3TCKA

Crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis - form 4
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
188
structure length
188
Chain Sequence
AEPLLVVGLGNPGANYARTRHNLGFVVADLLAARLGAKFKAHKRSGAEVATGRSAGRSLVLAKPRCYMNESGRQIGPLAKFYSVAPANIIVIHDDLDLEFGRIRLKIGGGEGGHNGLRSVVAALGTKDFQRVRIGIGRPPGRKDPAAFVLENFTPAERAEVPTICEQAADATELLIEQGMEPAQNRVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase
publication title Structures of new crystal forms of Mycobacterium tuberculosis peptidyl-tRNA hydrolase and functionally important plasticity of the molecule
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 54
structure length 188
sequence length 188
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 3tckA00
2JRCA 1RYBA 4LWQA 2Z2KA 4JWKA 4JX9A 2Z2IA 4QT4A 4JC4A 3TD2A 3TCKA 4HOYA 4DHWA 4QBKA 3OFVA 4IKOA 4OLJA 4ZXPA 4JY7A 3VJRA 4QD3A 5IKEA 4QAJA 1RYMA 4DJJA 5B6JA 3KK0A 2Z2JA 5IVPA 4FOTA 1RYNA 2NAFA 4YLYA 2MJLA 4P7BA 3P2JA 4FOPA 4ERXA 4Z86A 2LGJA 3TD6A 3V2IA 4FNOA 3NEAA 5IMBA 3KJZA 4FYJA 5EKTA 3TCNA 2PTHA
chains in the Genus database with same CATH superfamily
3LKVA 3EQ6A 2QX4A 4MP3A 1MAAA 1IHUA 3GBVA 5GOZA 2J32A 4JFRA 4YAJA 2BVNA 1GLVA 4HBZA 4CEJA 2NPIA 4XDGA 1U04A 2WE8A 1ZD9A 1RJGA 4E88A 3AW8A 5IAAA 1G9SA 3COZA 3RG2A 5LIPA 2QU8A 2V6IA 5MFZA 3CH5A 3M2PA 4ZP1A 4UEJA 3AK4A 1B00A 3AYZB 1XVLA 5IT5A 4MYRA 4ZEVA 1Z9BA 2KE5A 1D1QA 1UBEA 2FUG1 1T1RA 1WHTA 3H4VA 4WECA 4PRKA 3RFUA 3ZWWA 4BMPB 1W25A 4BQEA 4HXGA 4F7WA 2OAQ1 3TTVA 2JVKA 5C7IO 4U7TB 4P3OA 1X2BA 4ZQFA 1DBVO 2CC2A 4KJZA 4I1PA 1TMKA 2EOAA 1DKNA 1MO5A 2FSSA 2PTHA 2Q3FA 5EKDA 1J00A 3MMSA 4F9FA 3SJUA 4J49A 1MIOA 3DPIA 4N49A 1L4YA 1MO3A 2B5VA 3E9MA 4X1KB 1IPEA 4JELA 4IOMA 3C97A 3IHTA 3LRPA 2NVWA 4C3VA 4ZJUA 1BXGB 1P2BA 2VJDA 2W2LA 1T4MA 5E2AA 2C78A 3OZ7A 4L0QA 5IYZA 1WDLA 1N5MA 4PZZA 2JLXA 1Z5NA 1DJPA 2H92A 2QTTA 1PSWA 1M9NA 1UH5A 2VF2A 3SDBA 4CKXA 3MCVA 4EJSC 2C4WA 3CZ9A 1GTRA 1JI3A 3GMIA 4LRYA 4O4HF 4W7IA 2BBSA 2HQOA 2DTEA 2R44A 3WYFA 4PAGA 1G21B 1QQAA 4FOPA 2JGLA 1YASA 3D4PA 1PQYA 2Q5EA 3BL5A 3HVIA 4BQIA 4N47A 5KVAA 3QG5A 1HO3A 5E9JA 3TNYA 1ZN2A 4O2BB 4JGIA 4E5KA 2F59A 1V16B 3O73A 1SKBA 5LXTB 1ODCA 2A9QA 2FLVA 1ML3A 3NMUF 2CMHA 1E18A 4MV1A 3ISJA 3PU6A 1QMPA 3NB0A 5E7QA 3D0RA 3MVEA 3FE2A 4FYVA 4DDWA 4N5MA 1IDN1 1VLJA 2JPDA 4Q1DA 3D54D 2FMFA 5IDWA 4XKJA 1ZW1A 2FHPA 5K5EA 2ACKA 1UBJS 1YS4A 5JRZA 1UZLA 3VTFA 1VIDA 2RGNA 4YRTA 5KQLA 2A58A 3DFZA 2ZRAA 3AHFA 3C0KA 4L5CA 5CITA 2FRVA 5TJ9A 3CHYA 1SUIA 3LQQA 4JI1B 2QSZA 3O90A 4X7RA 3A6PC 1N2XA 5ALDA 2YKGA 1G17A 4RZIA 1VJGA 3OQNA 4QPJC 1DWUA 4BKPA 2UZ0A 4UREA 3Q3EA 1F48A 2OZLB 4V0MA 5GY7A 2QQ0A 2BOVA 5C1PA 4K8RB 1Z0KA 1FP4A 3ZHQA 3JQAB 3V2GA 2CD7A 2WHPB 1OX4B 3NVMB 1DUSA 1RIIA 1UL1X 1Z37A 2XNHA 4O4JF 4B7ZA 3TG2A 1RBMA 2O8DB 2PS3A 2I3ZA 3EQ2A 1Z6YA 3IBYA 4HZIA 1QF6A 4M1TA 4BUCA 4A2QA 4TTVA 1EUDA 4QFCA 1F4PA 5B2ZA 4AZTA 5CJ2A 3U3ZA 5JY6A 2ADFA 1NWHA 4OKIA 4ADSG 1E7SA 3H0CA 2HMVA 2NU8B 4UTRA 1HT1E 4Y1RB 1Y3AA 4O5AA 5T4HA 4EI7A 4R7ZA 4ND6A 1YJ8A 4LPSA 4JYAB 4GI5A 2XZLA 1QO7A 3T3HA 4QELA 3UFXA 2O0KA 4DCMA 5FBHA 2UUAB 2ZQZA 3B12A 4X1IB 3AQ4A 4YR7A 4JB8A 1JR3A 1XXHE 2QM3A 5EC8A 4C3UA 4LJKA 3UB2A 2EGHA 5FBQB 1AHPA 1ZQ1A 2V55B 3WIBA 5D3MB 2AGVA 2WHRA 3RSFA 2GM4A 3FJOA 5JZ9A 2UU9B 2FHSA 5BSUA 3MWKA 1I4WA 5I7OA 1OPXA 1S2OA 4PX5A 2DUJA 4FQ8A 1UMDB 1L7AA 1OWLA 3IL2A 5KYXB 3L77A 2P5SA 2WM9B 4RUKA 3SMVA 4A15A 3B36A 4XW2A 4YRAA 2FX2A 1Q0LA 2ID4A 5FFFA 1W85A 3LE8A 3NGMA 4HNAA 2AX3A 3EMVA 2NT4A 3ASVA 2FZLA 3UAVA 3WDKA 4US2R 3WRYC 3OU6A 4MQEA 1G7TA 4DN6A 1ZK0A 4UHKA 2BFAA 4NK5A 3KVRA 1GUFA 3CUWA 4GPTA 3V3KA 2QTMA 1JU4A 1W76A 2Y2UA 3EJWA 3ELDA 2FUNB 3ZGXA 4EVQA 2Z6QA 3DJYA 3ZLBA 2R4TA 2W2KB 3EIUA 1K5GA 1WF6A 1HEUA 1C30A 1UDAA 4BVAA 4F71A 1OF1A 5AW0A 4E7OA 2XGSA 1UXIA 1YC2A 3P52A 3QWAA 3K0AA 3ELWA 4U7PB 1R3UA 5CYOA 1GVNB 3IALA 1M2GA 1L1EA 1FUYB 1SUEA 1UEJA 2YHBA 3K1JA 2NUPA 4PAMA 5A0VA 3FDFA 4C0KA 3PX7A 2GOYA 3BXFA 3NJ4A 3QFCA 1VLZA 4E03A 1BHSA 1PGOA 3CNNA 5ALUA 1QHHB 3INTA 4D43A 2Z8YA 1DX9A 3ZNNA 4FX5A 5F51A 4I6JA 2D1TA 2Q3HA 3ZE2B 1UXKA 3P9QA 5EE9A 2C4MA 3K2BA 5SICE 1Z07A 5GJWC 1JFSA 2Z5FA 4QAJA 1T6XA 1J0AA 5DLEA 1SPXA 4H7KA 4BNTA 5KNBH 1RZUA 3MFQA 4AAYA 3FGZA 3INNA 2ZJ4A 2X0RA 3JQRA 3OIYA 4HDKB 4R31A 3SBXA 3W8NA 4NF2A 5GADl 3EPLA 2XA1A 1P4HA 3GLRA 2DBYA 3ESCA 2J31A 3MTEA 3WG9A 3GFQA 4I3HA 1L8QA 2X8LA 1E5QA 5ALRA 4PLZA 1M5TA 1O6FA 4JQZA 4HB2A 4NVRA 5CPBA 1F4VA 3WMRA 1OT5A 1CBUA 1HETA 1QZ3A 3UPUA 2QRUA 3A1DA 4GM0A 4O1HA 4LHZA 4KK3A 3WK5A 5F52A 1TEXA 2RAUA 4GW3A 5AT1A 5KPDA 1KO8A 4UMFA 5L3RA 1VPWA 2P3SA 3PV0A 4RZUA 5K8CA 3WKBA 1Q2XA 2H59A 1KAHA 4D3FA 2ZZNA 1Z75A 2BI4A 3IBSA 3RS9A 2NQ8A 1BCSB 2ZYSA 3IRUA 3F9CA 5PNTA 3UOAB 1LPNA 1LZKA 2RH4A 4EP1A 1JSRA 3OE4A 3L7OA 1H69A 3QLTA 2O2ZA 1MJFA 2OVFA 3NFRA 4EY6A 5KDDA 2COKA 4LJRA 1X2EA 3OFJA 1AK9A 3PF9A 3AB3A 4P7FA 1EQAA 1OHHA 4MW1A 2IV2X 1H2YA 3LP5A 5ILQA 3ZU2A 4RFSA 3PQ7A 4PLYA 2AT1A 2X5OA 2VAXA 3G0IA 4RVFA 4NMHA 3EW9A 4S1OA 3FTPA 4CDNA 1QDLB 2NZWA 5HFJA 3GUCA 9ATCA 1GNQA 4ZHQA 2QM8A 4H17A 2Z08A 2P75A 3C8MA 4FLMA 4D3XA 2OESA 2ZRPA 