I3MA 3R4CA 1AE1A 3ETCA 3L0DA 4R5HA 2MR6A 3KXKA 4KQWA 4Y6OA 1L5KA 3NOQA 4ND3A 3MUNA 3E05A 1AB6A 3GIWA 3NOVA 1L4BA 3LP5A 3IUYA 2AMLA 1GQOA 4J43A 4PG5A 4AC9A 4R01A 4RXMA 3PFBA 2OO7A 3D6FA 4II2A 4LI0A 4ITUA 1YACA 4L85A 4UTOA 1PFUA 3CNNA 4TTAA 3ZU3A 1C3VA 2COUA 4Q4JB 3B82A 4WZAA 2QRVB 1NRWA 4G0NA 1CY7A 2X7JA 4C2BA 4LJ8A 1P7CA 5KJEA 4ER6A 1SK9A 3Q5GA 3R9IA 4YAKA 3RIGA 3ZJ4A 3C6MA 5ABPA 2PUAA 5I3ZA 5HUJA 3NYWA 1U81A 3MN1A 5TEVA 1J97A 4BL5A 4L0CA 2RC6A 2WFLB 4EUEA 1SOAA 4C0SA 2UVDA 1MO3A 1B43A 3ML1A 2PZJA 1UXHA 2HRDA 3LKZA 1E98A 1T6XA 2AEJA 1QWSA 3I9KA 2RBEA 3ORSA 4LX0A 5FB3A 5A71A 3WA6A 3BIXA 1U94A 4JR1A 1TXGA 2VF7A 5E6UA 4Y9SA 2C2XA 2NUTA 1YA8A 1XCJA 2BP7B 3IDQA 4FEAA 4H7EA 5EIBC 1L4FA 1BFDA 3W2TA 1U0GA 1T9GS 3B89A 1SD2A 3ZN2A 5EJEA 5JT1A 2CXHA 2P9QA 1A8SA 1IHXA 3I01M 4I6EA 4LE2A 1CQWA 3UV3A 1P0IA 4YP9A 1T2FA 4AN4A 3NIFB 2KX7A 3ONVA 5TLSA 4D4IA 4ILKA 1APBA 1XRMA 3V8RA 1E2QA 5INTA 4AULA 1F20A 2NZVG 5FULA 2XZLA 1RLTA 4ZO8A 4ZV9A 4NSNA 4ZPXA 2BKUA 2QD5A 4AFNA 5KTNA 1AGXA 1NUUA 2AIRA 2YC4C 2G9NA 1A4UA 3JZAA 1SU4A 4YCSA 3DO8A 5EKTA 2BMWA 4JYAB 2CJWB 4DSUA 2OHVA 2A59A 1E2UA 3OJOA 2ZJ2A 2FLWA 3BB4A 1PJ4A 3P4UA 3ORHA 5C7YA 1OB5A 1BU5A 2JF0A 4EATA 3GJ0A 5ETJA 4Z2YA 2CNNA 2V45A 1E1CA 4YGXB 5EFZA 1B41A 4QPPA 3RFVA 2RGRA 1PJQA 3KSAC 1I1NA 4BFUA 1SHTX 3QVGA 2Y1WA 1LQTA 3GA5A 1E9FA 3W6PA 1QP4A 3HKEB 1M6NA 1Y63A 1DKUA 3JQ9A 3NBAA 5IAKA 3VC7A 2I2XB 4D4GA 3U4QB 1HGXA 4MITA 5I4IA 2CFRA 1KMNA 3UFXA 4TRJA 3K09A 1LVUA 1RRMA 4FYYA 1R4MB 3BDAA 3PC2A 4YCNA 4BBZA 2C5SA 1H8HA 1T4BA 1XDDA 4KGXA 1KDRA 1XJ0A 4LZAA 4ETWA 4KMOA 4YPVA 5MHTA 2IF2A 4MK4A 1O77A 1BHO1 1E7QA 1P4GA 2A30A 3DJFA 4PF1A 3T5DA 3TOXA 1W0KA 2BFFA 1PTKA 5ES4B 2B1GA 4KOAA 4FBGA 1NBEA 2VPTA 2YYSA 2YWJA 3DHEA 1EQUA 1A8UA 4X66B 1ECLA 1XD8A 2AR9A 4QT4A 3TW4A 5A4KA 1YGPA 3THXA 1WZIA 3DCJA 1WZNA 3Q3IA 3AP3A 4UUNA 1TYEB 1UJ5A 3HXLA 4UMVA 2B6NA 1Y98A 2WSLA 5BURA 4MVXA 4K9RA 5DM4A 4TQ9A 4QYXA 4Q1AA 2AG8A 1NBAA 4JBLA 1S2IA 5EWMA 3F47A 1YRBA 3HMKA 3TZCA 2R79A 4OHVA 1O5OA 2EX4A 2P2DA 3Q88A 4LVUA 1EINA 2OWEA 4H1TA 3TSZA 4DA6A 4A91A 4WLEA 3H1TA 1YQWA 4E4YA 1IXKA 1J0AA 2HBZA 1PNQA 5JDCC 3HYSA 3VPFA 2Q21A 3WMEA 3ZWCA 5EIXA 2XRZA 3CS3A 1WB6A 4TZKA 5DBHX 2WI8A 1Z35A 1ESNA 3I4CA 2H0RA 4JLSA 5J1SB 2AHOA 3LZ6A 4GR5A 2R00A 1GV1A 2ZE5A 2VYVD 2HA6A 3I83A 4H15A 4I6GA 3T7AA 3UJCA 3L8EA 2RBGA 3VYVA 4E46A 5ARCA 3THWB 4BLVA 3V4OA 1EK2A 1IK6A 1C41A 4RBNA 5L3SB 5JCJA 1U11A 2AC7A 4ZWNA 4AI6A 1I2AA 1SGWA 1OHHA 2DBRA 4L9RA 1RWXA 4AY5A 2AN1A 3N2KA 3OO1A 3SPXA 3P0RA 4MXDA 3LSTA 4JI1B 4Q37A 3EVBA 1LRJA 4PC3A 1CRPA 3G17A 5G40A 1CUFA 4MW4A 4F1KA 1CZHA 3I1IA 3K1JA 1ODSA 1XLTC 1RKUA 2OAP1 5IKXA 2IP2A 3R4VA 1OKKA 1PR3A 1ZD3A 1Q15A 3KPUA 4YCLA 3VVCA 2Q5OA 1VFNA 2GCIA 2HBRA 2QRLA 4OUDB 3K0KA 3LJKA 1E1QD 4I2NA 4LDZA 4IGIA 3EIQA 4KXUA 4F7WA 1KAOA 1NBWB 2QD3A 4HDRB 5J5AA 2VPWA 1XQ1A 2WYUA 3H1EA 4QKQA 2H1IA 4FS3A 2QL6A 1E6LA 3TOVA 2I71A 5JI2E 1P3Y1 5E3JA 3SZ3A 3R3YA 1Q6YA 1E3SA 1RNLA 2FW7A 2AFRA 4OV6B 2YXLA 3WWYA 2JEYA 4MR8A 1XTRA 4FMDF 1VL0A 3V4FA 4CLRB 1GTSA 4WN9B 1JIUA 3TQRA 1NYQA 3HFGA 4LF4B 1O6FA 3VAAA 3VOSA 2Q8QA 1XVAA 2BSXA 2BGWA 4YAFA 1NVDA 