1ZNXA

Crystal structure of mycobacterium tuberculosis guanylate kinase in complex with gmp
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
182
structure length
182
Chain Sequence
VGRVVVLSGPSAVGKSTVVRCLRERIPNLHFSVSATTRAPRPGEVDGVDYHFIDPTRFQQLIDQGELLEWAEIHGGLHRSGTLAQPVRAAAATGVPVLIEVDLAGARAIKKTMPEAVTVFLAPPSWQDLQARLIGRGTETADVIQRRLDTARIELAAQGDFDKVVVNRRLESACAELVSLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unique GMP-binding site in Mycobacterium tuberculosis guanosine monophosphate kinase
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Guanylate kinase
total genus 53
structure length 182
sequence length 182
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2005-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 1znxA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1znxA01
3MWJA 1KIMA 1N0WA 4ZCIA 2TMKA 4QBFA 3LNCA 3ZS8A 4JLKA 2ORWA 4UKDA 3X1XA 4LOAA 3GLGE 2HYDA 1XEFA 2OSBA 4NYIQ 1GILA 4S2EA 4ZPXA 5G41A 3PEWA 3HJNA 1Y63A 2QPAA 1G5RA 3FWYA 3W90A 1FUUA 4F7WA 1W5SA 1R7RA 4NZYA 1DAKA 3OESA 1QG2A 1XMIA 2VSOA 3LW8A 3TGPA 1IN5A 2VBCA 1RYFA 4XTRA 4HLDA 2AN9A 4GOJA 4K8OA 1NBME 1LTQA 2VQSA 5JS8A 3VR5A 2EFDB 2W2XA 3SJBA 4EKDA 1FTNA 1I4TD 3D8BA 4TMVA 4GI7A 1P5ZB 3KDSE 3FHOA 1OB5A 4URUR 3U44B 3FMFA 3SJAA 3A4NA 3PFIA 4C7OA 1A1VA 2PMDA 2ZR0A 1J90A 2FWRA 4BLRA 1G17A 3IEUA 2XSZA 3IILA 3P32A 1E9CA 4IDNA 4LBYA 2WSSA 4PAOA 1RRCA 2C96A 4JVLA 4OHXA 1SQ5A 4OK5A 2HXSA 4XOIA 5KDOA 4Q48A 2BHRA 2F7SA 3B13B 4ARZA 4DRZA 2ZE8A 2FMXA 2WV9A 4UNSA 3THXB 2ZR7A 5EE3A 2GJKA 3VFDA 4DT1A 2O0HA 1VG9B 2IUTA 2C04A 4LJ6A 2CVHA 2QRNA 3A58B 3E5HA 1HURA 1GVNB 3TUIC 1RVDA 5DISB 2DHRA 2HJGA 2ZANA 1SVMA 1E2GA 1RKBA 2GCOB 3DM9B 4PSAA 2WWXA 4Q4AB 1Z8FA 2PBRA 3B8HA 3A36A 1XBTA 4LHVA 4UNQA 2H5EA 5EP1A 4BRUA 2DWQA 2XNSA 3VHLB 4EJSC 5CM9C 4GBMA 3U7FB 3NG1A 3MWYW 1S3SA 5KSZA 2O8BB 5TARA 1TEVA 2G0TA 1E94E 3G82C 3GFOA 3LBNA 3NC0C 1J99A 2OE2A 3L8YA 3R20A 3TQCA 3C5HA 3LA6A 2J41A 2VP4A 1ZUHA 4QGAA 3VR1A 4C0QC 2Z5FA 4DCUA 4PXAA 4PR0A 1G3QA 3RS3A 2Q6TA 5FL7A 3LH5A 2GJ9A 2H8KA 3BB4A 2VLIA 4DT1B 4TMTA 2XZOA 1DE0A 1J8YF 3CRVA 5K8UA 2WIBA 3IIKA 3LBIA 3K09C 1SXJA 3SR0A 3X1YA 3A6PC 3OF5A 3GJ4A 1U2RA 2QP4A 5CB8A 4HB0A 3QF4A 1TEXA 5FFMA 3TVDA 3VNVA 2ZJ2A 4TL7A 1E2MA 1KO8A 4XWOA 1XJQA 1IQPA 1OIXA 1GSIA 1XTIA 3B1VA 3HDTA 3U4QB 2O8BA 2YJTD 1AN0A 4Q1DA 3KB1A 3EZFA 4KVGA 3GCGA 1KMQA 4LHXA 2BMEA 3FHTA 4B73A 2ZTSA 4MUAA 4D4MA 2IX3A 4A2QA 2GK6A 4LC0A 5C18A 1VMAA 3G0HA 5FOSA 4MRNA 2G83A 3SBEA 1IJFA 3UANA 4D0GA 1J7KA 2FU5C 2D74A 4PQYA 4C0AC 3CWZA 2IS2A 2QP9X 3EG5A 4FMCB 3MWKA 4OKSA 4DCSA 3IQXA 4B2LA 2XGJA 2R6FA 5AWFC 1OHHD 2A5DA 4FMDB 1KSJA 2GEDA 2ZRGA 3HU3A 4LYAA 1KO7A 3OE7D 3OFNA 2GETA 3QEJA 4GPTA 4GRAA 2OAQ1 4DCNA 2ZRJA 3KX2A 3NEJA 2P5SA 4C3ZA 3MJHA 2J3EA 1GRNA 1W2GA 3Q85A 4RZXA 1KKMA 1L4YA 1ZUNB 3BORA 2XNDA 2PCLA 3PEUA 1HTWA 5TXGA 3NWJA 2P6NA 5G3YA 1NBMA 3CF6R 1E6CA 2HCJB 4HAWA 1UADA 5JI2E 3B60A 4RFSB 1HT1E 3A1TA 3IUYA 4L16A 5DIFA 3SFVA 2EQBA 2QENA 1YR6A 2XTZA 1M7BA 3HWSA 1G6OA 2AD1A 2D06A 3R9IA 3ZYCA 2R6GA 1WF3A 1PLLA 5HE9A 1XTQA 4DIDA 1IOZA 1PLJA 3QNUA 3W6PA 3PUZA 1CF4A 3QKSA 4P33A 1N6KA 2QM8A 3SJZA 2B21A 2OXRA 4YMWA 3ZDQA 2PZFA 1T8TA 2ZI9A 3IO3A 4V0NA 2FFHA 5IRCD 1ZD9A 3ZVLA 2CE2X 4NCIA 4RD3A 1BS1A 1DG1G 1MR3F 1Z6TA 1E0KA 6Q21A 2PX3A 3E1SA 4JMPA 4LWZA 4NL4H 1C9KA 2R65A 5EQTA 4MKHA 4D2IA 3SEAA 2EWWA 4LJ8A 1JEDA 2WWYA 3UMRA 5FI0B 1GP2A 3PG5A 3VKWA 4ZIRA 4FCTA 2ASEA 3NEYA 3QVUA 3WRXC 4KFRA 1R10A 1G3RA 1P9WA 2NGRA 3QE0A 2V1UA 1E32A 5UKDA 4MGYR 1K8RA 2V7QD 1EFHA 4LJ4A 3KJIA 1FW6A 1Z2CA 2BJVA 3TLXA 4LJAA 3CZQA 1QHHB 8OHMA 1UAAA 2J46A 4I99A 5JWRA 5DSZA 4PO1A 5EZ5A 2ZI5A 5KDDA 3IPXA 3MMPA 4ZKDA 4LSGA 3EA5A 2ZRLA 2ZSFA 4Q1AA 1SVWA 3ZVMA 2CJWA 2VYFA 1ZIPA 2I1QA 2O0JA 3T1VA 4DLYA 2ZYVX 4L8GA 1KSHA 2WWGA 2CDNA 5FBQB 3S1AA 3AKYA 3DL0A 4US0R 2VP9A 1V5WA 1SVIA 3CKLA 1B0UA 1ZJ6A 3ADKA 3QVVA 5JWHA 4KSBA 2FA9A 3VU9A 3I5YA 4OJKA 4PC1A 2XTNA 4MKIA 4P4SA 5FTJA 1JBKA 3U3OA 1T5LA 1WDTA 1OFIA 3EPHA 1DTSA 4Q1CA 2GA8A 4JJKA 4PQRA 2QUZA 2F6RA 3RABA 4OL0A 1NL3A 2JA1A 4Q7KA 1G9XA 3DM5A 3PCRB 1TX4B 1IHUA 1G8FA 2DWPA 2JLXA 4HZUA 2GCNA 3Q8XB 1TQDA 3AKEA 2Z0MA 1Q3HA 4DLTA 3EPLA 1D2NA 1E9AA 4NE2A 3VHXA 4C0KA 1XD2B 3PUVA 1VCIA 4H1VA 5K8TA 3KB2A 3CPJB 3IEVA 3RRYA 4PQFA 1AZTA 4ON9A 4TMXA 4QHTA 1NLFA 1BMFD 4Q4HA 4EPTA 1NVVQ 1QHHA 2YWHA 4EIWA 2YINC 1XTSA 4P4TA 2QT1A 3RWMB 3Q72A 5CIWA 2JDIA 3IHWA 3I92A 3Q5EA 1WMSA 2AWOA 2IBMA 1U8ZA 3NH6A 4PC2A 4QL3A 2VHUA 4A1FA 2ZSBA 1UEIA 2VEDA 1BOFA 2LWIA 1WXQA 3C15C 2QI9C 4QNRA 2BKEA 3LY5A 2VHTA 4A8JC 1OE0A 3LXRA 3GFPA 1W0KD 1W0KA 2P67A 1UBGA 2CNWD 2O0KA 4HLCA 2FNAA 1GDDA 4R2HA 4POAA 1NJFA 3WYAA 1F3OA 1NY5A 5FPHA 1EESA 4A0HA 2XZPA 2N1BA 2ZAMA 5AUPB 3QY0A 3ZS9A 2VHQA 3HR8A 4LI0A 4PPQA 5TDHA 4C7OB 1FNMA 4IVQA 1W4AA 5LD2C 1COWA 2QNRA 2XB4A 4OQLA 1Z29A 5GJBA 1LB1B 2GDJA 3NHAA 5CYOA 1KDPA 4H1UA 2V4ZA 1RIFA 3LVRE 4MKGA 1N5KA 2GXQA 4MITA 4BGDA 1WCV1 5G3ZA 3CZPA 1XXHB 2AD5A 2GCPA 2XJ9A 4IOKA 4ZCLA 4DDUA 4UXHA 5EXXA 3DZ8A 3TE6A 4B6FA 4V0OA 1XMSA 2QMHA 4TMZA 4IDOA 4XVQA 1XTKA 3T15A 3TUZC 3L8ZA 1GL7A 2D3WA 2F1IA 4PZLA 5JS7A 