3TCKA

Crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis - form 4
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
188
structure length
188
Chain Sequence
AEPLLVVGLGNPGANYARTRHNLGFVVADLLAARLGAKFKAHKRSGAEVATGRSAGRSLVLAKPRCYMNESGRQIGPLAKFYSVAPANIIVIHDDLDLEFGRIRLKIGGGEGGHNGLRSVVAALGTKDFQRVRIGIGRPPGRKDPAAFVLENFTPAERAEVPTICEQAADATELLIEQGMEPAQNRVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of new crystal forms of Mycobacterium tuberculosis peptidyl-tRNA hydrolase and functionally important plasticity of the molecule
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords Peptidyl-tRNA hydrolase
total genus 54
structure length 188
sequence length 188
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 3tckA00
3VJRA 4QD3A 3OFVA 3TCKA 1RYBA 1RYNA 3V2IA 2Z2JA 4FYJA 2JRCA 2Z2IA 4DHWA 4P7BA 3TCNA 4ZXPA 3TD2A 4IKOA 4Z86A 4ERXA 4YLYA 4LWQA 2PTHA 3P2JA 5B6JA 4JC4A 4QBKA 4OLJA 4FNOA 5IKEA 4DJJA 2NAFA 2Z2KA 3KJZA 3KK0A 4QT4A 4JX9A 4JY7A 3NEAA 4QAJA 2MJLA 5IMBA 5IVPA 4FOPA 1RYMA 5EKTA 4HOYA 4FOTA 2LGJA 3TD6A 4JWKA
chains in the Genus database with same CATH superfamily
1IY8A 4ZAFA 4P3PA 3TQHA 3V55A 4PG8A 5LYYA 3RSHA 2Z04A 4CR6A 1RJ9A 5BORA 4RDXA 3EXG1 1CZHA 4M99A 5CVDA 4G0ZA 2HXYA 2OAGA 3I2KA 3IQIX 2UAGA 4LJYA 4Q4AA 2VJYA 5TPWB 1Z18A 5ESRA 1I6WA 1XFAA 5B3LA 3B1KA 1KP3A 1Z82A 2UZAA 3K5PA 2XHZA 3ZY4A 5AVTA 1ZVJA 3ZCUA 5KQRA 3U7QA 1EVEA 2D5CA 3EQ6A 5E9JA 4B3BA 3RE1A 3GYGA 3S2EA 1F8UA 3I34X 5ICMA 1BXRA 1T3HA 4B17A 3DHEA 1O4VA 3DCJA 2NSDA 3WNDA 4NZPA 2YR0A 4PQRA 5D3QA 1RJDA 3NHBA 1M1YE 4ZAYA 1Q6ZA 4O1MA 5DIFA 4CU2A 5ITWA 1R27A 1STOA 2ONKA 2Q49A 2BKEA 2AMJA 1MAAA 3IP6A 4IXDA 1DTWA 1UK8A 2A57A 3DAYA 1FYFA 5FBKA 5ICCA 2EXXA 1Y1QA 3GRVA 3QX8A 4WZAA 1SBTA 5HSGA 1PG2A 5HYVA 3HU5A 3G68A 1HA3A 1WY7A 3IIEA 2JJ2D 5BOSB 1I9CA 3IE0A 1UZAA 3RF6A 2HSJA 4UCWA 2ANBA 4UC0A 4B81A 4EY7A 2QMZA 3D0KA 4FGSA 4XM2A 1MA3A 3HO1A 3BIJA 1ZL0A 1THGA 2FW1A 3OY2A 