1ZNXA

Crystal structure of mycobacterium tuberculosis guanylate kinase in complex with gmp
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
182
structure length
182
Chain Sequence
VGRVVVLSGPSAVGKSTVVRCLRERIPNLHFSVSATTRAPRPGEVDGVDYHFIDPTRFQQLIDQGELLEWAEIHGGLHRSGTLAQPVRAAAATGVPVLIEVDLAGARAIKKTMPEAVTVFLAPPSWQDLQARLIGRGTETADVIQRRLDTARIELAAQGDFDKVVVNRRLESACAELVSLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanylate kinase
publication title Unique GMP-binding site in Mycobacterium tuberculosis guanosine monophosphate kinase
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 53
structure length 182
sequence length 182
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2005-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 1znxA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1znxA01
5EE5B 3AKDA 3KJHA 2ZR0A 2G1JA 3U7GA 1KAOA 1ODFA 1RRFA 2I1QA 3MFYA 1OJLA 1AS3A 2OLJA 5DI3A 2ONKA 1DG1G 1MH1A 3THOA 3N2IA 5JBQA 5HCNA 3KJIA 1KI7A 3MJHA 2R62A 1KMQA 2ZU6A 1GNPA 3VQTA 1EESA 3NDPA 2VTKA 4D4LA 1FZQA 1UBCA 1M7GA 2X2FA 3IIKA 2DCUA 4G5RA 4PSVA 4QFMA 1CP2A 2QPOA 3CUEF 2PX0A 1T9HA 3ECCA 1L4YA 4CW7A 3W8RA 4BECA 2OILA 5HTKA 2J0UA 4LV5B 4RSGA 2GCNA 2KB0A 1F3OA 4GOXA 3RVBA 1XZQA 3SBDA 3Q7QA 4Q4HB 3ZH9B 4YMSA 3NC1C 5DH9A 5FBRB 5HZKA 1NY6A 4KO8A 4KJZA 3VAAA 1H8ED 3PITA 4PQRA 1EG7A 4CT5A 3HR7A 3SJZA 3MGCA 3I5XA 4CEJA 3GCGA 1G7CA 3JVVA 4TYYA 1NF3A 4NKRA 5KNCA 4F93B 5LD2C 1SZPA 1UKVY 5L3SA 1NN3A 3BXZA 3TMKA 3ZYCA 1UKZA 2DFNA 3KUDA 2GF9A 4B75A 4RZUA 1NNEA 4YLGA 2R44A 1II8A 3IKJA 2Q9BA 1HEIA 2HEIA 1ZJ6A 1N5KA 2DFTA 2VF8A 2ZI3A 3QG1A 3IHWA 3NBZC 1VCMA 4E03A 1W0JA 4RY2A 1YZGA 2H18A 3BB1A 5FBVB 2FV8A 2HCJB 3CNOA 1BMFD 3SHFA 2CNWD 1NN0A 2P2LA 4LJ6A 4DLYA 3GLGE 2UVQA 1UPTA 1Z22A 4X8HA 3RWMB 3T5DA 4PAQA 5J5CA 4ARZB 3SDZA 2RGDA 4I1OA 1QVRA 1YQTA 4JLNA 5AJXA 3T15A 1IN7A 3G5UA 3T34A 4BUJA 2AR7A 4OHXA 2F7SA 3U7FB 3Q3JB 3HYTA 2CL6X 4PO8A 4C4PA 2OHFA 3QUSA 4ZI2A 2BDTA 1E0KA 4IDPA 1G8HA 5F9HA 5FPKA 1I4TD 1HQYE 2B7CA 3T5GA 2BWJA 1UFQA 1CR4A 2HT6A 3QBTA 3J81k 3IHLA 4BLQA 4DEYA 1W36D 2IHYA 4C0QC 4TZ6A 2O8CA 1WXQA 3DZDA 1BH2A 5EP4A 4LHXA 4TMWA 4EQ6A 4E07A 4Q5IA 5G40A 3GJ4A 3UWKA 3TUZC 3UATA 1WRBA 4MYHA 1VHTA 3PFIA 2H7VA 4LK2A 4PSAA 1SVIA 4XJXA 3GJ5A 1E69A 5FTMA 3BH0A 4NYIR 3LY5A 2QMUA 4B2LA 3QXHA 4AYTA 5P21A 4ZCLA 1KHTA 1MRNA 3LVQE 5FL7A 2ZXUA 1FFHA 3KKPA 4PQYA 1KJWA 5K8TA 4C0SA 1G291 4Q1AA 2QU8A 3RYTC 1UEIA 4AD8A 4BRUA 1KDOA 3M6AA 2E9SA 5ELXA 4D4JA 1IM2A 3DM9B 4AC9A 2H1LA 1Z6TA 2OV2A 4DLWA 3IPYA 1US8A 2RGAA 4AWXA 4YQFA 1KJZA 1S96A 2ZS9A 2G3YA 1D8TA 4TL8A 5FFMA 1D2EA 1XTKA 5FI0B 4KSBA 4W5WA 2CHVA 4AKEA 3PEWA 2OCBA 5FOWA 5ANRB 1OLOA 3CNLA 4JZKA 3LW7A 2J87A 1C1YA 2O5VA 4PXAA 3WYFA 2ZUDA 4PC3A 4C0KA 2PCJA 4TYNA 4BGDA 4G01B 4IHQA 5KYKA 2H17A 2JLRA 3B5JA 2HYIC 3QKRA 4TT3D 2GXSA 2OFOA 5AUOB 4KBFA 3TE6A 4DCSA 1GL9B 2IXEA 1ZM4A 2QRZA 1X3SA 2QROA 4LUCA 1Z0AA 3P32A 4B6FA 5HPYB 3Q85A 2IS6A 1L4UA 1OT3A 3QBVA 1SXJD 4X8MA 4U7DA 2IHBA 3A4MA 1VG0B 1XU4A 4Q18A 1P2UA 4KBGA 2GCOA 1EFCA 1DARA 5G53C 5C4MA 3ADCA 3ZIAA 1N6LA 1UDXA 2X19A 3F0TA 5F3WB 2JLQA 2PT5A 3DZ8A 4S2EA 4DBLC 1N6IA 3D7MA 3B8HA 1HURA 2GJKA 4OI4A 4FWIB 4M9ZA 3NG1A 1ZNZA 1J7KA 1NMZA 1YKSA 5EP1A 1B0UA 1OXUA 3A8TA 3Q7PA 5KSZA 3NVAA 5KDLA 4QM7A 4A0FA 2XXAB 5AR1A 1DAFA 4M21A 1TQ2A 2EFEB 2QP4A 3OEHA 1IN5A 1Z0DA 4MGYR 5EXSA 1NJGA 3REFA 2HF9A 3ZQJA 1LY1A 1WP9A 3KXIA 1N6HA 3ZZTA 1G19A 5C46F 2AL7A 1R2QA 4FCTA 4CF7A 3LXRA 4LCBA 4D82A 5JEEA 3C7KA 3HU3A 4Q9JA 5D3MB 3ZD6A 2ODNA 1HQCA 4M1YA 4LJ5A 4IOJA 4BWYA 4KYIB 4DVGA 1E99A 1KO5A 4LJYA 3GQBA 4KV9A 2ZJ2A 2ZRFA 2IUUA 1FX0B 1XMJA 2IS2A 1U81A 1G5RA 2IA5A 3TR0A 4D0LB 4FWTA 4C7OB 2WAXA 1MABB 4F4IA 1FTSA 2IS4A 1D2MA 1BOFA 1Z0IA 1JXMA 1AGRA 4NH0A 3ZZUA 5FH9A 1K6MA 4C2UA 1N0UA 1QHNA 2FA9A 4FMDF 4OK6A 1E2QA 3MG9A 4KSCA 5CLLA 2FN4A 4NDZA 2JCSA 1L8QA 4ACBA 5TARA 1AS0A 4XVRA 3OIVA 2ZE5A 3AF1A 3ZQ6A 4HZUA 1TF2A 3I3SR 2EYUA 4EFMA 1Q22A 4HAWA 2G6BA 4B3GA 1EGAA 3WNDA 5JJIA 4GZMA 4DJTA 2I1VB 4OJKA 3A6PC 4B2PA 1E2MA 3EG5A 3X2SA 1DAHA 1H8EA 1N0VC 3FYHA 2WBLC 4IRUB 3TIFA 3ZD7A 2AK2A 3CX7A 1CR1A 2OESA 1COWA 1XWIA 1GILA 4Q4HA 5C4GB 1OH5A 2ZSBA 3RRNA 2Z4RA 1ZW6A 4F4JA 1OKKD 1NG1A 3EIQA 2I3BA 4IW3B 4KCGA 2ZPTX 1KSHA 5B2ZA 2WSSD 3CPHA 3RNLA 5TV2A 5FTLA 1N6NA 2ZJBA 2C95A 5EE1A 1TU4A 1W5SA 2O8DB 4DUGD 2XAUA 2JLUA 2VP2A 3B2EA 4G5QA 5DO9A 2VH5R 4DIEA 4TMTA 2W83A 2IEZA 4ZKDA 1MO4A 4LV8B 4NPHA 5AJVB 3V9PA 4BFZA 1BMFA 2CNWA 3WY9A 1WA5A 1QHHB 2ONJA 1XFAA 2NPFA 2Z5FA 3IO5A 1AZTA 4PC6A 2NZJA 2GKSA 1QG4A 2JLYA 5DYIA 2CCGA 1P7CA 2B21A 4WBSA 2EQBA 3MWYW 1XZPA 1DAGA 2BEKA 2ATVA 3TW4A 1TPZA 3B82A 2ZSDA 4DT1B 3QKTA 4IOKA 1E9FA 2O52A 1KK0A 4LHZA 4QHYA 5DE3A 3CZQA 1RZ3A 3TBKA 2OLKA 1W36C 2QBYA 1P9WA 4JBXA 4ARZA 1GM5A 1GIAA 2IXFA 3LXXA 3NC0C 2ZRPA 4EJSB 3IQWA 2JA1A 4BASA 2PL3A 2WPDD 3BH7A 1Q20A 2JLVA 1WCV1 3E1SA 5EP3A 2FSFA 3TQCA 4LPSA 2JLWA 2D62A 2IEYA 1G5PA 2WIAA 2WOOA 4AKGA 2EFDB 3FKSD 3C14C 2FWRA 4KVGA 2WWXA 2F55A 4A8JC 2LCFA 2WTUA 2DFKB 521PA 2P67A 2ORVA 3QSYA 2NO0A 4PC2A 2V7QD 4Q1EA 4A6PA 1ZUIA 4TSFD 4EAQA 1Q1BA 1QVAA 3SQWA 1TAGA 5SZIA 4A8JA 