1ZNXA

Crystal structure of mycobacterium tuberculosis guanylate kinase in complex with gmp
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
182
structure length
182
Chain Sequence
b'VGRVVVLSGPSAVGKSTVVRCLRERIPNLHFSVSATTRAPRPGEVDGVDYHFIDPTRFQQLIDQGELLEWAEIHGGLHRSGTLAQPVRAAAATGVPVLIEVDLAGARAIKKTMPEAVTVFLAPPSWQDLQARLIGRGTETADVIQRRLDTARIELAAQGDFDKVVVNRRLESACAELVSLLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanylate kinase
publication title Unique GMP-binding site in Mycobacterium tuberculosis guanosine monophosphate kinase
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 53
structure length 182
sequence length 182
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2005-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 1znxA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1znxA01
1RC8A 2EU8A 3K53A 1VCMA 3FMPB 3SI7A 5TY0A 4D0NA 5AJVB 3KJHA 1T6NA 1T8TA 2BJVA 3NTUA 3K9GA 3CWQA 2R65A 4R9UC 3H0KA 3U3OA 1EFHA 1NJGA 1XZQA 2ZS9A 3IBGA 4CRWB 3BRWD 1G6HA 4KCGA 4EPRA 3VX3A 3U60B 2GCOB 1COWD 1WQ1R 1Y3AA 4HAZA 5FI1B 5AR1A 4GOKA 4KJZA 5ANRB 4IDQA 3FHTA 2ZQ5A 3NG1A 4BZPA 2GJKA 1E32A 5KDLA 3VNUA 1G64A 2ZR7A 2ZRIA 3AF4A 3HR8A 4EPXA 3RS3A 1NIJA 4JLJA 4OI1A 4ASUD 4B3BA 1OH7A 4G0NA 5FOUA 3I72A 4JBYA 4OHVA 2ZE6A 4DLXA 3GEHA 2PLFA 5H8WA 4IFBA 1JXMA 1ETUA 4Q9KA 3IGFA 1GRNA 3LQQA 3L43A 4DJTA 2QZ4A 1LS6A 1R8QA 2DFTA 2JAQA 4UJ3A 1Z0KA 4QGHA 1WE2A 3QE0A 1XB2A 4Q48A 2OHFA 3UPUA 1YZKA 4Z54A 4GFDA 5FR2A 4DSOA 2QENA 3J81k 2H92A 1U0JA 4GL2A 3K8YA 2CNWA 1TF5A 3CPJB 3IUYA 2QT1A 3A1UA 2G9NA 4QJ5A 2G6BA 4Q00A 4PTLA 3P4YA 3UG7A 1NJFA 1ZM4A 3ICEA 4Q4HB 4D2IA 2YWHA 2YHSA 2Q3HA 3RNLA 3OAAD 4JLBA 1PZNA 1XEWX 5B58C 3LH5A 2ZYVX 4NCHA 1HTWA 1HH4A 2ZYWX 5C46F 2J59A 2G83A 1E9BA 1ZBDA 3TQFA 1EK0A 1U9IA 5EXTA 1EFUA 3X1ZA 1NKSA 1KMHB 3BORA 2W6JD 5B64A 1GZSA 3C5HA 4NCJA 4TN1A 3A4MA 3E2IA 4DLSA 4JSYA 1XEXA 2WICA 1NSTA 3U5ZB 2OBNA 2DB3A 2ZXUA 4L16A 1HUQA 1LS1A 3DKVA 2WAYA 4QNMA 1IN6A 4UNNA 2OCYC 2WIAA 4BZXA 2VP0A 2GNOA 2XGJA 4FCVA 3MWYW 4EAQA 4JS0A 4LX0A 4QL3A 4LBZA 4BECA 1A82A 2J0UB 2ODWA 3O47A 5JI3E 4X8MA 3PENA 4Z51A 3VR5A 5BYJA 4JJZA 3ASZA 4NYIR 1IY0A 5L3QA 1KZ7B 3V4FA 2QSYA 2IW3A 1W0KA 1OV4A 2BBWA 2A9KA 2D74A 4PC2A 1FX0B 3QKRB 1OB5A 3G82C 2WOOA 4DCNA 2HJGA 4MYTA 3TQCA 1HE8B 2ZVQX 3RAPR 5FTLA 2BIFA 3GLIA 5F3WB 5DNYB 2O8BB 5G40A 1F2UB 4TLCA 3THYB 2YWEA 4JYBA 4URVR 4EPYA 1DARA 3KFVA 4IDHA 1XPRA 2JLWA 1DADA 4TMKA 1U2RA 2YOFA 4JYCA 1UPTA 2KE5A 5EUMA 3AKEA 2RAPA 1KK3A 3RRYA 2R6CA 2HF8A 2QRZA 1OPXA 3ZVRA 3NXSA 2Z0MA 3L0PA 4LBWA 4M22A 1AN0A 3ZS9A 5K8IA 1JEDA 4RCYA 1KNQA 3GLGE 2LKCA 3VR2A 4MUBA 1WCV1 5JZVA 1R7RA 1AGRA 3B1XA 4ZCLA 1JQLB 4RKFA 3UWOA 1GITA 2H1LA 3GMTA 3M4YA 4Q66C 1L8QA 3R20A 3A1SA 5JBQA 2CNWD 1P60A 2YWFA 1OH5A 1FFHA 1UEJA 2V8OA 1RPZA 3EC1A 4CEHA 3DZDA 4NH0A 4A8JC 4IJMA 4OJQA 2QPAA 4MA4A 3CUEF 2X8AA 4MGKR 4ZO4A 2OV2A 1BIFA 4MKHA 4P3YA 4GP6A 2VSXA 2ZI7A 5AWFC 2RGNA 1A4RA 2GXQA 1IAQA 1YZQA 4TYQA 5EE1A 2XTZA 3QF4B 3I8XA 4IKEA 3RS5A 4QJ4A 5KNCA 2F1IA 3GJ0A 4M1TA 2WWWA 1ZUNB 2CXXA 3H86A 1NLYA 4K8OA 3EIEA 1KYIA 4A2PA 1W7AA 1GNPA 2O8FB 1EESA 1D9XA 1VMAA 1XP8A 4JSTA 5TMPA 3R9IA 1T4GA 2IYRA 4OK3A 2FFQA 2R6FA 3SR0A 1IN7A 1G5TA 2AWOA 2ZUBA 5E7IA 2Z4RA 4ZCIA 5JLJA 4E03A 3HJNA 1YZGA 1UBGA 1F2TA 1KO4A 1RRGA 3GEEA 4DLUA 3SYKA 4E5UA 1T0JB 1XZPA 4DCVA 2H18A 1ESNA 1UKVY 1W44A 3X2SA 2JLZA 5FPKA 2C9YA 4KBFA 1T9HA 1W0JD 2ZAOA 4V03A 4HI0E 1W0KD 4AYTA 1CU1A 1FUUA 2IUTA 5HE8A 1Z8FA 2ZJAA 3SBEA 2FDCA 2V6IA 3CRMA 3KL4A 3TGPA 1G6OA 3G5UA 1R0ZA 1R10A 2G0NA 5JEDA 2PT5A 3UANA 1ZUHA 1ZCBA 3RS7A 1S1CA 1E2EA 3TVDA 3DPUA 2JJ1A 2VHJA 1E2QA 2GF0A 3R9XA 3KFXA 3RABA 4P4UA 4BEBA 1WA5A 3OEHD 4JBWA 3KXLA 3W9YA 3DZ8A 3EZFA 2OAQ1 1A2KC 2P5SA 1XPOA 3PEYA 1CULC 1DBSA 1DEKA 1CR4A 1N5JA 2XOKD 2ZE5A 3N5CA 1R2QA 4V0NA 3WXMA 1ZM3A 5KSYA 2IS6A 1AJEA 1SVKA 1E79A 5KNDA 2KI5A 2I1QA 2ORIA 1CR0A 1XTQA 2X2FA 1X86B 5L3RA 3RSOA 4JLVA 2BM1A 4BFYA 1IN8A 1E6CA 2PLRA 3VKHA 3KXKA 3N2EA 5FI0B 1KI8A 3AP3A 2OCPA 1KO7A 1QZXA 2H57A 1LTQA 3EPLA 3KB2A 3ZLJA 3FOZA 1M34E 1RZ3A 5EP3A 3LA6A 3SBDA 1YZTA 1XD2B 3RRZA 2AXPA 4IEEA 2GEVA 2Q9AA 4FMBB 1X3SA 2VRWA 2CHVA 3BD9A 4TL6A 2HJVA 4XWKA 3CONA 2O8CA 5EP2A 1AM4D 2QMOA 3LBNA 1CJTC 2H7VA 1E1QA 2CK3A 2IL1A 4UNQA 3K0AB 4JKYA 2ZRDA 4DB2A 2OO7A 1OYWA 2J5XA 4EPWA 4B6EA 1J70A 2PMKA 1Z47A 3VR6A 1KNXA 2ZRNA 3AQ4A 5FL7A 1NVVQ 1G8YA 1VG0B 2VYFA 4PAMA 1ZC3A 5KO2A 1ZIOA 4S2EA 5EUQB 3NH9A 1KK1A 1XCPA 1XMJA 4JLMA 1F3OA 1LF0A 2V55B 2J0SA 1Q44A 1N6LA 5B2ZA 1OIWA 4HZUA 4NMMA 1VKJA 4Y0VA 2WMOB 5FH9A 2D4HA 3CRQA 1G3IA 3SE0A 3U61B 3U4QA 4IOJA 1CLUA 3RDPA 4RFSA 3T34A 4PQRA 1IOZA 2JCSA 1NN3A 1GG2A 4ARZB 1FTSA 1XPUA 2PX3A 3GLHA 2VTKA 2QQEA 2ZRMA 1JR6A 4LJYA 4MDFA 2ONKA 3T12A 5H68A 1KDRA 4ZPXA 4WVFA 2RGBA 1AA9A 4H9GA 3LD9A 2ZR9A 3CF6R 3M1IA 1T0HB 1SVSA 2HCJB 2ZM5A 2B92A 3CNLA 2ZTSA 4RVCA 3SZRA 2EFCB 2NOAA 1KHTA 4NYJQ 4ZIRA 3T5GA 4B71A 2WVJA 3MWLA 4EFMA 5M04A 3TW8B 1J7KA 1E98A 2JJ1D 3W3AA 4TTQA 4B2PA 1DS6A 2C99A 2FX3A 1Q20A 2F9MA 2OCBA 1HQYE 4BFXA 2CMKA 3X1YA 2AKYA 4OI4A 1U8AA 4LWZA 1OHHA 2CLSA 4MRVA 1N6NA 4LJ5A 3W3ZB 3LNCA 2PCLA 