2ZVQX 2AFIE 1IN8A 3K8YA 4TYNA 4DLRA 1DPFA 4RD6A 3NBZC 4LV8B 4TSFA 5L8VA 1S9DA 3FTQA 3ZZUA 1E4VA 1RRGA 1QHIA 4M1TA 1EXMA 2FG5A 3F5FA 4EPYA 1RPZA 3U7EB 3B7GA 2ZRNA 4XWKA 2FGJA 3CX6A 1EG7A 3D7MA 4EPRA 1R5OA 2FX3A 4PZZA 2H7VA 1OXVA 1YZKA 2AXPA 5GJVC 1NI3A 5FPTA 3KFVA 1Q1QA 1G7CA 1CR4A 4QGGA 3K9GA 4XVRA 3FGNA 3RS4A 5LD2B 4QM7A 4F4CA 4IFBA 2WMOB 1CULC 4D81A 4DUGD 1CS4C 2Z6VA 4IOMA 5KSPA 1DAHA 2JIZD 3PXGA 1PUJA 1OW3B 1XJCA 4G0NA 1NG9A 1YVDA 3EWAA 1WE2A 1TUIA 4DB2A 2WOJA 1FL9A 4GZLA 4HLQB 2QSYA 1U0LA 3RSOA 2P65A 4NCHA 2G6BA 1E9FA 3FMOB 4JSYA 1W36D 3B2EA 3GLFB 3B1YA 1QHXA 2PH1A 3AVTA 1QG4A 3JVVA 1X8JA 3PQCA 4JVMA 2OBMA 2WAXA 3RDPA 4BLQA 3SS8A 4XVUA 4V0ME 1DAIA 4DVGA 2BBWA 4MYCA 2IHYA 4V0MA 2GNOA 4Y0AA 5E7MA 4UXJA 2FDCA 1P9RA 4BFYA 3UWOA 2ZI3A 2J0QA 1FUKA 1NKSA 4B44A 1MV5A 3V00A 4Q1FA 4V02A 1W36C 2IUSA 5FBWB 2IYQA 4WZ6A 4BFWA 1BH2A 4AURA 1AKYA 3UPUA 1GWNA 2E87A 2JEOA 1ETUA 5C46F 1F5NA 1W46A 3EIQA 1R8SA 4QM6A 4FW9A 3THXA 2W58A 1XD2A 3PUWA 3TMKA 1VIYA 2RMKA 3IQWA 3CPEA 3IDQA 4O2LA 1AS0A 1NVXQ 1L7VC 1WQ1R 3N5CA 2X19A 4UNRA 4PHTA 4TMKA 3B1XA 3W5IA 3L0PA 5K8IA 4GT1A 4QNMA 2W0SA 3FYHA 3K70D 3GLIA 2EW1A 3K9LA 5ELXA 4YXWD 3RNLA 4KITB 3KXIA 2GEUA 2R62A 4RFSA 1TQ6A 1SHZA 4KFUA 4D4KA 2ZYWX 2HLDA 3BFVA 3THYB 1U0HC 4ARZB 5JEDA 2W6JA 2OBNA 1O87A 4FCWA 1XFAA 2FFAA 4PHGA 4B2PA 4KYIB 2NG1A 3R9XA 4LV5B 3KQNA 1BO6A 1S9HA 1SKYE 2CLDX 4V0KA 1KHTA 3OFND 1ZAKA 3I8XA 2W6IA 3TNFA 1U9IC 3OEEA 3T12A 3PIRA 3TSWA 2B8WA 4URVR 2C9YA 2RGCA 4Q9HA 1JXMA 1W7AA 1BYIA 2FFQA 5FUVA 5SZKB 2AK2A 1G18A 1E2IA 4HB2A 3KUCA 1JAIA 2JJ2D 1A5TA 3AF2A 4W5HA 2ZRAA 1AGRA 2W6ID 5CLQA 4A36A 1MO4A 4JZKA 3T34A 4YMVA 2BEJA 2X2EA 1CKEA 2F3RA 3U2QA 3L82B 3FPAA 3TR5A 4L4UA 2WWWA 3W9YA 1II9A 5E95A 3EIEA 4A9AA 2CJWB 1G8GA 4ITRC 2I3BA 4KSCA 1IJEA 1KSFX 4B76A 4WVFA 1XMVA 1LVGA 1C4OA 4YXWA 3PV0A 4II7A 5E7JA 3WNBA 4CDGA 4DCTA 1RJ9B 1X1SA 2UZ3A 4M1MA 3GLIB 2HCBA 3A4LA 5J4YA 3BFXA 2G1KA 3E70C 4IEIA 3K0AA 1N3BA 1TF2A 5EP2A 4CW7A 2BMJA 4G5GA 1P6XA 3Q5DA 2IYRA 2FEOA 3ZVRA 2GF9A 2J87A 2V8OA 1TQ4A 3W5JA 4MYUA 1EX6A 5LB2A 2WBLC 2NTYC 3GEEA 1UBFA 3GLHA 3EARA 2CK3D 2PL3A 4GZMA 2GXSA 2H18A 3EWSA 1U90A 1DAMA 2HF9A 3W8RA 3W6OA 5BN3A 4JVNA 1KDOA 4LYHA 4AD8A 2W83A 4IXMA 3AF3A 5A5GA 4HDQB 2RGBA 5J4KA 1VYVA 2KWIA 3KKPA 1OB2A 1PZNA 2DFKB 2PT7A 4D0NA 1RRPA 2FEMA 2WPDD 1KO1A 3P26A 2D4HA 2QE7D 3OAAD 5KPDA 2FSFA 1W0JA 1G19A 5FOVA 3WP1B 4YMTA 1P75A 3JZMA 3UMFA 2XXAB 2CL7X 1US8A 3H84A 3O8DA 3Q9LA 5JCZA 3O8CA 3U3MA 2HYIC 2GCOA 1H8ED 4B6EA 1G5PA 2AL7A 4HDCA 4B47A 5JCPA 2FJUA 2JATA 5GADl 2A5JA 3TQFA 4DUGA 2MSEB 2EWVA 2YZ2A 2OCBA 1QHSA 1VCMA 1H65A 2YKGA 4Z8YA 5J4VA 2AX4A 1XWIA 2WSMA 1KI8A 2Z83A 2HT6A 1CR2A 4YMSA 3ADBA 3H1TA 4JVSB 2XOKA 4A2WA 1KSGA 5JRJA 1E4YA 3A1VA 4PHHA 1XTJA 2A9KA 3AVVA 3ZVNA 3LFUA 1TU3A 3HYRA 4Z54A 2HXYA 4Z8XA 1ZC3A 2QQEA 2ZJOA 4Q7MB 2WJIA 1SHKA 2AFHE 3P20A 1AQUA 4BQSA 1U9IA 1R2QA 3U7HB 3R7WA 1G3UA 1MABB 4TSFD 4NTZA 4D4LA 2MSDB 2ANBA 4OQFA 2ZSEA 2PCJA 4YQFA 2ZJ8A 3TIFA 2BCJQ 1TF7A 2RGAA 5EE5B 1G8PA 2DY1A 5G40A 1JR3E 1NY6A 5DN6A 2D62A 1Q57A 3CNNA 2OILA 1G3MA 4HLUA 4XH9B 2JLZA 1E9DA 1FQJA 2BC9A 3FFAA 1ZVQA 2QU8A 1IY0A 4PPGA 5AJYA 1N6HA 4OJQA 3U60B 2A7QA 1XP8A 3KFXA 1M6NA 3KKOA 4RVCA 4HDOB 5CB6A 3DVLA 3H0KA 1EX7A 1UPTA 4OBEA 2IL1A 5JSZA 1COWD 4IDPA 2FFBA 3QPWA 1N6PA 2VRWA 4QBHA 3ZH9B 1ZNYA 4XTCS 2ZM5A 4OQNA 2WICA 1NG1A 2IWRA 1AGPA 1PV4A 2QTHA 2Q3FA 3LBHA 4OHVA 3SHFA 3QXCA 3K53A 2FZLA 3VR4A 4OI0A 2ZROA 4GMDA 4QFMA 1ZNWA 1EFTA 2HUPA 3MGCA 2Q21A 2GESA 4Z1MD 1S1MA 2OBLA 2ZUDA 3K9NA 1Z0AA 1NSTA 4HZIA 4RZ2A 4FWTA 1E0AA 1IM2A 1F60A 3E2IA 3LQRA 1T6NA 4AYWA 4C0JA 3DPUA 2Z4SA 4HAXA 3UWKA 4R9UC 3VNUA 4TQUS 1TTTA 5AJXA 3B6EA 2HEIA 3R7WB 4ZKEA 4ZDJA 2PJRA 4LZZA 1SXJE 4ACAA 4GFDA 2QRZA 4LPSA 3UIEA 1ZCAA 4P4SB 1XTRA 2BBTA 5B57C 1QHYA 4JSTA 3M0EA 1KI6A 121PA 1SULA 1UJ2A 3A4MA 4UJ5A 3RWOA 1Z0IA 1YZNA 3AVXA 4C0SA 3GJ5A 3TAHA 2E9SA 3NDPA 1FQKA 2C03A 1BMFA 5F98A 2O52A 3GLFA 1J8MF 1NLYA 2DFTA 2ZJZA 1JECA 3GLFE 3PUYA 2IYUA 1KY2A 2WKRA 4RD2A 2D2FA 2NMVA 4TT3D 5FTMA 2BWJA 3K0CC 1M34E 2X77A 2DB3A 1JR3D 2PEYA 1U0JA 3K0FA 1EFUA 1EWQA 3GLHB 2C95A 3CF2A 4YONB 4QKQA 1JEEA 1KK3A 3J81k 1TQ2A 4Q4HB 5KSOA 4BRWA 2FGKA 4TL8A 4RKFA 3AQ4A 1NF3A 1NMZA 2RHMA 1XEWY 4FIDA 1MOZA 3CH4B 3CRQA 5FBRB 1P2TA 1VCNA 2ZSAA 2ODWA 3GFTA 4HB3A 3OEHA 1AQYA 4HAZA 2VPPA 1P2SA 1XRJA 2WJVA 4JYBA 5C4MA 3WBKA 5EJEA 2J5XA 5BN4A 2F9MA 4OQXA 1E9SA 4Q1BA 1GKUB 4B43A 4PO8A 3T06B 2C5LA 1RW4A 2JASA 2V1XA 3I3SR 1UF9A 2VP6A 4ASUA 4BEBA 2WJJA 4UQOA 4A6PA 3PITA 1FP6A 2NO6A 3NH9A 3ZZ0A 2B7BA 4YDSA 1GKIA 1OH5A 4CEIB 4C2TA 1CIPA 2IEYA 4E03A 3X1DA 1DAEA 2ORIA 5P21A 4F91B 4A0GA 2WWIA 3QIAA 1LNZA 3RVBA 1GNQA 4Q9IA 2IS1A 1OIWA 4MRPA 1R5BA 2J0UB 3L0SA 2PLRA 2WKPA 1PLKA 4M21A 3LLMA 4CT5A 4JT4A 4M8NE 3BGWA 4YC7A 1DOAA 3SC3A 4QOSA 3FFBA 1SKYB 3OEHD 2RCNA 4NBSA 4RZUA 1D9ZA 4BFTA 5G53C 3R9WA 1FOEB 4I1VA 3ZQJA 4BLTA 3OHMA 3CNLA 1KJZA 4CZ2A 5JEEA 5KNBA 1H8HD 3TW8B 4A0RA 2LKCA 3BD9A 4R71A 2HT1A 1JR3A 2ZUCA 4FD2A 3BERA 4A92A 3NKVA 4Q4LA 2CHQA 2UZIR 5JHHB 2CL6X 1GNPA 1P60A 3FKSA 3DKPA 4HZUB 4BLPA 4CEIA 1CBUA 3IHLA 1OJLA 4M0LA 1T3HA 