1DOAA 2V54A 2XTMA 3CWZA 4NYIQ 1E9AA 2HV8A 5DI3B 5FUYA 2BBWA 2QSYA 2GCPA 1R5NA 2BHRA 1XCPA 1ZD8A 1RJ9B 3K53A 4FCVA 1CS4C 1R0XA 2ZI9A 1KZ7B 3MWKA 4YDSA 2QSZA 1UKEA 4QJ4A 2KBEA 3R8FA 1Z83A 2QA5A 1EFTA 1XX6A 4I81A 3ICQB 2A30A 4DB4A 5AWFC 3RC8A 3C15C 4A82A 4N3NA 2QRNA 3W3ZB 1VG8A 2D3WA 1R0YA 4OK5A 1SXJE 2CCKA 2WJHA 2P6RA 1JAIA 1LF5A 1E9EA 1KKMA 4D0NA 1OXVA 2IF0A 3DHWC 4ASUD 2XITA 2H92A 3W90A 1GP2A 4UQOA 1OH6A 4CEJB 4FIDA 4GRAA 3P27A 3L8ZA 3BBPA 4LJAA 5AJZA 1UM8A 1JNYA 1G18A 5FOUA 3OIWA 1G6HA 5JCZA 2OT3B 2O8BA 4TYWA 2W0SA 1SULA 3BIFA 5HKKD 2J5XA 1XP8A 2BMDA 3O8CA 1XMIA 2NO9A 3C41J 2HXSA 5KHOC 1G1MA 4XSHA 3WBJA 1E96A 4MGIR 4F7WA 3AKEA 1UDWA 2G1KA 5FTKA 3ZS8A 4OHYA 1HA3A 4CIDA 2XEXA 621PA 3TAUA 2GEVA 4Q19A 5EP2A 3C4JA 3RS7A 1Z08A 3I73A 3GJ8A 1SXJC 4TT3A 1YJ5A 3KQLA 2UZIR 2ZREA 2ZI7A 3EW9A 3MUFA 2C99A 4LYAA 4ZDJA 2AKAB 5J4KA 4LBWA 1S0UA 4HATA 2O0HA 2B8WA 2IYSA 2V1XA 1A2BA 1FNMA 1ZD9A 2FG5A 4C9BA 1GNRA 2VP5A 4TYQA 3U61B 1SXJA 3HYRA 2G88A 3RS4A 3FVQA 1KGDA 3WYGA 1AKYA 3KUCA 1QHIA 3BFKA 3ZVLA 4JLDA 4UXJA 3D8BA 4EFNA 2QPAA 2ZSFA 1A7JA 2YHSA 1ZCAA 4C0JA 4N0DA 1KKLA 5LB4A 1VECA 2GEUA 1J99A 2JATA 4CZ2A 1RPZA 4V0MA 2N46A 3IO3A 2YOHA 2QAGC 4D81A 2ZYWX 3AVOA 2C98A 2MMGA 2PJZA 5L3QB 1KOFA 4CRWB 3FGNA 1ZU5A 2BOVA 4QG7A 1YHNA 4TTQA 3D6TB 2OSBA 2EYQA 1C4OA 1YZTA 2AFHE 2HJGA 1IHUA 1S4QA 4M9SA 4DCUA 2QAGA 1HTWA 1JJ7A 1ZNXA 2EFCB 4US0R 1MKYA 4QGAA 1Z0JA 1NVVQ 3SU8A 1P62B 2NG1A 3SI7A 3B1YA 1CLUA 1PLLA 2AXNA 2VP9A 1Z63A 3CNNA 4EPRA 2Z6VA 2K5UA 1KI4A 1N6PA 5L3VA 2ANBA 4B48A 2V3CC 3GLGB 1A4RA 1N5LA 4XWAA 1Z6XA 2VHTA 4AIIA 1YRAA 4QXAA 4DCTA 1XRJA 4GPTA 1E2DA 1Z6GA 3C5CA 3K9GA 1WBDA 1CIPA 2NO1A 2VF7A 2J3EA 5D3MA 2JJ8A 4XOIA 1JJVA 2BMEA 4A0RA 5DSZA 2GVDC 5KSYA 2RGBA 4B34A 4BFVA 1Q3HA 3KQHA 4O25A 2CVHA 3B6EA 1PUJA 4HYYA 4BZXA 2J0SA 4GMXA 1NIJA 3GJ3A 2F1HA 1NBMD 4S35A 4C7OA 4Q03A 1XBTA 2CLSA 1D9ZA 3DEFA 5FPHA 1KI2A 1SVWA 2UKDA 3U7EB 4H1UA 1XCGB 3SR0A 1KK2A 2BEJA 2AN9A 5IF9A 1P5ZB 2Q6TA 4LYJA 3BS4A 1Z47A 1US8B 3EA5A 3EASA 4IDQA 2QP9X 4YDHB 3LA6A 3AM1A 2V4ZA 4RJLA 3W34A 5DN6D 5JFGA 1HV8A 4Q1CA 1DAMA 4RD2A 1KK1A 4Q9KA 1OV4A 1GDDA 3NKVA 4DDWA 5K8IA 5JMTA 1D6JA 3ND9A 1RRGA 1OKKA 1Z2CA 2GDJA 2ZYTX 4E5UA 5AJWA 1N0WA 3K70B 2WSSA 1UBFA 1FPMA 1M6NA 5SZJA 4WZAE 2DWOA 2VL7A 4Y0AA 4P31A 4DUGA 3S1AA 1ESMA 1PJRA 3QKRB 5DLQC 4GMDA 1XMSA 3A1SA 3U4QA 4URXR 1AN0A 4MA4A 3LLUA 3AUXA 5EE9A 4G5GA 1OSNA 5DYGA 2NQ2C 4B44A 4LI0A 4F4CA 3K70D 5CYOA 1XPOA 1S3SA 3REGA 1TNDA 3MWLA 2IX3A 1FW6A 1FOEB 3AH8A 1E0JA 3DVLA 1U8ZA 3K8YA 5JHHB 1OFTA 2O8DA 1NP6A 3CO5A 4O3MA 2Q0HA 2ZIAA 1PVOA 3FFAA 3PUZA 4NCNA 3TRFA 4QC2A 3EZ9A 3SHWA 4HAYA 1G4AE 2GAOA 3KXKA 5AUPB 1E1QD 2A2ZA 2GJ8A 1DAKA 4MGZR 4Q21A 1QHHA 3AVTA 4NZYA 5BXQC 2GHIA 1N2CE 1YE8A 3Q9LA 1KI1A 3I72A 2NGRA 4LBZA 4XIGS 4WZ6A 4AG5A 2WPDA 4G5OA 1RW4A 1ZMXA 3QI2A 4MUAA 1QZXA 2WM9B 2GXUA 1E3MA 1IY0A 4DEXA 4QL3A 3FKSA 3R7WB 1J8YF 2IYQA 4Q9HA 2A5DA 2EW1A 2GZDA 2W2XA 1JECA 3U3JA 2HDNB 4JS0A 2RHDA 3KB2A 3BJIC 1DEKA 3AVPA 3BGWA 3IDQA 1XCMA 2V7QA 1DVRA 3HPQA 2A78A 4TSFA 4B47A 2ANCA 1QHXA 3EIHA 4GL2A 2P5SA 3QENA 4PHTA 3T1QA 4EPTA 3K0AA 2E87A 2VHCA 3GLHE 4GZLA 1P9RA 2QUZA 2VA8A 3C5HA 5J4VA 3SJAA 2PZEA 4C30A 1EFHA 3UIEA 4DLUA 2R6CA 4P33A 3QXJA 1W7AA 2A5GA 3A4NA 3ONWA 3QE0A 2JGNA 4A0GA 3OE7D 1W0KD 3UXMA 2D4HA 2TMKA 2IS1A 4Z1MD 4HZUB 2WHXA 3WHKA 1O87A 1AIPA 4P4SA 1EX6A 2VHQA 1CRQA 3F8TA 2LWIA 4EKDA 1RJ9A 1S9HA 2FF7A 1KO7A 3PUXA 1MR3F 3LD9A 1YZKA 3EZ2A 4ASUA 4QOSA 4EPWA 3TH5A 3Q72A 2W2TA 1JQJC 1U0LA 1N6RA 4O2RA 3A37A 2WIBA 4QBIA 3DMDA 2FGKA 4UJ5A 2DY1A 1P6XA 1HT2E 1RIFA 5D3QA 2XZLA 3AF3A 8OHMA 3FMFA 2WMOB 1OH7A 2P5TB 4Q02A 2IXGA 4K81B 5HKKA 1R4AA 3KKOA 5JJKA 2ASEA 3IIMA 3AVUA 4C0LA 4IDNA 1G3RA 1I2DA 1KDRA 4L15A 3T1TA 5JJLA 5HE8A 4H1VA 2F1IA 4Q1BA 1N6KA 2ZAOA 2O8EB 1TL7C 4M8NE 4BQSA 4DCVA 3GLHA 2VP4A 3AP3A 3VFDA 2F9LA 4V0LA 1HYQA 3PEYA 2ZVQX 2Q3HA 2Z43A 5L8VA 3OFND 2VBCA 3D3QA 4D25A 1RC8A 2PZFA 4MQBA 2RB4A 1KDTA 1DO0A 3ZVMA 1TQ4A 2C77A 3FMOB 1S1CA 5A4JA 2FJUA 4W9MC 5B64A 2JLXA 3EZ6A 2AHOA 2ZRBA 3D31A 3GJ7A 1FMLA 2C9YA 2W6JD 3MD0A 4MYUA 4JIMA 2W6ID 4Q1FA 5FBLB 1IXRC 1YR6A 4NTZA 1GNQA 4NCHA 4DCNA 1QF9A 1T91A 1ZM9A 3ASZA 4BFXA 3I5YA 4ZKEA 4F38A 4OHVA 2QGNA 2YOFA 3FMIA 3T1VA 5HCIA 1E9RA 5DIFA 5EE0A 2QBYB 4M9XA 3KQKA 4PC1A 3AVYA 4M2LA 5SZHB 3LBIA 4TQ9A 5FTJA 3H2YA 2QM8A 1NBME 3KX2A 1IOZA 2WWFA 5J4YA 2BIFA 1CKEA 3LV8A 1W36B 1SHKA 1W44A 2VSOA 1OXXK 5GVSA 1X1RA 4L9WA 1A1VA 3KTAA 3DOFA 1X8KA 4OI2A 3U3MA 3W3AA 1S9DA 1YVDA 1DAEA 3AKCA 3HR8A 3QPUA 1LV7A 5L3QA 1CR0A 4PHGA 5EZ5A 3X1XA 3ZS9A 1GWNA 4DZZA 2YWHA 1XEWY 2IT1A 4B71A 1TEVA 4DRZA 1NJFA 1V43A 4ON9A 4A8JB 5KO2A 3AGPA 1JAHA 2J45A 2PBRA 1XJCA 3EWSA 4B3BA 2FSHA 3EPLA 3IBGA 1AZSC 1Q21A 3V00A 5EXTA 1P2TA 4IEIA 2C5LA 1GKYA 5E7JA 5KU1A 1ZD1A 3R9WA 3KFXA 5FTNA 4D80A 1QHSA 2ZRJA 3GEIA 4RFVA 3GLGA 5DI9A 3GLFE 5JCPA 1T3HA 3ADBA 1QHGA 1G7TA 1T0JB 5TY0A 2KBFA 2GA8A 1NBMA 4RZ3A 2IYUA 2J0QA 4LBVA 2FMXA 3HJNA 2QTFA 1GTVA 1G64A 4KLZA 1P9NA 3AP1A 3RWOA 2RKOA 3A36A 4Q7JB 4FMCF 4HDOB 3RC3A 1U94A 2XZPA 1E32A 4JMPA 2EWWA 5KPJA 3SYNA 2O8BB 3BH6A 4L5BA 3L0IB 3GLIB 1T3SA 1VIAA 