1ZNXA

Crystal structure of mycobacterium tuberculosis guanylate kinase in complex with gmp
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
182
structure length
182
Chain Sequence
VGRVVVLSGPSAVGKSTVVRCLRERIPNLHFSVSATTRAPRPGEVDGVDYHFIDPTRFQQLIDQGELLEWAEIHGGLHRSGTLAQPVRAAAATGVPVLIEVDLAGARAIKKTMPEAVTVFLAPPSWQDLQARLIGRGTETADVIQRRLDTARIELAAQGDFDKVVVNRRLESACAELVSLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Guanylate kinase
publication title Unique GMP-binding site in Mycobacterium tuberculosis guanosine monophosphate kinase
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 53
structure length 182
sequence length 182
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2005-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 1znxA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1znxA01
4YMWA 4FI3C 5KTYA 1BS1A 3EPJA 4TT3D 2C9OA 3CWQA 1G17A 4JMPA 2L0XA 4QG7A 5EE3A 4Z1MA 3DM9B 3TW8B 1XTIA 3VU9A 1SXJA 1KI6B 3FMOB 4FW9A 1YZKA 2CDNA 1CIPA 2OAP1 4V0KA 1UDXA 2C03A 2H92A 2B92A 2IEZA 1N5IA 2A30A 4IDHA 1TUIA 4IEIA 4XSGA 3CRMA 2JLZA 5EUMA 5FR2A 4DLXA 1S2MA 3V9PA 3ZD7A 4O25A 4B32A 2DFLA 1E2KA 3GLHB 3IO5A 1NVWQ 5C18A 4LJ9A 2PL3A 2HLDD 2P3SA 2YJTD 3Q5DA 4GBMA 3RABA 2BBSA 3THXB 4BLQA 1GITA 1TQ4A 2ZJ5A 5GJCA 5KSPA 2GA8A 3DHWC 3IPXA 2QPTA 2BJWA 2GKSA 5AWFC 4CEJA 4Q4JA 1EWQA 3MGCA 4BFVA 5FPKA 4B75A 1G7SA 5AUOB 3ZVRA 1WP9A 2R44A 1GZSA 2R6FA 1EG7A 2P2LA 4QGHA 4LYFA 3PUYA 2WJHA 4FXPA 1J2JA 1Q22A 4CVNA 2WWWA 1M7BA 2C77A 1ZUIA 1F2UA 4ACAA 1GG2A 2V4ZA 4KFRA 3W8RA 4TLCA 4DWJA 4KITB 4E03A 3TSZA 1CP2A 1N6RA 2YC2C 4URUR 4HAZA 1EFRD 2GJKA 3SJBA 4BQSA 5DI9A 1Z6TA 4EAQA 2V7QA 1TU4A 2F55A 4KXFB 2W0SA 2FF7A 2XZPA 2KSQA 4AY2A 3PR1A 2JIZA 1ZNWA 4HZIA 1EGAA 4B44A 3LW7A 2WSMA 3VMFA 2GESA 4LHYA 2H17A 4NL4H 2W6JD 3TGPA 1JPJA 2XGJA 2K5UA 4RD6A 1G6HA 2GCOB 4HEJA 1E9CA 4HAUA 4BUJA 2IEYA 1OIVA 4DCSA 4KCGA 2YWGA 1NMZA 1E79A 1DTSA 3BE4A 4IFBA 4UJ5A 4DCUA 1XRJA 1R10A 1GNQA 2VP0A 2HJGA 4OQXA 1O87A 3RS0A 3AVTA 1WMSA 2ODWA 4D4MA 3PEYA 3RVBA 1Q20A 4LPSA 1YR6A 3K09A 1G6OA 2I3BA 2KI5A 5DI3B 2R9VA 1TAGA 3SYKA 3W6NA 2XZOA 1OH6A 3ADBA 2OFXA 3IIJA 2GZHA 1AIPA 2QG6A 4V0LA 4PO8A 2NPFA 1ZIPA 2LKCA 3LH5A 2JA1A 2WZQA 4M1YA 1UBEA 3K09C 4HI0E 3I61A 2OO7A 4JL8A 1M8PA 4A82A 3H86A 1TL7C 1CS4C 1XPOA 3VNUA 4RKFA 2OXCA 1MABA 2J3EA 2OV2A 3ADCA 1MRNA 2WWIA 3PENA 1XFAA 1LW7A 4BFUA 5HKKA 1VIYA 1GILA 2IF2A 3EX7C 4KLZA 2R8RA 1YHNA 3VHXA 4PC1A 2ZS7A 4F92B 3K9HA 1HE8B 2C5LA 3NTUA 1XD2B 2VSOA 4RZ3A 5EXTA 2CHGA 2WPDA 3KXKA 2VH5R 3ZLJA 5CYPA 4HDQB 4RZUA 2P65A 4S2EA 1Z6YA 5DGXA 5GJBA 1G3UA 4D80A 3QUSA 3ONWA 1ZU5A 1OKKD 2OLJA 4YMTA 2JLVA 3OFNA 5E7MA 2QTVB 2VLIA 4Q02A 2Z6VA 1H8EA 1ZD1A 4JS0A 2YHSA 2WV9A 4FCWA 1S3SA 1WE2A 4ERNA 4F7WA 1Q0UA 2EYQA 1NVXQ 2A2ZA 2O0JA 1YZLA 3DKPA 2J9RA 2V55B 5FPTA 4ZKEA 5BN3A 1M6NA 2ZJAA 4PX9A 4KYUA 1E4VA 3HU2A 1QG4A 4B3FX 3R9IA 2DHRA 5IDVA 1T4GA 1VDZA 1R6BX 2GVDC 2A5GA 1H8HA 4C7OB 3GLIE 3WYAA 2HJVA 1IJFA 5DE3A 1KAGA 2WWHA 3LBHA 1N6NA 3BIFA 4LYJA 1U2RA 1COWD 1KYIA 1CEEA 1G4UR 4Q19A 1U0HC 1IN6A 3ICQB 4TYYA 1OJLA 4IVRA 1HYQA 1YVDA 4P3YA 4PZLA 5FTNA 1KDPA 3SHFA 4IVPA 1XXHB 2P5SA 3U44A 4D0NA 3DOEA 1DS6A 3B13B 5HZHA 1YKSA 4BZQA 1A2BA 2A78A 3K0AA 1Q1QA 3CWZA 5DN6D 5JI3E 4XSHA 2Q3FA 2IS6A 2I4IA 1J90A 2G1JA 4NCJA 1ZCBA 4PZYA 3CZPA 3TKLA 4HUQB 4ON9A 4RD1A 1Q1EA 4Q1EA 2ZANA 1UKEA 5CLQA 1ZUHA 1N25A 5B57C 2XXAB 2J87A 4RZ2A 3NBZC 3B1YA 5D3MB 2PZEA 5BN4A 4OQLA 4PC3A 2FEMA 1R0YA 2NQ2C 1G7RA 1FUKA 3LW8A 4B33A 2C04A 1QG2A 2Q6TA 4RFSA 5C4MA 2ZJ2A 3EWSA 1W46A 2GJ8A 3VR4A 2GDJA 2WWGA 3K70C 2ZU0C 1E2IA 4Q9IA 2A5YB 1NY5A 4MKGA 2JLXA 1XF9A 1X6VA 2DCUA 2RGCA 4MKHA 5LD2B 4ZV4A 5FBLB 3L0OA 5LB4A 4Q1AA 1M7GA 3X1XA 1J7KA 1N5JA 4QGGA 1SVSA 5CJPA 2ZXUA 3I73A 1NRJB 1VG0B 1II8A 2ZRBA 2HXSA 5JCZA 2GJSA 2Z0MA 2JLQA 5KDLA 2D74A 1ZVQA 5KOYA 5FL7A 4CIDA 2ZM5A 2ZR0A 3DMDA 2X2EA 3PQCA 3V4FA 3L2OB 1N5KA 2QORA 2KB0A 4GDFA 1B23P 3GLGA 1IY1A 2FSGA 2O8FB 1GRQA 1S96A 421PA 1YRAA 3Q72A 1HT2E 1KMHA 4JT4A 3R9XA 1N2CE 2ZJ8A 3H4MA 5ANRB 5K8TA 1ZC4A 3GD7A 3L43A 3SEAA 2PJZA 2HT1A 1S4QA 1Z2AA 1OSNA 2GF9A 2NGRA 2W83A 3W5JA 3R7WA 1VMAA 5L3QB 1Q3TA 4Q7KA 2O8CB 2OLKA 1JALA 1BO6A 2ZE8A 5KPJA 3VFDA 2XTZA 3ZVNA 2ZS8A 3IBYA 2GEDA 1W4CA 1AQYA 4UJ3A 3ZQ6A 1E2GA 4L16A 4A92A 1MO4A 1ZM4A 2JDID 1WF3A 4E09A 1E1QA 2F3RA 1MRSA 2BM0A 2VO1A 5FUXA 4FIDA 2O5VA 5B30A 4NCKA 2UZIR 1TQ2A 2GWHA 1NMXA 2BCJQ 2FSHA 4LHVA 1YZNA 2VYFA 2W6IA 1WBBA 2JATA 3I1FA 3OEHD 2OAQ1 5FI0B 5J4VA 4ZKDA 4ZIRA 3L8ZA 3MLEA 5IHPA 3DKVA 4PPQA 2ERYA 4Q9HA 3A37A 4EJSC 3W34A 1DAMA 4LJ8A 3CKLA 3A1WA 4MDFA 4I1OA 4WZBE 4JLVA 2JJ8A 2REOA 4A0GA 2DB3A 2DFTA 1G8GA 2FSFA 3PV0A 2W0MA 2F1HA 3Q7PA 2A7QA 5SZHB 2ODBA 2GXAA 2W00A 5BQ5A 1Y63A 2UVQA 2IYLD 2YWEA 3TE6A 3GQBA 3HDTA 1G8HA 2ZTSA 1UKYA 3QF4A 3VX3A 3CUEF 2BM1A 4QHTA 2J0QA 2J59A 3QG1A 1S8FA 3AVUA 1EK0A 1C1YA 4MRSA 3T1OA 2BMJA 1GL7A 1T0JB 2O0KA 3DPUA 2RHDA 4JKIA 4YMVA 4BE7B 3KJGA 2IW3A 1F3OA 2IS4A 4P33A 2HCJB 3KUDA 3GP8A 4C0LA 2W2VA 4DEXA 4K8OA 2D7DA 3M1IA 1E2MA 1E9BA 1XMIA 4YXWA 1KI8A 3O8RA 2SHKA 1P7CA 3BOSA 4JLAA 3BFXA 3GLHE 1F60A 3GPLA 3PIRA 2UKDA 1E2HA 