1ZNXA

Crystal structure of mycobacterium tuberculosis guanylate kinase in complex with gmp
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
182
structure length
182
Chain Sequence
VGRVVVLSGPSAVGKSTVVRCLRERIPNLHFSVSATTRAPRPGEVDGVDYHFIDPTRFQQLIDQGELLEWAEIHGGLHRSGTLAQPVRAAAATGVPVLIEVDLAGARAIKKTMPEAVTVFLAPPSWQDLQARLIGRGTETADVIQRRLDTARIELAAQGDFDKVVVNRRLESACAELVSLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanylate kinase
publication title Unique GMP-binding site in Mycobacterium tuberculosis guanosine monophosphate kinase
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 53
structure length 182
sequence length 182
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2005-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 1znxA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1znxA01
1NIPA 1WCV1 1TQ2A 3QJYA 3TLXA 2BCGY 3CF2A 2A9KA 5KDOA 5DGXA 5BWMA 2FN4A 4IW3B 1M6NA 4NU0A 4KU4A 1OFHA 4RVCA 4EFNA 2QMEA 1P75A 2XJ9A 3OIWA 4FI3C 5EZ5A 1YR7A 3IDQA 5FL3A 2ZRGA 1BMFD 2OEPA 3QF4B 3SBDA 2J7PD 5KPDA 3R9XA 5FBVB 2P3SA 4HB3A 4OBEA 3TE6A 1TU4A 4YXWD 4U00A 1XTJA 3N2EA 1TF5A 2CLSA 3SOPA 4ZI2A 4DB2A 3NBXX 4EAQA 4CF7A 2J0SA 2NTYC 1QVAA 1I4TD 2FPMA 1G17A 2ZAOA 1RIFA 1FMJA 5BN4A 3K0CA 3PEVA 4A6XA 2OBNA 1XTRA 4D0NA 2ANBA 1HV8A 3RC3A 4DEXA 1IXZA 1QHNA 1DBSA 4KVGA 2IS6A 5KNCA 3AP3A 2NPFA 1I4DD 4KSBA 1AZSC 3CX7A 3QXCA 1KTVA 4LCBA 4DLUA 4PPGA 3SR0A 4RD6A 1FUUA 1UKVY 4PFSA 4PPQA 1SKYE 1NY6A 4LYAA 5DH9A 2EYQA 4N0EA 1G3QA 1ZU5A 1SGWA 2R62A 1E2IA 4PC2A 4DHEA 4Q00A 1KSHA 2F7SA 2QAGC 3TQCA 2NMVA 3PFIA 1XPUA 1W4BA 2HV8A 4IJMA 2OE2A 2JIZA 3FVQA 1TU3A 3KJIA 3WP0A 4PPNA 2XNSA 1BH2A 3W5IA 4GT1A 4LJAA 3SN6A 3WXMA 1UBFA 3V00A 2CCGA 2WOJA 2ZSBA 4MRVA 1GRNA 2ZYWX 5L3SB 4M1SA 3WP1B 1NF3A 1WBDA 4JVSB 3Q7PA 1W46A 1N6PA 2A2ZA 4EDHA 2DFKB 2B8WA 1US8B 5A5GA 4Q9HA 2CVFA 2C04A 2YWFA 4NDZA 3NBYC 4TSFA 4LBWA 2JAQA 2ZRFA 1XEXB 3LBNA 4Q9LA 4DIEA 2C99A 4DC9A 4M1TA 2PX3A 4XVRA 3B9QA 2AXPA 2VTKA 4UXJA 4JSTA 4M1KA 1XWIA 4KSCA 4UNPA 3BK7A 2F55A 2D2EA 2XGJA 4XWOA 3BGWA 1YRBA 4ESVA 3U61B 3SC3A 5CYOA 4ACBA 2CL0X 4M8NE 2WAYA 4RD3A 2K5UA 4Q4AA 1KY2A 3LY5A 2W6IA 1CLUA 1IAQA 3RS7A 2EU8A 5H1YA 1KMHB 4K8OA 5JWOA 2BEKA 1ZP6A 1EX6A 2V55B 1HY3A 2FZLA 2BM1A 4OQNA 5TV2A 3SI7A 2FFQA 1ZM2A 2BMDA 1NMXA 3B7GA 2FSFA 3FE2A 4JLDA 3BBPA 3A36A 3NG1A 5D3QA 3RYTC 3ZVMA 1GNPA 4ZIRB 2C9OA 4QJ4A 1XTKA 3I92A 1G8FA 1Z0IA 4PAMA 1QHXA 4BFYA 5EJEA 2ZRBA 2J1LA 2G9NA 3PUVA 2FWRA 2R9VA 3SYKA 2Q3MA 5J4YA 4DSNA 1TTTA 1ZW6A 1HH4A 1G8GA 1Y63A 4TT3A 3ADBA 2IA5A 4WW0A 2UZ3A 2GETA 1G1MA 4NCIA 1UBEA 2QP3A 1KNXA 2A3RA 4V0OA 5CM8B 2AR7A 2IYYA 3MSXA 4X8LA 3SBEA 3ZIAD 4LC0A 2JDIA 4JL8A 3QEJA 5ANRB 1GKUB 1CTQA 1II9A 5FOUA 4BPBA 1RRCA 4C0LA 2FOLA 2H57A 3MJRA 4XWAA 1CEEA 1NN0A 3SE0A 4DDUA 1G3RA 2ZRMA 4WZAE 4C0QC 5JEEA 4NE2A 2A5FA 2NO0A 4A0HA 4CEHA 2WBLC 5HCNA 1FTNA 4Q9IA 2GNOA 4PHFA 4P33A 1G21E 3KJGA 4RD0A 3VR4A 5AJWA 1CR1A 2FSHA 3S1AA 1D6JA 1YZQA 4A4DA 1T0JB 4BFWA 3WHLA 3OE7D 2GAAA 2X1VA 1N6LA 1T5LA 1X86B 4EUNA 3IQXA 4JJZA 4PR0A 5AUNB 4JLMA 4W7SA 3FDIA 3LX8A 2O8EB 1D9ZA 3ONWA 4JBYA 3LWNA 4P4SB 1VTKA 1IY2A 1E1QA 1LF0A 1P61B 2ZE8A 5TY0A 4QKQA 2A5YB 4LPSA 2R6CA 3F0TA 4G5QA 1YKSA 2VBCA 1JQJC 5D3MA 2QGZA 2QT1A 1X8KA 1G5RA 3NHAA 2O8BA 4JBWA 4L9WA 3X1ZA 2XNDA 5LD2B 3CR8A 2VF7A 4US1R 1MO6A 2KBFA 3GEEA 4ASUD 5L3RA 1E99A 2OM2A 1E98A 2OUKA 4KYIB 3A1VA 2LKCA 2D7DA 3QXXA 2OZEA 1FP7A 2J5XA 1MRSA 3PG5A 2QMHA 2GXUA 2YINC 4EPXA 1LS6A 2XB2A 2X8AA 3MJHA 3DMNA 5CDFA 1I4LD 1OSNA 4C7OA 1JB1A 3D3QA 1ZUIA 4YMUA 4DSOA 1OLOA 4FINA 2WVJA 1E0KA 1SKQA 3AVUA 3W8NA 3KQKA 5JWRA 1G3UA 1QVRA 1R10A 4NYJR 2QP4A 2R8RA 2ZQ5A 4LX0A 2ZJ2A 4PQYA 3TUJC 1P2UA 4AG6A 4DLWA 4DT1A 1J2JA 1R2QA 2VLIA 3FKQA 2GRJA 3B85A 5DN6A 5TB5A 3AEZA 3PUYA 4CT4B 3K09A 2JJ2D 3LBIA 1ZNYA 1AKYA 1OXXK 2QROA 2YC4C 1RYHA 4PAOA 3SEAA 4D4JA 1AZTA 2CLDX 4KFSA 2MSDB 4R9UC 1MABA 2Z0MA 4IKEA 2X2FA 4B2LA 2RH5A 1N0WA 5HKKD 1ZM4A 3IO5A 2P2LA 2IS2A 4HB4A 1OT3A 5SZJA 4FMCB 3DZ8A 4LDJA 2O8FA 4NPHA 1AM4D 4EPYA 4R2HA 1T8TA 3W3AA 3GFTA 2RAPA 3C8UA 1CJUC 4AKHA 5CLQA 4MDEA 1HA3A 2IWRA 3LQRA 2OILA 2HYIC 2QM8A 5DHFA 2E1RA 1NLZA 1EFRA 2OAQ1 2DB3A 821PA 1ETUA 4M4SA 1ZMXA 1Q3TA 4E5UA 2IYXA 1XEWX 2WOOA 3BC1A 2YC2C 1JJVA 2GCNA 4TZ0A 4BQSA 3GLGA 1TQ4A 2WHXA 2ZETA 4FWTA 1UAAA 3GJ0A 1OKKD 5TMPA 1UBGA 3LFUA 2GEDA 3MCAA 1YZGA 2VP2A 1EFCA 1YQTA 1IY1A 2ZREA 3E70C 3O8DA 2BKEA 4WIAA 4AD8A 4C0JA 2Z5FA 3NEJA 5AJZA 3GEIA 2QSZA 3THXA 4IVRA 3QKRA 1P2SA 2DYKA 3BFKA 3QBVA 4ZDJA 3J81k 1GTVA 4FCWA 3TSZA 2F3RA 2IWHA 2ZRDA 4JS0A 2JCSA 4A0FA 1M8PA 2QE7A 3W5JA 1AGPA 1IJFA 1GITA 4Q4LA 3R9WA 4W5JA 5LBIA 3SHFA 2WJIA 1X1RA 1U0LA 1ZYUA 5DYGA 4BUJA 4GNKA 1XXHA 1QDEA 3TVTA 1ONBA 2AFHE 1JXOA 4Q7LA 4B48A 2C96A 3AKYA 1GL7A 2ZVPX 4Q18A 1AKEA 4W5HA 1Z29A 4QXAA 1T91A 2BM0A 1Z08A 3W6OA 4TLAA 2RGXA 1TUIA 3GJ4A 3T1TA 1CIPA 2GXQA 4LOAA 4QHSA 3FKSA 3U44A 1C4OA 1UDWA 2W6JA 4GDFA 2YHSA 3M6AA 2YZ2A 1DVRA 1XPRA 4MGZR 1LB1B 1FOEB 4JLKA 1QG2A 3LLUA 1V5WA 1I2DA 2AKAB 3PVSA 1P4SA 3EPKA 2VRWA 3E2IA 1NN3A 3O47A 4HLCA 2QORA 3HU3A 3K8YA 4MUBA 4P31A 5FUYA 2ZXUA 1UJ2A 4D0LB 2N42A 3WMFA 1E32A 