4X45A 4BJ6A 3K9CA 2KSQA 1HUQA 4G1BA 1SIWA 3QP9A 1CQJA 1J9GA 2O2XA 4INAA 2CLCX 3I12A 4LOIA 1GQFA 1A2OA 3ZK7A 3ZDEA 5H16A 3VSDA 3F5FA 3ZY5A 2HSDA 4MZXA 4B48A 3LY7A 3D4LA 3UK6A 2C4TA 1NVMB 2DG2A 4OM7A 7MDHA 4GQAA 4YH1A 1CY6A 3ASZA 4COOA 1K8ZB 2PKWA 2VNAA 4JD5A 4LXQA 3OJFA 4ITVA 1XLWA 1YCFA 1YJ5A 4MWDA 4Y6LA 3RUFA 3W2EA 2Z6QA 2O2DA 3E7FA 1G6OA 1OVGA 4TRNA 5J40A 3TQFA 4BCBA 4DUGA 3E8XA 3ST7A 1XJ5A 4WOJA 4L3OA 1J2UA 3IKLA 5FL7A 2GZAA 4L74A 5F7ZA 2IYQA 1PFVA 5ICSA 4HVTA 4F6RA 2BELA 1C9EA 2W48A 2UZAA 5K5EA 2G9QA 2HYIC 1QKJA 2I7TA 1VG8A 2VA8A 4LPSA 1K4KA 2ZAYA 2VPYA 1UBEA 2PKQP 3KQTA 2R6GA 1P81A 2X5KO 3HCOA 4GFDA 1MG5A 2FWAA 1KZ9A 3LP8A 1O4WA 5AI9A 3IHWA 4J3FA 5B3JA 3WYEA 1ZRHA 5D85A 4OMUA 5HTKA 3CWCA 2XRMA 4YPFA 2HL6A 3COVA 2JFXA 4JLDA 2WJZB 2WF6A 2ZTHA 3FVVA 3HCWA 1DJNA 1ZUNB 3C5HA 1QGZA 4PGFA 4IG9A 1T1SA 3MOGA 2JAHA 1EWKA 4PHHA 4XWGA 1UZLA 3OLYA 4K9OA 2X2EA 3R9WA 3GZJA 1FPMA 4KXQA 1Z4QA 1Q1AA 4XRGA 1W5EA 1V5GA 1PFKA 2H48A 2IW1A 1BWRA 1UBKS 2VLIA 3FLBA 4K6OA 4RFSB 4NXNB 1HRDA 3CF6R 1QV7A 3G02A 1UDCA 1UBMS 1ZGCA 2JJMA 4Q4DA 5C31A 2DQKA 2BFEB 2O7QA 1M9NA 4KZPA 2NIPA 1N34B 2E1PA 3M2TA 2ID9A 5LFAA 2VT3A 1FPQA 5DW0A 5DI9A 1L5FA 2VHCA 4UUQA 4OMCA 2VOEA 1E62A 3LKBA 4FN5A 4E22A 3U7QA 3RAFC 4LYYA 2XGGA 5KHOC 4MS4B 2WFMA 1O95A 4NAUA 2OB1A 4CG1A 2RGWA 1P4RA 3RUPA 3S2UA 3NBYC 3QPBA 2UYOA 1PO7A 2G72A 3W8NA 4XYLA 1RPAA 1Z38A 4ZQIA 1N9GA 4YJDA 2HMUA 5EZ6B 1NLZA 3OX2A 5HHTA 3DS8A 2CV2A 4WE3A 3T35A 2HK7A 3ZGLA 4EX7A 1FRFS 4P3XA 3P9SA 3ZDFA 3EJWA 2XUQA 1NTOA 1IUOA 1N57A 4FOLA 3WJ2A 4QPNA 3SM3A 4CWAA 3WLSA 4BFLA 4CZ2A 2WG1A 4EFMA 2W4MA 4XTRA 1JEJA 1I0IA 4WKCA 5ARBA 1XZPA 2XQVA 1JLHA 2I76A 1ISHA 2GK3A 1SHUX 3B3JA 3ZD7A 4ENWA 4BCCA 2R86A 2WZBA 5H8WA 1U2ZA 1LY1A 1OFUA 2IPAB 4BB0A 1CB7A 1PP4A 5DM1A 3ET4A 1LBQA 1W5TA 1FLDA 1K6EA 1TKBA 1ZGZA 2QENA 2D62A 2P78A 1CUVA 2YRFA 2LE0A 3HRKA 3WBJA 2HLPA 2VKQA 3WDKA 2BFOA 4WIAA 2B3DA 3WR5A 3KD2A 4O4HF 1AC5A 3HE3A 5HIIA 2UUBB 1XAHA 2W8ZA 3H11A 1OB2A 1FUKA 3M1YA 2PSEA 3QH4A 4P98A 5FPTA 1JAYA 1FTGA 5AXDA 2EEZA 4C29A 4D57A 3NM4A 4DCPA 1H4TA 1XNQB 4JP8A 5E2IA 1COWA 1G1MA 4N7MA 4GI1A 2P5UA 1YR8A 2QAGC 3OU6A 1GZUA 1ND6A 1NULA 3GAAA 4MV7A 5DDIP 4HI0E 1FDVA 5LZ5A 1L8OA 1IRIA 4CE6A 3TTYA 1B14A 3FPKA 1I4WA 1VA4A 1O96B 2C2WA 3RTBA 4TLAA 4LJKA 2PANA 4L15A 1Z8HA 3B1XA 3D1JA 1CIVA 1MEEA 5F98A 2BGJA 3AM3A 3IDFA 4RV4A 1N2XA 4DZZA 5KSYA 4AN0A 3WJ7A 2ZAGA 2DYKA 3OECA 1Q2XA 4PN7A 4CM8B 1NTRA 1SCKA 3U44B 2R8RA 5C5EA 1KYTA 1EFRD 1WKVA 3HFSA 1LPAB 1PJ8A 4DIBA 4H6XA 4H1HA 1GNLA 1LRKA 1XNHA 3C39A 1K27A 4JDUA 3M9XA 5DHSA 4BJ1A 2P90A 3BB1A 4US0R 1E5QA 2X9LA 1R9JA 3IQDB 3OFVA 4HLQB 2WVGA 2X0FA 4KPEC 2IEAA 1Y82A 1JA9A 3QEMB 4EQ6B 4DV4B 2DEUA 5REQB 3EFOA 2BUBA 1Z2OX 2IZ1A 4N5IX 1BXGA 3QPCA 2DVMA 3T1YB 1X6VA 1PZGA 1PD0A 2MTBA 2PUJA 2YHIB 3I2JA 1C1XB 1KFKB 3DE5X 3WKAA 5EHXA 5C7OO 1U0NA 3NT2A 4OI0A 4E03A 3K5IA 4IF4A 4IIJB 1GAEO 2HWXA 2ZWMA 1ZFNA 4X85A 3FYCA 2IZ5A 2MT9A 4H7JA 2H2WA 5DBGA 2JVJA 2XUDA 4GOLD 2HHHB 2VF4X 1INLA 4IQ8A 5E3HA 5DCUA 4LV5B 3FUUA 4YMWA 2I99A 3HP7A 2QVBA 5TDHA 1ESEA 1XJCA 3MJCA 1XRNA 4J6EA 4UAGA 1VL2A 1DWUA 3O3OB 4FBMA 4R9SA 2QTWB 3EEBA 