1J22A

Crystal structure of archaeal xpf/mus81 homolog, hef from pyrococcus furiosus, nuclease domain, selenomet derivative
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
131
structure length
131
Chain Sequence
VKVVVDSRELRSEVVKRLKLLGVKLEVKTLDVGDYIISEDVAIERKSANDLIQSIIDGGLFDQVKRLKEAYSRPIMIVEGSLYGIRNVHPNAIRGAIAAVTVDFGVPIIFSSTPEETAQYIFLIAKREQEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent RNA helicase, putative
publication title X-Ray and Biochemical Anatomy of an Archaeal XPF/Rad1/Mus81 Family Nuclease. Similarity between Its Endonuclease Domain and Restriction Enzymes
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 47
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2002-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1j22A00
4BXOB 2BGWA 4BXOA 2M9MA 2BHNA 1J22A 2ZIVB 1J23A 2ZIUB 2JNWA 4M6WA 4M6WB 1J25A 4P0PB 2ZIXA 2JPDA 1J24A 2ZIWB 2A1IA 4P0QB
chains in the Genus database with same CATH superfamily
1VMKA 1COWD 4GZMA 3WY9A 3MJ4A 1NBAA 4PN7A 5BMVA 2GBIA 1M83A 4UCWA 1EWYA 3GJ6A 3PWKA 1XOIA 1IVNA 1X80B 4I2VA 4UEJA 1FVOA 5HF6A 3V8BA 1BDBA 3WS7A 1CHDA 1Z2CA 2QL9A 3GI1A 5D1NA 4JYAB 3EIQA 4G5FA 1IK4A 2BHTA 4PGAA 4HRAA 1GTG1 1K5DA 3OIUA 3FWYA 1NG9A 3PXXA 2VDNB 3SHFA 4ZYVA 1U9YA 4G5XA 4MMYB 2H3EA 4FIDA 2WFMA 1GQFA 2CNWD 2KQUA 3COYA 1RJWA 3B1WA 5FNZA 2NWQA 4XPIA 4OATA 4B79A 2VATA 2I8LA 2J0UB 2WBLC 4EH1A 4MSUA 2CNDA 2F1KA 4ND1A 3K8ZA 3R09A 2C82A 4RD6A 4BP1A 2V7EA 5DIZA 5NULA 4CKEB 5IG2A 1NY6A 2MSEB 4Y9RA 2ZYRA 3N59A 4MW5A 1KTIA 3C6XA 1IK6A 4IG9A 1BCRA 2XRYA 2OFFA 3V00A 4B7CA 2DCUA 2FJPA 1OWLA 3BH7A 5J58A 3PE4A 2CUKA 3V5NA 1E3QA 1UMDB 1ZOOA 1MW8X 3KPYA 2ZPUA 1FNSA 3EXG2 4GW3A 4FYPA 2P3OA 4WEOA 5K4AA 1U3UA 3ICCA 3MTBA 1OFUA 1Q0ZA 2UZ4A 5KWJA 4FLFA 3L8HA 4M9CA 4CJXA 3C3CA 3KR1A 2BMFA 4JUAA 2FWNA 2I34A 3BB4A 1W4LA 2X3YA 1U04A 4FGLA 3F6RA 4D3SA 2R65A 1QE0A 4YO8A 3JQGB 3UQZA 1GLVA 2IPNA 3JQFA 2BWJA 1DTWA 3G3EA 1ZJZA 4Y2RA 1G2PA 4YALA 2IEGA 4C0XA 4F8EA 2VQSA 4JVOA 2PUTA 4DL9A 4ZU3A 3RTCA 2BMAA 5FI1B 5JCOA 3ROGA 1SCUA 3Q3GE 3MUOA 1JLLB 2HMSA 2RKBA 3K0FB 3WLAA 3L7NA 1VI5A 3HFJA 4ACAA 1JXQA 1WCIB 1AB6A 3DMFA 4HDRB 1V5FA 4OH1A 2JIPA 3FXAA 4IY1A 2QTZA 4JIGA 5HJ7A 1TIBA 1YC5A 4CKWB 5FUBA 2NZXA 4EP1A 1FMTA 1ZNXA 4UJ5A 2Q2WA 4YT2A 4DB4A 3ILVA 1B0UA 3N8KA 4NICA 3VKUA 1F2TA 1KK1A 3M6LA 3WYEA 2CLOB 1E0JA 1GQ2A 5LP6A 5AI8A 2V7XA 3WV5A 3M70A 1F9EA 1T3ZA 5IM5A 1FRVA 2ZSAA 1BYIA 2AFIA 1DZIA 3KEGA 4GO1A 1JEOA 1NM5A 3LUHA 1EINA 2O6HA 2WIAA 4L7QA 3P2OA 5HJ2A 1FBNA 2Q9CA 3FOCA 1UINA 1VSBA 2GXQA 2G1KA 4AJLA 5EHZA 4A6XA 3SHVA 4Q18A 1GGHA 4MKRA 1V96A 4CCYB 1X1CA 1QGYA 2FXIA 4CM8A 4P0PB 1E2GA 3CLTC 4WLOA 1RBYA 1J4AA 1ZZGA 2O2YA 2WYOA 3L7DA 4FONA 4IMJB 4OGGA 4UQPA 3RYIB 1N32B 2IYPA 4E3ZA 4R1LA 3KVVA 1E2BA 4XR9A 3E4CA 4EY6A 2VSFA 1FC0A 3H9BA 3INTA 5B30A 1OVGA 4EF4A 1A7AA 1X1EA 3K0HA 3W7BA 3FSGA 3CVWA 2XUZA 2ZUSA 3ENKA 3KQUA 2ETXA 3D5QA 1KE2A 1VJ0A 5J3JA 2GM5A 4NEGA 3VNVA 2X19A 4WESA 4Z99A 2I6TA 1FXWF 3GZTB 2O8EB 1GFWA 2R44A 4Y98A 1IQPA 4L4YA 3HH8A 4A9AA 1AF7A 1P7WA 1KRHA 1UXHA 3GDGA 4CKYA 4E2YA 4Q1VA 3L7MA 1WZCA 2VJYA 3TE7A 3K71B 2UYYA 3NHKA 1OYYA 1AXEA 5EZSA 1TPZA 1AX9A 1TJYA 2C9BA 2ZSBA 3OQ1A 1N2CA 4LJLA 1JLHA 1MB0A 3N3AC 2XXBA 4FR5A 5T64A 3O9VA 1JHUA 4G1BA 4Y6QA 5ALDA 2QRUA 4EWLA 5CFPA 3DTVB 2QN9A 3DO8A 4I6EA 5IJ0A 5CIQA 1E3DA 3AETB 4TMVA 4J6EA 4RV4A 1FU7A 4JGGA 1RJGA 4POAA 5JV5A 3SQOA 1GZDA 5LZ8A 1G4AE 1SUWA 5BSFA 4MUHA 2ARKA 3ND7A 1MT0A 1N9KA 4ZU6X 2RJNA 5BRNA 4L16A 1CIPA 1VE9A 1MEEA 2ID9A 2HM7A 4F11A 5FRDA 1OYOA 2PH1A 5LL6P 1D8TA 1QX4A 4XTCS 2F43A 2Q8QA 3ESZA 1FDOA 2Z3WA 2FF7A 2XEXA 3MCWA 1U0FA 2R5NA 4LQCA 5GV7A 3UFXA 4IS3A 3BMQA 1NBEA 2QM8A 3I6BA 3OWOA 1KY5A 4TYMA 3CO5A 3SQDA 5JQWA 2LZ0A 2HHCA 2IV7A 2XTNA 3W05A 4IF4A 2QYHA 2XGMA 4KAJA 1KGSA 2Q0HA 4PFQA 1FSGA 4JD5A 1M2GA 3LUGA 5B7PA 4YC7A 2YOGA 1FUIA 1LDNA 3GV0A 3LWBA 3EASA 3SLKA 1T5LA 3MBKA 3N87A 3O74A 4ZAGA 1WETA 2E4ZA 3GLQA 2H1RA 3E81A 1L7DA 2DR3A 3INRA 3W90A 3W3AH 4N6OA 1QLJA 2POCA 3NCTA 3LT1A 5LBTA 1OXVA 1CDDA 1XTUA 2H1VA 3DBVO 2A9OA 2N1BA 2ZLBA 3W8FA 3H19A 4M89A 4K2HA 1ISFA 3ZY6A 5IW8A 1E9EA 3SIWA 2MSNA 4IINA 4MYUA 4PG5A 1GZ6A 4IOJA 3IUQA 3OM8A 3ORSA 4IJMA 2PLRA 3K1ZA 1P9LA 4UDYX 5KTPA 2ATVA 4INZA 3AEYA 2CLEB 4DUGA 3SZUA 1GZHB 1PR1A 3IFSA 5EJIA 3H6HA 3NP7A 5EMNA 3FYCA 4JXKA 2PUCA 3FFAA 1Y5RA 2FX3A 4ZVPA 5HKLA 5INTA 1RWMA 3BMCA 1ZMTA 4MUEA 5EG5A 3BYZA 2VHUA 1JMYA 1WD7A 2NYUA 4OB8A 1LDGA 3FWHA 1G20B 4IJ5A 3QX7A 4M9RA 4LDZA 4B8YA 4DABA 2PUEA 3HO1A 4DMKA 5AI9A 3PI6A 3O4HA 3C6MA 4V24A 3HV2A 2WJHA 1I0IA 1L6IA 2HCBA 3AI2A 4ZOCA 5BOSB 3L4EA 1Q2UA 3UH1A 3HZZA 3PXDA 2XSZD 1KY4A 4NAVA 5ILOA 2AUNA 3HVRA 1AUOA 1ISPA 3V8PA 5KWIA 1ODLA 1KC3A 1FRFS 3U7EB 4E30A 2FLWA 1C29B 3H05A 4IIBA 3T99A 2PUHA 4TYQA 5JS1A 4L7VA 4WFJA 3EF0A 2D4AA 1OZGA 4KXXA 3QVJA 2VPXA 4PAQA 3SX0A 4NYIQ 4HXFB 2P4UA 5JZMA 4ZVQA 3DVRX 3IE1A 5EJ2A 1TQDA 3IJRA 2QLFA 1K88A 4I4NA 5F9HA 1ZL2A 2RD2A 4RTRA 3DCYA 3B70A 4EENA 1JF8A 2EP8A 2ECOA 5C8XA 3R5TA 1UT8A 1X80A 3DFZA 5C80A 4N5IX 2CXHA 1UDBA 2CSUA 3CLHA 1OFTA 1B93A 3PTLA 4BUZA 2ZS8A 3MIZA 4GOMD 4OHCA 5AMXA 3I2JA 