4OQFA 5FBRB 3T1OA 5TVKA 1FUKA 5IK2A 1E79D 3OE7A 4OI2A 3HWSA 4KODA 2X77A 2ZI9A 4HAXA 4QGAA 4CZ2A 3TR0A 4OHXA 4US0R 1E2IA 4YXWD 1UKZA 3KX2A 3BK7A 1OB2A 4G5SA 4RZXA 4LC0A 1TUEA 3MD0A 4QHSA 1KZGB 2QN6A 4DDUA 5FPSA 2O0HA 5C4GB 2FNAA 5E7MA 2CL6X 3FMFA 4KSBA 2QMEA 4JLOA 3U44A 2W2TA 1E1QD 2CK3D 4GNKA 3CPEA 2UKDA 4TYYA 1TQ2A 5AUPB 2HYIC 2EWWA 4LZZA 1XCGB 1ZC4A 4W5JA 1EX7A 4BASA 1MH1A 1ESMA 2VSFA 4TT3A 421PA 1S3GA 2W00A 3R9WA 5LDDC 3PEUA 5CK4A 4V0OA 4WBSA 3KKMA 3QJYA 5K8UA 2YKGA 4HUQB 4C7OA 5KDDA 5CM9C 2Q9CA 3SC3A 2C5LA 4BLRA 2P65A 4JVSB 4C0SA 1DAKA 4BE7B 1CJVC 3OF5A 1XJ0A 2ODNA 2HXYA 2GEDA 1YQTA 1ZU5A 2C2HA 4OK5A 4BFVA 5BN4A 4O0MA 1E0KA 1IN5A 2V4ZA 3QPWA 3BB4A 3MRSA 2WWIA 4A0GA 1NBME 3K70D 1AQUA 3REGA 1D6JA 3NC0C 4QOSA 3SYNA 4Q02A 3KUDA 2I4IA 3DMDA 2AL7A 4LV8B 2REOA 4PZLA 2ZANA 1S8FA 5FPYA 1YKSA 3THOA 2WJJA 4LHWA 2B21A 4M9XA 3PUYA 4J0QA 2N42A 2IXGA 2ANBA 1ZW6A 5IRCD 3GEIA 2XB4A 4MGIR 2PL3A 3RC3A 3L0OA 1Z07A 1MO4A 2NO6A 3WY9A 1HURA 2RGXA 5LPNA 1ZNZA 3A36A 4V0KA 4D4LA 4LYAA 1N6HA 1OXXK 3L8ZA 3X1WA 1U90A 1KSHA 2ZS8A 3WNBA 2RGNC 3ZZUA 3JZAA 5F9HA 1KI3A 4A2WA 1GL6A 1P62B 3SJZA 3QOFA 4B3CA 2ZREA 1P7CA 2F3TA 3VFDA 4NDZA 4TMZA 3PFIA 3WMFA 4Q7JB 4Q1EA 1OHHD 3QSYA 5HR5A 3AP1A 1FL9A 4GMXA 1PV4A 1XFAA 3KDSE 3NBFA 5IK2D 2CHQA 2O5VA 3OE7D 2PT7A 1SXJA 3U6KA 4M0LA 4RD4A 1YR7A 2FFHA 3B1VA 3CNOA 3DKPA 5JJIA 1DO2A 3HYTA 2H8KA 1QHSA 3QXSA 3R7WA 4AYXA 3AH8A 4A8JB 1KK0A 1QHHA 1OH6A 3AVYA 1IBRA 3HDTA 1AZTA 4FCWA 1VYVA 2ZSAA 1E9AA 5KUTA 2ZAMA 1A5TA 2DFNA 2QL6A 1UFQA 4M1MA 4DCTA 2IYSA 2CVHA 1YE8A 1CIPA 4TLAA 1JECA 4DEYA 1W5TA 1T3SA 5G3ZA 2ZI5A 4CW7A 2ZJ8A 4RCZA 1OXUA 3RVBA 4D81A 4DZZA 4C2UA 2RGEA 4DT1B 3PEVA 3FE2A 3AEZA 1CEEA 5HKKA 4TT3D 4WXRA 2Q9BA 2VF8A 4A6XA 2QPTA 1G3MA 1CJUC 2IC5A 1FTNA 4PHTA 5G53C 1AS3A 4LBVA 4JMPA 4TWZA 3SU8A 4A6PA 3W6OA 2JATA 2CE2X 2OFXA 2X1VA 2WWXA 2OLJA 1II8B 4KU4A 3P32A 1M7BA 2BJWA 3X1XA 3D8BA 4ON9A 3AF3A 2OEPA 1DOAA 2NMVA 3VKGA 3Q3JB 1KKLA 3QKUA 1I4DD 1P2SA 3NVAA 4XWOA 2GZHA 2OESA 4PHGA 4G01B 1U94A 1NVXQ 4OQNA 2IUUA 3T06B 3ICQB 3NHAA 2WM9B 2F3RA 2FE4A 3EIQA 2NTYC 2WZQA 3P1JA 4LYJA 4HATA 3L0SA 3AKYA 1F6BA 3CIOA 4XWAA 3WHKA 1W4RA 3BB1A 1BYUA 3K0SA 3FDIA 4Q7MB 3F0TA 4M9ZA 4E09A 4QJ3A 3LQRA 2G1JA 3A4LA 2O8DA 1RFLA 2FA9A 4GT1A 4PPFA 1AQYA 2F7SA 2DCUA 2G77B 3TVTA 4B2LA 4BEJA 1YRBA 3CWZA 1Z0IA 1JAIA 2OG2A 1O3YA 1HA3A 3RANA 1E99A 2OBMA 4URWR 4C0AC 3R8CA 2PJRA 1RJ9A 2NPIA 4JIMA 5EZ5A 1G21E 1II0A 1PLJA 2ZUCA 2RGDA 4LYFA 1T8UA 3THWA 5D3MB 4QXAA 3Q7PA 2WBLC 1PUIA 4QFMA 2G0TA 3TKLA 1ZM2A 4AG5A 2PEZA 4L4UA 4C4PA 2MSCB 1E3MA 4ACBA 2R44A 2JJ8A 5BWMA 2QBYA 3ZGXA 3A58B 3FMIA 2VEDA 3KQLA 3VHLB 3K70C 2QI9C 4DUGA 1SXJD 1GFIA 4A0FA 2AN9A 1U0HC 3CX7A 3GJ8A 4FD2A 3T61A 4LRWA 1XTRA 4LBYA 5KNBA 1WB9A 2ZSEA 2ZRCA 2D7DA 3BFXA 1XXHA 2QU8A 4M1SA 5J4LA 1VCNA 3ADDA 1S2MA 4P4SA 4R71A 3O8DA 4HDOB 4MKGA 4B3DA 1GL9B 2P67A 2QORA 2IUSA 2QAJA 4WOPA 2J1LA 3ZD7A 4TSFD 2B7BA 2GJ9A 2KB0A 2Z43A 4ILEA 3KZ1E 1QHNA 4L5BA 2HF9A 4B44A 2HLDA 1CR2A 1QBKC 5HKKD 3NEJA 3DDCA 4LJ9A 2WWHA 3ZS8A 3AP2A 4DEXA 1JR3A 1U99A 2EFHB 4NCNA 4LSGA 2IS4A 2XITA 1I4TD 4LI0A 5EP1A 1D2EA 2YV5A 4QG7A 2AK3A 3QKSA 2J7PA 1VHLA 4DIDA 3BERA 1E94E 2C9OA 4OHYA 2AFHE 2ZJ5A 3NBZC 5FUYA 1J8YF 2YZ2A 1NBMD 3GLFA 1MABB 4IVPA 1T3HA 5FOWA 2ZETA 1Q3TA 2C77A 4BGDA 1E9RA 2VPPA 2QAGA 1R8SA 1GKIA 2WOJA 4P33A 3BH0A 4CEJA 2VL7A 2GK6A 3KQUA 2FSFA 3AF1A 4P4TA 5FOSA 3QIAA 4H1UA 2F43B 3LBHA 4Q4AA 2MSDB 4IHQA 4URUR 3K0CA 1CRQA 3QY0A 4DSUA 5BN3A 5HCIA 3AUXA 3B1ZA 1K5GA 4PX9A 3QVVA 4G1UC 3C15C 3OIVA 5L8VA 2VBCA 4PSAA 3TLXA 4G3XA 4PQFA 4Q1FA 3DM5A 2W2XA 2FMXA 1NN1A 4HSEA 3ZDQA 3OZXA 1XEXB 1Q1EA 3QNUA 3NIBA 3B5JA 3TUJC 3VR1A 4DRZA 4L8GA 1MO5A 5DHFA 3SJAA 2BV3A 2W2VA 4M1KA 2A2ZA 5K8TA 5EQTA 5SZJA 1U8YA 2AD1A 3ECCA 1J90A 1ZRHA 2FEOA 3AV0B 2GCOA 1S9HA 4IDNA 4LPKA 4V02A 1N0UA 1UKYA 5LB4A 5CDFE 2Q6TA 4JLAA 1NY6A 3OFNA 2P6UA 4MDEA 1OFTA 5CK5A 2CDNA 1IJEA 4Q4JA 4CF7A 3VNVA 3IILA 2VO1A 5JCZA 5JWRA 3QBTA 3FHOA 2FGJA 4KSCA 4Q9IA 3AVPA 1NLZA 5DIFA 5J4HA 3SOPA 4NHOA 4TQUS 3QXXA 4NPHA 1M8PA 3F3YA 3MJHA 4ZDIA 2H17A 2QTHA 1NVUQ 3I4LA 4DIEA 1Z22A 3IQXA 1ZD1A 4WW0A 3BE4A 2ZRFA 4C30A 3H1TA 1LNZA 4OHWA 4LPSA 3ZIAA 3IO5A 4UKDA 4HEJA 3GLIB 1G291 2HLDD 5J4KA 2IWHA 3RC8A 3I92A 4BLOA 3QEOA 2GEUA 4FMCB 2YC4C 3Q8XB 1EFRA 1NN0A 1SZPA 3WNDA 4MITA 3FKSA 2W0MA 4WZ6A 4NYMR 4LHXA 1JR3D 5GJCA 3FKQA 5L3SA 3IIKA 4Q4HA 1P72A 1SGWA 1NY5A 2QE7A 4DB4A 2V1XA 3GJ5A 4I4LA 1E9EA 1NG1A 4NE2A 3QUSA 4DLVA 5AJZA 3KKPA 2CHGA 4IVRA 4B43A 4PC6A 1J99A 3L82B 1EGAA 4N0EA 1SXJC 2GAOA 3E1SA 1NMYA 2PCJA 4R98A 2PJZA 4POAA 2R6DA 1G7RA 2MSEB 4TL7A 3U3KA 1KMHA 4YQFA 1TQ4A 2WWGA 3C7KA 2OILA 2ZRAA 2EFGA 4MUAA 2F1RA 2G3YA 2GBLC 4TMXA 3PV0A 3I1FA 5A5GA 1UBCA 4TL9A 2EYQA 2FPKA 2RMKA 3BS4A 2QP9X 3A1TA 4Q9HA 5GJWC 1QVRA 1EWRA 2WWYA 4AI6A 2GTPA 1II9A 2J46A 4FWIB 4WZAE 3F5FA 1HV8A 2WHXA 3DM9B 1H8HA 3KTAB 4NP6A 5FPTA 1LF5A 1MV5A 3PXGA 1NP6A 2ZITA 1X1SA 3P4XA 2V54A 2ANCA 4LYHA 2IYWA 4PHFA 3EZ6A 4AYWA 3RWOA 721PA 2JLYA 1N2CE 1G8PA 1Q0UA 3SDZA 2ASEA 3EC2A 1XMIA 2CJWA 1G17A 1M6NA 4AD8A 2CCKA 1OH8A 3PVSA 2RHDA 3KXIA 3M0EA 1KSJA 1R5OA 2YOHA 3A37A 