1J22A

Crystal structure of archaeal xpf/mus81 homolog, hef from pyrococcus furiosus, nuclease domain, selenomet derivative
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
131
structure length
131
Chain Sequence
b'VKVVVDSRELRSEVVKRLKLLGVKLEVKTLDVGDYIISEDVAIERKSANDLIQSIIDGGLFDQVKRLKEAYSRPIMIVEGSLYGIRNVHPNAIRGAIAAVTVDFGVPIIFSSTPEETAQYIFLIAKREQEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent RNA helicase, putative
publication title X-Ray and Biochemical Anatomy of an Archaeal XPF/Rad1/Mus81 Family Nuclease. Similarity between Its Endonuclease Domain and Restriction Enzymes
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 47
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2002-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1j22A00
2ZIXA 4P0PB 2BGWA 4BXOA 2A1IA 2JPDA 4M6WB 1J25A 2M9MA 2ZIUB 1J22A 1J23A 2BHNA 1J24A 2ZIVB 2JNWA 4BXOB 2ZIWB 4P0QB 4M6WA
chains in the Genus database with same CATH superfamily
3AJ8A 1E2EA 3PXAA 1KQ3A 1QYXA 3AUAA 1C81A 3ES9A 3MD0A 4QKQA 1YI0A 2ZI7A 4FYIA 5AHKA 4YT8A 1KR2A 3M9WA 4KJXA 4HNAB 4QICA 4I1RA 4QYIA 3NWOA 4YLGA 2X0FA 1L4FA 3L7AA 1JLHA 3AHFA 4IBOA 5JAQA 4R8SA 1TF5A 5LQMA 2RBKA 1VKZA 2FF7A 3UGJA 1VP3A 4RQAA 2XQKA 1B8OA 4L74A 4JI8B 1IK6A 1KDOA 3IPXA 1B8UA 1MFZA 4G97A 4LOIA 4UXJA 4D74A 1L6RA 1E58A 4BP8A 2P4QA 1YS7A 5F1OA 5LUBA 4O4LF 3U09A 4EG4A 5IXYA 3IHKA 2RKWA 4I55B 4TV8F 3TLMA 4EHFA 2C78A 1C0IA 3LSYA 4OHUA 4U4AA 4ERXA 4R1PA 3RSQA 2PV0A 4EQ6B 1EDDA 2PAAA 1NRWA 1LPAB 3ITKA 3QUBA 3ILSA 1NQWA 2JLAA 4DUPA 1ZIXA 1QO0A 3I6QA 4HT3B 2VRBA 4NPCA 5IJ0A 1G8YA 2QAJA 4KQJA 3W5VA 2NYUA 3AEKB 3IJPA 3YASA 4ETNA 3O94A 3PQ4A 4XCQA 1WO8A 1Z4KA 4IJ5A 5DW3A 3WQSB 1OPRA 5ALIA 2RGYA 4Y2UA 2DETA 3KYDA 2JFBA 3HVIA 4MKIA 2A4MA 3T9AA 2AOTA 2JFQA 3DLCA 4H9GA 4L51A 4YUAA 3UMFA 4M1EA 1HZZA 3BB3A 3EW9A 3RTGA 3ZDRA 3S1AA 2VHCA 5AKZA 3LT2A 5CX1A 4BE9A 5LXTA 4YK7A 4MDYA 2J0UA 3WL7A 2V98A 1E9EA 4JB0A 4KLRA 2A1IA 2FA9A 1E9CA 2FSSA 2QLBA 3R1IA 3EVDA 1VHTA 4ENTA 2ATVA 1EVEA 4N41A 4BLQA 4IMIB 2VAPA 4OB8A 3QU9A 1FFBA 2J0QA 2J3MA 3T12A 3RYFA 1U0RA 3SIPA 3TOSA 3VR1A 1C9MA 1GRCA 2AJBA 2JRLA 1FTSA 1PFVA 5FFFA 1OYVA 1M8JA 1ZUNA 1KARA 5AJXA 3I83A 4FDMA 4OK3A 1IATA 3OFKA 5G0WA 3V4OA 4CM5A 3SXUB 4E03A 2CE7A 1V4VA 2EZ4A 3LDUA 1GN9A 3A4TA 4FZ5A 3T6KA 1B4DA 1KJ8A 4JJ8A 3GJSA 3U39A 3DV0A 1T9HA 4HR7A 5I5EA 3RVDA 1OX4B 4UEQA 4F9GA 1W0CA 4TKUB 3WK9A 1P61B 4GLLA 3ZN2A 4KXUA 5C5IA 4G0YA 4KFTA 5AM2A 4L22A 4AKHA 2JI7A 4HSGA 4MRSA 1Q0TA 4KACA 1HDZA 4DQLA 1JDNA 1J0EA 1JSLA 3E9RA 5FHQA 3T54A 1KJ9A 2ZB7A 4JASB 3DL7A 1YCFA 5E7QA 3L07A 3ESZA 1T1JA 1GGNA 1C1YA 1TW3A 3C39A 4G0VA 3D4PA 3HLYA 1GGJA 2PO5A 4HRXA 3H7AA 1CULC 4L16A 1VKNA 4MP8A 1ZCFA 4ZICA 1W88B 5SY9A 2D5CA 1NVEA 2BGKA 3RFFA 2IXEA 2EJUA 2QNRA 1UKCA 4EB6A 1E3MA 3NBQA 3P9RA 3B9BA 4RTPA 4LWQA 4EX6A 2GN6A 2BBOA 1FDIA 4ZV9A 2VHWA 1IY1A 4PTLA 1C4OA 1DFHA 5B5SA 1TYBE 4QPNA 5JPIA 4DPMA 3N2KA 3NBXX 1SKUA 2I22A 1QQ6A 4Y2QA 1G2IA 1SXJC 5K3FB 4XPIB 2TECE 3T7TA 3S3TA 3HL0A 2C9DA 3KYBA 3IEMA 4EKIA 4OIMA 4DV5B 2CHVA 2J3JA 3EAQA 3L0OA 4LGVA 2X6TA 4WZ6A 4JOBA 2CMKA 1RLMA 5GJCA 5THXA 4HTAA 3KV3O 3RTEA 1BA2A 4JEMA 2XB4A 1JBKA 2FDXA 1ZEJA 3OU7A 3GLRA 4I3FA 1RADA 4KXNA 1DSSG 2BGIA 2ZPAA 1AQ6A 4B33A 4B48A 3NANA 4KMSA 7ABPA 4K7JA 1QHXA 4OI2A 4DR6B 1ZH4A 2OB2A 4GOLD 4YRQA 2WVJA 2IXGA 5EE5B 3RYIA 2V6JA 3W1WA 2FLVA 1MB9A 2QZZA 2ZIXA 3N2GA 1HYBA 3RU7A 1QP7A 1NAIA 3D6UA 4DC1A 1POXA 4BGUA 4KDCA 1MEOA 1FSSA 4NICA 2IS2A 3QWIA 1DIAA 3PX7A 4D8VA 1ZHHA 2HMVA 2ZRPA 4B47A 4JLNA 3OZAA 3B5EA 4CQMD 2O5CA 1VPTA 4LDPA 3V2HA 1J22A 4CLHA 2I66A 3EMVA 4YAIA 1R7RA 1V6AA 1XZJA 1E3JA 2FPUA 3DVQX 5IHXA 5L53A 1VJ0A 5IK2D 5ESRA 2ONJA 1NR1A 1STOA 2YC2C 3F97A 3BULA 4K6HA 3OZCA 4LKRA 5REQA 3M1AA 4Z6KA 5J43A 2NG1A 1ZY2A 2MTBA 2OHXA 3SP1A 4C7MA 1LD3A 3P9YA 1JMKC 4AYWA 1XTBA 3PWTA 2IUTA 2TMKA 5KTPA 3BOSA 1M8GA 2J9RA 5MFZA 4QU5A 1HC7A 4WFQA 1E1RD 3EUAA 4UAVA 4XUEA 4LF8B 1BE0A 1JIQA 3W34A 3GJ5A 1HT2E 2CLOB 3IALA 2VK2A 3U16A 2C83A 3C6XA 5EP3A 3VTZA 2DYKA 4EUSA 5KTSA 3DXYA 1JFSA 4AY6A 4GOKA 4FK8A 3NQ41 1KJJA 1ZD2P 2XA2A 4XIGS 1C8BA 5KUTA 1C80A 4BNTA 2ZAYA 3N58A 3K70D 1A9XB 3VU3A 4YV1A 5DI9A 4EFDA 3EUFA 1KK1A 2C42A 1R16A 4MJXA 1L7PA 3BERA 3DDSA 4PPYA 1UJ2A 1F2UA 3BF8A 4B3XA 4XM2A 1E2MA 1OGIA 2GA8A 4L7VA 3R9XA 3RYCA 1FC0A 5CB4F 2FG6C 2VNJA 1Q3TA 3SJ7A 1T8UA 1SK8A 3Q4GA 4F2WA 4IFIA 4S0XA 3SMQA 1TK9A 4Z1OA 4R9UC 1S01A 1AZSC 2X86A 1KSFX 1NM5C 1YL7A 1ZM7A 2GAOA 2ZYTX 5AXBA 1I14A 2EX4A 4RQBA 3CKYA 1DIGA 5IT5A 4L1KA 2B4QA 2C3OA 3E5MA 2HF8A 4UHKA 2XXAA 1CJCA 4RUKA 1Z18A 3CH4B 4C1BA 5BWNA 1EUQA 2B0JA 2QYSA 3BK7A 3IEIA 2IIVA 1ZJ6A 1UH5A 5LSAA 4J3JA 1GZ5A 4MV8A 4C9BA 2A84A 4YLYA 1MAHA 1NDQA 5FTMA 1XUOA 3OEED 3AHHA 2AG0A 5IMBA 2ZT5A 3H75A 4LHSA 4TXMA 1I9GA 3JQGA 3THYB 4ETMA 1US8B 1KVSA 1W4CA 2IYYA 1KKUA 2C2HA 3WGGA 1IVYA 1I4LD 4YRJA 4BBZA 4DMKA 2MMGA 4O8ZA 4RHXA 2BF4A 1WXDA 2YWBA 4GRIA 5EE9A 2C2XA 1IBRA 1E3TA 5CYOA 5DOVA 3ZXIA 3MGBA 1FDRA 1R6TA 2WP8J 2DM6A 4M8KA 4RGQA 3H8WA 5F98A 3MWKA 3ZVLA 2ODWA 4QOHA 5E4FA 2XMRA 3KU1A 4QQKA 4IICA 4B1FA 2DECA 3JYNA 2OBLA 5B1DA 4BB9A 4BX9A 4BMXA 