1SHJA 1YZNA 3EFOA 2HADA 4ZT6A 2VHCA 3I0MA 1R8JA 5KSPA 2I65A 2ZROA 4C20A 4UAGA 4EB8A 3LGSA 4ASUD 2ATEA 2G8LA 2QLNA 1P45A 2RARA 2VF5X 4QYWA 5EMJA 1XLWA 4EVQA 1P61B 4K2AA 4PV7A 4D6XA 5IF9A 3AR9A 3VR5H 1BHO1 4ZO7A 4L08A 4BO6A 2P9BA 4YNBA 1LDEA 1YGPA 4N0PA 1UJ2A 3HDYA 1JIKA 4PANA 3O3NB 4KK3A 1K89A 5F2KA 3SF8A 2JLQA 3N2LA 3O8NA 4JYPA 4DE5A 2FU5C 1MHTA 2JFHA 3KUXA 3ONDA 2HUPA 5I7SA 5GOTA 1W2HA 1UXOA 1JL3A 3GLUA 5JDIC 3TDMA 3DYBA 1OI4A 4MLZA 3WHLA 2WKQA 1QP0A 4ADSG 4RWEA 2G1UA 3PD1A 1A1SA 1P4AA 4YBZA 4WCFC 4MINA 3V2IA 2HU2A 3C4JA 5TVKA 1ZEJA 4BV9A 5GGYA 4H3SA 2IU3A 4CW7A 3L79A 1S9HA 1OXBB 3WNQA 2LV8A 5ARBA 3S2ZA 5DZSA 4P3PA 5DSZA 3FUVA 3PGJA 4JGIA 1F8FA 4RGYA 1XLUA 5EMLA 4QM6A 2ATCA 4FXOA 3RYHA 2XW6A 1FP2A 1WL8A 3CTPA 2MR5A 3B3GA 3LNTA 4PPYA 3OOEA 2QB5A 3T7DA 4LYYA 1QCZA 3PICA 1RZRD 4H7IA 2GK4A 2IH2A 1W6UA 4EB0A 1ZVKA 3HB5X 2IS1A 3VR4D 2JS7A 1XCLA 2GPYA 1JAZA 3JQAB 2K5UA 2VXOA 3MERA 1WCIA 4FJ0A 3RAJA 3PE3A 1ZVMA 1XHEA 3D4LA 4LF5B 3KM0A 4X1YB 2PMDA 5CHYA 1C3LA 2DPXA 1MXHA 3DMRA 4ZYYA 2WG2A 1U11A 5I9IA 4AP9A 1GR1A 1GSIA 3KOWA 4HLCA 1Z0AA 2QRZA 2XOEA 4QULA 4RDIA 4ZI5A 4CNBA 3R5HA 4DM4A 4EY7A 4CKWA 1F8XA 1O03A 4ZVVA 4F5EA 5DTQA 1HT3A 4JLBA 1ZN9A 4JEIA 4S1PA 4D92A 2GZRA 3JY6A 3O9ZA 2VHVA 3CUWA 1EGMB 2G17A 2O3QA 1B0ZA 1PWXA 1QBKC 1OFUX 3MW8A 4Y30A 1LSJA 5D51S 4CN9A 1M33A 3EPHA 5F2EA 1PK7A 5H9VA 2RHMA 4MW0A 5G0UA 2XDAA 3AFOA 2HHHB 1ECPA 4R8MA 1G3IA 2IRWA 3B1ZA 4PAGA 1VHLA 1GPKA 1NHGA 3FYSA 3QKSA 4MS3B 4O4JB 3ZWDA 1ENPA 2BGTA 3FBTA 4ZOQI 3K9WA 5AK0A 1J1UA 1JJBA 1NQAO 4AJ2A 1KMHA 4G0NA 3RYIA 3SCZA 3UGTA 4ROSA 4C0WA 1QF9A 1L4HA 1PFKA 1T8YA 3SDSA 2QBYB 3G5MA 2ZWAA 1U28A 4IVRA 1SU8A 2RGWA 1IHXA 4IQFA 2CB0A 2C5EA 2R6R1 5LWHA 2NOAA 4RJIA 4QYXA 1OCEA 4OP3A 5IZCA 2VK8A 2COEA 1RRVA 3SBOA 1ISSA 5EQTA 2BJWA 3GNTA 4O63O 4WE3A 3UFBA 1Y82A 4ZAYA 4F9FA 5DM4A 4B75A 2V03A 4I6GA 4I50F 4FMDF 2E21A 5LMZA 3WP1B 4E31A 2UXCB 1YUMA 2HQBA 3LUJA 4ZWNA 5BNWA 3N0XA 4JJ8A 3GGPA 3U0VA 3VYUB 2JHCA 5MGNA 1MJGA 4WK0B 3H0EA 4RF5A 1K2VN 5KVVA 3IR5A 3Q7SA 3D7LA 3DTVA 4R5MA 5AVTA 3WWOA 4ES6A 1Y3FE 2WB4A 3M8KA 2FG7C 4ML3A 1O5OA 3D6NB 4PGHA 2CXRA 5C3UA 3GZJA 2NVUB 4Q3NA 2DTDA 2XKAA 3GOHA 3X2SA 2BC9A 4ZEXA 3AR3A 5JRJA 4YHBA 2IUUA 2G28A 4YJ2A 5M29A 3TNJA 3USCS 2NU8B 1BQ3A 5L3RA 3VZSA 1ABBA 4N48A 1XFDA 4JLSA 5KKNB 3R5FA 4HAZA 3UJHA 1NQUA 3I1YA 1FZQA 1RJFA 3ZKWB 1JDPA 3M1AA 4LDNA 2O54A 3FI0A 3LBIA 5ESWA 2CYBA 4DGSA 1ORWA 4IOMA 3QPDA 2C84A 3ZDFA 3TW4A 2MYUA 4Z9YA 1YKFA 1Z62A 1Q17A 5ICFA 5KOIA 4Y7CA 3LDAA 1AHPA 1EDDA 1Z83A 1NVTA 2OGZA 4FDAA 3K0BA 1M6WA 1GAJA 2ZIAA 2QG4A 3A3KA 4RZXA 4UTXA 1R0BA 2EL9A 3K35A 4G56A 1L5GB 3RS3A 4MQEB 4PRYA 2R84A 1Z73A 1VIAA 3E1SA 2I3AA 1G63A 4NYJQ 4TKLA 4CMIB 1S2OA 3BIWA 2V55B 3A1UA 2IVZA 2JNWA 4P5EA 1U8ZA 3KNZA 4QUHA 2QRHA 4Q9HA 3VISA 4DEXA 2XA9A 5I8PA 3EIOA 1T29A 3GJTA 3ADPA 3GHYA 4C08A 4X8MA 4X84A 1LDYA 3I28A 3UB3A 3IBGA 9ABPA 2JFYA 3KU1A 2ZYWX 3DE7X 5D01A 4B7XA 3ZE9A 2MTBA 2QV7A 1QO9A 4TMWA 5F9MA 4DREA 2YC2C 4G89A 4M7RA 1R5OA 1E1QA 2NT3A 5E3HA 1IHUA 1AGYA 1YQGA 3UMGA 3UY4A 1J9EA 5SY6A 2C5GA 3BHMA 4OAOA 2OZLB 2GEBA 3FDZB 4HPWA 1A77A 2VP2A 4MQFB 2WAAA 3DOEA 1ELOA 4GZ3A 3D8NA 1ODTC 2G4LA 3WTCA 4KSYA 4LX0A 5KOJA 1EE1A 4Y2QA 4BMOB 1KEPA 1LJ8A 1G6HA 3H9UA 1WD5A 1J25A 3R0ZA 3N28A 4ETMA 1WW8A 1FDTA 5BOSA 2QE6A 3EY4A 3N2EA 1YOBA 1DXQA 4XX0B 5ALUA 2PFSA 2P4EA 4DCVA 4KTVE 1K6MA 4UEKA 3T1VA 5AUOB 4OYLA 3PVSA 2FEOA 4C0JA 3F8SA 1DXYA 3GFGA 2OYCA 1NX6A 3K31A 1RAGA 2DJ5A 3E9RA 3NC0C 3LCUA 1Z33A 3R6WA 3WR5A 2BFAA 2ZSEA 5CVUA 3BQMB 1PTJC 1ML3A 2A0KA 1R0RE 5CH8A 2I7CA 4CIBA 3GG2A 4ZVTA 1LBQA 5JD4A 3GLHA 4P7JA 5CLJA 4H7DA 4K3VA 4NWIA 3ZXXA 1O94D 4PC6A 4HDMA 2L19A 3V9AA 3HKBB 1JQLB 4Q9AA 1Q14A 2QXTA 4QJ3A 3K15A 3IMGA 3VR6D 3EYAA 5T3UA 1D0VA 3LDUA 1P2DA 1ZDMA 4CEHB 2QQFA 3NHPA 3WB9A 1DJNA 2BP7A 2IS6A 1MGOA 1CP3A 1CUBA 3LQYA 3MK31 4W8OA 1MABA 3E7DA 5A3QA 4RY9A 3WRYA 4C1BA 3WQHA 1TZJA 3GEEA 3FSEA 4ZOAA 5KYVA 5KQLA 1IBKB 3L0ZA 4PYOA 1EHCA 2ZZKA 3LF1A 4B3TB 5JFOA 1GU0A 3EYWA 2HIMA 3U4IA 3KR9A 4JBLA 3E1KA 3TW8A 1DI0A 1S01A 4BZXA 5ADHA 2JANA 4OMCA 1SC6A 3H2JA 3EVTA 4X66B 4WQMA 4L8WB 2ACVA 3ZHZA 4AZ0A 1E2JA 2HRZA 3OG9A 4RTOA 3V1KA 4FEGA 2X8AA 5AICA 1UAAA 4WZAB 3EFHA 3RU7A 1DAGA 2P79A 1QHHA 3GCXA 4E12A 4M9SA 1IVYA 4MDFA 1JKFA 3OY7A 3AKZA 1B16A 4CI0B 4B40A 4FW8A 1LWOA 1IMJA 1CP2A 5FL7A 1BD3A 4KK4A 2C1ZA 1FZTA 1Y8QB 4NYMQ 2C97A 1DGQA 6ABPA 4K9NA 3G5UA 2YMQA 4EI7A 4U0KA 4YDQA 4WCDA 4Q16A 4ZRNA 4D9MA 2ZANA 4ZYUA 3TW0A 4C29A 3UPTA 3GR6A 1M8PA 3QUTA 2DLDA 3JQAA 2ID8A 2VT3A 2TMYA 3WGLA 4BYMA 4WOBA 3SHOA 4ZXPA 4K9MA 1EIZA 1P44A 3G9TA 2X5JO 4F91B 3FUXA 4X1YA 4JT8A 2Y4OA 1XZLA 3CUKA 4GF5A 1ECFA 1RYBA 2B4QA 2IQ5A 3FZQA 3MXOA 4R9RA 1ARZA 3IV7A 2VHTA 1N5KA 3COSA 5EFZA 4UEWA 1AHHA 3ZY2A 1K5PA 4R6XA 4DGQA 4URWR 4BCDA 5BP7A 4U2GA 3FZEA 3KVOA 4NF2A 3NT5A 2FWMX 5J2UB 1U0EA 2ET6A 4C5BA 4K46A 4EPXA 1NXVA 2CXUA 4F21A 2FFJA 2YRXA 5CW1A 1U8UA 2XMPA 4PIVA 2EF1A 1OI3A 1M72A 1VM6A 3NHAA 3PUHA 1U3CA 1Z8DA 2HSEA 1FQKA 4HGNA 1DU4A 4N5NA 2PZJA 1RMTA 1EEHA 1KPHA 1G1AA 2PWZA 2ODEA 3HN2A 4TS1A 4YUVA 3VR3A 1VHDA 4G24A 4W5OA 1AXGA 3D9QX 2PEZA 2CHEA 