3QSYA 1OKKD 5FTNA 2EFGA 2YWFA 2GK7A 4A0FA 3RRZA 2Q3HA 2YWEA 1NP6A 3T1TA 2J0UA 4B35A 5EP3A 3UKDA 4PFSA 3BB3A 2VA8A 2YHSA 4PAQA 2LCFA 1F6BA 5HKKD 4LHWA 5L3VA 4I1OA 4DCVA 2AXNA 5TVKA 1SXJC 1NSFA 4DLZA 3NBFA 1P2VA 1S8FA 2IC5A 1Z6YA 4Q1EA 1W5TA 1N5LA 1XX6A 2OM2A 3A1WA 4RFVA 3VX4A 1P3JA 1T3LA 1WP9A 1HQYE 3BE4A 4EJSB 5BYKA 1YR7A 4Z1MA 1JPNA 1I2MA 1FZQA 2GF0A 2ZVPX 3B1ZA 2BM0A 1E9BA 3B78A 1R4AA 2XNDD 1LS1A 1T5IA 4CGZA 2FF7A 2V9PA 2JAQA 5FTLA 3PEVA 5K8LA 4QC2A 4CVNA 1EFRD 1LFDB 1E0SA 1UBCA 2ZE5A 1SKQA 4TYYA 5DNYB 4P31A 4B48A 3VQTA 1VHTA 1AIPA 2JGNA 2A5FA 3EASA 2J7PA 3ECCA 4X8LA 5J47A 5M04A 1W4BA 2P0EA 1NN5A 2ZU6A 1YKSA 2B92A 4U5XA 3MLEA 4GNKA 1G16A 4OI1A 3U3KA 4C30A 3UXMA 2WJYA 4P32A 2QTFA 4MGKR 2J45A 5AUNB 1ZUIA 3U3JA 1YR8A 2FH5B 2ZIAA 2JLRA 5DN6D 3QKRB 2UVQA 3CX8A 4NYIR 1VG1A 4C4PA 1U98A 1RRFA 4NCNA 4QJ5A 2D2EA 3REFA 3SJCA 5A4JA 3SDZA 3SU8A 3GD7A 1ZIOA 2OESA 4E07A 4R7ZA 5JHGB 3OZXA 4B3XA 3THOA 3PR1A 3KZ1E 1JQLB 1G8HA 2ZJYA 4MH0R 4QJ3A 2G0NA 1VHLA 4NKRA 1E1QD 4ZI2A 2WMNB 2VHJA 4Q18A 5EUQB 4HUTA 5FOTA 3QENA 5FUWA 3QXXA 3H4MA 3WY9A 2BEKA 3GQBA 4JT2A 3HPQA 4JLDA 1XJ0A 1KK0A 2NZ8A 4DLXA 2ONKA 1YRBA 5JMTA 1NN0A 3QXSA 4IHQA 1KDRA 4TMWA 2CHGA 1KI4A 1OPXA 2NO9A 4A4DA 1OIVA 4JIMA 2GXAA 4F93B 5JZVA 5KUTA 1XB2A 1GITA 2ZS9A 1JALA 2CBZA 4B3CA 1F2TB 4LJ5A 3JZAA 4Q66C 4E09A 4DXAA 4QBGB 2RGNA 1NN3A 1RFLA 3K0EA 4EFLA 2ZEJA 5IT5A 4TWZA 3H2YA 4U02A 2Q9CA 2EYUA 3WNDA 2YOGA 1XMJA 1R6BX 2HDNB 1GL9B 1MABA 2P5TB 4N3NA 2CHVA 3CUEF 4Q4JA 4C0LA 5IF9A 4C9BA 1OFTA 4M1SA 5TY0A 1NN1A 1ZP6A 3CX7A 1GM5A 3FB4A 1KKLA 4N0DA 5F3WB 1E2LA 2YC2C 2RGDA 5IK2D 5BWMA 1RE0A 2MSCB 2WPDA 4RCYA 5HE8A 4K46A 2VSXA 2OLKA 2PX0A 821PA 1DELA 5HPYB 3A1SA 4L15A 3A1UA 3CO5A 1O3YA 4CF7A 2G1JA 4O0MA 4BZPA 1LF0A 4DSUA 1BKDR 5CDFE 5CDFA 1DVRA 4US1R 1DO0A 3OIUA 3O8RA 2EYQA 1C1YA 5GJWC 2XSZD 3EZ7A 3ASZA 4PC6A 3ZQ6A 4ESVA 4JLVA 1A4RA 3IIMA 3AP2A 4C0HA 2FOLA 2QL6A 4M1OA 4KJZA 4LYJA 1P72A 4RD0A 1OXTA 4RJLA 3K0SA 3GJ0A 3WNCA 1NRJB 1QHGA 4AKEA 3K0AB 2NO0A 4D6PA 2Q9AA 5FBVB 4ZCMA 5JJKA 4W5JA 5JRZA 3CWQA 2Q3MA 3LXXA 2C77A 4L5BA 2ZITA 4B3FX 5C2JB 1G64A 1E1QA 2RHDA 1E2KA 2F43B 1GG2A 5SZIA 1M1YE 1XU4A 2YC4C 4KODA 2DCUA 3VR3A 2H92A 2ZRKA 3D6TB 4DWJA 3CM0A 1Q44A 2A2ZA 2GJAA 1M8PA 1AKEA 3WMGA 1R0WA 1X8KA 3I5XA 2ZRMA 1OFUX 3B9PA 2C8VA 2Z4RA 2JJ8A 3MAAC 1U8YA 3HU2A 3EZ6A 4Q9KA 2WKQA 1XCMA 2L0XA 1LV7A 1ZINA 3CR8A 1G41A 4PPNA 4KFTA 3THWA 1XPUA 1ZNXA 1HY3A 1OSNA 3KXKA 3EAQA 4WW0A 5D3MA 2J7PD 5H1YA 3MRSA 4OI4A 1XNJA 2NO1A 1NVWQ 3CW2A 3OEED 5GVSA 2VP0A 3T1QA 1KO5A 4QGFA 3ADCA 3W6NA 1GAJA 3QPUA 1I4LD 2F1HA 1AS3A 1EFRA 1Z5ZA 2NZJA 4XSGA 1E1RA 3C5CA 3DMNA 3W3AA 1NVVR 1XZPA 4W9MC 2A5GA 3ADDA 3Q7QA 2FSGA 3EW9A 5DLQC 1HH4A 2YNMA 4IDQA 5DI3A 5E4FA 1G21E 3ND9A 4C0BA 1VKJA 2NIPA 2HLDD 4LCBA 2KBEA 4V03A 4A8JA 4ZDWA 4DLWA 1Q1EA 1F2UB 1KNQA 2QBYB 2P6RA 1LW7A 1W2HA 2IW3A 4AWXA 4Y0VA 2GBLA 5C4GB 3SYNA 4LUCA 1L4UA 1KOFA 2QMOA 2J7KA 4OHYA 5FOWA 1ZM9A 2ZS7A 4KAXA 3KKQA 4OK6A 1GL6A 1WRBA 1E2FA 4QHYA 3DO6A 4D4JA 1UKEA 1Q1BA 2ZREA 1NMXA 5D3MB 1GKYA 2WOOA 3TBKA 2A78A 3BC1A 1YZGA 2REOA 4CEJB 2IF0A 2ZPTX 5EXTA 4EPWA 2OFXA 1S2MA 2CLSA 2NPFA 4FXPA 4DDVA 2IXGA 1MH1A 4S35A 1JXOA 4G1UC 1NIPA 1OKKA 2QMUA 1W47A 4FMCF 4MUBA 3WXMA 5TMPA 4QBIA 3I4LA 4R2IA 1II8A 1BYUA 2XTMA 3RS0A 1X8LA 2OXCA 4ESHA 2O8EB 2ERYA 1HYQA 2GVDC 3B82A 4HEJA 4FMDF 4IKEA 4L9SA 1Z06A 3KJGA 4Q19A 5AR1A 2Q0HA 3QPVA 4WXPA 3UMSA 4JLMA 4EFMA 4DEYA 1H8HA 3EZ9A 3X1ZA 3WRYC 2CL0X 2ZYTX 2W0MA 4IVPA 3A37A 3T35A 1Z28A 3VTKA 2V6JA 4Q7JB 2AK3A 1W48A 2JIZA 1W36B 4RY2A 2JJ1D 3R8CA 1S96A 4HB4A 1R0ZA 4KBGA 2D7CA 1L8QA 2ODBA 4WZAE 5BYJA 4FCVA 4A6XA 2DFNA 1Z63A 3AKDA 4O2RA 2O8DA 5EE9A 4DLUA 3AB3A 5CLLA 4LYFA 3MCAA 4TTPA 2GJSA 3QBTA 4F38A 3B5JA 3BH0A 4Q9JA 2R6DA 4CRWB 4ASUD 3U4QA 2YWGA 4N0EA 3LX8A 4MDEA 5CK4A 4RZ3A 4CIDA 4PO9A 1ESMA 3ASYA 2ODNA 4WIAA 2QZ4A 4AYXA 4CEJA 2REXB 3T1OA 1E98A 3GMTA 4ZO4A 3TH5A 2B6HA 3EXAA 3SN6A 2AKYA 2ZAOA 3THYA 2ZI6A 1DAGA 3BS4A 2WJHA 2XEXA 1II0A 2ZRHA 3PUXA 3QG1A 5DH9A 4URZR 3BIFA 1YRAA 1KY3A 221PA 1JQJC 3WBJA 1U8AA 3K0CA 5F9HA 1CR1A 1JNYA 3S1AB 3CNOA 1DO2A 1G7RA 3RC8A 4GSYA 3BK7A 3D3QA 1KK2A 1SVKA 2H17A 4HAVA 3LWNA 3M1IA 2F3TA 1OF1A 2BDTA 4TYPA 4NYJR 5JWOA 2W2VA 4G5SA 2QQ0A 2CE7A 4TT3A 3L0IB 2AHOA 2ANCA 1N25A 3SE0A 5FR1A 2RGGA 4GDFA 2O8CA 2Q9BA 1FP7A 4TTRA 1HV8A 2OZEA 3N2IA 5B2ZA 2I4IA 1R8QA 5CYPA 2GEVA 1T0JB 3GP8A 2WJGA 4MGIR 2CXXA 3I62A 1MRSA 2QN6A 3F0TA 1VYTA 2X8AA 4PPFA 4XIGS 4US2R 3K70C 2GVZC 4BECA 4JL8A 1G6HA 3N70A 5AJVB 3V4RA 3AGQA 3AUXA 1CLUA 3BJIC 4L9WA 1YE8A 3KKNA 2V54A 4DDWA 4WOPA 3C14C 1XD8A 2IK8A 4K81B 1HE8B 1GNRA 2SHKA 2ONJA 3RHFA 4EAQA 4GL2A 3VKGA 3QKSB 3TW4A 5HZHA 1KGDA 1F48A 2BCGY 4G5OA 5LPNA 4DSOA 4BPBA 5EXSA 4MDFA 1JJ7A 2JLUA 5KDLA 3W8NA 421PA 5BQ5A 2GZAA 1ONBA 1F2TA 3U3RA 3ZIAD 4NYMR 4AI6A 1CJTC 3P4YA 4V0LA 3WMFA 2P2LA 1N6LA 1JPJA 3ETLA 2A5YB 3MD0A 2GBLC 2GAAA 2ZRPA 2ATXA 4BZQA 3AH8A 2O8FB 3GLIE 1WBDA 1F2UA 5KPJA 4WBSA 1AJEA 4TYWA 1OV4A 4OQMA 1TPZA 2ZI4A 1KZ7B 2QM7A 5JBQA 4G3XA 1ZNZA 2P6UA 2ZJAA 4JL5A 5JECA 4PHFA 1QHNA 1S0UA 3PVSA 2F1JA 4HUQA 4ACBA 2X2FA 1N6RA 4JLNA 3VX3A 4IOJA 