4TTPA 3VAAA 3CX8A 5HZHA 3B9PA 1SHKA 1SXJB 2ZI7A 1XJ0A 2HJVA 4JYCA 1M2OB 1QHGA 2B8TA 2ATXA 5G41A 2G77B 3QY0A 4A2QA 3WNDA 3BH0A 3LX5A 2X19A 2OLJA 1XB2A 3ZGXA 2D3WA 2YVUA 3EC2A 3ETLA 2F9MA 3W6PA 1NG9A 3GLFA 1FW6A 3CWZA 1YRAA 3MFYA 2A78A 4JLNA 2CXXA 3ASYA 5K8TA 3AVXA 1U8ZA 1RFLA 3L0IB 5JS7A 5JSZA 1M1YE 2GJSA 4NCHA 3QXHA 5CIQA 2IYRA 5B64A 3VU9B 4TZ6A 1A82A 1KI3A 2JIZD 2RGAA 1K5DA 4NKRA 2VP0A 421PA 4F4JA 1F6BA 4N0DA 1DAKA 1II8A 1TF7A 4URWR 2JA1A 3B5JA 3LAWA 2IYZA 1FQJA 1EWRA 4Q21A 5HCIA 1MRNA 1RJ9B 4A8JB 1HT2E 2PX0A 3LD9A 4FIDA 1QBKC 1AQYA 4JIMA 2REBA 5F3WB 3ZS9A 4MQBA 3SJZA 3Q5DA 3PJRA 4UJ3A 3TH5A 1T0HB 3AV0B 3TMKA 2IX3A 2EWWA 3GLIE 2ZUBA 1ZBDA 3KB1A 1DEKA 3K9GA 2BBWA 2W83A 3KFXA 4L16A 1N0VC 3DHWC 4RKFA 5CITA 1GKIA 2BCJQ 1AS0A 2GZHA 2ORIA 2HT6A 2RCNA 2REXB 3AKDA 3BH6A 4K81B 5CB8A 3T35A 2V6JA 4OI2A 4CEIB 1HE1C 4V0ME 4XOIA 4KITB 4QHTA 2CHQA 3QXJA 3QKSB 4IVPA 2AXNA 4TMTA 1KK0A 2AK3A 1R0YA 4ZI3A 3I32A 2PT5A 4QG7A 4QOSA 2DBYA 1F48A 4LHZA 2R2AA 4DCUA 3IILA 3NKVA 4Z1MA 3A58B 4Z8YA 2RHMA 1X3SA 2VQSA 4NBSA 5TVKA 1NIJA 2J0UB 1UKEA 1HQYE 2W6ID 4PZZA 5L3QA 3VKWA 2EFGA 2HT1A 2W2XA 2FF7A 2FSIA 3C15C 2C9YA 3T1VA 2F1RA 2ZEJA 4ARZB 4QHYA 1CJMA 3IHWA 3RDPA 3VR6A 2GKSA 4W9MC 5C46F 4MKFA 3CF6R 1H8ED 1Q57A 4LZZA 3UMFA 1XRJA 3B60A 1YVDA 2I4IA 5E4FA 2ZRCA 5BXQC 3JVUA 1U81A 3PEWA 2IS4A 3BJIC 4OQFA 4R71A 5JJKA 1MH1A 4XVUA 3ZJYA 2VL7A 1G7TA 2KJQA 1W44A 1E6CA 3CF0A 3SJAA 2OCBA 1PV4A 5L8VA 1E2FA 3HPRA 4TT3D 1GVNB 3CWQA 1FX0A 1YR9A 4AYWA 5AJYA 5FI1B 1NBMA 2C9CA 2VH5R 4Z51A 3NC1C 4TLEA 2JDID 4HZIA 3RLFA 5K8LA 1NVVR 2RHDA 4M22A 2HLDA 1KK2A 2GESA 4LHVA 4EIWA 1D9XA 3O8RA 3UIEA 1NKSA 3I5XA 4CDGA 1AS3A 1XBTA 4PQRA 2UKDA 3HJNA 3QPVA 3GLFE 3BAFA 1G8PA 2W00A 4OHZA 1H8HD 3QF4A 4M1OA 4IDHA 1KJZA 3NEYA 1P73A 3CH5A 1TX4B 5E7IA 1UDXA 3K9NA 5IDVA 3P4XA 4PO1A 4Y0VA 3CH4B 1G6OA 2I1VB 4PC6A 4CEJB 5BYKA 3VFDA 2RGBA 3Q5EA 2QTVB 1TEVA 2KI5A 2OXRA 1CR4A 3A1TA 5IK2A 5CJ2A 2ONJA 2WWFA 1WB9A 3RC8A 4PSAA 3TR0A 3CRW1 1OXSC 2E9SA 2ZJ5A 4A15A 1PUJA 1OW3B 1ZD8A 5BYJA 1G7SA 2RGNA 1Z22A 4MYHA 2VSFA 3EZFA 5UKDA 2PT7A 3RAPR 4CT5A 3K70C 1DAEA 4QL3A 2PCLA 3VQTA 3TAHA 3QSYA 2XNDD 4DRZA 5C2JB 1B23P 2W58A 5FL7A 3EPJA 3DPUA 4XH9B 1P9NA 4I1SA 2OCAA 4I1OA 3VHLB 4C30A 5LD2C 1S8FA 5EE1A 2VHTA 1N6OA 1Q1BA 5KSPA 1S3GA 2VHCA 3GJ7A 3VX3A 3OEHA 4A2PA 2O0HA 5FI0B 4D82A 1KNQA 2OBMA 2NPIA 3P27A 2ZITA 1ZM9A 2FFAA 3X1XA 1HUQA 4DDWA 1XZQA 1IN5A 1XD8A 4PC3A 3I8XA 2O5VA 1WDTA 1J8MF 3GLHE 4JLVA 5CLLA 1N5KA 5DN6D 3C4JA 1QRAA 5KDDA 4HZUB 1IJEA 2GK7A 3Q8XB 3EC1A 1E9BA 5J4LA 3QI2A 5L3SA 2Q9BA 4V02A 1T8UA 4XD7A 5BN3A 4B71A 1AA9A 1G4AE 1KK3A 2CE2X 3PEUA 4Q48A 1PUIA 3VNUA 2A5GA 5DYIA 3IIMA 1US8A 2EW1A 121PA 2QENA 3DOEA 5P21A 3EPHA 1R5NA 1EGAA 2WM9B 3TKLA 5AJVB 3U5ZB 4NP6A 1XMVA 4Q01A 3QKTA 2GK6A 3C5HA 4FN5A 1R5OA 4QBFA 3B78A 1ZIPA 1T9HA 3QG5A 2EFDB 4MGYR 3UMRA 3VR1A 1EFRD 1Q3HA 1S0UA 4RCZA 221PA 1DAHA 1SVWA 2PLFA 3AGPA 1CR0A 2Q3FA 2OV2A 1NBME 4TLBA 1E4YA 3AF3A 4UNNA 2C2HA 1GWNA 2QN6A 5JBQA 1NP6A 1KMHA 4IVQA 5FOXA 4MYCA 4MRPA 1KAOA 2WJYA 2ZRAA 3EA5A 3K0AB 4UNRA 2J7KA 4BE7B 4A9AA 3B82A 3F8TA 4ERNA 2Z43A 1YE8A 1ZNZA 2V6IA 4CW7A 5HR5A 3RS4A 2ZJ8A 2BBOA 4DLYA 5AR1A 2KSQA 2BJVA 2GEVA 4TMVA 4HDOB 2QE7D 1Q1ZA 1ZNXA 1Q21A 3MWJA 4NHOA 1GOTA 4IFEA 1CJKC 2QMUA 4KV9A 1QHSA 1VCOA 1Q1QA 2FPKA 4GOXA 3KZ1E 4WA7A 2ZJAA 4Q1AA 2JLYA 2IHBA 4HUQA 2CL7X 5E7MA 3L0OA 3DMDA 2O8CB 2ZE6A 2WJVA 1E4VA 1GAJA 2QRNA 2B7CA 5JJLA 2O0KA 4DUGA 1E9DA 4NYIQ 5SZIA 1S1MA 1G4UR 2RGDA 3SFZA 3FTQA 1RYFA 4QFMA 1TQDA 4EKDA 3L0SA 3D7MA 4PSVA 3VKHA 2BWJA 1GRQA 1FZQA 2H92A 3FMPB 4GOKA 3SNHA 1XTQA 4MRRA 2WJJA 3KXKA 4GI7A 3FGNA 1NJFA 4RSGA 2OT3B 1Z6XA 1SULA 3NWJA 1R0WA 4HB2A 3CBQA 3AB3A 3GJ5A 3SU8A 1TQ6A 1UKZA 5EXPA 3ZQJA 2ZR7A 5K8IA 2XITA 2F43B 1Z6YA 1YHNA 4F38A 5GJVC 3LBHA 1SKYB 4P4SA 3DM5A 2ZI9A 1VYVA 4KO8A 3SFVA 2R6AA 1E69A 1P60A 4FMDB 1JECA 2CJWA 2QQEA 4JVMA 2GDJA 3O8BA 1KJYA 3D6TB 3A37A 4Q03A 5GJCA 4OHVA 3D31A 5EE9A 1XNJA 3K09C 3SJCA 3LLMA 1CJTC 1E1RA 3JZAA 4O25A 2QMOA 5DI9A 5J47A 4YMSA 2R6FA 4HAZA 2ZS8A 5BQ5A 1F2TB 4B2IA 1OHHA 2WJGA 4P32A 2WKPA 3HP1A 3WYGA 2J0QA 5CM9C 5KNBA 4JKIA 2QPTA 1GDDA 3QQ5A 1KO8A 2IK8A 4TYYA 2AKYA 3W90A 2ZYVX 4Q9KA 3THWA 5AUOB 2QA5A 3R8FA 4C0HA 1IN8A 3K9HA 4KJZA 1QHIA 2ASEA 2J9RA 2Q21A 1NLFA 2MMCA 3AVWA 1ZJ6A 4MGIR 4V0NA 4TL9A 5FBRB 3EWAA 2NIPA 3KXLA 3QEOA 2CHVA 2IUSA 5DISB 4WAUA 3EASA 5EUQB 4D0GA 1KGDA 2J87A 5FUXA 1K8RA 2C95A 2GBLC 1NN1A 4RD1A 5EXSA 2G3YA 1AGRA 3NDBB 4AI6A 3PENA 4AY2A 4JVNA 1KY3A 3GP8A 2FFHA 2PCJA 1WXQA 4LHWA 4OI4A 5CYPA 4L15A 3KKNA 4EPTA 4F4IA 3NBFA 3BB3A 1N5LA 2WMNB 4TTQA 2IF0A 1R5BA 1W36B 3VR5A 2CNWA 1EXMA 2GHIA 1G9XA 3FMFA 5EUMA 1EFUA 3WMGA 4LJ8A 2OXCA 1OJLA 4ITRC 4Z1MD 3WYFA 1G16A 1J70A 1BOFA 5JECA 2XZLA 3VKGA 1LS1A 2HUPA 1M7HA 1OPXA 1CS4C 1FFHA 3CRRA 4LYHA 4Q5IA 5J5CA 1XJQA 3T1QA 2VA8A 4A6PA 1G3IA 1N6KA 2OCPA 4A82A 4AYTA 1KO1A 1GL9B 4IEIA 3A4LA 1W7AA 4LY6A 1RE0A 2NOAA 2DCUA 1D2EA 4IEEA 4M1WA 2IT1A 4Q66C 2NG1A 2ZRPA 4G5RA 4J0QA 1Z2CA 2ZSDA 4KFRA 1OFTA 2PH1A 1OH6A 5JZVA 1E3MA 1WF3A 2Q9CA 5JI2E 2XB4A 3OEED 1W5TA 2XTMA 1F2UA 4KBFA 4OQMA 4LJ7A 1E96A 1KZGB 