1YI8A 1Y8QB 5COAA 3LPLA 5EWLB 3HXTA 1PJLA 1ADCA 4MWTA 4QPZA 4LSWA 4ETNA 5CYGA 1KS2A 1NBMD 1P0CA 1PWXA 3GEPA 4DC0A 1A4XA 1DEKA 1YBVA 1CNMA 1GZ6A 4MCHA 3NNDA 4HF7A 4C7OB 4RNDB 1EA5A 2FR8A 3QLUA 2F7SA 3CH4B 3AM5A 4LRUA 4OI2A 5AICA 5DLPA 4WK0B 1ZH4A 3IQDB 3NBXX 4HR7A 4AO6A 4GWLA 2WZCA 2O2DA 4FBMA 5JVDA 2EQBA 3FRHA 3GNTA 4DXHA 3O8QA 1NVBA 4GOOD 1OI4A 1YMQA 4XQEA 4CHGA 3AJ9A 1XZKA 4CQMA 4MJLA 1T2UA 4WVLA 3D7NA 1KK2A 5FFMA 1F8UA 1MZVA 1LKZA 2B4RO 2PLRA 4ETWA 3GELA 2CNNA 3TPZA 4GOJA 4EPXA 2HLHA 1ZJ4A 4CFZA 1JHVA 4I7EA 2C92A 2I2XB 1XT6A 1LQUA 3M1LA 1JAIA 3Q3JB 4KLCA 3KIPA 4QDJA 1X7XB 3F6BX 2XYHA 4WRRA 4BNNA 5M5BA 3IO3A 2ZYGA 3PQEA 4KQJA 1LFDB 1A98A 4CM8B 1LVHA 1CYEA 2VDVE 2BC9A 2D2EA 1ATIA 1U9IA 3CLKA 2O1WA 1FFXA 3KLPX 2BFPA 4YXWD 3TX2A 2JEYA 3ECSA 3FSEA 4NBNA 4I6EA 2WYHA 4WY2A 1NNI1 2EJWA 2ZPTX 2VP3A 2AFHB 4V0QA 4HX2A 1UR5A 4CKWA 5ALHA 1IOWA 3AQIA 5DK4A 3HI4A 1S3IA 1HRDA 4WUVA 4PR3A 1UAGA 3H5RA 4A6PA 2PPVA 1EP3B 1E9VA 1SKAA 4HN9A 4UCFA 3UUGA 3UWMA 4YT5A 2P2NA 3SKYA 5I48A 2HF8A 1W88A 1GEGA 2H1LA 3CF0A 1Z4MA 3GFVA 5F9FA 3E7WA 1E98A 1E9FA 3PNOA 2VLBA 3RYHB 4UUAA 3SIXA 1QO0A 3TQRA 1T4GA 3HP1A 3VVCA 2XEDA 4F5EA 3BFPA 3K4PA 4O08A 1USVA 2ES4A 3HY6A 1H05A 2O8NA 4K9SA 4CF7A 1WU8A 1LNZA 2ZLBA 3KJFA 1A95A 2O2CA 4HEJA 5G4KA 3QFFA 4AG6A 3DDCA 4OMCA 5F3WB 1C0LA 5L7TA 3CLSD 1TD9A 3QVUA 4Z5XA 1DXOA 2VRBA 4G25A 1U0FA 1UAYA 3I3SR 1KYQA 1OBFO 3L46A 3RK4A 1MW9X 4AUNA 4J0CA 5J4YA 2YASA 5E1OA 3BWDD 3DZJA 3P9XA 2Q3LA 5IMSA 4EY5A 5K3FA 4TLDA 1PG0A 1ABEA 1G66A 4OU4A 3HA5A 1V1MB 1DDIA 4INAA 3VHQA 2OUKA 1JNXX 1A72A 3ETJA 5K8IA 2Q28A 4HFRA 3F8SA 3DOIA 2CLEB 3WLPA 5LYJB 4QLAA 1F06A 1SPBS 4UTZA 4LYFA 4Y6GB 3R5HA 4CKYA 2UVDA 1YR3A 2X3YA 4HCJA 3ROFA 1YT5A 2XRZA 4IDEA 3ZWNA 1PTJA 5AJVB 5A3VA 4FIZA 4H59A 2HAEA 4ITVA 1NI3A 1PR9A 1A7UA 2PD4A 4JWTA 4RQUA 1PZEA 2AN4A 4WJLA 2FEXA 2X2PA 3GWZA 3IA2A 1D1TA 3WGQA 1KKMA 4FT2A 3CCBA 1JG3A 4BNFA 2ZJ6A 2Q7OE 1J1ZA 1XEWX 2QLNA 4XX0A 5LYYA 4JI6B 1GGJA 1K75A 2PKWA 3VA7A 1C4KA 1QNFA 1T9ZA 1NYQA 4DMKA 4MKZA 3OEEA 1DI0A 4MKIA 1QG6A 2YUTA 1AG9A 3T9BA 3VR6D 1JTVA 1ZRNA 2YHIB 3TLMA 4DR7B 1X1BA 4KR7A 2I78A 3C8DA 4FFVA 3P97A 1GG2A 1CJMA 2BP7B 5TNXA 2JH8A 2BEJA 3KQHA 1Y4AE 3WGOA 4MICA 1GGMA 4K2HA 3KS9A 5J5VA 4BUZA 4PBRA 4BFUA 4BKRA 3SEQA 2VHCA 1N6KA 3KJQA 4LHYA 4RLQA 3W3ZB 5JNTA 1XKLA 2OKCA 5IK2D 3V7FA 1MG5A 1TA0A 3SC6A 3EPKA 3OHSX 1NVUQ 1OUMA 1KPHA 1Z5PA 1Z7EA 1UBKS 3I2IA 1E6MA 3K1TA 4ZO8A 1N0WA 4RKRA 3L6DA 3AVXA 4BLWA 4KYTA 5DM1A 3DL4A 1UJMA 3EIEA 1MC1A 1RDFA 1LDMA 3LQ4A 2AUNA 4NABA 3TH5A 2O57A 2A9KA 3E23A 3V8EA 2ONZA 2Z8XA 5T8KA 5MF6A 3HDTA 1P1FA 5HJ7A 1XA3A 1B0ZA 2X14A 3CZRA 2ERYA 3WLTA 3JAKA 4L9SA 2N75A 3CLRC 3MOGA 4ZIRA 3IXLA 5BUSA 5CLGA 3B48A 4IINA 5CFQA 5AUNB 3GXOA 4JC0A 5K05A 4ERXA 2P0EA 1CZLA 4EITA 1XPOA 4I0WB 3ZHSA 1O6BA 4PPFA 3C3JA 4KMOA 3JASA 2X23A 2Y71A 2ESRA 3SP1A 3H86A 2E6UX 1I7QB 2DY1A 4YVFA 5CCXA 3NAMA 4YAUA 3L6EA 3A6LA 1CQJA 1F2UA 3D6TB 3SKXA 3O1IC 2PT6A 4JR2A 5HYVA 5LP6B 4P4GA 3ZNQA 3JAMA 1ZNZA 3F7MA 4IAOA 4NQRA 4BBJA 1UDBA 3KAKA 1Y6GA 4ON9A 4POOA 2PSEA 4XJVA 5B1IA 3M5WA 2IIVA 1ST3A 2AC4A 5KNCA 2RCYA 1TFRA 2G06A 1A69A 4C43A 3G2QA 3R5TA 1FYWA 4P3PA 5A7GA 1YCFA 3N2KB 1YKGA 5FKJA 3LC1O 1Y4ZA 4C4PA 1AKQA 1LLDA 2QGZA 4DIFA 4RY8A 1EVEA 1S2GA 1A8IA 3BE5A 4NZOA 4EMUA 1R4NB 2A5DA 3INGA 3WJ7A 2PG3A 3USZA 2C59A 2D2XA 1TJYA 3QNWA 2CLMB 2XLBA 4QU5A 4D25A 2Q6LA 4HFJA 4JU8A 1SOWA 1ZJZA 1DO0A 2ZQYA 2XAUA 3QPBA 4UE6A 4Z7OB 4L3OA 3T0GA 1F7VA 2AB0A 3L40A 3W9SA 1GSHA 1L4BA 3LP8A 4QFBA 1NXOA 2WJHA 3IQFA 4HAVA 5E3IA 1P1IA 2BYTA 2CVPA 2XXAA 1BN7A 2UZAA 4RAQA 3E35A 5DEIA 1SCUB 3QOXA 1T36A 2IA5A 4BRZA 5K20A 3ZI7A 7ABPA 3C8UA 4KV9A 4B3FX 4JVLA 4BVKA 3COYA 4Q4HB 2HCBA 4YUAA 1HTWA 1PVDA 2WIDA 1LWNA 2OLJA 2Z2YA 3GR6A 4INJA 5P8WA 3L4SO 1XCBA 4NFHA 3WGMA 4BP1A 3VXKA 4EG3A 3CVXA 1W1IA 4DT1A 1MU0A 2OD2A 4WZAA 4QUEA 4EPYA 1M34A 1TI7A 1CB0A 1UIRA 2FK7A 5BNFA 3WFJA 3WNVA 1U28A 1TRHA 2XCUA 3KHTA 3QIAA 4KKVA 1HE4A 1KJNA 1DX6A 1OLXB 2I3BA 3ABQB 3E22A 2HCRA 3PGKA 3DBVO 4WBXC 2V7UA 3H9UA 4UNSA 1HL3A 3N76A 1EGHA 3QHAA 1IBCA 1W19A 1V6CA 3PWKA 4LXGA 1DRJA 3A4YA 3FMGA 5ALSA 1AV7A 3FCCA 5A6SA 1H4VB 2QR3A 1QIMA 3F98A 5CGQB 3WA7A 2CMDA 2QSUA 2GA8A 3PTZA 1QFZA 5KU1A 3OPXA 1NBEA 3OOWA 1ZGBA 3A9TA 1JIIA 1SUCA 3LLMA 4OQZA 1QYWA 4Q15A 2R1VA 3H2JA 5EGSA 1N6RA 3B7WA 4NCNA 1B8VA 2VUIB 4X00A 1KZ6A 5GIOE 3WBJA 2W8BA 1P3DA 4V1CA 1I9GA 1SWVA 2JHFA 1Q50A 3LWBA 4LZJA 1C7RA 2ECOA 3P45A 2UUOA 4N1AA 1FNCA 1OLSB 2XQVA 4UBLA 4YBZA 5KX5F 1CY8A 4YA6A 3RAPR 1N2BA 2Q50A 3C24A 4IIJF 2VDPB 1B0UA 1B2LA 1FMCA 2GZAA 2HLDA 1SG0A 1ZQ9A 4Q9JA 1ILWA 3U60B 4AUMA 5KOHA 1F3LA 3OO1A 5CDFE 5IUKC 3OM8A 1EUDB 2YWDA 3ITDA 3WZMA 4PC2A 3ZD6A 1TGYA 3KPJA 3ZWMA 3WIOA 4H1TA 4JT2A 3TQIA 4CKCB 2GA9A 4KXLA 4OOFA 1RNLA 4ZO9A 3IDAA 3CCCA 2IU3A 5LQKA 3DE0X 1WXXA 3DHWC 2GBCA 4YP0A 2CUZA 2QI9F 1XSEA 2Q4OA 3TMAA 5FX2A 3ETDA 1HMYA 1BJTA 1EGVB 1N2CA 2CMKA 2R8RA 1R5JA 3HKDB 3HY4A 4JFAA 2VCEA 1YTLA 3TOCA 4ZWNA 5ALLA 3L1IA 1Y48E 5GVRA 4CPDA 1Z68A 1APBA 1JA1A 3IUSA 4S0ZA 4EA7A 4EJ6A 2ZZMA 1WMDA 1T6ZA 1G5TA 1J09A 1W4CA 3MTAA 1MABB 1R0ZA 3JSAA 4TYNA 4MWEA 