2XCOA 3GLHE 4C7MA 4DNPA 4F1JA 5A9SB 3OIUA 3NUZA 4KGZA 2HU2A 1NN1A 3ER8A 4BKMA 1JIIA 4RX1A 2F64A 2QLLA 4HAUA 2B0CA 5FWNA 2R87A 1FCJA 5A3QA 2FFQA 4LY0A 4BTVA 5KPDA 4I8XA 2HLNA 5TMBA 3N8NA 1IMJA 5DJ5A 1L5HA 5LYJF 2OCBA 3NV7A 5TRTA 4F4IA 3WWCA 3QKUA 4WZBE 5K0EA 3C4JA 4E2FA 5JZSA 1U2SA 1TW3A 1CRLA 2CSUA 4Q3OA 3IXQA 5EMLA 2D2XA 3MTJA 4OLJA 1QB7A 1OWOA 1V16A 3CGGA 3CR8A 3WYDA 3AYXB 3FUWA 2B0JA 2OHGA 5JSUA 1BX0A 2P8JA 3QLVA 1N5LA 2AOXA 2YN2A 3N2KB 2X7HA 2V7VA 3AI7A 4LMBA 3V9AA 4BLRA 4IDCA 2PMCA 3D6TB 1R6VA 5LBIA 3NEAA 4IGAA 1HZZA 1XEWY 4Z6KA 1A5ZA 1X1BA 3LCRA 3LUGA 5I9NA 4MYHA 3DCNA 3TVTA 4FMBB 1Z74A 5JIBA 4INOA 4IYJA 4S24A 5JJIA 4P4SB 4AVYA 2DJIA 4DDHA 1BMDA 1ST2A 2Q2NA 1NE7A 2AB0A 3MS4A 2MSEB 2O8VA 1VM6A 3AFIA 1ABEA 1N2OA 3PIIA 4GX2A 4QBTA 2JAOA 1CDEA 3OJXA 3EASA 2FUKA 3VJMA 2P5SA 3NP9A 3C85A 4AAYA 4F4DA 3OT1B 1G6HA 1KQOA 4Y2QA 3Q3HA 2FE1A 5AHRA 2E82A 5JBNA 3W7VA 5KCZA 2F1KA 4NVRA 1HETA 3B12A 5DNVA 3AQIA 3NRBA 1Q44A 3CH5A 2OAEA 4UARA 2DTXA 3RSGA 4B34A 3LZDA 2P1DA 3BXXA 4KQKA 3WRVA 1FA9A 2RMKA 4LE1A 1VLJA 4GMDA 3UUGA 5CB4A 2IP4A 2ISSD 4Q1FA 3L8HA 3TTSA 2JHAA 3CRMA 1RM0A 4LHVA 3D6MA 3M6UA 2JLYA 4TWJA 6AT1A 4MRPA 4Q4CA 3BZBA 4JL5A 4X92A 3RNLA 4OKIA 4I08A 2XQJA 3DAFA 4XVRA 4N47A 3DDHA 4L4UA 5EZQA 3RE1A 2NQ8A 3HWSA 2C4KA 1ZD4A 3LW8A 5KQSA 2ZSKA 3QNMA 2NG1A 4XUEA 1A9XA 5LQJA 2QM8A 4BNMA 4OHOA 2EJCA 2JD1A 3UPTA 3K70D 3VNUA 1FRQA 1EA7A 2ZTSA 2IDMA 4I81A 3U37A 1UKEA 1E92A 2WIDA 3CLKA 3LVQE 2CVHA 4TLDA 4K2HA 1P1JA 1MVLA 3T9DA 5BSRA 1RWVA 2EG5A 3RS4A 3FHJA 3H83A 3Q9NA 1BX1A 2NXCA 2ZRFA 1GPKA 1YHYA 5CHEA 4KCGA 4ZOLB 1SCNE 5C1PA 1XXHE 4MW9A 4BVBA 4D8YA 1CC1S 5I51A 4Q3NA 5FL7D 4DCTA 5KTYA 3TS1A 3RU2A 1XEFA 1TVKA 1JKIA 2YHAA 1JR2A 4MR9A 4PPFA 2QBYB 1B73A 3Q10A 1W6UA 2VN8A 4BLUA 4B6JA 1XZQA 4CT5A 1LPPA 4OGWA 3NDBB 1Q95A 1WDMA 5FORA 5JNSA 2DHQA 5CW2A 1VL6A 4EA8A 2GR9A 1OUMA 2O2HA 2YZ2A 3L6RA 3CLSC 3IOBA 2X8WA 5JR3A 3LXUX 5AVOA 1FMTA 5FUWA 1WXHA 4O2BF 4Z86A 3GP3A 3TIIA 4EJSB 2OGSA 1MRZA 3A1TA 3AI3A 2WPDD 2Z4RA 1N5IA 3EARA 4ZD6A 3MMSA 3LH5A 1P5JA 2WE7A 3PGVA 4TTVA 5CG1A 4ZGGA 4P0PB 1LJLA 1PLKA 1FSPA 1QTQA 2DOKA 2A9OA 2A1TR 3A9VA 3CEMA 4GSYA 3OPVA 1XL1A 5BUSA 5BN5B 1CDZA 1YQDA 3TLEA 4BTEA 5FWXB 4U5QA 2ZROA 4UU1A 1C1XA 4XIIA 4S1PA 3WIOA 3D6HA 5AK6A 2YJGA 3H6GA 3MD0A 5EJ6A 5DFAA 3MILA 2BMDA 3A6GA 1SY7A 4JGBA 4U7TB 2MCFA 1X87A 2W2NA 2WWHA 4PV7A 3KE9A 1WCIA 2CYCA 3WK8A 3QX9A 4Q1CA 1OD6A 3AF0A 1JDNA 2FPMA 1BAPA 2PWZA 5AJVB 3D6VA 3D4PA 3UCEA 3E9NA 1VMIA 3GO4A 5DSXA 1KQFA 4U63A 4RHEA 3O4GA 1YQ9A 4K9MA 3M3DA 4FX5A 3OKPA 3JV7A 4V3BA 1SKAA 3TFQA 4J03A 4UTVA 3KAQA 2B8NA 2J1LA 3SQLA 5K8CA 3QYFA 5E4FA 5E7JA 1Q91A 2RAPA 1CUSA 1Z13A 2YIVX 4CW7A 1E61A 1HQDA 2AQ8A 1C9YA 2NNWB 3HWWA 3B2QA 4Y1RB 1J07A 1RZRA 3ZHBA 1W7AA 1Z0AA 2CJPA 4LXTA 5LMNB 4C0KA 1VPLA 1NU6A 4UU0A 4AJIA 1KDVA 1DIGA 3BYZA 1F1BA 3R5XA 1ZUHA 2YHUA 2QI9C 5DLEA 5ER6A 4QHTA 2Z5LA 3PQ7A 1BROA 5CB8A 4LSGA 5IJZA 1R8YA 3UWKA 2WZQA 4ZCSA 3DBHB 4Y2PA 1YDWA 3ROGA 2XDYA 3ZXUB 1F0NA 3MA0A 4RZQA 3RS2A 2RJ3A 2B6HA 3SK0A 4Z4CA 1HI9A 2ECQA 3TTXA 1ULHA 1EZZA 1BCRA 1D0SA 2LCIA 3MTQA 1Z47A 5DIZA 2YV2A 3Q9LA 2W71A 2G63A 4G8CA 3Q40A 