1E9SA 4EPXA 4XTRA 5J47A 3THWA 5DN6A 3SEAA 3CRW1 3H84A 2OFXA 1Q3TA 2BCJQ 2WWWA 1W47A 4OQXA 4XSGA 2XOKD 5CB6A 3AGQA 4NONA 1EWRA 4B76A 3BRWD 5DISB 4E22A 4LPKA 3QPWA 5JI3E 1IY1A 4NL4H 1YRBA 4A6XA 1VIYA 3CONA 4W5JA 3K70C 2QL6A 4BPBA 2YC2C 5CK4A 3TSZA 1E2NA 4TMZA 2AWOA 1SVMA 1NG9A 4AI6A 1NL3A 4GNKA 3B60A 1E1RD 3GLFA 4BE7B 2VP6A 2V6IA 2IUSA 3NXSA 4RVCA 3LX8A 2R9VA 3GFPA 1SXJB 2H16A 3PXGA 1W49A 3TR5A 2DR3A 4WAUA 3PQCA 4D6PA 4XWKA 1E2EA 3QKUA 4DDTA 5JZVA 3X1WA 2ODEA 5TXGA 3A4LA 4HUQA 2QORA 3WNCA 1E6CA 4QM6A 2P3SA 3GFTA 3SFVA 1Q57A 4FMDB 3BD9A 1E1QA 1UKYA 1MO5A 1PZNA 2F1RA 3KKMA 2OXRA 5E7IA 1NVXQ 1R10A 3N5CA 3Q8XB 2ZTSA 4A2WA 1F2TB 1I2MA 5CDFE 2YWEA 3AV0B 4LDJA 4MH0R 421PA 4HLCA 4OQLA 1K5DA 2QAGB 5JWHA 3TW8B 1H65A 3P4YA 1XD8A 3GJ6A 2F9MA 1KJYA 1P72A 2CMKA 2R65A 3EC1A 4MYTA 1ZVQA 4B74A 4EDHA 1SVLA 4TN1A 2ZRCA 3NH6A 5SZKB 5KTYA 1R8QA 1OIXA 2FZLA 4OYHA 2QE7D 1ZM7A 4MGKR 1XTSA 1OFUX 3KJEA 4QBHA 1JR3D 3ASYA 2QN6A 2NPIA 3GEEA 4MKFA 3EPJA 4JT2A 5G41A 3A1WA 4HDQB 4AK9A 1F48A 1NLFA 3FPAA 4CEHB 3UWOA 4PAOA 1ZM2A 2HJVA 1T8TA 1R5BA 3OAAD 3CR8A 4UJ3A 2GJAA 4TYPA 2ZYUX 3R7WA 4BFYA 3EPKA 4Q00A 4KITB 4FMBB 4TQUS 1TADA 2VSFA 3ZVRA 3GJXC 2HUPA 1OYWA 2ORWA 1S1MA 3PEVA 4GFDA 2YWGA 2XX3A 1QHYA 4F91B 1NI3A 1W0KA 1P75A 2WOJA 2F6RA 4LHYA 4Q48A 1BYUA 3GMTA 1Y3AA 1RRPA 1XNJA 1TF5A 2FH5B 2OAQ1 3LDAA 4LY6A 3O8DA 5CDFA 1ZM3A 3FDIA 4HLQB 4R71A 3CLVA 4Q01A 2KSQA 3UK6A 1CF4A 4P4TA 3F5FA 2Q9AA 1XTQA 1G8YA 3K9NA 4YMTA 3CRRA 4V0NA 3QF7A 121PA 1J8MF 2YC4C 1I4LD 3CPJB 4I1SA 3QVUA 2XNSA 3VX4A 4JL5A 5FUXA 4L4UA 2WV9A 3L8YA 3WXMA 5EZ6B 3G0HA 2PEZA 2FZ4A 2HCBA 4QGGA 4V0KA 4OJQA 4TLAA 1A2KC 1KNQA 2P65A 4YXWD 1FP7A 3GPLA 4TL9A 3UG7A 5F9FA 2RCNA 2ZRHA 1G8PA 4P3YA 1EFUA 1ZIOA 2R6FA 1E79D 3E70C 5FR1A 3S1AB 1T8UA 3I62A 2W0MA 5KDOA 2QTVB 5FPSA 2GK7A 3W5IA 4DSTA 1NLYA 3CF0A 3VHXA 4ERNA 5C2JB 3U4QB 3OFNA 2W58A 3THYB 2F3TA 1U99A 2AK3A 3W6PA 2H8KA 1G16A 4QGFA 1KYIA 2VQSA 3CZPA 4KODA 4R98A 4ZDIA 1GAJA 4OBEA 2O8EA 1MOZA 3WHLA 1F5NA 1FQJA 1GFIA 4WA7A 2YKGA 2QEQA 1JEDA 5IK2D 2EU8A 3KQNA 2W6JA 4GOJA 4GDFA 5K8UA 2W6IA 3QY0A 4KAXA 4IDHA 3ICEA 5FOXA 3QQ5A 4ILEA 3WYAA 1R0ZA 4DIDA 2DHRA 1ZUHA 4WZBE 1SHZA 2G0NA 2NZ8A 2BCGY 2J7KA 4B6EA 1JPNA 3RS2A 3LO5A 1UBEA 2W2VA 4NYJR 1H8HD 3RSOA 3IPXA 1KTVA 2FGJA 5C18A 5EUQB 2O0JA 2QGZA 1KK3A 3H0KA 6Q21A 4GP7A 1VG9B 4JT4A 4PX9A 4OHWA 4MRSA 2D06A 1OFHA 4ZIRB 4BLRA 3MRSA 1U98A 1CJMA 4TMXA 1JXOA 2RHMA 3DL0A 2D7CA 3HWSA 2YNMA 3U44A 3JZMA 1YZQA 2GBLC 1ZNYA 1IN4A 2ZRMA 1HH4A 1PLKA 1YR7A 2H57A 3MSXA 2YOGA 4BFTA 2YJTD 3K0AB 1Q12A 5B30A 4Q4AB 1WF3A 2GBLA 2PJRA 2OZEA 2GESA 5JSZB 1HE1C 3GLIE 1NN5A 2IYRA 1X1SA 2OFWA 5BYKA 4NYMR 2OG2A 3I8SA 1VCOA 4TL6A 4QNMA 3THXB 1F60A 5EJEA 4M0LA 1XEXA 1VTKA 2ZJZA 1KIMA 4UNRA 3SQXA 4QNRA 3I92A 4P4SB 3CF2A 1GL7A 3F3YA 1QG2A 3PV0A 4CVNA 5HZHA 2YINC 4RKFA 1GG2A 4Q47A 4WOPA 721PA 4W5HA 1OPXA 3X1YA 1M8PA 1KSJA 1X8JA 4BFWA 1JALA 1NY5A 1U8YA 4UNSA 4Z51A 3TNFA 3VX3A 1VKJA 3IQXA 2ODWA 5DNYB 3MLEA 1XB2A 1IBRA 1X8LA 3KL4A 3VR1A 4I1UA 3AKYA 1GRQA 1P60A 2XOKA 1KO8A 4Z8XA 4G1UC 821PA 1E0AA 3GLHB 4QBFA 3NIBA 3IIJA 5M04A 5H1YA 1O3YA 3GLIA 3LLMA 2HLDD 3KFVA 3LVRE 5IHPA 3LFUA 1IN8A 3LBNA 4TLBA 2F43A 3BWDD 4HAXA 2G9NA 2GTPA 1E1RA 2P6UA 3KJGA 1JR3E 2O8FA 4LBYA 4A1FA 1NIPA 5UKDA 3VKGA 1Z29A 4GI7A 1NSFA 4JJZA 3W5JA 1OF1A 3Q5DA 1W4AA 4JVLA 3U3RA 1JQLB 3TSOA 4M4SA 4IOLA 5CIQA 1KSFX 3QJYA 2MSEB 4ZV4A 3FWYA 2ZQ5A 5EXPA 3P4XA 4BZPA 4A15A 1VYUA 1G4UR 2XSZD 4NCJA 3RRZA 2ZI6A 2GRJA 1VCIA 2KJQA 5GJCA 3NDBB 3NBFA 2Q3FA 4P4UA 1N5IA 1SVKA 4PPGA 3L0SA 2XZOA 3T35A 5LPNA 3ADKA 3H86A 3Q5EA 1FTNA 1W4BA 2FSGA 3B13B 1G3IA 1LVGA 3KTAB 3O47A 5KDDA 5BWMA 3QVVA 4K8OA 1II0A 4JL8A 5KNBA 3SN6A 4JLOA 4X8OA 3TJZA 4M1WA 3TK1A 4URZR 3B78A 2OBMA 2WJIA 3LW8A 1E2FA 1P2SA 2QE7A 1N3BA 4DDUA 1F2TA 5CJPA 2QPTA 1D5CA 1G21E 4IFBA 1SGWA 1WQ1R 5TB5A 3CW2A 1JR3A 1NKTA 2Q21A 2CK3D 3CB4A 3W6NA 2MSDB 2A5YB 2CLCX 2ECKA 1JBKA 3AF0A 1BYIA 2ZS8A 3QKSB 2J59A 3K0SA 3OAAA 5LBIA 3WMEA 2ATXA 1PUIA 4B43A 2CHGA 2J1LA 1IXSB 3HU2A 4XD7D 4ACAA 1M7BA 3SJBA 4L9SA 3I61A 3CRMA 4NMMA 4U5XA 4IOMA 4NBSA 1IXZA 2A9KA 2OCAA 3FE2A 4JYBA 1E2LA 2GF0A 2H5EA 4M53A 2QMOA 4CEHA 1TF7A 4P0TA 1RVDA 2G83A 1LNZA 5DHAA 4AYWA 2V8OA 2QMHA 4C3ZA 1NMYA 3VR4A 1V5WA 4YMVA 1XTRA 4JLBA 4Q7LA 2GWHA 4OQFA 3IILA 1KMHA 1GL6A 4BFSA 4NP6A 1U8AA 3THWB 1DPFA 2GXAA 1TUIA 2WKRA 4IDOA 4PAMA 3GD7A 3T1OA 2CLDX 1E2JA 3B7GA 4YXWA 1OH8A 1F2UB 3H4MA 2J7PD 4LYHA 5FR2A 3BORA 4QKQA 5EQTA 4GOKA 3HDTA 2R6AA 3PG5A 1OXTA 1E79A 2NO7A 1DE0A 4OQMA 2REOA 1ZAKA 2OXCA 2WJVA 5B58C 4R2IA 2XJ4A 4B33A 3HU1A 1ZNWA 4TWZA 3AVXA 1G9XA 4B32A 3FHOA 1ZIPA 4C0HA 3I8XA 3GLFB 1XJQA 1E4VA 1J90A 4Y0VA 3OIUA 2G0TA 2GNOA 1SKYE 1K8RA 4Q4LA 2FSIA 5KNDA 2Q3MA 3LRPA 5CK5A 1ESNA 4LGMA 5FBWB 1R5OA 1ZINA 3B1ZA 3OIYA 3QXXA 1OB5A 3IGFA 2HT1A 4DSNA 1KNXA 4IEEA 1PLJA 1ELOA 4HUQB 3THYA 4PPFA 5FPTA 4URWR 5JWOA 3ZJYA 2JIZD 1A82A 3LX5A 3PUVA 2G77B 2GXQA 1KI8A 3K0FA 4NYJQ 4JL6A 4ZI3A 1H8HA 4MUBA 2F1JA 4LYFA 1HE8B 1OB2A 4PHFA 2MMCA 2IWRA 3L0OA 2N1BA 3BC1A 1P73A 5JHGB 5G3ZA 3LNCA 2FFAA 3EC2A 1MRSA 3BK7A 4IVPA 5HE9A 2BBOA 1E4YA 3CWQA 4M1MA 5TVKA 