1J22A

Crystal structure of archaeal xpf/mus81 homolog, hef from pyrococcus furiosus, nuclease domain, selenomet derivative
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
131
structure length
131
Chain Sequence
b'VKVVVDSRELRSEVVKRLKLLGVKLEVKTLDVGDYIISEDVAIERKSANDLIQSIIDGGLFDQVKRLKEAYSRPIMIVEGSLYGIRNVHPNAIRGAIAAVTVDFGVPIIFSSTPEETAQYIFLIAKREQEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent RNA helicase, putative
publication title X-Ray and Biochemical Anatomy of an Archaeal XPF/Rad1/Mus81 Family Nuclease. Similarity between Its Endonuclease Domain and Restriction Enzymes
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 47
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2002-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1j22A00
2ZIVB 4BXOA 4P0QB 2M9MA 2BHNA 2BGWA 2A1IA 1J25A 1J22A 2JPDA 2ZIUB 1J24A 4M6WB 2ZIXA 2ZIWB 4BXOB 2JNWA 4P0PB 4M6WA 1J23A
chains in the Genus database with same CATH superfamily
2VTDA 4QUKA 3SOPA 4ETNA 4OQ4A 4I9NA 5SYNA 1FNNA 2XTJA 4ACAA 2PRIA 4QBFA 1K06A 4TZKA 4ZVLA 4YJKA 3K92A 4Z4HA 1XEWX 1FU8A 3BEOA 3TDKA 3K2IA 2X5OA 5SZKB 1H3NA 1OZ0A 2XTMA 1R8QA 4JQYA 3PB3A 4E4YA 5F77A 3CX4A 1VYVA 1JSXA 1NI5A 1NBEA 4O2LA 1DQPA 1PO7A 2J5QA 1UZMA 2UYGA 3H5WA 2UZIR 1XROA 3NBUA 1C0EA 3PNBA 2WV7A 3F8SA 4R5HA 5JNVA 3AR5A 5HF6A 4QREA 3V1TC 1ZM4A 4L6IA 1XHLA 1L4LA 3MWLA 1ISHA 1TKRA 3ZCQA 4CUKA 5JFGA 4ESVA 1BGXT 4LBYA 5LYJB 3OQOA 5J43A 3OHPA 4FDMA 2GZRA 3RRBA 3GJ4A 2Y1XA 3SHWA 2UUPA 4DNPA 7AT1A 2Z1MA 3SC3A 4AC9A 4CYMA 3O4VA 4KVGA 1PJCA 2WA1A 3PDJA 2R85A 1OD6A 2VPIA 2Q9AA 2X0KA 1S8FA 3DQZA 4D3SA 1SC3A 3R7FA 4DTIA 4WESA 4LF5B 3AJDA 3C43A 1MW8X 4NYIR 2O5VA 1V7PC 3TJMA 2WAAA 3TQTA 3B3JA 2JJ1D 4EW2A 3ZGZA 2O8FB 1U8CB 4UOQA 1I0LA 3S1SA 1XN4A 3B38A 1KU6A 1S2GA 1QSGA 2VDMB 1WV1A 3CUUA 3QUQA 3UF0A 4DIUA 5B2EA 5C5DA 1YC5A 3DHWC 3EODA 3SIWA 1INLA 5LQUA 2KJQA 2OGWA 3BD6A 5IAAA 5KOJB 3AFMA 4HTAA 1TU4A 2LNDA 1SQ0A 4Q7LA 3L6RA 4B84A 3ENZA 1TO2E 1FFCA 4OTZA 2QRUA 3I6ZA 5BW5A 1PJTA 4ZVPA 2Y2VA 1JI3A 1WOMA 2IZ7A 4PPFA 4PQYA 4RPLA 5JS6A 1ILEA 2AK2A 4DR1B 2RGBA 4TLDA 2D59A 4MVJD 3HO8A 1RXWA 2MSWA 1NONA 1LI7A 5HJ2A 1X1RA 4H3SA 2ID7A 3EULA 4RKEA 3WLHA 4EMTA 3RADC 4HLUC 4JLJA 1QVWA 3QIVA 4E5VA 1DO0A 5EUQB 2YNMA 3BH7A 2BEVB 4XA8A 3R5XA 4GYJA 2ZS7A 4BL5A 1SC4A 3RC7A 1TVKA 5T4EA 1N2GA 1W6RA 2P67A 3RARA 3K71B 2FQYA 1AOXA 1V3UA 3GGSA 3F5MA 4LJYA 1XU9A 1ZK0A 3HI6A 1FTWA 1IAVA 4KXNA 3ZD7A 2WWXA 3X3HA 2D3WA 4P98A 5HA5A 2FPRA 5EINA 3G8CA 3WBFA 5A9TA 1OFHA 2ZU0C 4BOYA 4CCSA 3K15A 4PYRA 4S1NA 3M3DA 1Z39A 2NO7A 2Y66A 1OV6A 4HVLA 2RH9B 2PMCA 2HNBA 1GCOA 1GT6A 4R8KA 4CEHA 3FNFA 1UBSB 2P4QA 3HNOA 1G63A 1GQRA 3PF8A 1W2WB 2ZYAA 4RLQA 3IAAA 1A88A 3EE6A 3BUSA 1NMXA 2LDXA 4WADA 3R9WA 1DXOA 2AUMA 2FR1A 1JSRA 2QIPA 1NLYA 2WSBA 1MVOA 3CINA 3IAHA 4Q01A 1Z4QA 4KIUA 5C8ZA 3QY9A 3P8ZA 3WOVA 1P2DA 1T1JA 2QZ9A 2WWTA 5IUNC 4KGZA 2HWXA 5G02A 2IV2X 1V16B 2R84A 1D2HA 1TM5E 4IIJF 4ME6A 2C4KA 1E89A 2JH8A 4PZ0A 4X1OA 4GX2A 4RM3A 1OV4A 4N3CA 2I6FA 3C1AA 1JBEA 1L7EA 4D57A 3NTUA 4ETIA 4XTRA 3ILHA 2ZZMA 3VQTA 5HHTA 3JARB 1TVMA 1E94E 5H16A 3S70A 3VAZA 3HACA 3HMKA 3RTAA 3UKOA 4DCJA 4PC2A 1LRKA 2DKOA 2FCRA 4K0RA 5IJ0B 3E27A 4X60A 4DBLE 2B99A 1PD1A 3LFTA 4XLLA 1QK5A 4ZPXA 4DG8A 4DDUA 5K4GA 1U31A 3O8BA 5BW8A 4X1KB 3DHYA 4MI3A 4DLLA 5KNCD 4XKJA 3S99A 5FPHA 2AVNA 1AQ6A 2HH9A 3WOHA 4ZI7F 1R6AA 1RWNA 1E18A 3ZQ6A 3F67A 4Y1RA 3ZDBA 2C8VA 2IWRA 3ZV7A 1NBWB 1R6VA 1WKBA 1T8SA 2CDAA 1VXRA 3IUPA 5F1KA 1E2KA 1TPYA 2P69A 1G8SA 3FBTA 3HCEA 4J0KA 4OHVA 5CB4A 5MN4A 2G4VA 1ISRA 1B42A 1U0NA 4LY3A 4TT3D 3MF4A 3ELBA 1CZKA 1UDXA 2BHLA 2M1ZA 3LUJA 5I4CA 2JLWA 1ADBA 3HLKA 4K28A 5K2MA 4N0PA 3VR5A 5DTIA 5K0JA 3BULA 1FSPA 1JPVA 2M6KA 3W1EA 4ZQFA 2CDBA 4B34A 1YK0A 1Z2DA 2MTBA 4R6WA 1RPJA 3A4IA 5ICSA 2PKQO 3THWA 1RZRD 4UE3S 2ZWAA 4LGMA 3STHA 4KO1S 2HU7A 2HU8A 4IZHA 1TM4E 3BL8A 1ECGA 1PFQA 1FDUA 3IQGX 1AK2A 1MTOA 2NTNA 4GR5A 5AW8A 4NCKA 5LD2C 2Q5CA 3MYRA 2PK3A 2J7PA 3KRTA 1KXJA 4YP0A 3VDXA 2VHUA 5E7JA 4BO7A 1A8SA 2GVNA 2I6QA 2ZUWA 3HJFA 4JGBA 5JRZA 1I4OA 4QHTA 4EO9A 1QOQB 3P9PA 1T10A 2WE8A 3SKYA 3REQA 4MUFA 1P2FA 3BMNA 3NVMB 3O8OB 4G4SP 1G8HA 5BNFA 1KKMA 1CSEE 4JLMA 3WB2A 3JWEA 4II3A 1OBVA 3DE5X 3PFWO 5GGYA 2XDWA 2IPXA 3CH5A 4DL9A 3W7BA 1YCDA 2CJFA 3LQRA 2J87A 2JS7A 3CJTA 3S40A 4M0EA 4COOA 1LRJA 1U0GA 2B8TA 2QTBA 3ASVA 4N03A 3EVZA 2WJJA 3SS7X 4AZ3A 3WGKA 1SHZA 2ZRNA 3T4EA 4BV8A 1NGSA 5H3LA 1SBNE 1V43A 3DEJA 2FN4A 3EXFA 1VBKA 5L3SA 3ZU5A 4BB6A 1Z63A 3R7WA 1KGSA 2Q4OA 3VBEA 4RF5A 2JATA 1TRHA 3IBSA 4WMLA 3WI7A 4Z7JA 1IHXA 3CEMA 1M2JA 4L4XA 2AF4C 1OFIA 4G26A 5TEVA 1LLFA 3R24A 1J22A 3PJDA 3HK2A 4N0DA 2B34A 1BEUB 4XJSA 3NATA 5EJFA 2W71A 5ITWA 2IQ5A 1F0KA 5F2KA 4AURA 3OTOB 4WLNA 4YGXB 3MGAA 2FRDC 4R7ZA 5A62A 1L5HA 3UPDA 2LW7A 5FBRB 3WGUA 4Z0PA 5T4FA 5ALMA 2ZATA 4YJGA 5TEWA 1SXGA 3AGPA 4URUR 2B6HA 3AVVA 1R0WA 1R15A 2PX4A 2ZYSA 3AM3A 3MVEA 5FV4A 2VWGA 1Y6RA 1VJCA 4BFSA 1CXZA 2IXFA 4XDHA 1DIBA 1JDVA 1KO5A 3EWIA 3DMNA 1H3EA 1I33A 2J6HA 4FUQA 2LCFA 4OFWA 1JDSA 2ZDHA 3M5DA 2ZXUA 3BJRA 1ECFA 4IFEA 1UIMA 3RO7A 4DS3A 1QDUA 2ONYA 1B00A 3D5QA 