3EPKA 5FR2A 3T5GA 3B9QA 4HYYA 4MYTA 3T61A 4LV6A 3TSOA 5FPSA 3TSZA 3MFYA 2BBOA 1ZD1A 4BASA 1ELOA 5C1BA 1GRQA 2C9CA 3EC1A 3C4JA 4DSNA 1S4QA 1KI1A 3ICQB 4LPKA 1Z83A 3DOEA 3NHBA 3QXHA 2VF8A 3KTAA 1U81A 3BH6A 3FMIA 1ZYUA 1W1WA 4KLZA 4M1WA 2KB0A 1GUAA 2RGEA 2AR7A 2IF2A 5AUOB 3BBPA 5DHAA 1VG8A 3IKJA 4JS0A 3KQUA 4RSGA 2IYWA 1Q21A 4EQ6B 4RCZA 4URXR 2QP3A 2QROA 4JBYA 2XOKD 4EUNA 1AK2A 3MWLA 3O8BA 3QBVA 4M4SA 1A2KC 3IBGA 3K0FB 3U44A 1OLOA 4Q21A 3RYTC 5SZHB 3I1FA 5DE3A 1QVAA 1ZW6A 3ZD6A 2O8FA 4O25A 2OUKA 4X8OA 2ZJBA 2QGZA 3WYFA 4ZI3A 4FMBB 1RYHA 1T91A 2VSFA 1DAFA 1G291 2QORA 1J2JA 1KTVA 1GTVA 3C7KA 4XD7A 1H8EA 1P73A 2ZE7A 4PX9A 1TU4A 1X6VA 2IT1A 1Z07A 2G9NA 2ZSDA 1MRNA 1NVUQ 1VECA 1Z22A 2GAOA 4LY6A 5CJ2A 2IHBA 1G7SA 3CLVA 4JLAA 4ERNA 2MMGA 1CU1A 1W0JD 2C9OA 3OAAA 2QE7A 3DDCA 1M2OB 1JAHA 3X2SA 3QOFA 5BW8A 4C2UA 2V55B 4OI2A 4TLAA 5DYGA 5JLJA 1HA3A 1HQCA 2WAYA 2ZJ5A 2OCPA 3OIWA 1XEWX 4M1YA 4KXFB 1RJ9A 4TN1A 4IRUB 2CK3A 4LBWA 4LHZA 1D2MA 1LY1A 5FI1B 1HUQA 1QF9A 1E79D 2OFOA 4NMMA 4LRWA 4BFZA 4FWIB 4EFNA 1VTKA 3ZJYA 4JBWA 3AVUA 5GVRA 3HYTA 3KQHA 1VCOA 2XXAA 2IUUA 1M74A 3MG9A 4MKFA 2CCJA 5JI3E 2OO7A 4DIEA 2IYYA 2GTPA 1GZSA 4GOKA 4JBXA 2YOFA 2RKOA 4JLBA 4DHEA 1TUEA 4Q02A 5FUXA 1NBMD 1HE1C 4F4JA 3V9PA 3AF0A 1X1RA 3QF4B 1G4AE 1MT0A 2OV2A 1II8B 1JI0A 3SQXA 4PSVA 2KI5A 2O8EA 4XSHA 1FTSA 2C98A 2GXUA 2HF8A 4BEJA 3OE7A 2JLSA 4HLUC 5J5CA 2DYKA 3DHWC 3DZDA 1ZM3A 4GP7A 2JJ2A 3AVYA 2VIIA 2EU8A 4I81A 1BIFA 2CVFA 3TJZA 4B3DA 4Q4JB 2J0VA 1PJRA 2PLFA 1UKYA 2FSIA 2OCAA 5B58C 2QAJA 4DZZA 1M7GA 1S3GA 2IYZA 4JKYA 2WWFA 4Q5IA 1T0HB 2FV8A 3FVQA 4ZDIA 4N1AA 1P4SA 1E0JA 1XXHA 2G88A 1G8YA 5LB4A 5KTYA 2GKSA 2IYXA 5AK0A 1X86B 2R6AA 1AS2A 4TYQA 2FPKA 1B23P 1XCGB 3QG5A 5H70A 2ECKA 2W6JD 2JLWA 5LBIA 4AKGA 2B7CA 5GJCA 4U00A 1KJWA 2NPIA 1NKTA 4KBFA 4QRHA 3O47A 3WHKA 1JJVA 3TK1A 3BWDD 5FPKA 4CEHB 1W4CA 2F43A 3L0OA 3CRW1 1IONA 1KO4A 2VO1A 2JCSA 2IWHA 2PZGA 1FNNA 3KXLA 2V6IA 4GOXA 5JJLA 2A3RA 1DS6A 2H57A 2QMEA 1TF5A 1W49A 1Z47A 1SXJD 5FPYA 1N6IA 2QA5A 4IEEA 4Q47A 3SZRA 5L3RA 4BUJA 1E99A 2H1LA 2WTUA 4D25A 2N42A 3LO5A 5TB5A 2FPMA 3UK6A 5DGXA 4B75A 2ODEA 2QT0A 5DI9A 1L2TA 4M1KA 2IXFA 3IGFA 3U61B 1ZRHA 4JYCA 3LV8A 5EP4A 2VL7A 4OYHA 3RANA 4JLPA 4B33A 2HJVA 1OXSC 3FOZA 2ZS8A 2O5VA 3C16C 1KI3A 4NHOA 5KHOC 2B8TA 4DC9A 2VP5A 3SQWA 2RH5A 1KI7A 3CPHA 4JLOA 1OH7A 1Q12A 3AVQA 2BMFA 5CITA 1A82A 4A82A 1Q0UA 2AWNA 2R9VA 4LBZA 1NIJA 2QTVB 2ZQ5A 4KCGA 5J4LA 3IIJA 4EPXA 4DDTA 2GZHA 3CH5A 4ILEA 2NOAA 2YYZA 1LF5A 1D9XA 3BRWD 2QGNA 3BAFA 4OHZA 1UFQA 1Z0KA 2ZRCA 1AZSC 1CJVC 4LK2A 4LBVA 5F9FA 3UATA 4HAYA 4CYMA 2JJ1A 4MRVA 2XJ4A 4P3YA 4DLSA 1T9HA 4URYR 4CEHA 1EWRA 2O8CB 1D2EA 5L3QA 4XWAA 1XCPA 2EFEB 4MRSA 5D3QA 1Z2AA 2MMCA 3LRPA 1YZUA 5CJPA 3Q7PA 3RRNA 3WP0A 4AIIA 1SZPA 2WSSD 4BE7B 5HR5A 4AKIA 1SVOA 3M6AA 4QGHA 1I4DD 4R98A 5DHFA 1MO5A 3CF0A 4PC3A 1KI2A 3U6KA 3NDBB 2JLYA 3LLUA 5B30A 1YZQA 1KI6B 2IA5A 1N0VC 4AKHA 4TLDA 4NDZA 4TLEA 2WHXA 2BJWA 4A15A 1YZTA 1E2QA 4O3MA 3CRRA 3I32A 3AVOA 4WZBE 3F3YA 4TTQA 2ATVA 4LJ7A 5AJZA 3RS7A 4TQ9A 2RAPA 5KU1A 1XDBA 1DBSA 2DWOA 4P4UA 1XXHE 2CLCX 2FSHA 5L3QB 4B3GA 1MO6A 1Z0FA 4M9ZA 2R6CA 2OG2A 2IYTA 2ZE6A 4W7SA 1E96A 1PUIA 1ZM2A 2RB4A 2ZETA 3QEOA 1ZD8A 2A30A 2W2TA 3GJ8A 3H86A 4PSKA 3MSXA 1ODFA 1N0UA 3AUYA 1T8UA 4AY2A 3LAWA 2G77B 1KMHB 1I2DA 1FX0B 4EDHA 4NYJQ 1TADA 2OFWA 2WM9B 1G3IA 2C78A 2G3YA 4D0LB 1XZQA 5KO2A 1JB1A 3THWB 3K9HA 4LJYA 5L3SB 2ZYUX 4PC7A 1E1RD 1N2CE 3AGPA 4KV9A 1ESNA 1S1CA 2GHIA 3VAAA 1KJYA 3U7GA 3NBXX 2OHFA 3L2OB 4D80A 2CNWA 2ORVA 4BZXA 4OK3A 3IBYA 1Z6GA 5DI3B 1OYWA 3I8SA 3KTAB 4M9QA 4AG5A 1WB9A 1Z08A 3DMDA 1HEIA 2QAGB 1K5DA 4KI0A 4UXIA 3LQQA 5LDDC 1XEXA 1Q3TA 2E1RA 2FPLA 3FKQA 4IOLA 3AM1A 3FDIA 5JJIA 1Z3IX 4Q4AA 3EX7C 3P27A 4KVAA 1IY2A 2JDID 1ZMXA 3TR0A 1TNDA 3EA0A 2F1RA 4NH0A 5E3HA 4F92B 3R8FA 3RAPR 5L3SA 4AK9A 3QI2A 1HT2E 4TL6A 3ND8A 4JL6A 1EGAA 4J0QA 4AG6A 5CIQA 3CBQA 3N2EA 3TUJC 4MRRA 4LJ9A 1EFCA 1W44A 5HZKA 1FX0A 1Z6AA 3VKHA 3BB1A 3LDAA 4TQAA 2ERXA 2VP2A 5SZJA 3BXZA 3AV0B 1YZLA 3K09A 1IY1A 1OT3A 1CJUC 1E79A 3LD9A 3QKUA 4ZV4A 1CTQA 4DB4A 4IXNA 1KK1A 3GEIA 4H9GA 3RRMA 4BWYA 1QZXA 1US8B 1YJ5A 2QPOA 2CCGA 2QSZA 3PENA 1N5IA 2ZXUA 2J59A 5KNDA 3ZD7A 4B34A 2VTKA 4Q03A 1UKZA 1E2PA 3JVUA 4A2PA 3IO5A 4X8MA 5IK2A 5F2EA 3C41J 3RLFA 3PEYA 4U7DA 2QAGA 4HAUA 2ZRIA 5ANRB 5B64A 4UNNA 3U5ZB 1Q22A 3FE2A 3NVAA 2IYVA 1D5CA 3D31A 4NU0A 3CIOA 4MYHA 2YV5A 1VG0B 2FN4A 1ZM4A 1JR6A 3TKLA 3ONWA 5EZ6B 2BOVA 3TVTA 1DG3A 4M2LA 1EK0A 3VU9B 5FL3A 4B2IA 2O8DB 4XD7D 5FH9A 3QQ5A 1ZU5A 2RGNC 3W3ZB 4HUQB 5DO9A 1QDEA 1E69A 1FMLA 2QG6A 1ZM7A 4WAUA 3GJ3A 4WXRA 1GFIA 3EIHA 3C8UA 1CJMA 1VIAA 2Y8EA 3CONA 2N46A 4JKIA 4DLVA 1QRAA 3NXSA 5FOXA 2V7QA 1IN4A 2BMDA 2Z43A 2YVUA 4CT4B 3CB4A 1IAQA 5KOYA 3AP3A 3U6BA 1G5TA 3WYGA 1SVLA 1Q20A 3NIBA 4JLJA 1R0YA 3I73A 1VYUA 1T3SA 4Z51A 1CRQA 4KFSA 5IDVA 1E2NA 1ANKA 4NP6A 4E22A 4YDHB 3SYKA 5JSZB 4M9XA 5H68A 1IBRA 3AF4A 3OIVA 1E9RA 1YHNA 3K1JA 1G4UR 1N5JA 1CXZA 3KUDA 1ZC4A 4RD1A 4KU4A 1Z6XA 3SYLA 1VPLA 3SOPA 3VR2A 4DSTA 4QJ4A 1CRPA 3DEFA 4EQ6A 1N6NA 5J40A 1UDXA 4OHWA 2QEQA 1CEEA 3A8TA 5BN5A 2FZ4A 