1I4LD 1D8TA 3U7EB 1R0XA 2C78A 1SVMA 4F91B 3RS2A 3GEEA 3QQ5A 1XMVA 4L5BA 4TMTA 5JEEA 3I32A 2XZLA 2KWIA 2GCPA 4B3BA 4QRHA 3RS4A 3TW4A 5JEDA 3BH7A 3U7HB 3K0FB 4Q7MB 4C0AC 2GNOA 4JIMA 4Q4AA 3UPUA 1KO5A 3F5FA 2D06A 2DR3A 3QNUA 4DLUA 3KJIA 4GOJA 4DLRA 1FUUA 1E4YA 1ESNA 4G5QA 5B58C 1IBRA 4DT1B 1HTWA 1U9IC 2NTYC 2AKYA 4HLQB 5G41A 3U3KA 4A8JC 4BFYA 1N6IA 3CH4B 2QMOA 2BJVA 5TB5A 1HUQA 3KQLA 1T91A 2FH5B 1IXSB 4YMUA 1KK1A 3CPJB 1N6LA 3I5XA 1F2TB 4TL8A 4AI6A 4N0DA 1DAGA 821PA 3BS4A 4DXAA 1VG1A 3BD9A 3E2IA 3A36A 1AA9A 3GJXC 3QPVA 5EJEA 3LQRA 1W5SA 1ZM7A 1Z06A 1S1MA 1JECA 3PEUA 2FJUA 4PHHA 2XNDD 3U6KA 1XEXB 3QKRB 4D25A 3ZD6A 1UBCA 4DSNA 4GPTA 3CNLA 3GJ0A 1OXUA 2V8OA 3LX5A 1JAHA 4QHYA 5IT5A 3LDAA 3QI2A 3G82C 3QXSA 3S1AB 1NG9A 1XTJA 5SZKB 3RS7A 4URWR 3ZZTA 2PCJA 4UXHA 3OAAA 4NYIQ 3EPKA 5FTMA 3B1VA 2G9NA 3J81k 1P6XA 2RGBA 2ZREA 4U5XA 1U8AA 4IXNA 1FFHA 3MG9A 4TYPA 1G8FA 1OHHD 1GUAA 1R7RA 2H1LA 3X1WA 4HZUB 5FOUA 1E2DA 5J4KA 1GL9B 3SNHA 3AVXA 4X8LA 4W9MC 3NXSA 3BH0A 4F4IA 2IHYA 5CDFE 1CRPA 1G3RA 1NN0A 4PPFA 3B1ZA 2QBYB 4EQ6B 4UKDA 2NZ8A 3T5GA 1F5NA 3KFVA 2PH1A 4NCNA 2O8EB 1CF4A 3U3OA 4C0JA 1N0VC 4TWZA 3WRYC 4UNNA 5JJLA 2JJ1D 3U61B 2REBA 2VPPA 1W0JA 3UATA 4MYHA 4TMVA 3K0CC 3PUVA 1JBKA 1ODFA 2GCNA 2CL0X 1SXJB 5G53C 2PMKA 1LVGA 2BEJA 3RRZA 2VRWA 2J0UA 1ZNXA 1GP2A 3EZ6A 1G3IA 2OBLA 3WBJA 4LV6A 1PLKA 2PZGA 3C4JA 3AF1A 4JVNA 4XIGS 3GFOA 4TMXA 1GFIA 2GTPA 1PJRA 3VR5A 5JECA 4UQOA 1LV7A 2XSZA 3KJEA 2CE2X 3OE7A 4C9BA 4A36A 5HE9A 2YWHA 1Z22A 4TQ9A 5EP3A 1L2TA 2ZIAA 3FMPB 2I1QA 1IY2A 2X8AA 2IHBA 2OZEA 1TF5A 4Q4JB 2IYYA 3NDBB 1Y3AA 4PAQA 4Q9KA 1EFHA 3BBPA 4M8NE 4D81A 1MH1A 3IO3A 3V00A 4A6XA 4PAMA 4AYXA 4NH0A 4U00A 1XBTA 1U81A 2JLYA 2O8BA 4WW0A 1GWNA 3CNNA 1NMYA 3WMGA 1F48A 4NCIA 1Z0FA 2QGZA 3LAWA 1GOTA 4LJAA 3FWYA 3W90A 4KODA 4DDWA 4IW3B 1M7HA 1T8UA 3QOFA 4MRPA 2XB4A 4GZMA 1RKBA 4Q9LA 1W0KA 4D4LA 1IN5A 1XP8A 1XXHE 1YZUA 2TMKA 4G01B 1TUEA 2P6NA 1HT1E 1P9WA 4TSFA 1E9SA 2QM8A 3FKSD 5CIQA 4RJLA 1KY2A 3GLFA 1N6HA 2AD1A 4NYIR 1T5IA 3RHFA 4F38A 5KNBA 2B6HA 1PLJA 1PVOA 2J45A 2QUZA 2ZJYA 2E87A 3K9GA 3WP0A 3CX6A 1HV8A 2XNSA 1FX0A 1QHGA 4B47A 2EFDB 4GI7A 3ZS8A 1G5RA 3WYFA 5HPYB 2ZSBA 3MWYW 1TPZA 2QSYA 4OBEA 3EZFA 3FFAA 2JGNA 5EQTA 2RGGA 4AKHA 2DY1A 4EDHA 1ZP6A 2IYVA 5KNCA 2HDNB 1Q21A 1ZD8A 2BKEA 1UBGA 2WWXA 1R8SA 1T9HA 4LZZA 4O3MA 4TTQA 4D0GA 3SYLA 3MUFA 4O2LA 5JRZA 2VHQA 4BFXA 3TAHA 4RD4A 5F3WB 3I4LA 2J0SA 2QE7A 5BYKA 2GJAA 3WNBA 3E5HA 4B43A 1NJFA 1MABB 1FNMA 3CX7A 4P4UA 3W3ZB 3L0SA 1XNJA 3NC1C 1Q3HA 1YRBA 1Q1ZA 2RGDA 3NBXX 2D2FA 3CLVA 1MO3A 1XTQA 2QM7A 4NPHA 5CM8B 3CX8A 2G0TA 2ZRMA 2OCAA 2IBMA 1RC8A 4NONA 3VTKA 4M1KA 4QM6A 3ND9A 2R65A 2GEUA 1L8QA 1N5LA 2WJGA 2QNRA 4C30A 4ARZA 3PVSA 1G291 3KXIA 2AD5A 1SHZA 1IONA 4L15A 1X8JA 1DADA 1W1WA 2WKRA 3CPEA 1DG3A 2DWQA 3B6EA 1NVVQ 4GRAA 1JXOA 2WKPA 2FNAA 2ZSFA 1ETUA 1ELOA 3CPHA 2IUSA 2RH5A 5E7JA 1NLFA 3KQUA 4LK2A 5LB2A 2CHVA 3TUZC 2RGAA 4KI0A 4KHZA 1I2MA 1MKYA 3SU8A 3WHLA 4IOMA 2R62A 1PUJA 4CT4B 3SBEA 2IWHA 2DFKB 4M9XA 3TR5A 5FBVB 1MOZA 5A0FA 4JBXA 1AK2A 1DG1G 3QG5A 4M1OA 5DISB 3MFYA 1NN5A 2JJ2A 2XOKA 2GBLC 1Z63A 1R2QA 3THOA 2IYZA 4B6FA 5C4GB 2J7PA 5BWMA 5ELXA 5FPHA 2OBMA 3BFVA 4Q1DA 1FTSA 3GLFE 2RB4A 3P32A 2GHIA 3GEHA 4WXRA 2B8WA 3ZVMA 1NIPA 4JSTA 4DDUA 4WAUA 3GMTA 5BYJA 3DZDA 3VKHA 4PFSA 1A7JA 1E2FA 4HB3A 4DZZA 1XTKA 1SVLA 3QKSA 2ZU6A 4GMXA 1RFLA 4MRNA 3MWKA 2XITA 3F8TA 2H7VA 2J5XA 4B48A 2P0EA 4CEHA 4QGAA 4JVLA 4LWZA 1P60A 2ODNA 3PJRA 1NN1A 4DB4A 4LJ4A 2VF8A 3LWNA 3QXCA 2OESA 4ZDWA 1YJ5A 2ZQ5A 2REXB 5JS7A 4H9GA 2FGKA 2CCJA 3RAPR 4XWAA 1IJEA 2JLRA 5JS8A 3CF2A 1G18A 4UNSA 1QHYA 3DZ8A 5F9HA 1HQYE 5A4JA 2ZRNA 2D4HA 4LJ7A 5FI1B 3TQCA 2NOAA 4M4SA 3EXAA 1NJGA 4ZDKA 2XX3A 2C95A 4JLKA 1BOFA 1UJ2A 4XD7A 1HY3A 1HH4A 1W36D 2WJIA 5CK4A 1II8B 5J4YA 3E1SA 3KQKA 3IBGA 4TT3A 4MITA 3KTAB 2PLRA 3QVUA 4JZKA 3LO5A 4HDCA 3NHBA 3GLIA 2PLFA 5KU1A 4OHYA 4DDVA 4DLZA 5FTJA 1KSHA 1FQKA 1US8A 3GLGB 4FCVA 3K0SA 1E9FA 2F43A 3UMRA 3OESA 5JJKA 1NVVR 2ZETA 2I1VB 4E22A 4JLMA 4YQFA 2FDCA 2FGJA 2FFHA 1P9RA 3ZGXA 4B3CA 2O8DA 2HLDA 2GEVA 2PMDA 4CZ2A 1TEXA 3R7WB 3R8CA 2Z83A 4OI1A 1OIXA 5J40A 3SHWA 1T8TA 1VPLA 4HLUC 3WMFA 4WIAA 4GMDA 2KBEA 1IOZA 3EG5A 3KKOA 1Z2CA 4FD2A 4P4TA 3BB4A 3QJYA 2IYRA 1OXXK 4URYR 2EU8A 1E99A 4UNPA 5EE9A 1G21E 1Z07A 3GFTA 4Q00A 3IIKA 2JLSA 2IYXA 3VX4A 1EFUA 2G83A 4O0MA 3SN6A 1EFRA 3X1ZA 4MUBA 1W36C 3U2QA 1J70A 3BJIC 2QAGB 3PG5A 4PQYA 3KXLA 4I99A 3TLXA 2BBTA 4CEIA 4FN5A 1JPNA 1U8ZA 4KVGA 4OQMA 4Q9JA 2IYSA 2ZR7A 2W6JA 1CR4A 1E98A 4TQAA 2V6JA 1L7VC 5L3SB 1E32A 1ZBDA 5KDDA 2LKDA 2WPDD 4TMZA 1S1CA 3C5HA 4B35A 2F1IA 4JYBA 5H1YA 4QKQA 3I3SR 2ZRDA 4F4CA 2ZRGA 1SVWA 3WNCA 4DC9A 2EFCB 2PX3A 3NWJA 1RYFA 1KI2A 2GXSA 4B2IA 2QA5A 4BPBA 1AM4D 3FDIA 3TMKA 2DBYA 1Z6GA 1KZGB 3LFUA 5CM9C 621PA 3VAAA 4RD3A 4ZI2A 5JHGB 3AGPA 3KQHA 4PZZA 3ND8A 2F3TA 3AVVA 3SS8A 3NEYA 3OZXA 2QL6A 4N1AA 5AUPB 1M1YE 2OCBA 1IXRC 3AM1A 4PC2A 2WMNB 5K8LA 4AC9A 1KO8A 2PT5A 3QKUA 1Z83A 4B3DA 3TJZA 5TY0A 4N3NA 2ZSEA 5CLLA 1XZPA 1U0LA 2ECKA 3BWDD 2NO0A 5AK0A 3RSOA 1R4AA 3OEED 3SZRA 3FYHA 4QJ4A 2AN9A 2QSZA 4RY2A 4IRUB 3PITA 3I62A 