4A4DA 5BQFA 3HHPA 4M1MA 1DJMA 2Q45A 4G63A 5KQGA 4F3CA 1U9IC 4Q3LA 3HBNA 1S3GA 1NMEA 1BX1A 1XTQA 5LD2B 3UTCA 2ORVA 2OMEA 3T5PA 1PGPA 5JRJA 2L42A 1KH3A 1S02A 1DMRA 3PUVA 4Z1MA 1I3CA 2OC9A 3RVSA 4F8EA 1WZNA 1KVQA 3SEZA 3L04A 3ZGLA 2Q3MA 1GZ6A 2WMOB 1C7RA 3FNGA 1SWWA 3G2IA 4YP6A 3WNBA 4GKKB 3QPUA 4D3FA 3N8HA 3DLBA 1UPXA 3WLKX 1M3SA 2Y68A 4RH1A 1VBMA 3F6YA 4NOMA 5FEUA 1DWPA 1WXQA 1Z6AA 2YIVX 3Q88A 4O2RA 1GDTA 3SSAA 5B53A 5K0TA 1FDOA 1PK9A 1JYFA 3Q15C 4BFYA 3P2IA 1NQUA 5C5EA 5JE8A 2VHYA 2PGDA 1DEAA 1UT8A 2C96A 5HKKD 5LKRA 2G4CA 2F67A 2BLLA 1NRWA 3RI3A 1NSYA 3M4JA 3WADA 5J5AA 1VB3A 3UV3A 1CP3A 5A71A 2WSSD 3AWIA 2VZ0A 4ONEA 4YB8A 1KK3A 1RCFA 1XXLA 2QU8A 5EJ9A 2P9FA 1YU6A 3B78A 3BDAA 1RRFA 1UP6A 4HQFA 1QGED 4K8RB 4RGVA 4XJVA 1XE3A 4HSEA 1D4FA 2Z1DA 5ELXA 2E5WA 1AGNA 4NTZA 4TL9A 5ALJA 3MWDA 1ZM3A 4KTVE 4BFZA 3IAM6 1K6MA 1KIAA 4HZGA 4AXBA 4EUFA 2Q6IA 3LOUA 1EM6A 1H2HA 1ZOIA 2H4WA 3ETCA 3P0HA 4OBEA 5MGNA 1BJTA 1RP1A 3RRZA 2O23A 3VKUA 5FULA 5AW2A 4KWCA 2OV6A 1SUFA 4KKXB 1V95A 3BGVA 1XYYA 2W2MA 1TECE 1UK8A 2ZUCA 4M9XA 3ZWDA 4DA0A 4JOSA 1NW7A 2G06A 3GLFE 2B8JA 4D43A 1E5DA 1NFQA 2I6GA 4WECA 1RWXA 2NW6A 2V4UA 2XOKA 3UXHA 3CNOA 3HY3A 2JBHA 1M2WA 2E4ZA 3L3BA 1JVSA 3UH0A 3W04A 4AX8A 4KWHA 4EJSA 4S1TA 2ZPTX 5KTSA 1SCJA 2W2OA 4G5YA 4YR9A 3L46A 4RA6B 3D7RA 2PBZA 3EBOA 3PIDA 2I99A 3RFTA 1UM8A 1AZWA 5LVAA 2NADA 1XJQA 1G7RA 1AO3A 4ABYA 4IXNA 3RS9A 4AUMA 4P0PB 3IDZA 5I7OA 3BIFA 1YFJA 1WMFA 1RJGA 1OGIA 1NBAA 2X1LA 3KXPA 3QFCA 1WZ2A 4KOEC 1XG5A 4Q9DA 4OFXA 2BM9A 3E8SA 4URWR 3ZCSA 1EP9A 2W4MA 3BXXA 5CLFA 8ATCA 5E1BA 1IY8A 1R0RE 3D8RA 4GPAA 3T95A 2OTCA 4POAA 3VX4A 1PJ3A 2GS9A 2GRAA 4J29A 5LQDA 5KYWB 1PBNA 1XO1A 3K5IA 1EVEA 1JLSA 1OBFO 4IIEA 1NLZA 4Q5IA 4UU1A 5D5PA 1FOEB 3UFBA 2MSLA 4J9UE 2PL3A 2HPVA 1Z6TA 2WD9A 2XMZA 4MWTA 1RE1A 4EB8A 4I8DA 2MCFA 3KETA 4Q66C 2WKPA 4JHXA 2J3IA 1OQAA 2ZS8A 2X2OA 4LHEA 5B1DA 2MT9A 4YRSA 5DGCA 3EUFA 3ZLJA 1Z0IA 5ISMA 3H97A 5JS1A 4U7HA 5DO9A 4HQ0A 1ZD9A 1RRGA 4GH5A 1JMKC 2QMUA 2PA3A 2TMDA 2NO0A 3HSKA 1KIMA 2XITA 2E3JA 1BZYA 1KVRA 1RLOA 3QEJA 5KTOA 5FV7A 221PA 2W6MA 3BILA 1LLCA 3NBZC 2JI9A 4RPGA 3LU1A 2J3EA 5EMLA 2QVGA 5K2OA 1VPWA 3ZWCA 1Y82A 2QMQA 5ESXA 2WTEA 3DD5A 4D9EA 3DDZX 5E4FA 1H2AS 1H4TA 1OLSA 4HX5A 2NU7A 4RKFA 2CVHA 4TWIA 1I30A 3MFQA 3BGWA 3GA0A 4MYHA 1J9ZA 1BXZA 2RCNA 3JQFA 2DHQA 1USIA 5ESRA 5KYGA 1PG5A 1UJBA 1V8OA 1VC2A 2G88A 2F90A 5B1IA 2NU8B 1R8JA 3ANXA 1YS7A 2WIDA 3Q7RA 4OHWA 3FYDA 4I9GA 4IJWA 3V7NA 4DV0B 2GJ8A 1IONA 2QX7A 2HHAA 3AERA 4L7QA 3HLYA 4OH7A 5K3SA 4CIWA 5H83A 2AL7A 5DGHA 4ML3A 3KSUA 4MQUA 1IEVA 1YULA 2H65A 4OF4A 3RJTA 3SHOA 2VK8A 4BJ6A 3DMDA 3ZHVA 1SG9A 1YHZA 3BYZA 1SUWA 1UQRA 4MA0A 5ECYA 2X9LA 1YI0A 4RJLA 1S5PA 1XD2B 3PJEA 3RREA 3ZY5A 4R5MA 1ZUHA 3JZIA 1GGKA 3I9KA 3BJZA 2YWFA 1EE9A 4DAEA 2G5PA 2NIPA 4O02B 5CEJA 4B9AA 2OFXA 1M6NA 1QK4A 2E6UX 1ZMXA 1RQGA 1M2OB 6ADHA 5JNSA 1Z5GA 2I4MA 4AJJA 4DV1B 4MMYB 2J85A 3ROEA 4IILA 4LVOA 3UJNA 2EKQA 4B6PA 3PDWA 4PAWA 3OEYA 4MYSA 1KOFA 1VKOA 4PYKA 1JJAA 3HCFA 1UWLA 2GK3A 2IZ0A 3DE7X 3N75A 4OUDA 5SZJA 1AZTA 5DHAA 3KHSA 4X1YB 1EBBA 1NOKA 3BRSA 1NR1A 3CEAA 3O9ZA 2QRLA 2XDAA 4J1TA 1O6FA 1E3TA 4GZLA 5DZSA 4LEIA 1TTQB 4JT9A 3SF8A 1U0OC 4GF5A 1WQ1R 4DLSA 1KFEB 3JS5A 1U5BB 3WYDA 3EFBA 1U2ZA 5CFZA 4HDNA 4Z7QB 3AILA 1V0JA 4PZYA 4TMWA 2ZJ3A 3LUBA 3W6OA 2OBMA 1ZNXA 3QOYA 3DHEA 4F4FA 1VPDA 1ZRMA 3EMVA 3PXAA 1ZD8A 2VXYA 2FPXA 4L8WB 4A03A 3B3AA 4F45A 1QGOA 3GRKA 2VCYA 3OCWA 1H05A 5A4KA 5LOVB 1O0BA 1Z4KA 5T67A 3BK1A 5DI3B 4BMCA 4C0XA 4ZOQI 3GFOA 4OAOA 2HDHA 1U0SY 4OU5A 3Q85A 3PPYA 3QOWA 5D7BA 4C3OB 5IT0A 2CT8A 2C92A 2Z30A 3GT0A 3QPAA 3L01A 4MUNA 5C4IA 4M37A 5CM8B 3TBHA 4CIVA 1NVEA 2CFRA 4FT2A 3THYA 1L6RA 2C2YA 3KHUA 4ZVVA 2P2YA 3IVGA 5BRJA 3C3BA 1ARZA 4BEWA 2O2EA 2WWGA 4FFWA 1N2SA 2M6SA 4P6VF 3GJRA 4QC2A 3T99A 3JAKB 4WBNA 1RAGA 1RYYA 1U7XA 2WG0A 4GRIA 1UZNA 3EC2A 2O8FA 3PC3A 6REQB 3DDNA 1JKXA 1A9ZA 3A2LA 3GUYA 4DA6A 1M2HA 3QM1A 2Q4DA 5JSQA 5KO2A 2HGSA 4HCJA 3OLXA 4HXEB 2VP0A 3NXKA 3DFKA 3EDMA 4TS9A 3FJYA 1YBFA 3LF1A 4O8ZA 4V0RA 3L0DA 3FHTA 3COWA 1FX1A 2WMYA 3EISA 1N2EA 3PQ4A 2XZOA 2TRSB 5J58A 4RV5A 2F8TA 4KFTA 1GRQA 2ALJA 1DPGA 3ZV6A 1XZLA 2NQ8A 3HXTA 4HZIA 2BKUA 5DNYB 1FSZA 1FS5A 5K99A 2Q5LA 3RRNA 1NLMA 3MWEB 4JMLA 4CL8A 4ZKEA 1FVOA 2AF3C 3FTPA 2OAGA 4B6SA 1CWUA 3KUKA 3LBNA 4R69A 3TEFA 4UTPA 3RAFC 2CHVA 3CB2A 3RV4A 1LC3A 2ECOA 1JDNA 3GU3A 4GRDA 4WKCA 1D6NA 1BDBA 1XZDA 2O4CA 3LDGA 4F2PA 2EX4A 2VHWA 4NDAA 5BT9A 2N1MA 3AZQA 4L8FA 4F86A 1VA5A 1IHOA 3KDSE 3WLSA 4H18A 4BNYA 5C8YB 4TXLA 1YZ3A 3JW8A 2BAGA 4LOJA 4LYGA 4M4SA 2ZVDA 4N4AA 1KZ9A 5KPJA 1W1UA 3FB1A 5DV9A 1CK4A 5AVOA 1YRHA 5AESA 2GLTA 3C6YA 4Y2SA 4N6OA 3S44A 1X1TA 4FPXA 4G41A 5TT1A 1BJRE 1GTG1 1A98A 1SXIA 3QPBA 2MR5A 3CLHA 3BXHA 2CXQA 3OICA 2ZYHA 5A3SA 2WTUA 2O8CA 2EP8A 2P2CA 2H5EA 5ILOA 4BZXA 1F8GA 4R2WA 5JU6A 4C6TA 3CIOA 3UJ8A 3MUOA 4YCJA 1N4AA 5DNAA 4IQGA 4ZC8A 4K6GA 4ZTBA 1ZEMA 4L9SA 1B14A 1QV7A 1ZUWA 1XA4A 3B3QA 4CR6A 4M46A 4ERNA 5F5LA 2OG2A 2QTRA 4GMDA 4DGQA 1SCNE 4EGSA 3NU1A 1X42A 5AKLA 2H52A 4NATA 1WMEA 1USKA 5EJ4A 1OH5A 1YVUA 3JQPA 4EYQA 3W5SA 4MDFA 1LGYA 