4Q4HA 1FNNA 2QSYA 2DY1A 2FU5C 1NBMD 3EZ6A 1XMJA 3OAAA 2QTFA 1EK0A 2DFNA 2P6UA 5LDDC 2A7QA 1X1SA 1YR6A 3AVPA 3B13B 1NVWQ 1ZIOA 1VCIA 4IOLA 2HLDD 1AN0A 3NH9A 4LJYA 2QGNA 1RC8A 1CULC 4DLXA 3V9PA 1LW7A 4P0TA 1KSJA 3IPXA 1G291 3R7WB 4D4MA 4EQ6B 4WXPA 4NCJA 1Z8FA 3K53A 1G7CA 4KI0A 5JEDA 3AF2A 1VKJA 2W0MA 1W49A 3WY9A 1IBRA 5EP4A 4XTRA 1P9RA 1ELOA 1G18A 3TW8B 4TMWA 3BIFA 4PHHA 1U99A 3EPLA 4ZPXA 2QPOA 3BH7A 3CUEF 2FA9A 4E07A 1FP6A 4BASA 4BLRA 2TMKA 4HAYA 4IDNA 4PTLA 4QNMA 3EIQA 4DEYA 4AKIA 2O8DB 2F1JA 1IONA 2P6NA 5EE0A 4BEBA 3BORA 2FSGA 5AUPB 1KI7A 2BEJA 1GFIA 4YLGA 3FMIA 5IF9A 2GVZC 1RVDA 2ZU6A 2LKDA 5EE3A 4NZYA 2ZANA 2IS1A 1ZC4A 3ECCA 1HYQA 1XFAA 2QT0A 4OJKA 1YZLA 2YWGA 2GF9A 4KODA 3PIRA 4F92B 4RY2A 3VX4A 3DL0A 2DFTA 2X77A 4YMWA 4PO9A 2WWYA 4QJ3A 1IN4A 4PX9A 5JI3E 4GP7A 3VU9A 2WWXA 4RZUA 4HUTA 3WNBA 4G5SA 3QF7A 1YJ5A 4URVR 1SZPA 3RRNA 3WRXC 1KDPA 2FG5A 3QBTA 2Q9AA 2ZRLA 4XIGS 3KFVA 4OK6A 2F6RA 4BFZA 1KDTA 2FJUA 5GVSA 3H86A 2V7QA 2V1XA 1E2NA 2WPDD 2N1BA 1RJ9A 2V8OA 4FD2A 4A8JA 2GXSA 4AURA 4BZQA 2JLUA 1JR3A 4TYNA 3UATA 2D06A 1JJ7A 2PLRA 4TYWA 2ZJOA 4AG5A 1W4CA 4XD7D 4ZO4A 5B2ZA 2XZPA 4U5XA 2JLQA 1VHTA 1I2MA 3V4FA 1Q1EA 1XCPA 3U2QA 1Z3IX 4JLJA 2GBLA 2L0XA 1E2GA 2A5JA 2J3EA 4CEIA 1DO0A 5FBLB 4MDFA 1XCGB 1T4GA 5B58C 1NY5A 3CPEA 4LJ5A 2J46A 3DVLA 4NYMR 5KNDA 1V43A 3THYB 1E0JA 4OL0A 3WBKA 2W2TA 2YWHA 5HPYB 1OYWA 3L0PA 1E2KA 2WV9A 3H4MA 4C4PA 4PHTA 1Z5ZA 2PJRA 4RFSB 2FGJA 3A1UA 1ANKA 4Q4JB 1OH7A 2HJGA 4GFDA 2FGKA 2J0UA 1WMSA 1R0XA 3QG1A 3CONA 2UZIR 3FPAA 1OH5A 5F9FA 2D4HA 1NRJB 1KI9A 3UXMA 1LNZA 1C9KA 1N5JA 4L9SA 4ARZA 1XPOA 4I1UA 4Q02A 2YOFA 2C03A 3U60B 4D2IA 1SVSA 2C5LA 1BKDR 4GZLA 1BMFA 1S9DA 2XEXA 1R0ZA 1UADA 4NL4H 5KDLA 5JCZA 4KHZA 3S1AB 1GRRA 3DDCA 1F3OA 3TQFA 4S2EA 1D5CA 4FMBB 4HAXA 5FPHA 4BFTA 1KDOA 3T5DA 4BFVA 2WJHA 4B6FA 2O0JA 3B2EA 1R4AA 2C77A 3F3YA 1WA5A 2IXFA 2VP9A 3AVQA 3FHCB 4QGGA 4YQFA 5HTKA 4BLPA 3MGCA 3CPHA 4EPVA 2EQBA 2WICA 1X6VA 2CEAA 2RKOA 4IDQA 2B92A 3RWMB 5CDFE 1N2CE 3KKMA 1KI4A 2PZGA 4D26A 1L2TA 2V9PA 4DUGD 1JPJA 1WQ1R 1NVXQ 2P5SA 3TUZC 1PVOA 2CMKA 1IM2A 1E2QA 4IDPA 4MYUA 3C5CA 3QOFA 3CKLA 3E5HA 3CB4A 3LDAA 4TLCA 5C4GB 1UFQA 1KDRA 2QAGB 2RGNC 3HR7A 3X1DA 2WWIA 2GJKA 4ZDIA 1G64A 3MUFA 4LPKA 5BN5A 1X8JA 5FUWA 1RZ3A 2LWIA 3PXGA 5J4KA 2QBYA 1UEIA 2C98A 521PA 2MSEB 3L8YA 4V0LA 2REOA 2GXAA 2B7BA 3THOA 3L8ZA 4C7OB 2QTHA 4CYMA 1VHLA 3TIFA 2ZPTX 2XSZA 1XD2A 3B1ZA 2B21A 4B3DA 2ZM5A 3PUXA 3I8SA 4AYXA 3DOFA 2HCJB 1ZUHA 1JBKA 4DCNA 1ZM7A 5JS8A 1XDBA 2GWHA 1KI8A 2FFBA 3K70D 4NONA 4QBHA 1SHZA 1XTIA 3W8RA 4Q7MB 5EXTA 2V54A 2ZJBA 4M9QA 1DADA 1FNMA 5FUVA 5G3ZA 3NBZC 4BFXA 1IN6A 3SJBA 4OK3A 3HU1A 3C7KA 5DNYB 3ZZTA 3OF5A 2ZI5A 4DBLC 1KHTA 2ZR0A 4MITA 3BWDD 3VR3A 1RPZA 1UF9A 2H5EA 3GLGE 2O8FB 5GADl 1U8YA 5KSYA 1OH8A 2J59A 5F98A 2BOVA 4P4TA 5FTMA 3ZZUA 4EPWA 4TSFD 2JLZA 1KJWA 2I1QA 2ZJYA 1IOZA 2GCOB 4QC2A 1KMQA 5EP3A 5AUQA 1F60A 3DEFA 2NZ8A 5TXGA 1KZ7B 3P32A 5JRJA 1QHHB 2ZI3A 2NO1A 2WMOB 5FTKA 1CF4A 4M9SA 2VHUA 3R8CA 3VMFA 4LJ9A 1ESMA 1MO4A 3GLIB 3QE0A 3GJ3A 4B34A 2IYLD 3LW7A 4PC7A 4B47A 1ZNWA 1NSFA 1E2DA 1XXHE 2OG2A 1J8YF 4UKDA 5FOWA 5IHPA 2Y8EA 3PUZA 4HZUA 1DAMA 5FBWB 2RMKA 3VR2A 2OHFA 2IXEA 4O3MA 4RFVA 4YDHB 3CPJB 2XOKA 5JJIA 3PQCA 1W0JA 1TUEA 4H1UA 1OIWA 2V4ZA 4LV6A 5GJBA 2F1HA 2QU8A 1G5PA 4Q1DA 3ZH9B 3KQUA 4RZ3A 2DHRA 2NZJA 5KYKA 4BLSA 2CNWD 2R44A 1NMYA 5CIWA 1E9AA 2HF9A 1JALA 1BO6A 3KXIA 5HE8A 3RRZA 4DJTA 2ZI4A 4A1FA 1W36C 4JLAA 2GF0A 2ZI6A 4DDVA 2G0NA 4HAUA 3ZIAA 3B1VA 5EP2A 4PPFA 2Q6TA 3AF0A 4HLQB 5CK5A 4B2PA 1VIYA 4BFUA 4WXRA 4MA4A 1BYIA 3H1TA 1E2HA 4BRWA 4DKXA 3U7FB 2P6RA 2ZU0C 3ADKA 4JYBA 2PMKA 1J90A 1FMLA 2BC9A 3C14C 1JEEA 4CIDA 4QM6A 1DE0A 4OYHA 2GZAA 4KAXA 2BJWA 2HEIA 2QPAA 4UNQA 3CX6A 2ZS9A 1J99A 3HPQA 1YZKA 3UK6A 5E7JA 3GEHA 4Q7JB 1MR3F 3ZQ6A 4A2WA 2CCJA 2DWOA 1KO5A 4L5BA 1OFIA 3U7GA 1HURA 4JVLA 2ZUCA 1EWQA 2ZE7A 1O3YA 3BXZA 1A7JA 1ZCBA 2AWNA 1RRGA 3CW2A 1R6BX 5JHHB 3EG5A 1Q12A 4C3ZA 1Z63A 2O8CA 2DWQA 4HDCA 4LV8B 3PCRB 1P7CA 1U9IC 3GLFB 1HTWA 4NYJQ 4HEJA 3RWOA 2WWHA 1E1QD 4TYQA 3DZDA 4NH0A 3AVTA 1E9CA 2FV8A 2IYVA 4N1AA 1P2VA 1VPLA 3U4QB 3IIKA 2QY9A 2KBEA 3RANA 3QVVA 3HU2A 4RD2A 4DLVA 3TAUA 4BLOA 1ZCAA 2IXGA 2PBRA 2IYWA 1R8SA 2P0EA 3H84A 4KFUA 4L8GA 4D4LA 3SS8A 3U3JA 1II8B 2F1IA 1G7RA 3RS0A 3WNCA 4UNSA 4U7DA 4KBGA 3OZXA 2IEYA 2EFHB 3SQWA 1N6NA 2P5TB 3P4YA 2EFCB 3A4MA 4JT2A 3OIYA 4M0LA 3GFPA 2BIFA 4DDTA 1W2GA 2OCYC 1S4QA 5DIFA 4EFMA 3LA6A 1CU1A 1COWA 1XZPA 1NL3A 1AS2A 4A92A 1II0A 3CO5A 2CK3A 1P62B 5H70A 4G1UC 4KLZA 1FQKA 1CBUA 2RGCA 2VP6A 1KOFA 5EE5B 1G8YA 1XMIA 3TW4A 2CCKA 2QRZA 4ZDKA 5DE3A 2JEOA 5DI3B 4B3FX 5HKKA 1M7GA 3ND9A 2ZTSA 3AGQA 4Z54A 3BE4A 1NNEA 1AQUA 1VCMA 1DAFA 1F2TA 3IUYA 4RD4A 1DS6A 4HLDA 4OHXA 4IHQA 1ZM3A 4L4UA 1G8HA 3GD7A 1CXZA 1S9HA 1XEXA 2BDTA 621PA 3FOZA 1GNRA 5H8WA 1R7RA 2WWWA 3WBJA 4OI0A 3FHOA 4ZV4A 1VIAA 2J45A 3GLHB 4WZBE 3LVRE 2IW3A 4ESHA 1H65A 5IRCD 2H1LA 3T15A 1JR3D 3MG9A 3BB1A 1DTSA 2PEYA 5L3QB 4QRHA 3KX2A 1OXVA 1YZUA 2QEQA 1GKYA 2AX4A 1A1VA 2A30A 3NVAA 1G3MA 2ODBA 3OFNA 2XAUA 4IRUB 1U2RA 1T3HA 4ZCIA 3RSLA 1OKKA 3HYTA 4JL5A 1SVKA 