5K8IA 3MCAA 3QENA 1NG1A 3K9NA 2Q9BA 3FHOA 5KSZA 5FBRB 3RLFA 1QBKC 4Q7JB 1TEVA 2EVWX 1Z29A 3VR2A 2O0HA 2WM9B 5P21A 1B0UA 2D62A 3HPRA 4PXAA 1NSTA 5EZ5A 1OKKA 2NG1A 3NIBA 5LBIA 5BW8A 4DSTA 4MYTA 2ZRJA 1KI4A 5HCIA 4R2HA 1KNXA 2A5FA 1T6NA 1X86B 4Q4AB 4JVMA 4XWOA 4HAYA 4KSBA 1A2KC 3EA0A 1OB2A 4JKYA 2WVJA 1XCMA 4AK9A 3I8SA 3AEZA 4Q66C 5E95A 5JWOA 1WQ1R 5DHAA 4HB2A 5EE1A 4B73A 3AQ4A 1KI1A 3LBIA 1FW6A 4U7DA 4KFSA 2OBNA 2RKOA 1Z0JA 1KAOA 5IF9A 1K5DA 2BC9A 1D9ZA 2ZR9A 2N46A 4R9UC 2V6IA 4XTCS 4UNRA 3VHLB 1VHLA 2QU8A 3C41J 5TV2A 3VR6A 3GJ6A 5HZKA 1X3SA 2V9PA 4OI2A 3EPHA 3SI7A 1DE0A 1COWA 1NL3A 1RVDA 2RMKA 2ZYTX 3B1WA 4ZDIA 5SZJA 1GRNA 2FV8A 1UFQA 4US2R 3CR7A 1GNRA 4D0LB 2IYUA 3AF0A 4TMKA 2H57A 1XEWX 2DWOA 4Q4LA 4R98A 4B3GA 5DN6A 3SJCA 1SGWA 3FTQA 3UG7A 3ZIAD 3U4QA 2XEXA 3AKEA 1TNDA 1G3MA 1Q1BA 3GLHA 3T06B 1T3SA 3A58B 4AKEA 2HYIC 4JLNA 2F6RA 5L3RA 2FPKA 1KDRA 3IEVA 2OCPA 3QEJA 3THXA 3DM5A 2XJ4A 3ZS9A 1SVKA 1J99A 4Q21A 2ZE5A 1J8YF 1NN3A 3W3AA 3ICEA 4FMBB 3K8YA 4DSUA 3U7GA 1NF3A 1WCV1 4WOPA 3R8FA 1E9AA 1KHTA 2CLSA 2ZUDA 3VKGA 1U8YA 4TLBA 3KDSE 3IILA 2QP9X 4YC7A 2DPXA 4HB4A 2ONJA 3REFA 3A8TA 4TQUS 5JJIA 2ZRFA 3NKVA 3VNVA 5H68A 4B76A 4II7A 4AWXA 1TMKA 2MMCA 5JHHB 3H2YA 3P20A 1XCGB 4XTRA 4EPXA 3QPUA 1D2MA 2NPIA 2YZ2A 2BMFA 1E0JA 3NDPA 1GKUB 1RJ9B 3BGWA 1G1MA 1ZNZA 1OXSC 1R8QA 1D5CA 2G0NA 3NH6A 3QXHA 1XTSA 4EJSA 2FOLA 4KYIB 1CJVC 4JVSB 4M21A 2P5TB 3B82A 4OJQA 4BWYA 4I1SA 1I4DD 4BFWA 3IQWA 1X1SA 4FWIB 1JQJC 3QBTA 2WOJA 3VR3A 1ZJ6A 4ABYA 5K8UA 3CF0A 4BLSA 3DDCA 1RRFA 1DAEA 3BXZA 2O8BB 4IDQA 3BB1A 1XEWY 1P9NA 4TLDA 4LBZA 4B2PA 1FOEB 1YZTA 4EPWA 2MSDB 4TN1A 4A0HA 2QT0A 4QBIA 2ZVQX 5CDFA 5C2JB 1Z0AA 4QC2A 1AS0A 1ZYUA 1M2OB 2ZAOA 1N6KA 2IC5A 4IKEA 3LLUA 2AHOA 1KI7A 2FFQA 2GJ9A 2E1RA 2QAGC 3DMNA 3BRWD 1KK3A 1Z28A 2ZJBA 5EZ6B 4QOSA 2WSSD 3OEHA 4YXWD 3U60B 1VKJA 1RE0A 5KSOA 2KE5A 2OM2A 4Q4HA 4DLVA 2AX4A 4AD8A 1XD2A 1FX0B 3FPAA 4QGFA 3MWLA 1ZD9A 1W47A 3RRNA 4R2IA 4RCYA 1OFIA 2YC4C 3KX2A 4FMCF 2A5DA 1DAHA 4GOXA 1E96A 4ASUD 2ZYVX 4KFTA 1S0UA 4AYTA 3NHAA 4NYMQ 1GIAA 4Q1CA 5C1BA 2ZI5A 2D7CA 1OE0A 3VQTA 1KTVA 2W2TA 3P26A 4HATA 4CYMA 3Q3JB 3CM0A 4OQFA 5GVRA 4LI0A 3L0PA 4NHOA 5DLQC 1O3YA 3OIUA 1U9IA 4IHQA 1VG8A 3CRRA 4PSKA 4A8JA 3KQNA 1A4RA 2EWWA 4DJTA 4W5JA 1DEKA 2EYUA 2GVZC 4IXMA 1UBFA 5E7IA 2QMUA 5TDHA 3UIEA 1JNYA 1IAQA 1EXMA 2R2AA 3TRFA 1OFHA 5KPDA 4DCVA 4OHXA 1NSFA 4Q47A 3LVQE 4A1FA 3O8CA 1GKYA 2CNWD 1ZAKA 3EIQA 4DUGD 1VYTA 1KIMA 1BKDR 4R71A 4LJYA 4QJ5A 3GJ5A 1KY3A 1VYUA 1XU4A 4L8GA 3DVLA 4KSCA 1XXHA 2WJYA 4G0NA 4KU4A 1BH2A 3SQXA 5JCPA 4NTZA 1Z0KA 3IGFA 4EFMA 1OH8A 1OIWA 4TMWA 4TTPA 5E4FA 1AQUA 4A6PA 2ZI6A 3EW9A 4MKFA 1SULA 4A15A 2XXAA 5FH9A 2CVFA 3RS5A 2R6GA 3CH5A 1SQ5A 5FPYA 3FVQA 5CYOA 4LJ5A 1D6JA 4AKGA 5JBQA 2Z5FA 1E6CA 1DO2A 2FPLA 4QL3A 1W2HA 2WIAA 5FFMA 2DWPA 1QHXA 5H8WA 4HDOB 4KO8A 1XDBA 3P1JA 2CJWB 4Q48A 2R6DA 4KJZA 1YZQA 4NCHA 5FPSA 1W0JD 2PEYA 3K0CA 2RAPA 1GM5A 3EC1A 1YQTA 3EA5A 3RANA 4A2QA 4ZI3A 4JJZA 4XH9B 5HCNA 721PA 1FNNA 5LPNA 3X1DA 4D4JA 1NKSA 2XTNA 5LDDC 3SFVA 2HUPA 4M1MA 4I1UA 4ESVA 5LD2C 1X8LA 4LV5B 3PUWA 3UG6A 1OXTA 1PUIA 3IIMA 4MGKR 1CR2A 5DNYB 3P27A 1R5NA 2BV3A 4MGYR 3H0KA 3VU9B 4H1UA 4NYMR 3KL4A 4YLGA 1Z6AA 3RNLA 3C8UA 3QPWA 2O8FA 1QZXA 4IDPA 4C2UA 2ZRIA 3A1SA 3A6PC 1QHNA 3QF7A 1LF5A 2ZUBA 2ZJZA 1G4AE 4MKIA 4P32A 4ZPXA 1FPMA 1KK2A 3TIFA 1OHHA 2IK8A 1KK0A 4U02A 2YV5A 1VTKA 1TADA 2GAOA 3KJHA 2VP5A 3QXJA 1DPFA 1E0KA 1NVUQ 3T1TA 3KKPA 2HYDA 4OJKA 4BZPA 2O8CA 3UWKA 1QHHA 2HCBA 3T5DA 3A1TA 4E07A 4EIWA 1OH7A 1KGDA 2FN4A 1P3JA 2ONKA 2ZRCA 1GVNB 3QVVA 4CEJB 1BYIA 4XJXA 3LLMA 2WBLC 2JJ1A 2VTKA 1P75A 2ERXA 4GFDA 4OL0A 1OPXA 2WIBA 2IS1A 3NBFA 3CRQA 3QIAA 3T61A 3B85A 1ZU4A 4V03A 4QJ3A 3MD0A 4MDEA 4PHTA 2BDTA 2F1JA 3GLIB 1F2UB 3B78A 2CBZA 1Z0DA 4CGZA 1US8B 3KKMA 3FE2A 4FINA 3WHKA 4LBYA 4JLJA 1R5BA 1SZPA 3D8BA 4HLCA 4C0BA 3ZZ0A 3B2EA 1TF2A 4MYCA 4IEEA 1OT3A 3PUZA 4XVRA 1RPZA 1J8MF 1XZQA 5AJYA 1CJKC 4DVGA 2JASA 3MSXA 5DIFA 2MMGA 5EP4A 2GF0A 4LDJA 4YDHB 3D31A 4OHZA 1E1RD 1AGRA 4G5OA 3SJAA 3U3MA 4BGDA 2ZITA 5FTKA 5JMTA 1XCPA 5TMPA 1BIFA 1E2QA 3Q85A 2ZRHA 5AR1A 4OKSA 4DLSA 1XPUA 1N0UA 1TQ6A 1R5OA 2OG2A 2IT1A 3AH8A 3LXXA 4IDNA 5A5GA 4PR0A 2VSFA 1KJYA 4MH0R 1NBMD 4B71A 2W2XA 3HU3A 3OIYA 4CEIB 2OSBA 3MRSA 1E2LA 4LBVA 4AG5A 3EWAA 3SR0A 1OXVA 2ZEJA 3ETLA 2IS2A 4DRZA 4GL2A 3FKSA 1XB2A 3OIVA 1XD9A 4PC7A 4IVQA 4AIIA 1ZIOA 3HR7A 2GAAA 1ZM9A 3BC1A 4Z8YA 3EZ9A 2O52A 3AP3A 4Z8XA 1CR1A 1GNPA 1Z0IA 4V0ME 3X2SA 3A4MA 1JR3D 2GXUA 5IK2D 3THYA 4X8MA 3QY0A 1BYUA 1EX7A 4QNRA 2RGNC 2WKQA 3B60A 1KKLA 5AJXA 2QT1A 4AURA 1DBSA 3ZJYA 1VCIA 2V1XA 1AS2A 1CTQA 3FMIA 5DHFA 3LBNA 2GXQA 5HE8A 2C9CA 4M0LA 4Q5IA 4DIDA 1AZTA 3RWOA 1V43A 5SZIA 3C15C 3UXMA 3TVTA 2G88A 4TLEA 4DT1A 5KSYA 2IA5A 1UKVY 5JSZA 2Q0HA 1TTTA 4Q7LA 3RC3A 2A5JA 4OK3A 1BMFD 1S9DA 1SHKA 2FMXA 3TQFA 1NLYA 2FE4A 3AKCA 4GP7A 1U99A 3A4NA 5HR5A 2C9YA 2BIFA 2GBLA 2JJ2D 3B9PA 1TQDA 1T0HB 2C2HA 3IPYA 3UMSA 2OILA 1ZM3A 2PEZA 2QTHA 3GJ4A 4B74A 2AK3A 2J7PD 1OF1A 5D3QA 1G64A 3AUXA 4DCTA 2C8VA 1XJQA 1QF9A 3MJRA 1YU9A 2H18A 1NKTA 2NMVA 1NY6A 2F9MA 4L9WA 1QDEA 1SKQA 