2DFLA 2ZRDA 1G7TA 4FI3C 4LHYA 4MQBA 1P62B 3LVQE 4A8JB 4M22A 5J4HA 2IXEA 2KSQA 3KQKA 5CK5A 1W4RA 1DEKA 1YR9A 4NCJA 4PZYA 2XZLA 2EFHB 4QHSA 4IDHA 4NPHA 3EPJA 5H8WA 4GP6A 4MA4A 4HSEA 3RS5A 4Q9LA 1KNXA 1TL7C 1OYYA 2BKUA 2ZR9A 3FMPB 2V3CC 2W00A 1R0XA 1UBEA 1OH8A 2BVNA 3LX5A 1DADA 2IEZA 3FHCB 4D82A 2DR3A 1SVSA 2REBA 5AUQA 1AA9A 3TAUA 621PA 5HCNA 1N6OA 3KJHA 1KI9A 3MUFA 5KYKA 1D8TA 2J0SA 3GLGB 1E2DA 4G01B 3AP1A 4LX0A 3K70B 4PANA 4KO8A 2ZRBA 3QXJA 2VH5R 4TLCA 5EXPA 3ZIAA 1TAGA 3ZLJA 4KLNA 2WVJA 1QVRA 4Q01A 4QG7A 1KAOA 1OHHA 1X3SA 3EZ2A 5KNCA 3HP1A 2BBSA 1XEXB 1NJGA 3AVPA 1XPOA 4BLOA 3LW7A 4MGZR 1IN6A 1J70A 1A7JA 2ZU0C 3AF1A 1ZCBA 2J9RA 4KYUA 2KE5A 1NNEA 3CRMA 3W34A 1GOTA 3NTUA 1P9NA 4UJ3A 1M7HA 4BFVA 2OEPA 3GJ6A 3RSLA 4BFXA 4G5RA 3BFKA 5HKKA 1LS6A 1XD9A 4XJXA 3X1WA 2XITA 1FPMA 2QAGC 2EVWX 1R5NA 2C2HA 2GJ8A 4KHZA 4PAMA 2R2AA 4IJMA 2HV8A 5DYIA 5HTKA 3SI7A 4DKXA 3BOSA 1E3MA 1SGWA 3GLGA 3RC3A 4TLBA 1GIAA 4AC9A 5HCIA 5BXQC 3FKSD 4I4LA 5CM8B 2RGXA 1K5GA 3MJRA 3SBDA 5EE0A 2IS4A 2BIFA 2QPTA 5A0FA 1MO3A 3IPYA 1KDTA 2CMKA 2OAP1 4FN5A 2F55A 4ABYA 3GEHA 1G20E 1E2HA 4I1SA 4TZ0A 2ZRFA 3SHWA 3HR7A 4HATA 3V4FA 5FL7D 1DARA 4IVRA 4Q7LA 1MKYA 4NYMQ 2AKAB 2PT5A 2LKDA 4I1UA 3WHLA 2CCKA 5FOUA 4BFSA 4TZ6A 4F4IA 4LGMA 2EFCB 1UKVY 3QKRA 4B74A 1RC8A 4AYTA 3GPLA 1CR0A 3QF7A 2GILA 4W5WA 2PZEA 1KAGA 1OFHA 1P61B 3F8TA 3ZGXA 721PA 1E9EA 2K5UA 3DKVA 2IYLD 3I61A 1UM8A 2DPXA 2WZQA 4DJTA 1OXUA 1XPRA 3P4XA 4G5QA 4TL9A 3L43A 3CR7A 2YOHA 4WA7A 2D7DA 4M9SA 4E5UA 1U94A 5TV2A 3OIYA 3I72A 2X1VA 5FUYA 2GZDA 3QJYA 4FINA 3VMFA 4DBLC 4URWR 1ZBDA 4IFEA 4X8HA 1FFHA 3SFZA 2IS6A 3UG6A 3M4YA 2QBYA 2KBFA 2PEZA 2CEAA 2BM1A 4GMXA 5FTKA 1WBBA 3GJ7A 3KQLA 2OLJA 2UKDA 1YQTA 2PJZA 2F9LA 4Q00A 1KMHA 1UDWA 3AKCA 4BFUA 1K6MA 1A2BA 3HU1A 2VHCA 2OT3B 4QXAA 4DEXA 1Z0JA 3B1WA 3KKMA 1E2EA 1OH6A 1KYIA 1NMYA 1NLZA 5FBLB 2XB2A 1GRRA 4PTLA 2R44A 1V43A 3WMEA 1IXSB 2JLVA 2P3SA 1Y3AA 2H16A 1XF9A 1ZU4A 3BH7A 3P1JA 1SXJB 3NBYC 2XX3A 4ZIRB 4LDJA 5EUMA 1WA5A 1IXRC 1G1MA 4NCKA 5EE1A 2GWHA 3SNHA 4EJSA 5IHPA 1P2UA 2QY9A 4YLGA 5KSYA 3ICEA 4ZDKA 4P0TA 1U99A 3GJXC 2NQ2C 2R8RA 3PJRA 2ZI7A 5E7IA 3Q3JB 2PMKA 3TRFA 1T4GA 4IW3B 2JLQA 2KJQA 5AJWA 2XAUA 4B71A 2NO7A 2I1VB 3EC2A 4RD4A 3KL4A 1OXXK 1CJKC 5JFGA 4JJZA 3AVWA 2ZUBA 1RZ3A 3DOFA 1P7CA 2FE4A 2J1LA 2DBYA 1Q1ZA 3QUSA 4D26A 3GLHE 1IN7A 1YU9A 3HPRA 3VR6A 1FMJA 2GRJA 2WIAA 4BLSA 4M53A 3RS2A 3B85A 2C99A 3REGA 3T5DA 2OCYC 1PVOA 3NC1C 4HI0E 1E2JA 1VDZA 4EPVA 521PA 1QBKC 3AEZA 4UNPA 4NONA 3KJEA 3QKTA 1AM4D 1IXZA 2IYSA 4B32A 4LC1A 4RKEA 3G5UA 2WWHA 2VF7A 3ZZTA 4YMUA 1D6JA 2BV3A 1CP2A 1TMKA 3UG7A 1UEJA 1KZGB 1Z0DA 4B3BA
chains in the Genus database with same CATH superfamily
1CWUA 4I4TB 3SSMA 1JFLA 3Q9UA 5CIYA 3LNCA 2H08A 3FETA 3ZDXB 3GLGE 4LOAA 3NUQA 3U9SA 3DE1X 3I2IA 4FOOA 3CKKA 3UPDA 1Y63A 2QPAA 5BQ3A 3D8TA 1JIKA 3C1TA 1M34A 2G25A 3CNHA 2HA5A 4NCAA 3K1YA 1R7RA 2BTOA 1FDTA 4HMPA 2BEVB 1KAHA 3CXUA 4NOLA 5LWQA 4BX0A 1L8OA 4QYSA 2QRPA 2SCUB 2CDRA 4KR0A 3PQEA 4ZTUB 4CKYA 4HLDA 2FP4A 1O6CA 1USVA 4B09A 1NBME 3T3NA 2PT9A 1F14A 1E6LA 1SCJA 3BL8A 1WNFA 2WTXA 3R09A 4HYTA 4Z4CA 1BD4A 2EFDB 1S8AA 4GYWA 3OPYA 3NCTA 3JVIA 3BREA 3PDIA 2LNDA 2V3VA 3W5CA 2RARA 2ATIA 2VF4X 3A14A 1T5TA 3U44B 3DLCA 1DX9A 3P9SA 4LCJA 3E8SA 3W2GA 4BS9A 2CMHA 5KVCA 5EMMA 4L08A 5F23A 5CPFA 2FWRA 1C9NA 1U8CB 2R8YA 3EDOA 1SVNA 2JI7A 4O5AA 2X1LA 2DPYA 1R9NA 1E4EB 2XSZA 4HRAA 1PJCA 2WF6A 4U39A 4Q6BA 1SHLA 3LI2A 2C96A 1B74A 2YHUA 3GXBA 3KTFA 4AO7A 2P9BA 1SQ5A 4XOIA 1E5XA 1CQXA 2C7VA 3ERCA 4Q48A 4C6TA 2BFEA 3B13B 3BWEA 4ZQIA 4ARZA 4UNSA 3U3DA 5C8VA 4J7AA 4CKXA 3GR6A 3PPYA 4FHGA 1RHKA 2J9ZB 2O0HA 3BX1A 1DT3A 3WRXA 3T7TA 1YDHA 2CVHA 2QRNA 3A58B 3E5HA 3O6VA 3PJGA 4P5PA 1RVDA 5DISB 4GOLD 2HJGA 1I1HA 1E2GA 1ZVMA 1RKBA 2GCOB 4FOSA 2Y2VA 4ZOAA 2NW6A 1HG0A 1HYGA 1NUSA 1AOXA 1QJ4A 3WRVA 2XNSA 5K09A 4ZC8A 4MAFA 1EGQA 1S2OA 1ORTA 3U7FB 1Z37A 2AS0A 2Y0EA 1O8BA 3AZQA 4QQKA 4OXIA 1V1RB 2QRUA 4OUDA 1M5UA 2BR4A 3I2HA 1E94E 1VLJA 1QNLA 1YVUA 3L8YA 1DPGA 3R6GA 3DDNA 2G67A 3UH0A 4YUZA 2HBYA 3X2FA 1DBWA 5FDFA 2XTAA 4KBGA 3RU9A 4C0QC 1DFGA 2Z5FA 5EOVA 1ZWLA 4GHWA 1JSRA 4EG4A 4C07A 2ID4A 3S8MA 1G3QA 1FVXA 3FPEA 4BAZA 3A6DA 3LH5A 2GJ9A 4KNVA 3WG9A 1S2IA 3NTQA 3UK2A 1KAMA 3OJWA 5JNRA 2XZOA 2M6KA 2MOKA 2VCEA 1DE0A 2VJDA 1J8YF 1HI9A 4FTWA 3V8QA 5K3EA 2WIBA 3HVKA 3U19A 3LK7A 2C2KA 1O94C 1DWQA 3TSYA 1AMNA 3G2JA 4RDCA 3ZY3A 2ECFA 4YRFA 3A6PC 1DP4A 3O4JA 2GUGA 1LVHA 4YVFA 3JQ6A 5FV7A 5FFMA 3VNVA 1YE3A 5IKEA 3CY6A 1NT2A 1G1AA 4R51A 4Y8VA 4YH1A 5D5PA 4BJ1A 1R0CA 1VBFA 2P6MA 1IQPA 1RDFA 1GSIA 1XTIA 1JLMA 1SIBE 3V4PB 3WC4A 3S1SA 3HDTA 4M1ZA 2YJTD 4YHBA 1F6DA 4OXXA 3M7IA 4Q1DA 4TROA 2ZATA 2FWAA 3GCGA 3PICA 3BIXA 2J9GA 4G36A 4GWLA 1Z8DA 4JR0A 3VBCA 5HFNA 4B73A 2EIHA 3KOZA 4MUAA 4L6CA 2GK6A 4EG6A 3OCUA 2BFFB 1T3ZA 1G5FA 2G83A 2Y92A 3SBEA 1IJFA 5KYTA 2EG9A 1J7KA 2ZYIA 1QV6A 3OE5A 1HNZB 4LDPA 4FGSA 2IS2A 4DA0A 2FW1A 4X64B 2QP9X 3T3OA 3D6AA 4Z3DA 3TFOA 1HNWB 3H3JA 4J0DA 1XRSB 1YUBA 2Q4BA 3LUKA 4KFCA 2Y1GA 4B2LA 2I4OA 5KNCD 3ZZ1A 3WADA 4XUGB 4P2GA 5AO9A 1X42A 10MHA 3HU3A 1JA9A 1JX6A 1KO7A 3F3KA 