1Z0KA 2AD1A 3DOEA 2JLZA 2VP0A 2ZR9A 4PPQA 3NEJA 4GBMA 5FPYA 4DKXA 2ORIA 1SVSA 5CB8A 2D2EA 3QF4B 4HLDA 4NU0A 4A2QA 3GEHA 2VEDA 4ESHA 3FHCB 1G7SA 1I4DD 1LS1A 1YR9A 1E2HA 2B6HA 2JEOA 4MDFA 3A1TA 2EFHB 3TVTA 4J0QA 3CM0A 4ZIRA 3H1TA 3E5HA 1DS6A 2DPXA 2PLFA 1F6BA 4L8GA 4RD4A 1QBKC 1W46A 2ZI5A 3LBHA 3WP1B 4JLAA 3M0EA 4M1KA 2ZRLA 1HY3A 4NYMQ 4UXHA 1S8FA 4RCYA 1G7RA 3OZXA 4TLCA 1FMJA 2A3RA 4ZCIA 3WMFA 4WXRA 5GJWC 4JVMA 2GJ9A 4CEIB 5GJVC 4I1VA 3CBQA 3UPUA 3FHTA 3VR6A 2OUKA 3HPRA 1KZGB 5JRJA 1BIFA 2ZJ5A 4Q4AA 2GJSA 2IK8A 5JSZA 1ZP6A 3VMFA 2P6NA 4U00A 1OE0A 5GVRA 3U7HB 3THXA 4RD6A 2R8RA 3T61A 4HLUC 4KLNA 2ZRAA 3QPVA 4HSEA 4B35A 4LJ4A 4PHHA 4X8LA 3CIOA 2AD5A 2RGGA 3K9HA 4JYCA 1LB1B 1Z5ZA 2J9RA 1WBBA 1KY3A 1QRAA 2V6JA 3TAHA 4HLUA 4LV6A 4D2IA 1WE2A 3ZDQA 5E95A 4PZZA 4TLDA 1ONBA 1U0JA 4R9UC 5C1BA 1TEXA 4A0HA 4B2IA 2WJGA 2B8TA 2HLDA 1TUEA 3DDCA 3VR5A 4JVNA 3AVWA 4PZYA 1KO1A 3SYLA 4EPYA 2D7DA 4B3FX 3UANA 2CE7A 1D9XA 4IXMA 1T5LA 4Q7MB 4US2R 2ODBA 4BRWA 3T06B 3L82B 3W6OA 1WB9A 2IYLD 3JZAA 5BN4A 2ZI4A 5L3RA 2FDCA 2ZANA 3UMRA 3B1XA 1P3JA 1Q1QA 1KDPA 2IYWA 3C8UA 4LC1A 1AS2A 2UZ3A 3P1JA 2GZAA 1CEEA 3BFXA 4UNPA 3LAWA 3TLXA 2JASA 1EWQA 2VHUA 3BAFA 4D4MA 4ZO4A 5DHFA 1J70A 1CJVC 1AK2A 5CLQA 5FI1B 2BJWA 1E2IA 2XSZA 3ZVNA 5CJ2A 2VSXA 1PV4A 4YC7A 4ITRC 4MITA 4D26A 2AWNA 2N42A 1SKQA 3LQRA 3AB3A 3OEED 4JVSB 1COWD 1LFDB 2AFIE 5FBQB 5JS7A 3CPEA 4LWZA 2C96A 1CR2A 3VNUA 4Q4JA 5E7MA 1XXHE 3U44B 4FMCB 3RABA 1ZRHA 4ESVA 3K9LA 4TL7A 4PQFA 4DSUA 5GADl 2PT7A 2BM0A 4YMUA 3DO6A 1S2MA 2OAP1 3TGPA 1G6OA 4R7ZA 4DXAA 3RS0A 2C8VA 2CK3A 1ZCBA 2X1VA 3L0PA 1YZNA 4LRWA 2JJ1D 3EAQA 1G8FA 1VDZA 2ZRNA 1RKBA 1JEEA 2Q9CA 2QG6A 3NBXX 4PTLA 4JKIA 1MO6A 2RGCA 1XEXB 3AUYA 4XD7A 4DLVA 3KQUA 1S3GA 5H70A 4A36A 5A0FA 2WKPA 3QOFA 3EA0A 4CGZA 2D74A 3QKSA 4A2PA 3BB3A 3N70A 5LB2A 2XTZA 4URYR 2WSMA 1E9CA 1DADA 3RRYA 2ZJYA 1KI6B 2ZE6A 2CXXA 1SQ5A 4GT1A 1RYFA 4DLTA 3UMFA 3WMGA 1XXHA 4TMKA 2WWYA 2CJWB 2GEDA 1OHHD 5DGXA 4V02A 5BQ5A 1XEFA 2GAAA 4QBGB 5AUQA 2FPLA 3U60B 4AKIA 3A58B 2QQEA 4ZDKA 2EVWX 1HT1E 3E2IA 1GKUB 1CULC 1OIVA 3EXAA 4Q66C 1ETUA 1EXMA 2J7PA 3DM5A 1XD2A 3P20A 3SE0A 4KFSA 4RFSA 2EFGA 2ZU0C 4A4DA 2IBMA 3B9PA 1CRPA 1X6VA 2ZE7A 3NHBA 3VU9A 2FFQA 2DWQA 2REXB 4LHWA 4LJ9A 1OXSC 3L43A 2F43B 2GETA 3K09C 4FI3C 1W48A 4FXPA 4M1SA 1WMSA 2E1RA 2ZRKA 4Z8YA 1F2UA 2O8FB 3OF5A 2DFLA 2BBTA 1VMAA 2BVNA 2DYKA 4JSTA 1LF0A 4EIWA 4BEBA 4QHTA 1AA9A 1EFRD 4KFTA 3K09A 3TUIC 3BERA 2C04A 1DG3A 1EK0A 2XNDD 4BEJA 5BN5A 1E2KA 4II7A 4DSOA 2DB3A 4MRNA 2IYXA 1N6OA 1HUQA 3CF6R 2JIZA 3NBYC 2RGNC 4FD2A 4WW0A 1Y63A 2IYYA 3KXLA 2VRWA 2ZVPX 1W4RA 2J41A 1GZSA 4FCWA 4RZXA 3PCRB 4JSYA 3T12A 2XTNA 1IQPA 1T5IA 4XVQA 2RGNA 4AKHA 1JR6A 2NIPA 1G20E 2GILA 2ERYA 1W2HA 1NVWQ 3PIRA 3SZRA 1N5JA 2RH5A 4YMWA 1IJFA 2IW3A 1DTSA 2A5JA 1T0HB 2JDID 3EZ7A 4XWOA 1RFLA 1W5TA 1VYVA 2IYZA 4TZ0A 5JI2E 3CH5A 1CU1A 2QZ4A 2FNAA 3HP1A 1N25A 2Z4SA 1Z8FA 4HAUA 2C9CA 1TX4B 4URUR 2QNRA 1Q1ZA 2XB2A 5K8LA 3RAPR 3EWAA 3UG6A 2XGJA 3FB4A 1ZYUA 2R6DA 4NHOA 3QF4A 1XTJA 2OEPA 3FMPB 1W2GA 3GFOA 1R0WA 4O0MA 3NHAA 1G5TA 4WIAA 5G3YA 2VPPA 1XPRA 1YU9A 2IL1A 4MRRA 1TTTA 4BLSA 4QHSA 4UXIA 1KI9A 5BN3A 4ZCMA 1T3LA 4GP6A 2C03A 1AQYA 2Z0MA 4FN5A 2WAYA 3UMSA 1C9KA 2ZE8A 3CRVA 4Z54A 4G0NA 3ZLJA 4KFUA 2ZYVX 4V03A 1CTQA 1D2NA 3OE7A 2ZJOA 4C2TA 4Z1MA 1KMHB 2BMFA 1AQUA 2RGXA 4CEIA 1IY2A 5J40A 4FINA 1GUAA 1Q44A 2RGEA 4IJMA 2ZRDA 4N0EA 3KZ1E 5FL3A 1ZU4A 1NVVR 3R8CA 1XMVA 3R9XA 2V9PA 1KI3A 4TMVA 4G3XA 3I4LA 2YYZA 1LW7A 3X1DA 3NH9A 1P4SA 1TQ6A 4QRHA 4BLOA 3V4RA 1UAAA 3PJRA 1IAQA 2HXYA 4P32A 5CITA 4W7SA 1TQDA 3KB1A 2RMKA 4JLKA 2NOAA 4HAZA 5IRCD 1JI0A 1T6NA 2ZSEA 4R2HA 4CT4B 2R2AA 3I32A 1RRCA 4KYUA 4MKHA 3IEVA 1NRJB 2X8AA 2BM1A 1YR8A 2SHKA 1AGPA 2ZETA 4PFSA 2BV3A 3QNUA 5JS8A 3DPUA 3EIEA 2ZROA 1E9BA 1MO3A 4HI0E 4MKIA 1FUKA 2F3RA 4XVUA 3DKPA 3K0EA 1XDBA 1Z07A 5IT5A 4JBWA 3VTKA 2QAJA 4CYMA 1W4CA 5AK0A 1NMXA 5FUWA 5LDDC 1E2PA 2FFBA 4UNQA 1CJUC 1G41A 3B1WA 3K0FB 1BKDR 4BFUA 1AKEA 3M1IA 4DC9A 3AVVA 221PA 2CHQA 2X2EA 1NLZA 4LJ8A 1KSGA 2ZITA 2A5FA 1WDTA 5H8WA 3CH4B 2NO6A 4K46A 1U0HC 2JAQA 3OEEA 5EUMA 3MJRA 3RHFA 4KI0A 4DDVA 3WRXC 3PVSA 1NVUQ 2FEMA 3RLFA 4DLRA 1BO6A 3RS5A 4JLVA 1G8GA 2FFHA 1BS1A 3BB4A 2ZR7A 2MSCB 5JLJA 1FL9A 1Z2AA 3RSLA 2YV5A 2CL0X 2JJ2D 3QIAA 2DBYA 1UEJA 1P2VA 2CBZA 3TKLA 3LQQA 1DO2A 1SKYB 1DELA 3QG5A 2J46A 2WJYA 3SNHA 3WP0A 4AURA 2JJ1A 1FNNA 2ZRIA 4KXFB 2OE2A 1XPUA 3NEYA 1OYYA 4H9GA 2ERXA 1M2OB 3VKHA 3FKQA 3RDPA 3AVQA 2OCYC 4NCIA 4LOAA 1L2TA 5JECA 1XJ0A 1UADA 2GK6A 5KUTA 2FE4A 2WKQA 4DLSA 3O8RA 4C0BA 3V4FA 1G17A 5J4LA 3EZFA 2C78A 1KAGA 1T4GA 3CRQA 1II9A 4E09A 2V55B 2YZ2A 1XD9A 2PLRA 1DBSA 2ZUCA 2FPMA 4LJ7A 2FX3A 5FUVA 5HR5A 4DLZA 4US1R 2BJVA 1YZUA 1ZUNB 1OIWA 2ZUBA 4IVRA 3EX7C 1XF9A 2HYDA 2QP3A 4PO1A 1GSIA 1VPLA 3X1ZA 1J2JA 1OHHA 1NKSA 3RRMA 3WRYC 4DWJA 3LH5A 4BLPA 1GKIA 3VKWA 2KWIA 1A5TA 1ZC3A 1E2GA 2IYTA 3AP2A 3B85A 4Q1DA 2WWIA 3CX6A 1IJEA 4PSKA 2QI9C 3OHMA 4IFEA 3MAAC 4TTPA 2IWHA 2FEOA 1KI6A 4KVAA 4BLTA 4ZDWA 2YWFA 4NE2A 4UNNA 3ZZ0A 4TQAA 4ZPXA 4HEJA 3B1VA 3KDSE 2OBNA 5AJYA 2AXPA 4OI1A 5CM8B 1NN1A 4A92A 2CJWA 