5I7EA 2VJMA 1WMBA 4YRFA 1VMDA 1US8A 1Z5ZA 1X9HA 3E81A 1U2ZA 1HDXA 1Z5VA 3DAYA 4PZDA 3ZU3A 5IUJC 2XYPA 1ADGA 5TDHA 3H8WA 4KYVA 4M54A 4K9NA 1KBZA 3C7TA 3CIFA 2X77A 3M4YA 4H7EA 2PD6A 4TUYF 4MEJA 1E94E 1I3KA 3PKIA 4TTRA 1GUZA 2JBWA 1ZJ6A 1ZISA 1EJ0A 3BGSA 2I29A 5FA5A 2E5LB 2NYVA 3R5JA 3KXIA 2AN9A 3PGJA 4CTJA 2WJ6A 3DBLB 5IAOA 1NV9A 4A36A 4BNXA 3DOEA 1SEVA 3IKLA 4R1UA 3SNHA 3FOEC 3PUXA 3BE8A 1N2IA 3BRQA 4GSYA 2BEKA 2Y1XA 3MWJA 2PSFA 1FRFS 2R8BA 3OCVA 3QPWA 5JZSA 1G3QA 4M1MA 3PEUA 4N5DA 1U1EA 2BFBA 1Q14A 2DTXA 2OCPA 2WM3A 3I9KA 2V7GA 1RM4A 3TLAA 2ZULA 5TGTA 3CLTC 3W34A 3KUKA 1MFPA 1FFHA 3GPDG 1AKEA 2WG2A 5L8VA 4R5MA 3AHEA 4II3A 4YCCA 3QMVA 4EVIA 1JH9A 3OIDA 4BLPA 1C9KA 4YWJA 4QOIA 5HKOA 4RKWA 3R6LA 2R5NA 2HM7A 4ZAFA 2GFIA 1DBRA 3IR5A 3OKFA 3AIOA 1B4DA 4QNRA 3DXXA 4UNIA 1KY4A 3THWA 1AKTA 3GLHB 1RXEA 5LC1A 2O1EA 3DZFA 4D4JA 4EB0A 1KORA 1N9KA 3MGCA 4N3CA 3BX1A 1GRQA 2F1RA 1N2EA 2Q29A 3FW1A 3MUEA 1WPXA 3QF7A 3W8RA 1BHO1 1T5HX 2GPBA 5DASA 3FPBA 3HU1A 5HRAA 1Q11A 4D98A 3DO5A 4QSMA 2R96A 4D3YA 4MHSA 1E4OA 3LCRA 3ZE0B 4KTVE 1GUDA 1D5WA 4B7XA 3TGLA 1JQKA 1TGVA 2IXBA 2J9GA 5HKKD 4HH4A 5CXUA 1SOMA 3U4QA 1RQLA 2V6MA 3WO0A 3GFTA 4YROA 1MXHA 4J6EA 1I4EB 2P3OA 5CVUA 5F64A 1F1BA 5CB4F 2TMYA 3I8XA 3U5ZB 1T0PA 1DKOA 1S9HA 2F8SA 1INLA 1GGEA 5BVGB 4NOLA 5EKSA 5JAOA 2RC5A 3ZE6A 1NLYA 1HOXA 3RJMA 1LZLA 1R6XA 1EYZA 2ZYWX 3F9IA 5FPTA 5KVSA 1HPLA 2XB4A 3NV9A 4F3TA 5JO0A 1TVMA 4PG7A 3KZNA 3OICA 5JAIA 2IUTA 4KRYA 4AP9A 4M53A 4B80A 1LV8A 1V2GA 4JI4B 1DOHA 3I58A 4FMDB 4FW8A 3OIUA 3OJ0A 4Y7CA 4RJ2A 3IR7A 3J7TA 4EW3A 1XA0A 1ZUD1 3QTBA 5BQ5A 4P4UA 3QV1A 3REQB 1QB8A 2ZKLA 2GWRA 1VHQA 2YXEA 4MLDA 2A5YB 1U2EA 2FZGA 3U7QB 3NC0C 2CWWA 4QEDA 4BLQA 5FOWA 1LB1B 4FYWA 2NTJA 3OECA 4B6PA 1XVAA 1T1GA 1FX1A 3KVVA 1N8TA 4RVOA 2HNKA 2M9MA 4UC0A 1BDIA 3PYLA 1TUIA 3VJRA 4R2WA 2XRFA 2E18A 3RS8A 1SHJA 1NYRA 3RVQA 3AWIA 3AJ8A 3E5RA 4TWRA 1U8EA 1C81A 2FFAA 7YASA 2QD3A 1UOOA 2R6R1 2C31A 1IEWA 1M2FA 2XZTA 3LT1A 4ZO4A 2ORVA 2WHQA 1TZJA 3AFHA 3OD5A 1DV2A 4G0YA 4F9EA 4KGXA 1J06A 4Q3NA 1Z6AA 2UYGA 3E7PA 3OU7A 5LMUB 3UO8B 3UJNA 1M8PA 2D5LA 3IJ5A 1E0SA 2BWJA 3WNZA 5AVZA 3ICEA 3QYJA 2N42A 1QONA 3GJ4A 2HJHA 2IS4A 1E1LA 4I5IA 4DC1A 1F8FA 2GKSA 5AI0A 5ALYA 5J2UF 1N9ZA 1SA0A 4RESA 3WWEA 1GL3A 4YQEA 3JQEA 1XALA 4V2UA 3X1XA 3EVDA 2BLNA 2IYTA 3ESRA 3GLUA 3PRYA 5CVCA 1ZHOA 5CLIA 2HIHA 1M5UA 1RQRA 2OWDA 5ARCA 1EB8A 2V97A 1D4FA 4BWFB 3RAEC 3ZE1B 4G8DA 1JQAA 1MEJA 1HNNA 3KT3A 2GEUA 1M6EX 4H31A 4UDXX 1X77A 4WKNA 2H16A 5AYVA 1TIBA 3HNOA 3IP3A 3C8ZA 1FUUA 2Y9MB 5CX1B 3GQBA 4YRBA 2I1QA 1Z6QA 5ALMA 4LF8B 4EBBA 1IULA 3QU2A 2YW2A 1QKJA 4MKRA 2QN2A 1JW9B 4UAUA 2RARA 2NYUA 4LTNA 5JJLA 2I2AA 4NZYA 3RQIA 4PGMA 5EFZA 4JP3A 4JH0A 2MSEB 1FP6A 3S81A 5CP8A 3KR1A 1E9DA 3STWA 3TE7A 2G5CA 3N2GA 4FDTA 3ZWVA 1ZHHA 4HVCA 2DLCX 3ZCXA 3GD5A 4AKHA 1VL1A 3RRYA 3D6MA 2IBTA 5L95A 3EHDA 3DO8A 3ZDEA 3EB9A 3F5FA 4YREA 1WE2A 2H2AA 2FW9A 1ZRHA 1B8UA 3ZHRA 4YMIA 4Q9KA 4BRSA 2BFDA 4KYIB 5EE3A 1ABFA 2OMEA 2QW0X 5BSVA 5REQB 2PO5A 3GUHA 4R8MA 1VZ2A 1DUIA 1L7EA 1RYEA 1YQTA 3C45A 5KNDA 3K0SA 2C3YA 2ZIUB 3BN3A 4GICA 1IIBA 4GPD1 4S1PA 4WA8A 2VF7A 4P0QB 3FZGA 3K9QO 1A88A 3TLJA 5COQA 2H9AA 2J5RA 1T0BA 3GY0A 5FI0B 1ZAYA 3OLZA 5TF0A 3IBGA 1YL7A 4XCQA 5ADUS 5G1PA 3L05A 1BH2A 5DYGA 1KU0A 2VF4X 3MNFA 1CULC 1G0OA 2C7GA 1YS2X 3FLEA 4YRNA 4HDRB 1EBBA 1M6VA 3MWDB 1LEHA 3F6SA 3NVAA 3P9NA 2FX3A 3QFTA 3PUWA 3ZNPA 4CNBA 2SBTA 2YR0A 4OATA 3M82A 1L5FA 4J0JA 2AXQA 1M0TA 2OO5A 4UBKA 5FJJA 4K6CA 4TMFA 4WKPA 1U8XX 2O3UA 2EBUA 4E2WA 1M75A 1QC5A 1IN4A 2PRKA 1KH1A 1UXGA 1VG9B 2PRSA 3II6X 3ODPA 5E6SB 4F2DA 5KDOA 5KU7A 4BN5A 3AV3A 5KTSA 4OUDA 1M1UA 1ZUIA 1WMSA 1KY3A 4V38A 4KO1S 4JCOA 1CZUA 2KYRA 3I0NA 3FHOA 2WYIA 5D86A 1IRIA 2OCBA 3EZ7A 1A9QA 5TY0A 3UMJA 1H8ED 1UZNA 4PGHA 3U0BA 4GYYA 2ISQA 3FTCA 5CMLA 2RAPA 4ER3A 5IKPA 1A9SA 2V03A 2GF9A 3TCXB 1XELA 4LIPD 1BGWA 3AFGA 1OZ0A 4QUBA 5B4VA 1EFRD 3DE5X 2FWPA 1E92A 4FFOA 4UBOA 4EQ6A 1PJBA 3LNCA 4ALJA 5FYDA 2P9BA 1AGNA 4DM7A 2J9FA 3LYHA 4ZVPA 1X42A 2ZJ7A 1EM6A 1EVLA 2BJWA 2OQIA 4TSRA 1GCOA 2WHYA 6LDHA 2OTCA 4Q1CA 3PXAA 4YXWA 1TAQA 1MQ9A 2OBXA 4A4DA 3REOA 4UHFA 2E87A 3H3XA 1X70A 2VSQA 4LV8B 4WE3A 3UICA 1TVCA 4MO2A 2V4UA 4MKGA 2BMEA 4I5EA 1R6DA 2MJLA 4BLTA 4U3JB 3FYHA 1NQWA 5EWMB 3TSCA 4G26A 4PLFA 3NWBA 3A1EA 3R74A 5EYPB 1CUBA 1YGYA 3T1VA 2K7ZA 4PRLA 2YQ4A 3WSTA 4B6JA 3Q10A 2PX8A 2J5XA 3TS1A 1XZLA 2QAGA 2IYRA 1JLHA 2H4YA 1QRAA 1PZFA 3G2OA 4R2HA 1UJ4A 1XRJA 5ADHA 2CV1A 2HPZA 1I94B 1YFKA 4MTCA 4D9MA 1U0NA 2J07A 2AOUA 4DSAA 4JOSA 2FMHA 5BUCA 2EFEB 4DRXA 1MW8X 4FJ0A 4QX6A 2KM1A 3D7SA 1RYDA 1O97D 2HTEA 1EM8A 2AFIA 3KELA 1WXIA 1JT2A 1X1TA 2JGDA 4GR5A 4KO4S 1XTIA 4MGYR 4QYMA 5DISB 5B1DA 1IN6A 2OV2A 1FW8A 1IG0A 1V4NA 4QYTA 4RPIA 4MUGA 3ZY2A 3GRRA 1ZJWA 3TQQA 2Y4OA 1FFYA 1RQ2A 1WULS 2WWGA 3K9WA 5MGBA 1TLTA 3MIZA 5IXYA 1WB6A 1TK2A 1T9CA 1GRNA 4LZLA 3RSGA 3C6KA 1L5WA 2WP0A 4MW0A 4XWKA 1XLTA 1E3TA 1FXUA 1I0LA 2PIAA 2AYXA 4ZQIA 5HS6A 4P4TA 5TMDA 1T2DA 3S68A 4U5QA 3KJHA 3IV6A 1Y7LA 3IVGA 4PNHA 1BW9B 3OKCA 3SD7A 1YDMA 4AUEA 2R8YA 3U7HB 4XVQA 5ENVA 3KSZO 3SE0A 2P91A 3M8KA 