1B1CA 3TZKA 2NO6A 1YR8A 1EX7A 3FAZA 4EPVA 4MH0R 1BWRA 3PXGA 2LGJA 3SFZA 4ZYYA 4YCMA 3R7FA 1KL7A 1C3LA 2F59A 4IWNA 3DKIA 4CHTA 4OM7A 4ZFNA 4D9BA 1O6BA 3C14C 3JYOA 4UVEA 1EAMA 5EHZA 3T8YA 4M6WB 1K3FA 2X14A 1X3LA 4AF6A 2CYCA 3UHPA 4YR9A 1A4UA 2PUBA 1EP1B 4DHWA 1PS8A 4RFSA 3WYCA 2AG6A 3H5RA 1L5ZA 3A7EA 1T8YA 2W90A 1QYWA 4KE9A 2FW1A 3ZDEA 2QLLA 5EP4A 1Z17A 2VNSA 3ZZMA 5JECA 3I3SR 4Z8YA 4FFNA 1AKRA 1IJFA 4V0QA 4YAGA 1JVSA 4MUMA 1H2YA 1PSWA 1N0WA 3BWYA 1EVKA 1WZCA 1MRNA 5E4TA 3D31A 3D7RA 5AI6A 5EWLB 4ZEVA 4TWAA 4FNOA 5DBGA 1W36B 4GR5A 1O0SA 4AN1A 3WYGA 1J8FA 3PS9A 2B2XA 3ABZA 2V03A 5BRNA 1YZKA 5KI6A 5C34B 1JHRA 1QH0A 4IKEA 2CBXA 3BWEA 2YUTA 3EF1A 1ZD8A 3CC8A 1KPHA 4RETA 3OP1A 4L8FA 1C1HA 1NJFA 1RM5A 2QMUA 2QRUA 3SWWA 1ZPDA 4XIFA 4C4TA 4X6YA 1UKBA 4LQ4A 4A5SA 3AHCA 4HDSA 4OQYA 3UENA 3LWNA 4P4SB 2YYSA 5KOHA 2J0SA 1E0AA 2FUNB 4YWHA 5AJYA 1L4KA 4FQ8A 2CUZA 1EE9A 5T6BA 4BQNA 4TZ6A 2QVGA 5IK2A 5LWHA 4EI9A 3STVA 2BRUC 4NBUA 5CCDA 3GJZA 4UU0A 4AWXA 1OHHD 4A91A 1MTOA 1P3DA 3BJIC 3DOOA 4BPBA 3HYLA 3I6ZA 4B85A 1EE1A 5K4HA 3QVOA 5IKMA 4D3XA 1NYQA 2Q5QA 5HMLA 1LLQA 4DMFA 1PNTA 2GSDA 1TTTA 3R9WA 1MO5A 1YR6A 2WYUA 2OT3B 3MCTA 2YMQA 1PK8A 4CE6A 1ODFA 3OICA 1E77A 1XTUA 4WHMA 4FYMA 3URKA 2B8JA 4JUBA 5BW8A 2AFHB 4GKVA 4O4HA 2VQDA 3IP3A 1DAMA 3PNPA 4KMMA 4ZOBA 3W8DA 3EVFA 3I05A 3UA4A 1BOOA 3TQIA 2IA5A 4NBSA 2VDOB 1FFCA 1E0DA 3ZD8A 1DAKA 3V8QA 1DTWA 4H18A 4ILEA 2Y1FA 4GXRA 1DKPA 4LJ5A 1C9EA 5JCOC 3G5AA 2WJYA 1M2GA 4IVQA 1P1CA 4KXXA 4I1PA 2FWIA 1QV9A 2WF5A 1GZSA 2NACA 3LQKA 2UAGA 4YJGB 5LQRA 4LMRA 1KEKA 2PXXA 2PLAA 5EKSA 5BQ5A 4D02A 5F23A 1ADBA 1NAHA 2HWWA 4Q18A 5FNVA 3A2NA 3DFUA 3A28A 5IJAA 3RREA 2GARA 1YA6A 4BASA 4M1OA 5JALA 4FE3A 1F51E 2B3TA 5TMBA 2PGLA 3T5TA 3KOXA 2XVYA 2RGNC 1CRPA 3FFWA 1E8MA 1ZWKA 1T26A 1E2HA 2WD7A 4DIUA 2VP3A 2XA1A 4KLZA 5JMTA 5KJFA 3ESRA 1JHDA 3GT4A 4J07A 4N01A 2RARA 1I1NA 3RF7A 1CRZA 2IHVA 2A7QA 3AM4A 3UWOA 4AT1A 2YZMA 1WD7A 3G2JA 3RR2A 3MT0A 5ELXA 5C7IO 1DHRA 1PJBA 3L7MA 2C5HA 3OEEA 1JHUA 2GCPA 1USKA 3E84A 4O2AB 4LSWA 2HQBA 4J7XA 3HTXA 1K06A 1TD1A 1EFVB 4I4TA 1RWWA 3EFHA 1XXHE 4ZVOA 2CNOA 2REBA 1N7IA 3ETDA 2F9MA 4MKRA 1UAGA 2VUTA 2BM1A 2POCA 1UBRS 2R8YA 4M1KA 4HGRA 3B20A 2WVHA 4GHWA 4Y0NA 1YS2X 2ZVQX 1U7HA 2CNLA 1RAAA 1EK6A 3BE5A 4HFJA 2O2ZA 2PT7A 3D8NA 3A04A 3RFTA 1T9GS 3NALA 3ICOA 2QUBA 3V1KA 3HMKA 1NF8A 4JOQA 5HXAA 3T5AA 2AXEA 1N4AA 1Y8CA 2I3GA 4GZMA 2GFQA 3S70A 3WWDA 2QOEA 3F6RA 5G2OA 3IQWA 3OWHA 1TQ8A 4D3DA 3EDRA 4ND4A 4C4PA 4RMHA 4WK0B 5IPFA 3UMCA 1E6LA 5LMCA 2QLJA 2X5OA 3AH8A 4QO7A 1Q0HA 5KIAA 2FQXA 3UJDA 4UNRA 1RJDA 1RXUA 1VHLA 4GOMD 3L4JA 3SQLA 3DL2A 4K9NA 4ZDIA 4EKNB 3ZWOA 4KQFA 4UUPA 1MZVA 4RC9A 1T8TA 2QU7A 2FUG1 2PLRA 3FF4A 3ILHA 1QTQA 3TRKA 1DRWA 2D0PB 1QQAA 3TGLA 3WFZA 3HB1A 1OBVA 1PJQA 5H80A 2LCQA 3PHJA 3EQ8A 5DDIP 4MR8B 2AR9A 1XN1A 2V0NA 1QF9A 5GZ6A 2QN9A 2YVQA 3GLQA 3OIGA 1MC4A 3HXTA 3CZQA 4X8OA 5IHPA 1GILA 1J9GA 1JSRA 1MXFA 1QIKA 3BTOA 1SVKA 1U3FA 2FJ0A 3CNBA 3MAJA 2RC5A 1QQ7A 4KXWA 1OXKB 3RHZA 3I0NA 4UFNA 1NI5A 3KDPA 2XHZA 3PA8A 1CDEA 3IULA 4ZHQB 1RWKA 3ZHZA 4GMDA 5AHOA 3HWRA 3IOYA 4HDMB 4NECA 4RVHA 3NM6B 4JT8A 2OK8A 2ZYWX 2HMWA 2J7PD 5IEBA 3HCEA 5CLLA 3IE0A 4YONB 5HIIA 3SZ3A 1V8FA 1XCOA 1FSGA 2IBMA 3ZZNA 1B6RA 1I32A 3C1UA 2X1HA 1X94A 3DS8A 4UHHA 2D1YA 2WB2A 1H0HA 4FOOA 5FEUA 1U5CA 4GD3Q 5GVRA 1ZJ4A 3GPIA 1D1PA 1MN6A 3NHKA 1L5WA 3PT9A 5AXCA 3UAXA 2D3TA 3TG8A 3CE9A 1KZHA 4O2RA 4CQNA 3HY4A 4MVJI 2V7WA 2QPTA 4YMVA 2WJ6A 1SAYA 4J0HA 1AX9A 4BRZA 1ECLA 1XXHA 2YHUA 3T7RA 4C7KA 2I6GA 2FPPA 2WYIA 2HXGA 2CJXA 3M33A 3LU1A 3ZLBA 3CX4A 4EATA 1MHPA 2Z3ZA 1GTZA 1Z5GA 1QHSA 3HA2A 3E18A 4MMYB 4N49A 3OZGA 2N3ZA 4CLRA 2A4KA 1YQEA 3DGEC 1KZ9A 3PWZA 4CMIB 4OCZA 3AUKA 2ZWAA 2Y93A 2PXHA 3W2IA 3P9CA 4CV2A 3A4YA 3MSXA 1YR1A 2DUMA 3GLTA 3EIWA 3WZMA 2AC4A 3DWFA 2EKDA 4AJ1A 1O08A 1Z0UA 3LPMA 1V1RB 3LUCA 1NJSA 1S3FA 4GMXA 2Z9DA 4L4UA 4O02B 4WI1A 3VZBA 2HXYA 1YMQA 4DWOA 2I2XB 2QMQA 4C7OA 2OCKA 2C8KA 3DM5A 4YRFA 4N0PA 2VYVD 3AHGA 4JLJA 4N5NA 2R8EA 1SCNE 3ESAA 4N6GA 4EGCB 3BXFA 2OQRA 4UU8A 1R5JA 2N47A 1HLDA 3IDQA 3RK1A 5EJAA 4FONA 5HZHA 1ECFA 1GKKA 1O96B 4ZCRA 3PGA1 3CEJA 4B3CA 2K5UA 4HG2A 1IIBA 4MS3B 2CNKA 2CYBA 5H02A 1UPFA 3RBZA 2NT4A 2BSXA 4LCJA 2CXOA 1GPUA 5B3KA 3D6FA 3GVHA 5AWFC 2J3IA 5BR1A 1S0UA 1XO1A 3BQMB 4CN8A 4G9GA 2ZULA 1AKNA 5EZYB 4CBVA 1QGOA 2PFKA 4OKSA 1SCIA 4LQCA 3Q3CA 1AKWA 2ZSFA 1KDRA 1XROA 1S96A 4HI0E 5I45A 2PZLA 4FWIB 4D3FA 2WM8A 3ZKWB 5CFPA 3RBAA 1BVYF 3VX3A 1KDTA 4KXQA 4L6AA 5JD4A 3S81A 4U6QA 3HRIA 1ZCAA 3MS4A 2D1SA 4RK7A 5FH9A 3UXHA 4GMFA 1FDOA 5IASA 2CSUA 3ZJ5A 3CCFA 2C7RA 2H7CA 3BX1A 4HXGA 3GEIA 3FFAA 2PR7A 2FRDC 2RH4A 1V6SA 1WW8A 2GH1A 3OTWA 1CR1A 1BTOA 3FMFA 4F93B 1Q15A 3M2PA 4DLYA 4C0SA 3TYXA 2YQZA 4N8EA 2XTAA 4LHXA 5IBQA 1IM8A 3RS7A 3E0XA 2PL5A 3VR3D 3LGXA 1H2RS 1MV5A 3O9VA 2A14A 1P74A 2VKQA 3F3KA 1H2WA 5B30A 1O6GA 4U9IS 1XDUA 5MDHA 1E1QD 3KQVA 3SCZA 1GYQA 2PD4A 2UZ1B 3BB1A 4PAWA 5DTRA 1E32A 4CLEA 4ZC1A 4K6FA 2WY2D 5LMZA 3NPMA 5L6LB 3FHCB 1N9GB 2QP3A 5HM8A 1OX5A 2HF7A 3CPEA 1G6Q1 1RQLA 4HTFA 4P92A 1KSHA 5AK5A 4ZZ2A 3PHBE 5B2FA 5F7XA 2LVBA 3X1WA 