4NJEB 5FKJA 2IU4A 3LOPA 2HQOA 3QEJA 4ZQCB 2OAQ1 4Z3OA 4DCNA 2PYDA 4NNOA 3PFWO 1X7XA 4F1JA 3W6UA 1FYFA 5FA6A 3VPDA 3ITNA 1VGRA 3KQYA 4YAOA 1Z0SA 4G0XA 4RZXA 1GPUA 1U4SA 2B0CA 1L4YA 1ZUNB 3PEUA 1TVCA 5H3HA 3CF6R 2AXQA 5I9NA 5K5EA 2AFVA 3PT9A 1T2NA 4RFSB 4DNOA 2PVPA 2KYRA 1B7GO 2WJ4A 3IUYA 4UBJA 2HR1A 2D54A 1SB9A 1RNLA 4JI3B 1JDJA 1YR6A 3HWSA 5BVHA 3KSBC 2AFIB 3MQ2A 2AD1A 3AEQB 2QNIA 1ZK0A 2PX6A 4ND5A 1Z4OA 4UW9A 2ACKA 1IOZA 1PLJA 3FAKA 4DIDA 2CXRA 4FJ0A 1YTUA 5DV9A 2B4TO 3QKSA 4P33A 3SJZA 1PJ4A 1RLOA 1XAJA 2B21A 4C3OB 2OXRA 3KSAC 3D6FA 3PHIA 4OHBA 3ZDQA 1W76A 4JI8B 4WLEA 1T8TA 4DYDA 3DMPA 3DULA 1QGUA 4FZJA 4OHFA 1KAQA 3B1FA 4Y2XA 2FFHA 4BJ3A 2O1SA 4K0KB 2M32A 4PR3A 2DFPA 4RD3A 1BS1A 4IDEA 2R0QC 2FETA 2YJNA 4WMLA 1FJHA 1JSLA 2BM8A 3CJQA 4GLBA 3LT4A 2PX3A 1WHSA 2O2DA 3BQNB 5EYPB 4ALJA 1ZG3A 3HHEA 2GS9A 2PWYA 4ZD6A 4D9HA 5I8PA 1C9KA 2R65A 4MKHA 1LDEA 1RMYA 1WDKA 3UKJA 2ZKLA 4JY7A 5FLEX 4Z4IA 1NW4A 3I58A 1XDWA 1UM9A 3ZGYA 4P7GA 3PG5A 2A9OA 1WKBA 1KFCB 2ZUFA 3R76A 5JMPA 2EGHA 3TQRA 1WW3A 2ZKIA 3WK8A 3WRXC 4A0QA 4DMCA 5BXYA 5IXJA 1P5HA 4RTKA 4NMXB 1Q7BA 3R7FA 3EDCA 4BMVA 4PLWA 5AESA 1E32A 1K2WA 3C8DA 3JU3A 3OUZA 2H06A 1DC4A 2EBWA 3KJIA 4H6XA 3O75A 4JOCA 1FW6A 5JJKA 5C80A 1F1BA 2P2ZA 4QOHA 4F7DA 3TLXA 1M2EA 2Q4RA 4LJAA 4DIOA 3RJ9A 1UAAA 2YRWA 4V3CA 3OZGA 5ECGC 1IZ0A 4JBNA 1BCRB 4I99A 5JWRA 1QIMA 2EAUA 4IEFB 1IE3A 4FOLA 5DSZA 5EZ5A 1KP9A 3T1HB 3EGXB 1KVUA 1QH0A 2CLMB 5KDDA 3HJRA 4TRJA 2V0CA 3OHSX 3OMLA 4UUBA 1NW9B 5FQOA 5C31A 4F6CA 3OY2A 4YRAA 2CZQA 3ZVMA 2CJWA 3AWDA 1ZIPA 3KC2A 3V6MA 2W98A 4DWWA 4BNNA 5EYPA 3A2KA 3BWCA 4ENTA 2VP3A 5JNVA 2IS4A 4N4AA 5JTTA 3AR3A 4D5EA 2CDNA 1VMDA 4UAVA 1D1QA 2X9GA 3HV2A 1UODA 3RGWS 1SVIA 2QDXA 3CKLA 3E9QA 3Q3GE 3QFRA 5JWHA 1ZXLA 3TVYA 4L5CA 3ZCSA 2XTNA 4EWLA 1C29B 1IQUA 1NQXA 2H4HA 3DOUA 4V39A 1N2HA 4QPNA 3JZFA 3U3OA 3AMVA 4UZFA 3LUPA 1XOIA 4G8JA 3OCXA 4N8DA 1W87A 2JZNA 5HF9A 4PYMA 5LNK1 1EFDN 3CTMA 2QUZA 3D02A 4OG2A 5CX1B 1XK7A 1X1BA 1U5BB 1DUSA 1X80B 4EO9A 4OL0A 2ZB4A 5LQDA 1G9XA 4YP0A 5AD1A 3RADC 1K5HA 3UTDA 5LOVA 3Q8MA 5GZ3A 2FUKA 2XBLA 4AMGA 4DC1A 3ZNQA 1NUAA 3OTHA 4HZUA 4WLUA 2DPHA 3Q8XB 1TQDA 2JI4A 3EULA 4DLBA 1PKXA 1UINA 2WABA 2OAEA 2R751 2JD0A 1ZVJA 3DTNA 4OHUA 5BWBA 3TO5A 1E9AA 1U9YA 1I0LA 5A4KA 5ITZA 2QLJA 3PUVA 4H4EA 3LSYA 2NVBA 4YJGA 4B17A 1GR1A 1P5JA 2XLCA 3DBHB 1I2AA 5JJCA 1ICEA 3RRYA 4ON9A 4EECA 1VJTA 2OGSA 1QHHA 2Q5OA 1ZIYA 2YWHA 3CLKA 4L8FA 2XD9A 3K3PA 3K7EA 2X4IA 2XGOA 3QLVA 3G9ZA 3PFKA 3IHWA 1O95C 1HDYA 1PU2A 1WMSA 2IBMA 3EZYA 2AB0A 3FX2A 4PC2A 1DHRA 1XALA 2E4WA 3WFJA 3VKUA 1BD3A 2AEFA 3HBMA 4LXGA 1UEIA 2QR3A 5JY1A 4UDYX 4CMHA 3G0DA 2QR5A 3OM9A 4MROA 3G2OA 2G8LA 2H1WA 4PICA 5KYNA 5K3DA 1G21A 3T9FA 4LF9B 2HHHB 5A0VA 1L3BA 4QTTB 5AKIA 2VHTA 5MHTA 2KMLA 5C5IA 2Q46A 3JQ9A 4UMFA 3TTXA 1LU9A 4XCVA 1JHRA 4JP1A 2GH1A 3V4OA 2EZ8A 4BFCA 1GTJ1 1L4GA 1FVHA 1TT5A 4WFKA 4YUXA 4M8SA 3ETGA 1GDDA 1QQAA 3ZW7A 3A1CA 4POAA 3V7YA 1DKRA 3KALA 3G17A 5FPHA 1EESA 4YLYA 3N6XA 3K9WA 4LTMA 1P4RA 4N0PA 5BN4B 2N1BA 2WG0A 3PSAA 3QY0A 2A8YA 3LY8A 4YRQA 2VHQA 3HR8A 4LI0A 4UZEA 1BHQ1 1C7QA 5HS6A 4GGOA 3P5BA 4AN1A 4DDKA 4F6RA 1LRLA 1LTHR 4AKSA 1COWA 2GPNA 2XB4A 3IX7A 4OQLA 3PQ7A 3SZMA 3WAKA 3FUWA 3MERA 4UPEA 1NJ8A 2WFZA 3GOQA 2OGTA 3MLBA 5CYOA 3G1TA 3WIDA 4H1UA 3BZUA 4KTVE 3FR7A 1RIFA 3VR4H 3P19A 1H4SA 1N5KA 1E7RA 1A8PA 3FVRA 1K68A 1N2ZA 1HE3A 5GTDA 4HS9A 4IOKA 1X7GA 1HZJA 2LVBA 4GWKA 3DZ8A 1K89A 2ID7A 2P2CA 3KKLA 3DF7A 5H80A 4OD0A 1XMSA 2JGDB 4M9RA 7AT1A 3KP1A 1VL8A 2AEEA 2AC7A 4K9SA 3VPAA 4QT4A 3RGGA 4IIJF 4XVQA 1XTKA 2HHCA 4YCMA 1QOZA 3DOOA 2F00A 1CY7A 1TVKB 4DUZB 3G49A 3TUZC 3KD2A 3ZI4A 3L8ZA 3RYHA 1U1IA 1YCGA 3KQMA 4EG7A 2QVBA 3GNQA 1LNQA 3O8NA 3ZD9A 4DLRA 3NBZC 3F1LA 4TSFA 3FCXA 3WGLA 2OXTA 1S9DA 3DMYA 1E4VA 3ND6A 3F5FA 3WLOA 4EPYA 1NMSA 2PY6A 3OTOB 2WU8A 4K2HA 5A7GA 1C0IA 3GP5A 4LS3A 3H13A 2NQTA 3F67A 4C6HA 1A69A 2HDOA 3KWMA 1F4LA 3RUDA 2O2IA 3Q3VA 1VE7A 2H51A 4N9WA 4U2FA 4UHEA 1VA4A 3G2IA 5KOHA 2V0NA 3DE5X 5KVQA 2VQ3A 3ZHVA 1ZD4A 4ZU3A 2OWEA 1FP2A 1C3XA 3NNSA 2BGNA 3WJ2A 3OICA 3D1LA 3L77A 1CR4A 4RQAA 3WK9A 4HDRA 3K9GA 3DAGA 4UE3S 2WQ7A 2PQ6A 4WA8A 3FGNA 4ZOLF 3WFIA 3RS4A 2QX8A 3E5MA 3IEIA 4AFNA 3R2JA 5LD2B 4G89A 1TYZA 3HG7A 1XZ8A 1SBQA 1YACA 4LTNA 2W2OA 2UAGA 3GDOA 1JVNA 3HYSA 5CJJA 1ONSA 4RPJA 4D81A 4E4RA 3OPNA 1J8FA 3C6XA 3FZGA 3G59A 5AK3A 4UUOA 5KTMA 1EVZA 2M2IA 2EJTA 2LE0A 1B76A 1EA7A 2MSWA 1NG9A 1YVDA 3QU7A 1WE2A 1V8OA 4WNYA 5THKA 3Q3IA 1QP7A 3OM1A 5REQA 3SZGA 4GZLA 5BUZA 3DE0X 3OJFA 1L5LA 2QM0A 1SCQA 2PUJA 2DFDA 2Y0PA 1IQRA 1E63A 2C5SA 3AJ8A 5E6SA 4C4XA 3B1YA 3E8XA 5CCBA 3KK0A 2UVDA 3JVVA 2XKAA 3WYEA 4IIGA 1X8JA 2ALJA 3UAZA 4BLQA 1YB1A 2WAXA 5C7LO 1YDGA 2UYHA 4R9SA 2UZAA 1RM4A 1MN6A 4UTXA 4V0MA 5ILQA 2A94A 2JI8A 2XUJA 1GKLA 4K0RA 2FDCA 1MG0A 2XA9A 2J0QA 2VPIA 4DG9A 4DV4B 3MA0A 4MZDA 4Q1FA 4D3SA 1W36C 3TLGA 4E5DA 2PR2A 5DHPA 2X8JB 3C0KA 2I4MA 2I2WA 3O0TA 5BUSA 2XBUA 2QUKA 1BH2A 4AURA 1RJGA 4DR4B 4IGEA 1SHJA 3UPUA 1GWNA 2Z30A 5GONB 1ETUA 2JZCA 4PN7A 5A3QA 4B3SB 4MQFB 3M4JA 4FBGA 3KJXA 2W58A 4WI1A 1XD2A 3ZWPA 1VIYA 4GXRA 4R9NA 1PP4A 3ICVA 