2IE0A 2P4EA 4JU9A 4ALIA 1P62B 1W49A 4MKXA 1L7MA 4MW2A 4ERXA 5A0VA 3Q0EA 4ZYTA 4M0PA 3RF7A 5CYPA 1QRUA 1J0DA 2AOTB 4G0MA 3P2MA 2ASEA 4IG9A 2J3JA 4ZEMA 4DT1B 4PN3A 5CXQA 2BRUC 1BHO1 2QRVA 3JCZA 3THSA 1YE8A 3LS2A 2QD4A 3LVFO 1EDBA 2GCNA 3DV0B 1DC4A 3BB4A 3QFTA 4OMUA 3W1VA 2QL5A 5AOBA 5BV8A 4BHTA 4TMZA 1U9YA 3DUFB 3IMKA 4CG3A 1OR8A 1UP4A 4R54A 1E59A 4KB5A 4NMHA 5ER6A 3T3MB 2IUTA 5EG5A 2X2EA 2IXTA 5E3JA 3MCZA 3VPFA 1JU4A 4E33A 4RGBA 1FRQA 2IODA 4NOJA 4PCAA 1TVEA 2ZYWX 5G1NA 5FQNA 4DQUA 1AC5A 2Z8YM 3NOXA 3HDQA 2CXOA 2YWDA 2B7LA 5ED0A 1K7YA 5EXPA 1TK3A 1RWBA 1ZS9A 3RUEA 3AF1A 3ZHZA 1QH9A 5ITVA 3MXOA 1DBRA 3HDTA 1LQTA 3HUUA 1T8TA 2NVUA 4BP9A 5AW9A 1Y0BA 3VNBA 5EC8A 5BW4A 3NEAA 4HUQB 1AMNA 4DR2B 3E7DA 3B12A 1RYDA 5DI9A 1B0AA 2BSQA 1Z0AA 1Z13A 4OB8A 1WF6A 2OOKA 5BVHA 3PEWA 1Y8QA 2JVKA 3AHCA 1L4FA 1ZJ6A 2OV2A 3H6KA 4P93A 4TXNA 5K0GA 1DAIA 1V6CA 3ITEA 3LY5A 4QUHA 1JEYB 1YE3A 3PTAA 2A30A 2FUEA 1P44A 2NTVA 3DZDA 3PUXA 2RHLA 5G3YA 2VAPA 3EQ6A 1W8DA 1P5RA 1FDRA 2GHRA 3F5DA 2Z5VA 4OSPA 4HNUA 5KYUA 4B4VA 4QJ4A 2DY1A 3LUDA 4W9RA 4XQGA 1OXXK 3GRVA 2WK1A 4D9JA 4RK6A 2P9QA 1GPJA 3GGPA 5CB0A 2GRUA 3T0FA 2A0XA 2PVPA 1MV8A 5KKCA 1BA3A 2OHJA 3MRXA 3ZU6A 1FP7A 3LCVB 4DIFA 2WUWE 2QX6A 3QXJA 3ZLVA 2X3YA 5I5GA 2WEKA 1AKNA 4XGRA 5BWBA 4KQCA 5JI2E 3I37X 4CTKA 2RDMA 1XZBA 4BQFA 2X4GA 1BS1A 3OM0A 1XCOA 2Z4SA 3WYBA 2FN3A 3E03A 1NHGA 3CQ9A 4GKBA 3PX2A 1KMHB 1Q0UA 4OQYA 4DUZB 3OE5A 4NBVA 5KX5B 3DNMA 3NTLA 3I73A 2O06A 1G7SA 1YIDA 2ZSHA 3V97A 3HCOA 1JS1X 2OGZA 2TMGA 4JSYA 1E3DA 4GSKA 2C54A 4B7UA 2ZYTX 2E4WA 3UWKA 1BFDA 1PT6A 3QU5A 2FFAA 5F33A 4UVDA 1WUYA 3L6OO 4U2KA 4PTLA 1Y89A 4G5RA 4QU5A 3EC7A 3RM3A 5EIWA 4X65B 4JQSA 3EIHA 4GZMA 5AKZA 4QYIB 3TNYA 4N82A 5JTUA 5I8ZA 3MWFA 1C9YA 3PDUA 2O3UA 4GEKA 4HVTA 2VO1A 2Y9MB 1LBSA 1F9EA 4C06A 4OIMA 1UFOA 3QKWA 3BWEA 1GAEO 4HDRA 1W1IA 1LZKA 4PCVA 2M9MA 2R65A 2Q6LA 4WESB 4AYTA 3QXXA 1HSZA 1N7IA 1VFPA 3KVRA 3L0OA 3T5TA 4FSDA 5HBRA 2J5RA 3HWWA 1AS2A 1CJVC 4KG7A 5AVSA 3DWIA 3KYCA 3K35A 4CLDA 5KPDA 5B4VA 3M4YA 5KVAA 1XTUA 2IXEA 2VNJA 3AVOA 3ORHA 4CCYA 2QENA 3C5CA 1IY9A 4Y2QA 1RJFA 1Y7LA 3D0RA 4RY8A 1JV2B 4O5AA 4WLUA 5FLXA 4CM7A 4YHBA 2QUBA 3AV0B 3D3WA 1KO7A 4RHYA 4JCOA 3GYGA 4BYGA 4QJIA 2C9YA 2GERA 4QULA 3WMFA 3O7MA 3CE6A 3DOOA 4M7RA 3IEVA 2EWMA 2C5SA 4QU0A 1KNXA 1DLJA 4DYVA 1P77A 1NBMA 4ZVSA 4F71A 1P81A 1CY8A 1HE1C 4IMRA 4ICIA 4KMOA 4RVCA 2QTCA 1RI3A 4D9IA 4YALA 3FPEA 3QMMA 3J81k 4G9BA 2VPZA 4X00A 3MOGA 1YZKA 4K9QA 1AUXA 3I9MA 3HADA 2PYDA 1WAMA 1GGNA 4HGNA 2WU1A 1YFZA 2F1RA 1CEXA 2IY9A 3A1SA 1Z6YA 2IIPA 2OHVA 1GLNA 3AKZA 1CZOA 1PT5A 3LDAA 3N9IA 4M3NA 4WDQA 1YZLA 3CB4A 3H1PA 3TIFA 3VZPA 2FW1A 1X86B 3HCCA 3AJAA 2HRDA 1Q7BA 1SUSA 5B3JA 1MW9X 5TGDA 3NTQA 3WNDA 3AL0C 8ADHA 3DE6X 2BJWA 3IO3A 4LWZA 3MTEA 5CDHA 1KEZA 2R751 4ZVOA 1HMPA 1I80A 1JDUA 2CMDA 3I39X 4IO0A 1EK0A 2Z3VA 4BO5A 3B3FA 2ZXEA 5JJ5A 1COWA 4AT1A 4CEHB 1HZZC 2OKGA 1NXWA 1WPXA 3CS3A 3DOIA 2IDJA 3R6WA 4Z4IA 5G0UA 3TE6A 1JALA 5AW7A 3OEED 3OM9A 2W48A 1HXHA 3GQBA 5KYXB 5A06A 1Q6ZA 2FP3A 1FQWA 1NXQA 4RK1A 4EI2A 3AB8A 1KTVA 2VZ9A 5TX7A 2P3LA 1CUYA 5A5EA 1EGMB 2AUNA 2FLVA 3MB8A 4BLTA 1YI1A 3A10A 3U4GA 4C4ZA 5AHXA 1XI2A 1MCZA 1XXHB 1Z2EA 3D3JA 4HDSA 1R8YA 2WIAA 3IRVA 3AYZB 3LKZA 4RMNA 4Y18A 3H5IA 3JWJA 4I1VA 3MRTA 4D9KA 4AMVA 4HUTA 2VHQA 3PHIA 1QC5A 4BLSA 1ZIXA 4B85A 5FL7A 2PWBA 1JQLB 3O4FA 4FCTA 1S8NA 2HV8A 1G7TA 1N5LA 4B3TB 4A82A 2OA0A 1WVIA 3BHMA 4LJRA 4Z9FA 4F0JA 3JQRA 5IU6A 4NZOA 3TSYA 2RE8A 4MAFA 4JH0A 3IAFA 5TIIA 2Z0MA 5F23A 2HR1A 2ZAOA 4DMMA 4MV4A 1MC4A 2PGLA 4EECA 5IC4A 2ADOA 3GZJA 5HX7A 3ESZA 1I1QB 1R12A 4Y1RB 3EZYA 1ISFA 2I71A 4IJMA 4L76A 3H8JA 4QRIA 1NF3A 4MIEA 5F3DA 3UUFA 5EIEA 2IDZA 4B4KA 5CB4B 1OBHA 2CD9A 3DWEX 3QKIA 5M5BA 4CF3A 3CX3A 2ZI5A 4N0EA 3ET4A 2HO5A 4MW6A 4EGQA 1FTGA 3A1UA 5EHXA 3TZKA 2ZB7A 2ZRLA 2QMOA 4C21A 5C1PA 3RIHA 2HA4A 3G6WA 1KVSA 1HE3A 4Y6SA 3ANNA 1OIXA 1LV7A 1BN6A 4Q1FA 4RFLA 1QRRA 1X3SA 2PZKA 2XWPA 1Q7RA 1KI6A 2WD7A 4WZBB 3K2BA 4QARA 3THWB 1G2PA 2N42A 4N8DA 4CKXA 2P6UA 4QFMA 3PRKE 1E6CA 2CN1A 2D54A 2P79A 4GX0A 1S2IA 3K9CA 5EJGA 5D5HA 4EHIA 1XDDA 3P0RA 4LHZA 3SYMA 5IAOA 2AMFA 2G9QA 4AP6A 1SVOA 4MIOA 1AQNA 2VJMB 4ZQBA 5C2JB 5CNIA 1PFUA 1Z18A 2YWEA 3GD7A 4GO1A 3FOAA 4TV9A 4IQ4A 3DVRX 2CFIA 4P83A 1NE7A 1A9PA 4P34A 4NFSA 4TMXA 3REQB 3ZE7A 4C7KA 4RTPA 1IPHA 5AM3A 1PYOA 1UBGA 1XD9A 1T6BY 3F97A 4RSRA 3H7IA 4J3FA 5EJEA 1Q84A 1UKAA 2IOFA 2QAGC 5IM4F 5D51S 4OXXA 4YT8A 2ZSIA 4NH0A 4ZT6A 1QAOA 2P9YA 1GADO 4F2HA 4CDRA 2VXBA 8MHTA 1NF8A 4GMXA 3TKLA 1L6IA 4UEKA 2PX6A 3EHDA 1T6ZA 1MH1A 2IF0A 2R5WA 4UQOA 1P4JA 3FCYA 4KQXA 3EXFB 5L3SB 1AUOA 4G5QA 5IJ9A 5DNDA 4RH3A 4FWIB 1EFCA 2ACVA 3TBFA 1C14A 2RG7A 1R5BA 3DKVA 2R1VA 4OJNA 5TR9A 3BC1A 3ZHUA 4D4GA 3T3NA 3HDYA 1FX0A 3HKEA 3M5PA 4CLXA 4LF8B 4BE7B 1G6HA 2ET6A 1CNEA 3T7IA 4CMEA 1JG6A 3EG5A 4LE1A 2YQZA 3QFFA 4QD3A 1PCXA 2FFJA 2XLCA 4LZLA 4EGAA 4EL0A 1JJVA 4TVKA 1ULAA 3ED5A 3RS4A 1OTXA 2RHBA 3L7JA 2JAQA 1ACJA 1L7XA 1BG6A 1MXFA 2A67A 2CLEB 4H2DA 3P4UA 4N12A 3A26A 3DL7A 1GUDA 2I1QA 2JAHA 4L78A 2HKIA 3ETHA 5LZ7A 3OZDA 4AB1A 1K0FA 4OXNA 5AJWA 4CKBA 4L2IA 5JS7A 