1DNPA 3MUFA 4YFVA 4QXOA 1XE3A 3AUUA 1Y3DE 3MA0A 5LKRA 3CPEA 3BMXA 3ES9A 4BJ1A 2HA0A 4MVWA 3GD7A 3NAGA 3WLAA 4C7MA 4FQ5A 3UZUA 2RHLA 3ZDDA 2M1XA 4K3VA 1ORWA 2HSWA 1Q95A 4JEHA 2C2YA 3KYBA 4G0VA 3EFBA 2I76A 4QFDA 5FOTA 2BHSA 1ZKMA 3VR6A 3U1VA 3ORYA 4GKBA 1NI4B 3QY9A 3RTBA 2X9NA 4Q9HA 1JQ3A 4N5NA 1Z0ZA 4HGNA 1PR1A 3K3PA 3OURA 4Z8XA 3Q15C 4R9RA 5CPFA 5C1OA 4QPNA 4D80A 3SOZA 1YMUA 4FC7A 3TLZA 1C1XA 4LV6A 3H18A 1VG1A 4XDYA 3QELA 3V4ZA 4DPLA 1P73A 1TYAE 4F85A 2Z1MA 3CLUC 1XVTA 4L16A 1VPTA 1CQXA 5A9TA 2ZW9A 4YRDA 5ECGC 3AJRA 4DG5A 4XGRA 4YJDA 5BW6B 2OD7A 4F4CA 3E3AA 3C3KA 4L8WB 1Z4QA 2IXEA 1Y1RA 3LY9A 4J0FA 1DARA 2N9UA 1N5JA 4PFJA 3WB1A 2NVUA 4WGGA 1AZSC 4C01A 3CG0A 3BWYA 1F4LA 2Q07A 1IK4A 2P9EA 2H0AA 1G3IA 1OFUA 3IAM1 3BH0A 4YGXB 3W5DA 1GKUB 3OAAA 4AS3A 1X7WA 1KO5A 2QBYA 3K1AA 4CMJA 3QEMA 1GTZA 4O3MA 2GCNA 3SC3A 3CRW1 1FDTA 5BR4A 1NQXA 1KDRA 3W6PA 3UMSA 2MSLA 2VDLB 4TL8A 1Y3CE 2ZANA 3O4GA 5TEVA 1CRPA 2Q8PA 4OCZA 3VVLA 4UTPA 1ZCAA 2WTMA 4BJ3A 3OIVA 1QS0A 2OWEA 3A6EA 1X7YA 3ZXXA 2LBPA 7GPBA 3GLFE 3HB5X 3A9VA 1HE5A 4XUGB 5JIBA 3N3AC 4O25A 2QYHA 5TPZA 4LVNA 4HVLA 3H3FA 4XQGA 1E9RA 1YQXA 3U37A 2MINA 1QGUB 5ALWA 1KAOA 1HXHA 2JGIA 2FQYA 3AI3A 1UFOA 1RJWA 2C7BA 4QGGA 1YACA 2NXEA 3FRIA 3IELA 4ENVA 2D8AA 3F90A 4BP9A 4IG9A 4N8SA 4ZZIA 3P8ZA 3PICA 4K86A 3ZD9A 2BMVA 2J5KA 5LQRA 1UK9A 4O2BF 1QYDA 5BXQC 4HXYA 1YH3A 3ZOZA 3E05A 4PINA 4MVJH 2BDEA 5LXTF 3D3WB 5C32A 1KK3A 1NV8A 1N5KA 2PSJA 3EGVA 4ZT5A 1A4RA 2P1ZA 4Q1VA 4YTEA 5IDQA 5CW2A 2K6GA 5JXGA 5JSHA 5LLDA 3PJEA 2VT7A 4FJ2A 4BU1A 1BS2A 2YBEA 1XHEA 1YI0A 2HKIA 3EVZA 3EXHA 1BMQA 3B53X 3ZI0A 2PY6A 3ZCSA 2WYVA 3W5JA 1AO0A 1DKQA 3AL3A 5ALQA 1MTOA 2DUUA 2XVZA 5IJXA 3WL7A 4YMTA 4RULA 2QVYX 2VLIA 3FUCA 3IUMA 3AIKA 3UANA 3VYUB 3DO6A 1K2WA 3D4OA 3IP8A 2AYYA 2XUJA 4L8VA 2RKOA 2RCNA 2EZ4A 1Z6PA 2PK3A 1WP4A 2TMKA 4FDUA 2YYAA 3SC2A 2VVTA 2ZTVA 4UFOA 1LPPA 4WXMA 5D3ZA 1KEVA 1VBNA 2D5AA 2WD9A 3D6VA 5GJVC 3I5XA 1PW7A 3AFIA 4CDGA 3KPWA 4YNBA 4OL9A 2YNMD 1OB2A 1N0UA 2GBPA 2H52A 4ZOAA 4N03A 3GLIA 4HQNA 5A5EA 3FF4A 5KYNA 1AUXA 4X7BA 3BAFA 2G80A 4REQA 1IM5A 2I6GA 4WOJA 5C4GB 2F43B 1OLOA 1OZHA 2YHSA 4GKVA 2J3KA 1XQ9A 4DV5B 1AKWA 2V7PA 4RIEA 4B3XA 3DAHA 1USKA 3PFFA 4KLRA 3BXOA 5I45A 1VL0A 2C7QA 1XPRA 2PVCA 1P4RA 2JRCA 1CZKA 3DCYA 4H3VA 4MQLA 2RHDA 2CCJA 2G28A 2X76A 3RRXA 2PMCA 1AB6A 2XWSA 4I55B 5EXPA 4CT5A 1FLAA 1KDOA 2RGCA 4RZ2A 5KCMA 4MYTA 1IN8A 2JFWA 4H1WA 4K9RA 3KOOA 4OLBA 2H1FA 3R3YA 1D2CA 5E7IA 1XK6A 2GD2A 4J2OA 1E9CA 3CRRA 4X20A 3ZIUA 5EAIA 3OPVA 2X6TA 1TX4B 3O74A 4PLGA 3ETEA 4D4KA 4BIIA 4YUWA 3C14C 1PJ4A 2JCYA 4G4SO 1CUSA 3DBRA 3I5MA 4K3UA 3C1AA 4PF1A 3JZAA 3T0FA 1E20A 4PLCA 1OREA 5FUQA 5DKFA 4EG0A 1YE3A 1FC0A 5JQGB 3GC6A 5D7NA 2XUHA 2Y0DA 4AY5A 1YIAA 3SQWA 3UKJA 4BVEA 3UK2A 4WK2B 1VSBA 4CNQA 3KSBC 1FFSA 3V4VB 1SVWA 1U8UA 3DB1A 3WXMA 1SBNE 2Z98A 1Y1QA 4IH9A 3VSEA 5IDXA 1UDXA 1GA6A 4BNVA 3SZ3A 4OQMA 4CUKA 5M34A 1YB1A 4V3BA 4EF6A 3SYMA 3WDLA 2B6HA 4AYTA 2FKAA 2POQX 4IH1A 4CKEB 4CM9D 1YS1X 4EELA 1WSWA 2WU1A 4U4AA 4CQJA 3OQHA 3ZY3A 3M7IA 5CXXA 5E2BA 4ETMA 2IYXA 4K9PA 3L7CA 3HBNA 1I1OA 4ZJZA 2Q2NA 4EHIA 1QP4A 3MT7A 3WK8A 4BMXA 1OC4A 3UCXA 4CMKA 4EATA 1P6UA 2P9YA 3P5BA 3PUVA 1EXVA 3MG9A 1RABA 4BNDA 2A0FA 5G41A 2C20A 3DTVA 1D3AA 3K6SA 3SDSA 2IHJA 4UFNA 4X9XA 4EI8A 3RRBA 4R1PA 3W79A 4PCLA 1EUCA 4H2DA 3ROKA 5HE8A 4FJ1A 3OLQA 3NTOA 2KW5A 1KSGA 3QUAA 2DZDA 5F5NA 5JBIA 4YRLA 2B34A 3AI1A 3ET4A 3IP6A 3O38A 3STUA 2ZYRA 3GAZA 3LA8A 5H16A 2JCVA 1E2DA 1T2AA 4LCEA 4PYMA 1R6VA 1AS0A 2O8CB 5IASA 1KIAA 1L4FA 3B6KA 3RWMB 1O57A 3EXG2 1I3CA 3UQZA 1KE2A 2LIVA 3WX0A 4EYOA 1R74A 4X44A 1FNMA 4DA0A 1XEFA 2BGKA 2V54A 3BH7A 2K4MA 4OK6A 2XMQA 4URXR 1PZGA 2RGAA 3ISTA 1J2EA 2JH3A 1CF9A 1NJ2A 2A84A 2HDNB 2HBQA 3KCNA 4GGOA 4H16A 1V5WA 4M1OA 2IK8A 1QLJA 3N2NA 1KOJA 5FA6A 4UNQA 5TGZA 3KPVA 2C3OA 1Y6RA 2WINI 2YZMA 3HN7A 4EHFA 4MA0A 1TO1E 3RHZA 1P1JA 4DYDA 5BMVB 1TAUA 2LCFA 1LVUA 3MCTA 2IUUA 3A1NA 1CS4C 3SM9A 4G1EB 4M9SA 2VPQA 4B4KA 2AF4C 3D1LA 1E2HA 2GJ4A 1VL8A 3HDJA 3IMKA 2H7VA 4HYYA 1ONSA 2GR9A 5JNSA 4PV7A 3SHQA 3GT3A 5L45A 1OYOA 4EPWA 4ZI7B 1YE8A 1B26A 2V7QD 1M1NA 3PP8A 1XDDA 3T6KA 2JEZA 2A1TS 4G36A 2G0NA 4HSEA 3KKQA 2XH8A 1G0NA 1HLFA 4UHJA 5JLAA 4BX3A 5FEUA 1VYHA 4QYSA 1KO7A 1QV6A 3HB0A 1ZMRA 3JVUA 2R97A 4FNAA 3TZ6A 2F9LA 1SVMA 3W1VA 1A9RA 3LKDA 3PNQA 2IYEA 2YXLA 1T29A 3JZFA 3BCHA 4CLDA 3TRFA 4F4FA 2G83A 3ABSB 5HRCA 1AQNA 3FTFA 3ZTTA 1DZIA 1TZBA 2R1TA 5LFAA 4ZVLA 1JB1A 2CUTA 4I5FA 4L3WA 5M29A 4ED9A 4Q66C 5HKKA 2BFEB 1QIKA 1TJPB 3FVVA 4EFDA 3GZTB 1DAIA 4BUJA 5HIIA 4O0MA 2FH5B 3GFGA 3GMDA 5E8JA 3ZHTA 2MOKA 1DELA 1QQBA 2WJ3A 2C9YA 3I8SA 3W6OA 4D0GA 4FQ7A 3MJFA 4IYJA 4GDFA 2IV3A 2F90A 1DG9A 2ZBRA 5EZYB 2QTHA 4HLCA 3B13B 5FIUA 2X41A 4RA6B 4EABA 1JKJA 1JT9A 3EVAA 1P77A 1MDBA 3PXUA 3BCSA 4NENB 1W34A 4U8GA 2NUTB 3E82A 4BB5A 4TRRA 4EJSB 2B9EA 3RVLA 3IQIX 4QYXA 4GQAA 2C3UA 2PZLA 4NPHA 2RGXA 2QRKA 2JFZA 3OCXA 1M0WA 4XQ9A 3D7KA 1MJHA 3IMEA 3KTOA 1NKVA 3VOBA 2ZTLA 3BUSA 4HO1X 3OHPA 4HOYA 5AH0A 2JKZA 3IFSA 3ZWKA 5MDHA 3HL4A 3W5BA 1Q6ZA 4D5GA 1H5NA 3L6CA 1V5FA 3GYGA 4J16A 1A1SA 2IU6A 4L15A 