3QIVA 4UM5A 1PJLA 3MQ4A 4LRUA 1J7KA 4R01A 1YU9A 3RUFA 1NUAA 2TYSB 4TM7A 4ND4A 3WSVA 4DS3A 1D9ZA 1X7GA 4ZYXA 5CB4B 2GAIA 5LZ2A 4RADA 5JMOA 3HKDA 4XXHA 2CNWA 4PLVA 4DILA 2XVZA 1GD1O 2JGIA 1BMFD 3DMYA 4RJJA 4RDIA 5CGZA 4B4VA 2P79A 3FFAA 3B1VA 2BTQB 3SR3A 1U7WA 3F8TA 4G5YA 1U7TA 3S68A 2HYIC 4FJ1A 4YP9A 3AXSA 2FEOA 4I1OA 5EUBA 2OUIA 3A11A 4LA4A 1K5HA 2GZAA 3P2MA 5CLLA 4AZSA 4EGAA 2G28A 3ZGOA 3ZWYA 4UHDA 3ROQA 2AQ8A 4OL9A 1VKNA 3QLEA 4WFQA 4AX8A 2AXNA 4FD2A 3AONB 2G5PA 4E4TA 5SZKB 2ETVA 5ARBA 4FHFA 4RK1A 1UP6A 2G5GX 3X2SA 4NCKA 4P93A 1JTVA 1JDBC 2P77A 4P31A 4A91A 4B83A 4CF5A 2DPMA 2BGRA 2HSEA 4OQYA 3W90A 5G41A 3DEHA 1U9JA 3L6RA 5JPDA 4L02A 1N5LA 4C0WA 2HBRA 4YMUA 2CYBA 2WEKA 3VDQA 4RQBA 2Q5JA 2Q2VA 4WOJA 3EPRA 1T9CA 1WX1A 1XU7A 3ETDA 4NULA 3BRWD 3HBNA 1MPTA 3K96A 4UDXX 4ZOAA 3KQKA 2J3EA 2JKZA 2V54A 3NBFA 4HNAB 3GLGB 4IO0A 1GTG1 1K7YA 3S1AB 5IJWA 1H42A 3GDGA 1GOTA 5BOVA 3GQBB 1I2CA 4QUGA 3T7SA 1K8YB 1Q22A 3QWAA 5HDQA 1AHHA 2IOFK 1B4DA 4Z4QA 4RZSA 2D0PB 3GFVA 3B12A 1UOQA 3I9V1 2DR2A 4ETIA 1UPXA 1ZCJA 2H9AA 2GZDA 3M4JA 4NNPA 4YXFA 3O21A 2PXHA 2FPPB 4LGMA 4B3MB 1X87A 3AKEA 3G0IA 4U2KA 2COEA 2Z5GA 1QUEA 2TECE 3PP8A 3V1KA 2QP4A 4KQ2A 2W2MA 4C3VA 1H5QA 1NWHA 2RB5A 5CFOA 4KWCA 5FWXB 3I61A 1QH8B 3A2KA 1FNBA 3W8RA 2ZR7A 1URPA 3P4YA 2HF9A 3L1VA 5D3KA 2E6UX 2PUHA 5E4JA 2J9FA 3IAAA 4NG4A 5HQTA 3GMSA 2B8TA 5LYJF 2ZYTX 4K9RA 2BLLA 3WAGA 1UZMA 1EBUA 4EJSB 3OPMA 1BWRA 4DZRA 2QX8A 3WJ1A 4A0FA 1NYRA 3E9EA 4HDKB 4CM8A 2VXBA 5IAKA 1U28A 5EXPA 5CJPA 1QQ5A 1PR4A 2UZ3A 3V46A 5LZ4A 4A8JA 2SHKA 1U5AA 2J5BA 2ZSAA 2ZVPX 2FRXA 1QTQA 2R84A 1K68A 4BVAA 4KXVA 4D4GA 3QF4B 1H1TA 2OKCA 4MPPA 2AEEA 5L4LA 2IBMA 2Q28A 3TG2A 3BA1A 2C0PA 1TQ6A 3BQMB 4M2LA 4D9HA 3HJAA 4FIDA 4EMUA 4UD6A 3OEWA 3ICQB 2RHBA 1ADJA 1PKXA 3VPXA 5IS2A 1NXTA 2MR5A 3HM9A 3BN3A 2R1ZA 3O73A 4GL4A 4J2OA 2D3TA 3NAGA 2HHAA 2ZZNA 4AUKA 1MEOA 4BO3A 1LRKA 1W4CA 3N6VA 4P5PA 2W8ZA 3E5MA 2C92A 1MXHA 2XUFA 3LMKA 