3ZY2A 2WRZA 4EKDA 2GYYA 3FWHA 2RHWA 3KKPA 4Q9KA 1TU4A 5CDTA 3KB2A 4QTXA 4Q9LA 3OZEA 3WP0A 3IT0A 1S2LA 4BZPA 1XTSA 4MP8A 3OJ0A 4BWFB 3BGDA 4QPJC 2PZMA 4LQLA 2BGKA 3WYCA 4A8JA 1YKSA 4R6WA 1IWOA 2HXYA 4I0WB 3FMOB 4JJIA 2JIQA 5CH3A 5EP4A 4YRKA 1KWGA 1O2DA 1T6BY 2DX7A 1TD1A 4M1QA 5JNRA 1XKLA 4PSKA 3FX2A 4NF2A 2VCEA 4RGYA 3P52A 2XDAA 2BKAA 4DMCA 1FTWA 1ZK2A 3PGXA 1CV2A 2JFOA 2WYHA 4NV1A 5E4YA 5ECWA 2A84A 2XE7A 3DTVD 4TKUA 2XCTB 4JT8A 1D1QA 1KMHB 2OP1A 3K5PA 3LI2A 5CUQA 4FB4A 3VR3A 2OLEA 1VCHA 3CPJB 1KSHA 2ZDHA 4KUHA 5H4HA 4R0MA 3GMDA 1NIPA 1Q16A 4G09A 4MPJA 3LL4A 4RM2A 3I9NA 4RACA 2NV0A 4IS2A 4KR6A 4FGSA 5KO2A 5JD4A 1ILEA 1N6IA 1QGUA 5IN4A 2RH4A 3QUBA 3T5BA 3BXFA 4RZ3A 2ZSFA 1G3MA 4HNVA 3FJOA 2AZDA 1UBJS 3NIDB 3MINB 2A5FA 4G8BA 4DCJA 1GRQA 2VDWB 3C5WP 4BEWA 4GH5A 3OJCA 3LUDA 4UEWA 4F4JA 3HVJA 3E9YA 5CEJA 4IIDA 5T3UA 4B6GA 1IOZA 3A6FA 3BFJA 3LXXA 3E23A 3S55A 3SYTA 4OQNA 2A35A 1LDNA 2QZZA 4QYMA 4F2PA 1F2DA 13PKA 1LBSA 3EZ6A 3U4DA 4CG0A 1T1JA 3RVDA 1MIHA 1Y6GA 2Q45A 1TM5E 1DDIA 3KE8A 1VMKA 1QHYA 4J1SA 2BTOA 4X8OA 5FUVA 1QIKA 3LU1A 2WHXA 3H5RA 1V4BA 3HBJA 2Q6OA 3L3BA 5TPWB 1GGFA 4IHJA 1QG6A 3OO0A 2GAAA 1UQUA 1VLVA 3IP8A 4TM8A 3WKDA 4EHIA 1DKPA 4RIGA 2GFHA 1YZTA 2V6GA 1P5FA 3AUXA 4FSHA 4BFYA 2I5PO 2GPJA 2OCKA 3GUUA 4I1YA 4YRLA 2P11A 1IOVA 3H5WA 2IKSA 2PG3A 2C61A 3NBUA 1IEXA 5AW1A 5KINB 5ILQA 1KKUA 1GVNB 4E3ZA 3NVAA 4L5CA 5HF9A 1WV0A 3INRA 1M8GA 4F3TA 2V7QD 1XMSA 2ZRDA 2RKBA 1XVIA 5ERGB 5BSKA 3TZHA 3ED5A 1BQEA 1VPDA 2IODA 2CL7X 1SUWA 5E9JA 4B4VA 1JVBA 1B23P 2P2NA 3LOUA 4LYHA 2J3HA 4DMHA 5U9CA 2C42A 1CE8B 4CM5A 2YUTA 3UVEA 1D1TA 3G49A 1E2EA 3DE7X 5D3ZA 3EYAA 3R44A 3PNQA 1Z34A 1Q19A 4PSCA 1FUIA 2A94A 2WWXA 3W78A 3MWDB 2IYSA 1J0XO 1KIFA 1V8BA 2FR1A 4BUJA 2XE4A 3AHGA 4B9AA 4AY2A 3CLTD 3NJ4A 2GEJA 1UFRA 3IJPA 3IQGX 1IBRA 1RC0A 4G5OA 3BD9A 2ATEA 1K6IA 3ZD9A 4CLRA 5I47A 3TM4A 3TSAA 1ZUIA 1QG4A 1KH1A 4G4IA 4HDCA 4P36A 3VNRA 1BEEA 4M60A 2ODAA 4LRWA 3WRWA 4NH0A 1XF9A 5JSHA 4JZKA 1DX6A 1OCEA 1DJOA 2WT8A 3PXBA 5IMBA 1Q3KA 2WSBA 1ZW6A 2XA9A 2IU0A 1N5MA 4I3HA 4HXYA 4JBXA 4F6RB 3IOMA 1R74A 3GL9A 3NNSA 3E3OA 1ACMA 1WULS 4GL2A 1GN8A 5KOYA 1ZK1A 4HGNA 2PKXA 4FNGA 5FCDA 2DCUA 1MJNA 1NVAA 1A8IA 2BEJA 1K97A 4B8WA 4YP7A 3R3VA 1OXXK 1F5NA 1ZOOA 2GHTA 3U7EB 4CM3A 4ER3A 2R6DA 3LUKA 5AKKA 4D80A 2FW0A 1QVAA 2GLXA 1XEWX 2JZNA 3W1EA 4MUIA 2IHYA 3BREA 2BLLA 3U81A 4LCEA 1PQUA 3KOOA 3QLUA 4QUAA 3EUWA 1ULAA 2EDCA 2GCEA 4E5VA 3IEPA 1D0VA 2C2YA 2A7XA 5EJ7A 3WGGA 2IH4A 1EVKA 2O05A 3V7FA 3I6MA 2B7LA 2XUAA 3U4IA 2Q7OE 4CG3A 1VLMA 1E96A 3ZNOA 1ZPDA 1ABBA 1G5PA 1FUEA 1Z45A 1G5IA 5E7MA 1A9YA 2AMYA 2R0QC 2EVWX 1EX6A 2BM1A 3ANNA 3IIKA 4WOBA 4XYGA 3CRZA 5C1DA 5KNCH 1V8FA 4JEIA 2PZAA 2UZ1B 1JYFA 4LHYA 4FUTA 4LY9A 1PDOA 1BRTA 4P6VF 4ZP1A 1DIRA 5EHGA 1EGVB 3HDQA 2HJ9A 4GLLA 1G17A 4ZIRB 3AUTA 4HAIA 2ZVDA 1HA3A 4BFTA 5AQEA 4UAVA 1KKMA 3U4MA 1KMQA 5EXTA 3JATB 1F0PA 4R68A 4JGGA 1H6DA 3T8YA 3ZGYA 5KJCA 5ITVA 1MIOB 4MQFA 4NDZA 1XN1A 4IKEA 1S8AA 4D0RA 3ADCA 3BTOA 4PBSA 4KFRA 4IGKA 3UAWA 1HZZC 1R1DA 3O7MA 2Y99A 3CC8A 2Y9MB 4NMLA 1C0IA 4MW1A 3UWOA 3G0CA 3CEAA 1L9XA 1OFGA 3W5VA 4EKEA 3Q5EA 4NZPA 4PGAA 