3KKKA 5KCZA 2HQ1A 2QTFA 1C3OB 5GQSA 1PF7E 4JVNA 2R00C 4DA4A 1U7PA 3IT0A 2QN1A 1Z6XA 3OF3A 5EP4A 2OBNA 3V8VA 3WK8A 4GKJB 4EJ2A 2CLMB 4TL7A 4HFRA 2Q8QA 3E9RA 1I9GA 3A3OA 1IN1A 5DHQA 2ERCA 4UM5A 4K3VA 3DTVD 3MILA 3CRW1 3V3KA 1H93A 3PQFA 2VTBA 1BFKA 3C39A 2RGWA 1LX6A 2R48A 1AF4A 1ISPA 2J3LA 1F51E 1GKYA 1MJNA 2CLKB 5LBUA 4KRFA 3PXEA 2VI5A 3S2IA 1DWOA 4H7JA 2Q1YA 2VWQA 3QVWA 4OLHA 1BTOA 4R1NA 3G0IA 3OJXA 2PS1A 3BVPA 2AC4A 2FN7A 4C4SA 5E6UA 4C7XA 2NO1A 4D7AA 1E4VA 1N36B 3ZD8A 3L1IA 3QE3A 3UT5B 2Q7DA 1O95C 1B3RA 3M2PA 4YPVA 3WJ2A 5MDHA 3UW1A 1OHHD 4MJ3A 4P9NA 5GONB 3TW0A 4HT3B 1DBWA 4OL9A 3K1JA 5BQXA 3G2HA 3E1SA 3O4JA 4FWBA 8AT1A 3OQ6A 3FWKA 3TLMA 3ZI7A 1UMCA 2QAGB 3W8EA 5BNTA 5C7OO 3GPIA 4WN9B 1VRVA 5BYKA 1H0HA 2C1EA 4M8KA 1SZDA 4R8MA 5AKIA 3NP9A 5DLPA 2BTQB 2G6TA 3DP9A 4MCAA 5G0WA 3EVEA 2QQ5A 1J06A 1C0PA 4BNDA 5I8WA 4U7DA 3IDQA 2FI1A 4DJTA 3N6RA 1TJYA 4MH0R 2PL1A 4D2IA 3DONA 3ZJ4A 4CFZA 2I7DA 1WUHS 5A7GA 1M10A 1KKUA 2G1UA 3OOYA 4LSGA 4OOFA 4WFQA 1XD8A 2C3YA 5CD9A 4MX8A 4ZP1A 1ZH4A 2VUTA 5FA5A 3L7OA 3IVCA 1SVSA 2CLDX 2QTTA 3QKTA 1JWLA 3AIKA 1I14A 1IZ0A 3CBGA 4JVOA 1LBQA 5B37A 1EIWA 5CTJA 2WABA 2J9XB 4PQGA 3ICEA 2VHVA 3UO8B 3HP4A 3R20A 4JA2A 3U7IA 3VH3A 4B3IA 4FHZA 4H17A 4HWKA 1JG2A 1U90A 2H59A 3I9OA 1W29A 3PT5A 4KJXA 5FPTA 4EI9A 5HWSA 1M6YA 3MIZA 1X1DA 1ZQ9A 3C8UA 2DHRA 3RSGA 4XVCA 4EG8A 3KTDA 1CY6A 1HYBA 1QDEA 2QM7A 5D01A 3PUIA 3PUHA 3BHJA 1I6WA 1HLDA 2BFNA 3KOMA 3C7KA 2QVCA 2HY7A 3KXDA 1FJXA 1FQOA 2ZJ5A 3DZIA 3PEEA 3P0JA 1JDZA 2XMPA 1P5ZB 3QVMA 2R3SA 5FCDA 3I45A 1W44A 5KWEA 3ZQJA 2I6TA 4KQMA 2FK8A 4F8YA 2VAWA 2V7QD 4KW7A 4PIVA 3THOA 3DMYA 1MQAA 5DYNA 2W2LA 2D4AA 2V1XA 3VKHA 4EF6A 5LU8A 3QHQA 5B3LA 2QUHA 4C07A 1KMIY 1UDWA 1UK6A 3KOUA 3W5VA 1JR3E 4J43A 3CHYA 5ALGA 1TGVA 1KAOA 2P9BA 2VRBA 4PGMA 1GIAA 3RKSA 4CT4B 4ZZ0A 5JBQA 1RLTA 4KE9A 1II9A 5I7VA 5L3QA 5EXSA 4HMOA 2QX8A 2RHTA 3R8FA 1JLLA 4EB6A 1WMSA 1PU2A 1ODKA 1SOAA 3EXAA 1NFFA 2IBTA 4QUJA 2QK4A 3RAEC 4ER5A 5F78A 1F14A 2REOA 3PHLA 2OHHA 4W1RA 1EJ6A 4QDXA 3ED1A 3KV1A 3IPAA 4LRUA 3ZY2A 2FEAA 1DU4A 3P5BA 5IF9A 1LW6E 1A96A 5FPKA 1F2UA 4YMUA 2ZYIA 3BBPA 4KLZA 1F6WA 1L7RA 3HBFA 3I8XA 1B2LA 4EZEA 2J1LA 1BAPA 4XYMA 4MS1B 4IDEA 2G36A 4OYHA 2VHXA 4BFCA 2VF4X 2ZR9A 3UW3A 1B74A 1EG7A 1N5OX 2DWOA 3INGA 3WK7A 4RKQA 5HGXA 1DARA 3AUKA 5EVCA 3IEXA 3KL4A 3IERA 4UDNA 1RS0A 1XZFA 1U2TA 3A31A 1JJBA 3O4HA 5CVJA 4DJ5X 1C3VA 2FPKA 3NYWA 1RADA 3GEMA 2FZWA 1OWNA 2Q3DA 2YVLA 2ZSEA 3HY6A 1NKSA 4K88A 4M83A 3RVPA 4KXWA 1OLSB 5IJAA 3HR8A 1A71A 3T3OA 2EW2A 2HMYB 1NSFA 2QLBA 3HVUA 3F6CA 4KMSA 1JSZA 3A11A 4ZAXA 1SD5A 3HB1A 4ZC1A 3FJOA 1JWBB 1SUCA 3Q3JB 1BDMA 3NEJA 4CTNA 2ZUFA 4L51A 1O96B 3ND9A 2WQ6A 1M7GA 4TSKA 3GFQA 1IIRA 2RGNA 3USCS 2HBRA 5C53B 1M1UA 2H1FA 2P91A 3F6PA 4DR6B 4MWSA 3A4MA 3AERB 4LWQA 1KZ7B 5IEBA 1J21A 4B7XA 5JNLA 1RPZA 1J0CA 2P9ZA 1DQYA 1F12A 4B81A 3OAAA 4P5PA 1TM7E 2OB2A 3DZKA 4TUYF 4LJ4A 3N3BC 4QWWA 4UNQA 1U0TA 3IXLA 3ZJTA 4MQ6A 1FW8A 3NO4A 1UANA 5LFAA 3EG9A 3R3ZA 4EHDA 4Z0TA 2F43A 3H11A 5IJXA 2JBAA 1H2FA 2WFLA 3GMSA 2XXAA 3L02A 4OHBA 1W0CA 1N2JA 1YHNA 4IH1A 4Q9AA 3JRXA 3PD1A 1RM3A 3I9V1 2CLHB 2V0GA 3VO9A 1BVHA 5KI6A 3O6VA 4D9NA 5T3UA 1UAYA 2FHSA 2YBDA 1PJZA 3GPDG 5FOUA 4FFPA 3SLRA 2DFTA 2VNSA 2CHFA 1NHWA 1W76A 3H7AA 3ESRA 3PTZA 2H18A 4H7EA 4MARA 4DZTA 1GNRA 1PRYA 3E22B 3UG6A 1TK2A 2PX5A 1R7RA 2C94A 1MPXA 4YV7A 4OUDB 3P9XA 5LA6B 2ORIA 1W48A 1M33A 2XLBA 4B40A 2DTDA 2AXEA 3OJFA 1SEVA 2CEAA 4FZ5A 3EVGA 4S0ZA 1TDJA 4Y2HA 3E2PA 3GAFA 1PX0A 2J3DA 2WKQA 3OH8A 5TQ2A 4QOFA 1QQAA 3SF8B 1ZNZA 3ZVKA 1PZEA 1PDVA 3U1BA 1G38A 4HC4A 3BTVA 1QNFA 1QOZA 2F3QA 1DRVA 1DVRA 3AHFA 3TYXA 1N7GA 2RJNA 2Q2WA 1TTHA 1T0HB 1ZITA 2WSYB 3KDPA 4WK6A 2C0CA 5C37A 2ZE6A 4RS3A 4C5BA 4IH4A 2VDQB 3SFTA 3TIIA 5EJMA 3OFND 4ZMRA 1QHXA 1S9DA 2KM1A 1OWLA 1PP4A 3M1YA 4LNUA 1TEVA 5IANA 5J2UA 1NW4A 1YB4A 1XVVA 1FYVA 4YRDA 1LJUA 1NRJB 3NGXA 2E2WA 3THYB 4Z53A 2WHPB 1I7NA 2CVFA 1QFYA 3VDMA 1F0NA 3VNAA 3FCOA 1DXQA 2CXTA 2IYEA 4MLPA 4HI0E 4JUDX 1IN6A 2BMAA 4WBNB 1NULA 9MHTA 2BI8A 2I67A 3DZHA 4HYQA 3UK7A 2WFZA 3MBIA 4A0GA 3LZCA 5FTLA 4C04A 3JVEA 5IASA 4B4WA 2VJPA 4XVHA 3C3XA 3NR2A 3QVXA 1MH9A 2PZAA 3NVDA 3VYSB 4B17A 3TIGA 3DQPA 1IN5A 4ZICA 3NETA 5B12A 1HDEA 3W3AH 3PC6A 3EOBI 3SKXA 1GYPA 2YZ2A 1YUMA 4O2BA 4HJXA 3OCCA 3D1LA 2XNDD 1THZA 1G60A 1GG9A 1DMSA 3UMSA 5HIKA 2B8NA 4JLWA 2FXVA 1ORTA 2FW7A 2OEPA 2VFAA 4M53A 3V7FA 1VI5A 2ZI9A 5KTTA 3X2EA 3Q3GE 3HSSA 2BGRA 4IXDA 1AGXA 2P3OA 4HRYA 1VL1A 2ERYA 5DTJA 2PGJA 4BTVA 2Y0BA 1KDRA 1T91A 1VJRA 4K03A 1P4AA 2I1VB 3ZU2A 3D2BA 4RGQA 3D4PA 5F73A 3B85A 3IA7A 4JBWA 4YIKA 5F64A 1W19A 1QPZA 2IS1A 3H1BA 1CNFA 4NYJQ 4WV3A 2HK8A 3RKRA 3N0RA 4QXAA 3P96A 1ECBA 3G02A 3CF2A 3CYFA 4F9TA 4R6XA 4NBSA 1AQIA 3EQ9A 5KS2A 5LOVF 1EFUA 2JJ1A 1C9EA 3GEEA 1PQ4A 2P3SA 3AF2A 1CRZA 1U63A 4FN4A 1R6UA 4RHTA 3VGJA 2W93A 4YXWD 2ZJOA 3JD3A 1OBCA 1UXOA 2FUCA 2YXLA 4INPA 3U4QA 3NBKA 2IU6A 1I4DD 1LQ2A 3NDIA 4YRNA 2O8CB 3DULA 1XQXA 2WUDA 5F52A 1WS6A 2WWFA 4C6TB 1OI7A 3B9RA 3H2KA 1CS4C 3LQKA 4ZVMA 4AG6A 1OB5A 1Y4ZA 3WL4A 3R3HA 1CQWA 3V1YA 2JGRA 4BE4A 5DW3A 1T2UA 1GN8A 3TNLA 1D1SA 