4Z1MD 4WVFA 4P4SA 1SXJD 3SQWA 1CR0A 3U44B 1QRAA 2AWNA 3AB3A 4F4JA 1Q44A 3K0AB 1UF9A 2J46A 3MJHA 1W4RA 1N6PA 4JSYA 4URVR 1M74A 2H8KA 1S3GA 3MMPA 3K70B 1KDOA 3PXGA 2FPMA 3FGNA 3TH5A 5JZVA 3O8DA 5G3YA 4DLWA 4NYJR 2HEIA 2CK3A 2FSIA 1D9XA 1NLZA 1LS6A 4BLOA 3OHMA 5EXXA 4EQ6A 1OFTA 3EIHA 4FMCB 4M1SA 2BBWA 1OW3B 2OE2A 1Z5ZA 3L8YA 4RFSB 4AG6A 2CLDX 2AXPA 4EUNA 4DEYA 2C96A 2JLWA 3HPQA 4FWTA 3UKDA 3WP1B 2FZ4A 3ZZUA 4EPYA 2ZI9A 3GFPA 1E0AA 4JBWA 2PJRA 3MWJA 3HJNA 4FMDF 4NU0A 1FP6A 4D26A 1E69A 1G19A 1XMJA 4BECA 3TR0A 2B7CA 3I8XA 5CITA 1CULC 2IYTA 4QM7A 2WWYA 3P4XA 4EFNA 3AP1A 5FOWA 1EFCA 1ZRHA 3O47A 5IRCD 2V7QD 1H65A 3K53A 3U4QB 3FKQA 5KO2A 1WBDA 1RIFA 1SVIA 4HYYA 2XAUA 2JIZD 1SXJC 2QPOA 3AKYA 3PEVA 2NO6A 5AUQA 1A1VA 3THWA 2VP2A 1P2UA 3AV0B 1VG9B 2CXXA 1KMQA 4LUCA 4OYHA 1HQCA 2VHUA 1KMHB 1GDDA 3IQXA 4HLUA 2R6CA 1Z8FA 1UDWA 4RCZA 1LF0A 2OFOA 1DAFA 1E79D 5KHOC 1XWIA 1JEEA 1R0ZA 2QP3A 4XVQA 4A0FA 2BOVA 3C5CA 4LYAA 2D3WA 1NBME 3RSLA 4GSYA 3SDZA 4A2PA 1KO7A 2GZDA 3D6TB 1PV4A 4LRWA 2Q21A 4HB0A 3KKQA 5FOVA 5TARA 1Z47A 2ZE7A 1RZ3A 4D4KA 3GJ8A 5JWHA 1CRQA 2VBCA 3HR8A 2IL1A 2OHFA 3ZYCA 3PFIA 1AKYA 3RWMB 2BMEA 3ADDA 4Q01A 3QE0A 4BFSA 4KVAA 2IUUA 1KDTA 2X19A 2NZJA 2ZE6A 3FB4A 1XMSA 3NEJA 1GKIA 1JR3E 2GK7A 1MV5A 2FU5C 4JLBA 2MSCB 2RCNA 3GEIA 3LQQA 2BHRA 3RYTC 4EJSB 1KOFA 2JLUA 1P2SA 2WWFA 5HKKD 1ZINA 2G6BA 2ANCA 3KZ1E 1JQLB 4C0KA 2QROA 1DAIA 4US0R 2ZYUX 4ZIRB 4MRVA 2YNMA 4G5GA 2CHQA 4HLDA 5FOSA 4TL7A 1DARA 1JB1A 3O8BA 2F9LA 1VHTA 2HV8A 2PZFA 4S35A 3HYTA 2YWFA 2VEDA 1E2JA 2DFNA 3ASYA 3B8HA 1E9RA 2X1VA 4WBSA 3DO6A 4M53A 3OFND 4UXJA 4A9AA 3LVRE 5KUTA 4MQBA 5L8VA 4EFLA 4P0TA 1H8ED 3PCRB 4KLNA 4G5RA 2EWVA 2AR7A 2WOOA 2ZJOA 4I4LA 3M6AA 2EFGA 3QF4B 3M4YA 5GJWC 4DIEA 5JLJA 3BAFA 3LD9A 4IOJA 1XTRA 1E2PA 4BASA 2ZS9A 4TYQA 1SKYB 2VL7A 1IN8A 1LY1A 3ZVLA 4H1VA 3AVPA 4B2LA 2ORVA 1A5TA 1U98A 3WXMA 1H8HD 1SXJE 4Q4HB 1MO6A 1I2DA 3N70A 3WRXC 2V54A 1ZC3A 2Z4SA 4NP6A 4MUAA 1YE8A 2H5EA 2ZRKA 4AYWA 1WXQA 3DEFA 2N1BA 2ATXA 3UANA 1IN4A 4W5WA 3B1XA 4DCNA 4K46A 4Q1FA 3T12A 3CW2A 2ZRLA 3EPLA 4MRRA 2HXYA 2ANBA 3NVAA 5DYGA 1CJUC 2AFIE 3UMFA 2YKGA 2J41A 4EPVA 1EWRA 3A4LA 1LTQA 3CRW1 4A8JB 1MT0A 4HAVA 3TSOA 3K70D 1K6MA 4B6EA 3WY9A 4G3XA 4DSOA 4GOKA 1F6BA 2YVUA 2ZI3A 2BBOA 3QSYA 4OHWA 1EX6A 3RS3A 1KNQA 1E9DA 4C2TA 2B7BA 4G1UC 4NDZA 2QQEA 1P61B 1UPTA 4GP6A 2WTUA 4RKEA 2CL6X 2GETA 3OEEA 2J1LA 1WA5A 2B8TA 4CW7A 4F93B 4IOLA 1IXZA 3WBKA 4GZLA 2QGNA 1FP7A 4LX0A 4C4PA 4DLYA 4EPRA 1ZUNB 2ASEA 4ZCIA 3U6BA 4YDSA 5JRJA 3E70C 1IY0A 1JAIA 5EUQB 3SC3A 2JCSA 4AKIA 2BWJA 3VKWA 1W44A 2VHCA 4NMMA 3W8NA 1FMJA 3JZMA 4LBWA 4M1TA 3WYGA 2NIPA 2CCKA 4TYWA 3AF3A 5FL7D 3EZ2A 2J0VA 3TNFA 3FHCB 3BORA 1KI6A 1KSJA 1JI0A 4A2WA 3RRMA 2WHXA 1G5TA 3NG1A 2OT3B 2GRJA 1G3QA 4LHWA 4ESHA 3SBDA 2KBFA 1RYHA 1KJZA 2QQ0A 3JZAA 1Z6XA 2V1UA 3CNOA 2QMEA 1LB1B 2ZPTX 3FHTA 1II0A 2PBRA 2ORWA 1GAJA 3AVYA 3A1UA 4PSVA 2BMDA 3AGQA 1VYVA 4QNMA 2IUTA 4LCBA 1ZCAA 4JJKA 2WAYA 3VR1A 4PPNA 1UEJA 3H84A 1OB5A 3EC2A 1FTNA 4W7SA 3KTAA 1ZW6A 4HSEA 2BCGY 2VF7A 4CRWB 1E1QD 2IX3A 4PHFA 1ANKA 4O2RA 1KO1A 3FFBA 3U5ZB 4CF7A 2FX3A 5DH9A 3LRPA 1OLOA 3ZIAA 1K5GA 2J0UB 4NKRA 3LV8A 1UM8A 1X1RA 3C16C 4RD2A 1G5PA 2W6ID 1CJMA 3T35A 2ZRPA 4TL9A 2IF0A 1CLUA 2RGEA 1C4OA 1DO0A 3ASZA 1P5ZB 2J7KA 5FUWA 2ZI7A 2QEQA 4DLTA 4PSAA 2GCOA 2PCLA 2QENA 3U3RA 1RRCA 3BB3A 2WAXA 4LHZA 4YONB 3QXXA 1QHHB 3QEOA 1GL6A 4NBSA 5FBQB 1I4TD 4IJMA 4JL6A 1TX4B 5J4LA 4PPGA 1RW4A 4C0QC 4TL6A 1UEIA 3AF2A 4DDTA 1W48A 3LA6A 3HYRA 1IHUA 3X1YA 5GADl 1P4SA 1P62B 2CLCX 4A0RA 1AKEA 3C7KA 3ADKA 2CCGA 3BERA 5DI3A 2ZSDA 2CE7A 1XD8A 3AVOA 3HU1A 3P4YA 4HUTA 3AUYA 1YR8A 1NNEA 1P73A 2QAGA 2XJ9A 5F2EA 2KJQA 1RRPA 2JDIA 1W49A 2HF8A 2ZRAA 1PLLA 3RC8A 4WA7A 1IQPA 1KSFX 4M1WA 2IXEA 3ZH9B 3CB4A 1T3LA 3JVUA 4LC0A 5L3SA 2VSXA 2Y8EA 3KUCA 4R7ZA 2EQBA 2AL7A 4ZCMA 2C99A 1GRRA 4TZ0A 5FOXA 1VCOA 2ZAMA 4KBGA 3GLFB 2IXFA 4LOAA 4LHXA 2VHTA 1G20E 5EE0A 3LY5A 5BN5A 4V0OA 1E3MA 2P6RA 2WJVA 3TBKA 1ZMXA 3PEWA 5DO9A 4LC1A 3L82B 4FMDB 4PQRA 3TSWA 3WNDA 3JVVA 2Q3HA 3AVQA 2B21A 4PQFA 3L0IB 2CEAA 4POAA 4Q18A 2ATVA 3K9LA 1GSIA 5EE5B 1LNZA 1YZGA 2BEKA 1GTVA 2LCFA 1D2NA 1G16A 3QBVA 4QFMA 4RZXA 4Q1BA 4RFVA 4RVCA 4C3ZA 1G7TA 3K0EA 3NBYC 2QAJA 2AK2A 3V4RA 1LS1A 2Z4RA 4MGZR 1AS3A 1FQJA 4CDGA 1HA3A 1QHSA 1HEIA 2FG5A 2QY9A 2D2EA 2G3YA 3B5JA 4V0NA 4YMSA 4LGMA 4PANA 3HWSA 2RHMA 1E2EA 3CO5A 3HP1A 5L3VA 1G8YA 5JFGA 5GVSA 1G9XA 4OK5A 1U94A 4BEBA 5KNDA 4I1VA 4WXPA 2WSSA 3IKJA 4LY6A 5TXGA 2PT7A 2ZI4A 4L9SA 4C7OA 4M9ZA 1CJTC 3F3YA 1W7AA 1K8RA 3TUIC 3THYB 3LNCA 3GLGE 4ASUA 2NO1A 1NI3A 2ODEA 3LX8A 5G3ZA 3UWOA 2XB2A 1P72A 1VCNA 2OEPA 4US1R 5F98A 4N0EA 2ORIA 1CU1A 1TU3A 5HTKA 4OK6A 4ARZB 5AUNB 3OAAD 5GJVC 3GJ3A 4QBFA 4LSGA 2MSEB 5CB6A 2GK6A 2IXGA 1WB9A 4HUQA 5JSZB 1CKEA 1DOAA 2Q9AA 4ZDJA 5FUVA 2IYQA 4BLTA 1JR6A 1C9KA 1QVAA 1W5TA 2FFAA 2NO9A 2QPAA 2QRNA 3NC0C 3TUJC 3EARA 5CK5A 1JJ7A 5D3MA 3D7MA 2OFWA 1HURA 2Z43A 4LJ6A 5G40A 3GJ7A 3R9WA 3B9QA 2CNWA 1XJCA 2BVNA 4Z51A 5B64A 2CVHA 4DUGA 3T1QA 4BZXA 4Y0VA 1UKZA 2V3CC 4I81A 4E5UA 1AN0A 5EXSA 1W4BA 4PHGA 4BLPA 3AKDA 5CJ2A 3IDQA 1AJEA 1E0SA 