2GAOA 4OPMA 2H7CA 2ZUCA 1CJVC 1E60A 1I24A 1RXYA 2VQ3A 3NGLA 4XR9A 5LDGA 1YHZA 3T7TA 3USCS 1KZGB 2DFKB 1ZYUA 1KBOA 2VYFA 5LA6B 4ALNA 2HNBA 3L8HA 2Y0EA 3BGDA 4YRPA 2GNOA 1N0HA 1LY1A 3B6MA 4IQ4A 4D57A 4QJ3A 2HTFA 2O07A 2JGKA 3E3MA 5ELMA 1AHIA 5SYNA 4R6WA 5DIFA 3TUIC 4DNOA 4MUFA 4DSTA 3GLGB 3R9XB 2A5JA 4M8IA 4HJXA 1GPYA 2VF8A 2P1RA 3FOFC 3E2PA 3MYRA 4TXJA 3ZCUA 1N2HA 3PF8A 5DLYA 2OBBA 1N5IA 4PO3X 3VI4B 2DLDA 1PZXA 1H8HD 1RLJA 1G7RA 1T9KA 5EJ2A 4G4JA 2QTCA 3FVRA 4CLRB 1ICIA 1SGWA 3RTAA 4ZJYA 1KWGA 1PGJA 3OJLA 3SHWA 4N65A 5JASA 2AKEA 2HMYB 3ONFA 3I8OA 4OSOA 3OQIB 3D8BA 4CIAA 3WXBA 2H1VA 4O4IA 3WGNA 4LWZA 1MJGM 4BPRA 2D1FA 1WOMA 4B4WA 5DHSA 5IMBA 4ZFNA 3CH7A 4KEAA 5CDSA 5F2OA 2CV2A 1WQ1R 4GPEA 4L78A 2YXNA 4F60A 1E64A 3MS4A 3ZWDA 1B43A 2HHLA 4OQDA 3CC8A 4D4IA 1E8NA 4AJNA 3LPAA 1T0JB 2J41A 4JMLA 1RVDA 4DVJA 1D07A 2P27A 3FMVA 3K53A 2ABWA 3EG9B 1CUGA 1KSFX 2ZYTX 4TKUA 1N25A 1S2IA 4QBGB 2CT8A 3GP5A 4L5BA 2EGGA 3PBKA 2BUAA 2J48A 5AKLA 3S44A 4ZO6A 3DLCA 2WTEA 2HJ9A 3CKLA 3I42A 5EJEA 3EZXA 5KYUA 4S35A 1LTHR 1YRQA 4R51A 3FFAA 4AS1A 4I66A 4PX2A 1M3SA 3T3IA 3M6WA 2OAP1 2IPMA 1JJAA 3S27A 4EGSA 1A8QA 3MXTA 4KC0A 4L74A 5DBOA 2HX1A 2X8JA 3MJRA 3T5MA 4KDEA 4MCJA 2PYZA 2E4XA 2DFVA 1SMKA 2C5BA 3QP9A 4QOHA 3ZIAD 2VKQA 5LYJF 4Y2GA 3WZ2A 1BKDR 4WZBA 1XZEA 4DJAA 4AQ7A 1WSAA 4Z9YA 2PA3A 2HDWA 3VSCA 5ARBA 2F3SA 5CBPB 1G291 5DI3B 2G1UA 4OX9Y 1ZCJA 4IUYA 3C70A 2N0SA 4YDSA 5EG5A 4TZKA 4ZYYA 3RS2A 3GVCA 4IUDS 5DM2A 3PTAA 4AECA 1OFVA 5ILGA 4QRHA 1KOFA 1D0IA 2JFPA 2XF2A 1F2DA 4GI7A 2J9RA 5KQPA 4ZCSA 1GAQA 1Z33A 1NM5C 1Z47A 3FROA 4HI0E 3SPXA 3TFOA 3IAS6 1E2PA 1ZINA 3H11B 1EK6A 3BOSA 4R54A 4ZKDA 4MKHA 2AG0A 4IDNA 1YHYA 1SZCA 6CHYA 6AT1A 2BKUA 2C4VA 1X14A 3I9V1 3UYLA 3BHIA 2GRAA 4MS3A 3KBOA 3WRWA 5EE1A 3I9JA 3TIIA 3DQPA 1C7FA 2I7DA 1D04A 4PG6A 1CUFA 3NM6B 2V4MA 4J0IA 3UH0A 1ICEA 2ZWVA 4G1BA 5H7XA 3JSXA 3WGUA 4BVBA 5ITZB 3PEYA 1HT2E 3MYYA 1ETHA 3QKSA 2QGFA 3VO2A 2ZRKA 1SK9A 3KKNA 3H1GA 3GQVA 2ZAGA 5U4QA 2CXUA 3CNHA 2OZEA 5CXSA 4A26A 4I9UA 3STHA 1H8EA 1PYGA 4G5FA 4IVNA 5CLHA 1RBZA 2Q46A 3WMFA 2H85A 4PN7A 2NTNA 3LRTA 1H23A 4UMVA 5C3UA 2Z4SA 1YZUA 2YOFA 5HHTA 3AEKB 2Y4NA 4YQFA 5IU6A 1EGAA 4BQNA 2FF7A 3VR5D 2AOVA 4NICA 5DMXA 3BFJA 1KFCB 4ND1A 2GS9A 4X95A 3GO4A 4EYKA 3Q8MA 3V1YA 3AOEA 4E5NA 3SQNA 2QXYA 2BT4A 3G49A 1XJCA 4OHWA 2B0CA 3IO5A 5G02A 2XODA 2BV3A 3FOAA 1IXZA 2OL4A 4MR9B 4UXHA 5HRUA 5SZJA 4X61A 2AWNA 2QTLA 1XNQB 4LQ4A 3R8FA 2BTQA 1V47A 2IPXA 3CONA 2WSMA 1S01A 1YL5A 4MUXA 3TZCA 1Q1ZA 3DDUA 4EI2A 4RTOA 1MB2A 5F1KA 4TX1A 3WNCA 1U8TA 3DZ8A 2YFQA 3H9GA 2V3CC 4D8XA 1VE7A 3RBXA 521PA 5KJ1A 4LJ9A 2CXRA 3NPAA 3FVQA 5H80A 3AF4A 5T5QA 4JP5A 3JWEA 5FAKA 5GTDA 2WTNA 2PWAA 3MC1A 1UFQA 4PFQA 5IJZA 2AYZA 1LRKA 3VHXA 3TD2A 3E3NA 3MLBA 1NJ1A 4HFMA 2P79A 3UT6A 3WK6A 9ABPA 5LP6F 3PTLA 3WRVA 5CCBA 3MERA 1DCKA 4JS0A 4TXLA 3SFVA 1OFTA 1DOAA 3L18A 1D6SA 4PR0A 1I1QB 3F97A 1X6VA 3QVSA 4R16A 3VPSA 4NECA 4W8GA 3PNMA 4ALLA 3Q6NA 5AUQA 1TJ5A 1TTHA 3DVRX 1JSLA 3MUOA 3WLHA 3VYVA 1JA9A 3ILSA 5CR9A 1AKNA 1H0SA 2EHJA 3FLMA 1VJ1A 5DSXA 3KKZA 3GEEA 4PHTA 3KKMA 4E12A 1RQXA 2GZDA 3QQPA 4JLKA 1BHQ1 4WFJA 4RXTA 2XUDA 1VA5A 3H7AA 2BW0A 3K0BA 4PZLA 2WMOB 3HEAA 3JW8A 2RBKA 3CNEA 4UUBA 4PICA 1WAMA 4X0EA 1TYDE 2ZIXA 3MAAC 4ZYVA 1IONA 4JVNA 4NBUA 2GVDC 1D2EA 5C18A 1C9MA 4BOYA 1QGOA 5KTPA 1WCYA 2NU9A 3C5CA 1C1DB 4EEXA 4Q47A 3PDIA 4WN9B 1HKUA 2WDZA 3UXMA 1SUPA 2XNCA 4YO8A 4RK7A 5THKA 1Q3TA 4NEGA 4E4TA 4H7FA 1BYIA 3N59A 3UXYA 3GJ7A 3TQHA 5H9WA 3TTYA 3A6KA 1EKXA 1AE1A 2XGJA 1ECFA 1GRRA 3T5CA 1JH8A 1Q1BA 2IH5A 1N0IA 3Q85A 4M99A 3NONA 5H70A 4LC0A 3TLCA 1R9JA 4E3ZA 5C52B 3JTEA 1RMYA 1U0BB 1H6BA 2QZ4A 4R9SA 2IP4A 2C83A 4ZVQA 1DAHA 3AEYA 2JAOA 2ZIGA 3OZEA 2ATEA 5T3YA 1QGZA 3IP7A 1I8TA 3WIEA 1NC3A 5AKHA 4FHZA 3JWGA 1ZRMA 1JKXA 3SR4A 1QIFA 2J5QA 1IEXA 1PGPA 1GXSA 2V6BA 4RDIA 1E9AA 2MSDB 2RJOA 1P0FA 2Q4RA 4Y9UA 5LWHA 1A2KC 1YKSA 3J80A 3SC2B 3VAYA 4F3NA 1R5NA 2O0HA 1PIWA 3P0HA 3ESDA 1W4ZA 2PZKA 5CT9A 2VDOB 3EG5A 1POWA 3H6HA 1SN7A 3Q11A 2VPZA 3B5IA 1X0XA 1MR3F 2FZVA 1ZK3A 3N5CA 3JYOA 3OLCX 2Y9PB 1Y3HA 1JJIA 4YO7A 2Q0SA 2CXHA 2RHMA 2AUTA 4HTFB 3QVKA 4E2XA 3ZVLA 2AL7A 2BGLA 5JJIA 3ZHXA 4DMMA 3OIGA 1U7ZA 2G3YA 2FSGA 2QQGA 3OEYA 2WPDD 4G6ZA 4URWR 3N05A 2J0EA 1P8AA 2YV3A 4DM3A 2HSGA 2O8DA 4CL0A 2IYNA 3RUAA 5A7FA 2YIMA 4FTWA 2ZM5A 1IB6A 3PD7A 1PT8A 1P7CA 2BBOA 1D1SA 3ANMA 1QYIA 1J7KA 2BMWA 1ESZA 3SVZA 4BGIA 2DRIA 4Q21A 4O59O 2OB2A 4Q34A 2QTWB 3AHGA 3RYFB 3RC3A 2PKEA 3SQMA 2X5KO 4F3CA 4WBNB 1U5CA 2A4KA 1XF9A 3SEZA 4DEYA 5IC4A 4I9HA 4QJ5A 4CL3A 4B0OA 4EEKA 1KI8A 4HLNA 4BE7B 1RM3A 821PA 1WW2A 2O2XA 3ICVA 3NHAA 5JCOA 4FZJA 1IXRC 1TA4A 2N47A 4L5JA 1XB2A 4NV1A 3KC2A 5DV9A 5I7HA 2C7RA 4HGPA 1EDBA 5EJMA 2FJUA 5B6JA 4GWKA 4KPUA 3O92A 3ZZTA 3I6QA 4UW9A 2PGNA 1DXYA 1J07A 1S1MA 3TKLA 3RU7A 1EVZA 4NJEA 4O2AB 1EXDA 1TVKB 2CLCX 3UJ8A 3K30A 2C5HA 2R8OA 4UQPA 4EO7A 5KYGA 2DH6A 1W4AA 2QYTA 3DMRA 3TEMA 1XRNA 2OXRA 4XB6B 1YZTA 1V1RA 2PGIA 1IZ8A 2D8MA 2RK3A 5EJ4A 5A5GA 5JEEA 2CNOA 4LFBB 2BSAA 2HRRA 4N0DA 1V4VA 1U9JA 5ALNA 1X19A 3OPMA 3QE0A 5KSWB 3GCDA 3F6YA 4G5XA 2UDPA 3HYRA 