3ZCQA 4P53A 4BMVA 5F9HA 1D1SA 3O93A 2P9FA 2GM3A 2JCVA 5EKUA 2B4TO 4CMCA 5SICE 1Z4JA 3LY7A 2EAUA 3U62A 1L3IA 2W6PA 3KEGA 2JGNA 4QRHA 2V55B 3ZV7A 3Q72A 2WKWA 3WB0A 2DQ4A 3ZC3A 4JXKA 1ZI8A 1N5LA 4WT7A 2D6FA 1TK2A 4OU4A 4UMFA 1JRLA 3H1TA 3DL4A 3TJMA 3IQZA 4ZVLA 4RYDA 4URWR 4OP2A 5EP2A 1Y1TA 3MILA 4IDHA 3LK6A 2XE6A 1W2WB 2UZ3A 4BO9A 3E9NA 3GXOA 1DJQA 1WQ4A 1TTPB 1P60A 1YNSA 2ODEA 5ALOA 4DUYB 2VHQA 1G55A 4HNGA 2IYWA 1ZUHA 1HRDA 3EWSA 4R9VA 4RH0A 3HBMA 1GPYA 1PG2A 5COAA 2XITA 5AKYA 4QOSA 5DIFA 1JIKA 3OCYA 3QBDA 4KIGA 2FEWB 2CK3D 1XMQB 4BNHA 4WGFA 4KE6A 3L0ZA 3VSDA 1XTIA 2FWMX 5D84A 3FVVA 2NUAB 2NAPA 1R9MA 2QZJA 3U9LA 4CM7A 1LGYA 4OAQA 1Y6FA 3NT5A 5BXQC 2IF2A 1V1MA 4EPYA 3NMUF 1DWUA 4TTPA 1BDJA 3KE8A 8AT1A 3Q3JB 3K4PA 4IXNA 1Z6ZA 4TPKA 3PNKA 1VRCA 4GP9A 4Q9AA 4QLOA 5FA5A 5TVKA 1KVUA 3HV0A 4W82A 4Q02A 2R7NA 4GSLA 3BHJA 2AE2A 2GCGA 2HHCA 5DT2A 4NFSA 5KINB 5KTRA 5JJIA 3OE4A 1PZFA 4WFIA 1UZAA 2GHIA 2OENG 4EZBA 3BHMA 4MLZA 5KTNA 1E7RA 3WK4A 3V8BA 2WB4A 4WKPA 1V7PC 4GT1A 4TLLB 2QPLA 3HEMA 3K0FB 1YNOA 1E5QA 1H05A 3KOZA 4IWYA 4KQGA 4Z4HA 5HX7A 2QQEA 1RI2A 4BKPA 1BE6A 1CSEE 4C0WA 1YO6A 1R8JA 2BKLA 1A7AA 3S68A 3G0GA 2GM5A 4G81A 5IKEA 3KDSE 1P1FA 4ZAWA 1GP2A 4RV4A 1DEOA 3U3ZA 4Q4AB 3T61A 4D8WA 1OPXA 4L28A 2H3HA 5E1MA 3TKYA 4HVAA 5KQLA 2O8FB 1WE2A 4PLTA 2AYZA 1Q6ZA 1NJ6A 4ZJPA 2X0JA 5DGHA 4DCPA 1X7ZB 3OZRA 2GKGA 4PG6A 3LM8A 2MIIA 4YQZA 4RIGA 3T3DA 1K9VF 2YV4A 3G2PA 4F97A 1QUEA 3MIZA 2V1XA 2XYQA 4MEBA 3QVWA 1KJNA 1WMFA 3MSCA 4XFKA 4ZI7A 1Z4IA 1PJ4A 4N54A 1E7WA 2O8EB 2JLWA 1ONNA 5JCZA 4CLOB 1NKSA 1XWWA 2PKXA 1A9RA 3FOZA 1LPSA 4LGMA 1OJLA 3IKMB 3ZBQA 2ID7A 4QD3A 2XIJA 4ZU6X 4AW9A 1K7SN 3MHPA 2EHDA 4WLNA 1KAOA 2GD6A 2GXAA 3NTVA 5KEIA 2W93A 3JALB 2VSQA 3QWAA 4KR9A 4B6FA 4CMAA 5I6DA 3VR2D 4YCJA 1NJ8A 3E9QA 4MW9A 4HKTA 5I4BA 5K3AA 4D9NA 1PFYA 3HC7A 1GEEA 4FFVA 1FX0B 1UKEA 3OCJA 3KZNA 5E6RB 3L79A 3F6SA 2YJTD 5FUWA 5FT9A 5TS3A 4TVSA 3EPLA 3WWZA 4R0NA 3W6UA 3AR5A 3KYIB 3BMQB 4RV5A 3DM9B 4URHA 3W6OA 3GN1A 3KUUA 3RTBA 3KR0A 7REQB 4CVNA 4TXLA 3KHKA 5BQOA 3WGIA 1O9HA 2ZANA 3HRKA 5A5DA 5B4TA 1Q12A 4Z0PA 4ALKA 5LU8A 4J94A 4GE0A 2GZHA 1L5LA 3H4TA 3KJHA 1TQ2A 4I5EA 1NXWA 3CB4A 5HJ7A 4EYOA 4RQTA 1EUYA 3R7DA 1MEEA 2FOLA 3LUFA 2XOKD 1SGWA 4KVFA 4MHSA 3TNFA 4AQDA 2FWPA 1SM4A 3KSRA 2WP0A 4XGKA 3RC7A 4K05A 5JSHA 3J80A 4LIPD 3LT0A 2O3TA 2YOFA 2QMZA 4JA2A 1SBZA 1VA4A 1C0EA 3B60A 1G60A 3DC7A 1LI4A 3CEHA 4RNDB 4X44A 3N5CA 2A30A 3WKCA 2DB3A 4W5WA 1DDIA 2BUBA 3X1YA 3JQQA 3D2AA 3FBWA 4E2YA 4EMTA 1N8TA 2IF0A 3OPYB 4WJLA 3EXHC 3TZEA 3RG8A 4EPWA 4F60A 1O5TA 2ZB2A 4LHYA 3SYTA 2NSJA 4YV0A 4EF6A 5AVYA 2VRCD 3AVWA 1MT3A 3HVKA 1JB9A 1JZQA 1VCNA 3F4LA 5FLKA 3LECA 4QRDA 4IV5A 4OVKA 4BNYA 3CFYA 3GLGE 3MOIA 3LNCA 2HU5A 3KR1A 4W9RA 5GAJA 1XYGA 4Q15A 4BMYA 4RCVA 1CJMA 5ERGB 2CVPA 2XKAA 3NH9A 1D7OA 2PKEA 1QC5B 4UBKA 5A7FA 4AJPA 2BEUB 4OQNA 4Q4LA 4Q6BA 1FQJA 1QGUA 1V8BA 1SG6A 3R3VA 2CK3A 4JUAA 1KFJB 3GEPA 4CMBA 1TQDA 4W5NA 3WVNA 3PUWA 1RW4A 5C8YB 1HH4A 2ZWPA 1BMQA 4RZ3A 5FAXA 1N2GA 1Y80A 3W3ZB 2X19A 2ALJA 1V11B 3MINB 1U7XA 5ALJA 4KQ2A 3CJQA 2HQSA 4PV7A 4OF4A 2E85A 5KVAA 2BZGA 3E9DA 3G49A 4M1SA 1YS9A 3UUGA 4LXIA 3W79A 1ZSYA 3A32A 2RK3A 4BLPA 3KT3A 3CZRA 4MB6A 2XYHA 4G5HA 2X2EA 4BVGA 4ESOA 1DIRA 1MB4A 1CR2A 1XZAA 2OGZA 3JQAD 3LT1A 4R81A 3OZTA 4RDCA 3WGNA 4MV3A 4IHKA 3GGJA 1FNSA 2I2BA 4ZT4A 1MAUA 5ELMA 4EKGA 4IHJA 2E21A 2SECE 3FYSA 3KHTA 1PL8A 3OJOA 4LQDA 4QVGA 4ZQEA 1N32B 5JS2A 1B2LA 3VNQA 4BX0A 2DSTA 4DQKA 4S35A 1QCCA 1GFWA 1JEDA 3T1VA 2ZI3A 1EFCA 2SKDA 2J8ZA 4D1YA 3ZX5A 3QX8A 3QPDA 4ZAZA 1GZ4A 1ADFA 5E4JA 4G1EB 4ID9A 2VJMA 4LBYA 4DAEA 3NEYA 5L8VA 3MNFA 3HJTA 4L76A 2OCDA 1RXIA 2O1WA 5IKOA 1UWLA 2QTTA 1U2ZA 2Z09A 4EAQA 4X3PA 2DX7A 5CLJA 2CNBA 3GA5A 4L4YA 3TN7A 1M1NB 1M10A 2CW5A 2C54A 4H1VA 4ZAFA 4AZWA 2V5VA 2WHPA 2VFAA 3O26A 2CWDA 4URZR 1U1FA 4RH1A 1JFLA 4E5MA 4UNPA 1X1RA 2ILTA 3SHWA 3GLGA 5BW5A 4W1QA 4HWGA 4KRFA 3A6FA 3P0HA 3TVDA 3BA1A 2V9PA 4FP9A 3EXAA 3FTNA 3GL9A 4MKXA 4QUBA 3MJVA 4KMOA 1ZJYA 5JW6A 4NENB 1P19A 3P9PA 5C7OO 1G4AE 1L4NA 4H3KB 3ICPA 5CA0A 3VR2A 2I5PO 1H1LB 5JNTA 2GPNA 1YFLA 4QJBA 3I37X 1VPDA 2PRKA 2K7ZA 1OWPA 3DBRB 2MWMA 2VF7A 3QU5A 4KAFA 4LZOA 4ZOCA 1EIZA 4R69A 3W5HA 2Z3VA 1XCGB 2GZ3A 1T3SA 2JAHA 2G88A 3K2IA 4JUIA 3KTAB 3O3CA 4H6WA 4ZVQA 5BMVF 4J6EA 3V9PA 2JLVA 4OKNA 3NGLA 3RSGA 1Z22A 4V0ME 2A0UA 2GBPA 4DRXA 4ISBA 5KU1A 4YFVA 1UADA 3QELB 1MQSA 1BWPA 2HA5A 3VH2A 4JLWA 1I1HA 4F1JA 3DTVA 3X1JA 1A5SB 4NP6A 2YMLA 3CEPB 1Q84A 1NVAA 1OLXB 1A69A 2DCUA 1I3KA 2CVHA 2H2HA 1Y98A 5CFLA 1B00A 1L0BA 1UF9A 3O73A 4HDRA 2B8NA 3IAXA 2OM6A 3MM4A 1PJTA 5M3BA 1E2JA 2P41A 1HNNA 1LSUA 2A1TR 3U0BA 1SVSA 4A6DA 3CVUA 4J0DA 3MTEA 1IB0A 1FXSA 4IGEA 2Y0BA 4EZIA 3ZWWA 1XTTA 6REQB 5EHQA 5BQ3A 4YDRA 5BQXA 3T3OA 1XEWY 3CBGA 3HP4A 1AKMA 2AA3A 2QN7A 5K6RA 3W7BA 4IVPA 3CLUC 5KNBD 1BFDA 2VT7A 2BKAA 3LBAA 4TWBA 2DEUA 3H9CA 1FNMA 2DPHA 2A9OA 4RIIA 2WU4A 3LQ4A 4B7XA 4D57A 5HNKA 1YQXA 2W5UA 4E33A 2R2AA 1E3QA 2Q3CA 2VRCA 3KZVA 4EG0A 3FH0A 4Z49A 2C5GA 1UANA 1DQYA 4ND1A 3E1KA 1K7FB 4MLPA 4PPFA 4DWWA 3MWDA 4WFKA 2A9PA 3O8OB 2DWPA 1OWLA 4ODIA 1B8NA 4TV9F 