4GNKA 4XVUA 5J4HA 3G0HA 1MO5A 2QZ4A 2FEOA 2ZYWX 3TVDA 2IWRA 2FFBA 3T1VA 1KO4A 1Z08A 5TVKA 4MA4A 4OQNA 1T3HA 3F0TA 3CONA 4P4SB 1KZ7B 4LYHA 2Q9CA 1VIAA 4IFEA 1YR9A 1YR7A 1XEFA 1WRBA 2XNDA 2FA9A 4TZ6A 5KDOA 1KI3A 2VP6A 2YOFA 3N5CA 3ZDQA 5CIWA 2RGXA 1IN7A 2YYZA 2H16A 3U7FB 4V0MA 2YINC 3SYNA 2WMOB 1CBUA 2QRZA 3WMEA 4JT2A 4B34A 2VP4A 3EASA 3QKSB 4WZAE 3FOZA 2X77A 5FOTA 4MYUA 1V5WA 1U0JA 3MAAC 1TF7A 2CL7X 2XSZD 3OE7D 4DHEA 3IHWA 3RDPA 4XOIA 4CEHB 5AJWA 4BLRA 1RRGA 1W2GA 1X8KA 1XJ0A 3ZQJA 3A1VA 2G1KA 4JLPA 2YOHA 1ZNYA 3KFXA 5E3HA 4OI0A 3REGA 4TTRA 4ZCLA 1SKYE 2LWIA 2P67A 1L4YA 1DELA 2UZ3A 4HAWA 5L3QA 1E2NA 3DOFA 2JEOA 3PUXA 2OCYC 5UKDA 3EZ7A 121PA 4NE2A 2ZUCA 1FMLA 3I72A 4OI4A 4PAOA 1G41A 1EFTA 4KFUA 3KB2A 2AFHE 1ONBA 4W5HA 2ZVPX 1SVOA 4MGIR 5AJVB 5FBWB 1KSGA 1RJ9A 4QBHA 1P2VA 1W0KD 1E9EA 2VHJA 5F9FA 4J0QA 5FTLA 4TSFD 1T5LA 1WDTA 3THWB 1II9A 1UAAA 4RD0A 2F43B 2QMHA 5BXQC 4WZ6A 3GCGA 2Q3MA 3SJZA 2EFEB 1UADA 3UK6A 4K81B 1D2EA 1KJWA 2BKUA 1EESA 2VA8A 2O8DB 5AJZA 4PTLA 4HAXA 4DB2A 2PX0A 3G5UA 221PA 1G8PA 1JEDA 1N6OA 3SE0A 4BRWA 4LV8B 5FR1A 5EP1A 3D3QA 2ZSAA 1N3BA 2DYKA 3NH9A 3M0EA 1Q57A 3ECCA 3OIWA 1W36B 1DAKA 1S9HA 3T15A 4BRUA 2EW1A 4QBGB 2GILA 1A82A 3I92A 4KBFA 1U90A 3B7GA 3H1TA 4KV9A 3EIEA 4XWKA 4BEJA 3BFKA 1NP6A 4ACBA 1R0WA 3CR8A 3W9YA 1ESMA 4UNQA 2QE7D 3TK1A 4ILEA 5J47A 4NYJQ 1MR3F 1OV4A 2IYWA 1XX6A 3AVWA 2QN6A 2W58A 5JWRA 4BFZA 1LFDB 2AXNA 2VQSA 4KAXA 2A3RA 1P2TA 3EAQA 4NZYA 1JJVA 2CMKA 3IUYA 2YOGA 1FL9A 2RGNA 4FCTA 2E9SA 1G7CA 2X2FA 1OYYA 4PO9A 3W6PA 4DBLC 3AP2A 1E1RA 2AWOA 1QVRA 5M04A 1PZNA 1OYWA 4ZO4A 3Q8XB 4IOKA 1ZM2A 3N2EA 1XPRA 2FWRA 6Q21A 4OHVA 2F7SA 3BK7A 1KKMA 2VIIA 1QHIA 5FUYA 3IHLA 4PC6A 4C0SA 2G77B 2ZROA 4JLOA 3DL0A 3C14C 4EKDA 4X8HA 2AKAB 2OUKA 3Q7QA 1E94E 1Z3IX 3CIOA 3BH6A 2VP9A 3K0FA 1NIJA 3TAUA 1IM2A 4C0HA 1AZSC 1NBMA 5C46F 3IEUA 2XTMA 3CZQA 8OHMA 1OFUX 521PA 1CXZA 3N2IA 5EXPA 3Q9LA 2A9KA 1DVRA 4B3XA 1KI9A 5CB8A 1Q12A 1JXMA 4M2LA 1F2TA 4URZR 3W6OA 4Q03A 5J5CA 4BFTA 5B2ZA 2R6AA 2XOKD 4GT1A 2OXRA 1VCMA 4TYNA 3CF6R 4UXIA 3QKTA 3SOPA 1JR3A 4RSGA 5IK2A 3U3JA 3W5IA 1N0WA 2QTFA 1OH5A 4JL5A 4D2IA 1XEXA 3SFZA 3QKRA 4EPTA 2WICA 2EFHB 4V02A 3T34A 2QI9C 3CRVA 4M22A 4P31A 3S1AA 5EP2A 2P6UA 4A4DA 2QP4A 4PO1A 3AF4A 4JYCA 4D82A 5KYKA 2C98A 1AGPA 4QXAA 5JI2E 4CT5A 3I5YA 4Y0AA 1M34E 1W4AA 3FMFA 4URXR 4L4UA 2CK3D 3KB1A 4G5SA 1BMFA 3R20A 4ITRC 4X8OA 4QHSA 4IDOA 5DYIA 5H70A 4TLAA 1FZQA 2HT6A 5DSZA 1HE1C 2N42A 1L4UA 4HZUA 4Z54A 2CJWA 4LPKA 3K1JA 4DKXA 2HF9A 3CBQA 4D6PA 4JLDA 2JAQA 2NO7A 3KKNA 2GZAA 3Q5EA 2QBYA 1VECA 4JBYA 4M9SA 5FL3A 2WJJA 2O8EA 3OF5A 3RRYA 2F1RA 2FZLA 4XD7D 3LXRA 4M9QA
chains in the Genus database with same CATH superfamily
4YMWA 3B3FA 4X1KA 2FEAA 2JKYA 5EWLA 1BS1A 3H6HA 1OREA 4RABA 4JMPA 2IZOA 2GNAA 1DC3A 1XLUA 4QG7A 5ITZB 1GXSA 4EKYA 3AWIA 5FA6A 2Y27A 1U0FA 3ZY2A 3ECSA 5BN1A 3NOOA 5EIFA 5HTOA 1UDXA 4N9QA 1FFDA 4AY3A 4RLHA 2C03A 2IEZA 2IOQA 2J3MA 2QW1A 3DT6A 4QOEA 5KTRA 2O59A 4XSGA 1Z74A 3CRNA 5I9MA 1SCKA 5EAIA 4O8ZA 2GN9A 2XE7A 4KN5A 4N03A 3ILVA 1U4OA 1VMEA 3EGXA 1WIWA 3QLUC 4PS0A 3GLHB 1CUDA 4OA8A 5LQAA 1FS6A 4WOCA 4GVPA 1W6UA 5I9SA 2QXYA 2HLDD 4IIFA 4L8YA 2X23A 3MOIA 1RHKA 3VTZA 4BLQA 5BOSB 2ZJ5A 2PVSA 4QDUA 1GUBA 1I6KA 1P7PA 5GJCA 4GU5A 2QPTA 1X70A 4CEJA 2PWZA 2UYOA 4Q4JA 3W2FA 1E8DA 1TTQB 3MGCA 5AUOB 1LUAA 5E0KB 2QRMA 3ZCRA 1TPYA 1EVEA 1Y8CA 1DJPA 3TDMA 4JYMA 1NPYA 5AHKA 4F9TA 2JGMA 1XMPA 1YBMA 4JOQA 1J2JA 2PGNA 3B3JA 2GN6A 5HRAA 2WWWA 3W5AA 1M7BA 2SKEA 1Z26A 2C77A 2CFTA 2WYVA 1GG2A 3AY7A 4KFRA 3L02A 5IDWA 4DJFC 3V8NA 2EIHA 1M2WA 2NSJA 4EDFA 5J2UF 2FEPA 1M6VA 2AMVA 1EFRD 4XWYA 4BQSA 1Z6TA 3K1AB 2V7QA 4J3JA 5CCXA 1DZIA 4UHFA 4DTCA 3FNEA 3EIXA 2ZB4A 3JQ9A 3O8OB 3W1EA 3ZGVA 4HZIA 1ZNWA 3GUYA 4DIDA 2GLTA 2R0QC 1S8AA 2HFKA 2WSMA 4MQ6A 1UM9B 4LHYA 5IVIA 4D4HA 1C9MA 1IRXA 5KOIA 2XYRA 4Y3UA 2D5LA 4RD6A 5CGQB 1NJ2A 4TM8A 5TJ9A 4NC9A 1OZFA 4IVNA 4D4GA 1ZCFA 3AHJA 1RWBA 1RCTE 5C1IA 3U7IA 3E3LA 4ER6A 3TLYA 4EG0A 1HWYA 1RRKA 3OCCA 1OTYA 5EHZA 1E79A 1FLVA 3PDIA 3PGVA 1V8FA 1ODLA 1YDWA 3G2PA 1PDVA 1UMKA 1YJAA 4GPIB 4HN4B 3MQ2A 3ZBPA 2YJZA 4DCUA 5JQGA 2VP0A 1Y6GA 4O29A 3GXBA 3ZWVA 4N0QA 4TWIA 1U28C 4Z5XA 5I4KA 4CL2A 5MN5A 1GQOA 1YR6A 2BRUC 4O4HB 3RB8A 1X9GA 3K09A 4QUBA 5CIYA 5JOQA 2I3BA 2KI5A 2QK4A 3UAXA 5H3HA 2I87A 5DI3B 3ST7A 1SWWA 1TAGA 1YQGA 2EQ5A 3W6NA 2OFXA 3RIXA 3QNMA 4CHGA 2RHBA 4B7ZA 5JY6A 3FBWA 2R6HA 3ULKA 5D7BA 1O4VA 2NPFA 3NLLA 2IEAA 2FK8A 3FHJA 1ZIPA 2ARKA 2LKCA 3MWEA 2WZQA 1AK9A 2AFVA 4HI0E 3CG0A 3WFIA 1SUCA 2GPJA 4G09A 5ITWA 4L5CA 3L7MA 1QAMA 1LBSA 3HBAA 2J3EA 3QMVA 4R9RA 4KXVA 1MRNA 4IAOA 4IGFA 1OR8A 1YTUA 5HKKA 2R84A 2RHGB 1CJSA 3IIEA 3O4RA 4HNAB 4KLZA 4WLVA 1T0UA 4DLLA 1JDSA 1ZI6A 1YHNA 2P11A 4RADA 3WO0A 4DQDA 2ZS7A 5JC1A 2W6CX 4ZXPA 2NUAB 4EFKA 3ZZNA 2G9VA 3QOYA 1XD2B 3TNJA 3GVHA 3GT4A 5EXTA 2HBQA 2WPDA 1O6ZA 3CBGA 3FTNA 4XVHA 1A96A 5B7NA 5DRYA 4ZYYA 4JI7B 2FXIA 1QHFA 1GCAA 2GYUA 3OZ7A 4LG1A 4PY2A 5AXDA 4CBVA 5M34A 3UH0A 4YECA 4UAJA 1ZU5A 1OKKD 4MYDA 5KTMA 1GEGA 2TS1A 1J42A 3DQZA 1YDFA 2JLVA 2ZB2A 1P39A 3A4VA 3RV3A 1FDSA 1MP0A 4R2XA 3G17A 4ZYVA 