1EG7A 3TSOA 3UIEA 2ZPTX 1FX0A 5FPHA 3QKRA 1RYFA 2JDIA 5BXQC 1BMFA 3PQCA 4DLWA 2XTMA 3FWYA 2ZJBA 3AVQA 3F8TA 2QGNA 3NWJA 3WNCA 1JALA 1R5NA 4TQ9A 1AS2A 2AR7A 3OFND 3IEUA 2O8BA 2IYLD 3WYGA 1HE1C 1HY3A 1LV7A 2ZJYA 3THYA 5AJYA 3PITA 1AS0A 5TB5A 2NO1A 1XF9A 4NZYA 1P6XA 1QF9A 1QVAA 2XZPA 3GJ4A 4TLEA 2FSHA 1KI7A 4KHZA 3VU9B 4XVUA 5KSZA 1EX6A 5SZIA 1OXSC 4Y0AA 5CLLA 2BDTA 4W7SA 2Q0HA 4C0KA 1OFUX 3THXB 3FKSD 4AIIA 2ZRPA 3W5IA 4HAVA 2CL7X 1GRRA 3SQXA 3I8SA 4OQLA 1Z0FA 3EX7C 1W4AA 1IXZA 1N0WA 1RE0A 3Q7QA 4DLRA 2GZAA 2QE7D 4Q21A 4DDWA 2MMGA 3L2OB 2MMCA 3GFOA 2HYDA 3P27A 4HLCA 4BLPA 1W2GA 5DI3B 1C4OA 1CS4C 1CTQA 4DSNA 5IDVA 1KJWA 1DTSA 3LFUA 2IYUA 2WAXA 3LVQE 4MGYR 4HAYA 4AKHA 1OSNA 4QHYA 3VTKA 2P5TB 4ZKEA 2BOVA 2NPFA 2FPLA 4I1VA 2ERXA 3K0FB 3U6BA 1QHYA 4LUCA 4YONB 2IX3A 2GWHA 2H16A 2QUZA 2EFEB 2E9SA 1GAJA 3B78A 4URXR 3PCRB 2ZI3A 1QHXA 1G8GA 4OQXA 5KU1A 2IXFA 3K1JA 1HEIA 2O8FA 1Z6GA 2FH5B 1AK2A 2OUKA 3FFAA 3DOEA 5FL3A 4ACAA 4D4MA 4TYPA 4JLDA 2KBEA 4GPTA 3TUZC 2BBTA 4MGZR 1P61B 3GLGA 1OJLA 2HV8A 2NO9A 2HT1A 1ZJ6A 1FQJA 1NI3A 2Y8EA 1PUJA 4PFSA 4Q4LA 2ZSFA 1M2OB 4RD2A 3AVVA 1C9KA 1EXMA 1VHTA 3IBYA 4H1VA 1E0JA 5JRJA 4URYR 1SVOA 2O0KA 2Q21A 2B8WA 3ONWA 4X8OA 3EPHA 3EZ2A 2JLSA 3ZYCA 1UAAA 1KSFX 2VSOA 2P6RA 3K09A 1T5IA 2I3BA 3IIJA 3KJEA 4EJSA 5FR1A 4PSKA 2QROA 3ZZ0A 1X8JA 4FCTA 3K70B 2JDID 3EA5A 1BMFD 1Z0DA 2BKEA 3ETLA 1WBDA 2A5JA 3M6AA 1TX4B 3MG9A 4LCBA 1ZNWA 3IPXA 1XU4A 4V0ME 3MFYA 3GLHB 4D0GA 1E4VA 621PA 2DY1A 3D7MA 3SYLA 2PH1A 4PPGA 4QNRA 3DL0A 5KHOC 3SFVA 1YHNA 3P26A 5JECA 4LJ6A 2VF7A 4W9MC 4YDHB 4GZLA 4JLPA 3UK6A 4NYIQ 4OJKA 5EXXA 1VPLA 1E2LA 4GOXA 4Z1MA 2VP5A 1OF1A 3B8HA 1JB1A 3FGNA 1GL7A 5LD2C 1XMSA 2GK7A 1KI6B 5A0FA 2UZIR 3EARA 3WMEA 5JHHB 1PLLA 1RYHA 8OHMA 2IEYA 5G41A 4EFNA 3Q5DA 2R9VA 4A9AA 2JIZA 4RD1A 4TMWA 1U0LA 5FOXA 1O87A 3ZD6A 3EPJA 1SHKA 2OLKA 1LVGA 2V6JA 2GA8A 4IOMA 1Z06A 2HUPA 4D80A 1UBFA 1SKQA 1S96A 4XJXA 1KAOA 1H65A 1XDBA 3T1VA 3CLVA 4LJ8A 3G0HA 3KQNA 1C1YA 3K0AA 2JA1A 4QGFA 2BWJA 3L0IB 4PR0A 4ZDKA 2HCBA 1U9IC 4CEIB 4D6PA 4ESVA 2G88A 4RSGA 4S35A 4FXPA 3O8BA 4M9SA 4KFRA 4Q19A 1CXZA 3MCAA 1AKYA 3EG5A 1YR6A 1Q12A 2ZI6A 2BCGY 4HDCA 2RGAA 3CRVA 2IXEA 3L8YA 4DSTA 2DBYA 5J47A 121PA 1ELOA 1PJRA 4ESHA 1A1VA 3I62A 2QP3A 1JJ7A 1KDPA 1GNRA 2WJYA 3C8UA 5IF9A 2QGZA 2ZUDA 4EPTA 4Q18A 2EWVA 2RB4A 1N5IA 4EUNA 2CCGA 2IT1A 2WJGA 1RVDA 1X8KA 4ARZA 1V43A 5C18A 1MR3F 3KQKA 2GDJA 2DYKA 3K9LA 5J4VA 1G20E 2KJQA 2QQ0A 4NKRA 4XTCS 5FFMA 3PJRA 4M1WA 1VIYA 4GOJA 5DGXA 3TNFA 1W47A 1QG2A 2OT3B 1R0YA 3TRFA 1FMLA 3AM1A 2SHKA 1OIXA 1JPNA 1FZQA 1IY1A 4GZMA 4IRUB 1E2HA 1XTSA 1GTVA 4JVMA 1G8HA 2C8VA 2WJVA 4US1R 4UNPA 5JRZA 2IS2A 3B85A 2E87A 4JJKA 3H84A 1NG9A 4KI0A 2EFDB 3RRNA 1BH2A 2WTUA 5FOVA 5BQ5A 3OIYA 1Z2CA 5CLQA 4BFTA 5FL7D 5JI2E 4P32A 2WSMA 4LGMA 4XD7A 1JEEA 4EIWA 1J8MF 2RKOA 4M8NE 3U3RA 1Q3HA 3UG6A 3NKVA 2AWNA 4QM6A 3EIHA 3TAHA 4Z1MD 1D9ZA 2QRNA 3ASYA 3LX5A 4CVNA 3DVLA 4U00A 1EFCA 1ODFA 3SFZA 2NZ8A 1N0VC 2ZSBA 3ND8A 3I73A 3N2IA 1KI1A 1SULA 4JT2A 4EQ6B 1GSIA 1DAIA 2JLXA 2JLVA 1OFHA 5KYKA 2BMEA 5E4FA 3LDAA 3BB3A 2GCNA 4QBFA 2YYZA 3IDQA 1XD8A 1FOEB 1V5WA 6Q21A 1CKEA 1WF3A 1YJ5A 2XZOA 4I81A 5JCPA 2VP2A 5TXGA 3DO6A 3RS2A 1IY2A 2WKPA 3SEAA 3TIFA 4TZ0A 3FTQA 3C5CA 4HUTA 1SXJB 2IF0A 5HPYB 1EWQA 4DCUA 3OIWA 3ND9A 2C9CA 2GXAA 2ZE8A 1E1RA 4C9BA 1GIAA 1XTJA 1XD9A 2IK8A 4B33A 5GVRA 4ABYA 3U7GA 3H4MA 3A1VA 2NIPA 4HUQA 5AJXA 3REFA 3T5DA 4DLTA 4I1OA 2ZI4A 2ZJOA 3CRW1 3EWAA 2D7CA 4MKFA 1KSGA 1I4LD 1QRAA 2OZEA 1LFDB 2RCNA 4PC7A 1G7CA 1UKEA 2PMDA 1GILA 4K46A 4BFSA 2BCJQ 3MJRA 1JI0A 2VP9A 1P2UA 2XAUA 5P21A 3T1TA 1OXVA 1SVWA 4ZDWA 5FTJA 2BC9A 3W34A 4RD3A 4OKSA 1N6KA 1Z28A 2XB2A 4PPNA 3BH6A 2J41A 1JJVA 1YZLA 3A1WA 1ZNXA 3AGQA 3HU3A 1GNQA 2PZGA 2VA8A 2ZRBA 4IVQA 2GRJA 2CCJA 4ZI3A 5AUNB 4YC7A 1VG9B 2YOGA 2ZJ2A 4RZUA 2IYZA 3U3JA 3BWDD 2YNMA 3CO5A 3AUYA 3CX8A 1KY2A 3WP1B 2CLCX 3TAUA 1IJFA 2A5YB 4FINA 1N6IA 4G5GA 2FPMA 4FI3C 2REBA 4QC2A 1Z6YA 5CYOA 3K9NA 4Q03A 3IKJA 3RYTC 1IM2A 4DWJA 5JWHA 3ZH9B 2DR3A 3RS4A 4OI0A 4HB2A 1E2FA 1B0UA 5HE9A 2YJTD 2ZEJA 3QVUA 2NQ2C 4PPQA 2OCAA 3VHXA 4B3XA 4F93B 3A6PC 5DISB 2BMJA 1F48A 2JJ2A 1WP9A 1SVLA 4MRRA 5CM8B 2BMDA 2WV9A 2ZYUX 3LVRE 1ZYUA 4IDPA 4OYHA 4R7ZA 5D3QA 1H8EA 1NBMA 4AC9A 3SJBA 5TV2A 1R0WA 4B3FX 4IEIA 1NMXA 4HZIA 3RLFA 4BZQA 2O8EB 4Q7LA 1S3SA 4CGZA 1Z3IX 4KYUA 4PO1A 5DI9A 3U7FB 2DFKB 5DH9A 1AZSC 1G4AE 2AK2A 4A8JA 4WAUA 1IHUA 4LDJA 2P6NA 2DHRA 2ZRKA 1E2KA 821PA 4N0DA 1UEIA 3CH5A 2OFOA 3K09C 4EJSC 3OHMA 1RRPA 2QBYB 1DPFA 1COWA 3B1YA 3QEJA 2XXAB 1TQ6A 4BPBA 1Q57A 1ZCAA 2GJ8A 4DT1A 2W0SA 1MRSA 3BIFA 3ADCA 5JSZB 5AJWA 1E0AA 2C98A 3WP0A 1E2NA 2J7KA 4NONA 4ASUA 2RHMA 2HXSA 2XJ9A 4NL4H 1MO3A 4B76A 4IXMA 2KBFA 4OQMA 1P2TA 2WPDA 1TTTA 2W6IA 4DLYA 1UJ2A 1Z6TA 1M7GA 3QXCA 4URZR 3E5HA 1KK2A 2RH5A 1II8A 4BRWA 5AUQA 2FSGA 4P0TA 4A1FA 3EAQA 1ZP6A 4EDHA 3TR5A 1G9XA 1QG4A 3EPKA 1YZUA 4BFUA 2IF2A 3S1AB 3QPVA 1Q1ZA 1JPJA 1OE0A 2AFIE 3PEWA 2VIIA 3WMGA 4PC3A 3Q85A 3AF2A 1M7HA 1DELA 1U8ZA 1GRQA 3PUVA 4Q1BA 3SNHA 1T5LA 1DAFA 3QKSB 3OAAA 2C04A 2Q3FA 1QDEA 2NO7A 2JLRA 1GM5A 2XZLA 5GJVC 2WSSA 1DG1G 