1GP2A 1DZ3A 3LLMA 2FFQA 4AN1A 2HZ7A 4PN3A 2HTFA 4W5QA 4TX1A 1BHSA 3GVHA 1NYQA 1VMEA 3WL5A 2QAGB 3E2MA 1GGJA 4DIFA 1H2EA 4J0JA 4PCVA 3KPWA 1D8AA 1C0EA 1NLMA 2VO1A 3Q9UA 2FWBA 4HRYA 4JKYA 4DRXB 4WKCA 5JZ9A 2AOTA 3ZY4A 5HZGA 2QBYA 4U7HA 1LK5A 2OHFA 4DMMA 3UXHA 5BPHA 5ALQA 2LXNA 3UMYA 3RYTC 1Z4MA 2PPLA 3JARB 4LW8A 5LN1A 1JILA 8ADHA 3B51X 3R7BA 3DLAA 3NUGA 5DP2A 4GBGA 1R4AA 4RJLA 1ZN8A 2AFVA 3LWDA 1AUPA 4EL5A 2FE1A 2YX1A 2I0FA 4P7KA 3KJGA 1P18A 2FFBA 4CEJB 2IHVA 2X5NA 4RC9A 2UZAA 2ZYSA 1T6YA 5JATA 4M2LA 1CRPA 2XGSA 4JBHA 5GINE 3FPCA 5AOAA 3MMSA 3UJ3X 5JSHA 1BOFA 2I33A 2NIPA 3TB4A 4QT4A 2LCFA 3RGWS 4M0MA 1MV8A 5JS6A 4ZHQB 1XG5A 1GPJA 2ZSHA 3AQ4A 2C83A 5E2AA 3FPAA 5EXTA 1FQWA 5L3QB 5LKRA 4C3OB 1NF3A 2YN2A 2NU8A 3NDBB 3H1AA 1KZYC 1SCJA 2R7MA 1SKBA 2P7IA 5K2MA 3TQRA 1ISMA 1NOJA 3JD4A 2ZRNA 3DUWA 2HSZA 3M1YA 1IM5A 4H6VA 2BLLA 4M8IA 3WGKA 3HCEA 5SZHB 3E7WA 3K2EA 3LM8A 4TZ6A 1NQOA 1E63A 5T4EA 2VK1A 4G6ZA 2RHDA 5JFTA 2WKPA 3ADBA 2HWWA 2ON6A 4DPLA 3PG5A 4H15A 3RIHA 1UDWA 1CERA 3L06A 5E7JA 3DD1A 3WNCA 4F1WA 4DEYA 2A0FA 1T9DA 2NV0A 2NXCA 3PU6A 4OJKA 2FWIA 1ZMRA 2AOVA 2J09A 2IXGA 2XOKA 1N8NA 4JLOA 4BVGA 4MH0R 2UDPA 2BJHA 1M6EX 13PKA 3ISJA 4BNIA 2WMOB 3SFVA 5ITZB 1H8HA 2OCPA 3QLVC 4LDJA 4G5OA 3CEPB 3DHNA 3IAXA 4Q7QA 4ZICA 3IQZA 1TTTA 3FTFA 1CKEA 1AH2A 3RVQA 4BB0A 1PT7A 4UKDA 2PT9A 4AFNA 3WXBA 5IWAB 1YVUA 2H0RA 1E1NA 4WUVA 1H4TA 2WD8A 1PJQA 3JV7A 1X70A 3QY9A 1HLGA 1GNPA 1Q3TA 1U2PA 4CCWA 3E18A 3FETA 3MT0A 4O2BB 5AW3A 1VPDA 1JU4A 2Z43A 1E64A 3QSYA 4LIPD 4J03A 3CNBA 4KUEA 4I9HA 4BBZA 4O3MA 1T36A 3KAPA 5I9BA 1L4GA 3A1FA 3CX3A 3KJQA 3AY0A 4H1HA 2XCTB 1RXYA 3H8JA 1W5EA 4NCJA 1C2TA 3FDZA 4LEIA 3TZKA 1CD5A 4IYRA 4G1VA 5BQXA 4MRVA 5A4MS 3S2UA 2WVHA 4OX9Y 1LQTA 2CVHA 3LUPA 3BSWA 1YNSA 2WUDA 4ZZ3A 5ELLA 2C7BA 1U2SA 1X1RA 3MD0A 2HPAA 1TXGA 1GARA 2IHKA 1P2SA 4QBTA 3FNEA 5DN6D 4ZJZA 1B74A 3TUZC 3ST7A 1M73E 4OI0A 3TQSA 3BMXA 4NP6A 4BKPA 4CDGA 3F49S 4HEA6 5CU7A 5AVSA 3ZY5A 3K70D 2W70A 1FK8A 1TD1A 2A7QA 2D5LA 4XUDA 5FAKA 4OQLA 3PX2A 1Z8NA 3IAS6 2PS9A 3LVRE 1NJGA 4MCHA 5ALXA 2FEKA 3LHKA 1UPAA 4PLZA 2RC6A 1UMBB 3TEMA 4ARUA 3PJEA 5LZ5A 3RVJA 2BHNA 2HTEA 3G2OA 1I14A 3EZ7A 1OF1A 1KTVA 3RAPR 1BJRE 3FTEA 3MTIA 1MH9A 3CIFA 4JSTA 3T7KA 2A3RA 2AD5A 1C3JA 4NNOA 3TSAA 4YPOA 1LWNA 4BFCA 1BFDA 3HKBA 2X0EA 3KV3O 3JQBC 4CM9D 1XD2B 1H2BA 4YQYA 2NYAA 2RCNA 3PIDA 5JYBA 3KTFA 4MVJG 1H2HA 1LQ2A 4AY3A 4OQDA 4JHXA 1UKAA 1PGJA 5TMEA 4MKHA 3IXQA 4DLYA 1TVEA 2OP0A 5C31A 2AFHE 1GZ5A 3EVEA 3G2LA 3LBNA 2E4VA 4WECA 3UA3A 2EOAA 4TTQA 4CF4A 4F2WA 2YIMA 2Y66A 3JD3A 4YRIA 1W47A 2QK4A 1SOWA 3GJZA 3FY4A 4Y8VA 2C57A 1R4MA 1OH5A 2Q8PA 2QRPA 1JWBB 1DKRA 3G8DA 5K0ZA 4HMOA 1WKBA 2FB9A 5GONF 3I9FA 2O23A 3PC8C 2YXNA 2C95A 4LOHA 4OLJA 1HK7A 5TEVA 1R6DA 5BQOA 3GARA 5AJYA 4J1TC 5D85A 2VNAA 4UBKA 4M9QA 2ZI4A 1MB2A 2RE8A 5DJ5A 2RH8A 3E7XA 4YP5A 3HXTA 2FZ4A 4Y1RB 1KDRA 221PA 2EBHX 2JFXA 1XVTA 3U9TA 3BE6A 2QTNA 2WJ4A 3ZJUA 3PNSA 1OV6A 1VKNA 1K86A 2F67A 2NVBA 1Z17A 3JD2A 4Q6BA 4PYIA 4BO0A 5AW1A 1EB8A 3V4RA 3TSYA 4DY6A 3GFQA 5K0LA 4HWPA 3MFYA 3QHQA 2W8BA 1XTPA 1CS4C 3LUDA 1EIWA 1RQXA 2IXBA 2CLKB 1PJCA 3NOXA 3TQCA 5B4UA 2A30A 3H5NA 4JLDA 1VE6A 3ZNNA 3RGGA 3MGBA 4R98A 1B26A 1I7LA 2H7CA 4GYJA 2KBFA 4JR2A 3M6WA 3X1XA 5AVUA 1T3HA 1UFRA 3GFTA 3MAAC 1XVAA 3PFCA 1E3LA 3DL0A 4EQ6B 4ZYXA 5L3SA 3VU3A 2VP4A 3SSNA 1L3CA 1SXJD 2QQEA 3EPPA 1IHYA 3G85A 4HB4A 1R74A 4QKQA 4K86A 2CL6X 2HHAA 2E7ZA 1XR3A 2C4NA 1SUFA 1YJXA 4CEIB 4DC9A 3QP9A 1XROA 1VE3A 2XV1A 3QELB 4JWTA 3BCRA 3ZYCA 3J7AC 2OOSA 4RD3A 3TRKA 4CMBA 1LY1A 1OA0A 4DSTA 1J56A 1EVEA 1Z26A 4ND7A 2UUCB 2GXSA 3RUHA 2QAGA 2WWRA 2X2EA 2ZJFA 2NNLD 1JA9A 4HC4A 4C89A 2O59A 1MRNA 5BPFA 5IF3A 1DLIA 4KU4A 4RCVA 5IARA 1MV5A 2XF8A 2RAUA 4AXBA 4RZQA 4LWZA 2JASA 4RQUA 1KJJA 2BRUA 1QRAA 2WABA 2ZJBA 1G7SA 1TQ8A 4L73A 4YR9A 2I3BA 4UFNA 2CNBA 1HMYA 1AJEA 4JLVA 3STUA 4JP2A 3HY3A 2IZOA 3G2QA 5M34A 1KEEB 1DC3A 1OA1A 3GUUA 4FIZA 1L5WA 3B48A 3I9JA 3GRZA 2HQ1A 4L75A 3QXJA 5JAHA 1QRSA 2N0SA 4CEJA 3KOOA 5BT9A 5I5EA 3O90A 2DGDA 4JFAA 3IUEA 2P5UA 4ZAFA 3X1KA 4CLEA 1OTXA 1HO3A 2EXXA 4OFWA 2R7AA 3QYPA 1E1MA 1NVKA 5BSTA 4FDTA 2Z1DA 5GIPE 1U0SY 4IZOA 4LY6A 1TYBE 2NP6A 1RPAA 4BYGA 3TPFA 1YZGA 2ADMA 5LR6A 1E3MA 1LX7A 1BC5A 4F4IA 1MVNA 1BHQ1 2O3SA 3AU9A 2WF7A 3IAM1 3UUEA 2VK4A 5CR9A 3FPEA 4OFBA 5K0SA 2R8BA 4NBKA 4ZO8A 3GJ4A 4NU5A 3INGA 4EX6A 4JA0A 2GN0A 4QPPA 1VHTA 2IXAA 3LPMA 1K3FA 2QJRA 1M8GA 4QE3A 5CXXA 4DM7A 4K6OA 3PUYA 1ZIDA 3P52A 2Q9AA 4MIEA 3OPMA 4LJ4A 3LAWA 1FYFA 4AMYA 4OHYA 2WEKA 3D7SA 3H7AA 2JEYA 5HK8A 2OESA 5JWHA 4L3OA 4V2IA 1JYEA 3HVKA 3QTLA 5F73A 1RI5A 1RWXA 2CJFA 5TGZA 2BI4A 3BXGA 1KZHA 1P2BA 1AB5A 4QREA 1WP4A 1UBNA 3UUWA 3LYAA 4XWTA 4WWHA 5KJCA 2Q1UA 4TTRA 4XDZA 1TK2A 3AJ9A 3HGMA 3AEKA 3AFIA 5ALVA 2L18A 4M1KA 2CDRA 3PC2A 4EABA 2R8XA 3LX8A 4J0CA 1P5RA 1TPYA 3D0KA 1L5LA 4B3MB 3ZD6A 4QDUA 1IPHA 3X1YA 3ZI0A 2UV8A 1N6RA 4RK0A 2WU8A 4B81A 1ACJA 1G8AA 1Z0UA 3RSLA 3HGQA 3LGXA 5AVZA 1VXOA 4CXMA 4ZAZA 3VZCA 1X9GA 1XCBA 1ZCFA 4ZVLA 5BR8B 2CJXA 2ZAMA 1E3IA 1YQQA 2JI7A 4W5HA 2YVQA 4M9ZA 3OFJA 4GWLA 3SC6A 3IT1A 1JXOA 2QRLA 2ZTSA 1KE1A 2PX2A 