4JS0A 2YHSA 1RM3A 3DDNA 4ML3A 4LTDA 1P2FA 1V0JA 1E6UA 5EVJA 4QAJA 4DA4A 2EYQA 2ON6A 4O0LA 2A2ZA 2O0JA 3G49A 4D3SA 3OCWA 1SXGA 4RA9A 4BB5A 3F98A 1KZYC 3ZJ5A 4IIHA 4S1TA 4UAUA 4ZKEA 1W4LA 2D1TA 3H8SA 5IM5A 5G0VA 1E18A 2IZ7A 3VMMA 1E4VA 2JC3A 4KGDA 5T6MA 3O84A 2WTAA 1OGJA 3TW6A 1R6BX 3F9CA 1BX3A 4OQ4A 2N0SA 3BXXA 4C7OB 2A5GA 2D1YA 3GLIE 2HJVA 1XA4A 4Y6QA 1T35A 4RETA 5IN5A 1NW8A 3ZWMA 3LBHA 3JZFA 4FGJA 1PJZA 2PS3A 1WVIA 3BIFA 4CG2A 4QT0A 4G84A 2W2LA 2HMWA 4DZRA 3O91A 3VPAA 2PXHA 2R6ZA 3PC4A 4KAAA 3N76A 1FEZA 4TYYA 3IDFA 2XYVA 3D8RA 3HBMA 2J4DA 3IQZA 2EX0A 3IYLW 1OXMA 4IDGA 4Y1EA 5FTNA 5IU6A 2Q6VA 5AVOA 3DOEA 4ZO7A 1RXSA 3B8EA 5ICCA 2YQ4A 4YX9A 1J0DA 1DFIA 3CZRA 1FNSA 1QS0B 1RI4A 1YUBA 4IGIA 4XSHA 1J90A 2YIMA 1ZSNA 3R2JA 3WKEA 3OTGA 1XV5A 1T9ZA 1UMBA 3DGFC 3TKLA 1NNI1 4ON9A 5DCLA 4KE7A 1Q1EA 1KQPA 1UKEA 3E84A 5CLQA 2J30A 3H19A 4RZ2A 1GTRA 3GUZA 2I4OA 3BHIA 5D3MB 2IKSA 1XKXA 3PX7A 4BXOB 2Y67A 3A9UA 3C4QA 2QJWA 4PC3A 1MEJA 1UFOA 1OUMA 3GH3A 1WCIB 2PL5A 4ZXFA 1BQ4A 2C04A 3IQIX 4KQCA 5EYPA 2ZJ2A 4YJDA 5IUNC 2O3UA 2NZYA 3AXTA 2ZG6A 1P91A 3K5IA 3R7LA 2C9ZA 1RLTA 2HBZA 2BSXA 4MKGA 2JLXA 4DXDA 2DCUA 2RGCA 3SQOA 5CFPA 4JFRA 2P75A 3F78A 2XECA 3O3OB 4LQCA 4LSMA 4TZKA 1SUSA 1K7SN 1Q6ZA 3AQIA 3BTUA 3OPVA 4G37A 4ND4A 5FBLB 4F84A 3L0OA 4OIMA 4MPTA 4Q1AA 3C0KA 1M7GA 4W6QA 3VSBA 3F3KA 4QGGA 3A6LA 5CJPA 3ZW9A 4KNVA 1VG0B 1M66A 1YL6A 3GPDG 3KAQA 5CMLA 2VHVA 3OQNA 2ORYA 2CXHA 3ZK8A 2OPBA 3WWOA 4UDNA 3C24A 4CIDA 1QGAA 1U3GA 4F85A 1TZBA 3QEMB 4K86A 4AP6A 4BMNA 4B5KA 5LJIA 4G63A 1YDEA 3OLQA 1UPCA 3I76A 4R1QA 4M55A 4E6PA 1LNQA 5K1ZA 1N1DA 4MVJI 1B3BA 1IY1A 4BMYA 1HBJA 2ZW9A 2O8FB 3BE6A 1YRAA 3KLOA 3EGCA 3R6TA 4JP2A 3CB2A 1EA5A 1RM5A 4WXMA 4HJRA 4P8RA 5AKXA 3V4ZA 3GD7A 3RUFA 1R88A 2GTHA 2JI8A 1A8QA 3MLBA 4AXBA 2PJZA 3QA9A 4FVTA 3WJ1A 3TM4A 2B34A 3FWKA 3GP3A 1OSNA 1I30A 1JIUA 2Q5OA 1NYTA 2NGRA 2G82A 1QIMA 5B37A 3F96A 3O03A 3C70A 2HU2A 2O8CB 1JVBA 1SIOA 1BO6A 2X2PA 2ZE8A 3I37X 1EHYA 3IUBA 3BK1A 4YCNA 3WK6A 2XTZA 4EENA 3KG2A 3IBYA 1AQYA 4UJ3A 2GN4A 4JK3A 3HDHA 1ZW1A 4AF8A 4JUAA 2JVIA 1AUOA 1NXXA 2NU9A 4MW7A 4WN3A 3UHJA 4Y7CA 1DKMA 4YO8A 3U4MA 1E1QA 1VL6A 4BNVA 4U5QA 3UCFA 3RVRA 2BEWB 3I9V1 5EZYB 5KMGA 5JO9A 1WU8A 4MS1A 5FUXA 5JNWA 4TVKA 2F64A 4HTFA 5B30A 4RJ2A 4QO8A 3VNSA 3PFNA 3PXCX 4ENQA 1NMXA 1BW9B 5B3LA 2WUVA 3JQPA 4UHCA 2D6FA 5A3QA 2H4JA 2G76A 3VKFA 5CFLA 1TE2A 1QCYA 1WBBA 2KLHA 5FI0B 3HA2A 1UK9A 5LQCA 2C8JA 1BS9A 3CKYA 5ECYA 4BLWA 4TYMA 3DKVA 3HNRA 5CDHA 5TIIA 3A37A 2XB9A 3WIUA 3K4PA 4J4BA 4BFLA 3FZNA 1X3LA 1DAMA 5AMXA 1PQ4A 1U0RA 3AHHA 3DMRA 4D1YA 4FHEA 4MDFA 4HJXA 2JJ8A 2LP4Y 2REOA 4YRCA 4BX3A 2UZ1B 4UZSA 2DB3A 3NT4A 4YIKA 4DILA 2FSFA 2HL6A 5COBA 3V1KA 3UGQA 4CU5A 1IMJA 2A7QA 2X3FA 3T9CA 3MJDA 4RTMA 1Y3IA 1K3FA 3QELB 5C34B 3UYKA 3ZHVA 3UFBA 1FSFA 1FSGA 4XJTA 4G25A 3N39C 3ELWA 3U4HA 5C8VA 1TJ5A 3FF4A 1UKYA 1VRWA 3CUEF 4WEOA 3BEDA 5JV5A 1H0HA 2NUTB 4UOQA 4H7PA 4QHTA 5EXEA 2E2WA 4KWHA 1ZISA 3QMWA 4JI6B 3QG1A 1EFLA 1LPPA 2EKZA 3QUQA 1VA4A 1U3CA 1GA4A 3FNFA 5HKOA 2BGMA 4DEVA 2WDPA 3DV2A 3T1OA 1YR1A 3O1HB 1Q2XA 2JPDA 3H5LA 3FNGA 3DPUA 5TQ0A 3NTVA 1L8XA 3WAKA 1WNTA 2AV6A 3MILA 1I0ZA 3KJGA 3E4DA 4WESA 1ZVVA 5CXQA 1SXIA 2YICA 2OYCA 2WG1A 4I1RA 2HCJB 4AZWA 4N7RA 4OYRA 1C2TA 3DGEC 3T54A 2AF3C 5BRAA 1UOEA 3C43A 1M1UA 4BP8A 3L0DA 5HKBA 2UZAA 1E63A 4YXWA 4CV3A 1JDBC 1KI8A 5TQ2A 1CQZA 3G2NA 3BOSA 2VPIA 2XMGA 3CW9A 1DRKA 2VWGA 3FJOA 3GLHE 3JWPA 4AZ0B 3S70A 4WLNA 4B4UA 3DLBA 3G6KA 3PIRA 2UKDA 4J3NA 1BXGB 1D8TA 4MJ3A 5DIZA 3HCCA 1VPTA 4ZVNA 5GV7A 4CFYA 1W93A 4KXWA 4L5BA 4Z9AA 4ER5A 4RYDA 2Z8YM 1W35A 1FFXA 3IODA 5JRDS 4QRHA 2I78A 2W6NA 2OCIA 2XUGA 1KE2A 4ZJUA 5KTNA 2GNOA 1HDOA 1EX9A 3F67A 5D6OA 4I4TB 2GPYA 1NW9B 2Q3BA 2D06A 3E05A 4LDRA 4DLRA 1E4YA 1ENOA 1IBRA 4DT1B 1HTWA 1U9IC 3ETCA 4X63A 3ROPA 4BFYA 4C03A 3ZUPA 2B20A 1DIHA 2QMOA 1EM8A 4R3NA 3QHPA 2DX7A 2VPTA 5DM2A 3N0WA 1YC5A 3JQAB 1KK1A 1N6LA 3RYHB 3I5XA 5A03A 2LV8A 1DAGA 3IT2A 3BS4A 4DXAA 1R1DA 1ZUNA 3TL6A 4DIOA 3E2IA 3A36A 4Q05A 1UXHA 4KHPB 4GMKA 5DW3A 1V6CA 2Z8ZA 5FLYA 1TVKB 3C8DA 2HLPA 4YEDA 4LISA 2DUNA 4MV4A 1JHXA 4PHHA 5F33A 3LQFA 2BH9A 3EXIB 3QKRB 4D25A 3AI7A 1JRLA 4FFBA 3TEMA 5K0SA 2JFNA 1UC4B 4GPTA 2O14A 3LX5A 1JAHA 4ND3A 3T9EA 2PANA 4QQ8A 5EGNA 1NG9A 2ZWVA 4NOMA 1LPBB 2RJOA 1V41E 4EHIA 4G0XA 4MV6A 3ZZTA 1NE7A 1RP1A 3OAAA 2Y77A 2G9NA 2BI7A 2C3OA 4H1HA 3ZTYA 2RAFA 2W43A 2WHQA 1MFZA 1OAKA 2ZREA 3NGMA 4M9CA 1T36B 1U8AA 5EWMA 4BV9A 4IXNA 2GT1A 4EA7A 3RODA 4TYPA 2DG2A 4P34A 1LFAA 2BFWA 4J29A 4LGVA 3FN4A 1OZ0A 4RPIA 2XRZA 3GN1A 1E1CB 1E2DA 1PDWA 4G26A 4UE2A 2YWBA 4RXTA 3AVXA 4PRZA 1JKXA 3NXSA 1QOQB 3DH0A 3K15A 3AZQA 3BH0A 3JVEA 3TE7A 2FRDA 4DCJA 2OFPA 2GFQA 1ZONA 3RS9A 4PPFA 3R3SA 1R0BA 3EVZA 4EQ6B 1ZGGA 1USVA 2PE5A 4EKGA 1DLIA 3T7IA 1QYDA 2PH1A 3KFVA 4JB2A 2IHTA 2KQUA 4C0JA 5M5BA 3WRYC 3A7EA 5JJLA 2PU5A 1FLAA 3WB1A 2AMYA 1T24A 3PC3A 3UATA 2ROQA 4EW6A 5M2QA 1C9DB 2EG9A 3DWEX 3KWJA 3PUVA 3BVPA 1LRJA 1ORHA 3DA8A 4AICA 4XQ9A 5CNKA 1ZD2P 1EPUA 1GXSB 1P1FA 1A8UA 1L3BA 3EVGA 3M4ZA 1MJGA 4J16C 3PBKA 1A9YA 2VJMA 1P17A 1CUXA 1T9DA 3EZ6A 3OZTA 1HSZA 1DT5A 