4ZV4A 1OXMA 4CPDA 2K2QB 1K75A 1OH6A 3ZTTA 5HQ3A 4ZVVA 4J0GA 1V47A 2VK8A 3G9ZA 4NBKA 1N8KA 3PD1A 1RJ9B 1S1MA 3RVMA 4V0OA 2CFOA 4CKCA 1VFNA 4Z9AA 1XALA 1JECA 3RUHA 3V9AA 5DN9A 3TVTA 1AS2A 5DOZA 1KI9A 2P2GA 3Q87B 4X3CA 4CCWA 5JEEA 3ADDA 2WV9A 1EEHA 2CSXA 3NEPX 5LIRA 2WUEA 1Z2CA 3QW4B 2II6A 4BTVA 3DH0A 4FB5A 4S24A 3UFBA 2HA2A 2G7ZA 3NXSA 4GYKA 3TRIA 4GQBA 5C1IA 4QUJA 2B1QA 3DF9A 4AFNA 1MOPA 4GXNA 1UKVY 3GFOA 1NLUA 5EJ8A 3AEXA 1NYRA 4FYVA 1N0VC 1ZGGA 3CZ4A 1H2EA 4QFBA 1RSZA 4UULA 3UO8B 1NOIA 3OETA 3TBHA 5AK6A 1PR4A 1XZMA 2BE9A 1N33B 1KMHA 5EVCA 2Y0DA 5T41A 1NI4B 1TCUA 4QO8A 4XSVA 3WLNA 4B45A 5BVHA 2WFMA 1JQDA 4PQEA 3ZTWA 4C4AA 1R12A 5BR7A 2JJQA 3LH5A 5ICMA 4I9GA 2XY4A 4YP0A 3U1TA 4TSFD 4DR2B 1ID1A 4ISCA 2OV1A 1QYDA 5HKOA 2G06A 2P6PA 5CT9A 4PC1A 5HM6A 4LY9A 1O95D 3I32A 4DMMA 4IMPA 1BW9B 3BCSA 3MCAA 4COKA 4FB4A 2C1XA 1IIRA 1K6IA 3NGXA 4XQ9A 3EZ9A 1A77A 3O4IA 3V8VA 4U39A 1H8ED 3C5HA 2A9QA 5ILOA 1TNDA 1MW9X 3SQOA 4BJ6A 4EO9A 2VK1A 4GWKA 1XJQA 3HI6A 4KN8A 2QG6A 2KLBA 3SC2B 4R2XA 2WI8A 2ZSJA 3GF4A 5IXSA 1JIUA 2LCFA 3IAAA 2DXIA 2OAEA 3IIEA 3GP3A 4LMAA 2C9BA 4XIIA 5CVEA 4IRMA 2I87A 3WBBA 3FB1A 4Z9BA 3JYPA 3CCBA 1Z5PA 1JLSA 1UXOA 2L82A 2VZEA 3I12A 3PGJA 1K2VN 4XSGA 5FV7A 2A5LA 3QLVA 2Z4SA 1UC8A 4FGUA 1I01A 4HSEA 5I5GA 4I4CA 2V0CA 5EJ9A 4MGKR 3SQMA 3PXXA 1HO3A 3C5VA 3ITNA 1EVYA 4KYIB 4ZPXA 4B87A 4K88A 1YZFA 3CRMA 3EMBA 2XCQA 4JR0A 2D5LA 5IX8A 3QV1A 2VF8A 3IA2A 3ZCPA 1FJGB 3I42A 4XVUA 1JKMA 4LV6A 2AF4C 4M8IA 3EPPA 4CM8B 3MBIA 2OK7A 3LC1O 1AA6A 5E38A 2ADOA 1D0IA 1R88A 2VRWA 3B2EA 4GPTA 2P40A 4P0TA 4R41A 4FBMA 4UHBA 3OCWA 2O50A 3UV3A 4XH9B 1WCIA 2A5YB 3V80A 4ZCSA 2FWAA 3BDAA 1AQYA 2X8WA 3LO8A 2RHTA 3TPFA 4C22A 3CKLA 4JKYA 3L8EA 2C4HA 2CL7X 1OT5A 2BELA 3PD7A 4DM4A 1IEWA 5JS8A 3EHEA 3A4IA 1QMGA 1XTSA 2JBAB 2OHIA 2XYGA 4HEQA 4IIGA 1P7CA 3LG2A 4UW9A 4DZZA 2ZITA 3NIFB 3NCHA 4NPAA 2HNAA 2HLPA 3NHYA 4JP2A 4NBTA 5A4FS 5FWNA 1KMQA 3QQ5A 4S12A 3JARB 1I5RA 5E1DA 2OV3A 1XLTA 1HDIA 5JUWA 3UC9A 1BN7A 4FD2A 4FKBA 1CY0A 2FCRA 1E1NA 2D1RA 4HLUA 4Q16A 2YJGA 1JP7A 2OHFA 1YS1X 1W59A 3F5SA 2V7BA 5CGQB 4X6XA 1Y6RA 3F6BX 4C7JA 4IW3B 4X62B 4V0LA 2EZ9A 2VAMA 4CUKA 2YJZA 4B2IA 4FHCA 4NZPA 2QM8A 2PXCA 4RBNA 5ABPA 2P9QA 2FMHA 4GMHA 2GVNA 5DCWA 1HR0B 4L5JA 5FWAA 2H5JA 1FVXA 2I7DA 4Y6SA 3I04A 4H77A 1C9NA 3D7LA 1CRQA 2WA2A 1W48A 3C4VA 4WNCA 3PEFA 1U63A 5AW4A 3BRQA 2IX3A 2ASEA 5HG0A 1O0CA 1WU7A 4OHOA 1WY5A 2YVLA 4N8DA 3ROKA 2CJFA 3Q5DA 2ZCVA 4AUKA 2EKQA 1SUIA 1BHQ1 5I7OA 1ZD9A 2SCUA 4B75A 3AR2A 4KH1A 1E4YA 3JQPA 3GMSA 3LRTA 3DFKA 3P4XA 4YJ2B 5HBRA 4A92A 1LF0A 2IEZA 2Q3FA 4FFRA 3K72B 1X7YB 4KHZA 4MEAA 3TTVA 5I51A 1CTQA 1Y63A 2QJOA 4RMJA 3HG7A 1F12A 3REQA 1OFUA 2FPIB 2XF8A 3KJFA 3CZ9A 1R9NA 1GARA 3NWBA 4PN7A 4S1VA 2CV0A 2GDZA 1RVV1 3ACDA 3LLMA 1I2BA 4QDXA 4DXAA 1Z6TA 2VI5A 3KKOA 4EECA 2OQ2A 2D2IA 4GLFA 2YMMA 3HZHA 1R00A 1WRBA 2WE7A 3IX7A 4PIVA 3SEAA 2BCGY 4EK9A 2JEYA 3WXMA 5AVXA 4HGNA 5K3SA 3GDOA 2W2LA 2HPHA 2WMOB 4Q3LA 2YHIA 1QAMA 2NVBA 2ZTHA 3W6PA 5L3SB 3ID6C 2LXNA 4G0NA 2NQ8A 4ZPJA 1XDSA 4ZT5A 5CB8A 3HKEA 2XUOA 5KYVA 1XT6A 3VTAA 5I3ZA 1QIHA 1FSPA 3BHIA 1T34A 1PWZA 2A78A 1DO0A 5IT4A 5LMUB 3PEYA 5AMXA 4NCBA 4ZU1X 2ZBUA 3K1AB 2CVZA 3INTA 4OGFA 5DGXA 3KTFA 2JI4A 1Z74A 1B1AA 2P77A 3RBVA 3S0JA 4B9AA 2CVOA 4CHGA 2ODPA 1FP4B 3NIBA 1PTJC 1PV2A 1VBMA 2H16A 2I1VB 1O95A 1GITA 3OI7A 1HG1A 5I8WA 3U6KA 2WSIA 4BFYA 1N1EA 1SUFA 3OZXA 3Q9SA 1U6IA 2QX4A 4ZMBA 1ZK0A 4NCKA 2OOKA 1H8EA 1RI1A 4XX0A 2QRQA 1BFUA 1K3UB 2CL5A 3DE2X 4RY0A 2FQ1A 2W8ZA 4E46A 4DMGA 4HH1A 1CP2A 3ZE7A 2YR0A 2E37A 4V3CA 3WB9A 4A10A 4B0PA 2X5JO 1XMIA 1M2EA 2W2XA 2WTAA 1Z6PA 3GD5A 4QU0A 2PR2A 5D51S 5F4BA 1M74A 1Z06A 1EP3B 1VKOA 3SR4A 4A15A 2VA8A 2ZQ5A 3W1EA 2Z2IA 3C8HA 5G0UA 4IZOA 3NTRA 1IN8A 4OJNA 3PDUA 4L0MA 1FIUA 1SKMA 4EPRA 5AVKA 1XZPA 3JRXA 4YAUA 3FPKA 4L8YA 4PIMA 2C4VA 4IH9A 1LRLA 4OHZA 3IL2A 4HLQB 3LQRA 3G59A 1AKYA 3UK2A 3H04A 1YONA 4GC9A 2F3TA 1GUAA 2ZYGA 3EA4A 1Z47A 2ZDGA 4QBHA 3K9BA 4H4EA 2XXJA 5FI0B 1H94A 3VR5D 5LOVB 1ECGA 3BUSA 1NC3A 2JB9A 3BKXA 2YIMA 3DZ8A 5K0LA 3WZLA 1E4OA 1K5DA 1O3YA 1X8KA 2GRAA 2OQVA 1YZLA 3UMVA 3JWIA 4Y0AA 4YFYA 4BO5A 4I50B 4UBNA 3K70C 1TAUA 2WTEA 1V96A 1XB2A 3PP8A 3DPUA 2WT4A 3GDHA 1HM5A 3QW2A 2OZLA 2EFDB 3MCWA 1U8CB 3QEMB 4YRBA 1R0YA 3E22A 1Z5WA 2OVBA 2Q5EA 3Q8XB 4MI1A 2Y66A 1KHHA 3THRA 3O4GA 3WG9A 1Z7BA 5HIKA 1DBPA 1GNRA 1YU6A 1VLVA 1JLRA 5BN4B 1A96A 1YQTA 1NMEA 1PNOA 2FOIA 3AKYA 4GF5A 2GZAA 4HD8A 4JQCA 5KO2A 4AKGA 3LIPA 5I7SA 4PAGA 4RIEA 1P0IA 4MGYR 4YMHA 3MB5A 3TLGB 2RONA 3A6EA 4TS4A 3ZK9A 4AI6A 4DBVO 1QG2A 1TM7E 3D0OA 4IGKA 1MDFA 3E5NA 3T5CA 4FFWA 3H2IA 3EE6A 4PZPA 2OZPA 5LXTF 3PR3A 1XD2A 3L43A 1LTKA 621PA 4L15A 4I0WB 1KDVA 1U9JA 1Z62A 4V0NA 2O8DA 1VIDA 3TDMA 2JJ2A 2PL9A 2JLYA 3KKLA 4Z5XA 2AXQA 4LZJA 4J0IA 1KFCB 4KOEC 2P5SA 3D7NA 2CHGA 5H0IA 5F3WB 2WFZA 2IYQA 1DCTA 3C70A 5FJIA 2AEEA 1LLCA 2AMLA 2C84A 4MKZA 4FE4A 2G71A 3DAFA 3HU5A 2L17A 3PC2A 1GEGA 4YWJA 3BGVA 3I45A 5DK4A 1X38A 4DLNA 4LJLA 3A27A 2VTBA 5TF4A 2RD2A 1IHOA 2J45A 4U7PB 3V6MA 4WASA 3S8MA 3W5BA 5K2OA 2W6ZA 4LN1A 2FJPA 4B6GA 1C7IA 1BZYA 4HGQA 4OLJA 3K9GA 4TMFA 