3E7WA 4FUQA 2UUAB 1XCOA 2WW8A 3N76A 1UBNA 4HXFB 2EQBA 2HJHA 1RU3A 2H51A 4M0PA 1VCNA 2O7VA 4ALIA 4EUKA 1IQ0A 4RH3A 3HN7A 3AJ8A 3KWMA 3NBQA 3VV3A 4E5PA 4CJXA 5JSQA 4NU6A 3ZE6A 4UTNA 1JG6A 2ILTA 1PJSA 3CZCA 5F76A 4ARVA 2ENWA 2F1RA 3LNTA 2C8KA 2G36A 2WILA 4OAQA 4BVGA 2RE8A 3EVZA 3ZZUA 2WVAA 3VU3A 3ROPA 3OPNA 3TVDA 1TF2A 3EEQA 3F3SA 5JS8A 3W5DA 1HLPA 3C24A 4JI2B 1LS6A 4KSYA 3HUTA 1J1UA 4RWEA 1KQPA 1U3GA 4RETA 1LD3A 2PAFA 2SHKA 5K7SA 1U0TA 5M04A 1MDFA 2X3UA 3GJRA 3LRPA 3PC6A 3UJ7A 3AUKA 1KEZA 3DBRA 1Y4AE 2V6JA 3LDGA 1XAIA 3M1AA 5A9RA 2IWRA 1SULA 1ADFA 1LWOA 2PQ6A 2EERA 5GQSA 5CD1A 1NBMA 1Q17A 2H0QA 1FP4A 5A2GA 1J20A 2FOIA 5EUMA 2QE7A 4RCVA 1W88B 3GPIA 5A62A 1Q5PA 4KGVA 3IT1A 1G7TA 2WV9A 1BWQA 1L6IA 3PQFA 2NPFA 2GLTA 3N7AA 3NXSA 1FK8A 1JV2B 1MOPA 3GVCA 1OAAA 2IXDA 2YV1A 3I61A 1L4LA 4WUTA 1CP3A 3RUIA 3LGXA 1F6WA 1WLSA 2OORA 2RGYA 1YFZA 1NDUA 4WJLA 1EVJA 3P9PA 2J5QA 1G16A 2O3SA 3K16A 2OPHA 4ZRMA 1TO1E 3SF8B 4Y2GA 1I13A 2PKQO 4M9ZA 5ALUA 1Q74A 1O6CA 2GASA 2HWWA 3C3EA 4AL4A 3UMSA 1DKLA 3G8YA 4HYYA 4Z1MA 2X5OA 3CG0A 1Y8AA 4D74A 3TFOA 1R0LA 1V41E 4A6EA 1SVIA 2G09A 3DZDA 3KJEA 5DNYB 2P4HX 2GN9A 3LFUA 1GY8A 4M9SA 1QH1A 2WOJA 3TWOA 1EXDA 1OR8A 1JBKA 1C50A 4R9NA 4UVDA 3L79A 5FUMA 5CT4A 4C2AA 5GV7A 4EPVA 2YW9A 4O8ZA 4RPKA 4DIEA 5B4UA 2YQ5A 4FZ3A 3ZHZA 4KO1S 1KE1A 2WG2A 2PMFA 2JLQA 3D8BA 1NUTA 3OIWA 2ZRNA 1Q1EA 2QUKA 5AM2A 5HKAA 1PFQA 3EISA 1B0ZA 3QI2A 3RYTC 1S3FA 1QYRA 4DLKA 2ILVA 4S04A 2XTNA 1IN5A 3ETEA 2AFVA 3E7DA 3MCUA 3WLMA 3DTYA 4M1YA 1WXQA 1SH7A 3JU3A 2W2LA 4RK5A 3GZTB 2JC3A 3O8QB 4MRNA 1DAHA 3CF4A 1MJ5A 1L5QA 3UJDA 2C8VA 2HRZA 4U7PB 1LBHA 2WWFA 4FDAA 4LJLA 4KWEA 4ASUD 4F3KA 4E14A 5JJCA 1OH5A 3ACDA 4EUNA 2XT0A 4ILEA 3KQKA 3MTDA 5HQTA 1IZ0A 3HVIA 4RZXA 5BQ3A 4ARZB 1QK3A 5JAOA 1X9IA 5FO0A 1W93A 3VU9A 5SYMA 1FLNA 1Y3CE 1AK9A 1JWAB 3LGAA 4FFRA 5IC4A 1XDZA 3EQZA 3L7JA 3OE7D 2FQYA 3K9QO 1MZPA 2R7MA 1TEZA 2Y1DA 2ECKA 3RFUA 5B4VA 2BMFA 4BNGA 1A4RA 1Z2AA 1MAUA 2VATA 4QWMA 1EDZA 5IDWA 1LNZA 3IVMA 4HDSA 3ED1A 4K6GA 2QL9A 4LYGA 3N70A 2ZJ4A 3HUFA 5A1JA 5ALJA 4QYIB 5HCUA 3RLIA 2Z43A 4LGMA 4I1RA 1LK0A 4JJEA 2H59A 2WPNA 4JP5A 5CFMA 3EULA 4RF4A 3WC4A 3GGOA 1K3FA 4GE0A 1ZBDA 2H4XA 2J3IA 4ZOEA 5EP1A 3EGXB 3GFBA 5T5QA 3F4BA 5A9SA 1NW7A 2NZUG 4C4RA 3AFOA 2JFPA 1UR5A 4HLUA 4C0HA 2ZM5A 3ZKWA 4N7JA 4ZDIA 2A0KA 1GU0A 4I5FA 3KZ1E 4X61A 4A0HA 1Z82A 3OC6A 3JASA 1AQ6A 2GRJA 3O3MB 3U7GA 3IHLA 3ILVA 2WTNA 3FNIA 3SDBA 4BMOB 3ZK8A 4D9HA 4IRUB 1SG0A 3WGMA 2AEEA 3PSHA 3E9QA 3PUZA 2Z2KA 4JSRA 1N25A 4WFJA 5ALSA 4MQLA 1VHLA 4GM1A 4TKMA 1SBQA 1G63A 4MB0A 3SS8A 5EQFA 5SV2A 1L5VA 3TMKA 4J76A 3WGLA 2FZWA 2QE6A 1EVYA 3PKJA 2C31A 4JBGA 1JEYA 3QX3A 3EFOB 4HQOA 5TVGA 2D6FA 1AQNA 5BN3B 5TPZD 1FYDA 4C6HA 3OC0A 4HVAA 4URFA 3LCUA 4RH1A 4DIMA 4CV3A 2I4TA 4NBWA 4DSNA 4M8LA 3QVMA 1WVMA 2WJPA 4I50F 2G40A 4EB6A 4J0FA 4EB6B 5MFPA 2DMRA 2R00C 4YC7A 1GCGA 3B1JA 3BK2A 3GROA 5LQRA 3B5EA 5B3LA 2CNKA 2VDOB 3PQ2A 3E9RA 1IULA 2J7KA 4CNBA 3ESAA 1T9GR 2IVZA 2JFWA 1B15A 5BMVB 1LCIA 3CNBA 1LI5A 4BX9A 1R4NA 4B71A 3TE7A 4KN9S 1JL3A 1VB3A 2H4WA 3EXHC 4PM4A 3NEJA 4DYVA 1JEYB 2CVPA 1PT5A 2FQWA 4RF2A 3VU0A 4CM6A 2V4ZA 