3B1VA 3IELA 4MVJA 1UQTA 1M5UA 3M3PA 4JWKA 3H8VA 3I72A 3AR2A 1UXJA 1GFSA 4S1PA 1T2AA 1QTNA 4XQ9A 5KB3A 2PMWB 4LRSB 2ZJ7A 4ZCRA 1C3EA 1QH8A 4PSKA 3T1QA 3OCUA 4RCYA 2PUCA 2WM3A 3R7DA 1FXSA 3AJRA 4R3WA 3BXEA 1CJMA 1WLYA 3GBVA 2QM0A 4H4EA 4RHUA 2OV1A 4MS4A 2VJLA 1JILA 3PDCA 3TLZA 1ZEJA 2B2XA 3K0CC 3VDNB 4ZXFA 2XW6A 1S7CA 5SV2A 3DR3A 4C6HA 3PUZA 3ENNA 1AU9A 3E70C 4OIFA 5H70A 5G41A 4J2OA 4Y9DA 2NXJA 1K6XA 2O7SA 4ZV4A 2A3RA 2EKBA 2Z8XA 3GMTA 1GGEA 4QHYA 1GQSA 3FKJA 4LK2A 4ZJZA 1CQIB 5BSVA 2DEUA 1SHJA 5TQJA 1JB1A 3EXG2 2UYOA 3K5WA 2FKNA 5A0FA 4FM9A 2PZFA 3GXOA 4NRDA 1XYVA 3Q3HA 1HTBA 5KVCA 5AUOB 3KQQA 1DCTA 3ENVA 1NN0A 3W6UA 1R8SA 3OJ0A 4IEIA 5C8YF 5A4DA 2NVUB 1DC5A 1JL3A 1UJNA 1U0HC 1Z8FA 3AHIA 3CLTD 3PDIA 4G8CA 1GKLA 4CL3A 4E2XA 4JVLA 2OOSA 1ZXBA 5H4HA 4PTZA 3PC7A 4DJDC 3HEAA 2DTEA 4L0CA 3LHDA 2G25A 3L40A 2CHEA 1LTQA 1NR5A 1YC2A 1Y8QB 1DAHA 3EJWA 1LNSA 4ZCSA 1CD5A 1JSLA 1RDFA 3PYMA 5REQA 3STYA 3AX6A 3TNJA 4MW7A 3CTMA 5E2AA 3BJIC 4KPEC 2H9AA 3DPUA 1Z2PX 2KI5A 3C5WP 4PO1A 4YXFA 3VC1A 5J4LA 5J1SB 5TGTA 1OH6A 4PAOA 5GV7A 4EG0A 4UBOA 3SLGA 1HL7A 3IQZA 2NZJA 5KNCA 3WQBA 5B4UA 1H2EA 1T8UA 2P9EA 3MJ4A 4NEGA 4NESA 4ZO4A 4C30A 2UU9B 1U28A 2DSNA 2XE4A 2EG5A 1JSCA 4JZYA 1KOLA 1JHAA 2I66A 3RRMA 2J30A 5IYZA 1J33A 3GL9A 1IXKA 1MVLA 3BTUA 2GPJA 3MRSA 1N5DA 1RAFA 3DLCA 5IT4A 4IJVA 5JATA 3ISJA 4NBKA 1PLLA 3FPGA 3FPBA 3PXGA 4A0FA 5P8WA 2CLLB 2EOAA 4TT3A 1NVKA 2AEFA 2O1XA 1H65A 1XDBA 3DSRA 5DVZA 1JH9A 5G2OA 4ZCIA 1CETA 3IE1A 1A3CA 1MKYA 2QOEA 1EZZA 1E3IA 1QHYA 5D7NA 3V2UA 5B3JC 4GPEA 4AAYA 1L7BA 5EIBC 4BPRA 4DV7B 1IB0A 1DC7A 3MT9A 4YUZA 5JUWA 2YJ5A 1D8AA 1N5KA 2UZ3A 3MJRA 3TQFA 3GLIB 1RZRA 3V8PA 3QE2A 5FA6A 5PNTA 3SQMA 1NATA 4DRXB 4WI1A 3W6NA 4WX2B 5DM70 2ZSBA 4TM7A 2I62A 4DSUA 3SHVA 4G8DA 5B1SA 3CLSC 2B5OA 4QGAA 3OTWA 4E0BA 2GCPA 4ECAA 2HMSA 4ZMSA 4TS3A 5JD6A 4JL8A 3EPHA 4JI1B 4KXXA 2HK9A 4H77A 3SDZA 2A57A 2ZBEA 1XRPA 1QO0D 1V35A 4BMPB 1N78A 1WP4A 2QXTA 4UPDA 3VTAA 1FQJA 2FDCA 3E15A 3JVUA 4RIEA 3D8BA 5FQOA 3ACBA 4ND1A 5FNVB 2XVXA 4O63O 5LUBA 3RHSA 3RU7A 3L0PA 3NTXA 3WWEA 1ZNWA 3EFOB 3GRZA 2BGIA 3ECAA 1WBDA 4HDRB 2IYRA 1VZ2A 2A1TR 4ER0A 5FR1A 5FBLB 2WVJA 2B4TO 2H7CA 4U63A 2X0DA 4ADSG 4LQDA 4B6RA 3CNHA 3D3EA 2GUWA 3ZHQA 4NCBA 3A2KA 2XDQA 4FYJA 5E6RA 3S7ZA 1IWBB 1JHQA 1ZYUA 5JPIA 3LK7A 3BCSA 2ZUUA 3PRJA 5DP1A 4P3PA 5IVKA 1EYZA 2HDNB 4UASA 5B2ZA 2QP9X 3QBTA 1VCHA 1NU6A 5E2IA 3NW9A 3A0RB 3B2NA 2JLXA 1ZH0A 3LX5A 3G13A 4CG0A 4F4UA 2DUJA 5JJBA 4NZMA 4ZWNA 2B7CA 3DOEA 3U60B 5HP4A 1P45A 3D3WB 3KB8A 3WHKA 1QZUA 3DBHA 3KQTA 2C00A 4JXKA 1QP4A 2KLBA 4HBZA 3VPGA 2NTJA 1P1JA 4K81B 2ACWA 3ZV5A 4I19A 4KYTA 1EUCA 5H8WA 1AA9A 5HCNA 4O4JF 1PWXA 1JLKA 4GOKA 5T6MA 4GQBA 2OORA 2CBGA 2GNPA 3K2QA 4X85A 1RQ2A 2ZGVA 2DOKA 2G28A 1H9AA 4ZGGA 1C8BA 2WIKA 1YS4A 2AG5A 1SZPA 1NUTA 5CFPA 2QNIA 1FPMA 4G9GA 4RIHA 621PA 2YW2A 5TMDA 5MFZA 1X38A 4XW2A 5HK8A 1G9XA 1P1CA 3IV7A 2JVIA 2IU4A 1P6XA 4DZZA 1QH1B 3DKIA 3NT2A 4HAUA 2O8DA 3PHJA 3N2IA 3E05A 1WM1A 3B1ZA 3DCNA 4UTXA 3KR9A 1K92A 2Q5IA 2W11A 3RSHA 3F4BA 3Q5GA 4BVLA 1PJAA 3B2QA 2WZQA 2FEMA 1KP2A 1VE1A 2PX2A 2EZ4A 3FGPA 1KDTA 2IWHA 1MJHA 1E6EA 2V7PA 3A7DA 1WJGA 3ZI0A 1KAQA 3AU9A 2XCLA 3WFZA 1CUFA 2XE7A 2XF2A 4QKQA 2VDVE 7REQA 3GQBB 4WY8A 4Q3KA 4XUCA 5CHYA 4AKHA 1P3DA 2WT9A 3FFXA 3EFEA 3R3VA 4TMVA 4F5WA 4G81A 4JI8B 1HA3A 1CQJB 2V7VA 3BK2A 4W8OA 1BE0A 1WVMA 2QY6A 5EEHA 5ESWA 1UPCA 2CL7X 4G5GA 3WLPA 4RTKA 4H7IA 1R9JA 3RODA 2G09A 2BFEA 5LLSA 4BX2A 4IRMA 2BGUA 3PEYA 4QNRA 3U31A 3UKDA 1CUXA 3W8DA 3CEHA 4F4CA 2OBBA 1QC5B 4ZARA 4BMOB 4DWWA 3G89A 3RYIA 1TJPB 2FQ1A 2NTEA 5BSEA 2BI7A 2FJUA 3LFHA 1GCIA 5H9WA 1VMEA 2LKCA 3FPLA 5IP5A 3HN7A 1UMKA 5HKKA 1HDOA 1OROA 4LKOA 1T5SA 4MEAA 1G0OA 3GP3A 2PL9A 3DL0A 2RHHA 1RIFA 4B3CA 1JI0A 4CMEC 1C9JA 1DWUA 1ZO8A 3R5FA 4N3NA 4AUKA 3OKCA 3N6XA 2WSSA 5IF3A 1Z5PA 4GLJA 5DOZA 3WGJA 2E82A 1RR6A 3I2HA 1DQSA 3CPSA 4KXFB 3B1KA 1QKKA 3K73O 4LY6A 2IKQA 3BMCA 1XELA 4MGIR 4E31A 4HNVA 2NMVA 2HA6A 1FBNA 4KPUB 1DKRA 1VJ5A 3IQIX 4OK3A 4MUJA 3BQ9A 1EFDN 1KZ4A 5HFNA 2IH2A 3O1JC 2WHRA 9GPBA 1O89A 3IV9A 4WEQA 4WSOA 3UMYA 1V8FA 3HFRA 3HJBA 5AP9A 5IKMA 4RMHA 2GF0A 3G0GA 3KQVA 3EWNA 3FUVA 1M34A 4RV9A 4ZODA 3TRHA 1GL9B 1QVVA 3B1YA 1UBJS 4H27A 4C0JA 2A2ZA 2PUDA 3NDBB 1KI6B 4A8TA 1PS8A 2WD7B 1FFAA 2ZJ6A 1P18A 2RHOA 3G8AA 1HLGA 4MV6A 5E6SA 1VFNA 3SNKA 4NVRA 1L4GA 1X2BA 1QKIA 1U7UA 1XMIA 4ROSA 3FKSD 4YFVA 2BKLA 4XR9A 1QE5A 5EZ5A 5K1ZA 1ZFNA 2P7IA 4BVEA 5LJIA 1JF8A 1PIWA 2FPPA 3T7RA 4GMKA 1LC0A 4KXQA 2OZLB 2YY6A 2CDRA 3BXFA 4IMIB 1FU4A 4PLVA 4EEXA 4B4OA 3TOCA 1QIKA 4LYEA 5KSYA 5EY5B 4QXMA 2YHBA 5GY7A 3UJBA 4DKJA 3DOJA 5DM2A 1F60A 1DXYA 5FJIA 2HA2A 3WGQA 2ZOSA 1YASA 4EFLA 3DLPX 4GLLA 2PJUA 1RWMA 2VHJA 4AFNA 4FNGA 1XKXA 3HA3A 3GBSA 4OXRA 3ULKA 1GO2A 1Q91A 2B8EA 4X71A 5KVSA 2A5LA 5BN3A 3OC6A 4LMAA 4RZSA 4AZVA 2ST1A 3SX0A 4C0WA 4LF4B 3RVRA 5T6BA 2E4VA 1JR3D 3BORA 4G09A 3G2MA 5IHXA 2O8EA 1FXWA 2EIHA 1P91A 3IHWA 1M2EA 2QXYA 3PHGA 4PR3A 2GFHA 4FQ8A 3AG5A 2IHKA 4Q7EA 1V1MB 4WERA 4JL5A 4S2EA 1CFZA 1KYWA 2HRBA 3LO5A 1FFYA 1K7SN 2DLNA 2OECA 4E2ZA 3RVBA 4YV0A 5KWJA 1MO3A 1XTSA 3FF4A 3GNTA 