3SXPA 1ZFNA 1YZYA 2UVDA 4D80A 3NGXA 3OKAA 5D7NA 4GLLA 2OB2A 4BTEA 4NJMB 4LG1A 1IPEA 2H4JA 2B8JA 2FG6C 5TQ0B 7AT1A 1PBTA 1ZNYA 2YV3A 2BKLA 1HDEA 2YWCA 3KKZA 4KVFA 4LCBA 4LYHA 2J08A 4X1KB 2UYHA 2Q6IA 2XQVA 4C7MA 3DM9B 2WTUA 4RMIA 1J2YA 2OG1A 4B4KA 3GRPA 2ASEA 3DBHA 5D6NA 4RPHA 3TJMA 2H5JA 1IG3A 1RR6A 3AP3A 3KD2A 3NHMA 1G5IA 4UM9B 2QU7A 3KKEA 3A7EA 4EX7A 2XMZA 5JPIA 2PZLA 4RE6A 2FDRA 3GRYA 2QD2A 2EERA 3AFNA 2V8BA 3I34X 1GTSA 4GKBA 5BN1A 3KCNA 4Q7MB 1THZA 1YS1X 1Z47A 3L40A 1XE3A 1J2JA 5C8YA 3QXSA 3V1UA 3BAFA 1LF0A 2M6KA 4J9UE 2I66A 1KEWA 2RHRA 3BUSA 5DU2A 1RQ7A 4JHLA 3R6GA 1YQEA 1Z75A 4ON9A 3EE6A 1PLKA 4BTLA 2NSLA 2QMHA 4L9RA 4C4YA 1N2EA 2X8JB 5L4SA 3E58A 2O0LA 4CKBA 1QVVA 2R00A 4DV7B 1RVDA 5CM8B 3LHFA 3JZMA 3R5KA 5BURA 5BUZA 2ZVPX 3HM9A 4WKOA 2YQZA 4LJ6A 1F60A 2EX0A 3FCUB 4EW1A 4NXNB 4IIJA 2ODBA 3F9RA 4U2EA 3ROZA 2G77B 4BVEA 4BV2A 2OMKA 1XDBA 5FTLA 1IUOA 3RHZA 1CQXA 3NH6A 3G82C 2OLKA 3PDUA 1JDBB 4Q4HB 2P4SA 3A1VA 1K7YA 2CFSA 3P20A 4L9WA 1OLOA 2G0AA 2IYVA 4KXMA 3LHSA 3X2EA 1PFWA 2X8WA 1EX1A 1Z5VA 3I8XA 4PZDA 4XJSA 5GV8A 2OPHA 5BV2P 3FKQA 3T6KA 3TVTA 3TKYA 3ZHRA 1N36B 2G09A 3Q7PA 5EL0A 4D4JA 2WU3A 4C6TB 5ED4A 1H9BA 4ZTUB 4WZBE 2PCJA 3EVGA 1NNSA 3NETA 4WTOA 5TEWA 3HGTA 3K16A 2NU7A 1MIHA 2W6CX 5D00A 5FWNA 3JQ8B 1RRMA 3GRRA 1X7HA 2V3WA 1XKQA 3DOIA 2J9XB 4Q03A 1F4PA 1ZBDA 4RCZA 3HB4X 2ZVQX 1UCFA 3T41A 3LF2A 2FVYA 2HJVA 1TJPB 1YIOA 3ICVA 3P9ZA 3FVQA 1EQAA 2AJTA 3OFSA 1V41E 1KEKA 1ND5A 3UB2A 4OQNA 1J0CA 3TLKA 1C9MA 5ECYA 1WX1A 3ZE6A 4B17A 5KI6A 3ODGA 1NN0A 1WXXA 3CTMA 2NMVA 3GLFE 1TU4A 1E8MA 1MPXA 4QAQA 1HOXA 3OT5A 5DTMA 2HQOA 4A6EA 2OUKA 1H2XA 2GF0A 3F3YA 3MTEA 3RVDA 3K32A 2VTDA 4XVCA 4HKTA 4NCBA 5EE5B 1CZNA 2RI1A 3OQOA 4N8SA 3IQGX 3T3EA 2YZNA 5TVGA 2GHRA 2PFGA 3S2IA 2V96A 3AHJA 2E87A 3QSGA 1E9SA 3B8EA 1DRWA 2WNIA 4HNUA 4DLKA 5E7QA 4JFRA 2GKGA 5BSUA 1KYZA 2YZ2A 3GB9A 2YIDA 5IDYA 3K6RA 4A2WA 1X92A 1ZY2A 3LCMA 3QXHA 3AOEA 4V1CA 5UKDA 1AKVA 3CRQA 3BX1A 2A2ZA 4NFLA 4CEIA 1P5JA 2DC1A 3KETA 2ZEJA 4XGIA 3TOVA 4M7PA 5AJXA 2JBAB 3GZNB 4HZUB 1Y1SA 4Q05A 4IQ4A 3IAHA 2B4RO 2VWQA 3AQIA 3VYSB 1SKMA 4X8OA 5L4LA 5K3FA 5FUMA 2CMDA 2QAIA 4KODA 4EF6A 3JTMA 4TWIA 4LQDA 3L8ZA 4RSHA 5DTJA 1S2GA 3TLBA 4TRRA 3GCDA 5BQ5A 3TQTA 3NBYC 1VGQA 4MAMA 3VVBA 2QLBA 3IVXA 4YYZA 2XYRA 3KIPA 2PXCA 4DA8A 5JADA 2O0MA 2PMFA 3RW9A 1OAOC 1RIFA 3F7NA 1U80A 2VJMB 4G63A 1K6JA 4LRQA 3H6KA 3KAKA 5AW8A 1WIWA 1J49A 3TSOA 1BXRA 2NNWB 4CV0A 1SBCA 1R0ZA 4NX2A 5IBRA 4M1SA 5TS3A 3RB8A 4AMBA 2B1QA 2JW5A 2CL7X 4DQXA 1CB7A 3U1BA 2QIOA 3PQ5A 4JOCA 3MJVA 1AZTA 1GEEA 4K9PA 2DQSA 4CF6A 3CN7A 4DA4A 2OO5C 3CGWA 3OWXA 3SU8A 1W88A 2YS6A 4DOMA 1FYVA 3CMMA 3G7UA 4S05A 1EFTA 1NL3A 2XNHA 4I1IA 4ZRMA 4EA6A 4HQFA 2JJ2D 4AJNA 3WADA 1X86B 2VPIA 3A3YA 1HOTA 1H0KA 3KU4A 3Q2OA 3DMDA 4EY3A 4PLGA 1TAGA 1MO6A 3B20A 2XXAA 4QUGA 4E5SA 1FW8A 3A6JA 4RV5A 4EYGA 2HDOA 4TL8A 1YKGA 1CK4A 3BGSA 1N25A 4I4TA 5B5SA 1MB4A 3R8CA 4MITA 1L5SA 2QNBA 2UVPB 1UPFA 2XY4A 2ZIZA 2H08A 3UW1A 4ESEA 4KXYA 3MEQA 4MUNA 1QH8A 5I01A 4J9VA 1X1DA 4OMFG 2EW2A 4P4UA 3HJGA 1KSFX 2P40A 3EVAA 4BWYA 1R88A 2YVKA 5KNDA 1TU0A 3DXYA 4J0EA 3W5HA 5BWLA 1ZGAA 1ZMXA 3H13A 3IIKA 3N7AA 1LH0A 1SXJB 3DF7A 3GUVA 3I5AA 2I91A 1QZUA 1U0JA 3L8FA 2K87A 1E1QD 3IIEA 4B84A 4DJFC 4M55A 1GFSA 3IP8A 1A98A 2FK7A 2PS0A 4G2TA 5DTRA 1Y3DE 1HZZC 3EH2A 3WKAA 4E70A 1P2VA 2V9CA 4ZEVA 2WZBA 3CBQA 4L4ZA 4IVQA 1V16B 1F51E 2WQZA 3N70A 4AAYA 5IZ4A 3R74A 1ICEA 1G55A 1XZPA 1UXJA 2HGSA 2X9LA 3SHWA 3PTZA 4KX5A 4MS1B 2GBPA 3D3NA 1QZZA 4FEAA 4U7PB 2H9AA 3O4JA 2IOHA 3W2TA 1CTQA 4LGYA 4AJ4A 1Y1TA 3AY6A 5B1YA 4IQ0A 3THWB 5CFOA 1Q7EA 2BFNA 4L5BA 5AK5A 5FOTA 3EBOA 5JNTA 3HMKA 2PX4A 5DRTA 5AUQA 3C45A 1VRVA 2VS1A 1W5SA 3I42A 3MF4A 4DBZA 2X7HA 1SBIA 5GAJA 1TVMA 3TBKA 4B34A 1XL1A 1CZOA 1E3EA 1JLRA 3IBYA 1XEXA 3IHWA 3QU2A 3H04A 4HAXA 1GZ7A 1Y6RA 1W1UA 2ID7A 3CG4A 1V71A 1ZW6A 3L2OB 3N0RA 2VR1A 1SCAA 3OJFA 5EXXA 4OGKA 1SVUA 1U7WA 4JQSA 4Q9NA 1SQFA 1J0AA 2B8EA 1THGA 1VGRA 1FYWA 3MRVA 3Q98A 4GYWA 3NAGA 4TL9A 1L5KA 1R4ZA 1U6JA 5L6MB 4FOTA 5CB4B 1Z2AA 1O3YA 3V3TA 3COVA 4TYPA 4X1KA 1UPBA 4GNKA 5TQJA 1XTRA 1CS0B 1QV9A 4ZN6A 1UBUS 5FWAA 3OQIA 5BVGA 3T7TA 1YI8A 2AC7A 3TTXA 1NF9A 1T13A 3D3WB 3UWPA 1JPUA 2IYLD 1DAHA 1XMVA 3KR2A 4O4JF 3TIIA 1XA0A 3COJA 4X1IB 4CRWB 3T1OA 5LQAA 2IW3A 3A1NA 3GJXC 4JT2A 3DBRB 2FZGA 1LFDB 4HLNA 4RESA 3OT4A 3DDWA 4LE0A 2HK8A 5EIXA 1HC7A 2RG7A 2FSHA 1KEZA 3A6EA 3D2CA 5TC4A 4C30A 4D96A 3IE2A 2UVQA 3ED5A 4URVR 1EJ6A 2ZVJA 2DECA 4W8HA 3NX4A 5FUXA 4TYNA 4ZEOA 3V8EA 4WLNA 2I55A 1UODA 1W93A 3O9MA 4FTWA 4NBTA 4TVBA 3V8VA 5KDLA 3K6SB 3O31A 4NV1A 5K3CA 2X8JA 1IHOA 3E23A 3ER8A 3P7MA 3RS0A 5AM3A 4ZC8A 4KQ1A 1NSTA 1NLZA 2A9RA 4RXUA 4ENRA 1JHYA 3PUIA 2PMCA 3VYVA 1RTTA 4N3AA 3VRHA 1QIIA 2AI2A 1BMTA 1QIMA 4LQLA 2O14A 3DBIA 3FNHA 3I2YX 4UM9D 1CY0A 1FPQA 5EY5B 1X39A 2R1TB 1IJEA 1U7UA 2XLBA 1IQUA 3NW9A 3E82A 1CWUA 3SR3A 1XZFA 1EQ2A 1EUDA 2QJOA 2WLTA 3EA4A 3GUHA 4H6WA 2LE0A 4KMSA 1LDBA 4I3HA 1T8SA 1PJLA 3T12A 4H3KB 1AIPA 1L5MA 2TRSB 5KKAA 5HA5A 4AZSA 2QTVB 4HMQA 2QRNA 2REOA 4KXQA 1P6XA 3UUFA 1C3XA 3WLSA 4JI7B 1KEVA 2NG1A 3PCRB 2ODQA 2X8LA 