4O2LA 2XT9A 1NVXQ 1PWXA 1L7VC 4UU1A 2OXIA 5REQB 2PRYA 3P0EA 4PHTA 4TMKA 3B1XA 4M7PA 3RAGA 4OH7A 1E3LA 1NAHA 2PWZA 2YYAA 3KKEA 5C0OE 3FYHA 2EW1A 3PB3A 3R5FA 3TTSA 1C7EA 2PSSA 2VDJA 2JZOA 5E6SB 5FI5A 2NTJA 3DLHA 1QCYA 4YPFA 2FYTA 4RFSA 3VI3B 1SWVA 2AQ8A 3EUAA 3IEPA 4F84A 2EKDA 4KRYA 5E6UA 4O8ZA 2GEFA 2UDPA 2ZYWX 4R01A 3WLEA 1U0HC 1B8VA 2KW5A 2W6JA 5DWQA 4ZT4A 2OBNA 3PA8A 2ZQZA 1KJIA 3LGXA 4FCWA 4B2PA 2K6GA 2NG1A 4YBZA 5FLYA 3PQ8A 5IAGA 1I2BA 2DWCA 3RBAA 3ZHRA 3AHIA 2ZIZA 2AG8A 1EUCA 3EQ2A 2D59A 3OFND 2X8JA 2AI2A 3BG5A 3EXG2 3WYCA 3QE9Y 3E53A 4FT2A 1D6SA 5ICEA 1AB5A 5CXSA 1R9MA 2P6PA 3DOHA 4MCAA 4EY7A 2YR0A 1W7AA 4H0CA 3BJEA 5ICSA 3PFBA 5SZKB 1J0XO 4EABA 2ZVDA 1G18A 2CD9A 4AJHA 2C59A 3KHSA 1BGXT 4LNHA 4MO2A 2XUZA 3DBLB 1N8KA 3JD4A 1L6RA 2JJ2D 4W5HA 1ORRA 5TSDA 1MA3A 4MUGA 3E3NA 5CLQA 4OOFA 4N9QA 3LCJA 3CUVA 3T34A 2BZGA 1DB3A 1XPJA 1Z4LA 4JAVC 2B4RO 4IMJB 2FMTA 5ADUS 2D0PB 3AL2A 2JFHA 3VVCA 1PR1A 1YOBA 4KVZA 4OXKA 5CYGA 2X6TA 1XJWA 2R1ZA 1IJEA 2D00A 4R83A 2AMLA 4Z2YA 4G5FA 1SK9A 3G13A 4CKZA 3VA7A 1C4OA 1NBWB 3D2BA 3FPJA 3CEPB 3PV0A 3PX2A 1CVIA 3AHHA 4K05A 3LOUA 5AI8A 4AUNA 4M1MA 3H9BA 4JN6B 1YFJA 2HJWA 3U17A 1SCKA 1BCRA 3LC7O 5EJMA 1UPUA 4DUPA 2NPOA 3E70C 4IEIA 4BXOA 4TRRA 3K0AA 2PZ8A 2PE5A 1HKHA 4I55F 1WDMA 1ID8A 2BMJA 3LHKA 2B1QA 4RQUA 2FEOA 5LP6C 4CLRB 2V8OA 1TQ4A 2BHTA 3EGEA 1FFBA 1EX6A 1L5MA 3DOJA 2V7VA 1BE0A 2WBLC 4JD5A 4W5QA 4U2CA 4GZMA 3STVA 4F1KA 1U90A 1N5OX 1O77A 1P0PA 1R4MA 1DAMA 2HF9A 2ATCA 2JGEA 2GZ2A 3I6ZA 4LRXA 3W6OA 3EXIA 3T9EA 4RJIA 2ETXA 3COPA 3IMCA 4O4JF 2PGIA 2W83A 2Z2XA 4F2WA 4I50F 5AW5A 2FCRA 1UOEA 3HFSA 4V0QA 3BEOA 4NBLA 1PZNA 4OIMA 5DNEA 4Y6OA 2FEMA 2COKA 3EBPA 4MVJD 3NM6B 4H77A 4BQQA 3VGPA 4C4AA 4EUEA 1D2AA 4JYPA 3P26A 3R5XA 4IHKA 4XEHA 3FRJA 3OAAD 1MAVA 2Y2UA 5FOVA 1FJGB 2GNPA 1H42A 2YDYA 2ZDGA 5C5DA 3I53A 3O8OB 1P75A 5C1OA 3JZMA 3UMFA 2CL7X 2AOXA 1ZJJA 1ULSA 4IBOA 3UJNA 1E3JA 3OLZA 3O8CA 4BKOA 1DSSG 3ORSA 2H7YA 1ZS9A 2RC5A 3IQHX 2QB5A 3V80A 4B6EA 1T1GA 2AL7A 2QRGA 3OBIA 1JQEA 4V0SA 4B47A 1M1UA 4R31A 4ND7A 3W2HA 3UWDA 4RTRA 4LNUA 3TQFA 1AHHA 4INZA 3KELA 3HCCA 3WWYA 5U4QA 2HCTA 3EVBA 3KWFA 3O2SB 3D0OA 8AT1A 3LPNA 4RU1A 1FSSA 1QHSA 1VCMA 2ZAIA 4LJLA 2TMDA 4R2XA 3WK5A 1BE6A 1ORDA 5E1BA 3SMVA 1NGSA 2OD7A 4X24A 2Y05A 4QUKA 1U3UA 4B6QA 3P8ZA 1B4DA 2HPZA 1WP4A 1DKUA 2AN1A 3UNXA 1BWQA 1VLMA 2ZJFA 1IZ7A 3H1TA 4QZVA 3Q87B 3AUSA 5GINE 3LQ4A 5JRJA 3MELA 3CH7A 3T5BA 4L5AA 2F3QA 4MWDA 5FB3A 2V7BA 3NXKA 4MI9A 5BWOA 2Q3BA 4LXQA 5LMZA 1Z5UA 2XF2A 5H3LA 3RSGA 1NXQA 5IVKA 4Z8XA 3ZJ4A 3O8OA 1FFWA 1SK8A 2QQEA 4F86A 2PMCA 1NC3A 3BE6A 3HFGA 1U9IA 5ALYA 4ZOLA 1G3UA 4QLOA 1POXA 2J6IA 1UT6A 1Y3CE 3L18A 4FGUA 4L3VA 3KEFA 3SAJA 3SKYA 1DQYA 1GKKA 4KE6A 3ZK7A 4PNHA 5DSTA 5AJHA 4GPIB 1PYGA 2BCJQ 2RGAA 5EE5B 3LCRA 5TQVA 2VDWB 3WXBA 2XQKA 3BTSA 1NY6A 1E3TA 1JHPA 2IE0A 2ZK7A 1VJ5A 2DE0X 4GI3A 4J43A 1Q57A 1UZAA 1NXXA 2P4QA 4PZ9A 3HB0A 1VM6A 1AT1A 5CB4F 1OTYA 3H6HA 2BC9A 3AHGA 1D4OA 1UDRA 3FFAA 5T4HA 2H7XA 4RTLA 1IY0A 4PPGA 5EXDA 2RHBA 4OJQA 2C31A 2CDBA 2AZDA 3U60B 4G1FA 2P9QA 3H16A 1KEEB 4BMNA 1R15A 2NV2B 2QKYA 1A5BB 1GLGA 4HDOB 4RVCA 1YS9A 1UBSB 3RC7A 4YRIA 1EX7A 3IUEA 1UPTA 2OB1A 3EVEA 3GRFA 4IYJA 5A1JA 2WFAA 3H9UA 2IL1A 2Q5QA 3V8BA 3QU5A 3M4XA 2OG1A 3WE7A 2VRWA 1HZZA 4QBHA 1XWFA 1M1NB 2Q6IA 5FWDA 4XTCS 3ZH9B 4CLXA 2ZM5A 4E1BA 2JBWA 2PJUA 2QLMA 2WE7A 4MW1A 4XYBA 3Q8LA 3FDJA 1NG1A 3P2YA 1IUPA 2IWRA 1DU4A 1PTJA 4MEBA 5DM70 2FEAA 1PV4A 3W2EA 3FA2A 2Q3FA 5LU8A 1C7ZA 1SQ6A 4M0UA 4G0VA 3S3TA 3QXCA 1T2AA 4BLUA 2FUNB 4BMOB 4BCBA 4RMHA 1XZBA 4QFMA 5H9WA 1EFTA 3ZDDA 1VCHA 2GESA 2JANA 2ZUDA 3K9NA 1LPNA 1QO7A 2VSYA 1NR5A 4UC0A 3X1YA 1E0AA 1O97C 5IS2A 2W8ZA 4YJ2A 2JFXA 1F60A 1YJAA 1U1CA 1T6NA 2P7HA 3F6YA 1EQUA 3QEKA 2VYVD 5GGXA 2VZ0A 3VNUA 2POCA 2K7ZA 1LQUA 3MILA 3R7WB 1V48A 4ZDJA 3KR2A 2C2WA 4Y6LA 2CWDA 4IIDA 4KR6A 5IJ9A 1J5PA 3FSGD 2MYTA 2VWPA 4TUYB 4BPRA 5LQJA 1QHYA 3BE8A 3VKFA 3M0EA 2QSJA 5LJIA 3A4MA 3O93A 3WFZA 1YZNA 4MUFA 1ZK3A 5KI6A 3RIEA 4DCGA 3WQBA 1B26A 3NDPA 4Z9AA 2H65A 3K6RA 4IIBA 2VI5A 4AY5A 3D7KA 3MPOA 3F5QA 3M4ZA 2DFTA 3MGKA 5KWEA 1JECA 4Y2HA 5AVWA 3ONEA 4AY3A 3SBXA 2IYUA 1YIDA 4GO1A 2D2FA 2V6MA 3WWOA 1T5SA 3IR7A 2XMBA 5EKSA 3RVSA 1KAEA 3HCOA 1TZJA 3A10A 3OCWA 5DF1A 2NYRA 1RWOA 1RBMA 1DC8A 3K0FA 3BTOA 1F12A 3T3GA 2A7XA 3GLHB 3FCCA 4MI6A 4FOPA 4YONB 2VDUE 2QG4A 1JEEA 1KK3A 3HO6A 3N3AC 3P9ZA 4FHFA 3P0RA 4Q4HB 4DIUA 5KNBD 4BRWA 3GEBA 1DO8A 2QYTA 3JATB 1C30B 2QZJA 4QOJA 4KK3A 1OLUA 5JSHA 3CH4B 1NQVA 1I33A 4HGQA 5EWLB 1BS2A 1VCNA 3C6KA 3UK7A 2ODWA 1WY5A 3GFTA 3NVMB 1TC1A 3FPKA 3BMNB 1AQYA 2VPPA 3KSDO 1P2SA 1XMXA 3PZBA 2WJVA 3RVQA 4IV8A 5C4MA 2HI0A 2R7LA 1CZHA 4RZQA 4BWFB 4NMWA 3DBRB 1KXJA 5J9FA 5BN4A 4EVSA 3OA0A 1E9SA 1U3TA 3LQFA 1Y8AA 2C97A 3O2NA 4Q1BA 4MW7A 4PO8A 4HXYA 4OM7A 3T06B 5TQ0B 2JASA 2XCTB 3I3SR 4QLBA 1UF9A 3TLGB 1J56A 4EG8A 1RTTA 4PSCA 3L92A 2H1VA 3NBQA 2RH4A 1ESZA 5TF0A 1NBIA 3ZZ0A 1T8RA 1OH5A 2BL4A 1TMYA 2XTJA 4C2TA 3X1DA 1DAEA 5P21A 3LJKA 5EESA 2WWIA 4YT2A 5JS1A 2EGGA 1GNQA 4J94A 4RLSA 5C7IO 2IS1A 1J2EA 3U3XA 4IY1A 1Y1SA 2Q28A 2BFNA 2GYWA 5F1YA 4M8NE 3EUWA 4UEOA 