3ZQKA 1II9A 2IHUA 9ABPA 1MDBA 3C8UA 4K87A 4BV8A 4MV5A 2I78A 1XMJA 4MA4A 4XVCA 1A5TA 2CHUA 5ALKA 3VZRA 5LQUA 4R2KA 3IRVA 1Z0FA 3ORFA 1IONA 1T9BA 4G23A 3NTLA 3GRZA 3GQBA 3VZDA 3EK2A 4R1LA 1V1JA 3WGTA 2JGEA 3IMKA 3SHQA 3SJBA 1FLAA 4AZ0B 2VAVA 2X9LA 1JT2A 3M9LA 5KYYB 4BNZA 2O3UA 3L4KA 1PEKE 2HKIA 2QRZA 1RQGA 4QNMA 3H9GA 1JFRA 1PWEA 4EX7A 2BI7A 3S28A 4F6RB 5C8XA 1K68A 1IY0A 1KY2A 1JYEA 3F98A 4CF6A 2NNLD 4IVRA 4KLAA 5AW7A 1D2MA 1SXJB 1Y4UA 2VSXA 4YLEA 5ALGA 1TRKA 2O8VA 3SD7A 3TSAA 5AW6A 4EA6A 4KQ9A 2HK9A 2P62A 2X8JA 3P2JA 4ZAXA 3PQ3A 2C7PA 1OU0A 3T52A 1DJLA 1DOZA 3N0TA 3T7SA 1R4MA 1H22A 1QIFA 1TAGA 3QXHA 3R3ZA 3G3EA 3R20A 2EQ5A 2VP2A 3T0IA 1SOWA 1YA4A 3QFTA 4C6HA 4CIDA 1FMTA 3KV1A 2OOSA 1DLJA 4PXSA 1X14A 2B61A 4IDEA 4U7TB 5HIMA 4CGYA 2E6KA 1C3EA 2HU8A 1NQUA 1SY7A 5TQJA 2NP6A 1ZCZA 4MS1A 3WLMA 4O3FA 2G83A 1J8YF 4NHEA 4Y8VA 5DHAA 4G4SP 3GJ4A 1C4KA 1SHZA 1JAZA 4WERA 2NXJA 4M38A 1NR5A 3F73A 2YMPA 4DEVA 2BKEA 2VJAA 3LAWA 3CQ9A 3INYA 4KIWA 1NQAO 3WKAA 2GZ2A 3PX2A 1ZR4A 3IEPA 1B0UA 2F8LA 3CEAA 1J42A 3M4ZA 4MINA 3TL2A 3IIJA 4KAXA 2O7RA 5EIEA 4YJHA 1U2RA 1XZQA 2V9ZA 2OY0A 2Q5CA 1U9ZA 1WKCA 1ENYA 3O90A 3SM9A 4C0BA 2RG1A 4GOOD 4BJHB 1JGTA 1QG0A 2HL6A 3KQQA 4GEKA 1B3BA 4ZOLB 1FYDA 3LS2A 3FY4A 4HX9A 3TRHA 1XJ0A 2C61A 3CX7A 2B5WA 3DP7A 1TKBA 1GGFA 2Q5HA 4B3TB 5BUSA 4KNVA 3IBYA 4U2GA 4HC4A 4CU2A 3ECAA 4MRMA 4C6SA 4Q1AA 1S8NA 2CDRA 4S3MA 3O4FA 4K9QA 2XT9A 3B6MA 3BXGA 1RKUA 1T1GA 2OECA 2QXTA 4PZEA 1RD4A 4JBYA 2V3CC 1UJ5A 1PF7E 2XNHA 1J2JA 1IC6A 1F9EA 1TEHA 3SYKA 5I7EA 2G09A 3QF4A 4KNWA 3AI1A 2MYUA 5DFAA 4Q9IA 3JSAA 3ME5A 3TSYA 1CZHA 1M2VA 3I8XA 1OF1A 4JSRA 2FLWA 1XAHA 3WYAA 2X6RA 4UATA 1T9KA 3N0XA 4XW2A 3KVOA 1W0KD 4N9WA 1PGOA 4JMLA 3NAGA 4PYQA 3RYHB 2IU3A 4UASA 5JNWA 4RKQA 3EJ6A 4OGKA 3GP5A 5TQ2A 1WXFA 3G9XA 3C3AA 1RQ2A 3A6KA 1HK7A 5L3QB 3QYAA 3BL6A 2JHFA 4RK5A 3WK8A 2AMJA 1TYDE 1RWOA 1QXSA 2GRUA 2XOXA 2QTNA 4QPJC 4MITA 3K15A 1KJYA 3OOYA 4NFHA 1ZNZA 4POAA 4RJKA 1JHAA 5CDUA 4HADA 4K46A 1ISPA 4WXRA 2GWHA 3W2EA 3CUVA 4CNQA 3H65A 1PL7A 3AIOA 1U3UA 1VECA 5H5JA 1ZYUA 2XUKA 3FWNA 5DBEX 2J3QA 5H68A 5KMGA 3LA6A 3RUCA 3UJPA 5EN4A 1OQAA 2YBEA 4IUCS 4ZO7A 2XGMA 3P2IA 5A2QA 2HZ7A 3SZMA 4RXTA 3O6VA 3WV5A 2G1KA 1GLNA 1RVDA 1ZA2A 3D5TA 5G02A 3DZKA 4WA8A 3A6PC 2PWYA 1VL0A 2FFHA 4IILA 1YR2A 3ITDA 2X23A 4WCVA 4OMCA 3V7UA 3GHHA 1VA5A 4D3SA 1UBSB 2M6SA 2QPOA 3ICCA 1DWOA 1RAGA 4NRDA 2ZAMA 4HHEA 3C3PA 4EABA 3GFGA 3H19A 4F7DA 4LE1A 1WVMA 3FUCA 1MO3A 2A1TS 1OC4A 2VOJA 3O0DA 3UH0A 1XYVA 3TG2A 2YFYA 1OREA 4E13A 2C5LA 1FNNA 4MROA 3O3OB 2VG8A 5FULA 1B0PA 2W2OA 4FCCA 3FDZB 1V5WA 4L6CA 4AUEA 3R6LA 1TZKA 3HZOA 3UKOA 1RJGA 2DFDA 3DBVO 1N77A 4MQBA 3HA3A 4ZGWA 2QW8A 1WXIA 1UPCA 4A0GA 4DIBA 5B57C 1WIWA 3OZWA 5E7JA 1GPLA 1ZU5A 2WICA 4CEHA 1XPUA 5FOTA 1Y34E 1WM1A 2NADA 3R41A 3IC5A 5IJ9A 4BXOB 1U7ZA 1Y9ZA 1CFZA 2YINC 5A3RA 5F51A 2ZJ8A 4LXGA 1DTSA 1WF6A 3B1XA 3ZWYA 4J1TA 1VLQA 3CVJA 1B93A 4HUQA 3M83A 1JILA 5AUOB 1RPJA 4BNXA 4PFKA 2UVDA 2BBTA 2UZIR 3I3OA 2PRYA 3PICA 4F4IA 2X1MA 2IP1A 2LTAA 3PITA 5L3VA 4YJ3A 1BYUA 1BQ3A 2XJ9A 1F4PA 1ACLA 2V6FA 3PDIB 2ORYA 3AF0A 3C3DA 2RK4A 3PE4A 4FYXA 1PSDA 3DF7A 4TLBA 5E2AA 4E5VA 2GXQA 4DFDA 3IKVA 4ACAA 2G9NA 5K3OA 9MHTA 3HFSA 4H7IA 1E2QA 1RZVA 3V4SA 1OI2A 1TU3A 5DNYB 4XD7A 1S2GA 1R0ZA 3ESCA 5AM1A 4KDFA 5EUBA 5LQKA 5HQTA 4O2BA 4OG2A 2V65A 4RZUA 3PQDA 1A2QA 4I1IA 2HWUA 2FZ5A 1RXSA 1YR9A 3GFVA 2HLDD 3F5DA 2XGJA 1CS0B 3HJNA 2O0MA 1YDMA 3QVUA 4H7FA 3CZCA 2HF2A 1CY1A 1EJ0A 2YXEA 5C81A 3PNSA 4OLFA 4U9HS 4FI3F 5CVVA 3T5BA 4Q7JB 5ALUA 4P35A 1P33A 1ATZA 1WSBA 4HQKA 4OOEA 2IZZA 1MRSA 2AKYA 4HPJB 1GTMA 2CCJA 2OCPA 3AVOA 3OBBA 4NLLA 2Z2XA 1G21B 1QV6A 2WWTA 1QZ3A 4IIYA 5IJXA 4ZODA 3UV6A 3UOAB 2ONYA 1BEEA 1I4OA 4DF3A 1OWNA 4ZOAA 5IM4A 4A2PA 3QE3A 4M9SA 1V4BA 2Q6LA 1QG6A 1VJDA 2EFCB 1QORA 2XAAA 5AKHA 3VTKA 4BV3A 3QJGA 4G5XA 3C41J 2ID8A 2WJ3A 5AVTA 1X70A 1YZ3A 2OBBA 3VSBA 3V1TC 2JDID 4J0CA 1DCFA 1TJ4A 2E0IA 2QB5A 3S2IA 4U1RA 3CONA 4TSRA 1HBJA 4IDBA 4WNYA 1QP0A 1NVTA 3EARA 3U7IA 1GNPA 2JAXA 4BLOA 3ED5A 4O4HF 3TD2A 3WBKA 4BVLA 1M5UA 3TQSA 5KX5A 5EMKA 2A9JA 4JQZA 4FNGA 5B7QA 1M7BA 4E7OA 4EHKA 3FTPA 1GTSA 1U0JA 2C31A 3HWWA 3L6UA 1U0TA 4IJVA 1W0KA 4H4CA 3LHIA 1ODIA 4N4AA 4PICA 4UNQA 4AZ3A 2OTCA 2QN6A 1C4WA 1NYLA 3KLNA 2BFMA 5KNDH 4D9MA 2CJWB 3IDZA 4L9AA 2FUCA 2WJWA 3FMIA 3IILA 3N2NA 3QJ5A 5EJ4A 4OHYA 5FNVF 1NC1A 3L40A 1IOWA 1SCDA 3DMYA 4GMKA 4RVGA 1IWBB 1DBSA 2CV1A 3UMBA 3SY8A 1PGQA 1ZK2A 1ISGA 4X7RA 2B7CA 3GDWA 4TUYB 2P7IA 2H8KA 2BT4A 4LRXA 2REQA 1BC5A 4LJ9A 5EIWA 3TTUA 4M36A 3LX8A 4GYYA 4YCCA 3ENZA 1JAHA 1AOXA 4M76B 5C3UA 4HDNA 3QG1A 1Q0SA 3RS0A 3ZVMA 1QHHA 3WWCA 4DXDA 2CDCA 1EXNA 4IIHA 2QGFA 4MNTA 2IRWA 2WBLC 1ORDA 3A14A 4EENA 1XMVA 1M33A 4TKVA 2QW0X 2F1KA 1ZVMA 4KV9A 3M8KA 3UAOA 5DLPA 3EWIA 1EWYA 3R3HA 3BIWA 4KUEA 1I7NA 1ZITA 1GKUB 1KYXA 1QF7A 2HAEA 2XUDA 3NBAA 4IKOA 4UDXX 3SBOA 3A1CA 4XRRA 2YWGA 1RBQA 2YVKA 2DHDA 1LNSA 1A9PA 2YRWA 3A1DA 3B89A 4I4TF 4PEVA 2EZ8A 4Y2GA 5T4FA 2XTMA 5EWMB 4C05A 4EHHA 4KSYA 4YMIA 3TSOA 1NNSA 4AUMA 3DDZX 1AK1A 4UD2A 1SKBA 4TL6A 2ZE5A 5BWLA 3PFBA 3GLIB 2H2DA 3LDFA 3OZFA 1IN1A 