1QJCA 1VI6A 3KYCB 3GGSA 4AG6A 3DL7A 3VJMA 5LFAA 2KX7A 5AH0A 2V7UA 2V7BA 4JELA 1DKMA 5EKXA 4JI8B 3K9CA 3BXZA 3M49A 3JQ8A 3H17A 1RYYA 2DTEA 5FA6A 4F45A 1OD6A 3R0QA 1U94A 1T24A 1ZCAA 2CCKA 4OQYA 3AK4A 4FR2A 2ONJA 2IU4A 3KZVA 4RH1A 1KQNA 5AUNB 3DZJA 2JAWA 3ELDA 2W9XA 2DMRA 4C06A 1ODIA 2HMVA 4L28A 3REFA 1AV6A 2ZSUA 3DTNA 5U9CA 3I45A 1M8KA 4FN5A 2HK7A 4AJOA 3UGQA 1UM9A 1DIRA 2XVXA 2YV5A 1I2DA 5FTMA 4UMDA 3PRYA 4MIYA 2PRYA 5E8JA 1YJCA 4YMHA 3DMNA 2IQIA 2CHUA 4YVFA 2RHJA 5DT2A 3H0CA 1NMEA 3A2NA 3IVCA 4EGAA 3UJBA 4YFVA 2UAGA 3VZDA 2NU6B 4EHIA 3F71A 1UM8A 1WUJS 2QPLA 1LUAA 4LWPA 2YWGA 4JKIA 2HF8A 3V7YA 5C5EA 4RKWA 3B9QA 1OKKD 4I55B 3OE7A 5JG7A 4MUFA 1ZQ9A 1W0KA 1IC6A 3B3FA 1XDWA 1XXHA 3L7KA 1E4YA 3M4NA 4WNCA 5AVJA 3U7IA 4E1VA 2O5CA 5JWRA 1PX2A 2A3NA 4MRRA 4QBGB 4MPJA 4Z5XA 4B4OA 5PNTA 4Y9TA 2JRCA 2K7ZA 4XLLA 5FBHA 3Q85A 1NJSA 1RLUA 1RI1A 2VCEA 3PNMA 3C5CA 1REQA 1GGKA 4HZUA 2CLSA 3ETNA 3LRXA 4G0YA 2HA2A 4JEHA 4XIYA 4YREA 3HACA 1Y5MA 2V7WA 3OJWA 4BFSA 2Q45A 1E2FA 4R8VA 1IONA 3EZYA 3GRVA 3N2KB 4G85A 5DASA 4B7UA 2WM8A 3IKJA 3O4VA 1TAQA 1Z34A 4MCJA 1RZ3A 2PGAA 2WV7A 4KAFA 3KEOA 3ZOZA 3A58B 3D8TA 5ALTA 4A1OA 1KYVA 1ND6A 2YJ4A 3DEFA 3R3WA 4QGAA 3G2JA 4DA9A 2VJMA 3TOCA 2BFFB 4YACA 4YPVA 2XCUA 5AT1A 3KZ1E 1U1IA 2LNDA 1MTZA 1S02A 2X0KA 2JFBA 1IM8A 4DBLE 2ZYHA 4L1KA 4EARA 1KC1A 1ZIYA 3CKYA 4NBUA 4PU0A 1UMCA 3DDSA 4WFIA 1L4UA 2W2MA 5ICMA 1XCJA 1KFJB 5JDIA 5KC9A 1GDHA 3EGOA 2FKAA 3R5SA 1JDNA 1YZVA 5FYQA 3V4SA 1Y8ZA 4LI3X 2QYOA 1KH2A 4NE9A 4AJJA 3OQJA 3FJOA 3O8OB 4WCFA 1AK9A 3D5EA 3OFVA 2HO5A 3T61A 4CT4B 4E3WA 4BRZA 1Q0TA 2H51A 3L49A 3QVKA 3SD7A 3RF7A 1V95A 5C1OA 2FX5A 1J0DA 1AKQA 1G8HA 2JAQA 2W6NA 3BTSA 4DAEA 4HYEA 1XAHA 4E11A 2ZYAA 1ZO8A 5CLHA 3OZRA 2FY8A 1E32A 1ULUA 3R0VA 3VAAA 2HSGA 3DEYX 4P31A 3GEDA 4XX1A 2H92A 4Q3KA 1GPLA 1ZHHA 4OAQA 2QX6A 4AS2A 3B9BA 1H66A 1TDJA 5DHAA 2JGMA 3MTQA 2GJSA 3EVDA 1X8KA 2VDMB 4JDPA 4KG7A 2OL4A 3HTXA 3U56A 2ZJ6A 2FSFA 3RFUA 2PRSA 3C3WA 3DEZA 4G1UC 4BMSA 4ZJYA 4RVUA 3LG2A 1XWWA 1KP3A 2O0HA 2YZKA 3PNYA 3ER9A 3EGWA 2EFDB 4X60A 5AYVA 4IJVA 1O7JA 1H69A 4QXAA 1EAYA 3GCGA 3P94A 4ZZ1A 2YQ5A 2OFXA 3CNLA 4WT7A 1DJPA 2B69A 4HR7A 1WCV1 3AERA 4H6XA 1I4LD 3DFUA 2WHRA 3NT2A 1KAEA 1BROA 1PO7A 1V16A 4K6KA 4UJ3A 1WVIA 1KJIA 4UDXX 1DDIA 1RT9A 4ZRDA 4MS1A 1VLZA 1ISRA 2BFMA 2MT9A 2Q1TA 4TTIA 5CYOA 2BEUB 3AWDA 3SR4A 3PHLA 4KB5A 2ATIA 3ZZ0A 1NGSA 2UZ1A 3PKJA 1N0UA 1NV9A 2ZW9A 4KIGA 4W5NA 3WLMA 2NGRA 5HKBA 1JEYB 5EE9A 2J5RA 3IMFA 2VT2A 1NUSA 1O57A 3ED1A 4PLWA 4E0BA 1H5QA 3CVUA 3AFGA 4UPDA 1V8OA 3OPYI 3RTEA 1D1TA 2GUWA 3WGJA 5J2UF 3AESA 1Q74A 2UZ3A 2ZULA 3KYDA 3FHTA 3PNPA 2WYUA 1UPTA 5JR3A 1G3QA 1CJBA 3H4TA 2HREA 1D6MA 1WXGA 3EXIB 4L95C 4JC4A 3GLIB 4RK7A 5C7LO 2ZRIA 1CS0A 3OTWA 2D0DA 4GD3Q 1VCHA 1S2LA 3I83A 1GIAA 5ITSA 1JHVA 3D3WA 5JSZA 1LXCA 4FLEA 1U1EA 2D2VA 3VH2A 1U81A 3DE3X 4XWWA 1PR9A 5C8DA 2H85A 3BDAA 3ELWA 1FTSA 1XU7A 4M8KA 5A9TA 3FOWA 4DR4B 3AL0C 5AHWA 1Z2EA 4MRMB 4BJ6A 5DNYB 3B9PA 3EPRA 5LJIA 4RFSB 3C1AA 3K8QA 3PUXA 5BSVA 2XB8A 3QG1A 4J75A 1BE1A 4KV9A 2V6IA 4II3A 2HQRA 2AV6A 4A0GA 4HCJA 4B3GA 3LTEA 3SLRA 1KFEB 3H1GA 1N8KA 1Z38A 3AKEA 2P9ZA 3FFXA 4I8IA 4OSPA 4P82A 5DMHA 5BYBA 3ZLBA 4A8JC 2GM4A 3PXCX 3GOQA 2ESRA 3M4YA 3PNVA 3JQPA 2Y0DA 3PQ3A 4X71A 1P9RA 2QIPA 2P11A 5C46F 4L4XA 1ZK3A 4XDYA 4HZIA 3ZBQA 4FYXA 4EG1A 5HOQA 2WQ7A 4PXSA 3TNYA 4NZ9A 3LD9A 1UBLS 3TSZA 4G37A 2VZ0A 3RYCA 5EZQA 3B7WA 5JNLA 3N0VA 4G5HA 2QN7A 2ECPA 1A4RA 5EIHA 4BJ1A 1BAPA 4ED9A 4ZK2A 3EIXA 2BR4A 4H3VA 5B1HA 4EFKA 2X4DA 1TYAE 1YBFA 1JZSA 2QORA 4HX5A 6REQB 4NENB 3RRZA 2FH5B 5F51A 2BMWA 3AUYA 3GGDA 4DCGA 3SBEA 3FNBA 4ZHQF 3CLKA 3WNZA 4YI3A 1Q6ZA 2G5CA 2QTVA 3TL2A 3D8BA 1CUFA 5SY9A 2PHZA 1CUWA 1XRLA 3I2FA 3MHPA 1HURA 3DMTC 1DBSA 1XLTC 3VBCA 2PJZA 2CV0A 2ZJ1A 3F74A 4I4CA 4UFPA 2GD1O 5DHQA 4D4KA 1WJGA 1WZEA 3B7PA 2PKCA 1A5SB 5ESRA 3EA5A 1J1IA 2GNOA 5LPNA 2FLVA 2BTQA 3B6MA 4MUIA 5HQ3B 2G9RA 3TCKA 3VR0A 3WKBA 4ZJUA 2AR7A 3L8DA 2PE5A 4Z4FA 4MIKA 1KL7A 3T3DA 5DM70 1E7QA 3ELYA 4QGFA 5AHXA 2P9GA 5CDFA 5EI5A 5K0CA 2BE9A 1IEWA 3H4VA 4Y9DA 4I19A 4CFZA 2VH1A 2XB2A 1P4SA 2IOFK 3ESDA 4CNQA 3PNQA 4X8HA 3Q8XB 3JQ6A 4IXDA 3T5CA 1IJKA 3GPCA 4EUKA 1GCUA 1ZD9A 3P9SA 2XVAA 1SU4A 1QG6A 3QTBA 4IIDA 2H57A 4P98A 2BGGA 2ZI6A 2NU6A 3LI2A 1I7SB 3MWJA 3WDMA 3CUVA 3FNIA 3AI3A 2B8NA 2XWQA 3UXMA 4AD8A 3V48A 4LYJA 4O2BF 3N05A 2R47A 4EYSA 3WL4A 1GTVA 1CR4A 1E1KA 1IQRA 2AW5A 2QY6A 1PFYA 2AFIE 3HU5A 1NVMB 3KC2A 2XMRA 3M4XA 4MEAA 4TTPA 2XQGA 3T5TA 4CDMA 5IS2A 3DV2A 1ZI6A 3HYRA 1Y7PA 3JALB 1RXIA 4G26A 4MEBA 4Z7OB 1H2YA 4OFZA 3C3XA 1CC1S 1N6IA 2ZXFA 1M1XB 1BGWA 3BB1A 1PTJA 3EUAA 2ZG6A 3LLCA 1X3LA 3GG9A 3ZE2B 1S2NA 2CKMA 2IUTA 5FUWA 4ENSA 5KTMA 2ZWOA 5IBCA 1JXAA 5FO1A 3FDXA 3OZCA 2D00A 4D8XA 4J3NA 3D5TA 2ZRJA 4QDJA 1N3BA 2VF8A 3WGNA 5ADWA 4RY0A 1YVEI 4CF5A 5B4VA 3KFVA 3GGOA 2B5WA 4AROA 3PC6A 2CNOA 2HF7A 4MARA 1O0CA 1QXSA 2OFWA 4D8UA 2YWFA 1SU6A 3RSCA 5DOZA 1T0JB 4EYKA 2Y27A 1MG5A 1PHRA 5DNEA 2VF2A 1D03A 1ACMA 2BFFA 2OGWA 1OU4A 1SY7A 4NAUA 1P9OA 2FETA 3NHBA 5GADl 3U4QB 3R7FA 1P6QA 2RB5A 1ZITA 3WNBA 1AY0A 3Q10A 4A91A 1BE6A 1KBZA 2E5FA 4EJ0A 