4RIIA 2CJPA 3NT5A 4UMEA 3UN1A 1U7OA 3G68A 4MAFA 1OLUB 2IHNA 3IVCA 4EFMA 3IVAA 3G1UA 4IIEA 3CO0S 1BMFA 1WXHA 3SF8A 5HKAA 3OQVA 4KVAA 3DEAA 1OFGA 3O1LA 1J2UA 2HT1A 1F14A 2JCXA 3RNLA 4RELA 5BQ3A 1J6UA 3DW1X 3FFWA 4C2UA 5C31A 3R3XA 2W6QA 4Z4FA 2OLEA 1E79A 4B17A 4R5HA 1JAZA 1FJ2A 3R7WB 1KEZA 1XTPA 1OVGA 5KI6A 2GN6A 3EZFA 3UB3A 3QYFA 4IRUB 4PHHA 1EWRA 5J1TB 4AYWA 1DRVA 3MCUA 3TE6A 4NE7A 1DKLA 4BNYA 1BGVA 1OW3B 5IM4F 1V11B 2PVPA 1PJ2A 3FPJA 2DPHA 2H1CA 1CDZA 1RWPA 4MUYA 3QVLA 1RWMA 3I2KA 4JDUA 4YV7A 5HILA 3WYBA 3AR4A 4IGAA 1WX1A 3A4NA 4QHSA 3JALA 2H57A 4C88A 4RHCA 1PFKA 2AIRA 4CMCA 1SCIA 4B4VA 2ZUDA 3EULA 3R20A 4B84A 4D0SA 2XYQA 1N2ZA 3ZHOA 3R6TA 4GE0A 1DO2A 2WVGA 3SXPA 1Y1PA 1P7ZA 4PGAA 1ZCFA 1CJBA 1JMVA 1ZJJA 1B1AA 2PT9A 3CB2A 4JJFA 1V26A 4ZOLA 2C8KA 2BHRA 3CKMA 3KL2A 1UKVY 2ERXA 2WAMA 3CV3A 3R6WA 4G8JA 1FDIA 2F64A 3QLVC 4GR9A 4I1VA 5F4ZA 1DAEA 3L6RA 1XAIA 1IQUA 2Q5OA 5IKOA 1I6WA 2CW5A 2HHAA 2QI9C 4WV3A 1WMEA 1MORA 3W2EA 1VE6A 1LF0A 4KIGA 4ND7A 2ZDGA 2WDPA 3IHLA 1L7NA 1YJCA 2WUGA 4KWEA 1RADA 2X40A 4G85A 5F78A 3SSMA 4I9GA 4FMDF 5HE9A 2PZMA 2YJTD 4YRKA 4KFRA 1V6SA 1TMOA 2C82A 3MQFA 4GQBA 2JFOA 3S1AB 3P2YA 2EWVA 4WVFA 4LGYA 5JAHA 1OH7A 1O1YA 2H7YA 1OBHA 4IO0A 2PKQO 1R0SA 3LGXA 1ESDA 1Z7BA 3FZYA 3IDSA 1C4XA 1RKBA 2BJHA 3KDPA 3FVTA 3RTGA 4CM9A 3P71T 3R9IA 5K99A 4JUIA 4X97A 5JFOA 3PA8A 5IKXA 3RRFA 4U7DA 2W2XA 1ZWKA 1GQYA 5CM2Z 1D2GA 4MVJE 2FWBA 4PZCA 1A5TA 2Y0CA 1GPH1 3DLPX 5CYPA 3VOAA 5KB3A 4XI9A 4CLOB 1IZ0A 3KQVA 4N41A 4JHXA 4R1TA 4O4LB 4WESB 1CT9A 1SURA 1RHKA 5CLQA 3E1KA 2X42A 3WZLA 4J7AA 5JSZB 4LYHA 4WA7A 4EWLA 2BLLA 4JLSA 3ZJVA 2E4VA 5D3KA 3A0RB 3HGTA 3DTNA 4OAPA 1XQYA 4UU8A 1E3DA 3RS5A 1ZGAA 2M6LA 2YFYA 1GR0A 1E9EA 1UC5B 3QITA 3G2MA 3A2MA 4NONA 4NYJR 4PQRA 1WEHA 4P53A 4TS4A 4UEKA 1ISFA 4IH4A 2O19A 1BDBA 1LK7A 1OY1A 4WXRA 4WXEA 2HWUA 5JH7A 1EFPB 4J2HA 3TD9A 5J58A 4RH3A 4LJ6A 2CBXA 2GNAA 1CHNA 1Q0PA 5GOTA 5HQ3A 3ZJ4A 3A4LA 1G63A 1FA9A 2TYSB 3N8DA 2JZOA 1KSJA 5J4VA 5LDDC 1TUBB 2A8YA 3GROA 3ZY4A 4D0NA 3GRPA 1H1LA 2HREA 2G8LA 4MHOA 2O8EB 3LHFA 1S8FA 3EXFB 5AVXA 3RSHA 3IESA 2J7KA 1PLKA 1ZP6A 1N5DA 2AW3A 1A7AA 1E99A 2VXCA 3BHNA 3IVRA 3U13A 1YDGA 4AZ0B 3L8MA 1OFUX 1NKTA 2DE0X 2RIPA 3M49A 1SAYA 3K9CA 2RDMA 3L7YA 1UPBA 4RHXA 1UC4B 2OKGA 2J7PA 2XVYA 1KXZA 5EP2A 2V7QA 2WRZA 4JOBA 5AKIA 4R7GA 1ZGCA 3LS2A 4KMSA 4JBYA 1I9CA 1Q1GA 1Y34E 2YOGA 3IQXA 1AQUA 2RG7A 4OL0A 4FHCA 1Z06A 2WUWE 3PA6A 2BRUA 3M4ZA 4L6IA 4P31A 1IU9A 3QVWA 2O2HA 4O0LA 2Z2KA 1M7GA 5C8YA 1FJHA 4BMZA 2VTBB 2I87A 2XRMA 1WXWA 3C16C 4NG4A 4B35A 2H0RA 4AKIA 1LBSA 1Z74A 4IJWA 1FIUA 1IUPA 3LDFA 3NC4A 5DU2A 5AHOA 4CGZA 1BQ3A 1XJWA 3WYCA 2H5LA 2C88A 3QU9A 1I0ZA 4KV7A 5ED4A 1G9TA 2VZLA 4QTYA 4QD3A 1HYQA 1GO2A 3RSCA 1ADBA 1Q20A 3F96A 2FCAA 2BCGY 2H18A 2JH9A 1RZRD 4FDAA 4NYJQ 2QYOA 4MH0R 4DVGA 3IVMA 3PVSA 3EGEA 4M1QA 4BNWA 3FTNA 3GUUA 3KEQA 1CXZA 5G4LA 5LR6A 4KXUA 3M3PA 4TWIA 4D9BA 1XF1A 4TRNA 3PNBA 2GEVA 1A4IA 3U17A 1UC8A 1CVLA 4GXNA 2AI1A 4HWOA 1WM1A 2JIZD 2Z04A 4I4LA 4YMWA 5IBPA 1L7QA 3U9TA 1NUUA 3A6HA 3CSDA 5KO2A 1M73E 5T67A 4L4RA 4OBWA 4ARZB 4F7DA 4PQFA 4ZV9A 4PNZA 1BEUB 4RD3A 2D62A 1FYEA 1ODSA 4RL6A 4BP8A 1JFRA 2XMDA 4US0R 2Y6VA 3OKAA 4BC0A 3TNLA 2J0UA 3KR9A 3Q72A 3ZV5A 2WG1A 3RANA 2VHJA 2ZXEA 3GJ3A 3QENA 3R76A 4F86A 1CUVA 5KWEA 3RT9A 4HQFA 3CISA 4QO8A 4YUVA 4BEJA 4C14A 1J8VA 1AX9A 4HLUC 1NFRA 4BB9A 1TPZA 3W05A 1XD2B 5BORA 4J0DA 1EIWA 2LP4Y 2FEKA 4G1VA 3QBDA 3HKBA 4YT8A 4ENTA 4HADA 3EXIA 3AEUA 4JN6B 1QP0A 5EOVA 5FOQA 4K9KA 3PEWA 4QJIA 3P4YA 2VP6A 3LPMA 2OCKA 4EJFA 3VNQA 2JBAB 3DD5A 4HAWA 1BS1A 4V24A 3QKTA 4XIFA 3ZLTA 2QQEA 4O33A 3W8DA 3QMPA 2GRJA 1A9XA 1O6ZA 3E61A 3Q3HA 3T41A 5GZ6A 3QKSB 2M6SA 3DC2A 3D7LA 4ZANA 1DQPA 1VKNA 3WWZA 1KEUA 3CZAA 1QGED 5HJEA 5LLTA 2X8WA 3OBIA 4W5QA 2HHHB 3MJCA 2PX3A 4CM6A 3JWHA 1KH3A 2FI1A 3Q1KA 1MN6A 2IYSA 1JDVA 5CRIA 2QLLA 1P2GA 4YCMA 1PNRA 2ECQA 1WBBA 3ZGZA 1FS6A 3EGCA 2F4VB 4RJKA 5FRDA 2ZJBA 1CDEA 1OU4A 1NXXA 3DQZA 2Z1DA 2FTKE 4Y6RA 2JFBA 1E58A 2IRWA 1YWGO 3AR8A 5HXAA 2VTKA 1ESNA 2C2WA 5DFAA 1PJAA 2GCOB 2Y67A 3OE5A 1RRMA 3F5SA 1KQOA 3QXSA 3NHMA 4RMJA 4ZAVA 1KQFA 1E2QA 2QS9A 3BEOA 2YVLA 2C03A 2H07A 5FULA 1V41E 2ZRNA 4QUIA 2HD4A 1U7PA 3DAPA 3VH1A 5DOVA 3ZDCA 2GN1A 4J8PA 5CFMA 3AF0A 1N32B 2NZYA 2A7QA 4GP7A 4X6LA 1R16A 1Y1TA 1VCOA 3K9LA 4I99A 5DEOA 5L3SB 1GZSA 4CF4A 2XE6A 2PBFA 4DADA 3H65A 2REQA 2QTRA 3ZS9A 1CUIA 2FFRA 3EXEA 1KK1A 3UWSA 1FX0A 1P18A 2RSLA 1QQ6A 1XEXA 2JDID 3BMCB 3H4MA 1T9DA 2CL7X 3Q2OA 5A71A 4HDSA 1ZM9A 3NCTA 4JXXA 4EFNA 4JL5A 3H0EA 4HNRA 2TMDA 3OIWA 3TIXB 4UDYX 1USWA 3KYIB 1AGYA 3FMPB 1JNYA 2GUWA 3FPCA 5TSDA 1JEOA 2ZTHA 4KGDA 1RC1A 5T6MA 4EUSA 5IC6A 3ZIAA 4L2IA 4A6DA 4KAXA 4IZIA 3ZVRA 4WOCA 4L3VA 2DR0A 4M0FA 3NTQA 4UD6A 4BNLA 1NVEA 2K2QB 4WDQA 2EGUA 3AYXB 2YY5A 2VHXA 5KKNB 4LY9A 4NFSA 4L73A 5B55A 1P19A 5KQSA 5LB4A 1LLFA 2DR2A 1UT8A 2FQ1A 3VC7A 1MOQA 1ISJA 1CQIB 1KAMA 2IYYA 2WYWA 4N54A 3UMRA 5KWJA 1E6WA 4GMHA 1W87A 3Q7QA 4R2JA 4RX1A 4CEIB 3ODGA 1JVNA 2Z0MA 1I2CA 5L3ZA 5ENZA 1Y9ZA 3LBFA 5EXEA 3WLQA 1BOFA 3K8YA 1IQPA 2Y1EA 1PX2A 1W2WB 3JD3A 1YRWA 3VOTA 4ZTUB 1IVSA 1XP8A 