3PEUA 4B73A 3L2OB 4RD1A 3BFVA 1M1YE 4OHZA 2IF2A 3FFBA 4PO9A 4AG6A 5KPDA 3SJCA 4EPVA 5AUNB 1FP6A 3TUJC 3KKQA 3I1FA 2DWPA 4JLPA 2B7BA 5JEDA 2BKUA 3CKLA 2B92A 2PMDA 1EFRA 2VIIA 3R20A 2CCJA 5KOYA 2J0UB 2QQ0A 4LSGA 2XNDA 5KSPA 5CIWA 2AKYA 4MYCA 5KSOA 1KY2A 2A7QA 1E98A 5FOSA 4I99A 1ZC4A 3A1UA 5J4HA 3U5ZB 2QY9A 2PCLA 4IKEA 2QT1A 4MDEA 4PPNA 4RZ2A 2OO7A 3OESA 2I4IA 1E94E 2WJJA 4DB2A 3EARA 1Q0UA 4OK3A 2VO1A 3ND8A 1CBUA 1R7RA 3CX8A 4V0ME 4C0AC 4MRPA 4L16A 3IBYA 3RS3A 5L3SB 4MKGA 1GRRA 1VYTA 4EFLA 1EX7A 1CJKC 3SC3A 5JRZA 4Q4JB 1TU3A 1II8B 2IYVA 2JDIA 1VCNA 1QDEA 2REBA 4HDCA 4KFRA 4N1AA 5LD2B 4HB4A 1GVNB 4HB2A 4ABYA 1X86B 3PENA 5EXXA 1OW3B 5TDHA 2D2FA 1MT0A 4NCKA 1TMKA 3C16C 4HAVA 4B3CA 1M74A 4BZQA 2IC5A 4DLXA 2KE5A 3PR1A 2P0EA 3AF2A 2QTHA 2WWGA 4OKSA 4JBYA 4V0OA 2BKEA 5CM9C 2NMVA 1RE0A 1SVOA 2XJ9A 1ANKA 3SOPA 5F2EA 1XEWX 2R6GA 5A5GA 2ZJ8A 4FW9A 2NTYC 1UF9A 4HB0A 5CYPA 3WBKA 4URVR 1U2RA 3K1JA 3N2EA 3W8NA 4QGHA 3BOSA 1E9DA 4IVQA 3GP8A 2WWHA 1W0JD 4WXPA 4TTRA 1Z3IX 3MWJA 4RKEA 1ZBDA 3K0CC 4JKYA 4LZZA 4RCZA 4B3XA 4JLMA 3TSWA 3DKVA 4GSYA 2CDNA 1FUUA 2JLSA 4A9AA 1MV5A 3W9YA 5B57C 2WMNB 4OI0A 1CJTC 2PZGA 3JVUA 3K0CA 1XXHB 2W00A 1NSTA 3KKNA 4I4LA 5F98A 2Y8EA 4AYXA 4HZIA 5BW8A 2ZAMA 2O8CB 4G5SA 4PR0A 1KO4A 2OCPA 3MCAA 3AQ4A 4EQ6B 3VNVA 2VYFA 2PEYA 3ETLA 4U02A 1XD2B 2Z83A 1UJ2A 2RAPA 4RFSB 2XXAA 2AX4A 2ZEJA 3NTUA 2VHJA 1K5GA 3U3KA 4OQNA 2BMJA 2OM2A 3VU9B 1AJEA 4JJKA 5GJBA 4M9QA 2X77A 1FQKA 4POAA 1W1WA 1XTIA 3BE4A 1CXZA 4Q9LA 2CE2X 3SFZA 2CL7X 5JWRA 3PUWA 4AY2A 4PZLA 4M22A 1DAIA 2WICA 4KHZA 2GVZC 3CR7A 3QXSA 2PH1A 4JLJA 4DHEA 1FX0A 2BBSA 2J0VA 1M7HA 1G3MA 1E0SA 1YZLA 2KI5A 1B23P 1MABA 5FL7D 2FOLA 5H68A 3U3OA 1Z28A 1Q1EA 3LWNA 3VHLB 2LKCA 3IUYA 1Z0FA 1Z06A 4RD3A 3O8BA 2VLIA 5IK2A 1R8SA 3A1VA 3IEUA 3ZGXA 2XB4A 3B9QA 3SBEA 3QEJA 1IN6A 3ADDA 2ZRGA 4B3DA 2ZM5A 3FTQA 3DMNA 3TVDA 3G82C 1R6BX 2QENA 4LC0A 3VR2A 2CVFA 4LX0A 3AEZA 2WVJA 3SS8A 2JJ2A 1G3QA 5TMPA 2EWVA 1GRNA 5FOTA 4MRVA 4XTCS 5FOVA 4O2LA 2QT0A 2C9OA 3PUYA 4XH9B 1G3UA 2IUTA 4EUNA 4YONB 2PX3A 4D0GA 4QJ5A 4M1TA 3AF4A 2GCOB 2WZQA 4IXNA 2QM7A 4UKDA 1GITA 3WNBA 5EE3A 2ZS7A 2HF8A 1AM4D 2V1UA 2C2HA 1JB1A 3EPHA 4PC7A 1U9IC 3TQFA 3M4YA 4RD0A 4Q9IA 2QMEA 2YVUA 3QEOA 3U6KA 3RANA 5E4FA 3ZIAD 4F92B 1JPJA 1U90A 1U9IA 2L0XA 4HB3A 4Q7KA 3UKDA 5E3HA 3U2QA 3QXCA 4EJSC 3NWJA 4M1OA 4DT1A 3R9IA 1VG1A 2PMKA 5IDVA 1IONA 1UBGA 4KU4A 1GOTA 2FPKA 3GJ0A 2FU5C 1M34E 1Z6YA 3VR3A 3SYKA 4PANA 1LTQA 4EJSA 3FOZA 2GZHA 3OEHD 4D4KA 5BYJA 2LKDA 1L7VC 1Z6AA 4QJ3A 4TLEA 2ZSAA 1LS6A 3U6BA 4HUTA 4CDGA 1P61B 2O0KA 4OL0A 4WVFA 2ZJAA 3MMPA 3P26A 2BC9A 2OBLA 4LHVA 2CEAA 1OFIA 1RYHA 1VHLA
chains in the Genus database with same CATH superfamily
4FNGA 1D1SA 3AKDA 3H18A 3QYAA 2PTHA 3C45A 1ZEJA 2W6OA 4IS3A 4MW0A 4UAVA 3GI1A 5CW2A 4AP9A 1KAOA 4EHBA 4S0XA 2FPOA 2ISSD 3O4FA 5JSYA 5BV1A 1QKKA 4F3YA 4GECA 1Y4ZA 1YRWA 1GSOA 2O3QA 3MTGA 1DG1G 2R79A 1YK1A 3THOA 2GN8A 3HVJA 5BNZA 2Z1MA 3E3MA 3T3GA 1JKIA 1NVGA 1Q1GA 3MJHA 5K2MA 1KMQA 1ZMOA 3CT6A 1SOVA 4UPEA 3R7SA 4XYMA 2VDWB 1FEZA 1ZGZA 2A4MA 5IWAB 5BNIA 2X2FA 3A9SA 3N2GB 5AIBA 1PJ8A 2QPOA 2W6NA 1AV7A 1T9HA 2HLNA 2PX0A 3O2SB 1L4YA 1P5RA 4LIPD 2AOUB 3VMMA 3AL2A 3W8RA 4BBZA 2ECQA 2EJTA 2KB0A 1GXSB 5I3CA 4MW5A 3GX1A 3DUFB 3TOXA 1IBMB 3RNOA 4CKBB 4UQLA 1CUEA 3I4CA 4EY7A 4HY3A 2E4UA 1XCLA 2WTAA 3R6GA 4RNCA 4ALKA 2PRIA 2RHRA 4YP6A 3VAAA 3H2ZA 5JDCA 3G9XA 4MI3A 1U2ZA 1CQWA 3PQ3A 4CEJA 2ZZMA 3JALB 3GCGA 1G7CA 2HRRA 4BQQA 1AY0A 1NF3A 3RPEA 2ZT8A 4E94A 4D5GA 5KNCA 1PYGA 4F93B 3PUIA 4QYIB 2XBMA 1JVNA 3VOBA 5L3SA 1NN3A 1FSGA 3CCBA 2I76A 3EZYA 3F78A 1UKZA 3KUDA 2GF9A 3F6CA 1JEJA 4GPBA 1NNEA 4YLGA 4OM7A 1RHQA 1IOVA 5F23A 1II8A 4W4TA 1PDWA 3ROGA 5K0GA 2F4NA 1HEIA 3P2EA 4NS4A 2WA2A 3SXPA 4DM3A 2VPWA 1PVVA 3PUKA 1TMOA 3LL7A 2DFTA 1NYQA 1U3GA 2ZI3A 3VJLA 4U8HA 2HCFA 3IHWA 3NBZC 3QUCA 3F67A 4PS0A 1VCMA 4AZSA 3TQOA 1W0JA 2WZCA 3HTXA 1WOMA 2NZYA 3IB6A 5FWXA 2O20A 1BMFD 1JDUA 2P2LA 3FZEA 2VQEB 4KIGA 4TMYA 4R6XA 4QTZA 5E1BA 3T5DA 5J5CA 1E5TA 2QL7A 4ZK6A 1K2VN 1QVRA 4BQOA 2Q5FA 3QMPA 1L5ZA 4NENA 5A6SB 5JH7F 2BTQB 4E2XA 4BUJA 2W42A 4FE4A 1T35A 4O2AB 4XM2A 2F7SA 1Z88A 3QVOA 3U7FB 4I6GA 3W4KA 3HYTA 1IATA 5LM3A 3WKEA 1I3NA 4PO8A 3C98A 3A3NA 3PWZA 3QUSA 4ZI2A 3HHPA 4B4OA 5CB4F 1WDKA 4B5LA 5FAKA 1GV0A 4K9OA 2K6GA 1HQYE 2CMFA 2B7CA 4HL6A 2BWJA 4NDAA 1UFQA 1CR4A 1PSZA 2HT6A 1KH3A 2VYND 3WO0A 3J81k 2OO3A 1H3FA 4DEYA 5MGBA 2NAFA 3FF1A 2G8LA 5KB3A 1NXOA 5K8VA 3WLPA 5EP4A 4LHXA 4MOWA 1CVLA 4D41A 2RI0A 4E30A 4EQ6A 1GEEA 1DKQA 1U6IA 2RHBA 2VCYA 4F2GA 1QRDA 4ZHSA 5IAGA 2JJYA 3AWDA 5KVVA 1LK5A 4NZNA 3ZW8A 3UATA 2FR8A 4K3VA 4N8DA 2EFYA 2QUHA 1VKZA 3UK7A 2P1ZA 3PFIA 2GTIA 1SVIA 4OVKA 1F0KA 2PUVA 4PSAA 4Z53A 1I01A 1YZHA 1E69A 1RYEA 2DBRA 4MR7B 5FTMA 2ZM6B 4ZI7F 4DJDC 2R4QA 3LY5A 5KEIA 3GK3A 5JYEA 2YN0A 2B98A 5FA6A 1FYFA 4W1QA 4Q39A 3V7UA 4D8VA 5F7XA 5HOQA 1KHTA 4Q9AA 1TA4A 5JQGF 1OI3A 3CN9A 1KAMA 5AOBA 3SHVA 4UTXA 3HVIA 3A6GA 4N6OA 5LQJA 1SCUA 3LF2A 2DECA 4Q1AA 2V7GA 5LP6A 1RADA 4AD8A 3D02A 1TJ3A 1U3TA 1G5QA 1D03A 4Y2HA 5IYZA 1D1QA 1STOA 2BELA 2E49A 3K8ZA 3M6AA 3VNQA 3HMKA 5JVDA 