1HH4A 1N2CE 2YVAA 3L0CA 4D45A 1T4CB 3NVMB 3QENA 3T1NA 1G8FA 1HXHA 3GJ0A 2BHLA 4AECA 3N0TA 1P3DA 1R00A 5F12A 2GYUA 4NNPA 4PSKA 3S40A 2PVSA 3A11A 1USKA 4IJUA 4QQFA 1AO0A 4MWCA 2E2WA 4UEOA 5ERXA 1U3TA 3IP3A 1TGYA 2OAQ1 2QSUA 3KZXA 4QXQA 4WVFA 5DBEX 1ILEA 2PXHA 1QCYA 3RC8A 1E5LA 2E48A 5KPJA 4JUBA 1IUNA 5DW0A 1IQ0A 1O4WA 1KKUA 2I1WA 3LLUA 4DUZB 4E4YA 1C4OA 2NSYA 3AJAA 4GU5A 2GK3A 2C31A 5SICE 1FTQA 5CDTA 1X7XB 4UMVA 4QXPA 5E8RA 4L8LA 4FMCB 1RAEA 3U40A 1K66A 4RZUA 3H8SA 4ZI3A 4KQ6A 2Z6AA 3L1KA 1TM4E 1SM4A 4L9AA 4BLQA 5BRJA 4QDTA 2XRZA 1VE7A 1A8IA 1UKBA 3L8GA 3WAJA 1KZ1A 1M2VA 1YHNA 1P7PA 1KEUA 1QIJA 1NVEA 2GZSA 2J6BA 2PSSA 2ZDGA 4KEAA 3I3OA 3WMFA 2TMDA 1CUDA 2PN1A 3UAZA 5EC8A 3PXUA 2DFPA 2F1OA 3DQZA 2FR1A 3F2IA 1Z36A 3ORQA 1XD8A 2A5FA 4KDEA 2HXGA 4PRLA 2CBXA 3NORA 2B92A 5HGXA 1S2IA 3PC3A 2XT9A 2CLIB 2B1IA 3HA3A 1PG2A 2PTGA 4EMTA 4AKHA 4HWTA 5CPBA 3CRVA 5DYIA 4JJFA 3OM0A 1Y37A 4JL5A 3K73O 1KQGA 1GT6A 2OCAA 4TQ9A 4E5YA 1LPNA 3O8QA 2FW7A 3PJDA 2Q3LA 4WGFA 2GZMA 3BG5A 1EH5A 2O8CB 2CE7A 1P0CA 3L92A 2VAMA 3ZV3A 1RBQA 2AZDA 2FN7A 1XHLA 5E6SB 1XYGA 2V6BA 1TVKB 4QATA 3KSAC 3C3YA 3KKOA 4ID9A 5JYCA 1A8QA 2NYRA 2Z09A 3LC1O 1U3WA 4JQOA 4OREX 3A36A 1SZJG 2QG6A 2VJAA 3T7SA 2AHOA 1IOLA 3M0EA 2WKSA 3CX6A 1JG4A 3HRIA 4AYXA 1J2TA 1T2DA 4L4UA 3S2EA 3B2QA 2C8LA 4CF3A 2CLHB 2H00A 5DX8A 2GFQA 1P7CA 3DW1X 4XSGA 4J49A 3RCBA 2CE2X 3EVCA 5E4FA 3VHXB 3WJ1A 4TRJA 2XZTA 5KC8A 5DX0A 3CEJA 3E22B 3GIWA 1SVWA 3CLSD 2BFOA 2QD5A 1OREA 1S7GA 2WVGA 1YL7A 3AJDA 3FKSA 4KE7A 4LXYA 4MKXA 2BZSA 1FLNA 2H2FA 4GGOA 2JFUA 2IT1A 5KHLB 5BYJA 1SUEA 5G0VA 2FUG6 2EDCA 5FTWA 1JJ7A 2ZDQA 1ZUNB 4CQJA 3JYNA 2ZBUA 1KY2A 1UBEA 2JD1A 4LZZA 2G4CA 1GUAA 1UC4B 2H48A 4EGJA 2Z56A 3GGGA 1PV1A 4YR7A 2W2PA 1GDDA 1ZK0A 1NV8A 4MW2A 2IF2A 4Q3CA 2EKPA 3N2YA 4AO6A 3P2JA 3PHHA 4DS3A 4AUNA 2GASA 1DUSA 1YO6A 3LRTA 3FMOB 2I80A 5H7XA 3RVSA 3S68A 3FWZA 1RWPA 4DA7A 4EZEA 5C1PA 4MO9A 1KU0A 3CT4A 4UUQA 1ZH4A 2A78A 1R9GA 4XYGA 2VXBA 1L5QA 2W2VA 1O6CA 5J59A 5GZ1A 3V34A 2HMYB 2O2EA 7ABPA 4BMZA 3QRWA 5LA6B 5JD6A 3VR6H 4Y7DA 1OUMA 1BFKA 2BMEA 2H1LA 3KS9A 4PSAA 2GEKA 6REQA 4EHAA 2XMDA 1NQXA 1KK0A 2C42A 2ZUDA 1K63A 1Z29A 1ZQ1A 4OGWA 4MS4B 4C88A 3RIGA 4YB8A 3QLVA 5J4HA 1N2OA 2ETVA 4JLWA 4JZKA 3NTXA 3T5BA 2BSQA 5D6OA 3DA8A 4OUKX 2ZXEA 1E9BA 1QO7A 4MXDA 1XJ5A 4QTYA 4HQRA 1K3TA 1I4EB 4IH9A 4IUDS 1IIRA 2CK3A 3ACBA 5COAA 5JYEA 4NH4A 1NYRA 4CMJA 3LLSA 3JQRA 4GPTA 1WMBA 4ZCIA 2F1IA 2ZBVA 3KT6A 1PTKA 3QBJA 2PZGA 1L3BA 4MLPA 3FTDA 2V5AA 3BIFA 4KQCA 4X41A 3C7AA 3IT0A 5BUCA 5HQ3A 3LBAA 4CR8A 5L45A 4ZDWA 3PF9A 2VDKB 5IKOA 3I5UA 2G9VA 3WK6A 5BSMA 1JT2A 1HYHA 1N33B 4UHHA 4Q1BA 3AHHA 1EMDA 4ALNA 5CDSA 1SKUA 1DINA 4F56A 2ZIXB 1C7ZA 1TX4B 4DDMA 5T67A 5DULA 3EODA 3F9IA 3DKIA 1L4FA 3QUQA 1T5SA 4I46A 1T1RA 4D9FA 4Y9SA 2R4QA 4HWGA 4QNNA 5FHRA 1Z45A 2ZATA 3RS2A 1RM0A 2IX9A 2VJNA 3FMGA 5GM1A 1IZ8A 3UAVA 3VSEA 1OH6A 2WHYA 2QRVA 4MNTA 3K0KA 5IDXA 3D7NA 3SMVA 4BMNA 4K6HA 3ZD7A 4ARZB 2OLJA 1U7XA 2R7KA 4N0DA 3QW2A 4JJAA 4YQZA 1H9AA 1CEYA 1Z25A 1ZD3A 2ZIUB 4G4SP 3VC1A 3KCQA 5EE1A 3IAFA 5I7EA 1T0PA 1WHSB 1V43A 3CNQS 4JZYA 2JJQA 3WDSA 4AJHA 5DI3B 4HQ0A 3WGYA 2AT1A 3H3JA 4YV7A 5KX5B 1QFMA 4P5DA 1PWZA 1KH3A 2M6RA 4UW9A 4UVHA 3IVAA 1R12A 1SO8A 3STHA 1D1PA 4LTMA 3AOGA 3GGJA 4GOOD 1Y9AA 3RC1A 1LS1A 4I5FA 1OZ0A 4ZCSA 4A03A 2BGIA 1XTVA 4Y6PA 4FEEA 1Q1GA 4MA4A 4CGZA 1QNFA 1ORTA 2V54A 3T3PB 2UKDA 1ONOA 2H9IA 1I3LA 2OLEA 3ICOA 3K96A 3NOQA 4IVNA 3EVNA 1CY2A 4LN1A 2ZAGA 4MV9A 4UTZA 3UCEA 5LJLA 1OSNA 2VJLA 4DIKA 1F3OA 2GLUA 1X8XA 5JMPA 2X2PA 1AQLA 4UREA 1UBSB 4PR3A 3HB7A 4QOGA 1DXHA 5JOQA 5GP1A 2CSXA 3D6TB 1QHGA 4P3KA 3HDGA 4Q3AA 1WV0A 2HX1A 4X5OA 1E5TA 4KR3A 4DVGA 2Q4OA 3D02A 3ABSB 4XQ0A 1QGED 1CY7A 2GN8A 1FFWA 1XZHA 2WPDD 3MYRA 4PYMA 4N1AA 3Q9NA 2Z08A 3MRXA 3TIGA 4QLBA 2ZR8A 1DFHA 1CQJA 1XQ1A 3EXEA 2Q0QA 4OU4A 2ZKIA 3KBBA 5FI0B 3N2NA 1FRQA 1N8TA 4RO0A 4BNJA 2G71A 3QKRB 2HQSA 5KNDD 4NCHA 2A9QA 1JI0A 4Y2UA 3F2VA 2ZIEA 3EQ2A 2WD7B 5TF4A 1FVXA 1JR6A 3ESQA 2A8YA 1N6HA 1W94A 2P69A 1IEVA 2RAVA 3UHOA 1FFDA 4EJSC 3QA9A 1SVSA 1YDHA 3LKDA 4J1TA 5EAIA 4GM1A 3ZWNA 2OXFA 5EIAA 4DMHA 4KRXA 4ZODA 1E2IA 3GJ3A 2NXJA 4WUTA 1Q7RA 2GARA 3PFIA 4HNHA 1XWFA 1XA4A 3MINA 3L01A 4YK7A 4U63A 4ZCLA 3FZGA 2J0EA 4E32A 2W7TA 5HZMA 1I1HA 1S8NA 5JS7A 4X97A 2FEPA 1TQ4A 1KI9A 3SP1A 3HABA 3IV6A 3UAXA 1JLSA 1T1JA 3ZNQA 4A0QA 4BQNA 5K20A 2A1UB 4K9DA 1SGWA 2WFLA 4V1CI 3K9QO 4IDFA 5TJ9A 4KLZA 3ZQUA 2B30A 3EPJA 3O5AA 1G2QA 1E6UA 4G0MA 4WW0A 4HBGA 4UU7A 3L77A 5C7IO 3UBMA 4NTZA 1CR2A 3CLTD 5FIUA 3B7GA 2ZB7A 5EP1A 3K0SA 1G9TA 3NBXX 3HVUA 5REQB 2VYVA 4BN0A 2B0JA 4YP9A 1IBSA 1DAOA 3CISA 2ANBA 2JH9A 2QUIA 2G08A 1TCVA 4P80A 1LNQA 5P8WA 2PXAA 2M6LA 1OT5A 2FMFA 2VF4X 1HMPA 4WXMA 1G5RA 1T5DX 3MJRA 4Q37A 3VOSA 5ICCA 1XZGA 3ETDA 2C9DA 3QXXA 4YA6A 5JTUA 1Y6JA 3A6FA 2FPGB 4DJDC 4F1JA 2C99A 3W9BA 2FW0A 3OIFA 1YQWA 3GRCA 1MZVA 1Y7HA 1D3AA 1FSFA 4IMIB 1OR8A 1XZJA 4ZO9A 1UKEA 4FJ2A 4M0EA 3ZQJA 4CLRB 3HKEB 5AW9A 5SZJA 3UT5B 3C3EA 4U7WA 2YBEA 2NADA 3EVBA 3O2SB 1GYPA 4IX1A 1TVKA 5E6SA 4ARSA 3QVMA 3GT3A 2CZGA 1JDUA 3QFHA 2XUPA 1YZTA 2BZ1A 4I9NA 1N3LA 1OILA 