4EL5A 5IJ9B 3U09A 1XZJA 4OHCA 3PXBA 2GXAA 3F4KA 4MJXA 4LZPA 3UK0A 4CM4A 4DLWA 2VP5A 4KK3A 4L74A 4WCDA 3ZDAA 5FUQA 1Z83A 4MVJI 4Z9BA 4LI3X 1OT3A 4J1SA 1FX0B 3HKEB 4WLFA 1GWNA 4KGDA 2JB9A 2OT3B 4MGHA 1DCMA 3OZFA 4OGKA 1NJFA 2G9VA 4UVHA 3GK3A 1WG8A 5E0KB 2OFFA 4B48A 5C1DA 4KUHA 5F51A 2ZTSA 3FUUA 1UBKS 1YOVA 3WLEA 1C7FA 1XTJA 1XXHE 3G0OA 2QTWB 2A58A 3H6HA 4YAKA 3NHRA 2XQGA 4HXGA 3F2VA 1ESMA 1SD2A 3MMPA 4IWYA 3G88A 4UBNA 5M7EA 3V1LA 2GMWA 2QG6A 4LMPA 3O82A 1HT0A 3VR0A 4YJ2A 2CC2A 4G5XA 4IF4A 4ITUA 5J2TA 2J8ZA 1G98A 3P4XA 3UMVA 2PRSA 1NM5C 4KNVA 4GR4A 1TB4A 4M6WA 3VSCA 3ZWYA 2VPPA 1RXYA 1UZAA 2EKDA 2WUEA 4EHHA 3TPFA 5HRUA 1EMDA 1HYEA 1RT9A 2IUFA 1YDHA 3LL4A 4U9IS 5DN6D 4XCQA 4KQWA 2JI7A 3TNDA 1TYEB 2C2BA 3UMFA 2H9IA 3WKEA 1VE9A 2YJTD 3KB2A 3P9YA 3HXOA 9ABPA 3WGLA 4X7RA 5D84A 1N8SA 3S1LA 3U61B 4PG5A 2ZANA 1OH8A 4FXPA 4U5QA 5JMOA 5K3OA 2ZG6A 4O33A 3VR4D 3LQ4A 5BR8B 4G0PA 5K0EA 4QSHA 2P9CA 4BCCA 2OAP1 5E8JA 1R0KA 3A3YA 1PS0A 2MHCA 1SHTX 5E6UB 3ZI4A 3V4RA 4M9ZA 3ROPA 4CKWB 1V96A 2UVPA 5L51A 2PZGA 5LUAA 4LXQA 1ZCBA 1TFRA 2RK6A 1CP2A 5C9ZA 2YUIA 1U1GA 1LWOA 2QWXA 3NDJA 1TJ4A 4LRTB 4WZBE 2C2OA 1K68A 4CIXA 1TQ8A 4PLPA 2BBWA 5BQOA 4TV8F 1Q14A 1V3VA 3INRA 4ID3A 4N5MA 5LNK1 2V6JA 2IS6A 5ALRA 3K9LA 3JQ9C 3V00A 4OD0A 3TXXA 1E0KA 3VR6D 1MO6A 4BNDB 3QQPA 5AUNB 1L7QA 3EJ6A 3ZKWB 4KDEA 3MFYA 1ULBA 5LMNB 1Y4UA 4ES6A 1AMUA 2YHUA 1D9XA 5AUPB 2EARA 3MNFA 3NBXX 1RIIA 3TNFA 3TZCA 1PZHA 3L6CA 2EEPA 1EVZA 3CVYA 4DSZA 5J4HA 2QLFA 1ZVJA 2VDKB 1SBQA 2ZR7A 4L4RA 4XQEA 1N1MA 3TVDA 3Q3EA 5F7XA 4W9NC 3EEOA 4DV4B 2IYXA 2EJBA 5HMMA 2IV7A 4LQCA 5E9AA 2QEQA 3BA1A 2C58A 2GDJA 3R1IA 1CUIA 2DM6A 5ECGC 5J59A 3LBIA 3HDGA 1L7DA 5LBIA 1MT0A 1XA3A 3BE4A 1K08A 4DRXA 2WJAA 3BMOA 1R0ZA 3OTGA 1ZPDA 4W7HA 1B0PA 1TYDE 2FCAA 2ZBDA 3WNCA 2XGSA 3EF1A 1L5NA 4KR6A 1TW2A 1J25A 4UUAA 3UMGA 2P75A 2Q1TA 4RPKA 4EFMA 2C97A 2QJRA 5CU7A 3TSOA 1HT2E 3I12A 4K6FA 1JDBC 2K2QB 1CR4A 3LC7O 4IIDA 4Y6QA 4ED9A 1NBOA 1GGJA 4IDDA 3ZZUA 2BFFA 2G72A 1AM4D 1QIMA 1TD1A 4IUCS 3IULA 2ZDQA 4Y2YA 5ALOA 1MJGM 4CCWA 2RBEA 2QN2A 4YREA 1A1VA 3D2AA 3QLUC 3K4HA 1U8AA 4KRXA 3T3IA 3HNPA 1P9OA 4EGJA 3RYCA 1HT3A 2X8LA 3QEMA 2X42A 1TT5B 4NICA 3FGZA 1A9RA 1Z7YA 5FUYA 2JFYA 3EHEA 5C0OE 2R62A 4JB0A 3NOQA 1SOVA 4IJUA 1CULC 1QPGA 1ZNYA 1VKRA 3F5SA 3RE1A 5EWJA 5GONF 4D42A 4POOA 1WDKA 3HJTA 2GHIA 1Z6ZA 1CF9A 1ZBDA 4KN5A 4XCVA 2E0IA 3P32A 2XBMA 4G0QA 1JFFB 1JPNA 1IBCA 2IUSA 3WA6A 4CFYA 4FKMA 5BV1A 3FOEC 3RSSA 1I5OA 3KKQA 1IXZA 3GHYA 4UNIA 5L3QB 3GIWA 4L8GA 1Z22A 1WEHA 2I9KA 3I6BA 1L4YA 1JLLB 3D8UA 1I36A 3IP8A 1EFPB 4BQSA 2BFWA 3EGXB 5CA1F 2QE6A 1PGJA 4YN3A 4LQ4A 5SYMA 4IQ0A 3AHEA 2QG9A 2ZVJA 1RLJA 4YBZA 1DJQA 2IE8A 3MTGA 4U39A 3L5OA 4Q4HA 1QJ4A 2XT9A 4KHZA 4WCFC 2X14A 4R41A 4P36A 4JLAA 1S8OA 3LP5A 4KZPA 2F55A 1TAQA 4JBXA 1F2UB 2FXIA 4IGIA 5BNWA 5KDOA 1ISSA 4WVFA 1FFEA 3PFKA 4JT2A 4P3KA 1GT91 1V47A 3C4JA 5K3DA 3TEJA 1NURA 3RAGA 3PT9A 2EJVA 3IEKA 3L9XA 4P2BA 3MTAA 4RZ3A 3EQZA 2AHRA 5TY0A 3EDQA 4PX5A 4ZEWA 2PVSA 2AXQA 1FXUA 3HA2A 3QELB 4LXUA 4BO6A 1SXJD 2AI2A 1SCUA 3PKJA 4HNGA 3SC6A 3S2SA 4D8TA 1PT8A 4KQ2A 4WNYA 1MXHA 1Y42X 4GI3A 3UXMA 4LPSA 5CDYA 2EG9A 3N58A 3JWPA 1KYZA 1BKDR 2IOHA 2GBPA 2WPNA 3HYCA 4QM6A 1NQTA 3HP1A 3Q8MA 3ZDYB 2QGFA 4F96A 4WFIA 1K2WA 3ZD9A 4R8RA 1SQFA 2GVZC 4RIIA 2HRCA 3TH5A 1GXSB 5COAA 4MTLA 4PPQA 1JDBB 3A2MA 5FPQA 2MYTA 2FTKE 4YX9A 4W1QA 4F97A 1DKPA 4FFNA 1W1WA 4CV2A 4M1KA 1LDYA 2ZIXA 2ZSJA 4LJ7A 4P8RA 5BV0A 5K8CA 3H2BA 1Z0SA 2XKJE 1CJTC 4Y1FA 4YP9A 4ZVUA 4CQLB 2J46A 2UYYA 1GEGA 1LBHA 3GG9A 3I04M 1YFLA 4EATA 3I5AA 5E7QA 2AIRA 4V0NA 5FJJA 3U2QA 1LSSA 1Y98A 1O87A 1UPBA 2CVZA 2DG2A 4H15A 3EEQA 3QKSA 3N86A 1V2GA 4W99A 2WNHA 3EG9B 1SD1A 5J23A 1YWGO 2F43B 3H11B 4IXWA 3U9LA 2XXAB 2WFLB 1KXZA 2CD7A 4D9CA 2A9KA 4KIFA 3QNWA 1O6ZA 3GYBA 5HIIA 2ILVA 2H5IA 2X15A 2PR7A 2AHOA 3ITDA 4HNSA 3SYNA 4MQMA 3RFFA 3VH2A 1KP9A 4F06A 1EX9A 2GKOA 4C4PA 3RK4A 3SYLA 1B6GA 4R8LA 2F3RA 5AXDA 3ZDCA 1E3WA 1U7TA 1WUTA 2I6XA 2X5XA 3DBVO 4YT4A 4ND6A 4X66B 3UPUA 3WJ1A 5A5VA 1BQEA 5BXQC 1RBMA 4WKBA 2GM4A 4MUYA 1KI4A 1EQ2A 2QL6A 1F9AA 3CKMA 3DEFA 2WB2A 1IM8A 1CLUA 4FS3A 1CRWG 1MN6A 4Z4QA 2R6HA 2Q1SA 3TKAA 2IS4A 5DCWA 4RUKA 5FUBA 2RAVA 5C1BA 4XJXA 2Z5FA 1FZTA 3K72B 4MVCA 1OWOA 5CP8A 4RD0A 3ZDQA 1DAMA 4C4AA 4L8VA 4IHKA 2XUPA 5BV2P 1GQYA 1R9NA 2J0QA 5HZMA 2ZJ4A 3FCXA 2NO6A 2A4KA 1SOWA 4XB1A 4FS8A 4BLUA 3AVQA 3OVMA 4YT5A 1XQVA 3STXA 3WP1B 1S1MA 3FAZA 4XWOA 1JIXA 3KAKA 2FH5B 5DTEA 5LZ8A 4EI8A 2UUBB 1Y9EA 1NVFA 2NUPA 1TUEA 1WO8A 4G86A 4GQIA 2R6AA 4DCOA 1GV1A 5HNKA 1VYTA 2FPOA 5GP1A 1VSVA 4AVYA 2Y9PB 4M0KA 1IYZA 4I50B 5HTKA 1GZUA 3PXCX 4AWXA 3JVVA 1SRQA 3OTIA 2BLNA 1HWYA 3LL7A 5EP1A 2JH9A 2WUFA 4I55F 4J0FA 1LRLA 1KHHA 3QXGA 4FMDB 4GW3A 1KF0A 5D85A 3SHFA 2XMCA 1P75A 2BC9A 2X3FA 3FMPB 3EXIB 3B5JA 5PGMA 1XLTA 1WX1A 5CT6A 3OEHD 4YI5A 4ARUA 2A35A 1UPTA 2F8SA 3IEMA 1T0UA 4HH4A 3FZEA 3G0DA 4NS4A 1ABFA 5A4FS 1K6JA 1F5SA 1OJ7A 2RBGA 4IIJA 2XXBA 1Z2OX 3OZSA 1VJ1A 4H3HB 1LI4A 1DCKA 1Z5ZA 3VYTB 4FYWA 3LHSA 1YJQA 2IZ6A 2D1SA 4O2BB 4B2IA 1A97A 1YB5A 3RABA 2Z57A 1LPAB 4EM6A 2PRYA 3CLRC 3LUHA 2ATCA 3AFNA 