3FCAA 4R2XA 4B44A 3KJXA 4W99A 2VTBB 1Q7TA 3DD5A 4E32A 3IESA 4HNAA 2EBFX 2QVYX 5BSHA 3B5IA 4INPA 4NL4H 4U0JA 5KTSA 4F72A 4CHTA 4TMYA 2H1FA 1JAHA 1IRXA 1IN6A 2OLJA 1E7YA 4IDOA 9ATCA 1SU8A 3E2IA 4II7A 4QECA 1Q0PA 1J25A 2YV3A 4GBMA 1FY2A 3RUEA 1XA4A 4DYHA 3O1HB 2Q5HA 4RD4A 1LLFA 3G9ZA 4QU5A 3RC2A 2AK3A 4F8JA 2JB9A 3MT9A 3P0JA 3G88A 4BU0A 4IVQA 3RODA 1YI1A 3N7TA 4GVLA 5H5JA 2MINA 1CULC 4ND5A 4NI5A 4R31A 4E1BA 5FTNA 5BWLA 1J39A 5DNUA 5C5IA 2JLAA 3O3CA 5DCWA 1P8JA 1D1PA 2YXEA 2P2CA 3ONNA 5FV4A 4Y0AA 4G37A 2ZDQA 3UXYA 5E4JA 3PT5A 1WZ2A 4OLAA 1YVRA 1IN8A 1LNQA 1NW5A 4GNRA 3X1JA 3BK7A 4QULA 1UBFA 3FHTA 4KXXA 5F3RA 2A3NA 2Y8EA 4ZVOA 1GU1A 2EAUA 2V6FA 4NONA 4CKBB 3PFKA 1P2VA 2FI1A 4E70A 4ENVA 5EIBD 1RLOA 1W2HA 3ESCA 5LQDA 1U28A 3QEKA 1EBUA 3DWIA 3RGGA 1FMCA 5DT9A 3PPWA 4PZZA 2QQFA 4GMHA 2CYBA 1GCIA 2V7UA 2FWRA 1GUDA 3A2LA 4O2LA 4EWLA 2B5VA 1FNDA 2QG9A 4X93A 4C4PA 1MA3A 4LZWA 5DWQA 4QBFA 2HPVA 3LYUA 1U9ZA 4E2YA 4ZRNA 5E6RA 3TO5A 4LRUA 1UAGA 1X70A 3O8OB 6GPBA 1UPBA 1AS2A 1ZGGA 4M0EA 2BM8A 4LJYA 3S2SA 3G68A 3P27A 3DDUA 2WNIA 3GWGA 2QM7A 2H29A 4FPXA 1IJKA 2GNPA 2GA9A 1P31A 1YRLA 3LYAA 3NYQA 3WQRA 4CI0B 3TQIA 1LBEA 3S8YA 4KE9A 3SICE 1X9GA 1GTMA 1NL3A 1ZWLA 3H1BA 4R41A 1Z3IX 3C1OA 3FGPA 4RPJA 1G3QA 4TVSA 1V2HE 3AM4A 5K20A 1VOTA 1XQ6A 3HYLA 1CDOA 3OZDA 3QMMA 2JK0A 4NPAA 3G5UA 2F48A 5ENDA 3V5NA 4YYEA 4YT8A 1A3CA 2OBLA 3CZ5A 4D3XA 2XB6A 4UW9A 1HSOA 4IV0A 3T1NA 2Q27A 2X8JB 3H75A 4B1FA 3HXQA 1N1MA 4I66A 2D7CA 4RF3A 3L7LA 4REQA 4D82A 2F3TA 1U9CA 2AVDA 4GPIB 4HKTA 3LLSA 4MI9A 3NDRA 1E4VA 1U9IC 3HDTA 5DRTA 2Z9CA 1K2WA 1ZKDA 3M4JA 4HX2A 2B69A 5EWJA 4EF4A 3B60A 2PWPA 5DW3A 4F21A 5AW0A 2O48X 1KJ9A 1G9TA 1DAFA 2HU5A 1Q1ZA 1DRWA 1MAHA 1YU9A 2ATCA 1J2TA 3CLRD 4I4NA 1ESZA 5CDFE 4EJSA 2O1SA 2V0CA 3NS7A 3HNOA 4WFIA 4X20A 1NPTO 4XR4A 3OG9A 3NGXA 4G5XA 5JFTA 2XUPA 4PCVA 5LU9A 4BMNA 3GVXA 5DOVA 3GRAA 3R23A 2GKSA 1X74A 2O0MA 3N8HA 2NZ2A 1RQNA 2G6BA 1VCMA 5DHPA 2LXNA 2QWXA 1PJ2A 1SCIA 2IYLD 5ALNA 2J6CA 3CLUC 1A8HA 2JFYA 4Q3EA 1KU0A 4KR0A 4BC0A 3U5ZB 2J3QA 2WINI 4GX1A 2QAIA 2HIHA 2WMYA 1Z17A 2LIPA 2Z5GA 1V25A 2ZSAA 3A32A 3T99A 2FEOA 2VT7A 4MWOA 2QPLA 3ITDA 2HCJB 3SSOA 1GGMA 2HJVA 1TT7A 3ELUA 3OEED 1FFXB 2CZCA 2H52A 2HJSA 1ZN9A 3ETJA 3NW9A 4TWZA 5K2MA 3THOA 1NPYA 2FYTA 1QO0A 3S2EA 1JEOA 4C1NA 4XQCA 5KYXB 4I5GA 4V0RA 2FG5A 2W5UA 1TM1E 4KTTE 3IOEA 2YXNA 4QJBA 3S40A 3TQOA 1X0XA 3DOIA 1WUKS 4FLMA 5FI0B 1NOIA 3IJRA 2PGDA 3WA7A 3RC8A 4CTOA 1H65A 1WRBA 4KAAA 4RAOA 1T8UA 4DG8A 5ENZA 1G8GA 4EYSA 1TTTA 5ADWA 2FUG1 2C82A 1SVUA 3LECA 2HC9A 3G0DA 1T9DA 3KSUA 5DH9A 5CEEA 1PW5A 2IBSA 5LR6A 4Z51A 1U0LA 1N6OA 2R7AA 2O5EA 1UC8A 3M49A 1E1LA 3MB8A 1H0KA 2PZ8A 1FFYA 4BMCA 2XXJA 1QVWA 3NVKI 1GRVA 5ICMA 2BHSA 2EJVA 3CF2A 3OZIA 4XWYA 2HK6A 3A6LA 3HH8A 1E2JA 4FC6A 4KQGA 2QU7A 5JCOA 3RSCA 5LQUA 4GU5A 4NG4A 1THGA 3EDQA 4LDPA 1YL6A 2EWVA 2XOEA 1BCRB 5COAA 3WXMA 5JH7B 2AYYA 2IUTA 2JJQA 5JAUA 1J5PA 1JEAA 4XIGS 4E5SA 1VIDA 5IAEA 3I8SA 4BN5A 1YDEA 2DLCX 3VKUA 3BMCB 2XA2A 3UJAA 4POAA 3HPQA 5IASA 1GL7A 1L5SA 3IQXA 3U3RA 2PUGA 2XKJE 4YJGB 5MFZA 2I6FA 2PRYA 5DX8A 4RLFA 4BQRA 4CIBA 1A9OA 1YK0A 1V37A 2JD2A 3AEKA 