2RB4A 3H1EA 3NR2A 3QE9Y 1XMOB 4C2UA 4KSBA 5BW6B 3BREA 4FQ7A 4ZGGA 5D1HA 3RS9A 1F0PA 2HJWA 4YDHB 3QU4A 4FGUA 4W6QA 3WL6A 1A8HA 1ATZA 1CXZA 2XJ9A 3ABRB 4F6RA 3IILA 3AF1A 3KOUA 1N2BA 1NJ6A 2O2HA 1SQ6A 5F2NA 2X0JA 5K8JB 1QIGA 1E2DA 4O2AA 4YRTA 3VZBA 1HFWA 1WDTA 2GPTA 2G6TA 2IP4A 1MNQA 4JBIA 4WLEA 3SYRA 3ZHCA 5K0GA 4WY5A 5JH7A 3QH4A 1IXZA 1Y48E 2GM3A 1F8GA 4C5AA 3SEFA 3RRJA 4EHLA 3JS5A 4PS1A 2FPMA 2P67A 1FX0B 4AURA 3EEFA 1JB1A 4KJZA 2APJA 4UNPA 2Y9MB 2VJBA 1QMPA 1FP4A 4B6RA 3U1VA 4JT9A 4HH4A 1LDMA 1A7UA 4EB6A 3B52X 2DKNA 3GLHE 1R0KA 3M3PA 1R6TA 3EDCA 4IJWA 4Y6GB 4F4JA 4ITVA 4GKAA 1Z2OX 2Z4RA 4YMUA 2AX4A 2J6IA 4LE1A 2WYIA 2JAOA 3QOXA 4ZIRB 4Z4HA 1LX6A 4JBXA 4LXHA 4PYJA 2X1VA 2QROA 1XNQB 4MYRA 1NI4B 2H1FA 3ID6C 3VU0A 1LZLA 1YONA 2X6QA 2Y0PA 3KKKA 5J40A 1FJHA 5IN5A 1JNYA 3PITA 1IH8A 1QYVA 3F9CA 4A2CA 4Z4QA 4OHUA 3JYLA 4MB2A 4GBMA 4TKVB 2EVWX 3HLTA 4QJ4A 3K4PA 2P2CA 3RRXA 3A37A 1B0PA 2NQ8A 1RP1A 1TRHA 3C5HA 3C6YA 3NNDA 3WYFA 3M6IA 4C07A 4N18A 5A4KA 3FG9A 3H3XA 3O47A 4ZPXA 4R7TA 4LOAA 4O4IB 5E95A 4RYLA 4WGGA 4AWXA 5KTRA 4WNAA 3CCFA 4CU2A 1GKLA 1SU7A 4Q01A 3EOAI 4FCVA 3PXAA 1PGNA 4HNGA 3U17A 3VGJA 3C1TA 1TUBB 1U4SA 2E4YA 4Q9KA 8AT1A 4AW9A 5DNWA 1F7UA 1NUTA 3IA7A 4KO3S 5JZBA 1QDEA 4C6RA 2O2JA 3SZGA 1N2XA 2HLNA 5ERYA 2VQDA 3I76A 2F59A 3T34A 3X3HA 3R4VA 1D6NA 1XRJA 4QDOA 1IBLB 2E9SA 5A7HA 3PWSA 1RC1A 1E3WB 1RKUA 2QDKA 3JWHA 5AK3A 1K98A 5CIWA 2R11A 2DQ4A 2H7YA 3SVZA 2CVOA 3B6JA 1JHDA 5AK4A 3UENA 3UBTA 4NJOA 2M9MA 5FNVB 1DG9A 4EW6A 2CVFA 1STOA 3W0LB 1E94E 4JVSB 4BB9A 1N7HA 3T15A 2Q99A 1BRMA 5TF0A 4DJEC 1ESMA 1JG7A 2Z6VA 1QQ6A 4S1VA 3JXEA 3SXUA 3QVGB 1OLXB 4DDKA 4DSZA 4A82A 1G8JA 4QEKA 1V8DA 1GLGA 1BTOA 3GBVA 1M74A 4YRFA 4N47A 5KJEA 1FU8A 2QV0A 3ZCRA 3KQKA 4DNOA 3C3JA 1F20A 3TBHA 1RWNA 1PZMA 4D79A 4OM8A 1VGVA 4YAWA 4RD4A 5NLLA 2I76A 3R3JA 2DLCX 1A82A 1OU0A 2AR0A 4XB6B 1TM1E 4F2DA 2PSFA 1MRSA 5A9SB 3V4ZA 4XRRA 1OYWA 5A9RA 1K6EA 4RMNA 5D5QA 3K9LA 1SBQA 2QN6A 2WV9A 4ZFNA 2X1LA 2Z5GA 3O3OB 3VR2A 1OBHA 1PX0A 4TWBA 3H7IA 3NB0A 5A06A 4RACA 4LWQA 1YR9A 5CDYA 1MTOA 4ENQA 1WHSA 2JIQA 3G17A 5K8UA 4ITUA 3DEAA 4U2FA 5FORA 4GLBA 1R6UA 1WZIA 4RS3A 2I54A 5KX5A 2CFRA 2W0MA 1JJVA 1RM5A 4BFUA 1EEXB 3L6BA 3HDQA 1F48A 4QUIA 4B8WA 2VQFB 4POOA 1YZ3A 3INYA 4D9HA 1J0XO 2VT7A 3KR0A 3GP8A 4RKEA 2X2FA 5CD1A 1Y42X 2PGDA 3AILA 3HBAA 3I1JA 3MWKA 1M10A 4L74A 3HS3A 5CB4F 4EY8A 3GAAA 3LUBA 4PX2A 4F7WA 2PZEA 2QQ5A 1ZGGA 3HWX1 1NVUQ 1TAHA 3HYNA 3KB2A 3MS2A 4FHEA 2KE5A 3KKNA 4QGBA 3UG7A 3KQVA 4LZWA 4P4NA 4TSFA 1NR7A 4C7KA 1A4IA 1I4WA 1MQSA 4NABA 1N78A 4XB1A 1IG0A 2Q3EA 4KQEA 5E6UB 3AEQA 4G4GA 3USZA 4C21A 3DR5A 5IBPA 5EXEA 4EA8A 1WP9A 3OCJA 1H5NA 2ZUTA 3NHUA 5BNTA 3QITA 4N7JA 1FDVA 1G7CA 4V0KA 3V4PB 4ZYWA 1K4KA 3I6IA 5CGZA 1ILWA 3LDHA 4RFLA 5DGDA 5H4GA 1B23P 2BR3A 1Y5LA 4BPBA 1ZHFA 1YS4A 5ES3A 4C2AA 3FTCA 4GZ6A 4JGBA 5EUQB 4EHNA 2WD7A 3I52A 3MAGA 3M6XA 2BGRA 2Y2VA 3FBGA 2QF7A 3OZTA 2GXUA 4G07A 1U1GA 1UOOA 4Q12A 2ODAA 5CXUA 3V7WA 2A0XA 3FGPA 5KQPA 1XF9A 2DWCA 1MBZA 1F38A 1P1JA 4JP8A 4UATA 4E21A 4GI7A 2WUVA 4MGIR 1I10A 3D6JA 4BQIA 3ZE0B 3I5YA 2PM8A 4BO3A 2J0QA 3IDSA 3O2JA 3QQ5A 4NH0A 3OJCA 4QQRA 4X20B 4MQ5A 4ETIA 5GOZA 1LLFA 4FI3C 3SM3A 1OGIA 3RBXA 3Q3CA 3C3DA 2WMNB 3HCBA 1V5IA 2EJBA 4X00A 2XB6A 1DHTA 1ZESA 4MUYA 5FWXA 3FZYA 2CWWA 5DBFA 3SQXA 1W73A 2BHRA 1K3UB 2FUEA 2GPWA 2YMMA 3GNLA 3H5VA 1J22A 1EFKA 1DBRA 2Z3ZA 2IU6A 1CNFA 2NYVA 1T2NA 3IT3A 4H4EA 4Q34A 2Q1SA 4Q7LA 3S1AA 3TSWA 5IT0A 2PUBA 1FUUA 2HF2A 4OHZA 3X1JA 5JZSA 3JRWA 2I7XA 3K6KA 4HWOA 2V0GA 4P0TA 3MB5A 3D54D 4BX2A 2IZ0A 3PHIA 2QI9F 1Z6PA 2QTCA 4F2GA 1ZSYA 4GMKA 1WHTA 1U5BA 4FN4A 1NBMD 2FPGA 3C3AA 4RETA 4NI5A 4EKEA 2WJGA 4FMBB 2NV6A 3HKEA 5IPFA 1X14A 3UT5A 1ZD8A 1YA6A 3A6KA 3MGCA 3OCWA 1UBJS 2Y1CA 1T5TA 1MLDA 2FPPB 4EB3A 5KTNA 3AM5A 3PFGA 1SWWA 5KSYA 1RDFA 2J45A 3HUUA 3PQ2A 3DT9A 4ZVRA 1XTQA 4OLHA 2BEVA 1SOAA 4KWCA 5K8TA 3TLYA 2CMGA 5E1DA 3T3NA 5CB0A 1Z06A 4GE3A 4FR0A 3PCXA 1PVVA 3GP5A 1OAOA 5EEGA 4AT1A 4Z51A 2YDXA 4H4DA 3D2BA 4CG1A 1JBKA 8MHTA 1QO0A 3BIOA 2ORIA 2QRKA 4F2HA 1O2DA 1IBMB 1W5TA 4XAQA 1JEEA 1C3EA 4HGZA 5IKEA 1EFLA 1G5HA 2R9VA 3PFFA 4JR0A 4QDXA 1KXJA 1TW3A 3R9XB 2JFVA 3QVOA 4DSOA 2OO5A 3ZWQA 1J8DA 2BV3A 4KE9A 1EFHA 4L15A 5EGNA 3KT3A 2GN9A 3RK0A 3EZ9A 1JR3D 2I6SA 4JP5A 5ULLA 2O5EA 3ONFA 3U4AA 1PVDA 1RQLA 2CFOA 4HGRA 3RREA 5BUSA 2VP9A 2Q7XA 5BMOA 5LQMA 5JCJA 1T4BA 3MT8A 3ICPA 1WPRA 2WR8A 2NUBA 1G1MA 1XTKA 3H2ZA 3I8SA 3M33A 3L7CA 3NDPA 4MP8A 4P36A 5IEJA 3GLRA 1GD1O 4C04A 2F8SA 3DULA 1V11B 3HRHA 2MSWA 4RK1A 5ECWA 2HRBA 3K6JA 4EZBA 3G88A 2B5OA 3GD7A 3OIGA 2G36A 1M66A 5GJWC 1NLYA 2C4TA 1YQUA 3FWKA 4G86A 3FYUB 3NDJA 1HDXA 2EFHB 3ZDEA 3A1CA 4YAKA 1Y5NA 1VKHA 4LF7B 4ALMA 3GLTA 3VMFA 2C2YA 3E3OA 3TD9A 4C7BA 1QYWA 2VJCA 1QR6A 2EBFX 4BNKA 4UD2A 5EIOA 1JAYA 1GDTA 3BEOA 2EFGA 3SS7X 5L95A 2A86A 4J1NA 2ZCUA 4ROTA 5EN4A 1H3FA 3VKWA 1HZZA 2GPBA 1TUBA 3Q0IA 2G70A 2O07A 4LYAA 4N40A 5DMXA 4WK6A 3DO6A 5ECDA 1RXVA 2DYKA 5GJVC 3ROEA 4U7DA 3W8RA 2C9CA 3AVPA 4K3UA 3JATA 4MUGA 1QGUB 5FFMA 3UATA 3G2HA 4WBNA 2YINC 5B6IA 1PJ2A 1YOVA 4PCAA 4Y1GA 3V2UA 2A9FA 2FMUA 1Y89A 2R86A 