3AEKB 2C1XA 1QGDA 3IVGA 3RV4A 1ISSA 4RTRA 2XGJA 2XD4A 4IWYA 3AIKA 3GHYA 1VJCA 3ZW9A 3CX7A 2ECPA 3PDIA 3I5UA 4RM3A 2JHCA 3FPEA 4QGHA 3OZDA 4PTLA 4DHWA 1SOMA 4B2YA 1VYUA 2Z2IA 1ULZA 1QPZA 4OX9B 4IR7A 1F2DA 5IH3A 1DADA 1DU4A 1SVIA 5C4MA 1SD1A 3T9EA 1KSGA 4JVSB 1EUDA 1TJPB 1YOBA 2EIXA 2IUYA 3NV7A 5EA2A 4CQMD 3A6LA 4K9MA 1KR2A 4RD6A 4YAUA 4NX2A 2VQEB 1YTLA 2YXNA 3RFUA 2IIBA 4M6WB 4EVRA 4X7MA 4J7CA 4K6HA 3DP9A 3K70C 4NV0A 1EI9A 4C20A 4FM9A 1JYEA 1D2NA 1XHEA 4YJGA 2O8EB 3DVLA 3DOUA 4ZAXA 3GGDA 1XAJA 2WV9A 3RFVA 4YUWA 4L0MA 5KQSA 3TB6A 5EP4A 4D0LB 1NP3A 5K0TA 1R6DA 2BW0A 2ZCVA 2ZS7A 1U0HC 2LCIA 5L7WA 1E8MA 2GZ3A 4DR6B 3QELA 4OKNA 2JDIA 2F1KA 1RLJA 2RI1A 1GYPA 2AOTA 1DIAA 4IYJA 2FRDA 1QO0A 1L4UA 2AN3A 2XUGA 4OHBA 4PC7A 1XDSA 1I3KA 3B1YA 6Q21A 5KO2A 1EVIA 1I4EB 2GK4A 3ZOZA 2ZJ1A 2XVAA 4MW0A 2O2XA 3DTNA 4NS1A 2UYGA 4G0PA 3UV3A 3V2UA 4D80A 4CTNA 5J2UA 3Q8LA 3TSCA 3O4FA 2LUOA 4YCLA 4XIGS 4JVOA 1E2LA 1MQ9A 2WFAA 4ZV4A 2CHGA 5FTNA 1X7ZA 2WSBA 3KOOA 4FR5A 4JP8A 2VJCA 3THWB 2W6CX 1R3UA 2ZG6A 1KETA 1P75A 3BXFA 3GA0A 1Y5LA 1Y7TA 1R6TA 3LC0A 5M7EA 1TT7A 3RUCA 3V2GA 5F4ZA 2O8DB 1B3RA 3AR8A 3O8RA 2YJ6A 4J0KA 1JEYB 3H04A 5BQ5A 1YCFA 4NQRA 2JZNA 3TZHA 3ASUA 3GL9A 3PBKA 5EE9A 1ZIOA 2DPYA 1L4HA 2W2LA 3CRNA 5AK6A 1N36B 2GARA 9ATCA 4WNAA 4LQLA 1C4XA 1IATA 1ZU5A 5D5HA 1LLCA 3S70A 1VCNA 1PNOA 3MN1A 3ETNA 5J9FA 2HU5A 4FU0A 4KVAA 3SE7A 1N9GB 5HFAA 3VZBA 3O38A 4B7CA 1E0DA 4UUQA 4EHJA 4Y7CA 4KQGA 3WKEA 2E7ZA 1GSHA 4IBOA 4U3JA 2GVZC 1FQWA 2JJ2A 1TXGA 1PK7A 1PFYA 4DCCA 4GQBA 1R0BA 2BMJA 3LD9A 3IP5A 3NWOA 1BSVA 1Z6ZA 4C2AA 3KR1A 3PPIA 1Q7GA 2YJ5A 3NM4A 3OT1A 2DP4E 5FFMA 3SSOA 4GZ3A 3I76A 5TNXA 3RJ9A 3WLAA 2M6LA 4DDUA 4D9MA 1SXJA 2J3DA 3M3HA 5KBYA 1CQIA 3DNMA 3L1IA 1ZLYA 3A1UA 1WSDA 2WOJA 3NATA 1WVIA 1V8OA 4LTMA 2ZM6B 5E6RB 1AF4A 1EESA 4Y2JA 5AI6A 1ZM7A 3U81A 2QTLA 3V8EA 4B74A 4DVGA 1N2GA 3HCBA 5BV1A 4A0HA 2RHCA 5HE9A 3UAWA 3W8DA 3O2NA 4EVSA 3ADBA 2CD9A 2NTEA 1ZMTA 5EZ5A 