1KO8A 2QA5A 1G4UR 4DDTA 3PR1A 2ZSDA 4M21A 2D3WA 1Q21A 3QXHA 1M74A 1KTVA 3MWJA 4XIGS 1LW7A 2I1VB 4OL0A 2W6JA 3UATA 4G5RA 3W90A 4HDQB 1XRJA 2ODBA 2XSZA 5EE3A 4FMCF 2AXNA 4IW3B 4XTRA 1J2JA 1DG3A 1CJKC 1TEVA 2IEZA 5KTYA 2ZRJA 1ANKA 1Z2AA 3BH7A 1GP2A 4TLDA 5D3MA 1VG8A 2OAP1 1ZU4A 5EE9A 5FUXA 4A36A 3W6NA 3Q72A 4PZYA 4V0LA 3IQWA 4B3GA 2OE2A 3T35A 5LD2B 4LHVA 2JJ2D 3AB3A 4WIAA 4NBSA 3AVUA 1OFIA 1VTKA 4KFUA 3CZPA 3HP1A 2QG6A 3MMPA 1ZNYA 2IHBA 4FMDB 3WYFA 3B9PA 5EE5B 1W48A 1FQKA 4Q7KA 1VECA 2GVZC 4HAUA 4KAXA 4YMSA 5C4MA 5IT5A 3ZJYA 3GP8A 1TPZA 1U98A 2Z5FA 2L0XA 1XNJA 2G1KA 4IDOA 3D31A 5JJKA 4B74A 1E4YA 3IPYA 1E9DA 1NF3A 4JT4A 1SHZA 3RRMA 3W8NA 3EA0A 4N1AA 2ERYA 4JVNA 2J9RA 4MYHA 4Q1AA 2IYYA 3GLIE 4Q1DA 4LHYA 4RJLA 4Q01A 1NNEA 2D2EA 2V9PA 4Q4JB 2REXB 521PA 2QMUA 3TSZA 1PVOA 2GKSA 5JEEA 1Z83A 2GHIA 3U2QA 4YDSA 1US8A 3BFVA 1Q1QA 1TADA 4PC1A 3NDPA 2Q3MA 3MSXA 1AKEA 4TMVA 1NKTA 3GPLA 4MYUA 4F92B 2WPDD 1I2DA 2LWIA 3X1DA 5JHGB 2W6ID 4TQAA 2ZRGA 3GQBA 3MWKA 4HYYA 2IYXA 1TF7A 5IHPA 4UXIA 4DVGA 5GVSA 3AGPA 2CEAA 1FP6A 2C03A 4MYCA 4B32A 1MABA 2OSBA 4DUGD 2QMHA 2IBMA 5KPDA 3QI2A 3WRYC 1Y63A 2B7CA 3B2EA 2UVQA 2PBRA 4MH0R 3V9PA 1SVMA 3O8RA 1W36D 5AUOB 4XOIA 1N6RA 1YR9A 4UJ5A 5L3QB 1WMSA 1KMQA 1R5BA 5L3SB 1FMJA 2IS1A 4WA7A 1TUIA 1CR1A 4IOKA 1YZNA 3HU2A 5HZKA 4TZ6A 4ZCMA 1NLFA 5H70A 2F43A 1P75A 2FV8A 2WSSD 4RD6A 1G3QA 1XJQA 1XTIA 3LXRA 3RS0A 3JZMA 2NZJA 4NTZA 4GRAA 3W8RA 4DBLC 1W4CA 5FBWB 1CF4A 1MT0A 2NG1A 1Q1BA 1Z6AA 3LY5A 4D4JA 1K8RA 1GDDA 4KO8A 4HB3A 2XSZD 5JMTA 1BYIA 2F1HA 2VHTA 2EVWX 1BS1A 3QQ5A 4CIDA 4HAWA 4HB0A 4WZBE 3WBJA 4YMUA 2YWGA 4F38A 4KV9A 4PAQA 4TTPA 3ZVLA 3VQTA 1L4YA 2J7PD 4NCIA 4A0RA 1W4BA 2FGKA 1VIAA 2UZ3A 2OM2A 221PA 5DN6A 1NVVR 3KKQA 3IHWA 1VCIA 2CVFA 4A4DA 3LLMA 3IEVA 2GF9A 5FUVA 4YMTA 1UBEA 2GCPA 1G19A 2FN4A 2F55A 4HLUA 3CKLA 2EYUA 4R2IA 1E2PA 1W0JA 3I3SR 4DCSA 1FNMA 1W5SA 2CJWB 3LW8A 3JVUA 4CT5A 4CEHB 1GUAA 2IHYA 2BMFA 2YVUA 4F4JA 2GJAA 3NHBA 4N3NA 1FPMA 2JLQA 1FW6A 1ONBA 1G41A 2ORWA 3PG5A 1G3RA 4C0QC 1ZUIA 3IO3A 3UMFA 1KI4A 4GSYA 4X8LA 4I1UA 1AIPA 4QHTA 4RKEA 5EZ6B 4L15A 3P20A 3B13B 4KBGA 5EXSA 4PO8A 5F9FA 1Z63A 5DSZA 1SQ5A 2CBZA 3OEHA 2J0UA 2V1UA 2QT0A 1WDTA 4C0BA 3KKNA 4B73A 4QGGA 1XEWY 4M1OA 4M53A 4TMTA 3SS8A 4CT4B 4ERNA 3OEEA 2ZRLA 3QPUA 1I2MA 4AY2A 2ZS7A 1GKYA 3ZQ6A 2ZU0C 3BC1A 4BLQA 2XOKA 4PZZA 4HB4A 4KYIB 4LHZA 3FVQA 4E22A 5FTMA 2ATXA 4NYJR 2GILA 4BLSA 1NL3A 4C0JA 3C16C 3I5YA 1VG1A 4O3MA 3BGWA 1HT2E 1VCOA 2WMNB 4GBMA 1W46A 2ONJA 1X6VA 1NMZA 1ZD9A 5CDFA 4XVRA 1NVWQ 2FWRA 5J40A 1F2TB 2X19A 3EWSA 1F2UA 5EE0A 2WKQA 5E95A 1D2MA 1L7VC 3QKTA 4EPVA 1OKKA 1MO6A 1X8LA 1CJMA 4QM7A 1E96A 5CJ2A 3VKWA 2CLDX 3WBKA 2BM0A 1DAEA 2DWOA 4I99A 2J0VA 3BXZA 3KTAA 3ZIAD 3TE6A 1QHIA 4B34A 2LCFA 5DO9A 4XVQA 2F9LA 4AKGA 1MKYA 2R8RA 1TU3A 1T91A 1W2HA 5KPJA 1EFRD 4Z8YA 4YMVA 4LY6A 1D8TA 3TW4A 2XNSA 5LBIA 1YRAA 2Z83A 5FBLB 4A15A 2FEMA 3ZVNA 2CE7A 4DXAA 2IWRA 4GMDA 3FHCB 2PEYA 4G5QA 1JBKA 3NC1C 3LO5A 4DKXA 2XX3A 4DHEA 1G7TA 1LY1A 1XEFA 1F5NA 5DLQC 5J5CA 3GLGB 2W83A 4RY2A 2N1BA 5DN6D 5CJPA 3GLHE 3AKDA 3PUWA 1UM8A 5CYPA 5A4JA 3WRXC 3TSWA 2ZROA 1W36C 1KJYA 4Q9LA 2ZU6A 2KWIA 3B1WA 4M1YA 3QF4A 2PZFA 2GZDA 5KDOA 3KJIA 2AD5A 3PUZA 3FB4A 2O8CB 3QF7A 1SVIA 4AURA 4EJSB 5E3HA 2VH5R 1SKYE 4ZI2A 4KLZA 2A7QA 3CR7A 3U7HB 5HCNA 5CB8A 3VU9A 3DMNA 5JS8A 2DWPA 1H8HD 3MAAC 2BEKA 5EJEA 4E07A 5DE3A 1BKDR 1CP2A 2VQSA 1WBBA 1UDXA 3WYAA 4F4IA 4DC9A 3B60A 4M9QA 3THXA 2A3RA 3MUFA 1NN5A 1Z08A 4PQYA 5J4YA 3OEED 1F60A 4X8HA 4ZDJA 1N6OA 5FBVB 1OIVA 1CBUA 2J0QA 4HZUB 2V3CC 4XH9B 4U02A 4UNSA 3S1AA 4AKIA 3U4QB 1N6PA 1TL7C 1YU9A 1D2NA 1YVDA 1Z6XA 2FU5C 2H5EA 3GJ6A 3K9HA 4RFSB 5DI3A 2ZIAA 3KB1A 4MQBA 4YMWA 1KIMA 5E7JA 4YXWA 1QHGA 5UKDA 2PZEA 1E69A 5AK0A 3IHLA 3AVTA 3A8TA 4UNRA 1U81A 3CZQA 1G5PA 4F7WA 2QAGC 2FSIA 3K0EA 4O2RA 1XCMA 3K0FA 1OKKD 4B35A 5GJBA 4US2R 4NYMQ 1P4SA 5FTKA 3AVXA 4MRPA 4KLNA 4C2TA 4QBGB 3BFKA 3GCGA 3AF0A 3AVOA 1SKYB 5DYGA 3RHFA 2YC2C 1R6BX 3TH5A 5JS7A 4TYWA 3K0CC 4TYNA 4ZIRB 1XJCA 1MOZA 2P2LA 3FYHA 1Z5ZA 3QBVA 4MKIA 5K8LA 1E2MA 4KVGA 1BOFA 3KUCA 4C0HA 3VX4A 3OESA 1D5CA 1G1MA 2QM7A 4QKQA 2JEOA 3DHWC 3CF0A 5GADl 2XTNA 5HTKA 5B57C 3I61A 4KFTA 1XD2A 2HT6A 1G5RA 2FZLA 2GESA 3QG1A 5TDHA 2O0JA 2GJSA 4AG6A 4Z8XA 2FOLA 1HQCA 1KI2A 3CPHA 1TF2A 2XNDA 4DLZA 1S4QA 3GJXC 3HPQA 1E2GA 4IXNA 5KSOA 4D26A 3BAFA 5EXPA 3QXJA 3B7GA 1XMVA 2EW1A 2QNRA 1DAMA 4EKDA 4PSVA 2Z4SA 1OLOA 2QSZA 1TQDA 2TMKA 4C3ZA 3NEYA 1WRBA 3ADKA 4TTRA 1L2TA 2VHQA 4JZKA 2DFLA 4BWYA 2PX0A 3CM0A 2WKRA 3SHWA 4F91B 1L4UA 1VYUA 2BBSA 3GFTA 3VAAA 1G7SA 3SQWA 5L3VA 1GOTA 3DEFA 3GJ3A 2AKAB 4LV6A 3U44B 4LK2A 2D2FA 3DOFA 5EP4A 1TAGA 4YLGA 2R6AA 4KVAA 3HPRA 2GAAA 3WHLA 4A2QA 1E0SA 1K6MA 2HEIA 1E9CA 4LOAA 3ZQJA 2IA5A 1KI6A 5LB2A 3C41J 3W5JA 5FBQB 2D62A 1G18A 1B23P 1NSFA 1LB1B 4UQOA 2GXUA 4JLNA 4R2HA 4BFZA 4U7DA 4C7OB 1JQJC 1KDTA 4UXHA 2BEJA 2N46A 2QPOA 2C78A 3LRPA 3RSLA 1ZIPA 4QBHA 2AX4A 4K81B 4M4SA 2ODEA 4NU0A 4U5XA 1KO5A 3TMKA 1SXJE 2V7QA 3V4RA 2ZYTX 1TEXA 2CL0X 4V0MA 4CEIA 1JAHA 2DPXA 3BBPA 2FJUA 4HLUC 1KI9A 2A78A 4ITRC 4CDGA 3OIUA 1ZMXA 1UADA 3I5XA 1OYYA 