4PSUA 1U7PA 2VYQA 1HTTA 3ZZ1A 4P4GA 5B2EA 3QWBA 5F52A 3TB6A 3V8RA 1G4UR 4RTPA 4LNHA 3V46A 3HKDB 3HA7A 3D4OA 4YONB 2IWRA 3O73A 1I2CA 9GPBA 1G59A 2D7DA 1G8SA 3AB7A 3OICA 1YB6A 4YH1A 1KYWA 4FEYA 1W34A 3O8BA 1X7WA 3S7TA 1V9LA 4AN0A 2PZKA 5IJ9A 3HEMA 3RYFB 3DDZX 1EJBA 1QHEA 3NBFA 4MPTA 4FHDA 2WKWA 2Y0BA 4ZOLA 2JB9A 4BMPB 1OLXA 5KKCA 2B61A 4DDUA 3NEJA 4DTIA 1EP2B 1Y9DA 1Z4NA 3OU2A 4GX5A 5KJFA 1EJ2A 1T4GA 1N2GA 4GH5A 4XWAA 4UARA 4LK2A 1MO5A 2IYZA 1ETUA 4NU8X 1KQOA 5AIAA 4WFQA 3FD8A 4BO7A 4E1BA 5B2FA 3UMVA 3I4LA 4S0XA 1NONA 2AEEA 4DQUA 2Q1YA 3BZUA 4NR0A 4D26A 1E1CA 1DB3A 4PLYA 3UOWA 2R60A 3QLEA 3ZTTA 3TQFA 1F0KA 2Y67A 1PQWA 1AUQA 2OGTA 3F5FA 1VB3A 1NI5A 1QFJA 2CMKA 2ZS9A 4IMPA 5I4IA 1UOQA 3A6DA 5JALA 3SIRA 2AEMA 2ID4A 3HB0A 4KNYA 3N39C 5CA1B 4X54A 4UBNA 3SJCA 3IBSA 5JROA 1GAWA 4D9IA 3D8HA 5A7GA 1N5LA 3UMFA 4EGQA 4N0EA 1Z68A 3TIVA 4MV8A 5IVKA 3T3GA 2B3DA 4E13A 1QQ5A 3KBOA 3B12A 3HVIA 2BM1A 3EUFA 4RADA 5CM2Z 1ONBA 2GA8A 5JARA 4N8EA 1NN1A 4Q24A 4R1PA 4QZVA 1Q3HA 4J0KA 2PJUA 4A8JB 5A4DA 3BK1A 2FSGA 2OXCA 1QQTA 4H77A 1KJ8A 5FPQA 3ZWVA 1NVAA 1Z4QA 5E1MA 2QVGA 4PEVA 4M8NE 3TOSA 1YDMA 4BRWA 4O0MA 4QNMA 4ZDIA 2OGUA 1TFRA 2BE7A 4EG4A 5K0JA 1TF5A 2ZE5A 4C7VA 2C7PA 3UJNA 2R751 2P2SA 2FV8A 4ITRC 1M1YB 3ZHUA 3H65A 1FVHA 1L4BA 4DWOA 2P62A 4DMRA 1JFVA 5MHTA 2RGGA 4TKUB 4Q4AB 3HP7A 3CPEA 2A5DA 2B94A 2HI0A 4Y2XA 1XGKA 2IZZA 5KBYA 3G8AA 1V45E 5EQJB 1E7RA 2Y68A 2QZSA 1YRWA 4OA5A 4PTYA 5L3ZA 3VU9B 3WX0A 5JAPA 5DSTA 4YIKA 1IY0A 2OMEA 4FGZA 2VSYA 4MPRA 3EOBI 3SEZA 3UAOA 1XBTA 1U7ZA 3T0GA 4XB2A 3HJFA 1TYCA 3JCZA 3DB2A 5D5PA 2UU9B 3I73A 2FP3A 3AB3A 2BSAA 3ZK9A 4OY3A 2OOKA 3K5PA 1XTZA 4G0XA 3C5EA 1NMZA 1XEAA 2Q6OA 5FBQB 4WASA 1T0BA 4DMCA 2WF8A 1XJQA 4GLOA 2ZQZA 4X7PA 2DH5A 2KS6A 3A2LA 5FUVA 2LCIA 2UYOA 3F4KA 4DLTA 1TIPA 4NU6A 5A62A 2JZCA 1R0SA 3D81A 2ZJYA 3FR7A 5LMNB 1UP7A 3KZMA 4KFSA 2EDAA 2KJQA 4XYEA 1QKJA 4BX8A 4PLVA 3UHFA 5IH7A 1CDEA 1USGA 1VB5A 3MJHA 2VUUA 1K5HA 2XECA 3H5IA 4XE5A 3KALA 4CLHA 1JUDA 3I53A 2XTJA 4LA4A 2ZE8A 1PNRA 1OHHA 4XUCA 4YUXA 1NC3A 2YWHA 3IE0A 1E4EA 4LV8B 2H59A 3BD6A 1NQTA 3EGDB 4IVPA 3K1AB 5F5XA 4B71A 5KVAA 1GTRA 1SQGA 2R2GA 1VLLA 1OB2A 3N8NA 5B3KA 3N8IA 3Q41A 5JQGA 4TTTS 3PQEA 3G23A 4IDDA 1MVOA 4FWTA 1M2WA 1NVWQ 3G7SA 1DBIA 7MDHA 2WM2A 3PB3A 3LCRA 1O08A 2O7RA 4N5HX 4DM3A 2JLVA 5CFLA 3WVNA 3T7IA 3NUQA 1F8UA 4FOOA 2IDKA 1GKYA 4GUDA 4OOEA 2ZWMA 3QKUA 4PRKA 1N6KA 1MAAA 2FZEA 1SKYB 1YBVA 5AO9A 3OQ6A 4J2OA 2FPUA 4KYUA 1UQTA 2EHJA 2AOUA 2HNBA 2P1ZA 3LDFA 4WI1A 2WJAA 1SUCA 4M0DA 3FKSD 5LYJB 2EFYA 1AKWA 1VJDA 2E3JA 1H94A 1L7MA 4GQIA 3H6GA 5JXJA 3FSRA 1EFPB 2QMUA 3HCCA 3AEUB 3PGXA 1Q95A 3PVCA 4WN9B 4FCTA 5E9JA 5CB6A 5LQKA 3ZWWA 3AWIA 1O5IA 4OQ4A 1JHZA 1HE4A 2ZI5A 1JU9A 1NQWA 4BNHA 2HMAA 4LY3A 1CE8B 1E60A 4QUEA 4FS3A 5IAJA 4B2YA 3EAFA 3NRCA 4RF3A 2B98A 1B73A 4XFJA 3FOAA 4BVJA 1VHWA 4Z54A 2AK2A 2YASA 3VZQA 3TR0A 3F6YA 3IEIA 3J81k 1BXZA 2JVJA 2I9PA 1U0TA 4JODA 2CF6A 3WLKX 5LLDA 1ZR4A 3ROPA 2AWOA 3S28A 4YUZA 1G9XA 3ITDA 4EUEA 1G3RA 1KR5A 3RFXA 3WIOA 4YCBA 4GDMA 3R9XA 2JC3A 1L0BA 3P27A 3QJGA 3UOGA 3WBJA 1UF9A 2Z2KA 1ZBQA 1H65A 2VKTA 3AHFA 1YCHA 3QI7A 3MGAA 4CMCA 5K03A 3JSAA 2J3QA 3ZHYA 3EEYA 4RDXA 2C9ZA 4AY6A 3VAZA 4XOIA 3V7UA 3RFFA 3ZC3A 4MPDA 2W6IA 5FFNA 4B4VA 1N34B 1E2KA 4DT1B 4FXPA 3ZS9A 1EFRA 5AXBA 4IJKA 1SCBA 3Q7TA 2HWUA 4C5CA 2FP4A 3BA1A 4FNAA 2XMBA 5J5AA 4IPTA 3VU1A 3AI7A 3DE6X 4B3IA 3EGIA 3IVMA 3W6NA 2IDMA 3WRXC 4A16A 1IAVA 5EUCA 1HLDA 5KSOA 1AQUA 2P1RA 1VKRA 3ENNA 4FJ1A 3VC7A 3GPLA 2X14A 1SVKA 3CCCA 2WWGA 5B58T 4OMUA 3G0DA 2FPSA 5DH9A 4D3DA 1ID1A 2EBWA 1O96B 3ENQA 4TLAA 5FF9A 1L4MA 4BIMA 2PUAA 4L51A 1D09A 5HE8A 5I7RA 4Q9DA 1BN7A 3A25A 4UMFA 5IK2A 1KDVA 2ZYDA 2DB3A 3L7BA 2D0OB 1SXIA 1KKLA 4C14A 4CM1A 3BOSA 4IIXA 2PNJA 1L4YA 4MICA 2AWNA 1H6CA 5JHGB 5CIYA 3FOFC 2PAFA 2HCFA 3AF4A 3ZTYA 2PG3A 2ZYVX 2R3SA 1BMFA 4CL0A 1SELA 1XYVA 1Z2PX 3V4LA 4FGSA 4BLSA 2NUAA 4AUMA 1A9XB 1W36B 4QUBA 1QGUA 3CNEA 3KKLA 3HHPA 4F85A 5LZ9A 1CUCA 3W77A 4HH1A 4M21A 3RM3A 3DWIA 4FMCF 1QYCA 4QHSA 3RRBA 3A31A 3LOPA 3CWCA 4EKYA 2VFAA 5J4VA 3WFJA 5K9ZA 2WOJA 4RVNA 2Z2JA 3IYLW 3KQYA 1TQ2A 2CUNA 3QWAA 1EESA 1N7IA 1TZCA 2JHGA 2LDXA 4GYKA 1JEQB 1YJBA 1PFVA 2QP3A 3ASVA 1G5PA 4LMAA 1SHUX 5I9SA 4BP8A 5KB3A 2YFKA 3PUWA 2C9YA 1ZRSA 4OQXA 3TSCA 3EMDA 5F7JA 2BKUA 2YHUA 3RYFA 1KVRA 3IQWA 3QVUA 4KPFC 1W9MA 1JAHA 2EKLA 4JB8A 5FCDA 2HCRA 3B38A 3VKHA 2ZR9A 3PUZA 5A4FS 1K75A 1V1JA 2D1FA 5B12A 4WCVA 4XRGA 1RYFA 2A5JA 4IAOA 4LCEA 2OV6A 2IBMA 1K7XB 3C5VA 1ZJ4A 1FLVA 3HCWA 3RSQA 4JR1A 1YNOA 1Z88A 2Q1WA 1XKXA 3DZBA 2RDMA 2ZJ7A 1LV8A 1R15A 3QHAA 4AKSA 1T2EA 2XB9A 1JFSA 3AIMA 1BEZA 1XB2A 4H17A 2VAPA 1U0BB 2LD4A 2HA5A 3VMMA 2P9HA 4INPA 4YAEA 3OLYA 1UOPA 3KYBA 2OO3A 3MD9A 2JHAA 5C1DA 5CA0B 1L5YA 2I6UA 4ECAA 1PS8A 5C2JB 3ROFA 4PSVA 4MR7B 3TG8A 1SB8A 3OT1A 2IXTA 1KETA 2H0AA 3PSHA 2NV2B 4GQBA 4H1TA 3W4JA 3ZV4A 3Q72A 3VH1A 1MEJA 5JT1A 5BWOA 1N5DA 1T2AA 4KZKA 3DZCA 4J0DA 2HHJA 1PL0A 4K03A 3AUKA 4FFOA 3C8UA 2IDJA 4A8JA 3GEPA 3M9WA 1B8NA 5BV0A 4OHVA 1A71A 3MOIA 1X1AA 4NCXA 4CMGA 2C77A 1IDOA 3OEWA 1SG9A 4IDHA 4XYLA 2WZCA 2LR0A 3SJZA 4Z0HO