1T5TA 1KOGA 2P5UA 3NNNA 5LA6F 4KXYA 4HAZA 3W5AA 1XAGA 1BGVA 2QRKA 4GKAA 3LUCA 1RHJA 1WPRA 1WU8A 1WOYA 2PZLA 3IOEA 3KZCA 5AJTA 2O0MA 3KNZA 4XSGA 4BO3A 2GN9A 3RS7A 2X23A 4JEIA 1T35A 2BGNA 3ZR4B 1KI7A 4ZI7A 1AXEA 4OMCA 2R47A 4PNPA 4U02A 3X44A 1A9XA 5FL3A 1J2UA 2W6ID 4MINA 3VOTA 5JALA 4G1EB 5LU9A 1KQGA 4KE7A 2BUAA 2J9YB 2BFDA 4OQMA 3OSUA 1ABEA 2D0OB 5DX0A 4TMTA 5K0LA 4GMGA 3O03A 4CEJA 3JQ6A 4KUGA 4B74A 1S3IA 4OI0A 5JCOC 3GI1A 3K0HA 4KU4A 3D6MA 4DBVO 1MGOA 1FJGB 2RARA 4A8HA 3ZD6A 1AV6A 3FSJX 4BMZA 1MG0A 2R8YA 2MJLA 1X2EA 3IXQA 3EA5A 2B92A 2KMLA 2YJZA 3SSMA 2HA3A 2O0LA 1XL0A 4D79A 4UM7A 3BD8A 4J4HA 4A1FA 3U4QB 4IRUB 1N0WA 1O5OA 1U28C 1LK0A 2FZEA 1ONSA 1L5FA 3ZDRA 1YQDA 2OXIA 3EH1A 3KQYA 3IHTA 3U17A 5D2CA 4EPXA 5AJYA 4JJGA 4UHKA 3RJ9A 1XR3A 4E3WA 3MS7A 4OHYA 3SBOA 1LDEA 1T8YA 4WK2B 2YV3A 1B2RA 3HUTA 1DBQA 2FMXA 1HF3A 5FA8A 4EY3A 1AT1A 5CEEA 1Y6QA 2B21A 5DTMA 1G41A 4IHQA 5ALIA 4JLKA 1ZJ4A 4QNNA 4F2DA 3ZY6A 1QH8B 2ZRMA 4C7OA 1DIHA 4U2EA 1RJWA 1L4HA 2BM1A 3ZLTA 1ONOA 4MS4B 1Z8HA 4YAEA 5JEEA 4Q48A 3BKXA 3IR6A 1W87A 2HZBA 4B3SB 1DKMA 1FRNA 5FOVA 4Q0MA 5KTRA 1N6HA 2VHCA 4U8HA 1SBZA 1E3QA 2YIDA 2HZ7A 4QT0A 2NV2B 4W82A 3S4YA 4D9MA 1V39A 1ZESA 2HO4A 2OHFA 4GI5A 1WSDA 2H1HA 2QZPA 3RRXA 4ENTA 5A4IS 4Q37A 4WNAA 5LWHA 2D8MA 3H05A 2EP7A 2I1WA 1TQ6A 4C0AC 1QB8A 4YI3A 2YMLA 3C98A 3FYSA 2R8RA 3TR0A 3STTA 4BFXA 5L40A 4JFAA 1XPRA 3RC9A 5T4BA 1X1SA 1OZAA 3OEEA 4R2KA 5THQA 3AOEA 3SEFA 4MICA 2R68A 1E62A 4JI0B 3K5HA 3M6AA 4B87A 2FF7A 3LVQE 3IKLA 5HQ3B 5IFLA 2JKYA 4HBGA 5KNBH 4RXTA 3HZRA 5BSTA 1A9OA 4B44A 3F3KA 3PDIB 4FN5A 4QX6A 4P7KA 3GCDA 3P9KA 2YOGA 3R2JA 4QTXA 1Q5PA 3KQNA 2IK8A 1LVHA 2P6MA 4A8PA 1SPXA 3Q2IA 3DDSA 3PZRA 3WWOA 3G1TA 3OQIA 1TIKA 3KZOA 2DPXA 1FFWA 2BHTA 2G9RA 3IGFA 3RB8A 1RW4A 2ZWPA 1G291 4LJ5A 1EGAA 3OZAA 2N1BA 1XZIA 3TVTA 1EJ2A 2WU8A 3AXTA 3KJGA 3KU1A 2ETXA 5LQSA 1EIZA 4PYLA 1QFJA 1MOQA 4B6OA 3DZCA 5FHRA 5IYZB 4D6PA 3U4HA 5CX4A 1YL7A 1R0CA 5GOZA 9LDTA 1VHQA 5JV5A 2GPNA 4TRMA 3J7TA 1ZM7A 4FFLA 2QN9A 2CKMA 3GN2A 3H1AA 1ZIOA 3QPWA 3AQ4A 4DJEC 4YMVA 5CVEA 1Q3TA 3GPBA 3G7SA 3TZ6A 1RTKA 2B0CA 2LVBA 1UXGA 3K70D 4OKSA 3U56A 3E3OA 2PX0A 5B6JA 1ISIA 2YIMA 1XAHA 4GR9A 3LLMA 3PC4A 3TEMA 3WLRA 3CMMA 1JHZA 2WPDD 1CF4A 1ZW6A 4AS2A 3EIXA 4FCCA 5EE0A 1GOTA 1WU7A 5D87A 1ICIA 2OUKA 3CLUC 3CZ9A 4ZOBA 3WMWA 2NU9B 4FGKA 5AK6A 1NW5A 2BFCA 1E2GA 1WD5A 1DV1A 3UH1A 3V4SA 4IIGA 1OFVA 1EWQA 4J9VA 3HSYA 1G6Q1 1G8GA 1UBUS 3GLFA 5B1EA 5JYEA 2AOXA 3PSAA 1VM6A 2WQZA 2RMKA 5H7XA 3G9XA 3GJ3A 4S1OA 2JD0A 2CE2X 4RA9A 1ESZA 1IOLA 1DOHA 2TMYA 4QOJA 1QX4A 5DHRA 3TIXB 4EBBA 5I3CA 1G59A 2JIQA 4RNCA 4MRSA 3M6FA 3PXUA 2IPMA 4C7MA 1E5LA 2Y8EA 3CLVA 3L4SO 3DBIA 2P5TB 4I14A 1WCV1 1O0CA 4KO3S 5AR1A 2Y76A 1PHPA 1T2VA 3H9UA 1YGYA 1M6WA 4N41A 2XDQB 4HFNA 2D00A 4EW1A 4IDGA 3TOXA 2A86A 3PNMA 1J20A 4RE6A 1WDTA 1SA0A 1KZ6A 3I0NA 4UCXA 1YQQA 4RD3A 4WA7A 1ENZA 5CVUA 2HC9A 1JJ7A 2PVCA 3MTIA 3AC0A 4R3NA 5CW1A 4RHEA 4EGFA 2DETA 4HDCA 3PP8A 3DTYA 1XFDA 1R5NA 2PANA 4TVOA 1TQ4A 4XX1A 3KQUA 2ZAIA 1UKEA 3B1XA 1L5LA 1H5NA 4DW8A 3MWJA 1IRIA 3C45A 4G1CA 3DBHB 4MQEA 1S8AA 1C8KA 4ZEVA 1DFIA 3DOCA 3JD4A 3UJ9A 4NL4H 3REGA 1I10A 2WKWA 4E22A 2F1JA 1C5KA 1KHTA 2R4QA 1H4SA 3OIWA 1EUCB 3SR3A 5LZ5A 2ODWA 3A06A 1ACMA 1YF3A 4OQFA 1J8QA 1JVNA 4KAJA 3ZQKA 4BNZA 3GUZA 4L4SA 3TTWA 2JJMA 3LPDA 3VU9A 3N2YA 1VHTA 4OHKA 5KMGA 1GZ4A 3QW4B 2I4IA 3N74A 4RTOA 2B1RA 1TMYA 1RTTA 4P53A 3CSUA 3QKRB 1ADYA 2UAGA 5A3RA 2XMDA 1JDTA 4FIDA 1E69A 3OE4A 3TSCA 5KTMA 1JIIA 5AKHA 1E7WA 3UMCA 4DR7B 1DV2A 2O8DB 4PFSA 3NM4A 4UXIA 4YWHA 4GLBA 3A58B 4PLZA 2JA2A 2PX8A 5BOSB 4P31A 4NE7A 2FOLA 3ON5A 4OV6B 2IPLA 3BG5A 3HZZA 1W7AA 5CPBA 4K9MA 3DTVA 1JQAA 2I22A 2H2AA 3S68A 4EYOA 4HEQA 5LP1A 1AVTA 2ONKA 4DOMA 3FCUB 3K1AA 1NOIA 4MLCA 3KWJA 1AKWA 2CUTA 4PO3X 1UKYA 2I7CA 3PUWA 1QMGA 4NMLA 5FNVF 2XD9A 2R1ZA 3ER6A 5AD1A 3HY4A 7REQB 1K8YB 2CCJA 2V0NA 4MIKA 2Z6AA 2FWPA 4A23A 1F1BA 1NW9B 1ODFA 4OHUA 4B6FA 2XODA 3OE1A 3PUYA 4NZ9A 1XRJA 5CPFA 1I7LA 2PWAA 3S3TA 3NUZA 2B61A 5IVPA 4DMGA 3GELA 3HZHA 4QPJC 4LHVA 3VM6A 4A5SA 4BNNA 5KYYB 5LQNA 3GLIE 3CWZA 2F4VB 1IUKA 4LOLA 4NARA 4BMDA 2QGZA 1Y3AA 3RYIB 3AHHA 3WXBA 2LCQA 2DCUA 1ONPA 1QOPB 4A0RA 5HIJA 3LUPA 4IS3A 2XQVA 1B15A 4B1FA 2WYVA 1V45E 3NRBA 1RE0A 3EY9A 3LWNA 2G77B 3A6FA 3DEZA 4MKHA 4DUYB 1C1YA 1DJLA 1F38A 1MJGA 2AEJA 4BAUA 4I5IA 1B1AA 1VA4A 4QXRA 2Q3LA 1ITZA 3WKDA 2QAJA 4XASA 1LH0A 1RZ3A 1I1HA 1VL8A 3OOHA 2WT4A 3PD0A 1IPFA 1OLXA 3OURA 4K9KA 1P17A 5C5CA 2CNLA 1IY1A 4DFDA 2YASA 3PU6A 3WGGA 1HQKA 4RY9A 3BWBA 1XEXA 3SSOA 3CUEF 4BE9A 3SKVA 3R3SA 2F6RA 2FV8A 4CI0B 4Y67A 3LHKA 3P4YA 2W70A 3BN3A 5EOVA 2I4LA 1YR9A 1Y4AE 3LT0A 3LY9A 3BZBA 3N0XA 4V0QA 3W5DA 3DEAA 3H5VA 3L2OB 3NFYA 1MX3A 1VJDA 1I4EB 3QVGB 4LFCB 4KGVA 5AHWA 4D41A 1XTTA 3ZDFA 2JJ2D 1U5AA 4H7FA 2GPTA 4E5NA 2HLNA 4DA7A 2H16A 1DDOA 3C74A 1GVHA 2YFYA 3C6BA 4JNKA 2FPPB 2NO4A 5JS2A 2Z3ZA 1BRTA 4MW1A 4A91A 4RJTA 1NBME 1NQXA 2R87A 1ULHA 2OGTA 3DH0A 1T9BA 1RBZA 2BHSA 2CLFB 2V7QA 3HH8A 1BQ4A 1KA9H 1QHEA 3GFRA 3N70A 5AVKA 4JEHA 4WZAB 3WE7A 1HYHA 2RAPA 4JP2A 4CZ2A 5HJ7A 2FN8A 3FOZA 3GQVA 5EE9A 1UDAA 2ILTA 