3HYRA 3Q5EA 1TMKA 3C4JA 3EW9A 3TJZA 2VP6A 5JJLA 1N5KA 3FMOB 3EXAA 1KKMA 3PUXA 1RRFA 2OXRA 4BRUA 1XWIA 2B8TA 3MGCA 4CYMA 4KXFB 4FWTA 2ORVA 1G16A 2R2AA 3IIMA 1RW4A 2GETA 1ZM9A 3E70C 3LLUA 2JIZD 1VYTA 4Q47A 4A92A 4BUJA 3NDBB 5DYIA 3NBXX 2JGNA 2VHUA 5BYKA 4DDVA 3LWNA 2HDNB 3KJGA 2ATVA 4RD0A 3HR7A 4B47A 2FZ4A 4EFLA 2XNDD 2ZJZA 4KITB 3KQHA 4RFVA 2VLIA 2AHOA 4GP7A 1HT1E 1RKBA 4JL6A 1N3BA 4MRSA 3JVVA 1KOFA 3UMSA 1XX6A 4W5WA 1VDZA 2FFBA 4D25A 5DHAA 3R7WB 4I1SA 1Q22A 1GKUB 1QHHB 2FF7A 4TLBA 3B82A 4JBXA 2JLUA 1JNYA 3I32A 5FOTA 4JL5A 4Q9JA 1ZVQA 2WWFA 5ELXA 2J45A 1ZD8A 2C95A 3CH4B 4A82A 3GD7A 1IQPA 1IXSB 3N70A 1HYQA 1X1RA 4HLQB 4AK9A 3D3QA 2WJHA 2XJ4A 4PHHA 4GI7A 5KOYA 4XSHA 4OK6A 4KFSA 4PXAA 1KDOA 2B6HA 4QRHA 2J87A 4MRNA 4EQ6A 1G8FA 2RGCA 5C2JB 2ZRHA 1XBTA 1NIPA 4Q1CA 3AVWA 2D06A 3UKDA 2GXSA 5BW8A 1AGPA 1IN4A 4B6FA 1S9DA 4AKEA 2X2EA 5CIWA 2ECKA 1PLKA 5SZHB 1KGDA 2FFAA 3LBIA 1Z0JA 2OBLA 2BBOA 1N25A 2LKDA 2R6GA 2V7QD 4QBIA 2A30A 2QTFA 5CITA 1T3LA 4HLDA 1P3JA 4XSGA 1E9SA 3AKCA 4GDFA 4LJ7A 4BQSA 1XXHE 2GBLA 1XTKA 5SZKB 2NGRA 3VR3A 3U3MA 4XD7D 5BN5A 2F1JA 1FP7A 1P2VA 2JASA 3EZ9A 4Q5IA 5KSPA 2Z6VA 1IXRC 4II7A 4FIDA 4JKIA 3CRRA 1JXOA 1ZINA 4BFWA 4D0LB 4TSFA 3ADBA 1YR8A 3TUIC 4PANA 1KAGA 3LX8A 1OT3A 1NRJB 1P9RA 3GJ7A 5JWOA 2O8DB 4L9SA 2OFWA 3UWKA 2P3SA 4D4KA 4BLTA 5B30A 5H1YA 4O2LA 1W1WA 3Q9LA 2P0EA 5CB6A 3NH6A 4D82A 1JR3E 4FMDF 1GVNB 1RJ9B 3HU1A 3V00A 3SN6A 4LJAA 1E2DA 3THWB 1P9NA 2BHRA 2ZR0A 3RWMB 3TBKA 4B2IA 4WXPA 4ZV4A 3ZZTA 1RIFA 2GVDC 3EASA 3BOSA 2IYVA 1DO0A 4FW9A 1KO1A 2QTVB 3GLFE 4NCKA 2QY9A 4LV5B 3VMFA 4O25A 4IFEA 1BO6A 5CIQA 1DE0A 3FFBA 4A0HA 1R0XA 2VHCA 3A4NA 3QENA 4B48A 4ZKDA 1E2JA 3C14C 3R8FA 1DAGA 1E1RD 2IYQA 3EZ7A 1W36B 1S1MA 5F2EA 2NO0A 1OXTA 1G3UA 1XXHB 3LV8A 1CRPA 3B6EA 3FPAA 4P4SB 1M1YE 5JFGA 4TL8A 1P5ZB 2BVNA 1RRCA 2F6RA 1UF9A 4JLKA 1UDWA 5G3YA 2QEQA 5HZHA 2E1RA 2DWQA 3CX6A 4G5OA 3H2YA 1N5LA 2FG5A 2J3EA 3GFPA 4UXJA 4P31A 2OXCA 4RZ2A 3TK1A 2XEXA 2O52A 3ZVMA 3O8CA 1A7JA 1P9WA 4L9WA 4OBEA 4B75A 3D6TB 2O8EA 5FUWA 1FNNA 1K5DA 2KSQA 1OW3B 2YINC 3W6PA 4LC1A 2A5DA 4F4CA 3VR4A 2EQBA 2R62A 2A5GA 3U7EB 1ZM7A 2C96A 1MRNA 4FN5A 4LJ4A 2BKUA 4IOLA 1WXQA 1W49A 2IYTA 1TU4A 1KY3A 3GLFB 2XXAA 2WIBA 3QG5A 4RZ3A 2ZVPX 1EFTA 1P73A 2A5FA 2RGGA 3CF2A 3CR8A 3BJIC 1GWNA 2QP4A 3LAWA 3B9QA 3LW7A 3LXXA 3PIRA 3CB4A 5JSZA 5C1BA 1E9FA 2QAGB 2K5UA 3NBYC 3SHFA 1TNDA 3UMRA 4CEJB 3CNNA 4PO9A 3KKOA 4JL8A 2QM8A 1Z0AA 1S0UA 1KJZA 2ZE7A 2WJIA 1R4AA 1DVRA 4W5HA 1A2BA 5TARA 4Q4AB 5FTNA 2W58A 1DAHA 3UXMA 4C0LA 3T1QA 4M2LA 3T15A 4JVLA 3MLEA 4PAOA 4OHZA 4AWXA 1IONA 1ZAKA 3CW2A 3SJCA 1H8ED 3CBQA 1Z29A 1US8B 5F98A 2VP4A
chains in the Genus database with same CATH superfamily
1GXSA 1RC8A 2PR2A 3D8NA 3IS3A 5DEOA 3FMPB 1FU4A 4D0NA 2OUIA 2QXTA 2ZPAA 4UU1A 3SKXA 1H1DA 5T4EA 1RS0A 1QX3A 4PNZA 2BJVA 1T8TA 5KS2A 1V0JA 2R65A 5DNCA 3C85A 2X3YA 5LQMA 2E37A 4R01A 3IBGA 5DGHA 3KPJA 4K9OA 5HP4A 1QO0D 4ND7A 2GCOB 3Q88A 1Y3AA 4OUKX 5A4FS 2FDRA 5BV2P 1NRIA 1C7QA 5JO9A 2IXAA 3ASVA 4X7RA 1CHNA 5AR1A 4BO5A 2Q1YA 1FDWA 3OQ1A 1FRNA 1SBZA 3QLUA 1ZIYA 4IDQA 4RX1A 3JX9A 3NG1A 3ZY6A 1DDGA 4M8KA 1PT6A 2P9TA 2A9JA 3Q40A 4TV9A 1G64A 1W96A 1HDXA 2ZR7A 5KDLA 1OC4A 4D8TA 1P74A 1DRJA 1NIJA 3JZDA 5BWCA 1OH7A 4ASUD 3N7UA 5BVGA 4G0NA 3F7MA 4FLMA 2B1GA 4OHVA 4L0MA 2ZE6A 4XAQA 1QFJA 2P9EA 3P9PA 4IPTA 1JXMA 4AJNA 3OD1A 4DXHA 1GRNA 1P6UA 3GT4A 5D5QA 2P90A 4M8SA 1LS6A 4POOA 4X6LA 1V4VA 2DFTA 4X95A 1IMJA 3CKYA 4RIIA 4YRPA 2OZLA 5BORA 1ZJYA 2Q5FA 3QE0A 1XB2A 2OHFA 1FRZA 2UYGA 4QTTB 5TQ0A 3RTCA 3UPUA 1PJBA 2PYIA 1K3UB 4GFDA 5DIZA 2QENA 4DDKA 4DV2B 1NI5A 1VLJA 3I9FA 1QCCA 1U0JA 4A8TA 4OLFA 3ZJ4A 2CNWA 9ATCA 5J1TB 2G9NA 2O2CA 3R3WA 4EEKA 4Q00A 3UG7A 4PTLA 3B9RA 3MQ4A 1ZM4A 1IVYA 3RIMA 2F9FA 2XE4A 2YHSA 3RNLA 2PKXA 3TSAA 3CF4G 3PHGA 1B3RA 4IUCS 4WKBA 5B58C 5B3KA 4NCHA 4B0PA 5KKNB 1XZ8A 2ZYWX 3Q7RA 3K8QA 3TZHA 4AMUA 1ZISA 2G83A 2AG5A 1QDLB 2HRQA 1H23A 1U9IA 4JP2A 4YJKA 4H7DA 4UBJA 3X1ZA 4B3IA 5K0GA 1NKSA 3ROFA 1MQSA 4MCIA 5B64A 5CFMA 3C5HA 1GU1A 3JQ6A 3MTBA 2G9RA 4D97A 3DZHA 3E2IA 4DLSA 4IJUA 4EENA 2CB9A 1QYWA 1UANA 3HDYA 5M5BA 2GM5A 2NV2B 1NSTA 1FU8A 2DF8A 3IL2A 4MUKA 2ZXUA 1H4TA 3BJEA 3O3CA 1HUQA 1LS1A 1MVOA 1XQ1A 2AQHA 3HY4A 3TFQA 3PU6A 3O3NB 4EG0A 2BH2A 1IN6A 4UNNA 1WUYA 3QPDA 4NBWA 3K5WA 4A03A 2G5CA 3N8GA 4LISA 2GNOA 4J3JA 2C7VA 3JSAA 5EIBD 2HAEA 2OV4A 2G6TA 3GDHA 3MWYW 1QAMA 1PJLA 1FFXB 2I7TA 4R54A 4XPIA 5EVJA 4CLOB 5LN1A 1ZITA 1XPRA 5JI3E 3H9BA 5IJ9A 1C50A 3CUKA 2DQKA 1XQ6A 1ULHA 1HMPA 1VXRA 3VR5A 3RYCB 3OTOB 2ZWIA 4S1OA 1GTG1 3ASZA 4BAUA 4BV2A 3IP6A 3D6VA 1GA6A 2XMPA 2YN2A 3R40A 4FS3A 5SICE 3V4FA 2C4MA 3UHAA 2Q62A 3K1TA 3VH2A 2K2QB 1OV4A 1MFPA 3RVPA 4NV3A 2CXRA 2ZTVA 4PC2A 3Q10A 2R7KA 2V3VA 3A1FA 1VPDA 5M3BA 1GUBA 1DAPA 4L7VA 2FPRA 5JPCA 4L95C 4C7KA 4R41A 3KM0A 5EESA 2ZVQX 1VLQA 2G82A 4OVKA 3RAPR 2BIFA 5F3WB 3F9RA 2VOEA 4NAUA 4UCXA 2ZULA 2C4KA 2Y6VA 3CY6A 1J9GA 4R9VA 1C8KA 4JFRA 5G40A 5LZ8A 5DNYB 1MXHA 2YWEA 4URVR 3DV0B 4EPYA 1G8JA 1UBMS 4MV0A 3N0TA 1ZAYA 3UOAB 1AHIA 3BL8A 3PX2A 1ND5A 2JLWA 2A59A 1RBYA 1Q5PA 4JYCA 3DG9A 3KOUA 4DLAA 5IC5A 2H0RA 