4O4IA 1MAWA 1AXEA 2YQ5A 2H1LA 2I9PA 2OVFA 1SOMA 3ODPA 1YQ9A 3W8EA 1EHCA 1K88A 2OV2A 1ZA1A 3PFNA 5TR9A 1KVRA 3GLRA 5A05A 3K4QA 1K6JA 5BUCA 3OMWA 1WPXA 2H0RA 1S7GA 2ZFUA 5GONB 2P30A 4UVGA 4AS1A 5LLTA 2FWBA 2DJ5A 2ZS9A 1E62A 1D8TA 2G3YA 3CMMA 1CE8B 1D2EA 1C8VB 1K7CA 1V3TA 1W94A 1XTKA 4RO0A 2JZOA 1YZ3A 4XJTA 3GNSA 5CVDA 1SHUX 2NVUB 1GQSA 1L6RA 2HD4A 2OCBA 3HCOA 4RQUA 2K2QB 4V38A 5ANRB 1XRLA 1I2BA 4JZKA 1A88A 1Q7RA 3LW7A 4I9UA 1WVIA 4L5IA 1HX7A 1V35A 1ENZA 1U0NA 4BRSA 1QF6A 2DUWA 3CHYA 2ZUDA 1SCNE 3PQ8A 4LJSA 1KYQA 1XQYA 3LPNA 3PC8A 4PC3A 2PCJA 4QQNA 5EFOA 5EPUA 4G01B 4IVNA 4IHQA 1T34A 2H17A 5KYYA 3WB1A 3W2GA 1EUDA 1HKUA 4IGIA 2QD4A 2HBQA 1HTTA 2OFOA 1JUDA 3OA2A 1F4VA 4KBFA 4R1QA 5AHXA 3TE6A 1XGKA 1TM3E 2QRZA 3C7CB 4XI9A 1X3SA 3E23A 1OX5A 4YYEA 2YBEA 2PUCA 3G2OA 5HPYB 3Q85A 4ZOLA 4X8MA 1PJ3A 1XU4A 2H0QA 3IFSA 3OKFA 4FLMA 4KBYA 4OQZA 4X93A 2QRHA 4YRFA 2JF0A 5DDIP 3QBEA 1E3WA 4N8EA 2Z6QA 1UDXA 2J3HA 1I7NA 2AOTA 5F3WB 3JQEA 2YS6A 2JLQA 4RGYA 2ZVJA 3ZQUA 4MIKA 3RJZA 1X2EA 3B8HA 3LCMA 5FOQA 4OI4A 4OSEA 1TB4A 3NG1A 4M9ZA 1A8PA 1UWCA 3KPWA 1NMZA 1IG3A 3I01M 4PGAA 1ZH6A 5GP1A 1EB8A 1B0UA 1SEPA 3DAOA 4BNYA 2KLHA 2CDRA 4G89A 4E2ZA 1GZ4A 2MYTA 3HFRA 4CN9A 5DBGA 3FTCA 4A0FA 2WJ3A 3LVBA 4YV2A 2FPPA 4ABTA 3HYCA 4KE6A 5EIXA 2C4MA 4FQ5A 4P5EA 4DMGA 1L4GA 2W8BB 1WSWA 1HG0A 1Z2PX 5E6UA 1R3DA 1Z0DA 2GD1O 2X5XA 4EB0A 3MAGA 3OOYA 1P9LA 1LY1A 3K16A 1TRHA 3AEXA 1KZ1A 1R2QA 2AQIA 2Y05A 3C97A 4BO2A 4CIXA 2A35A 3LKDA 4DEVA 1Q5PA 4CF7A 1JFTA 1CS0B 3ZNQA 2XT0A 3HU3A 5D3MB 3U13A 2EP8A 5ALWA 4AN0A 1F0PA 4S24A 4M1YA 2Z8YM 5KOIA 1I2AA 3TBFA 2HK9A 1ZGBA 4DVGA 2EKPA 3D5QA 2I4OA 3F7MA 1F8UA 3GQBA 1FX0B 1XMJA 4QVGA 4UUOA 5EQDA 1DLJA 2IXTA 2WAXA 4FMPA 4M86A 5T64A 4M8SA 2IS4A 4DIKA 1BOFA 3CYFA 4PCAA 2E18A 4M36A 4FMDF 2BFEB 2Z30A 1N2BA 1PZFA 2KQUA 2QPLA 4OK6A 1Z13A 2VSNA 3VVCA 3ZXXA 4AWBA 2FN4A 2WYWA 4MMYB 2NSLA 1NQVA 2GRAA 4NDZA 3UGKA 3Q8LA 1C7FA 1EWKA 2AQKA 3OJWA 3EGWA 4XVRA 3UV3A 1HFKA 1JLRA 1RI4A 1Z5OA 4D02A 1DDIA 1U7PA 4YRSA 4D57A 4XVHA 4YDQA 1EGAA 2XUJA 2IV7A 2JGAA 2AC2A 3H9UA 3KS9A 5FB3A 3LLVA 1RAAA 2REQB 4C14A 3DFIA 3WGQA 1O0SA 5LMCA 1X8XA 1LLDA 4XSVA 2BH2A 1UJCA 4V2IA 5CBKA 4JT8A 1DAHA 2DE0X 5LIPA 1H8EA 1N0VC 2VTVA 2XQJA 3FYHA 2WBLC 3KSDO 3TIFA 3N0TA 2F8TA 3ZD7A 2AK2A 4BBAA 3CX7A 3DCIA 2OESA 4XYLA 1COWA 1CIJA 1KA9H 4EI7A 1XWIA 3LC0A 1GILA 4HYTA 2R4TA 4Q4HA 2WVGA 3BQMB 1O6ZA 1IHYA 2OHJA 2Z4RA 4F4JA 4RM3A 5G4KA 1RVV1 1YAHA 4FYMA 4F8EA 2WSSD 3GO4A 3VTAA 2GLUA 3IDAA 1P39A 1C2YA 3B38A 1KDZA 4B9AA 1N7GA 5JPCA 5EE1A 5JAPA 3B48A 1MRZA 4L0DA 1G6Q1 4ZEWA 4PIPA 2VKTA 2VP2A 3VOAA 3MK31 4G5QA 5DGHA 2CD7A 3ZG6A 3PP8A 4ER5A 4IM7A 3L02A 4NPHA 5AJVB 5EWMA 4EABA 4FFNA 3KYJB 2VNJA 4ENRA 1H1DA 4H27A 3UCFA 1WA5A 5LFAA 3UKOA 1XFAA 1I5EA 4B80A 2Z5FA 2X3FA 2FW6A 3O8NA 2X40A 1IXKA 4MQLA 5HRCA 3UICA 4IG9A 2A67A 4G86A 2I2FA 1P7CA 2B21A 1YJXA 4WBSA 2VAPA 3MWYW 3ONNA 1Y98A 1DAGA 3DDWA 2BEKA 3F8WA 3K72B 3TW4A 2J0EA 4BN4A 3B82A 3QTLA 1ZZEA 4AX8A 1JMKC 2JHAA 5BRJA 4OIFA 2Y4NA 4OBWA 5GV8A 5IX8A 3CZQA 5K4AA 2QL9A 3NTLA 1BWRA 1GGKA 3Q9UA 2QBYA 3PL1A 5LXTA 1U4NA 1VSQA 5ALZA 4MULA 2GKGA 4FKZA 5DBIA 1JEQA 2E5LB 2ZCUA 1U1EA 2AZTA 4P54A 5AHOA 4YHBA 2JFWA 4JYPA 5DZSA 4RABA 3HBNA 1YTUA 2OK8A 3DV0B 1GUYA 3NEAA 3EIWA 3L04A 1FZTA 2JFBA 5K05A 2JRLA 2W43A 3I9KA 3MWDB 3RR2A 3OCZA 4AKGA 1KJIA 1BCSB 2Y99A 2V7TA 3FKSD 3AERA 2QLMA 5TGTA 3ZTWA 1UT5A 2F55A 1V3UA 1Z5GA 3MB5A 4GVPA 6NULA 2IOFA 2PRZA 2XWSA 5BOVA 2DFKB 2HSDA 1B4DA 2WA1A 4C4AA 3WRYA 2ORVA 5JMPA 3OCUA 4LHSA 1H4VB 2EL9A 4L3WA 4PC2A 2V7QD 1N1EA 3D6JA 4H2DA 2HMUA 3TRHA 4GXQA 3ZW9A 2A0YA 1DUVG 5SZIA 4F8YA 4RTNA 5C1IA 2C58A 1ULHA 1M2HA 4X62B 1B43A 3R7DA 3T5TA 5KYXA 1ZD8A 4N6NA 3HDYA 1RJ9B 3E22B 4FCVA 2J3IA 1CS4C 2O4CA 3OWOA 3F74A 2VKQA 2JZCA 1J9EA 4LDPA 2RAFA 2XBUA 3LL4A 1JIKA 2DFDA 1EFTA 1XX6A 1AHIA 2D00A 4C07A 1WEKA 2PH5A 2QE6A 2VJOA 3JS5A 4M8IA 1J42A 4CL2A 3WGVA 4HDNB 4DB4A 3C15C 3NFYA 3P0EA 4A82A 5HJEA 3HKBB 1M66A 2GT1A 2R85A 1VG8A 1ST2A 1R0YA 3AY3A 2IJGX 2H1IA 4OK5A 1APBA 1LF5A 3L7KA 3OI7A 1E9EA 5AVSA 3P5BA 2VJCA 3NM6B 3KK0A 3PBKA 5FNVA 3OZ7A 1NW5A 3BIXA 2QRVB 2E4YA 2XITA 2H92A 3OU2A 4FIDA 2J6IA 3E9EA 2AGVA 4GRAA 3TXYA 5IW8A 1E92A 1G18A 1JZSA 1IDOA 1KEVA 1LLCA 2R87A 3A6FA 3AW9A 5FOUA 4BGEA 5JCZA 4M9RA 2C00A 1AU9A 1SULA 5HKKD 2CLMB 1XP8A 3HKCA 1T1EA 2PN1A 5E2BA 3O8CA 3L1IA 1U8EA 3KWJA 1X1CA 2SICE 4Z49A 3AFGA 3AKEA 4GYYA 1UDWA 1VFPA 2G1KA 1J2TA 3DVAB 2O59A 5FTKA 1HA3A 4PPYA 4LYEA 4TXHA 4LOHA 4PS1A 2HIHA 3TAUA 1XDZA 2FW1A 3H99A 1ZESA 2B78A 5F9MA 3MGBA 1D5WA 3N7TA 4F5WA 3RS7A 1KE1A 1Z08A 1ND6A 1UC4B 1U80A 2FW8A 1Z0SA 1YJ5A 1BE6A 1FFCA 2ZREA 1L4NA 4ZDJA 3MUFA 1Y42X 3T54A 5J4KA 4KPEC 3WWDA 1U7TA 3RADC 2O0HA 1UQUA 3RFVA 1VFNA 1DRUA 3I2YX 1ZD9A 3M82A 5TQ0B 3UNXA 3ZCUA 3ZNPA 2VP5A 4TYQA 2C31A 5IKPA 1RIIA 3HYRA 4X3PA 3LQYA 3RS4A 3FVQA 1RMQA 3O82A 4DMKA 4XASA 4CMAA 3GLVA 1QHIA 5EJ4A 4JLDA 5E2IA 4UXJA 1YJBA 5E1DA 2PQ6A 4L5YA 4EFNA 1ZCAA 3W5HA 4N0DA 5LB4A 2GEUA 5HIMA 4HWTA 1K86A 1BFUA 1Q74A 1I6LA 3L7OA 1W9HA 3L8DA 4IR7A 4YS6A 4D81A 2XHEA 5CX1A 5IXYA 1X77A 1U8TA 2M1XA 1I5RA 2ZYWX 1JKFA 5D85A 2GHTA 