7ADHA 2POCA 3WHLA 3I53A 4GSLA 3D31A 4TWIA 3I2YX 5BRNA 5EWLB 3PFNA 4HFJA 4OQPA 3PLNA 1PI3A 1SD5A 1ZC3A 2NTJA 2DWOA 3KT8A 4NNJA 4XFKA 2ZSEA 3JWEA 4PZ9A 3PTZA 3U13A 1QJCA 2WM3A 5KVCA 3P5SA 4FWTA 1FFAA 3HYRA 3KX2A 3SHWA 1PGOA 3D2BA 1US8B 3CKKA 1L7NA 1B42A 2DQ4A 3T3HA 2FSHA 4XUGB 3ITKA 3VKVA 3D2CA 4AY6A 3QX7A 4WFKA 2FFJA 5KNCD 2OQIA 2CL0X 2N46A 2W6ZA 3LS2A 5A4AA 2X2FA 1DQPA 1P2BA 2R4QA 4MO2A 2HQSA 3GX1A 2B2CA 3DTTA 2IS4A 5JC8A 1H69A 4ZT3A 5J3JA 2VTKA 4ARAA 1QC5A 1DBWA 1ANKA 3KSRA 3T7CA 5K01A 2NU7A 3HCEA 4PFJA 3MWLA 1QYVA 3SP1A 2DR2A 2FSPA 5ECGC 3SC4A 2O8EB 2C03A 3KB6A 1R8XA 4MQUA 2V3VA 4Q9DA 3G6WA 4WSOA 3V34A 3ZHXA 1WPQA 4EKYA 3ORYA 4URUR 1H05A 1ZHFA 1TMYA 3V4ZA 3O82A 2Y1KA 1SVWA 2ONYA 2PK3A 5SY9A 4U1RA 1A5BB 2E7ZA 1MW9X 4LZPA 2V74B 4F46A 3DQZA 4KIWA 1OTHA 1VJRA 5JALA 3GLTA 1GA6A 4MGKR 2PUDA 2N0SA 5AKGA 1L9KA 1HDOA 1NHWA 1U8TA 3LKVA 4JJ4A 8ATCA 5BXYA 1CUHA 1SZCA 3A28A 3GRRA 2H9IA 4INZA 1QDLB 4PAMA 3OCZA 2HR1A 1DAKA 2EIXA 1Z07A 4PYIA 4ZXPA 3HXTA 4U7JA 1CNEA 2OECA 4LDJA 3FSGD 4ZARA 4AWXA 4JROA 4MCJA 5AM1A 4ZCMA 1O0BA 2CFCA 2EGUA 1NU8A 2XI4A 2ZBUA 3DDZX 5KYYB 2A86A 2JDIA 3DDNA 1JJIA 5IW8A 5SZHB 1H2XA 5JVDB 4D98A 1WMFA 4LYFA 1FU7A 1YD7A 2LDXA 1NC3A 2QDXA 3I5AA 1BHQ1 4U2FA 5ULLA 4J2TA 3ER9A 1JKMA 1RLUA 3VDXA 4Z1MD 1KK1A 2AXEA 4G67A 4NHEA 1P2SA 3OZFA 2YJNA 1CEYA 4DNFA 1PR1A 3HKBB 1IBKB 3KQUA 4N01A 3OURA 2PDAA 4CHGA 1PT9A 4TT8A 3I5UA 3B6ZA 3T1VA 4O4HA 2OBFA 4MYRA 4Z0HO 2ZJ6A 4UU8A 1RWOA 4O5AA 1T4CB 3TW8B 3VSEA 4MVJP 2AR0A 2TMYA 2C58A 3FFTA 2B61A 3W06A 2IL1A 2X1VA 4YRMA 4CYMA 3E22A 1XTJA 4CM4A 2IKQA 1HFEL 3IQHX 3H3JA 5JMTA 4RVHA 1WDLA 1OQAA 4ABYA 3CZ4A 3ZXSA 2CHFA 5HE9A 1NHGA 1CSEE 5KYVA 1LF0A 3FPEA 3N5CA 2VSQA 2ZSHA 3CURA 3JZMA 3R5KA 4ALMA 4ZCIA 3VZQA 1W0KD 1QORA 1D03A 1U1EA 4QM7A 2CSXA 2BFWA 1OZFA 2Z6AA 4YMTA 2IHJA 3DBVO 3QW2A 5LIPA 4HQLA 1JU9A 2X4IA 4JVNA 2RGNA 3BJIC 4HNQA 3SXPA 4XDGA 3UUEA 3VOAA 1LSJA 2GWHA 1MW8X 3NNDA 4YRJA 5LP1A 3QF4A 2ASVA 3RKRA 4KXVA 3M4ZA 3S7TA 1L3IA 3WGNA 2NQ2C 5AR1A 1PJZA 3GLHA 4KPGA 4D99A 1D6JA 3E70C 1MABB 2W0SA 1H2EA 3LUHA 3EWNA 5DGDA 2HQOA 2Q3MA 1KR5A 2HIGA 3CZPA 2J7PD 5TGDA 3X1KA 3ZIAA 4ECAA 1XSEA 2XNHA 4UNRA 4Z4HA 3GLFE 1HRKA 2G28A 2H7YA 2C0CA 4KPUA 4RD6A 3MJFA 3PI6A 3OQIB 3F67A 3GGDA 3ROZA 4M49A 3UJPA 3ZS9A 3H9QA 1EUQA 3SYKA 5KSWB 3OEYA 1J6UA 1DRUA 1GEGA 3M6IA 2Y77A 4QGFA 3RYCA 3V4LA 2Y1CA 4YDRA 4QYTA 1IE3A 1TAHA 4KRFA 2GZHA 2R97A 2Z8ZA 2OO5C 4HNUA 4WZZA 1VJ1A 5KU7A 3VKHA 1SHZA 3K1ZA 3M6XA 5EUQB 2FPGB 1B6RA 1E5VA 1G60A 1Q22A 4KVGA 3R7AA 2OM2A 4EGCB 1O8CA 1Z4KA 1GN9A 4FM9A 4DJEC 2CCJA 4H0FA 3SEAA 1D6SA 3K0EA 1XVLA 3FZYA 1H0SA 4F6CA 1T3SA 1DKRA 2XTJA 4FT2A 4QTZA 5B4TA 3LIIA 4EX6A 3DE4X 1U4NA 2C3MA 2RARA 3ONEA 2WEKA 3AF6A 2D7DA 2PUBA 4CR8A 2GCOA 2QLTA 3ELYA 5LP6C 4TYMA 3CLHA 5A06A 4YCCA 1YMUA 3EZLA 2FWNA 2ZS8A 3KQSA 3PITA 4TMFA 5EWLA 3L6CA 4EHJA 3TECE 4KQJA 1N7GA 3EQ7A 1E94E 1YS9A 2RK3A 2B3TA 1STOA 3F6RA 3LRXA 4F96A 3O73A 3ADBA 3GJTA 4P31A 4I55B 4LK3A 4TUYA 1JHMA 4GI5A 4G63A 2L2QA 4QBHA 1T1IA 3UGQA 2MU1A 4NARA 1RXYA 3BJRA 1FDSA 2GHQA 3GFVA 1RLJA 3JQAD 1EP1B 4WKOA 1CUXA 3EPKA 3H0CA 3OP1A 1VJCA 1JJVA 1U8ZA 2JGAA 3ICVA 