3ZDQA 3ZVLA 2HCBA 5E3HA 3RVBA 2EVWX 4V0KA 1E2PA 3HR8A 1VG9B 2ONKA 3AP2A 3TSOA 2XTNA 1XCMA 1DOAA 2IUTA 2YNMA 2ZSAA 4FMCF 4NCNA 3CNLA 4JT4A 2BVNA 4KXFB 4ZIRA 3M1IA 3OESA 3O8CA 1P3JA 1Z83A 2BV3A 2VSXA 4B3BA 1Q22A 2G1KA 1LVGA 3HYRA 4B73A 4DSUA 2ODNA 4F93B 3A4NA 4EJSB 5EXXA 1D2MA 2GA8A 5KO2A 5KUTA 4CGZA 1E0SA 1O87A 3MAAC 3U7HB 1K5GA 1GM5A 4DIDA 1Z0AA 3QENA 4JL6A 5E95A 6Q21A 1JI0A 3N70A 4Q1BA 4Y0AA 3TBKA 4C2TA 1AK2A 1MO5A 1OIVA 4LYFA 5C18A 3I1FA 3BFXA 5L3VA 4G3XA 2KE5A 4TL6A 2QG6A 1VECA 3CRVA 3L43A 4C0BA 3U6BA 3FKSD 4LYJA 5FTNA 4HSEA 2W6JD 3CLVA 4AKGA 3Q7QA 2JLRA 4MUAA 1ZRHA 3OIUA 3LXXA 2C8VA 3T61A 1EX7A 3LW8A 3TSWA 4GSYA 2KB0A 5JCPA 4A36A 2HDNB 3ADCA 5JMTA 4C0KA 1PJRA 1N0UA 2RGEA 2OFOA 4C2UA 1TAGA 1Z6TA 3TVDA 4PAQA 3BD9A 5B30A 1PLKA 3LH5A 4BRUA 3GCGA 3NDPA 3SYNA 1MV5A 2OFXA 5JWHA 2IYSA 1WP9A 5FTJA 4URUR 5KOYA 1U9IA 5FR2A 3MWKA 1Z6AA 3DKVA 3BRWD 3ASZA 1SXJC 4URYR 4DLRA 4QGFA 4QM7A 4UJ5A 3B1XA 3AQ4A 3KTAB 1IHUA 2O8EA 4TL8A 3IEUA 4ZKEA 1VYTA 3PEYA 3R7WA 2ZRHA 2ZRNA 3EIEA 3KDSE 4EQ6A 3IEVA 4JSYA 1CP2A 2E87A 3ICQB 2PEZA 3RSOA 2AN9A 2EFEB 4OQXA 3ZD6A 2VP4A 3CZPA 3SYLA 2ZAMA 4QJ5A 4JLOA 1LV7A 5B57C 2GJ8A 5C4MA 2FEMA 5ELXA 3FFBA 4WVFA 2XSZD 3F5FA 5KTYA 4ZKDA 2WSMA 5AJXA 2KWIA 4EPRA 1XEWY 5F9HA 5KHOC 4M2LA 3K0FB 4BLTA 1G5TA 2VSOA 1Z0JA 3N2IA 3Q3JB 3V4RA 2R65A 3IIJA 2O8DA 3AVVA 4R7ZA 1ESNA 3QVUA 3REFA 1OXTA 5FPSA 2VHJA 1BS1A 1E94E 3GFOA 4JLBA 2ZSFA 1D2NA 4DXAA 3REGA 3A6PC 3I3SR 1NJGA 3NTUA 4GOJA 2XXAB 4DLTA 1E9SA 3T1OA 2V1UA 4A8JC 3AH8A 1KYIA 4FW9A 1KI2A 3B8HA 3P20A 4M21A 2IL1A 1RKBA 3EZ7A 3IQWA 1ZUNB 3K0EA 2ATVA 2BHRA 4N3NA 3RABA 4I1VA 4MKHA 4EFLA 4MRNA 4B3XA 1NMZA 1L7VC 2ZROA 2QQ0A 3BFVA 2ECKA 4RZ2A 4XVQA 4LI0A 2BBSA 5FFMA 3FB4A 1Q0UA 1L8QA 3IHLA 2Z4SA 2A5DA 4AWXA 5AWFC 5K8UA 4LRWA 4LBYA 4TQUS 4OJQA 3ZVRA 2H18A 3KKQA 4C0AC 1KI6B 3W6NA 4M9XA 4D80A 3EA0A 4GBMA 1F5NA 3PITA 4QNRA 3U3OA 4D4KA 1E2JA 4US2R 1NKTA 4LK2A 3I61A 1FL9A 1NVVQ 4B76A 4B32A 1SVIA 2XOKD 3KL4A 3T34A 1JXMA 1W0JD 1RRFA 3ZS8A 3GPLA 3TK1A 1T3SA 4B33A 2F9LA 2PZEA 2ODEA 4LHYA 3VNVA 1NG1A 3RRMA 1H8EA 1FTSA 1W47A 3FYHA 4P3YA 2GTPA 4JLPA 2DWPA 3P26A 3X2SA 2ZUDA 4G0NA 1MKYA 2ODWA 1Q20A 3MMPA 1M74A 3UANA 3THYA 3GMTA 4UXHA 2OBLA 4HAVA 1HE8B 1YU9A 4HLUA 4AC9A 4HUQB 5G3YA 2H7VA 1IN7A 2DPXA 2YOGA 1IXRC 1JPNA 1A2KC 1JNYA 4RFSA 4Q9JA 1UM8A 2IYUA 3A1SA 1YR8A 2ZRKA 4ILEA 3Q72A 3AF1A 3MD0A 4H1VA 4Q4JA 4ON9A 5FBQB 4F4CA 3G0HA 2JATA 3CRQA 3W3ZB 4PSKA 4GL2A 2FMXA 1E2LA 5GVRA 1DO2A 2ZYTX 2PZFA 4UXIA 5JLJA 2ZVQX 2BMEA 1TADA 2JLVA 3LV8A 2F3TA 4YMVA 1H8HA 1S3SA 1IY0A 4JKYA 3UPUA 4RCYA 1LTQA 1SQ5A 3UWKA 3B1YA 4U02A 3ZVNA 4FWIB 3L82B 1ZAKA 3DO6A 1U8AA 3NHBA 2XZOA 1GL6A 1XD9A 2CL6X 1VMAA 2WTUA 3I62A 1AJEA 2ZYUX 1GZSA 1U0HC 4QBGB 4W5WA 3U7EB 4DLSA 1D8TA 4TL7A 2R6DA 3KJEA 2YV5A 3M0EA 4GPTA 4X8HA 1U98A 1KKLA 1VG1A 2HF8A 3RS2A 1A5TA 2Q3HA 3K9LA 4PHGA 5IK2D 1SXJA 4BZPA 2JLXA 4MKGA 3K70B 1UEJA 4FCVA 3NXSA 3B6EA 1JR6A 3PUWA 1X8LA 2CJWB 5LB2A 1WBBA 1W4AA 4D81A 3R9IA 3BERA 1E79A 3UG7A 4BEJA 1CRPA 2AWOA 1FUKA 2OFWA 1TEXA 2Z4RA 2BMJA 4X8MA 3LQQA 4H9GA 4I4LA 2QAGA 1GP2A 3CIOA 3HWSA 1XU4A 1Z28A 3FFAA 5FL7D 3KQNA 4PXAA 1CKEA 1L4YA 4IOMA 1EFTA 1W0KA 2AL7A 4DVGA 1Z06A 5KSZA 1GG2A 4XJXA 1VDZA 2OLKA 1GILA 2QI9C 3LNCA 1Z47A 1VYUA 2JJ1A 3GQBA 4M53A 3THWB 3WYAA 2D62A 2VPPA 1C1YA 2WSSA 3Q85A 4DLZA 3X1YA 1E2MA 1HT1E 2ZR9A 3OEHD 4MKIA 3A8TA 1W2HA 4QBIA 4PQFA 2J0VA 1EESA 1ZD1A 3MWYW 1COWD 3FMOB 4Q4AB 2B6HA 1ZC3A 2CK3D 2ZJZA 1NVUQ 2FNAA 3GJ8A 5SZKB 4A0RA 2N46A 4BWYA 5CB6A 4E09A 3RS3A 1M34E 1YZNA 2WAXA 4CVNA 1EFHA 4US0R 5C1BA 1BIFA 2QNRA 1TMKA 2BMFA 2ZRIA 1B0UA 4GZMA 2OAP1 1YZTA 5SZHB 4D25A 3A1WA 2XTZA 3DKPA 1W5SA 1EG7A 5FOTA 5LB4A 2GCOA 4MGKR 1JAIA 4BFSA 1K6MA 2WWGA 3SZRA 1LF5A 3AKEA 3QKSA 4E03A 1N25A 1G19A 1QHHA 4M9ZA 3LO5A 4Q1FA 3X1WA 1DAGA 4B6EA 3EX7C 1IXSB 4ZDWA 2WZQA 4TLDA 1QHYA 3GLIA 1ZVQA 1QG4A 3EWSA 1MOZA 4IDOA 3OFND 4B75A 3QNUA 3AUXA 4F91B 1OB5A 5DHAA 3Q9LA 3R20A 1LFDB 3ZD7A 4B44A 4GMXA 4V0MA 2DR3A 2BKUA 3BB4A 3DM9B 2ERYA 3AF4A 1NSTA 4CEHB 1TPZA 4A0GA 5CJPA 1F2UB 3TJZA 3ND8A 4TMKA 2P65A 1KI1A 3QPUA 2J7PA 1N5IA 1XJCA 2FZ4A 2FX3A 4I99A 4Q4HB 3T5GA 3QKUA 4QGHA 4YXWA 1W36D 4GRAA 1S1CA 4PANA 4B43A 4O0MA 3QIAA 2OSBA 3U3KA 2JLSA 4B3CA 5EQTA 4II7A 1G6HA 3CM0A 1HQCA 1KIMA 3MLEA 3PR1A 5G40A 1W4RA 2MMGA 4X8OA 3TGPA 5FR1A 1SXJE 1NLYA 4EJSC 3M4YA 1ZD9A 4E22A 4OI1A 4URZR 1N6RA 4D6PA 2GEUA 5KU1A 2Z6VA 5D3MB 3SQXA 1S96A 2JJ8A 1PLLA 4O2LA 2O8BB 4R98A 4UQOA 5M04A 4FXPA 3T06B 3TRFA 3U3RA 1BYUA 4HB0A 1SVOA 1NI3A 1U90A 4WOPA 4ABYA 1RRPA 4AKEA 5DSZA 3RS5A 1OV4A 1U0JA 2JASA 2FDCA 8OHMA 1IQPA 1SVLA 1CJVC 2YWEA 3AKCA 1OFUX 1AIPA 4MH0R 5J40A 4OHYA 3OIVA 1CRQA 3P1JA 5BW8A 2YKGA 2ZRJA 4S35A 2ZSEA 4OHWA 4LSGA 4CEJA 4BZXA 2QAJA 1VCNA 3SHWA 5F2EA 4YMTA 1SVMA 4LHXA 4ZCLA 4NYIR 4DT1B 1GUAA 1N6HA 2D74A 2IF2A 4DCSA 4M1YA 4WZ6A 4DWJA 1JR3E 4TWZA 3UMSA 2YJTD 3AM1A 4PZLA 1CR2A 2H17A 2CE7A 3U4QA 4F7WA 5CK4A 2FEOA 3D8BA 1MABB 2W2VA 2QM7A 3ZYCA 2BBTA 3QXSA 1GSIA 1DELA 2GZDA 4OK5A 1UKYA 2VF8A 2ZIAA 2SHKA 1RW4A 1E1RD 1PZNA 3OHMA 3B1WA 2VYFA 4JMPA 3UG6A 1N3BA 4AIIA 2GILA 2IYQA 5FPYA 1ZINA 1OHHD 