3RRYA 3D02A 2QRZA 2NVWA 3L40A 2PMWB 1EM8B 1NFQA 1OPXA 4WD3A 3NXSA 1XVTA 3ZVRA 4AKSA 4G8BA 5ADUS 1JEDA 3B6KA 4E33A 3DMPA 1DBVO 2M1ZA 3IBCA 4FPXA 1YTLA 5EWLA 4IJQA 1IUOA 3ZTYA 3D4BA 2LKCA 1N2OA 3L0CA 4MUBA 3VR2A 4WJLA 5GONF 4CIAA 5JZVA 3B1XA 3PHHA 1JQLB 2CLHB 3TLEA 1GZ6A 1I01A 5LP6B 2YRFA 4MCJA 5I7RA 3R20A 5DOZA 2PUJA 2CNWD 2H3HA 1MCZA 1SBCA 1RM5A 1FFHA 2V8OA 3LKVA 1RPZA 1BNCA 2W6MA 2WNIA 4NH0A 1RC0A 1YOBA 2AC4A 2OQ2A 4MVCA 4OJNA 3VYTB 2QPAA 2WJZB 5DP2A 3SEFA 1XHLA 4ZMBA 3A04A 2DTDA 3WL7A 1U7ZA 4EJ0A 4DV6B 4OOEA 1NBEA 2X8AA 4XGNA 1NHGA 1REQA 5CCXA 4IM7A 2R8YA 1EUYA 4ZO4A 2OV2A 3GC6A 1RQRA 2E4ZA 3HM9A 4BO8A 4ZD6A 3OTIA 4MKHA 4MRMB 5JD4A 2ZI7A 4KE9A 4U9UA 4Z1OA 3SVZA 3K32A 5AWFC 1GPUA 1YA8A 1JDBC 4BWGA 4A8PA 3PHCA 2P41A 2RGNA 4QGBA 5BWOA 1DG9A 1PKXA 3C3JA 3SXUA 3OMWA 2HIGA 4U5QA 4FP9A 4TYQA 1E4EB 5ITZB 1XDDA 3BWVA 4MV3A 5F2OA 4CM7A 5TLSA 2YV2A 3L77A 4AZ0B 1B93A 3H9QA 3QLVA 1GGEA 4ER3A 4ARIA 5KNCA 1ZD4A 2D4AA 3PXAA 3C7CB 5JR3A 1CVIA 2ENWA 4E30A 3AG6A 1C1DA 1UBSB 5TR9A 5ICMA 1NLYA 3EIEA 4WINA 3NHZA 5JADA 1FVXA 3OPNA 4A2PA 1GNPA 4RDIA 5K0SA 3ONVA 3CUWA 1LPOA 2FPOA 1XP8A 2ZB4A 4UUOA 4DJFC 4HOYA 1N1MA 1T4GA 2IYRA 2Q4EA 2FFQA 4W1QA 1L7XA 3VM6A 1A7UA 5IVKA 2Z1NA 1IN7A 2W9XA 1G8KA 1RZVA 4OGGA 1QGUB 1UIRA 2V9ZA 3ML1A 3KPUA 3Q9SA 4G9GA 4DLUA 4EHDA 3NHWA 1KO4A 1NJSA 2QD4A 4E5UA 3KB6A 3IMGA 1XZPA 3FWNA 2FYTA 2H18A 4KQHA 4DCVA 1UKVY 1WSWA 3BE5A 3BMOB 3MJVA 4C7JA 1SKBA 1T9HA 1ZCJA 1NF9A 1W0JD 3FPHA 5BRJA 1YS7A 3QVWA 4TWRA 1QK5A 2EL9A 2NUBA 4Z49A 4AYTA 1ATIA 4DQXA 3H6GA 1BROA 5CIYA 4IUYA 4QNNA 1QP8A 5FJIA 5HE8A 1NAIA 2ZJAA 3RIGA 3CRMA 1G6Q1 1RYBA 4UVGA 2WHQA 1R0ZA 2G0NA 5JEDA 3O2SB 2PT5A 5A6VA 1ZCBA 5ALLA 2Q28A 1H0KA 4QRIA 3DPUA 3RBXA 5JANA 5K1ZA 3H87A 1HOXA 3PE3A 3RABA 4BEBA 3OTWA 4XXHA 4JBWA 1AB6A 4W8GA 3FSGD 2AOVA 3VZBA 2COUA 3TIGA 2ZAIA 4M60A 5EKTA 2OZKA 4PNEA 4YAEA 4F9EA 1N2IA 1JIUA 3I6YA 3FW1A 4JIGA 1CULC 1DBSA 1DEKA 3P9QA 2EEZA 2XOKD 3WXMA 1R2QA 1ZM3A 2IS6A 3UAVA 4YJ2A 4UTNA 1UKBA 3HSSA 3KXPA 2P2YA 1XQ9A 1IY8A 2I1QA 3E0XA 4BFYA 1A2OA 3I2IA 2R85A 4JKOA 4JLVA 4Z2AA 5DM70 4BQEA 2G4CA 3Q8LA 4LF5B 2PLRA 5LYYA 3VKHA 3KXKA 3N2EA 5FI0B 4DZRA 1KI8A 3INNA 1FX1A 2HM7A 3G13A 3GZNB 3OWHA 1KAQA 3HJBA 4TUYB 1KO7A 1QZXA 2WYOA 1Q1NA 5A2QA 3KB2A 1PNRA 3OFVA 2Y3IA 4MGHA 4MUXA 3REOA 3U0VA 3ZLJA 3WKEA 1RZ3A 1KYYA 1OLUA 1YZTA 2P77A 4WY2A 1XC7A 3N3AC 4KN9S 5J59A 4D42A 3DBOB 3H9GA 3RRZA 4WERA 1YMVA 4HPWA 1M0TA 3NTVA 1WR8A 3BD9A 4X1OA 1BMQA 1QSGA 5EP2A 3PLRA 1EFAA 4DUZB 2H7VA 1E1QA 2O6HA 2WE7A 2AN3A 4P7FA 1MXFA 4GUAA 3TOSA 4UCWA 1S2GA 3IOMA 4LRQA 3P94A 4DB2A 2OO7A 1NOIA 5DV9A 1JUDA 4LFAB 3EGEA 2PMKA 3VR6A 4MEBA 2JJQA 5DGDA 2BDUA 2WY2D 1NVVQ 4CKYA 3O73A 1LC0A 4RANA 1HO3A 1NX6A 2XA1A 1Y8QA 1TVKB 1EXNA 2IPMA 3NH9A 3RKRA 3TTVA 2QL7A 1M83A 2V55B 4JLMA 5AVYA 5KNCD 5IH7A 5ALUA 1N6LA 3KJNA 4MVJE 2IRWA 3MTDA 4BQNA 1OIWA 2C92A 3C3BA 4HZUA 1SK9A 3K6RA 5IUNC 1VKJA 3N8KA 4J1TA 2WMOB 3NJ8A 4UMFA 3WZLA 5FH9A 2NZ2A 3QIVA 1HDGO 4IMJB 3U61B 1DU4A 3U4QA 3OLCX 1AQIA 4R1NA 2AOTB 2O8NA 2VT3A 3Q8WA 4IHKA 1FC0A 1EQ2A 1NN3A 2JCSA 2QSJA 1FTSA 1RHKA 4P38A 5AXCA 2VTKA 5I51A 4B4VA 4ARAA 3OM8A 4BAZA 2PKQP 1JR6A 3RTEA 4ZPXA 3W1WA 4E5SA 2A0WA 4H9GA 4W5OA 3LD9A 3NHLA 2FSVA 3WGMA 4BMXA 2HCJB 2QZJA 1K86A 2C4WA 1LPBB 4Z3DA 3TTYA 2NYUA 3HB1A 1ML4A 2Q41A 2OMKA 2IV7A 5HEKA 3A25A 1EU1A 1M2JA 2GS9A 3L8FA 2ONYA 1LRKA 2NOAA 2RI0A 2VDVE 3KQMA 3RRJA 1PU2A 2JD1A 3JPYA 4D9JA 1KHHA 2B20A 3F5SA 4K88A 5EAIA 3EVBA 3NTLA 2XT6A 3TW8B 4B2PA 4BNDA 4IUBS 1CS0B 3ZCTA 4DRXA 3OQOA 4ZVMA 3DDNA 3PQ5A 5DM0A 3Q8KA 2JZCA 2OCBA 1ZN7A 2C0PA 4L4RA 1Y9DA 3LU1A 4C01A 4ESOA 5CB4A 2A8YA 3QLEA 4MRVA 1GRVA 1RI1A 1ORWA 3PK0A 1YQEA 2I7CA 1VSVA 5FBRB 3T1OA 5TVKA 1Z73A 3IT0A 5ARBA 1HL3A 3OCYA 3C4QA 3QSGA 4OI2A 3HWSA 1LI7A 1QPBA 2FI1A 2ZI9A 1E1MA 4HAXA 3TLBA 3U7RA 3GUYA 3MW8A 4TTSA 3LUCA 1PF7E 2R97A 3TR0A 1Q7RA 2JGDA 3G2OA 1C14A 3WL4A 4YXWD 1UKZA 2B99A 4DQUA 7MHTA 4RZXA 1CZHA 5K45A 1TUEA 3MD0A 1K66A 1MMFB 5IT0A 2Z56A 1RCUA 3IEPA 5FPSA 1TQHA 1ZCFA 5JSKA 1A8PA 5C4GB 4AP5A 2PH7A 3RSGA 2CL6X 4IO1A 4OHPA 4DM3A 1PD0A 3OM0A 3ORHA 5AD1A 1YJBA 3V8VA 1K4YA 3GPBA 3KZMA 1LPNA 4KDCA 1NVTA 2W2TA 3QWFA 2P40A 4Y1RB 2ODAA 1E1QD 1UBTS 1TYAE 2PKYX 2PV7A 3FFWA 1TD9A 1QWSA 5C81A 2HYIC 4LZZA 4TYYA 1N1DA 1R66A 1ZC4A 2IU6A 1XDUA 2KQUA 2PQ0A 2WVHA 1GPBA 1A9PA 1OTHA 3PUKA 2SBTA 4C2BA 4GX2A 1D6MA 3E84A 2Z9DA 5CH5A 2RG7A 1PDVA 2V7UA 3R1IA 3TM4A 3VR6D 4HVCA 1QOPB 3UB4A 4OQQA 5K8UA 3BWYA 1QOZA 3DLHA 2Q2WA 4G0XA 3S29A 1XTVA 3GT7A 3L46A 3T7SA 4AZVA 3SC3A 4EGCB 4LTDA 3WWCA 5EPUA 2VPIA 2Y93A 5DP1A 4DV7B 1L5QA 5H80A 3O3OB 1CJVC 3OF5A 4XW2A 2HXYA 1GTJ1 2JPDA 1YQTA 4ND8B 4XJVA 5E38A 4A8HA 4CTMA 5I7FA 5U4XA 3EIFA 3D2CA 3EDOA 4C3UA 4QSMA 1YONA 1ZHHA 4HT3B 3L0YA 2BFBA 3F71A 4WADA 4OFXA 3S6JA 3T9EA 2C1EA 5EJGA 2YJGA 3EOAI 3BB4A 4HBZA 3USCS 3P2KA 4A0GA 3K70D 2HDOA 3PUJA 4QO7A 5JYEA 4XIYA 1JLSA 4C5AA 3KUDA 1YRYE 5K3EA 2DCMA 3BAZA 3RYFB 4HQLA 4PZLA 2VYQA 3I5AA 3H1AA 4YJ3A 2ZANA 1S8FA 4S1NA 1DEHA 4M0KA 5FPYA 2OBYA 4HK4A 4UVEA 3B7WA 4O2AF 5KQLA 2IXGA 1SK8A 3H5OA 1G9TA 4NCAA 4DV4B 1M6VA 4G1BA 2LDBA 1IB6A 2PL3A 3M6LA 