4R3WA 2FEXA 5EWLA 2HIAA 3FGNA 2CB0A 4XGQA 1FFEA 2IGTA 4TTQA 4U8GA 3QFSA 3D6TB 4OB6A 3UHPA 1B6SA 1C4OA 1YZTA 2CKMA 2AFHE 2EYQA 2P6MA 2XVXA 2F8LA 3I6MA 1HTWA 2PKRA 4DCUA 4D9FA 3MRVA 3MBKA 1MKYA 4QGAA 1NVVQ 1Z0JA 3K15A 4XCQA 5JCOC 4ZCTA 4K1LA 5ULLA 2PAAA 3MHTA 3B1YA 1PLLA 2DPYA 1Z63A 4MUKA 5JISA 4TRRA 2WTBA 3GUYA 3IPRA 3P2MA 2Y1KA 4B6QA 1J24A 3TZLA 3AJDA 2SKDA 1KI4A 1N6PA 3IPCA 4HNQA 1S2GA 4QPPA 1BWSA 3OTOB 3OF2A 4LXUA 3FH0A 2V3CC 3T7TA 4WFJA 1A4RA 2ZUWA 5BR4A 3LIPA 2D1YA 2QTMA 5JY6A 4AIIA 4DM4A 3O74A 4QXAA 2A1IA 4IL5A 4DCTA 4DZRA 3KKZA 2AG8A 1Z6GA 3PUHA 1WBDA 5CU7A 4KPYA 1CIPA 3L4KA 2C59A 3E27A 4IV8A 5GAJA 2J3EA 3A9WA 1M1UA 2WUFA 1QKJA 4KE9A 3GBVA 1ECGA 3FCUB 4E08A 4UFOA 3NYRA 4B34A 3KQHA 1O7JA 1THGA 2EC5A 4HDAA 4O25A 1SA0B 2CVHA 3T7RA 1Z4OA 3B6EA 2P77A 2I33A 4HYYA 3ME5A 2VYCA 1HORA 1VL1A 2ZCJA 4LSZA 1BRMA 1K97A 1B8VA 3IDOA 2O07A 4BU1A 1IPHA 1RJGA 4QXMA 3PVCA 1XBTA 2QG4A 5FPHA 1ZRNA 4CKEA 1KI2A 1SVWA 4JX9A 1W25A 3DD5A 3SR0A 4AULA 2IZ5A 3QWBA 3KEFA 5FBKA 2Q6TA 3C24A 2QV7A 2QXTA 3BS4A 1XQVA 1H0KA 4DHWA 2WUDA 1HBJA 4KQJA 1RI5A 3L9WA 1REQA 4LWPA 3KZOA 4YDHB 4EGCB 4FBMA 3X3HA 5JASA 3LSYA 5CH3A 3GNQA 4I5IA 3WSVA 4ZMBA 1SC6A 4G0YA 4QQKA 5EMJA 1K8ZB 2B4QA 2DHDA 2PSEA 5AW5A 5DN6D 1HV8A 2NLOA 4Q1CA 1DAMA 1KK1A 3M4ZA 3OLXA 4JKOA 3H1PA 1GDDA 4Y2PA 2PFSA 4DDWA 1QGUB 4PTYA 3R3WA 1JFSA 4E12A 1JSXA 1RRGA 5BP7A 2ZYTX 4YR9A 3FI9A 1N0WA 3P71T 5LKRA 1D1TA 3CLTD 3Q1KA 1QFYA 2G5GX 1LDNA 1Z25A 2JGKA 1YONA 2Y1CA 3EDMA 4LVNA 5CYFA 3SLGA 5BR8B 1XRSB 2ZBRA 4CM9D 1MU0A 3DE6X 4IXDA 5FWNA 3HBJA 1P0FA 1UMKA 3QKRB 4ZREA 3TOSA 1O97D 1VL8A 3UTDA 4LF5B 1XMSA 1M1ZA 3A1SA 3MN1A 5E7QA 2VJBA 2MSLA 2GWRA 4X0EA 1PK8A 1GGNA 4G5GA 4C0XA 2QDXA 2ZP1A 3AMVA 4X7MA 1E3DA 1M1NA 2J9FA 5ALIA 4B44A 3U39A 3RARA 1X94A 4B6GA 1U8ZA 3CLKA 5JHHB 3TZEA 3V2HA 3LJKA 1CZKA 3CO5A 1E58A 5ECYA 5JYCA 3Q2KA 2F00A 4YJ3F 3TXAA 1BHSA 1NYTA 1RLJA 3LDGA 5I4BA 1PVOA 5CLFA 1XAHA 2L18A 1H6CA 2FDXA 1CUJA 4X20B 1MJ5A 5CLGA 4HAYA 3V7YA 2GAOA 3BWYA 4IQ0A 4F1WA 1E1QD 4NOMA 2WJWA 1QAOA 3KJFA 1QHHA 2BSXA 3AVTA 5BXQC 3ZDRA 4G81A 1J07A 3CW8X 1N2CE 4LC9A 1KI1A 3I72A 5ELMA 3B6MA 4L0MA 4CNQA 3RFUA 3B1FA 1NE2A 2XRYA 1ZMXA 3OOSA 5FIUA 3FG9A 1BWPA 1QZXA 2WM9B 3WGOA 2EIXA 2YWJA 2JFPA 3R3YA 3NBUA 1TYDE 2PXCA 2XNCA 3DMFA 3PQ4A 5GMOA 4LGCA 3TLGB 4DEXA 1H85A 1K8QA 2EW1A 2X1HA 4KDEA 4E5KA 4ETIA 1EUQA 4XD2A 3WAKA 4FGZA 3KB2A 4YCCA 1DEKA 3IDQA 1ISFA 3TCKA 3KXPA 4O1HA 5BSRA 3ZBPA 3OWXA 4YRTA 4JGGA 2A78A 3OCYA 2WMDA 3GH1A 2QVLA 3UJCA 1GDHA 4OAOA 4B84A 1XA0A 2QD5A 1MXFA 2AVNA 3L7YA 1LZLA 3T1QA 3WKCA 4HVLA 1N1MA 2YWDA 4IGEA 2E87A 4GZLA 3MINA 4C1NA 2QUZA 2VA8A 3U7QA 1DP4A 5J4VA 1V2GA 2PZEA 3UIEA 5HG0A 2ACVA 2V0CA 4IH4A 2NO4A 4RVSA 2GOYA 4MS3B 2NU6B 2BHLA 2PVPA 4X84A 5J2TB 1YUBA 4N3BA 3H5WA 4F97A 3MEQA 2Q29A 1DX4A 3HUTA 4A0GA 4UHHA 2V98A 5DSTA 4CIAA 3LKZA 4BO0A 1GDTA 1F06A 4KZPA 2WHXA 4OGWA 2J9XB 3PFBA 3OJCA 4G1VA 1NUQA 2AEJA 1CRQA 4PO3X 4PLFA 2XQFA 4HEA1 4ZVVA 3FY4A 2H4YA 4HSGA 5CFOA 1NRWA 1XP5A 2FN3A 2Q4OA 1KO7A 3TD2A 1QIKA 2WU8A 4ASUA 2A57A 4NV1A 2DUJA 1JEYB 1H66A 5FA5A 3ZHQA 5JH7B 4Z4IA 5HILA 1NYLA 4AZTA 3MERA 3WGHA 1TJ4A 1J7JA 4O2RA 4QBIA 4LNUB 4BP9A 9ABPA 5EUBA 2R8XA 2FGKA 1J8FA 3HDJA 5C52B 1MJHA 1CVIA 3GN1A 2IXGA 4K81B 4RGQA 1RDFA 5EZQA 2W90A 1SB9A 1V48A 2C8JA 3AVUA 5CB4B 3NKFA 1WUYA 4RY9A 3A2LA 2WG2A 2BE7A 2PL5A 3DFZA 4G09A 3FXAA 3GVPA 4PXAA 1X7WB 2F1IA 2D59A 4Q1BA 4PG4A 4JA2A 1TL7C 2K4MA 3PEFA 1EE1A 3QQPA 3EWIA 5B5SA 2V45A 4JUAA 5JAUA 4YP5A 3HCBA 5BT9A 2Z43A 2ISCA 5FWYB 3OFND 4L5AA 5AW1A 2RHWA 4IIBA 4OG2A 4HH1A 1UJMA 1D0SA 4MQBA 1C7IA 1KDTA 3ND5A 1QRSA 5EIBD 1PNVA 1TQ4A 2C77A 4L4RA 5DHRA 2O23A 1YUMA 3N5KA 5A4JA 4KR2A 1RTTA 3NVKI 1ZISA 2AHOA 1Y33E 4DL9A 3MD0A 1ABFA 5SY6A 1U8CB 4JIMA 5IUKC 4ZI7B 2FZCA 1Q92A 2BAGA 1YR6A 3LZDA 4NTZA 3I5YA 2Q0SA 1JT2A 1POWA 3U4GA 2QGNA 5H9VA 1Y4SA 4HGRA 2XUKA 5DIFA 5EE0A 1EA5A 1MQ8B 1T26A 1Y3DE 4M9XA 4WFQA 1RSZA 3MJCA 3KQKA 5EHNA 3AVYA 3LBIA 4TQ9A 4AUNA 4UUBA 1VB5A 1ETHA 1U2DC 3KX2A 1IOZA 1K7XB 4RLFA 2WWFA 1SQ6A 4QBTA 2MTBA 1W4ZA 4YI5A 3CNQS 4OLBA 3AWIA 1SHKA 4HK4A 1XA4A 3DOFA 3JPWA 1H2XA 4N5IX 3HM9A 8ATCA 3FWPA 3INYA 2Q4BA 4F46A 5CG1A 3HXLA 1N9GA 3AKCA 3DFUA 5L3QA 1HZZC 2Y1DA 4O3FA 3M5WA 1WDWB 2C9BA 2HTEA 3C3AA 4WMLA 5EGNA 3VR0A 3FHLA 4DZZA 5FDFA 4G1FA 1KMMA 3PNKA 3WRVA 1V43A 2CLKB 3OJFA 2SCUB 3HZHA 4H59A 1JAHA 2J45A 4MQ4A 4XXHA 1ZONA 2PBRA 4BB6A 1K0UA 3EQ7A 3JZIA 4U6QA 5DWDA 1T15A 4B3RB 2PLAA 1I33A 2D1FA 2B5OA 4C01A 2P0AA 4UAUA 5DPMA 1NXQA 2Y1EA 4JI7B 4IRXA 3OQBA 1T9GR 4GX5A 2QJTA 1QH1B 4KXQA 3KFXA 4R1OA 5F2OA 4D80A 1PJLA 2XOXA 1I9CA 1R4ZA 2BFWA 2IVFA 3M6XA 4Y2TA 4FB5A 5FI5A 4N3AA 2WE8A 2XGMA 5FADA 2G6TA 3CKKA 4Q9NA 1QHGA 1DQNA 2WVAA 3G79A 3AFIA 3C6BA 4GG1A 4HADA 2XE4A 4JOCA 3L6BA 4P80A 1YS1X 2FMXA 4H6PA 1G64A 3B2NA 1XTBA 3M83A 3EFBA 4AJNA 3GRKA 4MWZA 4MWCA 3PB3A 5FQOA 5CA1F 4EI9A 4KR0A 3TJMA 2DH6A 4HDOB 3KRTA 1BVHA 3SQLA 4PBRA 4D6YA 3V7NA 3QA9A 5KPJA 4MEAA 2O8BB 1WUKS 1T3SA 2VCEA 1RLTA 2IXBA 2CLOB 4X1YA 5C8YF 4GLLA 1JDVA 1TEZA 1Z2DA 3PQDA 3H84A 2OFXA 4D7AA 5JSFA 2HU8A 2WWWA 4AL4A 2HQBA 5K20A 3FYDA 5HQTA 4IWYA 3AGQA 4MPJA 3U31A 