5FUXA 4LFAB 2VJYA 3W5IA 1PWYE 3IQEA 3N8IA 1QAMA 2EP7A 3F6CA 2FX5A 2E5FA 2MSKA 5KC8A 1VGVA 4HDNB 1NUAA 4DJ5X 3JAWB 3BE4A 1I5EA 1KHTA 1KYXA 2GCGA 4G9BA 1Z26A 3HB1A 4GMXA 4PCAA 5HCIA 2A0KA 2J5BA 3CY6A 3F0TA 3K9FC 2WA1A 1MB4A 4YN3A 3IIMA 3TBFA 2FJPA 2OORC 3B1XA 1P62B 3DHVA 4RANA 3R7BA 5I3ZA 2FVYA 2AMJA 4K1XA 7AT1A 1JHOA 3H5NA 5CT4A 1YVRA 2B8WA 2Q6IA 3JQ9A 1NOIA 1YMVA 3ASZA 1SHLA 1UKBA 2X0IA 3OM0A 3S3TA 4B7UA 1C9JA 1WQ4A 1S2LA 2IF0A 1WKBA 1ZN8A 4KDFA 2AQKA 4I4TA 4N3AA 1ZD2P 2BFMA 2F8LA 4WKGA 4UQOA 4U0KA 5ES3A 4AP5A 1XZQA 4W63A 1GQSA 3VJLA 1KEEB 4C4ZA 1YCDA 2I71A 4C9BA 3AWDA 3ZWCA 2HK7A 1MQ8B 1XTVA 1NXVA 2ODQA 3G2JA 5EERA 3TSZA 1V9SA 1QK5A 5EP4A 3L1VA 3I9MA 3VI3B 2DT8A 1VZ3A 4HH1A 4Z2AA 3NWEA 5A2GA 1NI5A 1ZZEA 1SKQA 3SCZA 1VKHA 2VNHA 5DCLA 3WYAA 3G5UA 1KBQA 1RXCA 2BZSA 2JNWA 2R11A 3K2EA 1G8PA 2W6MA 2DQ4A 4PPNA 4QUAA 2AJBA 2BM1A 3EIQA 4BRUA 5BN3B 2EERA 4TMKA 2ZUVA 3DT6A 1GAEO 4JI5B 2FR0A 4UHBA 3B3AA 5JCZA 2Q3BA 4H35A 1DIAA 3B6EA 2W6ZA 2QN1A 1FXSA 2N3ZA 1M7BA 1TQ8A 4CWAA 5D84A 3NYIA 1JEQB 1FTWA 2NU6A 4LS3A 5K0JA 1E5TA 5E4YA 5IF3A 3DBHA 4RPHA 1JG1A 4NS4A 2XQJA 5HR5A 2DPYA 2RONA 4P81A 1DKUA 1A04A 2PEYA 2QSJA 3P9YA 4YRSA 5BW5A 2A0XA 5TX7A 2CHVA 4BO3A 4DCNA 3EGXB 4O1IA 3OZDA 1E7MA 3OEWA 3NBYC 3JXEA 5EFOA 4F4IA 4MMYB 1NNUA 5DE3A 3RRMA 3RKSA 3D02A 4OHUA 2LCQA 3GAFA 4WHMA 5G2OA 1G6Q1 3ECAA 3OQMA 4KPUB 1UEXC 2P2SA 3HO8A 3PT5A 4WASA 3U7JA 4JZYA 4NDAA 4EJMA 3LUFA 1HFWA 1U8CB 5BUZA 1HDGO 1UMCB 1M6NA 3F5MA 1RHUA 4XSGA 3CYFA 1X1QA 1Z4IA 3FAKA 1KNQA 4DB4A 4MEAA 2H6EA 1VMAA 3D5QA 3QF4B 4L51A 1CRLA 4Q3BA 1WW3A 4II2A 3F2VA 4NCKA 5J2TB 2R68A 3B1WA 4BECA 1K3UB 2EKQA 1UM9B 4LYDA 1QUFA 4J3FA 5CM9C 3ZKAA 4U5XA 4V2IA 2HMAA 1TZCA 1VMEA 2COEA 2J1LA 8OHMA 3EFOB 4ITRC 1TDJA 2P2GA 1DTEA 1GPWB 1GTMA 4RH1A 3PIIA 5AI9A 1XQVA 5BNWA 1P7VA 3BJMA 4NZZA 4IM7A 3BHJA 1ZEJA 2O5VA 3GJ8A 4H60A 1JIQA 2NQ2C 4EFLA 1L6IA 2XOKD 5A9SB 1O9HA 2I7XA 3CBQA 3TAUA 3KSDO 4B6OA 3UMMA 4ZU3A 3U49A 2JLCA 2LPMA 1PWZA 3BB4A 1G5PA 4MQUA 3TW8B 2XUGA 1K92A 2JHGA 2VT3A 3SNKA 3AIIA 5BMOA 1CEYA 2PSHA 3UGTA 2GNPA 2CLHB 1E3IA 3HZOA 3R0ZA 4S1VA 1EX7A 4U7WA 4WFIA 2XWJI 4Y2RA 4D9GA 1ZRSA 5TQ0B 1SQFA 3H2BA 4NYIQ 4I55F 1FE8A 1ZM7A 1RXSA 8MHTA 4IHJA 4EHNA 2VG8A 1VB3A 3LQFA 1Z7GA 2QIOA 3MJ4A 5AFSA 5HPYB 2AFHE 4CL2A 1E5DA 5KWSA 4WQMA 2HBRA 3W2GA 1R64A 2JAQA 2QIPA 4GT1A 3DC7A 3M6LA 4CCYB 1QTIA 2GSDA 4NDZA 1QU3A 1YVUA 4X41A 2DT5A 1D2NA 4QATA 3S2EA 3H2KA 4ROSA 4DV1B 4DR4B 1XI2A 4C0LA 2FFJA 1XL0A 2PLAA 4MLPA 3QVXA 3AFNA 1XZCA 5JQGF 2Q7DA 2WPDA 3IJPA 3LLUA 4V03A 2FWAA 3O2JA 3U2QA 1V7QA 3VH4A 4FR2A 3IKVA 2F1HA 3P4XA 2JLYA 2QL5A 3RW9A 1NATA 2O1XA 1IEVA 3AI7A 2X0DA 4G1FA 4U6SA 1ATZA 2HSZA 2ZRFA 3JWPA 1VLHA 4BN4A 4CTNA 1GTVA 4K88A 4L8GA 2NUAA 4GRDA 4ZZ1A 3CLTD 1KMHA 4JGBA 3WB0A 1EU1A 3JATB 4CV1A 1JLRA 3GJRA 3VU9A 4EYQA 2VRWA 4KNWA 3T34A 3U4GA 4JLAA 4RM3A 3W7AA 1M2EA 1M2VA 4IIDA 3D8SA 3F8TA 2AE1A 1J2YA 2OPHA 1SXJD 5DLDA 5EHNA 5J4LA 2IYUA 2OGTA 4KNYA 4IJUA 1AQJA 1B1CA 1XZIA 4YQYA 3PITA 3BIWA 4HS9A 5H0IA 3A28A 3G9UA 2GYWA 1PLLA 1CY1A 4E31A 3WQBA 4D82A 5I9BA 2QE6A 1GQFA 2UZ3A 3T7EA 2ACVA 2JI8A 4B5LA 4F4DA 2CJYA 2FW0A 4XJXA 3LW7A 1W94A 2OHVA 5T4EA 1PR4A 3LAWA 2QMQA 4XIYA 2D1SA 3THSA 4UTNA 1UP6A 1RLIA 3LVRE 3PHHA 3C3EA 1ZD8A 4X63A 3HO1A 4JI7B 5JDIA 1T9BA 4MPJA 3D64A 1U0OC 1CEQA 4FFNA 4Q9IA 4YP5A 1L5YA 1H2XA 2A9PA 5JC8A 1MVLA 1UBOS 2G71A 3HU5A 3TAXA 2APJA 1FNNA 1QLWA 1BVYF 5FCDA 5CVDA 4E1VA 3O95A 5CNJA 3VVBA 3V2IA 4E09A 3IOBA 3WRXA 4MQ5A 1XJ5A 2QPTA 5CD1A 3R40A 1XC7A 1F51E 5CT5A 1GG9A 1MOSA 2OQRA 4AS2A 3UAGA 1RE0A 3VH2A 5BMVF 5BN5A 1YL6A 1ZIPA 3TLGA 3L1HA 5B36A 4E11A 3UAXA 1FYVA 1EDDA 4O1MA 4D56A 2P77A 1WIWA 1EGMB 3QKWA 2OV3A 4ZI7F 1EVQA 1Z4LA 5HBGA 1JQBA 2FMXA 2XQFA 1FDVA 3QWIA 3EBLA 3PHCA 2AI2A 2PJDA 4J1NA 1KI2A 2BEVA 2CKDA 3KRTA 4NZ9A 4OHMA 3VBEA 4D9HA 4IV0A 1P5ZB 2KWIA 3IUYA 3IPLA 2Q4DA 3TXAA 2I8CA 1G38A 1XZAA 3HV0A 5KC9A 3T38A 3BXEA 4CMEC 4IXMA 3R8CA 1YGPA 3TNJA 4DQDA 4RYDA 1WO8A 4JJ4A 1UXHA 1KGSA 4JC4A 1E6EA 4DW8A 4W5OA 3OUZA 4UJ3A 2IZ5A 1ZESA 1X1AA 2G82A 2JLQA 4JROA 3AHJA 1S3GA 3D3QA 5LIRA 3R4CA 1BX1A 1OA1A 3NU1A 4JY7A 4Z7NB 2I62A 2D0IA 3DONA 4AIIA 3K5IA 3GDHA 2ZSHA 2E1PA 3FPLA 4NTZA 5EZYF 1H2FA 3QUSA 1SUFA 1YKFA 2D0PB 2XTMA 3EVEA 4WIAA 3CW8X 1TF5A 3PC3A 4BP3A 2P2YA 4MMZB 5B3KA 1MB0A 1MRSA 1RRPA 2WVJA 4JIGA 5JPDA 5FV7A 3QTTA 1A50B 4D5EA 1EDZA 2B82A 2CFSA 1O7JA 2DUNA 2H5JA 3AB8A 1RI5A 3NNSA 5T57A 3HPQA 2MSCB 2O0MA 2DHEA 3HS3A 4MGIR 3TL2A 4C29A 1MQSA 1CHDA 1IAQA 1L7PA 4YRJA 4L57A 1A76A 1DG1G 2FSPA 2FY8A 2H2GA 2WWRA 1ZI9A 3ZGOA 3MMZA 4F45A 5AM3A 3M1AA 2JLBA 2HH9A 3NBFA 1KL7A 2PS1A 4RADA 4TOIA 1DC7A 4MINA 1E1YA 4GXTA 4HAYA 3G8AA 1WLSA 3V2UA 2IUEA 4WFKA 1FFAA 1VMIA 4PANA 3SU8A 2XB6A 3G8YA 1Z28A 2L42A 1TEZA 5LA6F 3HJRA 3D3KA 4Q7EA 1X7ZB 5BN4A 1IQRA 2JI9A 3IT1A 2ZIZA 3EMDA 3NZEA 3L8DA 5FAXA 4MUEA 1EAMA 1TTTA 1IXYA 1QGYA 1L5HB 3E8MA 3NT4A 4GUAA 4Y0NA 3BDVA 1I36A 4J9UE 2GM5A 4HAOA 5CHYA 4JR0A 3I0MA 4S1WA 4YJ3A 4Q4AA 2BR5A 4WLNA 3D4IA 5BQXA 4IHAA 4QU0A 4OB8A 4HMQA 3SYNA 2ZVPX 3GZNA 2DFNA 4OHKA 4JJEA 4UTOA 1S8OA 1XNGA 1DMSA 3FBWA 3RC2A 5A1TA 4AL4A 4KVGA 