4F60A 1QH8A 5DW0A 1BCSA 5FWXA 1E1DA 3W8NA 4AWBA 1KRHA 3ZWMA 4U7DA 4S0XA 1ABEA 3OURA 4CM9D 5M04A 3H2JA 3ZKWA 1NVAA 4HX2A 3HVUA 4LRQA 4LGYA 5EFZA 3MWJA 1UP4A 1Y6JA 2JB9A 3PPWA 3ESQA 1QK4A 4TGLA 4AMGA 5JZSA 3F6SA 1JZQA 4MTLA 3SJAA 3ZDQA 4F9GA 3MIZA 5T4BA 5BWBA 4MVJG 5U9CA 2A8YA 1PWHA 2ZBFA 1HX7A 4G97A 1EFUA 2RGBA 1KKUA 2BGTA 4MDYA 3X2EA 4CLRA 5ADWA 3AP3A 3FBTA 3GFPA 4P4SB 5AOCA 1DINA 3JASB 1M33A 2XADA 2WWWA 4E1AA 4IDAA 1R4NB 3HJHA 1JALA 4JNKA 2CUNA 5E38A 2BFCA 1E7MA 1L1QA 1ETUA 1YA4A 4LC1A 2X1LA 4UCQA 1L7RA 3OKAA 6NULA 1A9PA 4LIPD 1SH7A 2X0NA 2ZUUA 2XLCA 2I4LA 1G59A 2W11A 3BICA 1SXHA 2HRBA 3GVCA 3Q3EA 1GDDA 1K27A 3PX2A 4NSNA 3CNNA 3OVMA 4L5BA 4NAVA 4M4SA 4PRKA 3ZHCA 3I6YA 1UMBA 4BVEA 4MDEA 2X5NA 3HSSA 3BUSA 2LVBA 3OZGA 3BDIA 4PVCA 1FXSA 2IS1A 2Z9BA 1ZJZA 3DBIA 1ZK2A 2X0KA 3DFKA 1BVYF 2VPXA 3QP9A 4NK5A 1M2KA 4OXNA 3VFDA 3FCOA 1B1CA 1SUWA 5I8ZA 2WICA 2O19A 2Q62A 1UXHA 2C00A 7ADHA 4I1SA 1AXEA 1IHXA 5DZSA 3R7NA 3DZHA 4BEJA 4MQUA 2PV7A 3IJPA 5B1HA 3W2GA 1EXNA 5T4EA 3FLBA 2OR3A 4RPKA 4KFCA 5EKTA 1JLLA 5A6VA 2MYUA 4YRIA 1MDBA 4QDTA 2VBCA 3A2NA 3QYPA 1CUUA 1KU0A 5LIRA 1U04A 3FAKA 3KZ1E 3AG6A 4YCCA 3DDHA 1E2FA 5C0OE 2RGRA 3WADA 4BFUA 1DC8A 3AYZB 2K87A 2O0HA 1C9EA 4UNIA 4D9NA 1W52X 3V34A 2DUWA 2OXEA 5B4TA 3FDIA 2FSVC 4KO3S 1KMCA 1EHYA 2FJ0A 2PDAA 3ZEAA 4D43A 2XXJA 3R0IA 2JHAA 5JY1A 2A0KA 2YH2A 1OIWA 1NPDA 4R2HA 5LQNA 1G8KA 4ERNA 4ALMA 3QX9A 2VEOA 2FWAA 1P5HA 2W4MA 1PGQA 4B6PA 3KE9A 4R05A 1Y3FE 2MSDB 3AWIA 1JHQA 2EFJA 3L8HA 3NT5A 2GNOA 4X71A 2XNKA 2AFIB 2WKWA 2XGSA 1SXQA 5BOSA 3OJXA 4JQOA 4HFJA 4HQOA 2WSYB 2PUFA 1FBNA 1G5IA 4TQGA 4UDOA 2B5OA 2IJGX 3DEFA 1PZHA 4D9IA 3H2GA 4BFTA 4DA6A 3N8HA 3C2QA 3DWGA 4QGBA 1RXEA 4HAYA 2AFHA 2WF8A 3C3EA 4TMKA 4G09A 3SIWA 5EIEA 2QV7A 2PUBA 1V6AA 5DLYA 1JFTA 1ZMBA 4YX9A 2ZREA 3C3AA 5CEJA 4JSRA 4R1LA 1U0RA 1U2QA 1VRWA 4WOCA 2OBYA 1HYEA 2D8AA 5EL0A 2AZTA 1J5EB 1G5HA 4WECA 1QVWA 2H1CA 3MC1A 1AUOA 3B5EA 1LC3A 2O8CB 5HOEA 