4B76A 2P78A 5DISB 2CV0A 3ZC3A 5EIFA 2HHAA 4FLEA 5K6AA 5DYTA 4WEQA 3SIXA 4A6XA 4LOLA 2KMLA 5EJAA 4QOFA 2BR4A 3EXEB 4A8JA 1EX9A 4F06A 1NP7A 3Q3IA 3TWOA 3TSZA 4C7BA 3I23A 1A71A 2AWOA 1SVMA 2JHGA 4TMZA 1L5KA 3CLRC 4AY5A 1FMTA 3IOYA 4KWHA 5ALHA 1IOLA 5JANA 3G2MA 4BNFA 4AI6A 5JNVA 5A4DA 3WAGA 4UW9A 1E1RD 4X00A 3VNSA 3GLFA 2AIRA 2DBZA 2IUSA 2WFZA 5EERA 3GFPA 3S8MA 3KJQA 5EJ2A 3CZAA 3IPAA 1NE7A 1W49A 4D9NA 3DZJA 2DR3A 4R1UA 3QVWA 3EXFB 3K9FC 4WH0A 2HQOA 3ZI7A 3HDGA 2C4NA 4Z99A 4QODA 3C1AA 1RRVA 1YCGA 4YVFA 3R09A 2WE7A 1CZHA 2ODEA 5TXGA 1YKGA 4RVUA 1E6CA 3H75A 4QM6A 3BM5A 3GFTA 3FZNA 4NMLA 2QR5A 1SY7A 4FMDB 1UKYA 3ICOA 4N5MA 3HCAA 1MO5A 4NJOA 4KWEA 1V47A 2OXRA 1I3CA 4H4CA 1D1PA 4I4NA 1NVXQ 2EZ8A 3Q8XB 2ZTSA 5TSDA 4YLYA 1I2MA 4ZO7A 3G2NA 421PA 4AMGA 4CL8A 3JQFA 4HLCA 5HM6A 5BVHB 3MWGA 2DQKA 5AHWA 2BKVA 5KNBD 3GJ6A 3FUXA 2F9MA 3GY0A 4OHOA 3E9CA 3EC1A 4G9BA 4DJFC 2O7QA 2SECE 1GSAA 4EZIA 2BGKA 1C1XB 3B6KA 4IHJA 1K66A 2PKWA 5BSFA 3QMVA 1UFVA 4LXQA 1ZM7A 3HA2A 3W78A 1XTSA 3RSHA 1CY6A 3KJEA 1JR3D 3F46A 2QN6A 2NPIA 3FPKA 4KRFA 4JT2A 3A1WA 2FMUA 1F48A 1YL6A 1N1DA 3OT5A 3N53A 3AI2A 5K4GA 3TQTA 1R5BA 4OXYA 2GJAA 3BMCB 2ZYUX 4QUJA 3ZGZA 1RI3A 3KQMA 4FMBB 4JROA 3LHFA 4TQUS 4FDUA 1TM4E 1ARZA 2VSFA 2JVKA 4IFIA 4XQ9A 4BNUA 2ORWA 1S1MA 2GFHA 2P2ZA 3HUEA 3PEVA 4HAIA 2FZVA 3PA8A 4U2KA 2XX3A 1FS4A 2ZDHA 4K8RB 2BFPA 1P75A 4AKSA 2F6RA 1D8AA 3GVCA 4L5JA 3GMTA 2JARA 1TF5A 2G72A 4HQNA 4LY6A 3IVMA 3O8DA 5CDFA 5JXHA 1MB0A 2AFHB 1KZ9A 1H23A 3AR8A 3OPXA 3ZVKA 4ZWNA 1RR6A 1GKLA 2KSQA 4L6AA 1VPEA 3ETNA 3DBHB 4MLZA 4P4TA 3RYFB 1J09A 1BFKA 3O7MA 1G8YA 3LWZA 2ZBGA 2O48X 121PA 5EIAA 2YC4C 1Y1PA 3R0ZA 4I1SA 2CWDA 5J5VA 3IP7A 3NAZA 3PS9A 3L8YA 3OOEA 4MX8A 5K0ZA 2PEZA 2FZ4A 2NQTA 2WTNA 1PK7A 3JARB 1HDZA 2XB6A 3I83A 5TE9A 5DOZA 1FP7A 1QQ5A 1RNLA 3LOUA 3EGXA 3PXDA 4TL9A 1QYDA 5IP5A 1TAUA 1A4IA 1F8GA 3V46A 2ZCVA 1KR2A 2P40A 8LDHA 1VMEA 4PLPA 3PT5A 2HPHA 2UVPA 1C4XA 2OQ2A 4KO4S 4QLAA 1TI7A 4QREA 1E79D 1XHFA 3E70C 1UMCA 1ECBA 2B35A 2PIDA 1DEOA 3VO9A 5C1PA 5EIBC 3T5CA 1G59A 3HSYA 2DPHA 1NLYA 5DV9A 3FOWA 4LISA 3VHXA 4ERNA 1J1ZA 1JYFA 4XWYA 2WT4A 4OO3A 4V3CA 2ECOA 1U99A 5IAAA 1M8JA 2C8KA 1Y5RA 1B2LA 2X58A 2YJGA 3RVQA 5EVCA 2HV9A 2IUEA 2XE7A 2VQSA 3GGJA 4GX0A 4W63A 2PTGA 2JANA 4DCJA 4LMAA 2ZIXB 3GA7A 1RC0A 1GAJA 4L2IB 3CB2A 3HDQA 3HJBA 2O8EA 1ORHA 4GXTA 1FQJA 4LRXA 4MW7A 1Y8RA 2YKGA 1AK1A 2FSVC 2I4NA 1C50A 4PWZA 5HIKA 4GOJA 1DIGA 2EWMA 1TVMA 4IDHA 5KINB 3ICEA 1OAOA 2HZ7A 3QQ5A 1R0ZA 3WYAA 2PZJA 1HYEA 1W6RA 3H11B 2GPWA 3CEMA 1SHZA 2G0NA 4WZBE 5L95A 2BCGY 3AT1A 4I14A 2F3UA 1SUFA 1OOEA 5H4GA 1PTJC 2IIQA 4INOA 4NYJR 1H8HD 2ICAA 3C5EA 5C18A 2PUEA 4Z9BA 1FY2A 2O0JA 4BVHA 1SXPA 1CEXA 5J58A 1S8AA 3P9PA 3M70A 3H0KA 4K0RA 2HWYA 4GP7A 1K27A 1VG9B 2IDZA 4ND2A 3SBXA 1DOZA 4OHWA 4MRSA 1TKRA 3O9VA 1MZVA 1ES9A 1OFHA 5HNKA 3U48A 1BDJA 4BLRA 5BV0A 1NBWB 1U98A 4CCYB 3W77A 4PZDA 1NYRA 1JXOA 5HF6A 1SKAA 1ZIDA 3DL0A 1SD5A 1EM8B 4CKCA 3F6YA 4LI3X 2R1UA 3WB2A 3G0IA 3L8GA 1ESDA 2JNWA 3FI0A 4GOND 4DJAA 1A98A 2J08A 2Q2OA 1IN4A 2ZRMA 1HH4A 1YR7A 2DQYA 2TRSB 3L01A 3H6GA 3R77A 4FE7A 2XUAA 3MSXA 1V1MB 4B7AA 4HWKA 3T3IA 1KFJB 1QM5A 1Q12A 3L8MA 1KPHA 4HNAA 1VPVA 3BMQB 2GBLA 2GESA 3GLIE 5JZBA 1AZLA 2OFWA 1SPXA 3FPLA 4QPJC 1HXHA 3I8SA 5MFZA 1NQUA 2QQFA 3GEBA 1J56A 5EJEA 2NVWA 3VU0A 2W2KB 3L1VA 4Q3KA 4UNRA 4KI7A 3I92A 4HWPA 2JS7A 3IALA 2GF2A 3VR6D 1SUAA 2WP8J 5LIRA 4HKTA 3ANXA 1QG2A 1HZJA 4UASA 3RW9A 2C9MA 4J0JA 2WHPA 2YINC 3NI2A 4HWRA 1MNQA 2ST1A 721PA 1YL5A 1UOEA 4RY8A 4UHBA 4A8HA 2I34A 1X7GA 2R00A 3R3UA 4OGKA 2D0DA 1DKNA 1FFAA 1KSJA 4NF2A 4CUZA 3K9WA 4ED9A 1P1BA 4Z51A 3EQ6A 5JPDA 3SWWA 2NU9A 3B5IA 1VKJA 3TNFA 1EX1A 2ODWA 3KZCA 1XIVA 2J3KA 2B4RO 2Q6LA 1CQIB 3MIIA 3C7AA 3C8HA 3MLEA 3Q7RA 3S2FA 7ADHA 4I1UA 4ZZ1A 3ZYZA 1GRQA 4GYKA 5AVXA 3UH1A 3BRWA 1QG6A 2HW8A 5JNLA 1I2CA 2EJWA 3TLBA 2Q4TA 3M3HA 2H4FA 1QP8A 5H1YA 3AESA 5IJZA 3DEJA 5JXIA 5TJHA 4RSMA 5IHPA 1X1EA 4BRZA 4IY1A 4FFBB 1X9GA 2KYRA 3L7DA 1Z26A 4J1SA 3DXXA 4TLBA 4Y9RA 1NWCA 2IPMA 1ZK3A 4PNZA 4HAXA 1ZO8A 2G9NA 3RVSA 4L5CA 1PR4A 5DXJA 2AKEA 1FX1A 1JR3E 3BGSA 5IARA 3U9LA 3E3LA 3SDBA 2Y1WA 4LBYA 4K6HA 3TLYA 4F5ZA 5F2KA 3GG9A 1IPEA 3RC7A 4RV4A 3DWGA 1U5CA 1F0NA 2WNSA 2XHZA 3M3PA 4B6PA 2Q3JA 3W5JA 5K0FA 4IWXA 2BD0A 1OLXA 3KL2A 3PICA 3DBIA 1W4AA 3VA7A 4IOLA 5CIQA 2BFFA 4OHKA 3OTIA 3FHJA 3H5LA 5F7OA 2BKAA 4KR6A 1PBNA 2XSZD 2KJQA 1B0ZA 4RMNA 1BEEA 5ECGC 5GJCA 3BTVA 3NBFA 1EQAA 2HA2A 2Q3FA 4P4UA 3SZLA 3A27A 1SVKA 3PC7A 4PPGA 3C6QA 2HJHA 3T35A 1OWNA 5CDSA 3LYAA 5FQNA 5I5EA 2CZQA 2QK4A 3Q5EA 2B2CA 5JZ9A 1XVVA 2ZJ1A 1ML3A 4Z3KA 3KTAB 4CU5A 5BWMA 3C1TA 3RREA 2EAUA 1VJDA 3WNVA 5IFKA 5EKTA 5F5XA 3TK1A 4CM8A 2XCOA 4C04A 2ZTUA 1RXWA 3MTIA 4N3CA 1YFKA 3D4LA 2QE7A 1V7PC 2IEAA 4OREX 5CJPA 2QPTA 1G21E 3BXEA 3SYMA 1LPNA 1WWKA 1SGWA 4ZRMA 4YRRA 3UC9A 5TB5A 3TB6A 1GR0A 1NKTA 4KPFC 3A4VA 5SYAA 2A5YB 2CLCX 2ECKA 3AF0A 4B4WA 1MOPA 3G5AA 2XMPA 4S05A 2IY7A 4BVGA 4J3FA 4EOGA 3LGSA 3I42A 2WI8A 3VAZA 3TEFA 3CURA 2G28A 3OAAA 1NMSA 4ZVMA 3WK4A 3WMEA 3HCRA 3ZE7A 2WTMA 1GPDG 1Z4JA 5TF0A 4QDXA 3HFGA 2FPXA 1G6KA 3MELA 5A0TA 4TV8F