1VMIA 2HGSA 1G3IA 3I5UA 5A3JA 1Q19A 4LV6A 3P4UA 4YJ3F 5REQB 2PZGA 2ZIGA 3U62A 3TD2A 1UBOS 3ETNA 3GFOA 3HP7A 4NECA 4ZO9A 1GFIA 2RDMA 3OOEA 5JECA 1JT9A 1SH7A 3TRKA 3LPNA 2XSZA 3B51X 4G9GA 3VBCA 3CLTC 1BE8A 5CFOA 1Z22A 2IYFA 3DXXA 4DIUA 4TRNA 4I6GA 4CM7A 3FMPB 2I1QA 1IY2A 3NAMA 1UT5A 4TQGA 3LUKA 4ZVSA 4QSHA 2O20A 3IH5A 2DLCX 5JD4A 1TF5A 4Q4JB 1QH8A 2IYYA 1PFYA 4L76A 4TV8F 4DG5A 4M8NE 1MH1A 1V3QE 3MAGA 3RTGA 3IO3A 4CL0A 5JDCA 4AY4A 4GX5A 4I9UA 4A6XA 3STUA 3TIGA 3DAHA 3F47A 2IU6A 4U00A 1OBVA 3PGLA 4BNGA 3JU3A 1PWYE 2PWYA 4ALLA 4GMHA 1CFZA 1Y6ZA 2L82A 3WMGA 5K9ZA 3UW3A 3H3FA 4KUHA 1EXNA 4JU9A 1Z0FA 3DBHB 3H5NA 1TO6A 3B12A 4JEMA 2MR6A 3FWYA 1T1SA 2JI4A 4KODA 2GGSA 1GZ3A 3RHSA 3FOWA 1FB5A 2OORA 1RS0A 1T8UA 3QOFA 1O97D 1P5HA 1ML4A 2YUIA 1TYBE 1A1SA 3TQHA 2WDZA 2VYCA 1YZUA 5DVZA 5C8DA 3T5MA 3HLKA 5LMUB 4BB9A 5FOQA 5EJ9A 3QOXA 1HNXB 3FKSD 1CNFA 1VQ1A 4RJLA 1ORTA 4M37A 5DLDA 3ACDA 4OP1A 2M6KA 1UC9A 3RYFB 3RHFA 4BQRA 4CR6A 1SZJG 4N65A 1PVOA 2J45A 3D2LA 3CZ5A 2QUZA 1JG4A 2E87A 3K9GA 4MCAA 5DT9A 1FFBA 2BFCA 4UCQA 3SP1A 4HV4A 1HV8A 4C6RA 3RH0A 1Z7BA 3L8DA 2NTEA 4RVGA 5HNKA 3ETEA 5I7UA 3FUWA 1MEEA 4FHDA 4HEA6 5JQGB 4NLLA 3WYFA 1CS0A 4K9MA 4DS3A 5ADVA 3RBZA 1YMVA 2Y1OA 5ARDA 2MJLA 1QMGA 4JOBA 2FPXA 3MT9A 2QVLA 2VQ6A 4I6EA 4AKHA 2W48A 1YZ3A 1ZP6A 2IYVA 2QX8A 1ZI9A 2YVQA 4HDRB 2BKEA 1IEXA 4JJFA 3PC7A 4QREA 1I4WA 1EEXB 4UZFA 3GFQA 1K88A 2ZATA 1R8SA 2VPZA 4G4IA 1RWNA 1TECE 5FO0A 2C29D 4BMXA 3W5UA 5HOEA 3TAHA 4KR6A 1VJ1A 2ZWAA 3I4LA 2J0SA 4LTMA 1JU9A 4IS2A 5D86A 4AT1A 1GUYA 2YXBA 5H3LA 4GNRA 1SBQA 3QMMA 2MR5A 3AU9A 4R9VA 4B3JA 3NTLA 1F14A 4HSGA 1XNJA 1U2QA 3NC1C 4QE3A 5CT6A 1XRRA 1B7GO 1IOLA 1YRBA 3IP1A 3EG9A 4LRSB 2QM7A 2WIKA 5CNIA 5CM8B 3WICA 1IG0A 1DJQA 1Z5NA 1BA3A 4NONA 5BORA 1JSLA 1EUZA 1OLSA 2VT3A 1PJ8A 2P4QA 4GPAA 4RMJA 3H5IA 4W7IA 2FSUA 1WMFA 2CNBA 3LGXA 2GEUA 1N5LA 3KHUA 3ZQUA 4O6VA 4Y2YA 2EJWA 3GVXA 3VPDA 3H4IA 3KXIA 2AD5A 3B1JA 3H13A 4W1SA 4L15A 4OFWA 3KSAC 1XCOA 2DWQA 1FS4A 1A5BB 1JDUA 2JARA 4H31A 3E9NA 1U2TA 4OX9B 1Y4SA 4B8ZA 5CVDA 2IUSA 3GRZA 3CIFA 4RA9B 2NLOA 5DHSA 2ZVJA 1KGSA 3OX2A 5MFPA 3TUZC 2RGAA 4BMZA 2QD2A 4KI0A 4LDNA 1E62A 4KHZA 2X86A 5GOZA 4K40A 1I2MA 1MKYA 2PUVA 4P3OA 3WHLA 1U0SY 4CT4B 4NQRA 3S2EA 5JPCA 3NPAA 1P2DA 3RBVA 1T6YA 1WEHA 2FR0A 5FBVB 3ZOKA 1JEYA 1KRXA 1PZMA 4FLMA 4MWZA 4FGLA 3GGDA 3AL0C 5C53B 2G4VA 2YZGA 4KNWA 2HM7A 3AFGA 3QG5A 4M1OA 1LBHA 2JF0A 1HM5A 3V8PA 2JG3A 1NN5A 1EVIA 1NXOA 3MTGA 5LQDA 2GLUA 3GLQA 2X9NA 1IZ9A 4D98A 4JDPA 1YQQA 1NF2A 2OBMA 1SRQA 4CLOA 1UPBA 3R23A 4OLHA 5ESDA 5IUKC 4OH1A 5F1KA 3VJMA 2GHIA 3GEHA 3NTXA 1V11A 2B8WA 4J0KA 4DDUA 3EH2A 4JGBA 1UMBB 5JSHA 3GMTA 5BYJA 1KXZA 1CRLA 3DZDA 3ZW8A 4YQZA 4PFSA 5CCEA 3VKHA 1E2FA 1MVNA 1XTKA 1NYRA 2ZU6A 1FVXA 4MRNA 4JCCA 2G7ZA 4N6OA 4LRXA 1CZUA 3N8GA 3AY6A 3UK1A 4B48A 1L1RA 1MGOA 2IIQA 3PQFA 4LRUA 4QGAA 4R7TA 3B52X 4H6WA 1P60A 2HREA 1T10A 3MN1A 5FADA 5DTRA 2RAUA 4UUOA 1ZRMA 2FWPA 2QLMA 1EM6A 2IQIA 3L5OA 4IIYA 4UTZA 5EYPB 3V4OA 1CZNA 2CV2A 1ZEJA 2I4MA 5HQ3A 2ZQ5A 3WV5A 1TCUA 3MB8A 4H9GA 1EP9A 3KT6A 3RIGA 1PTJC 2FGKA 2CCJA 4Z4HA 5CVJA 3RJTA 5A5VA 4KYVA 4XWAA 1IJEA 1FDUA 1O94A 5K20A 1G18A 3AEKA 4UNSA 1HDXA 3DDUA 4B6QA 4Q39A 3IP9A 3STTA 5B4VA 5TPWA 3GR6A 3FY4A 3BXOA 3KZVA 1HY3A 1B0ZA 2M2IA 4J9VA 4H60A 1L1QA 3NYRA 5CK4A 5HF5A 3KQKA 2NU8A 1V1MA 1Z75A 4QXOA 2PL1A 2RIRA 3KTAB 1RBYA 4JZKA 4LIPD 5HUQA 4PLHA 4A7PA 2IYOA 1PL8A 2E0IA 2YV2A 4WKCA 5FTJA 4QTZA 4ZVRA 1E3TA 3TZBA 1KSHA 3I1JA 4Y6GB 2DBZA 5AFSA 1LU9A 1PYDA 1FIUA 2VG8A 2Q07A 1AE1A 2XQVA 2HADA 4GPEA 4LXTA 1V16A 2I1VB 2C2ZA 3ZCVA 4CXMA 1QDLB 4CM9A 1XQVA 3R5HA 4I4TF 2CLIB 3L18A 1KVTA 1QH9A 2O8DA 3T3HA 3PNPA 5HJ5A 3KSBC 1ISHA 3FROA 4R1OA 2PZLA 4BBAA 3H2IA 3CN7A 3L8FA 2Z83A 3R7NA 3FBGA 3T3EA 5HW0A 1OIXA 1PKEA 2O8VA 5K5EA 3GDWA 3PSAA 1SBHA 1JHRA 3SZUA 4EQZA 1VPLA 2P2DA 3VSAA 4MW4A 4GMDA 4WIAA 2KBEA 4OMFG 1YMUA 3U80A 3L0BA 3WMFA 2XWSA 1TUBA 3KKOA 4OYYA 3ZLVA 1QOZA 1SCUB 4RC9A 3Q1KA 4RPKA 1VLZA 4URYR 2BTQA 4MP6A 1E99A 4UNPA 3CURA 1HETA 1GQ2A 3IIKA 1P19A 4H7IA 4DPLA 3QBEA 5KMGB 4JSRA 2CGEA 3V7WA 3VJRA 3I6BA 4O0MA 4HTFB 3UXEA 4REQB 5IVKA 1YQXA 5NLLA 2H2WA 1GPWB 3KCQA 1DC6A 4YTEA 3BJIC 5TMEA 2YMMA 3NHFA 4B5LA 3TLXA 4R69A 2EP5A 4FN5A 4EA8A 2JVKA 4JV5B 5CX1B 3RW9A 4K0RA 3VJLA 3DUFB 4OQMA 3WL6A 5JDIA 2P1DA 5TS3A 2QVBA 3W5CA 2ZR7A 3WHIA 4BV8A 1M0EA 2XCTB 5EJ4A 1LBIA 5LCXA 5L3SB 2Q3CA 1ZHFA 3WSWA 1U2EA 4TMZA 1IUPA 1QRRA 4WKBA 3UAZA 3C5HA 1B74A 2M9MA 4W8OA 5G0WA 3ACCA 2ZRDA 3GJZA 4QDJA 4ARAA 1SVWA 4EZIA 3LIPA 1P2BA 1B8OA 2XDAA 4L0QA 4I8XA 2EFCB 2PX3A 1Y6QA 2NVOA 1JH8A 5IAKA 1GZDA 1NBOA 2XQIA 1XQXA 1WXGA 1Q84A 2FPPA 4LVOA 2CZGA 1SKUA 1MFPA 2DT5A 4OBBA 3LFUA 5FEUA 2CNNA 2QLJA 3FPLA 5IASA 4JJAA 2HRDA 3AR7A 5ETJA 3ROEA 3ND8A 4ARVA 2M98A 2F3TA 3S27A 1FE8A 1GNLA 4FK8A 3AVVA 9LDBA 5K0BA 3NEYA 1NW7A 4XGRA 3HCOA 2D7JA 1IXRC 2OCBA 2QRLA 3KU4A 1Z34A 2ZPUA 3WQQA 5CH3A 4E88A 5K8LA 4BNZA 4BRZA 2YWRA 5TQ0B 4FIZA 4JA2A 3QKUA 1JAXA 3K05A 2PL9A 4UCFA 4B3DA 3T5AA 3OPXA 3COSA 3GJYA 3IQEA 1GCGA 3QGMA 2CFRA 4LXXA 2ECKA 3B5IA 3E3OA 3IFSA 4F71A 1HOTA 2LDBA 4NBUA 3OEED 2ERCA 3H8JA 2V7EA 3KLBA 