2KLBA 1JKMA 1VDZA 4A6XA 1CRQA 1Y80A 4BB0A 2B1RA 2JIBA 2M32A 4ER0A 2YWHA 1T13A 3BA6A 2YZKA 3IT3A 4ZVUA 4MR7B 4OGLA 5BRNA 1EK2A 5DZSA 1U3VA 4JIMA 1JIJA 5AQEA 5CLFA 4QRIA 4F8YA 1L5LA 3A1TA 1XCPA 2SCUA 3I39X 2P9QA 4Z0NA 3T54A 2QXUA 1OI7A 4BQRA 3B1JA 5AKEA 1RWBA 5JDCC 2GLUA 4NZNA 3S5JA 4IDPA 2XE4A 1CW2B 5CXQA 6NULA 2RKBA 2ZSFA 3O1HB 4K8OA 4U2DA 4AIRA 4LK2A 5DB4A 1H4TA 3S2GA 3PFBA 2CZCA 3T5DA 3FTDA 3Q9UA 1FSFA 1HZZA 4RLFA 2DXIA 3R0XA 1BMDA 2VP5A 3BXPA 4WK6A 2GQ0A 2HN9A 2WJZB 4LOAA 1ESCA 3A8TA 4V0ME 2VK2A 1BHJA 1FNSA 4Z53A 4U7GA 4I3GA 3EEYA 1JAXA 1IATA 2GEKA 5H3LA 3ZHCA 3THXA 4JLBA 3BMOA 1KRXA 1TC1A 2YN2A 4HUQB 1O5OA 2CFIA 2QX9A 3ACBA 3L8YA 4TKZA 5C1BA 5CCEA 3WWOA 5GP1A 5LOVB 5DNCA 4LX8A 4X60A 1Z8FA 2PH7A 1PD0A 3H2IA 5CGZA 5AW4A 4YRCA 2PX6A 4KQCA 1V96A 3NDIA 2G7MC 3CINA 4UCQA 4FS8A 1NYLA 4ZQHA 3RR2A 1KFKB 2BGRA 4GNRA 1KDTA 3KFVA 2KJQA 1GQQA 1FX0B 3RYIB 4XYGA 4IV8A 4JBGA 3HYCA 1QCYA 2AJLI 5CIQA 2QTFA 2XDQA 3OPYB 4BV2A 2OXEA 2HA2A 3DMTA 2YYYA 1KR2A 2CL0X 1E1MA 2PH3A 3ENNA 3NHLA 2C3MA 2H2IA 3IAEA 3MW8A 4J90A 1JR3E 2DF8A 3KEMA 5B3JA 3TW6A 3WTCA 3BILA 4MV3A 4OEHA 4BCDA 2O05A 1Z6XA 1UQRA 2OCGA 1V6AA 3WLJA 1GNRA 4MKFA 3AB7A 1RPTA 5KNDH 4BAZA 2O8CA 4Q3EA 1IHPA 1NVMB 4B8ZA 1RR6A 3NOOA 4MRPA 4BV3A 3LK7A 3PX2A 1CETA 3L0DA 5CU7A 2E48A 5E95A 2Z56A 3SSOA 3AUJB 3E70C 4Z8YA 2JGEA 3BULA 2R47A 4GPIB 1QHNA 1XMQB 2YVUA 1ZG3A 4JYBA 1H6DA 3A3PA 5JC1A 4FW9A 1QO9A 2IZ7A 2Z30A 3B3FA 3I2JA 5A4KA 5CLJA 1YA6A 5K0ZA 2HL6A 4UE2A 4WCFC 1H2AS 4YMHA 2VQ6A 3VR1A 3HRIA 4FYXA 4LRQA 1TM5E 2VDWA 1O95C 5KUTA 4MX8A 5LD2B 2WA2A 2ALJA 3G82C 3VISA 5HUJA 4LBVA 5JD4A 5AHWA 4DAEA 4RS4A 1UDCA 2X1MA 3IP5A 3EF1A 5KYYA 3OWOA 2PZ8A 4DJDC 4HN2A 1ODLA 2ZSJA 5G40A 3NO4A 2AG5A 1M8JA 3AR9A 3EMBA 1ZLYA 1WDWB 4UARA 3F74A 2UZ1A 1P8JA 4NHOA 4KSBA 2V9ZA 1LI4A 4FPXA 3IA7A 3O94A 4OI0A 1K8QA 4JXZA 2FN4A 4XM0A 4IGIA 4MRNA 4I4TB 1TU4A 3QBEA 3WKAA 3H2GA 1FP7A 2I9KA 4A7PA 5AD1A 2O3TA 3EC1A 4KE6A 3WMGA 4QDTA 4J4TA 4OQ4A 3FKSD 4AJJA 4D96A 4BIMA 4RORA 1XCMA 621PA 3VDNB 1F12A 2FAXA 3M2TA 1UPFA 3HLYA 3WKDA 3NGXA 4WBSA 2QWXA 4XPIB 4A0QA 1RKUA 3LP6A 2GZ1A 4ZOQI 3ZDZB 5K0CA 5JD6A 5D85A 4CM3A 4U9UA 2E2WA 2VNKA 1RPNA 4PM4A 5AJHA 1GFWA 4GBJA 2HLPA 4M88A 3OA2A 5CEJA 1Z39A 2HJRA 4MPTA 1ODKA 2IELA 4C22A 3KWMA 3NHJA 4PTYA 1N7IA 1I4LD 4HNGA 4OYLA 2JDIA 3HUFA 4PZAA 1IN5A 4WSOA 1ODIA 3IMFA 2QMUA 3RIEA 3DZBA 4KR6A 3UHAA 2GAIA 1T4CB 3RUHA 4CHTA 4J1SA 5B4UA 2OV1A 4ZREA 3OD1A 3RFVA 3ZEIA 3U61B 4AXXA 4GG1A 1CQZA 1BWPA 5DX1A 2QUKA 2XT0A 4RCZA 2FUEA 2DPXA 3RVOA 3PNPA 1L1FA 5HW0A 1L4EA 2RB4A 3HABA 3UAOA 3CLUD 1XXHA 3VNAA 2JLVA 5E9AA 3ZDFA 1BAPA 2PHZA 2QENA 3IT0A 2Q8NA 4I1UA 5AM5A 1UKCA 5KJEA 3GL9A 2QLMA 5B53A 3MHPA 3H5VA 2IHZA 1U3DA 3CZMA 3NTUA 5U1PA 1JE1A 1BWQA 1NXWA 3RSOA 4WLUA 5FOSA 4C6TA 1IWBB 3R9WA 3KVYA 5J3JA 2I7VA 2P4UA 2W6CX 3JQBA 2Q1YA 1KE1A 1N2JA 4QASA 4QOGA 4YCJA 1WZEA 3RJ5A 3HC7A 1T2EA 1BXRB 1U3UA 3LWZA 1FQKA 1NF2A 5K6TA 1ZUHA 1S3FA 4KXQA 3JQQA 4HRXA 3UT5A 5AI4A 3NNNA 3DXFA 3PRKE 1CUWA 4Z1OA 4RVHA 4PZPA 1U81A 3HCDA 2Q1TA 4DARA 3FLBA 3INYA 5GZ1A 3RBAA 3A1CA 4B09A 2NO0A 3LCVB 2ZAOA 3MTGA 4J1TA 1DINA 1KYWA 2HBYA 2YFKA 2CLSA 1VGQA 4R8SA 2ZRGA 3WBFA 3T3OA 2F1OA 1PSDA 3DE3X 4LFCB 3WS7A 4D44A 2NV6A 3VR4A 4BX2A 1NSFA 2FRDC 4EHLA 2GPSA 2H8KA 3T7AA 1B8PA 3QHQA 3NRJA 3U4DA 1QCCA 3DD1A 3GFPA 3NATA 4KMMA 3EGWA 3R5FA 1W52X 2Z2IA 4ZD6A 3ERCA 4FDMA 1ZNYA 1YDEA 1GU0A 2FPLA 2WD7A 4B2YA 3BH6A 3JQ7B 3W5SA 1CS0A 4UCXA 1NW7A 5GONA 3WA6A 4Q00A 2DH5A 1CUCA 1EI9A 4G0NA 1TZ2A 3MT8A 1HF3A 3UWKA 4BVJA 2OGUA 4FCCA 4QGFA 6REQB 3GLFB 1N6OA 1SC3A 3TNDA 3FYUB 1K6IA 5A9RA 2W37A 2XXJA 1SHKA 4RQAA 5DRTA 2ZVQX 1VE3A 2WY2D 3FKJA 1U0TA 2WSSD 3MD0A 3ZWPA 4BKUA 2YV2A 4HQ0A 3MAJA 4CQLA 3M5DA 1NAHA 3BICA 4EL5A 3A05A 2PN1A 3CUTA 3HVRA 1J8QA 1NURA 3DXYA 2ZTUA 5I9NA 2PQ0A 4QGHA 5EI5A 5IVDA 3MJHA 2HF7A 3ULKA 1JYSA 2DJIA 4TLMB 5ICEA 1K3TA 3A4MA 1GLGA 4PSUA 1X7GA 3V6LA 4AURA 4WBNF 1UWLA 3SMQA 5H8WA 4WD3A 1NUPA 2CZQA 3MMNA 4OOEA 4DV3B 5I9TA 4IEFB 4PZYA 2H4ZA 1QIDA 1O58A 1VGRA 1YBAA 3GNQA 3I92A 3PIRA 3PL5A 5CJPA 2YWGA 3SEFA 1QTRA 1E3LA 2K5UA 3KX2A 5AMXA 2DECA 4C7BA 3KR2A 4Q9LA 1H3NA 1GZ5A 2AG6A 3DWIA 1Q1AA 4MS1A 1JG7A 3O8OB 3P7MA 3CR7A 2QD4A 1YS9A 4RK5A 1A96A 4XVCA 1T5TA 4O2AF 1XDUA 1C50A 2A88A 4GVXA 1X8XA 2JI7A 4M0CA 1HG0A 1K4MA 3IEXA 5EJIA 2NUAB 1FVXA 4RU1A 3D8RA 1Q92A 2EAUA 2L17A 1W581 2W9XA 2AEJA 2ZE6A 1H6AA 1I6KA 3COWA 1JBKA 2D4AA 2OQ2A 3ANXA 1TT5B 3OZSA 1A2BA 1W2HA 1M2VB 2VHYA 5AI5A 1P74A 3W5UA 3REFA 4FZVA 4HWRA 2H65A 4QODA 5AKKA 1FQWA 1T5BA 1UANA 5EPUA 4TWJA 2HRBA 2BMFA 4XCXA 4U2FA 3HXOA 4LF9B 3MINB 5TT0A 4F4HA 4YB8A 3QVMA 5HNKA 3G5AA 4NESA 1UJ6A 1U65A 2JRLA 3FUTA 3VJKA 1F9AA 1ZDMA 1G60A 1SUDA 1TM7E 3OTWA 1YR2A 4FBGA 3M70A 1K06A 5KKCA 1EWQA 3GB9A 1ENZA 1TUEA 4I50A 1P5JA 5EKUA 1MT3A 1HNXB 2FWRA 1W75A 2OC9A 4DDHA 5FWXA 2BFFB 4TV9B 1QWOA 2EFYA 4R1LA 1RP7A 3THYA 1CP2A 2RGNC 3OTIA 1BQEA 1RTKA 3ME5A 4HAXA 1B16A 4Q6WA 5K3DA 3LXXA 3LUPA 5B5SA 5ENDA 2H4XA 3ZVMA 2ZE8A 4G2NA 4ZVVA 1P5HA 5JWRA 2G36A 2OCAA 1AN9A 3HLKA 4BNMA 4HWPA 3HJAA 4PHFA 3YASA 5I7SA 1HKHA 4JLOA 3UJ6A 1JA0A 2ZJ5A 4DDMA 4TYYA