1KO7A 4HAWA 1E9EA 4PO8A 4AK9A 1FPMA 4DZZA 3GJXC 3I72A 5JHGB 2NO9A 5DO9A 5DLQC 4KFTA 4IXNA 3WRYC 1JQLB 1HEIA 2HXSA 1DG1G 4HYYA 2PL3A 5HE9A 2G83A 1KAGA 2WIAA 2IBMA 2HXYA 3RNLA 2QZ4A 1DARA 4DCVA 3KQHA 2HYDA 4TMXA 4YC7A 3VTKA 1Q44A 4KVAA 4LV5B 3TUIC 1TNDA 3TR5A 4ZCMA 2PMDA 2XJ4A 1G41A 1W48A 1U94A 2WIBA 1WRBA 3G82C 4FMDF 4TN1A 2VHQA 3GLGB 2IEZA 3HDTA 1KSFX 3KUDA 5TARA 5TDHA 1UPTA 1T5IA 5GJWC 1Z0DA 2G6BA 2ERXA 3FHTA 5DI3A 5A4JA 1M7BA 3THXB 3QKRB 3AP1A 3L2OB 3LXRA 1LY1A 1PLJA 3EZ2A 1E9RA 4P4UA 4FCTA 3RRYA 2GJ9A 2FE4A 3AVOA 4TTRA 3UKDA 3EAQA 3FWYA 4XTCS 2IC5A 4G01B 3EARA 2P67A 3GLHA 1T6NA 5FH9A 5J4HA 3PV0A 2QP9X 1G20E 1VG8A 1XXHB 2G88A 3H0KA 4DSTA 1OE0A 2FH5B 4XWKA 2V3CC 1VG0B 3KKOA 3CNOA 2DFLA 721PA 3W34A 2GVDC 1MT0A 2ORWA 4BGDA 1DG3A 1N6IA 1QF9A 5EZ6B 2EWVA 2W0SA 4KCGA 1OXUA 4K46A 2H16A 3IPYA 3N5CA 1Z0KA 3KKPA 3U44B 4M1MA 2VP5A 3NIBA 4MYTA 3I4LA 2Z83A 2EYUA 3W9YA 2Q0HA 3K0AA 4LWZA 1DAIA 2CHGA 3CZQA 4Q1EA 2D2FA 4TQ9A 2LCFA 1JAHA 3OEEA 3ZLJA 5G53C 2JGNA 2FPLA 4ACAA 1P5ZB 2GAOA 1XX6A 4JZKA 1XTSA 3E1SA 3C16C 2QL6A 4Q19A 3OE7A 1OF1A 3OAAD 4EJSA 4CRWB 1A2BA 2ZE5A 2AD5A 3WHKA 2UVQA 2XX3A 2WKRA 1XP8A 2YYZA 1R8QA 3EW9A 4LUCA 3K0CC 1A4RA 1Z07A 3BOSA 2RB4A 4C9BA 3QUSA 4LGMA 3ADDA 3K0SA 1Z0FA 1OIXA 3I5YA 1NN5A 4KLNA 2AFIE 3T12A 3NC0C 1TL7C 2NGRA 2QBYB 1XF9A 4RJLA 3ZZ0A 5AK0A 5JSZB 2X2EA 2QUZA 2GCPA 4I81A 1Z6GA 4GMDA 4LJ6A 4OQLA 1DPFA 4LC1A 4B3GA 4ASUA 4R2IA 1XD2B 1ZU4A 4XSHA 4WBSA 4RKEA 5A0FA 4V03A 4IFBA 5IT5A 2PJZA 5FOSA 3K1JA 2YOHA 1T3LA 3KB2A 5FPTA 4G5GA 4Q7KA 2I3BA 1SXJD 3MWLA 5KSOA 3LVQE 3QPWA 2VO1A 4RZXA 3C41J 5H68A 1S2MA 2CVHA 4TQAA 1XMSA 1E0AA 5HZKA 3EZ9A 2IUUA 1E2EA 1E79D 1OYYA 3U3MA 2AK2A 5LPNA 2F43A 1XEFA 3KTAA 1KK1A 2O52A 3AVYA 1QZXA 3KQLA 2JJ2A 2NO6A 2ANCA 2GJAA 4QGAA 2C78A 4TYPA 3CR7A 3H2YA 4IXMA 1P72A 1OB2A 1W0KD 1GNQA 2G0TA 3JVVA 4NTZA 2NQ2C 3GJ6A 3IO3A 1TF2A 1UBCA 3EXAA 2ORVA 2CBZA 2JJ1D 3IKJA 4KYUA 3AUYA 4NMMA 4PC1A 4DB4A 1KSGA 4LBVA 3RHFA 2CLCX 5JRZA 2RGGA 2WSSD 1P2TA 3K0FA 1Y3AA 4BLQA 4NYMQ 2ZS7A 3IGFA 4PZYA 1J7KA 4POAA 4YONB 2OESA 4XSGA 4OKSA 2WPDA 5KPJA 5FOVA 4NCKA 2V7QD 1WE2A 2AD1A 3BS4A 4Z8XA 4MRSA 1KO4A 3MRSA 3LRPA 3NH6A 3IBGA 4Q1CA 4IOJA 3UWOA 5FTLA 1L4UA 4TMZA 3CNNA 1P6XA 2XXAA 2VIIA 1MO3A 4B35A 5EP1A 5FPKA 4O2RA 3JZMA 3SDZA 4URXR 3G5UA 3U6KA 3CRMA 1KKMA 4CZ2A 1JEDA 5JFGA 1P9WA 2H8KA 4HI0E 1Z2AA 2IYTA 2NO7A 2JLWA 4IOKA 4LJ4A 2MSCB 4HDQB 2D7CA 4JJKA 1GIAA 4LBZA 4B74A 1E9FA 3IBYA 2IHYA 2R6GA 2OO7A 3I73A 4JBXA 3EIHA 3VHXA 1FX0B 4G5OA 2CDNA 4HATA 4DCTA 3KJHA 3KUCA 3TNFA 2WKQA 1KI6A 2AHOA 1W1WA 2G1JA 4Q47A 4C0SA 4BECA 5J4VA 2J41A 1ODFA 4YDSA 4GP6A 4HLUC 3WMEA 3ICEA 2VEDA
chains in the Genus database with same CATH superfamily
1WCV1 1H23A 1XVVA 1E5VA 2BCGY 2P3OA 2Y1CA 3BTVA 4JDUA 5DGXA 5DHSA 3KU4A 4M8LA 5B36A 5GV8A 2Q8QA 4KU4A 1P6UA 5U4QA 4XOUA 3O7WA 1SC9A 4D98A 5A2GA 4CDMA 1H5QA 3H19A 4RVCA 3QEBZ 4KR7A 5EZ5A 4LMRA 4H7HA 2AW5A 5FL3A 1BMFD 2BONA 1PL0A 1KYXA 5KPDA 3R9XA 4BQRA 3I4FA 2YCLA 2EJTA 1QE5A 1M8JA 1TU4A 3TE6A 2W4MA 1UDBA 4YXWD 1I14A 1M6EX 3SX2A 4YMGA 4DB2A 3SOPA 2VT2A 4EAQA 2C2MA 3GN1A 1JUDA 3EF0A 4HBGA 2IZ5A 3N39C 4XDGA 3E58A 3I2HA 3HUDA 3ROZA 1YL7A 4BJ3A 2G7ZA 5B53A 2PJUA 4B0PA 3A25A 3AHDA 3K0CA 3PEVA 4XPIA 2OBNA 1XQVA 2ONZA 3CURA 4OREX 5BR8B 2GFQA 1XTRA 3FCAA 4CF3A 4FGLA 3O4HA 4IJVA 1I24A 3D2BA 4UUOA 4YAUA 1VHQA 4EO9A 2BFFB 2WF7A 1DBSA 1JFTA 1GG9A 3NHWA 4GBED 1X1CA 1DWUA 4ND8B 1AZSC 3A9RA 3DV0B 3QXCA 4YBRA 3U13A 3V6MA 3W7VA 3ECAA 5KX5F 2Q4TA 4RD6A 4UATA 1FUUA 2WYUA 2NXCA 1PFKA 3H2ZA 3WL8A 1SKYE 4DM7A 6REQA 2BSQA 4GRDA 3RHTA 3HLTA 2ZDHA 1NY6A 2RBKA 4LYAA 5DNAA 3DBLB 3WGOA 2DT8A 3OIDA 1PG0A 1SGWA 1E2IA 1T4BA 3RLIA 4WY2A 1KSHA 1MX5A 1B93A 1WOYA 4O5OA 4YO8A 2NMVA 2VT3A 2HNAA 3I64A 1T5SA 1RNLA 1MGOA 1U2SA 1YI8A 3AY3A 4FNGA 1U5AA 5EZSA 3STWA 2EKBA 4G0MA 3GFFA 3C97A 2O2CA 1LDYA 1NVTA 2AA3A 4PPNA 4D8WA 3W5IA 1LQ2A 3BZBA 3G9QA 3EQ2A 4F8JA 3FSGD 1AQNA 3SF0A 1TJYA 1KIAA 4FONA 1L5MA 4LJAA 3E7FA 4XLZA 5FWYB 3WXMA 4KFCA 3QX8A 5JH7A 1UBFA 2RBEA 3BL8A 4F21A 2OZPA 2WOJA 4HX9A 4MSUA 5A4MS 4FM9A 3SVLA 2RHLA 3IDZA 1PS0A 2NTJA 4M1SA 1OFVA 1WBDA 3U9LA 5B3JC 1HEUA 3QV1A 4LG1A 4X65B 1J0BA 1TZCA 2WD7B 2WD9A 2ZBUA 3Q7PA 4NR0A 5A02A 1TZBA 4CL2A 4F3KA 4RY8A 1KRWA 4HKTA 4YJFA 2PX4A 2DFKB 5A5GA 1US8B 3BGOS 2BE9A 2YWFA 2G9VA 2E4YA 4TSFA 1H2AS 3PE3A 4QRIA 2JAQA 3A9CA 2ZRFA 3LBNA 1YUMA 1CYEA 3IAM1 1TM1E 4EF6A 5MN4A 5KMGA 3LHSA 4OGLA 2PX3A 2EV9A 4XQCA 4GMKA 5AESA 4EHJA 3BK7A 1QWSA 4N39A 2MWMA 2NVUA 3JW8A 2X0DA 4CLRA 2P79A 2VDOB 5KTMA 3CJRA 5JDCA 2O5EA 2H07A 4RQUA 1CNMA 2OPHA 3RGWS 4ESVA 3LIPA 3LK6A 3SC3A 1OA0A 1C7RA 2CL0X 1KXZA 2I1WA 4MVJH 4LMBA 2GQ0A 4ZWNA 3U16A 5JVDF 4Z4QA 3GYBA 1QH0A 2GOYA 3AR8A 4K8OA 1G5FA 1MA3A 3BG5A 4Q6WA 2B5WA 3SI7A 3HP7A 2FFQA 1NMXA 2XCTB 3C6ZA 3TLAA 1T4MA 4CG1A 1I7PA 2P9BA 3RYTC 3VVBA 1TD9A 1OGIA 5DBEX 2F17A 2WTAA 3E9DA 4J0KA 3HKBA 3ZYZA 3U0VA 3PX7A 3VKUA 1WMDA 1Z0IA 1RLIA 3HUUA 3K8OE 4JFRA 1U0NA 2ODAA 3D02A 4Z4EA 3GVHA 4ZARA 1BXZA 2J4DA 3M9WA 4R8RA 1MFZA 2NXWA 5J4YA 4MW2A 4DSNA 1TTTA 3N8HA 3MRXA 4R2MA 5SV2A 4HPJB 4JNKA 4TT3A 1I10A 3ADBA 4QDXA 3HFGA 1WLSA 