1QG0A 2I78A 2QT0A 3A6KA 2Y1LA 3GUCA 3N0WA 4U6SA 5ADVA 5ADUS 3CZCA 1D6MA 2IOQA 1ONBA 1QHIA 2GZDA 2IXGA 5IAEA 3PNVA 3W5BA 2V59A 3H3JA 2C2HA 1VBFA 5DT2A 5GWXA 3UJHA 3PGXA 3RHFA 5LJLA 1TZMA 1JIUA 2XB4A 4RZUA 4N7BA 4B0PA 3W5JA 3HXLA 4CTOA 5JJKA 1DG9A 2J5BA 1U7WA 3WLJA 1ZVKA 4E4TA 1P4HA 3PDHA 4RL4A 4I4CA 1M2FA 3Q72A 3QMWA 4P81A 5C46F 4NBWA 3R44A 4X20A 5HDQA 1BIFA 4L1KA 4FJ0A 2ZS9A 3ZGOA 4WIAA 3V6MA 2POQX 2YJ4A 2L19A 4YCLA 1OTHA 2C5BA 4LCEA 3KEFA 3AT1A 2YVUA 5GTDA 4U7PB 4XFDA 1DX4A 5EYPB 1WVGA 4WJKB 3T0GA 3COVA 3L6EA 3IHKA 3LT4A 2W2PA 5IKOA 2Q50A 3OA2A 3V33A 3C5EA 1QE0A 2J6BA 2YWJA 3WX0A 1OIVA 3GEDA 3I04A 3AVUA 2H0AA 3EBLA 4YQZA 1N25A 2N9UA 1H1DA 1YOVB 4YP7A 3VYVA 2ZUVA 3CRZA 1HV8A 1FDTA 1Q7GA 3OF2A 3SQLA 3BHIA 3FOFC 3V6LA 1EXDA 1QGUB 1NVVR 1U8XX 2DPHA 3HGMA 1P0MA 1XV5A 3DYBA 3NIWA 4CPDA 2A9VA 3D2LA 1YQEA 2ZWOA 1JKJA 1KJNA 1UKZA 3W2GA 4UEWA 2QD5A 1GAWA 5M34A 2VOEA 3IUSA 2H7VA 2WU4A 4LI0A 2KE5A 1WDWB 2DQZA 4A73A 3EPPA 5J2TB 5LMZA 1E3LA 2QQGA 4ROTA 5JZSA 3ST7A 2XJ9A 3AVPA 2QVZX 1BHJA 4KE8A 5ES3A 4ZCTA 2W00A 4UHCA 4E15A 1TKCA 3K16A 1JBKA 4FJ2A 4B3HA 4MVJG 4DXAA 4CLEA 1BCSB 3CX6A 4MEBA 4U2GA 3BXZA 4ZOLB 5FAXA 2F4NA 1MAUA 5JASA 1BJKA 3THXA 1J8FA 4BN5A 3L8DA 2ATIA 4Q9KA 3B7GA 5EJ6A 2VXOA 2GFQA 3KCQA 1MDBA 2B7BA 1KYVA 3NHUA 4UFOA 2QSZA 3U3ZA 1XZCA 3ROXA 3HMQA 2HCRA 3I1YA 4JROA 3N1UA 3UHAA 5GJBA 1WB6A 5TS2A 5IMSA 1UKVY 2JZOA 1QIGA 3QVTA 2K5UA 3MG9A 1VMKA 2H1CA 4Z49A 1M83A 13PKA 4AD8A 1AJEA 1HE5A 1FTYA 1T2FA 3JQ7A 3PD7A 4MPRA 4RQAA 1WBJB 3T54A 3WBBA 4ALJA 4B09A 2A84A 4REMA 1M6VB 3LW7A 4X24A 3UOAB 3SVLA 3MHTA 1PJSA 4TVSA 1W5AA 2C9DA 4NBNA 1EFKA 1U11A 2QP3A 1SQ6A 2JIMA 2EJUA 4PEVA 3ABQB 1MF7A 4KR7A 3I6QA 2ZRAA 1Y6ZA 3WB0A 5JSUA 1K5HA 2WJ4A 2Q2OA 1SVNA 2JIZD 3C5HA 2HB6A 4MKRA 1SCAA 4Y9TA 5CFOA 3DLIA 2AWOA 1E3JA 3K6SB 2H1OA 3TK1A 1E1DA 1KYQA 4DM4A 3O7WA 4RPCA 1JMVA 3IB6A 3TLGA 3JAWA 3LC0A 4KX5A 4OXQA 4AJ4A 1R0YA 3T35A 4IEEA 1GU7A 3BM5A 1S7GA 3L8MA 1UBMS 5HUQA 5JAHA 3TDNA 2WE7A 2V1UA 4BZWA 4N18A 2X8BA 1WQ3A 1KI1A 3DUWA 2Q28A 5D3KA 3IE0A 2W98A 5FUXA 4MV7A 2FG7C 2J67A 2JD1A 3BMOB 3HQ4O 2YYAA 3FHCB 3VVBA 3MJSA 3AWDA 5AW1A 1SBIA 2HSEA 2PTHA 2D0PB 3I9NA 3LWDA 3QWHA 5AIBA 2XRZA 3FI9A 1O95D 1ORHA 3AFHA 3SG0A 3OFNA 1SVIA 2H8KA 3KL2A 3BGSA 4WWHA 1A7KA 2IEDA 4WASA 2V6MA 3FVQA 2BFFB 2W8BA 3BWCA 3OCZA 3GEIA 3JASA 3LPCA 4GT1A 3DO5A 4XYEA 4GXQA 3R5KA 5GZ6A 3IQWA 1T6YA 4LZWA 4NYMR 2ZAMA 2R1UA 4Q4AA 5ICEA 1YGPA 3B6JA 3HVIA 3KR1A 3L7YA 4DB4A 3EDCA 5CTAA 4MGEA 3NAQA 3Q9LA 5EPUA 4ZO8A 3V8QA 2UXBB 1IJFA 1BQ3A 2R6GA 4LXXA 3HXPA 4IICA 5CFNA 3Q8LA 1QWOA 4DCCA 1EB9A 1QTRA 5KTKA 5L3VA 2A3NA 2VYVD 4HN2A 1Q20A 3RU2A 1MU0A 5EWJB 5GJWC 1QBKC 4JOQA 4OK5A 1GUAA 2HLPA 2PV0A 3PF9A 4TLAA 4PYJA 3LOQA 1YDWA 1Y5LA 3CC8A 4KQGA 4LBWA 2HSWA 3X1ZA 1GKIA 3UAWA 2ZRIA 4I8IA 4P3YA 4F56A 1N4DA 3EXHA 1I4TD 4MRAA 4BQQA 2XNDA 4MW0A 3BE5A 4E5DA 1GDDA 5AI4A 3V8RA 1SZJG 2Z6VA 3A1FA 4NP6A 4NNPA 1OU0A 5HFAA 1IG0A 3P2OA 4UAGA 2WTNA 3EAFA 1VLQA 3F47A 1E9RA 4B3GA 1Q12A 1PYDA 1U8TA 4MWEA 3GJZA 3I4LA 4GDMA 2KYRA 4L27A 1F6BA 2OHGA 3D1JA 3S8MA 1IATA 2OC4A 4MV9A 4HAXA 4J4BA 4TSFD 3WL5A 1QWSA 4RVHA 4DMLA 4ZGWA 4F21A 1LDBA 3BXPA 3MJTA 4A5OA 5CURA 1DO8A 1PGQA 3E5NA 3HYNA 3FBWA 3OPYA 1PG0A 2Y1EA 2RGXA 4J1NA 1ZR2A 3A6LA 5KHOC 2VN8A 4J16A 4JD5A 2ZUSA 3O84A 5EE1A 3BJMA 4OHXA 2RD2A 4BO0A 1CIPA 2R8OA 3BFVA 5AJXA 1UM9B 3JSAA 4PAMA 3UCFA 4Z1OA 5LSAA 5IS2A 2GASA 2C82A 2GN8A 2KX7A 3CX8A 5L8VA 1N3LA 1SB8A 5FBZA 1II8A 1H9BA 1TAGA 1WHSA 1X0VA 4LF6B 5CIQA 4YXWA 5LBTA 4HQRA 1EU1A 2XCOA 3RIGA 1E66A 4C7BA 2C4UA 5K01A 3F96A 4MQFA 1LEHA 1ELOA 1U02A 3HZOA 2QJTA 4IJ6A 1IE3A 1C9KA 2QPLA 3DVQX 5FYDA 4ETWA 1V11A 1DT5A 2CL5A 1E2QA 3GT4A 3UWSA 3GX1A 4IKOA 4BNLA 2R2GA 1J2YA 2GEVA 1VIYA 2AC7A 4HDQB 3TB6A 1MIOB 3K96A 4B31A 4LZZA 1GUZA 1VQ1A 1VE7A 3UQYS 1PJLA 1O8BA 2QYSA 3BWVA 3OT1B 3Q40A 2ZSAA 4MR7A 1I51A 5BUSA 1E1QD 1DRKA 3UZUA 1MRNA 3NEPX 3RVOA 4CDMA 1VPLA 1NVMB 5KNLA 1OI3A 1UBHS 3JZMA 4X5OA 3G3EA 4YRQA 3I2KA 4ITVA 2YOFA 5KNDD 4OSEA 3QQ5A 1YMVA 3P94A 3ORYA 1WXFA 4WOPA 5LZ2A 4DM7A 3E3AA 4ZHSA 3RPEA 3ORSA 3HJAA 4BDSA 1VRCA 1OJLA 1Z0JA 2OQ2A 3S2YA 1Z0FA 1PTKA 1B93A 2PWPA 2VOJA 1FYXA 4C2UA 1CZHA 3AY0A 3VPDA 1I4LD 2PRZA 2R7AA 1U3WA 1XF9A 2V45A 1EWYA 2QE7D 2QRNA 3L7MA 1JXQA 3GGJA 3TE7A 4YCNA 3I8OA 3RUPA 5A1TA 4AG5A 1Y8AA 1N9ZA 2WUGA 1IM5A 4LXYA 1E3WB 1VOTA 4PHGA 4BMSA 4EY5A 2XH8A 5JI3E 3E48A 4JI3B 3SBXA 3U26A 1KPIA 4XE5A 4PC7A 3GMDA 5BY2A 1EHCA 1W5SA 3ZWMA 4FOLA 2O57A 2LWIA 5BVGB 3EDYA 3HN2A 1M8JA 1JNYA 2HCBA 4P54A 4OAPA 4TMYA 3VA7A 1E1LA 2VLBA 3KK0A 1ZI9A 1LUAA 4PW0A 3ADOA 2Q6TA 3QYFA 2AMVA 4CXMA 2I7VA 1IEQA 2MU1A 4ZAYA 1IVNA 4D4KA 3DE3X 4EH1A 1CPYA 2O2HA 1H2BA 3M82A 3OLQA 3WR5A 1EXVA 2BF7A 3DKPA 4B0OA 1RHKA 5I7RA 1J5XA 2QUKA 3GB9A 3JXEA 1RLIA 3DJYA 3K9HA 1BXRA 3P2YA 4HMQA 4AN0A 4ARBA 1E2HA 4GXRA 3E8XA 4UTVA 1SIUA 3TWOA 5F3WB 2F48A 3DPIA 5K3CA 2ERXA 2OO7A 2FSVA 1JAXA 5EA2A 2C31A 1MEEA 2A5FA 4XDZA 4AIIA 4ZO6A 5AVWA 1QU2A 3CXUA 1THMA 4MKIA 2DWQA 2PLRA 1ZK1A 4GECA 1RQRA 2QW0X 1E9CA 4MP8A 2Q3EA 1X8LA 4FLMA 4Q3CA 3CF0A 3UG7A 3VO8A 4XGIA 1HSOA 1HFKA 3AUUA 4MGZR 4Z99A 1TQ2A 4KE6A