3SKXA 2IT1A 1YACA 2HSZA 4J1SA 2WMNB 2JFYA 4ZYVA 3HO8A 1U3GA 1S8OA 3HXMA 5I7AA 3SVZA 3WNQA 4Y7DA 2C7GA 3LP8A 4OA5A 2XNCA 3R40A 2HSEA 3DJFA 3IMEA 3VDNB 2ODAA 4OKIA 5ICSA 2X3UA 4LC1A 5J9FA 2ATIA 3GGGA 3B9PA 3C6KA 1IHYA 4KTVE 1I10A 4PGAA 4D81A 4E21A 4ENVA 4F85A 2EATA 4OQZA 2XUQA 2A33A 2JH3A 5KDOA 1UBNA 1OLSA 3INRA 2PD6A 1C1DB 2W6QA 2WF9A 1D07A 5CXXA 3RE1A 3GW8A 3UT5B 4GAEA 1A4IA 3KZKA 4X41A 5TARA 1L5MA 1E8NA 3TZQA 1GZ6A 4CEIA 2FFBA 1NWHA 5JRJA 4FR2A 5K45A 1XJWA 3QEAZ 1T2NA 1ZAKA 2VP6A 1FQWA 5ICEA 3HCFA 4COOA 2WFLA 2O8BA 2O2YA 5EKTA 1QVAA 3LUGA 3GEMA 4YV2A 2J3DA 4BFVA 4XUDA 4YUWA 3BMCA 3UW1A 3WMRA 1OTYA 2XB9A 1OFGA 1F3OA 1IN6A 4GI5A 1JFFB 4RS3A 5EJ7A 2F48A 5JQGA 1CQJB 1WBDA 1PYGA 3FKQA 3OCVA 1L7DA 3I4FA 2UYYA 1E5TA 3N05A 4X8HA 1VE1A 3E3NA 1EUCB 1W5FA 2CMHA 4HO1X 3G9QA 1NL3A 2ZIAA 3L0CA 3L04A 4WKGA 2NAFA 3L7DA 3WK6A 4DQ0A 5K4GA 4ROTA 1H0SA 4EHLA 1PWHA 4BAGA 1Y9EA 1FSZA 1CUYA 1KZGB 2HLDA 4B4UA 1CVIA 4RORA 4FMDF 3K9NA 3I2JA 3GJ0A 4MAAA 4R98A 4TX1A 3PRJA 1W2GA 3FOAA 2BF7A 1IPFA 2BEVB 3AIMA 1BE8A 3FWKA 4BMSA 3HBAA 2A1UA 4EVSA 1WHSB 1K88A 2XNDD 3A6DA 3GDGA 1NJ2A 1T91A 1E69A 3WQHA 4B31A 1R66A 4OD0A 1ZBQA 3LKZA 2PKWA 4XOIA 1YD7A 1GRNA 4ZEOA 4WY2A 5D5QA 1NF3A 3ZX4A 4PC7A 1ML3A 3GC6A 4MWZA 5H81A 3TE6A 2QVBA 5LB2A 2VF5X 1ZUD1 3VSAA 5JHHB 2ZJ4A 3EODA 2O2IA 3Q7SA 5ALVA 1TZ2A 2Q8QA 4LPKA 2RJOA 4NOLA 2VJBA 3E70C 2JDIA 3IIIA 4WZAE 2XMCA 5AESA 2DUWA 2IBSA 1QHNA 3M3PA 3VKFA 4BWGA 1AZWA 2CJPA 4IPTA 4AWAA 2BHNA 3WYBA 3VR6H 2QP4A 3KB8A 2RHHA 3QKIA 4CI0B 3B8EA 4H7PA 5FBHA 4PNZA 3ZZUA 4BC1A 4C07A 1LA2A 3HM9A 4LJRA 3AFIA 3B82A 3BICA 3F7MA 3WP1B 4BP3A 2CZCA 5JJBA 5LIPA 2IQIA 3GFFA 4F3YA 5K05A 1K63A 3BFKA 3E3AA 1J49A 3TKLA 2P9YA 1D0SA 3E2MA 3FWYA 2JH9A 4CF4A 2I3BA 1PD1A 1TECE 4X95A 1OZAA 2JLSA 3C74A 2CDAA 2A9RA 2CMFA 1FLNA 3K9WA 4HAXA 3HS3A 1H85A 1H3NA 5KYUB 1T1IA 3AVUA 1U31A 1GWNA 3LLCA 4FMPA 3DKPA 3ZDBA 1GL3A 3T7EA 1MR3F 5HZGA 4BGDA 1RHMA 3HB4X 1D7AA 1SOAA 2Q0SA 5B1SA 3UJ6A 4U3JA 1Z4PX 4I9FA 2R00C 3V42A 1GLGA 1Y8QB 2H5EA 3H4VA 3PK0A 2VHXA 1JXQA 3CG4A 5DMXA 3SYNA 4DLWA 5M2QA 1N5RA 2LIPA 1DXQA 5CYPA 1CVLA 2VCEA 3EGVA 5LFAA 2I33A 3E9YA 2XT6A 1QBGA 2ATXA 4J8PA 2HF9A 4MO2A 2WTUA 2L2QA 2RAVA 3JATB 3QVGB 3OP4A 4X64B 2AMYA 1QCDA 1AUVA 3HY3A 5B1HA 3VNRA 3B78A 2NYRA 1GQSA 3W3AD 1E3WA 3MWFA 3FNIA 5BW4A 5ADWA 5FP0A 5IULC 2PWZA 3GQVA 2CWWA 4DLTA 3A1SA 1QH8B 5K0NA 3SDSA 3K9CA 3AC0A 1QFYA 3R6DA 2O8CA 3GT0A 2JCYA 4BO4A 1QKIA 2VPPA 3I6MA 1I7PA 4KPUA 3NBFA 4LYHA 3BH6A 4P86A 1HKUA 2WDPA 1WBBA 1EB9A 5TQ0A 4BB0A 4RDXA 2RHWA 3HFGA 1XQ1A 2KB0A 3AX6A 4M83A 1UCFA 3LPAA 2YWCA 4GI2A 5BSGA 2Y1LA 2ZBVA 5DT9A 3H1PA 4YP9A 3NASA 1WUTA 3DMHA 1JR2A 5A7HA 4GZ3A 4TQAA 3SICE 1NW9B 4ZZ0A 1I7DA 5A3JA 1EVZA 2FR0A 4ASUD 4N5MA 1PU2A 2Y6UA 4P7KA 4QUIA 2MYTA 1SZCA 4EHIA 1NVFA 1ABBA 1CK4A 4AG5A 1ZIYA 2OC9A 1GM5A 4PXYA 1R9JA 1UWVA 3EZGA 3W78A 3QOFA 4WZAA 3TMYA 1L5OA 3W5SA 2O1EA 4TXJA 1ZBDA 3OQMA 4DSOA 1BGXT 3X1MA 3L8ZA 2WILA 2PRIA 3DCYA 3WQRA 3RVSA 1ZOOA 4AN4A 5LD2C 3HU1A 1KEUA 3ZDFA 4JK3A 4FIZA 1CJUC 1K6EA 4P7GA 4Z3KA 4S04A 1I36A 3FWZA 5IZ4A 2OCIA 4DCSA 1MUUA 2R85A 5FHRA 1LC3A 1CLUA 4IV0A 4FMBB 4JU9A 4A16A 4DMRA 4YROA 4HNQA 3FGPA 2I9KA 2EDAA 3SJAA 1E60A 4J9UE 4XJSA 4L9SA 5HSGA 1RPTA 1VIVA 4P7BA 1GQQA 2H00A 2COKA 3U4QA 4DA7A 4RLQA 4MUEA 5JSUA 3IA7A 2Y6VA 6LDHA 2IZ1A 3CZAA 3ZE6A 2ZJ1A 3U3JA 3G5UA 4XKJA 1QH9A 4U0JA 4HVLA 4OATA 1ULZA 2CLCX 2ERYA 2GEVA 2P5YA 2ET6A 2VP9A 4OMDA 5CFNA 5IKXA 2GJAA 1K0FA 2YY5A 4FFSA 4HDQB 4EFLA 4GP7A 2VHUA 3BL8A 4MMZB 4XTCS 4GEGA 3JQ8B 1HQYE 4EFMA 1AD2A 3GZNB 1KIFA 3IXLA 5ETJA 3EVGA 4OHRA 4DL9A 1RMYA 4FYKA 2KM1A 5THQA 4FHEA 1V26A 3RIEA 3O8QB 1VZ2A 1QHYA 5E95A 1BS9A 3LGAA 3PKZA 4IIVA 1XAGA 2BFCA 2XNDA 4IXMA 4LOAA 1E1CA 1YXMA 1ZD4A 4UHDA 1RCFA 5BPHA 4MVJH 3RS2A 1KEVA 5KOJB 2NWQA 2GM4A 1VLJA 3NHWA 3ZE9A 1PR5A 4IL5A 4G63A 1BG6A 2FSPA 5H70A 1N6RA 4PC6A 2JGDA 5GMOA 4LDAA 3K94A 1MLDA 1EM8B 3K0BA 3MPOA 3O31A 4ARAA 5JRZA 3T0FA 4MJLA 1TIBA 4H0NA 4O0MA 1ZGBA 2ISCA 1Y4ZA 2BEWA 3JCZA 1K7XB 3L06A 4BTLA 1FQKA 1T6NA 1PQ4A 4AO6A 4JD5A 2VDRB 2FVXA 3F9CA 3II6X 4V02A 1DS6A 2CXPA 1M34E 4S1NA 1UDBA 5CA1A 3CVVA 2P1RA 4F2DA 1TVKA 1T0JB 2Y9MB 1XEXA 3L1JA 4NYIR 5IH7A 4X8LA 3CN7A 5EA2A 4GKJB 2J0VA 2REXB 3LKBA 3KUXA 1DG9A 3J81A 2PX0A 5K3CA 1XWFA 4J4TA 4I6JA 3CXRA 2IL1A 3D1VA 2ATEA 1UT5A 2Y2UA 4RD1A 4M22A 4Y2RA 3ZBUA 4BNMA 4F4DA 3M6AA 4PSDA 2Q1TA 3QLVC 4JGBA 4ZI7F 5EWJB 3Q7PA 3ZQ6A 3HNPA 3T1QA 3IV6A 2QGNA 3LHKA 1REQA 1Z13A 2NMVA 3WQBA 4IS3A 1ADYA 3IJRA 4G25A 3EAFA 4WK4B 3S29A 4EJSA 4CIYA 4WEQA 1SIOA 2YQ4A 4G26A 1CUFA 4XFJA 2DY0A 1X8XA 2PSEA 2WUFA 3VX4A 3NDBB 1BH2A 1NHGA 5CAEA 3SIXA 3GVXA 2F8TA 2C2KA 4DMCA 2FU5C 3W90A 4F38A 5JFOA 2F9LA 3ZJUA 3GG2A 1SHUX 1G6OA 2LR0A 5AHWA 5D7BA 4AZTA 2DY1A 2QYTA 3H8VA 3LCUA 2XGOA 3AZQA 4G01B 3FUUA 4IO1A 4E2XA 4YCAA 5FTJA 4YBZA 5JVDB 2QTWB 3W3AA 4MW0A 1E2PA 3DTYA 4ZRMA 3MT7A 2P4EA 1KKMA 2WAXA 3PDHA 5FXMA 4MZXA 4BKQA 4XYLA 2EJCA 1QGZA 1YKFA 4FFBB 4NABA 1HL7A 4GOXA 5KU7A 1WD5A 4F3CA 3C7DB 3PB3A 1KTIA 2QD2A 2QRJA 2JAOA 1R0KA 2EGHA 2GZDA 4B6RA 3WK7A 1UFQA 3OQIA 4R68A 4YQYA 2WHEA 3S2GA 3WLQA 2R11A 3F2VA 4UU7A 