2GN8A 2UZ3A 1UBEA 2BM8A 5ALNA 4UTRA 2A3RA 5CM8B 3QU9A 2X22A 2NQTA 1RQNA 3I9MA 5ANRB 3VU8A 2P7IA 3ODPA 1MAAA 2AF3C 2XDQB 3MMNA 3OZDA 4Y2GA 2X1LA 1H85A 2FOLA 1RRCA 4XWAA 1EGHA 4IDAA 4MXDA 2NYVA 3VJRA 1BOOA 5K3BA 2VHEA 1S5PA 1NXVA 1JHXA 2ZRMA 1YACA 1FXSA 3AYXB 1KJQA 2W2QA 2ZJ3A 3PR2B 4ML3A 4MOWA 4WN9A 1EJBA 5AM3A 5K0EA 2VH1A 4M99A 2PUDA 4PHFA 3F5MA 3FI0A 3FX2A 3P0JA 2FSHA 5E1DA 3S1AA 3R3VA 1T0JB 1AK9A 1LJLA 1CQJA 3EG9B 3OM1A 4R84A 3WHLA 4GM4A 5BVGA 5IMSA 2GAAA 4OLJA 4KSYA 1IBKB 5TMBA 4RTQA 3FSRA 4YUZA 4PLFA 3MMXA 4MW9A 2QTWB 4Q4DA 4TZKA 3H4TA 2IW1A 4AU1A 4XB1A 5BWLA 4JC8A 3C6YA 4KL8S 4HGRA 2O8EB 4WY5A 4HWPA 3VBEA 5I9LA 1P4HA 4L3OA 4LRQA 4YX9A 1X9HA 4B2YA 4E2YA 1UIRA 4QKQA 2A5YB 4II3A 2G80A 4E30A 1P1IA 3GJQA 1ULUA 1ISJA 1DQYA 1EHYA 2C58A 1C0IA 1G5RA 3ITEA 3NHAA 4JQOA 5ENVA 4JBWA 5ESRA 4L9WA 2PFGA 2PNJA 3X3HA 1B73A 3FUWA 4K3VA 2VF7A 2K2WA 4HGYA 4PTYA 4N03A 4ZK2A 1SUDA 1PK8A 3Q6MA 2G9UA 1Q7RA 2D7DA 4REOA 1RXIA 1FP7A 1LZLA 1MRSA 4AMZA 2YINC 1XL0A 4ETMA 1EVIA 2XB2A 3L6CA 1Q6ZA 2DPLA 3FCUB 1WCYA 2A1UB 2C31A 1I4LD 1OSNA 2PA3A 4C7OA 1VSUA 5EKDA 1CUXA 3GZNB 5FJJA 1IK6A 1CDEA 2WVJA 3HTXA 3FPBA 4Z86A 3STXA 3EBPA 3W8NA 1VCHA 4DF3A 1EUCA 3CEPB 3KQKA 1W36D 4JJ7A 5CA1F 2VKQA 2OV1A 3E6AA 4LWQA 5ITSA 3ADOA 2RD2A 1IBMB 2ZQ5A 2ZPAA 4N3GA 2ZJ2A 3B20A 3ISJA 9ATCA 5HNKA 2BZSA 4PQYA 3TOXA 3TUJC 4DLWA 1NDHA 4DT1A 1J2JA 3OZIA 2AUMA 4OEHA 2GRJA 3B85A 3H16A 3Q41A 4OJMX 5DN6A 3WGQA 1H1LB 3COSA 4BO3A 3LBIA 4GQAA 2QROA 4D4JA 4BWVA 1U8EA 4H6XA 2MSDB 1P6QA 1OFUA 2I6GA 2VG8A 3UJDA 4R9UC 2Z0MA 4IKEA 4RAQA 5DM60 4BO9A 5HK8A 4DY4A 3PPXA 2XMZA 1RAEA 3NI2A 3N5KA 4GPAA 4KKXB 4B2LA 1CZOA 3GT3A 1JHUA 4GYJA 4XA8A 5E3JA 3WWDA 1DRWA 2P2LA 5HM8A 5KOHB 1OT3A 1ZJJA 2JFOA 2UUCB 2O8FA 2FLWA 3CZMA 4XRGA 5WRFA 1XZEA 3NONA 1M2GA 2I99A 4WRRA 4QDUA 1KYYA 1CJUC 4QUIA 1EUQA 4Z9FA 1Z4NA 5CLQA 3PHHA 5I48A 1IWBB 4J07A 1HA3A 5CLJA 3E4CA 4CQJA 4L6CA 1FTWA 2HYIC 2WSBA 2JBHA 3TQHA 2BGJA 2QM8A 1UBUS 4I50A 4KPEC 1EFRA 2FWNA 4GBGA 2WT4A 2O06A 4F2PA 1JILA 4MNTA 3G2LA 1SXGA 1Q3TA 2ABWA 2C2XA 2I6SA 1GZDA 1XEWX 2APJA 1TVKB 1EQAA 3BE8A 4G41A 4J2OA 4OHKA 4WADA 2HRZA 4ZXPA 3NATA 1HDIA 5AM5A 3DCYA 2MDTA 3E3LA 2IHKA 1OROA 4H16A 5D1NA 1M76A 4L8WB 4TV9B 2XZDA 2XQVA 5EEHA 1DSSG 3F7OA 2YQZA 1OKKD 1SHLA 1C0PA 5ARCA 1MO2A 3RU3A 3E70C 1GKKA 2G07A 3K96A 3KKLA 1H3NA 3H0CA 1PJSA 2YN0A 3NEJA 3O8DA 4C0JA 1N3LA 2AOUB 4AROA 3C3CA 5L4LA 1P2SA 2XCOA 4FR5A 4Q3CA 3RVNA 1XNRB 1GTVA 2WUGA 3T7KA 5CD9A 1JJFA 4JS0A 2VYCA 4CR7A 2JCSA 3I9JA 4NMLA 4Y2PA 3W5JA 4BTEA 2PUEA 2OZKA 1DWPA 2Z3ZA 4BNJA 3R9WA 3PC2A 5LBIA 1V1RB 1GR1A 1QOQB 3SHFA 1X1RA 1U0LA 1ZYUA 4RY0A 2AMFA 5J2UB 1KPHA 4M6WB 1QDEA 3LYAA 4PLGA 3TL6A 2OCXA 1OU0A 1DBIA 3O1IC 5CDSA 3ZHOA 4FFOA 3W2EA 3Q87B 3DJFA 3GLRA 5IYZB 3BXOA 1O9GA 5HRUA 1GL7A 2ZVPX 4GM1A 1W35A 1XA4A 2BM0A 3VO8A 3NTVA 4TLAA 5DNVA 1RQGA 2HADA 5AKIA 3ZE0B 1G8SA 3DLAA 4QELA 5LBTA 3GJSA 1NW8A 4HQOA 3R7FA 3UFBA 4QGSA 5ADUS 1C4OA 1UDWA 3QFTA 5J2TB 2PZAA 1M5TA 2W6JA 4GDFA 1U9CA 3TL2A 3SQDA 3E7DA 3ESAA 5BRAA 1SY7A 4MKXA 1LB1B 3EEOA 1XAIA 1QP8A 5DTRA 4YWHA 3D3WA 2XRMA 2ZOSA 4DA6A 2CV2A 1P4SA 1NN3A 3O47A 3OPQA 3K8YA 2OYSA 1BWSA 2B1IA 5LNK6 5DYTA 1DUVG 1UJ2A 2AE1A 2WIDA 2WJ6A 4S1TA 4DWVA 5TX7A 2A9JA 4G4JA 3VAAA 1RMYA 3O26A 1Y3HA 2Z9CA 3UENA 4CM8B 4DGSA 2Z8XA 4M76B 1NU8A 1PVDA 1Y4DE 2HJVA 1NTOA 3GRUA 3SKVA 1M2OB 3SCZA 2A1IA 2B8TA 4GX1A 3JYOA 4DJJA 3QY0A 3OLQA 1NGSA 5IJ9A 4MW4A 2C4VA 3I45A 4N8SA 3IXMA 2VDJA 2CB0A 4S24A 5BSEA 3I0ZA 5FAKA 3JYNA 4Q3EA 1XB2A 2IP1A 3ZGXA 3O8OB 5AW5A 4DLAA 3ZBUA 2YVUA 3EC2A 4WLUA 1SD5A 1HK7A 3U17A 3R3WA 1WZ2A 4KZKA 3MFYA 4L4XA 1K6EA 1UKBA 2G1AA 1JFFB 5HZGA 3P9XA 2G09A 3ASYA 3DFIA 3JYHA 3VHQA 5K8TA 1A8UA 3AVXA 1U8ZA 3E15A 3BGVA 4V0SA 4BQIA 3ILVA 3AEQB 3OFSA 4DDHA 4EL0A 1UK9A 2GJSA 3QXHA 2AFRA 2DPGA 1ZEMA 1HBJA 3VU9B 1VL8A 2EKLA 1KF0A 3MA0A 2RHCA 2VNKA 2VP0A 4NKRA 4BB6A 5KNCH 1F6BA 1SJ9A 1J9ZA 1NAIA 2B4RO 3I9OA 4EZEA 5BUQA 5BUZA 3LAWA 2O19A 2QM3A 4D3XA 5C52B 1XDZA 2NYRA 3L02A 2AJTA 3TVYA 1OZFA 5HCIA 2YYYA 4F9FA 7ABPA 1DT5A 3Q3IA 1HT2E 1UMDB 3LD9A 1QBKC 2OGTA 3K05A 1U8TA 2H51A 2R8PA 3H5RA 3ZS9A 1N4DA 3AOEC 1P18A 5K3FB 1ULHA 3NIFB 3Q5DA 3BULA 4FZ5A 4UJ3A 1SCUB 1CVIA 3PJRA 1FYFA 1F0PA 1I5OA 1QYRA 1TOAA 1ZVMA 2ADFA 3AONB 3R0QA 4HH0A 4NJEA 4S1PA 3TMKA 3TQSA 3UMYA 1B8NA 1EBBA 3K9GA 1LLCA 5HIJA 2XDAA 2XUIA 3HO1A 3HB1A 3ROQA 1N8NA 3TRDA 2GZHA 3AG6A 2RCNA 2R87A 5KWIA 2ILTA 4K81B 4MWCA 3SXJA 4C3OB 3DE6X 4F86A 4GYYA 1HE1C 1MMFB 4E5PA 4D99A 1L4GA 4OKNA 3B7PA 2I7XA 3KJFA 2EP7A 2Q50A 1NYLA 3KQPA 2D00A 3QKSB 3QXJA 4K05A 4CCYA 4HF7A 4TMTA 2I03A 4CM1A 2QG9A 3VNRA 4YCAA 3IA2A 5GOTA 4J03A 3I32A 2XQKA 4QG7A 4WLFA 1RKVA 2DBYA 2P9YA 1J09A 1F48A 4ERXA 4IGIA 1EP9A 1J42A 3OCCA 1L4MA 4QE3A 4B40A 1QCYA 4P4LA 2Q4BA 4RVGA 4XGNA 4Z8YA 2BR5A 4KZPA 3IQDB 1FU4A 2J0UB 1HQYE 2X4LA 4PZZA 3UB4A 4QPCA 5L6MB 5J1SB 1RJDA 2MSNA 3QE9Y 4J4BA 5KYVA 4NNPA 5BW4A 4HGPA 4D41A 4BV9A 2PS0A 2H2IA 4EENA 3N59A 4X61A 1TQHA 1PGNA 5KTNA 1A96A 4QHYA 2PBFA 3O9VA 1CJMA 4PGAA 4A0SA 3FUCA 2WWVD 3RDPA 2CLFB 3VR6A 4INPA 3TJMA 4C7JA 3UA4A 1L4LA 2NVWA 1Q57A 3P9ZA 3H42B 5KBYA 1XRJA 2B99A 