5EERA 1V6AA 3Q2KA 4O1MA 2IGTA 3SC3A 1L5HB 2B30A 3UB4A 3LLVA 5G53C 3VVBA 1ISJA 4PZCA 3R9WA 1FOEB 1QKIA 2ZVJA 3GRAA 3FD8A 4NDNE 5LDGA 5HMMA 3ZQJA 2DFVA 2FWBA 3OHMA 2VKQA 4KUGA 5H5JA 4L9RA 4J2TA 2P40A 3AJ9A 2IEBA 3TW8B 5IM4A 2XIQA 2LKCA 4GMHA 4DQLA 4NV3A 5L4SA 1RWMA 1RFGE 4FFBB 4KI7A 1PEKE 2AG6A 2G6TA 1ZN7A 2CL6X 4ZZ3A 1KEPA 1EWKA 3VU0A 1HPLA 1NJ2A 3PDHA 5EKUA 1E5TA 1DRJA 1DJLA 1V7QA 4LF6B 4YB8A 3DMTC 3SQDA 4BLPA 1Z4QA 4EMSA 5BNTA 3IHLA 4FC7A 3MMSA 1T3HA 4LYEA 5KOHB 4M9UA 1C2TA 1OKKD 4R54A 5GP1A 2YWFA 4A0FA 1RHUA 5BSGA 3DMHA 3MQFA 4UDOA 4XLLA 5HA5A 4B35A 1H0HA 3W5DA 5HG0A 3HMKA 2UYCA 1ZQ1A 3OC6A 3OEYA 3FFWA 5ALSA 4YP5A 3H5OA 3BCUA 2ZYHA 5HKKD 1F6BA 4IF4A 1CQJB 1O94A 1P3Y1 4NCXA 4A6DA 4J91A 3NHFA 1LC3A 4HO1X 4QPPA 4RTJA 1VE5A 3A9SA 5GV7A 4KGVA 1V26A 1JWAB 3FF1A 1THTA 3HZZA 1KOLA 4E7OA 2OM2A 1N5LA 5KNBH 3OP1A 1SFRA 4GW3A 1WP9A 3GRCA 4GVPA 3TW8A 3MAJA 1HQYE 2V4UA 3ZJ5A 1SVUA 2PGXA 3H7IA 3P52A 4O63O 4A03A 2H9IA 3TMYA 1M3SA 2Z04A 3ZNOA 3NO4A 3LOQA 3DT8A 2FKNA 2BM0A 1E9BA 3AFGA 2XNDD 5BN3B 2FPGA 2WM8A 1O7JA 1T5IA 4OVKA 2YNMD 5G1NA 4L02A 2JAQA 3I83A 4D4GA 3JARA 4Y2QA 5K8LA 4CVNA 1WAMA 1LFDB 5LYYA 4M0KA 1W8DA 4YN3A 2W5UA 1NF8A 4TYYA 5K0SA 4B48A 5HHTA 1U8FO 2GPTA 4EHFA 1AIPA 3ECCA 2A5FA 3EASA 4JI2B 1AHNA 1UBHS 2A0XA 4TT8A 1W4BA 2W6CX 4LZAA 2P0EA 5YASA 4QSHA 3USZA 2B92A 4HFMA 4OH1A 3QLUA 4ENVA 4ARUA 1CUVA 1CB7A 4K86A 5NULA 4KOAA 3RU2A 3U3KA 3K6SA 4FU0A 3UXMA 1TCBA 4P32A 4LDZA 2D5CA 2RBGA 1QGUB 5AUNB 3PTAA 3A2LA 5HIKA 4G63A 4AMYA 2I4NA 2NSLA 1YH3A 2FOIA 4X7MA 4B85A 4X63A 2EJUA 3M9WA 1VG1A 3HO1A 4MP8A 4QJ5A 5A4JA 2HSWA 4MWBA 1IZ8A 3SU8A 1Y33E 3GH1A 4BRZA 2HW8A 2C5EA 4E07A 4R7ZA 2Q6LA 3O1LA 3OZXA 4D8WA 1YQ9A 3THOA 1GT6A 1VHLA 3BPSA 4ZI2A 3DLPX 2VHJA 4QGSA 1GPAA 4FFSA 4L95C 2FXIA 1PJAA 4YAJA 4LVOA 2QUJA 1KHHA 3OOEA 4PLPA 2O2GA 3E15A 4GPBA 4UBNA 4JT2A 4DEVA 2ON6A 4OQDA 3HPQA 1WD5A 3JQPA 2WLTA 5T8KA 4EY3A 1XI2A 4CCSA 5JMTA 1EGVB 4KPUA 1K6XA 3HB5X 1FBNA 1E58A 1BMTA 3G2MA 4F93B 3UGQA 3GZ4A 5HKLA 3HXPA 5KUTA 2Q99A 3LYHA 4YJDA 2CBZA 1A3CA 4JYMA 4B3CA 5LIPA 4LJ5A 5TMEA 4Q66C 2MR6A 4AT1A 2ZPAA 3PUHA 3W7BA 4QBGB 1NULA 3OWHA 3IPCA 3PNMA 4YJHB 1BQ3A 3E18A 4DPMA 3I6BA 5IT0A 2O20A 1IB6A 1JG3A 1GEGA 2RBEA 2RGNA 3QEMB 5F1KA 1ADFA 3SHOA 3H2YA 3U4CA 5EJ2A 2QTVA 4U02A 2CJFA 5EJGA 5FHQA 1XMJA 4BL5A 4YP1A 2V5UA 5JNUA 1FRFS 2VRCA 4E70A 3N2GB 1JA0A 4BQFA 3NPAA 3HGTA 1OFTA 5TY0A 2BD0A 4WGFA 2BUBA 3SLRA 4DC0A 4KG7A 1IZYA 2OCLA 4B3IA 2I4TA 3HDQA 5MN5A 2RGDA 4DABA 5IK2D 2MSCB 1NZFA 2B83A 3N6VA 1EFKA 2ZOSA 4RCYA 3OA2A 4G26A 3LDHA 2Z5VA 3HDGA 3ILVA 2XRZA 3QEBZ 3A1UA 2RHJA 1O3YA 2CLEB 3ZXXA 3STWA 2Q3LA 2X8LA 1NONA 5CDFE 5HJ5A 4LQLA 1FSPA 2C2YA 2AVDA 4INAA 3C6QA 2NSDA 4CV0A 1DFIA 1B14A 2BFDB 3TNJA 3PR2B 1KE2A 4LVUA 3O8RA 3DFFA 3I6IA 5EJ7A 3S5UA 5EIBD 2Z95A 2F3UA 4ESVA 6PFKA 4JLVA 3ZLBA 1HL3A 2GZ1A 1I1NA 4PRKA 1NNSA 4C0HA 1FDSA 2GFIA 3UENA 1UC4B 1P72A 1ENZA 1YE5A 3ICPA 4TXMA 5LQNA 3K0SA 1W9HA 2WTAA 1G66A 2OV4A 4W5JA 4I3HA 5JRZA 2IXDA 4S0XA 3VPFA 4AMVA 3IAUA 1L5ZA 1G64A 3AIMA 3KTOA 3QWFA 3H04A 2VTBB 3B20A 2VDOB 4CN9A 4YJ2B 4KODA 4L50A 1V3TA 2DCUA 4IDCA 1BCSB 3FOAA 5ED0A 5EJIA 4KR9A 1J0BA 4DWJA 1P39A 2UUCB 1Q44A 2A2ZA 4D9NA 2WT9A 2Q5IA 3WQRA 4DYVA 2DTXA 3LUCA 1YXMA 2CLKB 2MYNA 4U7GA 1HTTA 3N6RA 1WDLA 1QB7A 1NVKA 2O23A 4CM5A 2NXWA 3ES9A 2PQ2A 4KH1A 3BA1A 1I1OA 3R5SA 1IUOA 3CR8A 4R41A 4FGJA 4NY1A 1Q0QA 1ZMTA 1WVIA 2E7ZA 2OO5C 1UFRA 4J0JA 2C84A 3EAQA 3RRBA 4RWEA 4WW0A 5DXJA 5D3MA 5K3CA 5C3UA 2P0AA 5LZ5A 4DGQA 5J43A 2P5UA 3MRSA 5H1YA 5LP1A 4OAQA 1NVWQ 3OEED 3B6KA 4CCAA 2VPYA 1J24A 1YFKA 3TCXB 1KO5A 3CLSC 3W6NA 3UUEA 3F90A 2F1HA 1EFRA 2GLXA 3BGOS 4FEYA 3S29A 3ADDA 3W3AA 2FHSA 1NVVR 1XZPA 4RDHA 4JYAB 1EE9A 2LR0A 1XKLA 3BSFA 5E4FA 2XODA 2OPBA 1VKJA 2ODAA 3A7DA 1DJPA 3DD5A 3PVZA 2HLDD 2WHEA 2KBEA 4V03A 3DDUA 2R8PA 3ACDA 2RHOA 2XYQA 3WQQA 4DGSA 3L84A 3DV0A 3JYOA 5I45A 2HA2A 3UT5A 1CFJA 1ESCA 1W2HA 2GLUA 2IW3A 3B9RA 4TS3A 5M7EA 2P6RA 4HQFA 2GBLA 1VP3A 3BMXA 2X0FA 2XBMA 3HNOA 4BUZA 4ZVNA 2F64A 3ZD8A 4LUCA 1Q50A 4GOMD 3UO8B 1YZYA 3PEEA 2ZS7A 3PRYA 5C8DA 4K3UA 5AW0A 4OK6A 1WRBA 3OZDA 1E2FA 1H6AA 1UKEA 1XCLA 9ATCA 1O5OA 3OT1A 5AW4A 1B43A 1NMXA 5D3MB 1GKYA 3KZXA 4UUPA 3BC1A 1Z6ZA 4BNYA 3VSCA 1L4BA 1VLQA 4G5HA 3QTTA 1S2MA 2NPFA 2AEMA 4YRTA 3PVCA 3SSAA 2Y0DA 1MOQA 4G1UC 2QMUA 1RVV1 4QBIA 3I4LA 2J3KA 4IF6A 5A3SA 1MDFA 2OXEA 2O8EB 5IWAB 3CC8A 4IX9A 3RYCA 3MHTA 2ICAA 1Q2XA 1Z15A 2GD6A 5TJHA 2WZCA 4L9SA 3QFHA 3KJGA 4HCJA 1M2JA 3FPSA 2YWDA 2YS7A 3U81A 3UMSA 1GT91 5D85A 4M86A 3BXEA 3O5AA 4M54A 3HM2A 4HRXA 4DNPA 1MW9X 2Q6KA 3IQEA 4P98A 1O6ZA 2W0MA 3ZV6A 3FZEA 2IEAA 3IA7A 1CUUA 4IVPA 3T35A 2GO7A 4D02A 4ER6A 5D1NA 1Z28A 2OHJA 3JQAA 3VTKA 4WCFA 1W48A 1LD3A 3P97A 3DE7X 3AJAA 1W36B 4GH5A 1QR2A 1QUFA 2A58A 1BDMA 3DGFC 4OU4A 3QMMA 4RE6A 1S96A 1U8TA 4B4WA 4DY6A 2C7PA 4LF4B 3IP9A 2X2OA 1QLHA 1ONNA 1QFSA 2VT2A 2WJAA 2BHLA 2ODBA 2XNHA 1M6VA 2Q1TA 1JMVA 4FCVA 3ONDA 4R7TA 4XRRA 1Q16A 1JRLA 1G2PA 2I1WA 4OFBA 5ITWA 3LL7A 1Z63A 1M2FA 2R6R1 3M6XA 4O2RA 1LI4A 3MOGA 2GBIA 4YRBA 4DR3B 2GJSA 2YWJA 3LT1A 4RKQA 1XZIA 3M9XA 4UVHA 2CF5A 5ALPA 1WHTA 5ESDA