5ITVA 4XI9A 3A6ZA 3UGKA 3TG2A 2ZIXA 3E3MA 4Q1VA 3ZV4A 1C4XA 4HD8A 3MCAA 6GPBA 5IDXA 1PVVA 5IZCA 5K8IA 2B30A 3E8XA 3IELA 3V55A 3FLMA 1X94A 3ZHTA 1QBKC 3MAJA 1TEVA 3HUTA 2ZPAA 1U7OA 1GAEO 4FFLA 5HBGA 1QRUA 4ENUA 2X15A 4GICA 5HGJA 2NZWA 2WAMA 3LUGA 5F64A 1P80A 3PU6A 3PQ4A 1V95A 4FYJA 4X6UA 3H18A 3E7PA 4DSTA 7YASA 5COAA 1KI4A 3ZXSA 9GPBA 3DBLA 4P3NA 2A5FA 4EBFA 1PSWA 1NPDA 4JVMA 3V32A 1UXKA 4CMEC 1T1IA 5C51B 4HAYA 1A2KC 5KHLB 5E2IA 2PIDA 4KVZA 3SM9A 3R6LA 4J1SA 1USUA 2WVJA 4OVKA 4YP9A 3VGJA 4AK9A 4Q66C 1EH5A 3N8NA 1WQ1R 5DHAA 3L49A 3TNYA 1JWBB 2RHCA 2PKXA 3D6NB 3E0QA 3S0JA 5EE1A 3KJZA 3AC0A 3RUCA 5C1PA 5JD5A 3FNHA 2YFYA 4N18A 1G0NA 1FW6A 3IPLA 1VKZA 2RKOA 3SHQA 5EXDA 3E22B 4J76A 4MULA 2QN2A 2O6LA 4XTCS 3SKXA 3SC4A 2QU8A 3RVLA 2BGUA 2J6HA 4LZAA 4OI2A 2B0JA 3MINA 5HKLA 4MQEA 3VR0A 1P1IA 1DOHA 2PBZA 3JWIA 4Q16A 3TVYA 2X9LA 4AX4A 1H9CA 3K9BA 1H2YA 3TOZA 4D8TA 3OJOA 3I04A 3OF3A 1AY0A 2VSQA 5JQGF 4TMKA 4B3GA 3QNWA 3SWWA 3AOGA 5HRCA 1XO1A 1KEEA 4AWBA 4WX2B 3TLGA 1YB5A 3LTNC 4NICA 1PGQA 1H6DA 2JZCA 3AKEA 3ZGOA 5EWMB 1UAGA 2YJNA 1Q0QA 3GRPA 4QZVA 3VTAA 3T06B 1MQ9A 3L1IA 2F6RA 1K8YB 4JLNA 2UUOA 5EKDA 5L3RA 2MWMA 3LHDA 4M0CA 3TPFA 2OCPA 3W6ZA 1K86A 5FT9A 1GZVA 2VJLA 4E5VA 5ALMA 5A06A 3W3AA 3KQYA 3ICEA 3N7UA 4ONEA 5BSFA 3U7GA 1WCV1 4WOPA 4CCAA 1JMKC 1V7ZA 3HZOA 1E9AA 3U4IA 2CLSA 3N0XA 3KDSE 1UP6A 3H97A 1V39A 4ALNA 1Z4KA 1EBFA 1QWOA 1YNOA 3G2HA 1J2UA 2Z9CA 4BO8A 4U8HA 5F1PA 2DM6A 4TMFA 3ORHA 1CV2A 3R9XB 1IM5A 1EVZA 5JNUA 3VO8A 1N92A 1WZUA 1XZKA 5F4BA 4NBNA 3I2GA 3SXJA 1PWHA 1Y8QA 3UK0A 4BQQA 3SYRA 4II7A 3SC2B 3ANLA 3BD7A 1W29A 1XCGB 5A9RA 4Y9UA 2W11A 2YWDA 3C1OA 2D13A 3H83A 1DBQA 2O4UX 3D4LA 2BMFA 4D0RA 3IT1A 4CI9A 3ZI4A 4GKJB 3NUQA 3QE2A 4Q12A 3FTEA 4RXMA 2CZCA 2DPMA 4MRAA 3LP5A 3F8WA 1DNPA 3QXHA 4EJSA 2NAFA 4JBNA 3AJ9A 3WKBA 3JYNA 1RKUA 2EHJA 2GPNA 2P5TB 3B82A 3H6GA 3P5SA 4OJQA 2Y6UA 4RFVA 4XFJA 3CVJA 1XNRB 3O0TA 5U1PA 4E1AA 2QGFA 1MNAA 3L7BA 2Z1DA 4LDPA 5JZBA 2D4AA 3ELDA 3D7KA 1CUUA 2FN9A 5KJFA 1EWKA 4ABYA 3CXRA 5KJ1A 2YL2A 3TI9A 2R6JA 3DDCA 1AURA 2EXXA 4GVXA 1RPTA 1W1IA 3CUUA 2AR0A 2R87A 3RG2A 2GZ1A 3KWMA 5CDYA 3BB1A 3DULA 4YB8A 5ALZA 3ZYZA 1U8FO 4B2PA 3H5TA 1ISJA 1DX9A 2L2QA 1R4ZA 1R6AA 2Q0SA 1AQJA 3HFGA 4QBIA 4P7BA 1X0VA 1YKFA 3IMGA 3RUAA 4ZOQI 2DUMA 5BW4A 5K0CA 3HO8A 3EEFA 2FR8C 3FAZA 3N2YA 4DZTA 2WA2A 5KAPA 2ZAOA 4XX1A 4QU8A 4CI0B 5BMVA 3LLUA 3DZBA 1KI7A 3E15A 4J3FA 2OY0A 3TQIA 5EZ6B 3A1EA 1J56A 1Z4LA 2HPVA 3U60B 1VKJA 2I7CA 1EDOA 5CB8A 5KSOA 3FD8A 3FPEA 4Q4HA 3CPSA 1E5VA 1QPZA 1J20A 5LUBA 1L1EA 2JFOA 2QTBA 4F3TA 3DV9A 2IZ0A 1ZD9A 2Z5LA 3N3AC 1V6AA 2OO5C 1P4AA 2YXEA 2QB5A 3DZGA 3OKPA 4OXYA 1CS0B 3KX2A 4MWTA 4RCYA 5DHTA 4RJTA 4LF6B 2B5OA 2VT2A 5TRTA 4K1XA 3DJFA 1T2UA 3RARA 1S0UA 3EB9A 4Q7EA 1DRUA 4NYMQ 1V9CA 4FYYA 5C1BA 4W1RA 2D7CA 3D2AA 3OO1A 4ETIA 1YCHA 2AZTA 3KKZA 1NWCA 2CWDA 3QTLA 4WFIA 2EFJA 3V46A 4V1CI 1F8XA 3FIUA 5GVRA 4NHOA 1D03A 1RYYA 4A6EA 2AOUA 2JGAA 4NIMA 3OIUA 4BC0A 5CLJA 5DTEA 2CF6A 4LE2A 4A8JA 1M67A 1A4RA 4H77A 1JIKA 2EWWA 3ANTA 4M98A 5CHYA 4DJTA 1V48A 2AZDA 3ME5A 4I5GA 3VGPA 5IT4A 1MX1A 3AYZB 4K9NA 2GVZC 4QWMA 5DTQA 3WNQA 4CKWB 5E7IA 2QMUA 5HUJA 5JZOA 4BN4A 3FDJA 1JNYA 3ZCTA 1R5JA 2C0QA 1EYZA 3ICPA 2PGOA 5KPDA 4NE7A 3NTQA 4Q47A 1A9SA 3FRHA 2XYPA 3EG9B 2CNWD 3LECA 1IY8A 3EIQA 4FDVA 4Y98A 3UJNA 1KIMA 1MVLA 2Y1KA 1D4AA 4MR9B 2D3TA 3D0KA 3Q3EA 1P7ZA 2P78A 3A4TA 1OLSB 1LSSA 1OQAA 2QTCA 1XU4A 2NTVA 1TKCA 1C9NA 3DWGA 3QU5A 4A8TA 4KH0A 4G1MB 3LC1O 4KSCA 5CUQA 3D54D 4H2DA 1FNBA 4G0NA 4JU8A 5LN1A 3N7TA 2ZIWB 3D3EA 4QA9A 5I7HA 1PJ3A 1NW5A 2GAFA 3SQXA 3PRJA 4EFMA 1PHRA 1HEUA 2G17A 2OP1A 2IIPA 1U8XX 1PJCA 4TMWA 4TTPA 3TLJA 4A6PA 2JFZA 1J21A 2J32A 4IF4A 4OXQA 4PRYA 1M6YA 5CJJA 1SULA 4QTXA 4IQFA 2PUAA 2CUTA 1C0EA 5DGDA 1NAHA 4ARUA 1GGKA 2CVFA 3I9OA 3HZRA 5LLDA 4YBRA 2W6PA 5CYOA 1P0IA 4YJFA 3UCXA 3AEXA 2MCFA 3WJ7A 4QG3A 1C3VA 1D6JA 2B69A 4DC0A 2Z5FA 4DKJA 1DO2A 2H5JA 3WE7A 2GPSA 2JIBA 4QL3A 5DGHA 2IH5A 1M2HA 1JEYB 2DWPA 2AUMA 2Q5LA 3HH8A 3HBLA 1CZRA 4HVAA 4K5QA 4EJ6A 2DKFA 2EG5A 2E7ZA 3EZGA 3NP7A 3HO1A 4P93A 2TYSB 5B5SA 2W8BB 1YZQA 1IRIA 1SY7A 1Y3CE 2PEYA 3K0CA 1GPBA 4NCHA 4R1UA 2XNJA 2QTMA 4DF3A 3MS2A 3D6JA 1GAWA 3EC1A 4RKQA 5IJXA 3RSFA 4IMIB 3CNHA 1LVHA 2V3WA 4XH9B 1Z25A 3IA7A 1IHPA 4S2UA 5JBIA 3SBOA 3PUWA 1UWVA 1OXTA 1PUIA 1V11B 1VSTA 2CXUA 2J9YB 2Z5VA 3QPCA 2MINA 4KTTE 3G8CA 4MGKR 4PVDA 1OBCA 4MO2A 3RV4A 1R5NA 3TPZA 3VPGA 5DNYB 2DU8A 1JKFA 3VU9B 1CUFA 1YFJA 1Z6AA 3RNLA 1R12A 3SX0A 4DCPA 4YASA 3E9QA 5ISMA 2ZUBA 4RQBA 3A27A 4Y2UA 1QG6A 4P32A 1KOGA 3QFRA 4ZPXA 5TLSA 3R7DA 1OHHA 1EFKA 2BM9A 4GHWA 2YQZA 2YV5A 2ZYGA 2XYHA 5F3DA 1TADA 2ZIFA 3MC1A 2VP5A 4OQDA 5HQ3B 1FYWA 1W94A 1QV9A 4NQZA 4RTSA 1NVUQ 2C1XA 2ZR8A 3ZU2A 4WT7A 1WAMA 5J2TA 3JYQA 1KGDA 2FN4A 1KJ9A 2R96A 2WHRA 3EMKA 1Z2DA 2ONKA 2ZRCA 5IAAA 3ROTA 1KTIA 5J58A 1EDDA 1N0HA 2JJ1A 2VTKA 2WBLC 4GFDA 4L7QA 5DP2A 1OPXA 2H1SA 3B7WA 4L27A 5IJ0A 2IS1A 5AM0A 4DVJA 2OGWA 1CDEA 1V1MB 3CRQA 3B85A 1J49A 1QIHA 2XT9A 2ZB3A 3BHMA 2J3JA 4JI3B 1WXXA 3ZWNA 1SG6A 2Q5FA 3WGMA 4F4HA 3H3JA 3B78A 2QXUA 3C3AA 2ATIA 1Z0DA 4WCFA 1JG3A 4CGZA