2PXXA 1AOXA 2QTZA 1AX9A 5E4FA 2B4YA 2ZRCA 2WV7A 3JVUA 4F2WA 2QIPA 4F2HA 3BJIC 5ALHA 4F06A 4R71A 1DI0A 4QLOA 4JGGA 4XVUA 4WZBA 4B4DA 2KJQA 1G20B 1W44A 3GAAA 5EFZA 1PSWA 4JXKA 3SJAA 3F49S 1KQNA 3SQLA 1FNSA 3WB1A 1WX1A 2FSSA 5L8VA 1X13A 3QFHA 3NM4A 4TT3D 3CWQA 1FX0A 3RJZA 2ATIA 5EWLB 5AJYA 4WKGA 4PZEA 2C9CA 4G84A 1VBKA 3CEAA 3TLCA 4TLEA 1XZFA 1OXBB 4FX5A 3COWA 2IQ5A 4KH0A 4JVOA 1U3GA 3RLFA 1NVVR 2RHDA 3AX6A 4M22A 4D9HA 5C4IA 1ABBA 3FNBA 3VJKA 4EIWA 2QRQA 1LDBA 3UIEA 1N2ZA 1REQB 1GPH1 1H2XA 2ADOA 3JWGA 2AKEA 4MQEA 2PRYA 2NU8A 4GI5A 5FUQA 2QXUA 3QPVA 1N78A 2OHJA 2X8LA 3AOGA 1G8PA 4UQLA 1NNI1 5EQDA 4DG9A 4IM7A 1H8HD 3QF4A 3INGA 5KWEA 1CUAA 2HQSA 3G5TA 1KJZA 4K9NA 2HCFA 4CQLA 5JOQA 3CCCA 1YWGO 3ABSB 4N7MA 1BAPA 2XGSA 1XZHA 1CY2A 3P4XA 4PO1A 2OD9A 4UFPA 1YO6A 2PO7A 1G6OA 2QN9A 1PJBA 2I1VB 4PC6A 3Q5EA 1U1GA 2QTVB 5CXUA 4TZ0A 3IUBA 2J32A 1CR4A 2JGKA 2A3NA 3PVCA 4RO0A 4BRSA 1GZ4A 1T13A 2WWFA 1WB9A 1W8IA 2YDYA 2M2IA 1M8FA 3G7UA 5I9IA 2Q6VA 4UEJA 3CRW1 4UU8A 5LYYA 2E9SA 5JCXA 4A15A 4HOYA 3AIKA 2AFIB 5ALEA 2UXBB 1V2HE 3AIMA 4JJAA 3BUSA 1PZGA 5LA6F 2EQAA 1L5VA 2G04A 3WLRA 2EDAA 1I1OA 1QGOA 2IDMA 4BX8A 5AW7A 2VSFA 3RVQA 5UKDA 2PT7A 5LMCA 1DAEA 3TAHA 1RJGA 5AI6A 3GMDA 2FWJA 4WXHA 6LDHA 2Y3IA 3DDHA 1B23P 5JNVA 3EPJA 2NYAA 3DNFA 4XGKA 5HS6A 1L1RA 1UC5B 3EFOB 4B6GA 4D3DA 2A9VA 4I1SA 5HP4A 3SDSA 1G9SA 4DKJA 3LE8A 2PWYA 4QPDA 4BIMA 3TM4A 5LD2C 4QEZA 1SB9A 2C2OA 3PXDA 4CCAA 1YBVA 4Z6KA 3U5TA 2I6QA 2WAMA 3LS2A 3MTBA 4MUGA 1F0YA 1IM5A 3DCIA 5LYJB 1NJ6A 5LBUA 4YRGA 3JQEA 2DQYA 5JISA 4UDYX 1NJ8A 2V98A 2ZTVA 4AQ7A 1T3GA 5FA8A 5EKTA 4WBNF 1F38A 1GLGA 4K9DA 2FFAA 1NQWA 2C1XA 3X1XA 1LPOA 2XKJE 3C7DB 3PYLA 5EJ4A 3AOEA 2R7KA 2DFVA 1DC5A 3QMWA 1T4CB 1WDTA 2O5VA 3GLHE 4MIKA 4PYRA 1JIXA 4YGYA 3HZHA 2J5QA 4ZVVA 4KLAA 4YUVA 1K6IA 4BLVA 5KDDA 1DGQA 5IT0A 2GK7A 3Q8XB 3T1NA 5CBPB 1E9BA 3AJ9A 1P74A 4CKCA 3UJ8A 1MJNA 1X38A 4G1CA 2ZYSA 1GT6A 4OLBA 1VLZA 3UFXB 3FYCA 1ISGA 4NCBA 3KSDO 3P9RA 3WLHA 1EB8A 4Q48A 2AC4A 4WOCA 5DU2A 4CDRA 4Q3BA 2A5GA 3K35A 4DREA 3MT8A 3EDOA 4YEDA 5AOAA 1KHHA 3A4TA 3ITNA 2RDMA 2Y0PA 2X0NA 2JFUA 3H3XA 3ZK7A 3EPHA 3RVOA 3KTFA 2JBAA 1EGAA 2WM9B 5AJVB 4Q01A 3EXIB 4PZPA 3C5HA 1J8DA 2VJQA 2CKMA 5JAMA 1J1IA 4QBFA 3UWMA 3ZKWB 1X8XA 3DQPA 4JEHA 2XMQA 1T9HA 4N54A 2EFDB 3FB1A 3B48A 4KWIA 4D96A 1QP4A 2JRLA 1S0UA 1EFRD 1Q3HA 1Q7CA 4PPYA 1DAHA 1P5RA 3AGPA 1DEHA 3KOUA 3KYDB 3LK7A 3N28A 1LD3A 3DMPA 1FDUA 3PC8A 1NW6A 1KYTA 2HF7A 4F96A 3B3JA 2XA2A 5AXCA 3QLVA 1K6XA 2ZXEA 4MQ6A 5CT8A 5SICE 1C9MA 2IU4A 3DVAB 4L07A 1E4YA 1IOVA 3IESA 3D9QX 4ZZ3A 2HLPA 1GWNA 3EFBA 3O4GA 4I2VA 3A7EA 4C4RA 1GQ2A 4C22A 1BXRB 1KMHA 4X20A 4CIVA 3FZGA 1KAOA 3H17A 3HC7A 1YIOA 5H02A 3QMMA 4QQNA 1SWWA 3WGUA 2J7KA 1F7VA 3EBLA 4A9AA 4ERNA 3UICA 4FOSA 5FYQA 4CW7A 2V6IA 2TS1A 4CCSA 3K2EA 2DBVO 3AY6A 4MEJA 4ZHQB 3Q3EA 2A1TS 4CGYA 3KOZA 4BEVA 3S4YA 2AG1A 3AHEA 2QR2A 3OETA 3TTSA 1Q21A 1Y34E 4W7IA 1KOJA 3A1FA 2R47A 1ZZEA 2WG1A 3U31A 4P7GA 2YMLA 4IHAA 5CX1B 1XZGA 2Q6LA 1OLSA 3KQMA 3IV9A 1YXMA 2IHBA 3DE5X 5FT9A 5H5JA 4LQLA 3WNVA 4H1WA 4YH1A 1PFYA 1XTZA 1P2DA 1W7AA 4WUVA 4MA5A 2QSJA 3DMDA 4EGAA 1P17A 2YZMA 2O8CB 3RFUA 3DB2A 1USIA 1IWOA 2XYHA 3MYRA 1QDLB 3ZZMA 3TINA 1Z62A 2RGDA 3ANTA 3SZUA 1Z17A 1LUAA 3KWFA 5DRTA 4QFMA 2VXOA 5CXXA 1TQDA 3V4SA 1RADA 5IM5A 3ZCQA 4EKDA 2HD4A 5EUBA 1CV2A 1RWKA 2NQ8A 3SXUA 1UBTS 4BNGA 4K2HA 3I05A 5EMMA 1FZQA 1DDOA 2H92A 2F90A 3SOZA 3FLAA 4MRRA 2O05A 1TW3A 2WJJA 5JROA 1BH6A 2OSVA 1VOTA 1ZW1A 1Z6XA 2ZAYA 1SULA 2WIJA 3HDQA 5C3MA 2FR0A 4JX8A 5KEIA 4TKVA 4PCVA 1BFKA 3JQPA 3FNGA 4AY3A 2GN0A 3AIOA 3GJ5A 1TK2A 3CT4A 3PSAA 3SU8A 3HXMA 1ZA2A 3R0ZA 1PWHA 3RRBA 5EXPA 4AQYB 2Z9DA 5DCLA 5BR7A 5ICFA 3BZWA 2Y1XA 1ZRMA 5CH5A 5CA0A 4HEA6 1JXAA 1CB7A 1KFCB 2YZNA 2VT7A 3UT0A 1FRVA 3MCWA 3AU9A 1SKYB 4P4SA 1K4YA 1O4VA 1ZCZA 2C1EA 3H6GA 3L3BA 4MUKA 1ATZA 4UREA 1E69A 4LDAA 1V41E 1P60A 5KYYA 3BF7A 2DM6A 3AHJA 1AURA 1QO9A 4KG7A 3MUNA 8ADHA 4HGNA 2AZXA 1DC4A 3STHA 3J81k 1NURA 2D5AA 1XNJA 5CLIA 5ALUA 3SJCA 5DIZA 1WXHA 2MSKA 2QMOA 3DZJA 5CEEA 2PWPA 1SXQA 4J1QA 2ZS8A 4BNMA 3FBWA 3IKMB 5J23A 1YRLA 4OHCA 4AIRA 1WMEA 4CLEA 3IJPA 4RK7A 3WYGA 1Y7PA 5CNKA 3UAZA 3UCEA 2FPUA 2XKBA 4DNQA 2YWJA 4YO7A 4MVCA 1C8KA 1PO7A 1GDDA 1RCUA 3QQ5A 2IK8A 4XW2A 2GTIA 2ZYVX 5IBCA 3K1YA 1RAAA 1XNHA 4GOND 5LP6F 4AKTA 3U4DA 3EZLA 4C0HA 3MQ4A 5EVCA 1IN8A 3VGPA 3KSUA 1TW2A 3F4BA 4X1KA 1IH8A 4FFWA 4WT7A 1Y1TA 3C43A 1W4LA 3VAZA 1ZO8A 2XH8A 4PNEA 4RTOA 3ONVA 1PJ2A 2RHWA 4TL9A 4ZICA 3EWAA 1PU2A 2JI6A 5IUJC 3DBHA 4JASB 3SWWA 4MULA 2Q62A 4WAUA 1PZXA 1P1RA 4EMBA 5IT4A 2J9XB 3NOVA 1KGDA 2HHJA 3TQOA 4B4UA 4GL4A 2GBLC 1NN1A 2HK7A 1Y3DE 2G3YA 3NDBB 4Y67A 2PMCA 3PENA 1ACJA 4ALLA 2PCJA 2I6FA 5CYPA 1G98A 4EPTA 2F8TA 1GTRA 5CMLA 1JHQA 3BMNA 4CETA 4MAAA 3FRHA 2KLBA 1PG5A 4KN9S 1DWQA 3RUEA 1R5BA 4IIDA 1W36B 1IRIA 1DEXA 2GHIA 4PLWA 2JAUA 3CHYA 5EUMA 3VR5A 4CIWA 3TPCA 2OV8A 1OJLA 4HO1X 3IP8A 4MW0A 4I50F 3ZLVA 2K7FA 2XZLA 4OM8A 2P0YA 1K6JA 4XZ3A 3CRRA 3QLUC 2HIAA 5J5CA 3T1QA 3AEYA 1Z0ZA 1LJ8A 1FPQA 1N6KA 1SH7A 2PTHA 4MVYA 3V8VA 2XMRA 4F5EA 3GXOA 9LDTA 3SBXA 1ZIXA 3A4LA 1MUUA 1QB8A 3F1KA 2FHSA 