1ADCA 2VC2B 5BYBA 2IU4A 1YZQA 2H1VA 4M1QA 2H08A 2ZIFA 4V0KA 3WGQA 3B1YA 3OTOB 2GCOB 3Q3HA 4JI1B 3E8XA 4DC9A 4DNQA 1GZ7A 1RLOA 1XLTC 2XX3A 2QM7A 2B30A 1RXWA 5L4SA 1HYGA 2ZRLA 3PFFA 5CM8B 1QTIA 3H7IA 2CFCA 4HLUC 4QUAA 3M5WA 3A10A 3V4PB 1AUPA 1XVUA 2IXAA 4MQLA 4QPCA 3AO0B 1SPBS 4DUGD 3E35A 1KWKA 1F3LA 3DO5A 5DB4A 4BKUA 2BGUA 3KJNA 1Y89A 1T0HB 1TFRA 1YS4A 2PVSA 4MYSA 4LZWA 1ELOA 1M34A 2FPRA 3K3PA 4OGLA 4BVKA 4W99A 1PX0A 1X74A 3TNDA 3NHZA 1NN5A 3LNTA 3CMMA 2X8AA 1CIJA 2O0JA 1G7RA 3AEQA 4A0QA 4QDJA 1KI4A 5IVIA 2VTVA 3U7JA 3THWA 4XJTA 3PCXA 5BV7A 3DHNA 5BY2A 3GRCA 4R1TA 3SHOA 3OOWA 4DQXA 3NTOA 1RRVA 1Y7TA 2XBLA 2JZCA 3G17A 4A6EA 4CI9A 5HRUA 3HSSA 2ROQA 2VYCA 5KVSA 2HIAA 2ZTVA 5AYVA 3H5LA 4NYMR 1HY3A 1OOEA 3BMNB 5DI3B 1DZIA 4XWTA 1XCLA 3IYLW 4YH1A 4DRYA 4BFZA 1JEQB 2VWPA 5IVPA 2B3DA 2G70A 1YKSA 2B78A 4L27A 1XOIA 4RCZA 1SCUA 2ZVPX 4AZSA 2BP7B 3KLPX 4PZYA 4CU5A 1T6ZA 1Y1SA 3C3EA 2HV8A 2JD0A 4I66A 5HRCA 2XCRB 1JUDA 4LHZA 1J2UA 2BGNA 3ZZ1A 4HWSA 3KFXA 2JLXA 1NULA 2GYVA 1U6JA 2GOYA 1NUPA 5DP2A 5CD9A 3TECE 1KVRA 3O4RA 1CEEA 1JJVA 2VH5R 4G4SO 1H0KA 3NUZA 4G4GA 4JZYA 1T9CA 4UBLA 1W85B 2G40A 3C16C 1OX6A 1L1EA 4CIVA 1I0LA 2Z2ZA 3GLFE 2J5RA 4L5YA 3VR4H 2QY9A 1AGPA 1QWOA 3FB4A 4JVNA 4GW3A 4JEUA 1F4VA 1NSFA 3NYQA 1Z08A 1MABB 2GD1O 4MV4A 4PYLA 4WINA 3D8TA 3WKDA 3BSFA 4BUCA 3CWQA 3O1IC 5BV2P 4WSOA 3F5FA 4R9SA 1GQRA 5A1JA 3KXIA 1U0EA 4EO7A 4UOEA 1O0BA 1N34B 1C5KA 1O95C 3G0DA 4LY0A 4FCTA 5KTOA 4IHJF 1WZEA 4LNAA 2R48A 2HBQA 5BV8A 4I7EA 3TR0A 3W2FA 3AW9A 3KT6A 1DIBA 1V35A 3AHEA 5DX0A 4M1MA 4QBFA 3Q12A 1IOVA 3ZVNA 4G37A 3I9NA 3TPCA 1HDCA 2C2BA 3EVCA 1U2PA 1ZDMA 3PUIA 4UBMA 3WP0A 1TKRA 1MQAA 2Z1DA 5C2JB 4IG4A 1KY5A 1SC1A 3AWDA 3L0IB 5LA6B 1SK9A 4GSYA 5KNDA 1U0NA 1QM5A 4CZ2A 1MOZA 5F12A 3KBBA 2V1UA 3LP5A 4L9WA 4WZBE 1BO6A 1MU0A 2B4KA 3AB3A 3DULA 2OYCA 3DWGA 4G0WA 2OGSA 4G84A 3U60B 3HJGA 3K0AA 3V4ZA 3AERA 3DZGA 1Z8FA 3KWLA 4WJKB 4Y0VA 4P34A 3N8HA 3TW8A 1CP3A 2GETA 2ZRIA 4EL5A 3R23A 4O4LA 3BAZA 3G7SA 5BV0A 2XMSA 1I3LA 2ZBGA 2GDJA 3PLRA 3ZE0B 1Q1ZA 3L82B 3JPYA 2CNWA 1YUBA 5H59A 2UZ0A 1AG9A 1NXQA 2Q3JA 4QWMA 4YIKA 5JEDA 1AQUA 1V3QE 3OJWA 5G53C 3UUFA 5ALPA 4PVCA 3JVDA 4FR0A 2PQ6A 4YBRA 5FYQA 2EBUA 4G5YA 1F2TA 3H5IA 1T25A 3K8OE 1CUSA 2I6XA 1SFRA 3BEDA 2WKQA 2WKPA 3L4SO 4G09A 4QTYA 2W22A 4JI0B 2BSQA 1C1XB 2MINB 4EYSA 5JNVA 1MIHA 1T2AA 3PQ7A 4IH4A 3GLFA 1WAMA 3D0QA 3MJRA 1F2DA 1T3HA 2PUGA 3FYCA 4ARUA 5C7YA 3I5UA 3W7AA 5KQRA 2KS6A 3KKMA 4JBNA 3R76A 1YOVA 2QE7A 2CFSA 5ADUS 1Y4SA 2QE6A 2AOTB 3FI0A 3OQHA 4YJDA 3TXYA 4QOEA 1K5HA 1FRVA 2AK2A 3QFRA 5DYNA 4H7EA 2EFGA 4MUHA 4PPQA 5COBA 3S1AB 2IW1A 4RK6A 4W5RA 2FGKA 2ID9A 1XZIA 4NVRA 3SSAA 2D3WA 4Q7EA 1NQTA 2EKLA 3AU8A 4ZO8A 1FUYB 2D0IA 2YY6A 3MWLA 3MJEA 3Q7TA 4NXNB 3VJRA 1K7CA 3G2HA 3DDOA 1MO4A 2C77A 4JH0A 4DUGA 5JANA 3Q8KA 3HHEA 5AIBA 3CT6A 3DQPA 1LDNA 4LJ4A 1XRJA 5CK4A 3D4NA 3D8BA 5TEWA 4LNHA 4UCXA 3MRTA 4NMLA 3P2YA 1G64A 1LH0A 4NJEA 3SR3A 3M2TA 2WQ6A 3FNGA 1JJ7A 2DT8A 3AIIA 1CIVA 3QE2A 4EA7A 1LWOA 2NPFA 1TUIA 1Z6XA 1N2ZA 1RQPA 4JLOA 3VUFA 3WS7A 4JJ7A 4R1UA 5D00A 4DM7A 2MSDB 2YICA 2ASVA 4QG7A 1DCMA 2D7JA 4WZBA 3W8EA 4TLDA 1RHQA 4BATA 1BCRA 1I80A 4RM2A 1SU4A 4NU8X 5FOUA 1UMBA 1PZNA 2QG9A 1IBSA 3AGQA 3QGMA 4KKVA 3SSNA 5GWXA 4TSKA 5EXPA 3RUEA 1UEIA 2DHCA 4Y1GA 3OJLA 3VBCA 2ZRHA 5AM4A 1P5FA 4N0MA 5B53A 1ZI6A 4OGWA 5CVUA 1UINA 2BGTA 3WGHA 4HAVA 4RNCA 1HEUA 3AEUB 5DHSA 2E5FA 2NUTA 3RT9A 5HUJA 1ZMXA 1DUVG 1QS0B 1EKXA 2FSHA 2VATA 4L4ZA 4NOMA 1WKVA 2EL9A 1BXRA 2OO7A 4PQFA 5F64A 3FNBA 3HKBA 4HLNA 3FPJA 5JROA 2XB2A 3AMVA 3VJMA 3HVJA 5CH5A 3IIMA 1NNLA 2DGDA 3RVPA 2XA9A 1DFIA 4FILA 4GOJA 3V8PA 4ARBA 4OYHA 2FZKA 3ZY5A 1QIMA 1OIWA 3EGDB 1O6CA 3G0CA 1WMAA 4YC7A 5FBVB 2GUWA 2P7HA 2O19A 4GU5A 1H6DA 2QRMA 5AKJA 2VSNA 1SHLA 2AG8A 3IQEA 3K5WA 3SKYA 2M1XA 421PA 3VO2A 4EJ2A 3AF4A 2EBHX 5FRDA 2PCLA 4A23A 4F0JA 1L3CA 1YV9A 4OJKA 4XVQA 2IS6A 1JHZA 1TLLA 1T10A 3WTBA 2VDLB 5KWSA 3CVWA 1P1KA 1M2OB 2JFVA 4H3SA 1ZUIA 3AETA 3H9EO 3GCWA 4UMDA 2RHJA 1RMTA 3CX3A 1Z0AA 3FVTA 3BMXA 3HJUA 2IUEA 2RIRA 1RCTE 3WOHA 4CUJA 1HNXB 2XWJI 3R44A 1JIIA 4QOFA 2EWMA 2HMSA 3FCXA 1JSCA 2BD0A 3SYRA 3ODPA 1Y0BA 2WM2A 4L5BA 2X0DA 3RFVA 5C8VA 5LNK6 2R66A 4IJUA 2EJWA 3LX5A 8ADHA 4H7DA 3TJRA 3F3SA 3MWGA 1MH9A 1QRSA 3QYFA 1UC5B 3C85A 4DOMA 4I3HA 1OA0A 2FQYA 1TU0A 3E8SA 1SUAA 3O9MA 3PNBA 2J3EA 4HVTA 3WRVA 3HYNA 1KI7A 4ZIRA 16PKA 1YB7A 2V4UA 5IAOA 2QRKA 3EGXA 4X1OA 5DM0A 2QI9C 3A05A 4KDEA 5D01A 3E23A 4W5HA 1P4AA 3TLKA 4UBIA 1ESDA 5KQPA 1GSAA 3GLHE 1DTEA 1VLZA 3FE2A 4CIXA 2FG7C 2V9CA 5REQB 4MW7A 3F46A 4NG4A 1JIVA 4EW2A 1BWSA 5LUAA 2OO5A 4UUMA 5D3MB 4L8GA 4HZUA 5BYKA 3Q85A 4RELA 4BVJA 1T5HX 3M81A 5TPZD 1YBVA 2PGOA 2R1VB 3AZOA 3DPIA 3G8BA 1GQ2A 1IPHA 2IVZA 4FOTA 2O6HA 4WN9B 3MJTA 3UTDA 1W581 2AKAB 4DR5B 1BJRE 2VSFA 3AP1A 4DZRA 4C0QC 1TTQB 2RC6A 2JGMA 1RE1A 4U63A 2HWKA 3CNOA 3LUDA 2G4LA 5DLYA 5IC5A 5CT4A 1S2MA 3AM5A 3WIVA 3R6TA 3H2ZA 1X7HA 4K6OA 5EHGA 4D92A 2ECKA 4OK5A 4FJ1A 4CFSA 4I6EA 4YJFB 1S02A 1UJ4A 2UDPA 3IBSA 4Q9KA 5ARCA 2AN4A 4DVGA 3AVYA 1VL1A 1UQRA 3UIEA 1Q20A 1D2CA 3DAOA 3AJRA 1SCKA 3L8CA 4U2CA 5CHEA 4D9EA 