1NY6A 2GPBA 5BVGA 1UM9B 3C39A 5BQOA 3L6DA 3E70C 5FBLB 4NBRA 5EIBD 1G21B 1K4KA 3U3JA 4BO1A 4EPYA 2J3KA 4ZU1X 5A2GA 5T67A 1QFZA 4ZCRA 4Q6BA 4R2KA 4XGIA 1BFUA 4WCVA 3M6UA 3UOAB 2H4FA 2FPGA 4TS9A 4INAA 2FP4A 1OH5A 5CTAA 3KL4A 3QVTA 4MHTA 3MWEA 1VLHA 4OEHA 2C1EA 1LDNA 4RLQA 5ALYA 2RHGB 1T2EA 1GVHA 2PSEA 3SYNA 2F1OA 5HCNA 2BM1A 1SNYA 4H1TA 1IZZA 1Z3IX 2QZJA 2F64A 4GNKA 4I50F 1LF0A 3O94A 4HAIA 2DJIA 4URYR 1RYZA 1EM8B 3OM9A 2OHXA 1DG3A 1WHSB 1WQ3A 1X1SA 4GICA 4ABYA 4E5YA 4F04A 1R64A 3B7WA 3BTUA 3EUFA 4AICA 2ERXA 1R16A 1UEXC 3LY7A 4OFZA 5A9RA 5IX8A 5DM70 4MGHA 1SQGA 4IMRA 3RWOA 5ICGA 1AKTA 4X1KB 1L5NA 1GSIA 2XA1A 3NC1C 2P30A 3T7KA 4LBWA 4G9EA 4XARA 1JKIA 4G8BA 2AX3A 3T5DA 1IWPB 2E1PA 5LOVA 4GM0A 3KKEA 2CXOA 3STYA 1QLHA 3JYLA 3L7CA 4TROA 4EX6A 5JSYA 3R5TA 1ODLA 1N7IA 1P4GA 3SHQA 3DB1A 5K01A 1SVMA 2H5LA 1ADCA 5CEEA 2WMDA 4G07A 4IIJA 3UK0A 1ADGA 5JBQA 1N34B 1TF7A 2ATIA 2ZWVA 1WXQA 1KAEA 3JAMA 2FZ5A 2GVNA 2D4HA 3ZWPA 4I99A 3CURA 2ORYA 3IS3A 3DAFA 2NTJA 1ZZGA 3WLPA 4YRTA 5REQA 3KJGA 5KKNB 4I6GA 1UAGA 5AICA 1L7OA 3WRXA 2GF2A 3LDFA 2QM8A 1XK6A 5DBEX 1IN7A 2J9GA 5AKKA 3RCBA 4E1VA 3NKLA 1AQJA 3Q98A 1DUIA 3ZBUA 2HHHB 3L1UA 3ZDDA 3E15A 3TZBA 1WMDA 3K05A 3DLCA 1SXIA 1XBTA 1WS6A 4B8ZA 2JIOA 2VUSA 4BN4A 1OMOA 1MW9X 2OV3A 1MGPA 3TQTA 3FY4A 4WNCA 5CIWA 1NI3A 1E0JA 2QUZA 4UVIA 1YBVA 4PPNA 1DAIA 2CVHA 1QZZA 5HJ2A 4AZWA 3Q8XB 4X1OA 2V74B 1GFSA 2PX8A 3H9UA 1LXCA 4M88A 4C78A 4YV0A 3IA7A 1E2QA 1QC5B 4MPDA 2EHDA 2C31A 2RBEA 3GMDA 3JQQA 3QE0A 3DG9A 4KVGA 4QPCA 4C4RA 2P6RA 4QLAA 1NVXQ 4KO1S 4OYHA 4UNPA 1UXIA 1RFGE 4HSEA 1V7CA 4WXEA 2Y1FA 2DXIA 1HDIA 1WP4A 4UHFA 1QH9A 4QULA 3A1DA 4HVAA 3U7FB 2Q5IA 3AHDA 1BWPA 1L4YA 2GLXA 3Q9UA 1FIUA 3N39C 4ZJZA 4IX1A 1T8YA 1HLPA 2B5VA 4LYGA 3TMKA 1TM5E 1ZU4A 3LLCA 1QZ3A 2YWEA 2QSYA 3GROA 4LI0A 2GHIA 4EO4A 4U6NA 1ZJJA 3ZY5A 1DKUA 5D1HA 5IDXA 5E1BA 1OJ7A 4LBVA 3BXEA 5CNJA 4CMAA 1E3LA 5J1TB 3A36A 4L16A 3OUTA 3GJ5A 1TJ5A 3PQ4A 3ZC3A 2G1PA 