3WJ7A 4E94A 5FWYA 5CD1A 2RD2A 1R9NA 3AFGA 2V6MA 1RWMA 2Y1WA 2D00A 2O0LA 1Z2DA 2C3MA 1LKZA 4S1WA 2RGXA 2BMWA 1EI9A 1L5NA 3VNBA 2JEYA 4GX5A 3DFKA 3A36A 4D4LA 1RAAA 5KSOA 3CU5A 2DKFA 4C6RA 1P2GA 3O1IC 3JZAA 2NUAA 2MYNA 3LVBA 1GQYA 5F9HA 1MT3A 1H6DA 2YXPX 3N8IA 1QQTA 1XP5A 3QOFA 4KR3A 2F3TA 5EG5A 4YASA 2DT8A 4Z9YA 3PFIA 3IKVA 4UZFA 3DC2A 3LHKA 3GI1A 3WGQA 2E5LB 1NQUA 3FZNA 5FKJA 1JIXA 2WNHA 3VHXB 4GMXA 4QREA 2AZTA 1XFAA 2QD2A 1JKIA 3DAGA 3WK4A 4CL2A 3KDSE 4A73A 4PLVA 3N1UA 1SY7A 1COZA 4XJSA 2O5VA 3T4PA 1IZ8A 1SCIA 3RVDA 1JGTA 1U2SA 1Y9JA 2PT7A 3LUAA 3U3ZA 4KPYA 1CUUA 1KBOA 3HA2A 4FB4A 3M2PA 5KOHB 1CUFA 1T4CB 4RD4A 3KOZA 4CU2A 4YR7A 3JPWA 3P9CA 3DKPA 4X90A 2FWNA 2OXTA 3S8MA 2L17A 2PUBA 3PFHA 4FZVA 4ZU6X 5JJIA 3KETA 3HYTA 3A4YA 4D3DA 3GNSA 3R7WA 4EBBA 2VQ6A 4PSUA 5LA6A 4H2DA 5A3RA 1KYXA 4ZJYA 2Y76A 4MW4A 3U0BA 1OLXB 2HK8A 4LX8A 3EZYA 2ZSAA 3DFUA 3T95A 3FR7A 3WVNA 2ZAMA 4OY3A 1EB8A 4A7PA 2DFNA 5KUTA 1UFQA 2VJCA 2IYSA 3EEFA 1H0RA 2R86A 4TLLB 1Z0SA 1CIPA 3K7EA 3GD5A 1JECA 4TLAA 4RKQA 5I5EA 2WLTA 3VH3A 3CBGA 3CZCA 2QLFA 4ZFNA 5F2NA 1WJGA 1QB8A 3Q6MA 3EMBA 5ICEA 1E6KA 5JISA 1Z75A 3PEVA 3FE2A 3AEZA 4TROA 4OB6A 1A9XB 3Q2KA 2B34A 2I6TA 4FSDA 2VF8A 4D0SA 5DCLA 3IDSA 4IGKA 1FPQA 1U0FA 5G53C 4JP8A 1DTEA 4LBVA 3QVSA 1SUPA 4K6CA 3W6OA 2A84A 2JATA 4J6FA 4E1AA 2I71A 4NE7A 3P97A 3R5FA 2PSSA 2FSUA 4XRGA 2UZAA 2XUKA 4UUAA 5C8DA 1XA0A 2WWXA 2OLJA 3TZLA 3FOFC 4B3TB 4KU4A 4MJ3A 1UBHS 1YO6A 3P32A 2X86A 2I2XB 1ATZA 2BRUA 4IZOA 1WCWA 1Y3BE 4LDZA 1FDRA 1R12A 2DR0A 3LIPA 1P2SA 4NCBA 3RKSA 3NVAA 5AJTA 3B5EA 4KE8A 4G01B 5CA0B 2H9AA 1Z56C 3OQIB 2FR8C 5F5XA 4I4TB 3G2KA 4CCYA 2F3RA 4AIRA 5BMVA 4JGBA 4BMPB 2WB4A 2VQDA 2I4TA 3P1JA 4JA2A 1Q74A 3L0SA 3AKYA 4HATA 3CIOA 4QXMA 4RM3A 5YASA 4FE4A 1UJMA 4ALMA 1EJBA 2A9RA 3ABIA 3FDIA 5HM8A 3A4LA 1SXQA 3NVMB 1RFLA 3CUTA 4PPFA 1MN6A 2F7SA 4UPDA 1H22A 3T7RA 1YRBA 1Z68A 3CWZA 3PB3A 1JAIA 2OG2A 4CM9A 1XNGA 4NPCA 1E99A 1H1TA 2HIHA 2OBMA 3IQEA 1SBYA 3LHFA 1RJ9A 4HQ6A 4JIMA 4NNOA 5KZMB 2PJRA 5EZ5A 3BCRA 4YJHB 1II0A 2ZUCA 1P1BA 4LYFA 3UPTA 1L4LA 4YROA 1DMRA 3LBYA 1ESDA 2J6CA 2C7QA 4YP0A 4XIJA 5KYYA 1PS9A 4H77A 5MF6A 4YAUA 3CISA 4R83A 1ZSVA 2FMHA 4GEKA 3QMPA 4AY5A 5BWMA 1LDMA 2R47A 3ZGXA 1P2DA 3A58B 5AVXA 5JNVA 3KQLA 3VHLB 1Z8DA 3HLYA 3GJTA 2YWRA 3D0OA 4PYRA 4B8ZA 2EHDA 3GRPA 2OG1A 4FD2A 4RHTA 5IBPA 4LRWA 2JHFA 1AO0A 1F8FA 2Y0CA 1IQUA 5KNBA 1D4AA 4HRVA 4JQCA 1D5WA 1GAEO 2H59A 5FNVA 5BR7A 1DCKA 2DHQA 2YR0A 4ZA2A 1XXHA 2QU8A 2ZUFA 1YVEI 4P93A 3O82A 5J4LA 1S2MA 4P4SA 1LNSA 4K26A 5GV8A 3OPYA 4R71A 3DT8A 3ZUPA 3OCWA 3UMCA 3TGLA 1JHOA 1FLVA 3A31A 5IYZA 2J5KA 2P67A 1CJCA 3UJHA 2AZXA 1RWXA 3BMCB 2J5BA 4RQUA 3IX7A 1O6ZA 4U7GA 4TSFD 3SMVA 1OU0A 4BC1A 5B7QA 4DNQA 5KOIA 2DMRA 1I3CA 2QVCA 4I08A 3RVLA 3BCHA 4DABA 3ANYB 1ZH4A 3L6EA 1K2WA 3AUKA 3PQDA 1OZFA 2VDMB 4WTOA 5SY9A 3K5PA 4R05A 3DDCA 1RI4A 4QE3A 4QLOA 4QYMA 4FQ7A 2XWQA 1W30A 4DEXA 1JR3A 4Z4HA 4G5XA 2ZIXB 4NCNA 3C1OA 1YDGA 3JRXA 5ADHA 1G21B 2JGJA 3KJXA 1MHTA 3ILHA 1PK8A 4QG7A 5A4MS 3AL2A 4KP7A 3GG2A 1NM5A 2UZ1B 3QQPA 4YK7A 3WWEA 4B4OA 3TM5A 2BEUA 1IEVA 1K7CA 4II2A 5FUYA 4R31A 1NC1A 4ZO6A 4OXQA 4F8EA 4ANFA 1Z62A 4IVPA 2Y1KA 4E08A 4ZWNA 2HWKA 1X42A 3NORA 2VUIB 5TQJA 2GN2A 2OYSA 4E31A 2Q4RA 3A6EA 1O89A 3TTWA 4BGDA 3DWFA 2QAGA 1R8SA 2XE7A 1GKIA 1UC4B 1Z45A 4WUTA 4QT0A 4P33A 3BH0A 3HDGA 2XBMA 2VL7A 3GRAA 4ZVQA 3FH0A 5A1JA 1S3IA 3HBAA 4CF4A 3AF1A 5DBFA 1XPJA 3G7NA 2EZUA 4E32A 3GUHA 4M76B 3EN0A 4DL9A 4TTVA 3WGLA 2ZB2A 1CRQA 3LY9A 4YRFA 1PEKE 2X8LA 4PPYA 4QUJA 4MLCA 4DSUA 2QVLA 5JARA 3P19A 1UM9A 3AUXA 3B1ZA 3ROEA 1K5GA 1U0RA 3AJAA 2D0DA 4MUGA 3SC6A 5EHZA 3UBTA 1PYDA 1EGMB 2I34A 3F5QA 3QA9A 5CHYA 4G3XA 1JIIA 1V8PA 3DM5A 4PQFA 1H2FA 2FMXA 4NJEA 1YB7A 1IULA 4G0OA 3DLPX 5LP6F 3B6ZA 1DC5A 3QNUA 1IBLB 3WFJA 1E3TA 5BV0A 4FJ1A 4D7AA 5KYUB 2JI8A 4OHBA 3FNBA 1KVSA 3IUEA 5DHFA 4DQLA 5JNLA 4L9RA 3K2BA 3EXEB 5TMBA 5K8TA 5DN9A 1JKJB 4QDOA 5SZJA 4BO3A 2ZBQA 3SZLA 4HNRA 4BNJA 4N49A 2AFHB 4GYKA 5LB4A 1N0UA 4R81A 1TDJA 4HMOA 2Q6TA 1JA0A 3DS8A 1YUNA 4QQKA 2XKKA 5DM4A 2P6UA 5CK5A 3MEQA 4FHZA 3IILA 1FXUA 1IY9A 2VO1A 3OZBA 1XN1A 3ER6A 1U9YA 1K8YB 1WZEA 2A0UA 3QBTA 2X0EA 5KNBD 1QTNA 3BWCA 4DUYB 3PPIA 4KSCA 5DIFA 5IBQA 5J4HA 3I09A 4NHOA 2RHBA 4L5JA 3QXXA 3ETDA 3FROA 4TQUS 5EL0A 1RPNA 3FI9A 3MT8A 3IQGX 1C7FA 3ZY4A 4ZDIA 5TJ9A 3V1NA 5IT4A 2AE1A 1D03A 2CNDA 1Z4IA 3I4LA 4OATA 1KPHA 5DBIA 2OQVA 4B6PA 1RLUA 2XVYA 4BWFB 1JYEA 1W9MA 1I3NA 3SC4A 4DIEA 4OKIA 1TD1A 3H1TA 1LNZA 4UKDA 5AI6A 4HEJA 4E15A 2PU5A 5ERXA 2WNSA 1NGSA 5PGMA 2CSXA 3I92A 2BP7A 1Z4OA 4WN3A 3VVCA 4Q1VA 4UZEA 1NN0A 4BV3A 5EY5B 2H07A 1XZAA 1SC9A 4NYMR 1JR3D 2JIOA 5CG2A 1OFVA 3FKQA 5L3SA 1M1ZA 3OU6A 4NABA 1GCAA 2EP5A 3IC5A 4RPJA 1Z4PX 5EFZA 1NQWA 2WJ3A 3DZBA 4RENA 4ZZ1A 2NSHA 2O4CA 5AM0A 1E66A 1QORA 1Q1GA 5DF1A 4XEHA 4YCSA 3VPXA 4IVRA 4RTPA 5I7HA 3L82B 1EGAA 4D9HA 1SXJC 2GAOA 3CLHA 2C2GA 2PCJA 2Q50A 2ZYGA 2ECQA 4HNGA 5EIXA 4EO9A 1YDEA 3AHIA 3LIIA 3U3KA 1K98A 3X1WA 1M1XB 3IAS6 2VKQA 2WWGA 2OILA 3WFZA 4MUAA 2H1FA 1Y8RA 3RB8A 3N59A 3WLJA 1QK3A 2GBLC 4TMXA 4CMHA 3K6SA 2GPJA 1DKPA 1GARA 4OSEA 5IW8A 2EYQA 2JAWA 