3PFKA 1QDLB 1QKJA 3GG9A 3GBVA 1R8YA 5EJ5A 1L4BA 1L5HB 1ZGJA 4FGKA 1WHTB 3RC3A 5I7HA 2WAAA 3MFYA 2C58A 2O2CA 1Z15A 5K2MA 2MMCA 2Q1YA 4R5HA 3CRQA 2OHVA 2FP4A 3PKJA 3PX3A 4MP3A 4W8GA 4WIAA 3WJAA 4A03A 4CTMA 1NT4A 1RLTA 2WM9B 3FLEA 3ISVA 3RRMA 1S9HA 2O7SA 1QZUA 1W76A 4UTOA 3QNMA 1K6JA 3AB7A 4IGAA 2A7XA 3RIGA 4LGYA 5BV1A 5FV4A 5JISA 2WV7A 2AEJA 4J03A 2CLKB 1NUSA 3EMDA 3ODGA 4HYTA 3K8ZA 3AM3A 2FMTA 4GRDA 2ZYUX 3O4JA 3VV3A 4OXIA 4RSHA 5FUMA 3ERCA 1ZZGA 3G1TA 1SUEA 5EUQB 4RLSA 5FL3A 2DG2A 5JARA 1P17A 4A6PA 4EUEA 4F91B 3NRBA 1XCMA 4QTXA 3IXMA 4S05A 3K0CA 3H17A 5G0SA 1HUQA 4Q1CA 1HQDA 2NZWA 3GNTA 4RA6B 4UOZA 1THGA 1UXKA 4RCYA 1IJBA 3MTJA 1V8ZA 3QXCA 2FP3A 2IIPA 1JDBC 1YU9A 1YJXA 2O23A 2GYUA 3AUJB 3GLHA 1VC2A 1GYPA 2LP4Y 4IZ6A 4G0ZA 5GY7A 2QAGA 1U4SA 3JASA 2QTAA 3OFNA 4AG6A 4BBJA 2ZIGA 1R3DA 1TK3A 2B36A 1DAGA 2KHZA 4NNJA 2VJDA 3KSDO 4ES6A 5KQGA 2GTPA 4N0QA 1EINA 1GU0A 3KQLA 2RDMA 4AF7A 5EG5A 2IYRA 4ZT2A 3O8LA 2AC7A 4J2HA 2I6UA 3N6VA 3T5MA 4QU8A 1FFHA 2BFBB 4B34A 3ABRB 2JFXA 1MMFB 5FLXA 3KG2A 1XYYA 4IAOA 5AKEA 4Z3DA 1OZHA 2HJHA 3KXDA 1E9FA 2IOHA 4IDQA 3HRHA 2BGRA 3CJRA 1Y7PA 4GI1A 3Q98A 4QUKA 4Q9DA 2R1TA 4UE3S 2PYZA 3OY7A 2H4ZA 1JAYA 1G1AA 1U6KA 1BXKA 1LDGA 3D2CA 4LDJA 3RLIA 4GVPA 4M9UA 1IZ8A 1I4DD 4BO6A 1PFKA 1UOQA 3N3BC 4PZ0A 3ZHUA 4N3CA 4ZEWA 2HA0A 4KRGA 4RTLA 1P2GA 4GE3A 2CB0A 1YCDA 4IMJB 2EKBA 2VT6A 4JSYA 4NZZA 2WWRA 1LPPA 3R3UA 3DHWC 1KBOA 1EZZA 4J1TC 1AU9A 5JE8A 5IN4A 1XQVA 4XLZA 4JR2A 1IL0A 2ZB4A 3NP9A 1GT6A 1RLUA 4OHXA 1NMYA 5KYWB 4I36A 2PL1A 1WMBA 4D44A 4AJ4A 1ZG3A 1GG8A 3O3MB 2V7GA 4L73A 5EJFA 2ZDQA 2XUHA 4UHCA 3RWBA 1T5SA 4BPRA 1KRXA 4KE8A 4M89A 2ZJZA 3V33A 4JBXA 4FD3A 3QA3E 4YEDA 2V6GA 5L95A 2JHGA 2Y1OA 4UE2A 5D1NA 5ICFA 1NT2A 1E92A 4P9NA 3M0EA 3STHA 2ZZMA 3RU9A 4GDMA 3SZLA 1UAYA 2VQ3A 1QU3A 4CQMB 1U2SA 3JVEA 1P7ZA 3GGDA 5KOHB 1MW8X 2X2OA 2DPMA 1EK5A 1E62A 3RRNA 4FJ0A 3W9SA 2PLNA 3L7CA 1G5FA 2QZ4A 1KH2A 3F8TA 4XUCA 1L5KA 5HE8A 3ETNA 5JH7B 2ZYDA 2WWWA 3IKLA 2AG5A 2ACVA 4AP9A 3QWHA 4YRGA 3GVCA 4HX2A 2Y05A 2NZXA 4MR9A 4Q39A 5C5CA 3B3QA 2HHJA 2PSFA 3SZRA 3UMSA 3AR4A 4Z1MA 3UJ9A 2PK3A 4BNVA 4ZYUA 2QUKA 3JAWA 1X7WB 3TR5A 1XRQA 4GLJA 1ZZEA 5HF5A 3RH0A 2SBTA 4W63A 5MN5A 1J0XO 1L7MA 1XVIA 2JPDA 1M67A 4V1CB 3LCVB 2CHQA 3IEKA 4F3KA 4KP7A 1T36B 2PTGA 3TQTA 3WR5A 4X1KA 1TT5A 2RGCA 1G1MA 2PBZA 2P6RA 4YY3B 3GT7A 5LBIA 5GIOE 1OROA 1RYZA 1TIPA 2Q0HA 5E8RA 1C41A 1F0KA 2A5DA 1GPMA 1YTLA 5L3ZA 1W93A 4FFLA 3H1FA 1G3MA 4CQLB 4DG5A 1YULA 2XEXA 1Y37A 5KPDA 1DAPA 4EGJA 5F5NA 4N03A 3BFPA 5I4KA 3PJDA 2FK8A 2JATA 2VDUE 3DONA 3QP9A 1U0BB 2V59A 2J32A 3NM5A 4FZ3A 4RHCA 4EVIA 4D96A 3LBYA 5G3YA 1KYTA 1K5GA 2W2MA 4YECA 4OYYA 5LBUA 1GGMA 3LUAA 3M5CA 3NVDA 2G72A 4FSXA 2NO0A 3IV9A 4OQFA 3EXFA 1CJKC 1K4YA 5DMHA 4DY6A 3UTCA 2XE8A 3UJNA 2OFPA 3STUA 3MTGA 4EB3A 2VCYA 1MIOB 1EDBA 5ALRA 5SZHB 1LRKA 4IKPA 1T2UA 5F2OA 3UFXA 5C9ZA 4NCAA 5K51A 3RANA 4FZJA 1T6XA 1YRYE 3IE1A 1PS9A 3DBOB 4RMIA 1THMA 4MAMA 5DGCA 3GUUA 3DUWA 3FWHA 3OM0A 4QUDA 3WLKX 2RMKA 1Z5ZA 4PZ9A 4F4JA 2ZRMA 5C4MA 1N2JA 1Z2EA 4TZTA 1XQWA 2ENWA 2ZRBA 5DXFA 1U80A 4IFTA 4IG9A 5DNDA 3UPDA 2ZS9A 2GGSA 2NTEA 2WSBA 3HUEA 1XXLA 3KQTA 1A5ZA 4GPAA 5A7GA 3ZS8A 1I51A 5J4YA 4IQ4A 3V8NA 1ORVA 3EAGA 3EZ7A 2BTQA 4XGRA 3VMMA 3CZMA 3T15A 5B64A 5HKBA 2PSDA 4DR4B 1FDVA 5BSMA 4UTPA 1X2EA 2JLCA 2XPCA 1QOZA 2ZATA 4ND8B 3WDSA 4XR9A 1LJUA 3ZCXA 4R05A 2AVDA 4TTRA 3URMA 3BTSA 3U7GA 3QOYA 2HIGA 3DE1X 4L4RA 1GRRA 4ID3A 1EVJA 1OXUA 4IV8A 5LZ7A 1MXHA 1QE3A 1QYVA 2Z57A 4WK2B 5CDHA 3KTOA 5HW0A 1KEPA 3T99A 4HNAA 1BSVA 2OCGA 3T38A 5C51B 5D6OA 1ZVQA 1AM4D 5EKXA 4V39A 3RLFA 2Y1GA 4MAFA 5FBWB 1ABEA 1L4GA 2RGGA 1JF8A 4RSRA 3SQDA 4JA0A 3VR4A 3WB1A 1UJBA 1KTVA 1CEXA 3BRWA 5DYGA 2VZ0A 5LKRA 4W5TA 2GRJA 1OVGA 3LV8A 4HZGA 2LD4A 5K0TA 3SG0A 4I55A 5DLDA 3L8GA 4BKMA 2C9YA 3D7MA 4E6PA 3AKDA 3I28A 4KXFB 3K09A 5E6SB 3MGCA 4CG1A 4KPEC 1A97A 4OFWA 4GKAA 2QVCA 3FIJA 4PO1A 1B6SA 3SBEA 4LA4A 4CCYB 4EQ6A 4DDUA 1C2TA 1LUAA 4D0SA 5JY1A 1VI2A 1NF2A 1MT0A 3R0VA 3NFRA 4UVDA 3WOVA 2XJ4A 2VNIA 3DBIA 3AEKA 3EQ7A 5FB3A 1CLEA 4B81A 4BNLA 1LDBA 1KYQA 2ZI4A 1DMSA 1QRUA 1U11A 1UPBA 2R96A 4WY8A 2GYWA 2YDXA 2WSMA 1ZRMA 4RPGA 1CQXA 1ZVVA 4OX9Y 4LYDA 3UW3A 5T6MA 1VP9A 1R6UA 1VCHA 2DFNA 2HJ9A 3AB8A 3CY6A 4JP8A 4RHTA 2FV8A 3MGAA 4Z0TA 1V3TA 2HJGA 4CV1A 2FEKA 3C3KA 4LSGA 1YR7A 3D3EA 4XWOA 3NB0A 2FN8A 5EPOA 2W6ID 4Y7CA 2NU6A 1T1SA 4UCFA 1YVRA 1PUJA 3I92A 2WZCA 3DHYA 3JWPA 4NV3A 3PEVA 4MIKA 2YS6A 4OB7A 2BISA 5IUKC 1RT9A 2VDJA 1SU6A 1LCIA 2HREA 2YV2A 1JDVA 3TTTA 1PR0A 4WA7A 3TOZA 3B1VA 1W0JA 2QI9F 3FMOB 2I2AA 1YE3A 5KJ6A 3OFSA 3N5KA 1XEAA 4HYQA 4B5LA 5G0VA 4TLCA 4FXPA 1TZCA 4Y9UA 4CDRA 3SXUA 3AVXA 1KAQA 3PGKA 1W5SA 4QPZA 4B4DA 1VLLA 2ZWIA 4G0MA 5A4DA 3OZDA 1TKCA 3S27A 1YBHA 3KJEA 3B1KA 1OAOA 1OX4A 3QNUA 1IVSA 4TKUA 2HSDA 3V8MA 4XRGA 1F38A 5DNEA 5AJVB 3B3JA 5F9MA 2WJJA 1B0ZA 1WVGA 4GOND 1PEAA 2ZFUA 3A9RA 2CC2A 3TBKA 3AF5A 3FZNA 1WETA 2I3AA 2FSUA 3EGWA 4XDYA 4ZXFA 2BGJA 2JFGA 2D2VA 4W5JA 2IEDA 3BD6A 4ZN6A 3VZSA 2YV5A 3FHLA 3R6WA 3I04M 2Z5LA 1JDJA 1YB4A 4FDUA 2GLUA 1NX6A 1SA0B 6AT1A 2FUEA 3UAWA 3RTDA 4R9RA 1W88A 4ZAVA