3VR6D 1P5FA 3WL6A 2YWXA 4F2GA 2YBDA 4OCZA 1JHVA 1RE0A 2FWIA 1IB0A 4DDMA 1D2EA 3PHJA 4IEEA 2IT1A 4NG5A 2COUA 1MF7A 4BJ1A 2ZRPA 3K94A 1ADYA 2PR7A 1V8PA 4OIMA 4J9VA 5REQA 5FNZA 2C4KA 3ZX5A 3DUFB 1OFTA 2Y05A 3N8DA 4DC0A 1T8WA 4ZEVA 3T8YA 1KMIY 2OKGA 2Q9CA 4HC4A 5DPMA 4JEIA 3MWDA 4KBFA 2O57A 5DK6A 2FMTA 3PRHA 4LJ7A 1HDOA 4P6VF 4WLEA 4JOQA 4R9VA 4UZSA 4YT5A 3SBOA 2FU5C 3Q3CA 1XMJA 3OAAA 1FX1A 3HMKA 1MZPA 1TT5B 1X1SA 1Y9JA 1YR6A 3AVPA 3UKJA 3OOJA 1CC1S 1ZIOA 4JY7A 4J7UA 5MF6A 1TJ5A 4BBPA 4CIBA 2BFOA 2CGEA 4LJYA 2JFYA 1RC8A 3IAS6 3PU6A 4DLXA 2CUZA 4ZOAA 4B4VA 2F8MA 3OJFA 1EM8B 1G291 1KMMA 4MTLA 3WKDA 5EJ6A 2Y71A 4TXNA 3WYNA 3EIOA 4BNIA 2I55A 4AICA 4D4MA 2FUNB 4EQ6B 3FLEA 1KQ3A 3R1IA 1Z8FA 4D9MA 1FQWA 1Y5MA 3NHYA 2F1KA 2XWPA 2BSXA 2DF8A 1VKJA 2W0MA 2C2WA 1V1MA 3WY9A 3AM3A 2HTEA 5JT1A 1P9RA 2CYAA 3AFIA 4MUIA 1C1DB 2XZTA 2C83A 4ESEA 2J4FA 3EPLA 1KY4A 5K2OA 4UUMA 3FA2A 4PINA 3BH7A 2FA9A 5FNVB 3WO1A 2Q4RA 3HADA 4LMAA 4PBTA 2EKDA 1F06A 4G0VA 2Q8NA 5L95A 2O8BB 4AKIA 4JI7B 2QZZA 1IONA 4KREA 1J97A 1EP1B 3G0BA 3LFHA 4K9RA 4XDHA 3KTDA 1F6WA 5EE0A 5AUPB 3WHPA 4BVHA 1HDEA 3VZDA 1RVDA 4NEHB 1AQ6A 2LKDA 5EE3A 1YQGA 3ZU2A 2ZANA 4QZVA 2RBGA 4ZCTA 1UFVA 1K89A 5IKMA 3S27A 1XFAA 4G1VA 1PWZA 3LZ6A 1VJRA 2HMYB 2VPWA 1QR2A 4LZOA 4F92B 5AVTA 3NUGA 5IDXA 3MILA 4TXJA 3WK7A 5E9AA 3VZQA 4BV3A 1GGMA 3DUWA 4FOOA 2KM1A 4YMWA 1XA3A 5AVQA 5K1ZA 4TKLA 2WWYA 3EF3A 1IN4A 5JI3E 6CHYA 2PKQO 2BI7A 1FBNA 1I6LA 4GP7A 5BQ3A 2XTAA 4LXQA 3HDGA 2BFCA 2JFBA 3HKEA 1KOLA 3VH2A 3IIEA 2P3LA 2IYNA 1LBIA 3IP7A 3WRXC 5CG2A 3IRVA 3ZV7A 4GW3A 3AJEA 5CFPA 3LGAA 4XIGS 3KFVA 4BO0A 5I4BA 4URHA 2F6RA 4GH5A 4UBLA 2CD7A 3VSBA 3H86A 3WJ1A 1XT6A 3LSYA 5LMNB 3U1BA 3HV2A 4A8JA 5IAAA 2C0QA 1AUQA 4AURA 5BWCA 1APBA 3G49A 1N4AA 3T94A 2DQZA 3HDVA 2D06A 1JJ7A 4G2NA 4H7FA 2FXIA 4FHFA 4K1LA 5F35A 3NM5A 5B2ZA 4XIYA 4X0EA 5KJCA 3EMVA 1LBQA 4W5QA 3V4FA 1Q1EA 2DRIA 2WTMA 5EIOA 4ZMSA 5LOVB 2GBLA 2L0XA 1Y33E 1WZNA 2O4CA 2FP4A 2YFHA 4JENA 4CBVA 1Y1RA 2JIMA 3UHOA 2C2GA 4R69A 5ES3A 1XCGB 2ACEA 1EB9A 3ZWDA 3CPEA 4LJ5A 5JPIA 2BTQA 3A6JA 4QWWA 5TSDA 1RLMA 2PVPA 3WQQA 2ZYIA 3COPA 4D45A 4F7WA 1OYWA 1G4HA 1RQLA 1MIOA 3A4YA 2WV9A 1K7FB 2B2XA 4ALMA 4EVQA 3DTNA 2C94A 2LTAA 3PRYA 3SS7X 4C0QC 4QTTB 5GTDA 2JIRA 5LXTB 4RFSB 5KOJA 3QLUA 4Q4JB 5CT6A 4AJKA 1RHQA 3VH3A 2V6MA 4IHJA 2P1DA 1OH5A 3FPAA 2UZIR 5BO5A 4R4JA 4ZZ0A 4DAEA 4FYVA 4QTZA 3UUWA 3OQIA 1ARZA 4CFSA 5A3SA 1LNZA 3O4IA 4L9SA 1NFQA 4G36A 1G5QA 4I1UA 2GPTA 2JI7A 3OTOB 1XVTA 1SVSA 1GZ3A 4OUDA 5EWLA 1BKDR 1U4SA 4WMLA 3L0BA 2MHCA 2NV6A 5C34B 4BN4A 4KP7A 3LSTA 3CMCO 1ECFA 3S1AB 1CUHA 1VM6A 1GRRA 3DDCA 1F3OA 4O02B 5TS3A 2QJRA 4Y2YA 2GI4A 1YB4A 4S2EA 3TQFA 3FSJX 4OHBA 2WZBA 5BVGB 4OGFA 4A3SA 2OHHA 1KDOA 1QRSA 1ITZA 3VNAA 3D5EA 1WA5A 2OD2A 4H7JA 1PR9A 4ZALA 4EF4A 3AVQA 3FHCB 4RABA 3MT7A 5HTKA 3E3NA 5IAGA 1J0EA 3P5BA 5LM3A 1RBQA 4IILA 3IODA 2O07A 4DTIA 2O5RA 4PHCA 2H0RA 1ODCA 2RKOA 3BMCA 1SXHA 4LRTB 3G0DA 1UC4B 4MS4B 4NOMA 1OVMA 1GRCA 1QZUA 2HJ9A 2V9PA 1C9EA 2WYIA 4FSHA 1W59A 2UUOA 1GUYA 3TUZC 3ORQA 1H93A 2CMKA 2BGWA 1YONA 3PHCA 4XI9A 5KNCD 4MYUA 3QOFA 4D5EA 3STUA 1VE7A 5C8DA 4ISBA 4JN6B 2NADA 3DA8A 4Z5XA 2V74B 4IDGA 1TM3E 2O7SA 1NVGA 2RGNC 3X1DA 1B0AA 2YHAA 2ASVA 5EJMA 1HLFA 1VJCA 1I9GA 2LW7A 4PYQA 3JQAD 1AUXA 4DFDA 3GGOA 2JK1A 4AUEA 2ZYHA 3KPJA 1UEIA 3ES9A 2CXNA 3U1TA 4B9EA 5LQNA 4Z0TA 2VDUE 3AZQA 1K8QA 5HBGA 3NNSA 3ZGLA 2QNBA 4I3FA 3LC0A 3TM5A 1EUYA 4C7OB 3INRA 4R7GA 3PJFA 3NAMA 3TJRA 1IPEA 2IITA 2ZPTX 3B1ZA 1XD2A 3JQ6A 3R6DA 1TTPB 1G63A 2ZM5A 4BXOB 2H3EA 3WK8A 3O4FA 5TJ9A 1USKA 4BVAA 3HXQA 2C88A 2HGSA 2PA0A 5JS8A 2GAFA 1TCBA 2ETXA 2B2NA 4QBHA 5THXA 4MWDA 1SHZA 1XTIA 4ZQFA 1PBNA 2V54A 2ZJBA 3KP1A 1XXLA 4FR0A 4BFXA 4BWFB 3PF9A 4X93A 5G3ZA 4DARA 2IIVA 3F3SA 3KIPA 1Y8QA 5EHGA 2WT9A 5ESWA 4PIVA 1S8NA 1TA4A 1BXGA 2ECOA 4QO8A 1KHTA 1Y7IA 3L07A 4MITA 3RSCA 4XYBA 5I9BA 3O95A 2ACWA 4EECA 2H5EA 4M9RA 3UTDA 3GLGE 1OLUA 5GADl 1U8YA 2O8FB 2QK4A 4GS5A 3MC1A 1OLXB 2BOVA 4UHDA 2O1XA 4B6RA 4F04A 4OB6A 1Y1KE 3MJTA 1K68A 1HL7A 5JXGA 2WU4A 1KJWA 1QJ4A 3OHPA 4QOHA 2CY0A 4WFKA 2EP8A 4Y9RA 1IOZA 4XE5A 3WKEA 2WU8A 3GV0A 1KMQA 3M2TA 3N2YA 4I14A 4RGVA 3E27A 4B9AA 2VSQA 3QH4A 5FLEX 4HV4A 1QHHB 1RLUA 1T6XA 4Q9DA 2WMOB 4YRMA 3MOGA 3ISTA 4DXHA 1U65A 4RKWA 3UHJA 3ORFA 1FW8A 3M4JA 4AWBA 5C1OA 3QE0A 3GJ3A 1NF8A 1ZNWA 5K3OA 1NSFA 1XXHE 2OG2A 5FOWA 5FBWB 4UD6A 2RMKA 1RXUA 2AJLI 4XVHA 4BP3A 4H1TA 4RFVA 4X44A 2IPXA 3CPJB 4FE3A 1QQ5A 4UVDA 4YLEA 3VYTB 2J6BA 1TUEA 4H1UA 4AS3A 3PTAA 3E8XA 3ZDBA 1PNVA 1KU6A 3JV7A 4RA6A 4WCFC 3HKCA 1G5PA 3OTWA 5AOBA 3KQUA 2QQ5A 3GRRA 3QVGB 4R0VA 3RWBA 4KN6A 1YB1A 2BR4A 1UZAA 3VR5D 1NMEA 2ZB4A 1E9AA 4IYRA 5SY4A 1JALA 4JJFA 2I9KA 3BREA 3RRZA 1XRMA 1LSUA 4DUPA 4WASA 2FPSA 1W88A 1YD7A 3GI1A 1RACA 4YB8A 4IPTA 3WFZA 2G0NA 1PQYA 2ZBGA 3L7JA 2ZZNA 3ZW9A 4CMBA 2Q6TA 1VGVA 3E81A 3KHSA 4HLQB 3WWPA 4X63A 4B2PA 1VIYA 4MVJM 2Y4NA 4RIGA 3PJDA 4EY4A 3A32A 4BRWA 1OI7A 3FVRA 1BE1A 2YJ3A 3PC6A 3CH7A 3P19A 5BP7A 3ADKA 4JYBA 2P6RA 1KEWA 2QD4A 1J90A 4JUIA 4TUYA 1WWKA 2J9YB 4MQ5A 1FFAA 3RHZA 2CF5A 1DE0A 1TEHA 2D3TA 2GZAA 4KAXA 4O5AA 5EA2A