5AM1A 4IDDA 4Q9HA 1PL8A 2H48A 3WGNA 4DIBA 3DWIA 3EDCA 3MFQA 3PEEA 2WWYA 3F1LA 2C7RA 3UJCA 2XV1A 4RLSA 4YGYA 1G8SA 1ZL0A 1MJGM 2J46A 2XCLA 1NT2A 4FWIB 4WZAE 5AP9A 3UQYS 1GDTA 1WMBA 2CXSA 2WHXA 2I1WA 3DM9B 4NP6A 3TFOA 4KXXA 2PYDA 2ZJ4A 2O1XA 3CX4A 2OTCA 2CDCA 4QT4A 4GOLD 1TJYA 3MRTA 4RZIA 2WF6A 3H5IA 5DBEX 2R7NA 4G24A 4UUBA 4Q3OA 2OCGA 3RWOA 4TUYF 1N2CE 3SDZA 3EC2A 2QR5A 4KQ6A 3DOCA 2XXJA 2GCGA 3DE1X 2G07A 4PG4A 4ME6A 4DY4A 2DFPA 4S0XA 1G17A 1M6NA 2YW9A 4O4LB 4AD8A 1X80B 3KQVA 4ZRNA 3UA3A 1XZKA 3EIXA 3TSOA 3UIEA 1BGWA 4R0VA 2OWDA 4IY1A 1FX0A 2QN1A 5LIPA 3SOZA 3H16A 4KOEC 3BL6A 2H1WA 4W99A 8AT1A 3CG0A 1RWOA 4K1LA 1UQUA 3FWYA 2ZJBA 4IWNA 3WGVA 3HBLA 2AR9A 4FILA 3EOBI 5DT2A 4C6TA 2O8BA 3CSSA 3K1AB 4EZBA 1HY3A 3QVLA 5DKFA 1AD2A 4PINA 1YL6A 1VSQA 2H1HA 3PD7A 3N2NA 5T41A 1PGJA 2ZBGA 3DL2A 3R5SA 1EUQA 1HZZC 1O5IA 2AFRA 1MZPA 3AZPA 1Z3CA 2NO1A 3LVFO 4BNYA 2H4YA 4NZYA 4R2LA 4ID9A 1P6XA 2VPZA 1QVAA 5KNDH 3RKUA 4HXFB 1XVIA 1KI7A 1U8EA 3ECAA 1P19A 3TRKA 2DUWA 3WJAA 3CLTD 3T1YB 4KQWA 4U4AA 1L7EA 1N4AA 4TLMB 2CJFA 2JVJA 4I8DA 2PS1A 4QBTA 4K9QA 1NW4A 3L6OO 1JSXA 1W34A 2BDTA 5HJ7A 2DGDA 1V6CA 3B9BA 3FDZB 1L7RA 1M6WA 2Q0HA 3IJRA 4M1ZA 3GAZA 5G02A 5A3JA 4IIDA 1PO7A 4X92A 4CKWA 3JQ7A 2D5LA 5AKYA 3EX7C 3EXG2 3ZBTA 3VVLA 1YTUA 3D64A 2HNAA 1THGA 4RJKA 1N0WA 1PUXA 4DLRA 1K3TA 4DDWA 4M46A 3BSWA 3SX2A 4V2UA 1UMKA 3L2OB 5F5LA 1KMIY 4XCXA 2HYDA 3DH0A 4HLCA 3PE6A 1HC7A 4LF9B 1X19A 4QTUB 3LVQE 1M2NA 2V7EA 3NBUA 2J6BA 4HAYA 3GF4A 3NP7A 4KN8A 4AKHA 4BP3A 3ZGOA 4A6DA 1EJ0A 1YS6A 4X6UA 3A2NA 2AHRA 2B36A 3TECE 3ZIUA 3SICE 3FCYA 2ZBUA 4YONB 1K8XB 4KKXB 3X2FA 4DXDA 2IX3A 2CVPA 1F9AA 2GWHA 2R48A 2FETA 1PZXA 1H3EA 1GAJA 3B78A 5LJIA 2XNCA 4WGGA 1FNSA 2JH3A 3OJLA 4M0CA 2PUDA 4KLRA 5AICA 1ECBA 2XRFA 4OQXA 4UBNA 5KU1A 1VPVA 3MLAA 5IDYA 1H4VB 3U1VA 1Q50A 2QX9A 2OUKA 3DAPA 3DLIA 1UZUA 4JLDA 2KBEA 1T36A 3ZN2A 4FT2A 3QW4B 5AIAA 3ILSA 3QHAA 3L1HA 2Y8EA 4M89A 1HK7A 4Q4LA 2ZSFA 4RD2A 3ZWCA 5DW0A 3S8YA 2FWIA 2I55A 2P8SA 3AR9A 1N2GA 5HQ3B 5KVCA 1MRZA 3GZ4A 1L4MA 2O0KA 3FOAA 4RK4A 4DJEC 4LQDA 2I7XA 3EZ2A 4L27A 1Y6RA 2CFSA 5CVVA 2J5RA 2VF4X 3ZY5A 1KSFX 4MVJP 2OD2A 3BKXA 4D6XA 4RTOA 2ZWMA 4EJSA 1T5IA 3KJEA 2P6RA 4QATA 4EATA 1RWBA 1XZFA 1M1NB 1U2DA 1CZRA 5JFOA 1TZCA 2A58A 3ZZ0A 3M5CA 4Y67A 1P5HA 2BKAA 1WBDA 5A04A 2EKBA 3QLUC 3IPXA 8LDHA 1G0OA 3WB2A 1R0SA 2O7VA 2WT8A 621PA 3TG2A 1UZLA 1NR1A 2O1EA 3ELYA 4R1LA 3USZA 4PPGA 3DL0A 1KE1A 3U7QB 4Z5XA 3SFVA 1YHNA 1YKGA 4LJ6A 3D3WA 1YVPA 4ZI5A 4Y9TA 5P8WA 1ISIA 4ZHQA 3CB2A 4O8ZA 1NXTA 2OORA 3CZAA 3PHIA 5LDGA 5LLTA 3IEMA 4Z86A 5EXXA 2DLNA 1E2LA 2VP5A 1QVWA 2BR4A 3DQZA 4KX5A 2O3JA 5IHXA 2F62A 2Y9MB 1GTRA 2B94A 3GN2A 3WBBA 3FTDA 5LD2C 4IIGA 3HN6A 5JHHB 2I9KA 1PLLA 4EMTA 1UBLS 3NT2A 4HWPA 2XXBA 1GZ7A 5FFFA 4EFNA 4TOIA 4A9AA 1GNVA 3DBHA 3EPPA 4TWJA 4E11A 4RD1A 2CLMB 3DUWA 3SLGA 5LM3A 4ARBA 3EPJA 2IU3A 3HCBA 4GE3A 2O59A 2Q6KA 4OUDB 2VR1A 2HUPA 1Q0RA 3A3KA 1MBZA 3AU9A 1D1TA 1M8JA 3AO0B 1CLEA 3MT7A 5H3HA 1WY5A 1U1GA 2RKBA 1Y1RA 3V7YA 1JP7A 4BBPA 1YXMA 1QO9A 3T1VA 2X5XA 1MH9A 3CLVA 4AJ1A 5B6IA 2ZIEA 3UUWA 1UWKA 3VDRA 2QTRA 2QUHA 5IXSA 2JA1A 4I5GA 4G81A 2VXCA 5K0LA 2HK7A 1U9IC 2HA0A 3KOXA 1I1QB 4GQAA 1Y9AA 2R751 3CHYA 3TL2A 4Q19A 4MA5A 3F46A 4C5BA 1B73A 1JG1A 1MB2A 1PN3A 3DOUA 2V6FA 3BTSA 4MICA 5B58T 4FFOA 4Y7CA 2OXFA 5DTIA 4C06A 3AFMA 2WABA 2P5UA 1EHCA 5TJHA 4JA0A 4YFYA 3W5SA 4D56A 1E2BA 2YZMA 121PA 4YJDA 1ELOA 1PJRA 4ESHA 4CDRA 4N47A 2QP3A 1JJ7A 1Q14A 4EPTA 5ABPA 3GELA 4Q18A 2PNJA 3DT6A 3I1IA 2HRDA 3JQGA 1VRCA 2C5SA 4ZMSA 1D1QA 2HQSA 1RVDA 1ES9A 3CH6A 5C18A 2GDJA 3QYJA 3T7IA 4U2KA 1G20E 1X2EA 3RSSA 3IP9A 4D9GA 4XTCS 3PJRA 4JEUA 3A4IA 2X13A 4DJ5X 4CWAA 5BNTA 3UGQA 3KHKA 1W47A 3JAKB 3ZEIA 5AM4A 3A9WA 2G9VA 2E4XA 2OQIA 3FRIA 1UK7A 3MJEA 3UENA 3X2EA 5K20A 3CVVA 4PR3A 1XALA 2BGKA 3TRFA 1FMLA 1LBEA 1T25A 4PNPA 1F2VA 1AY0A 2SHKA 3A06A 4I1IA 1OIXA 2RHOA 3RODA 2Y6UA 3UO8B 4GZMA 3WDMA 2RE8A 1E2HA 1XTSA 1X7WA 3T6KA 3FLAA 1G8HA 3USES 4UNPA 2IS2A 3BGSA 2E87A 4JJKA 3ZDEA 1V8BA 2COEA 3REQA 1XTTA 2WTUA 5FOVA 2DQ4A 1E60A 1BU8A 1V6AA 2PX5A 3KYDA 5CLQA 4BFTA 2RBEA 4WNCA 2L18A 2Z3WA 3BVPA 3SSMA 4D8WA 4NATA 4EIWA 1FP4B 2RKOA 1YE3A 2RJNA 3MLBA 2JD2A 4PAGA 4RXMA 1UT5A 1Q3HA 5LU8A 2ZBFA 3T3OA 3JQRA 2NZXA 1TM7E 3TAHA 4F96A 1PZEA 2QRNA 1CRWG 3ASYA 1UXOA 3LX5A 4IIBA 3BJRA 1KQ3A 3OCCA 1T9BA 4H7IA 4U0JA 3HDJA 1EFCA 2R4TA 4UC0A 5AI5A 2ZXEA 1QRUA 2BHLA 3NPMA 4OPMA 2D1SA 1ID1A 3FPKA 4WY8A 2FPIB 2ZDGA 2RHWA 1N0VC 2ZSBA 2HY7A 3GLTA 3ND8A 3SFZA 1F8GA 1QYRA 2P9GA 1KI1A 4EQ6B 4PEVA 3EYWA 3WXBA 1NXWA 2F3QA 7REQB 3PDUA 3AFNA 1DAIA 2JLXA 3AF6A 2JLVA 1C3OB 1OFHA 4EELA 5H02A 1X39A 2NU7B 3CV3A 1AKRA 3QNWA 4BVHA 5CA0F 1WXIA 3IAAA 4KIFA 1OXBB 3G3EA 4EI9A 4I4TF 1V5WA 4EUKA 1QV6A 1WF3A 1EFPB 1GN9A 1ST3A 3AHGA 1NDQA 2QKYA 1QV7A 4EY7A 5F1KA 4RVSA 4EG8A 1JLLA 4TZ0A 1EDZA 4UDYX 5DDIP 1DJOA 5DHSA 4EHLA 5T4HA 4HUTA 3AUAA 2IF0A 5JRJA 3FF1A 1X77A 2PWZA 3PVZA 2HCTA 1C4WA 4KQ1A 4S1TA 1E1RA 1ZONA 2GK4A 1YR3A 1XTJA 1XD9A 3AJDA 2PK3A 3Q11A 2BFAA 2N3ZA 1RM4A 1CZKA 4K6GA 5BQ3A 5AJXA 1O6GA 2ZI4A 2BE9A 3RU9A 3L4JA 3HADA 2D7CA 3QLVC 1XCBA 1ZVKA