4B8YA 5TJ9A 2HRRA 1DV1A 1E58A 3O9MA 4OG2A 2XUGA 3BULA 2YRXA 2Y92A 3HKDB 3QMPA 1KVTA 5HF8A 2DFNA 1RWWA 4NU8X 4GICA 2NQTA 4UNQA 4YV1A 3PQDA 3K35A 4FMCB 4D3YA 5FPQA 1LV7A 2I33A 1DLJA 4HDKB 2QX7A 4ZRDA 2KQUA 2OSBA 2UVPB 3CV3A 4UASA 1JPJA 2IUSA 2VT6A 3FCEA 3V42A 1F0KA 1RWQA 3GXBA 3MVEA 4OFXA 2XYGA 1SC6A 1SQ0A 3TNLA 3HQ4O 3WIEA 1XZDA 4UHHA 5HS6A 5J5VA 4JJZA 1ZZGA 1U1DA 1T3GA 3U2QA 3ZQJA 3D8TA 2WJYA 4R1MA 3DOEA 2IYWA 1P73A 1Y1QA 3CWZA 3NONA 4J8PA 2DQYA 3O5AA 2MYPA 4R8MA 5EIFA 4I4TF 3ZWYA 4AKEA 2JGFA 3UMGA 2YZ7A 3ROKA 3ZDQA 2C77A 2WIJA 2P0YA 3QVVA 4G2NA 3MJVA 1VFPA 3S68A 3OTQA 3M4NA 5IWAB 3IE1A 1XTPA 2OHFA 4I8DA 5FR1A 4S12A 3MS2A 4PCUA 2WC1A 3O8LA 1TZMA 3A0UA 1KDTA 2XYHA 1TKCA 4F2WA 4PQYA 2G07A 1Y4SA 3ZU5A 4FYHA 1RS0A 1S2OA 3I9FA 2AJCA 3ABOB 4M9QA 5BWBA 1BW9B 5L53A 1IY1A 2QUZA 1UT8A 4DJJA 3OIVA 2IPNA 2O07A 4LJ7A 1E79D 1S3SA 2BGNA 1W85A 4IF6A 4P5PA 4B43A 1LDMA 2VDWA 3OFNA 4RF5A 3NHYA 1YS4A 4BPRA 2JARA 2YNMA 5GONA 4OQZA 5FTLA 1TQ6A 3GRYA 2CBXA 3FPSA 1ISJA 1JDUA 5CBKA 1VECA 4UM8B 1CNMA 1MP0A 1ZNWA 3IAEA 3L0SA 1Z5NA 4QUBA 4XWOA 5BV8A 1COZA 3H87A 1PGQA 1V0JA 1W4LA 3ECSA 3FHCB 3PDIB 1RWMA 4IIYA 2WJIA 4CQMA 2UXBB 1PGNA 2P62A 5FWAA 3A4MA 3WGUA 1C7ZA 2ES4A 4XR9A 1IM8A 1K2VN 2GDZA 2QLMA 5IG2A 1XVUA 3OQNA 3C15C 3D9QX 1UQRA 5JXJA 3NDJA 2RAUA 5C8YF 1S5PA 2IYPA 4FGKA 4EHBA 1RI5A 1AXRA 5LVAA 1EWYA 3CB4A 4DLNA 4P35A 3JZFA 2XYPA 3LUJA 2QD4A 2JGLA 4O3FA 3TGPA 3JAKA 4NCAA 2AT1A 1IBCA 1XVTA 3EN0A 2VEDA 4FMCF 1PZEA 1KI7A 2F3PA 2X4LA 4MKZA 4BV8A 4ZA2A 2YFKA 4JOBA 1E3DA 1ZH6A 2R8PA 2CZGA 5L6LB 1RYNA 4KB5A 3VTFA 1GU7A 1WUIS 3WMFA 3H86A 5DISB 2ZR7A 1CEQA 3FSGA 3N75A 4NFLA 3IHTA 3H0EA 4RSHA 4W6ZA 4Y2SA 3RS3A 4I19A 1L8AA 2I22A 5BXQC 5KKNB 1H23A 2G88A 3A1DA 4RZIA 2BZGA 2DFDA 1TC2A 5CIWA 6Q21A 3O8CA 2BBOA 4LC9A 1N5DA 1NRIA 4WH0A 5TQ2B 2FP4B 1DRJA 2ZSBA 3X2EA 4Z4FA 2FMUA 1HDEA 1UK7A 3R3SA 5KKAA 5K3AA 2YUIA 2OFFA 4QOFA 5BUZA 5FV7A 4EG7A 5EEHA 4MDFA 3PHBE 2VSNA 3I58A 4RKWA 3EC7A 4C6SA 2JNWA 1L7VC 4IDGA 2IV2X 1ZN7A 2V0NA 3M83A 1WEKA 3KBOA 1AURA 5FYQA 3RSLA 4M0UA 4IJKA 2PMBA 4JH0A 3WSTA 3KQNA 4CFYA 2ZBGA 5M29A 2IIQA 3JY6A 1E5DA 3FNRA 4G01B 4FYWA 4WECA 4Z53A 4R8VA 5TY0A 4TS1A 4N8EA 1N0VC 4YIHA 2RHBA 3WL8A 1GTL1 1OZGA 1XAJA 1ZSVA 3BXGA 4WOCA 4CR6A 1HXHA 1KBZA 5FADA 2BCGY 3BGIA 3N58A 3V00A 4DHWA 1YA6A 3WZ2A 5C52B 3EVCA 5JWRA 4MVCA 3S7ZA 1F4PA 1H6AA 1IZ9A 1NYRA 1N7JA 4Y8VA 3ZJUA 3G8BA 2OMKA 4Z8XA 1L5HB 1N1EA 3L4SO 4LHXA 1RMQA 4ZCTA 4QOEA 5JCZA 5KUTA 1RWNA 4BV2A 4PGHA 1NN3A 3IH5A 4X24A 2ZWOA 3AY3A 5DM2A 4RGVA 3AHEA 1MB4A 4LFBB 4XX1A 3FDXA 4HYQA 4WBSA 3DG9A 5E6UB 3U9SA 4P3PA 4FFNA 4W1RA 3K8YA 2BAGA 2AOWA 3BWXA 1D8TA 3SHVA 5IU6A 5AVUA 1MR3F 2FJPA 1P9NA 1SU6A 2FFAA 3QA3E 3TIXB 5H70A 2WOOA 3TD9A 3WDSA 3U17A 4TUYB 4HUTA 4R40A 2P9TA 1ATZA 3K2IA 3T3EA 1ECFA 1FVHA 4N1AA 3HB1A 5IH3A 3UYLA 3W4KA 3A06A 1EBFA 2QMHA 3K1TA 1E4YA 4IDPA 3KT0A 1Q57A 3L5KA 2G0NA 3UANA 1EGAA 2OBNA 1A50B 4ZVQA 1KI6B 5L7WA 2IQIA 2IUYA 3GPDG 3QKTA 5DBFA 3TTTA 4YO7A 2O8EA 1Y0BA 1OA0A 5EZYA 3DFIA 4XEHA 2PSHA 4OUKX 2DP4E 1GPJA 2NU7B 4IJ6A 1NV8A 1ND5A 2M9MA 1X92A 3IOYA 2E85A 1U8EA 2WYWA 1R0SA 4KQ9A 4WEOA 5KDOA 2WTBA 2OZVA