1D0IA 4NCAA 1D6SA 1MVLA 1L5RA 1PTKA 1SOAA 1UQUA 1PEAA 2Z83A 4LK3A 1Q19A 2CXNA 4OJKA 3UT5B 4CG2A 1TUIA 3EWIA 3UT0A 3JD4A 4RCZA 3H9GA 3GG9A 4AZ3B 4DG8A 1SQ6A 2FEAA 2C9YA 2MYTA 3D9QX 3O4JA 1Z0ZA 5J3JA 3VO1A 2D74A 3BGVA 3HZZA 2VZEA 2IPNA 3LE8A 5AVZA 4KB5A 1NQOA 3LF2A 3S55A 3KJHA 1UFOA 4OSPA 2DY1A 2O7SA 2YXBA 4QSHA 4ZCTA 3LOUA 1F20A 1HT2E 1NVMB 2OFOA 2XMSA 2ZI9A 2ZLBA 5B53A 3SOZA 3BMCA 1EKXA 5HF6A 1GNLA 1TQDA 3C24A 2R62A 4C4AA 4NL4H 5K6TA 2NZ8A 3TBHA 3T4UA 3B13B 4K9SA 5DNWA 3P0RA 3EARA 4A73A 3ZE9A 2I6TA 4BLTA 1P6QA 1RKVA 1TM7E 1BU5A 4YDSA 2O2SA 3QF7A 4CMKA 1MO3A 3JARB 4LWOA 3WL5A 2CL5A 4LI3X 4PY2A 3NNNA 1ZM4A 3ECSA 4LHSA 3TQQA 3FGZA 3VR6A 3H5AA 4ZOBA 2B35A 3AB8A 3OA2A 1J56A 5G0UA 2GK7A 5LWHA 3QBTA 4K9QA 3G9ZA 4Q1FA 2IDZA 4XGNA 3DCYA 1XYYA 3A4VA 3B1WA 3MWFA 4GRAA 5GP1A 1JH8A 3MWLA 1SHKA 1Z0DA 2HZBA 3BD7A 2P2DA 3BQ9A 3W1WA 4IG4A 3HO6A 1ZR2A 4NP6A 3WBFA 2ORED 3EX7C 5BUSA 2IYQA 3V7NA 1O57A 1Y9JA 2Q8QA 2PKQP 3IKMB 2ZUEA 2IPLA 3EG9A 3L8ZA 4O4IF 2BPOA 3L7BA 3CLUC 1CX9B 1NMQA 4LEIA 5JADA 3DKPA 2PSSA 2HMYB 2HN9A 1TTQB 4XEUA 2Y93A 5JFTA 1L5HA 1T9AA 2IYOA 2J9RA 2AGVA 4JP1A 4N0QA 1E7WA 2R8EA 4IXNA 4GOOD 4US2R 1DB3A 3E8MA 3OKCA 4NG5A 4D74A 2P7IA 4OI1A 5KNLA 2QUBA 1RQGA 5AVVA 4D9FA 3VUFA 4WK0B 3EB9A 3L4EA 4CLRB 1NXWA 4EY3A 3ONEA 1T5TA 2PUDA 3M3DA 1B42A 1JFVA 3ZQKA 2X0IA 2JJQA 3PV0A 2RH4A 4NI5A 1NMYA 5IN5A 3HI6A 2YW9A 3DUFA 1Y9ZA 3GN2A 4WGGA 3R9KA 4D6PA 5GZ3A 5IHXA 3W5HA 3AY6A 1EQ2A 2IZ7A 2FPRA 1YJBA 4LMAA 3CY6A 4Q4JB 2F9FA 4BP8A 3EHDA 4MQEA 3RTDA 3TLGA 1UBJS 3I9V6 1BCSB 4FGLA 4IIGA 1DIOB 1ZM9A 3SQWA 1MC4A 2BMEA 3GJXC 3TIFA 1GU7A 4P9NA 2V7VA 4JBLA 3T1NA 1NUHA 1ESCA 5FWYA 3JVIA 2K4MA 1UBKS 1KGSA 1JHPA 1QO9A 1NFQA 1Z5WA 3F7OA 3LT0A 4QODA 2ZRQA 4S1VA 4WWHA 4ZU6X 3IIMA 4PSCA 3S99A 2F00A 1F60A 3JPWA 2OAP1 2EJBA 3LUPA 3LUCA 3V8NA 1WDLA 4EUEA 5ITZA 3IE1A 1FP4B 2UXDB 3H2ZA 2JLAA 4BLWA 4KQEA 1P7ZA 3CVJA 2H8KA 2PMFA 4KLNA 4E2WA 5EMMA 4M49A 3DE5X 4Y6RA 4AULA 3OT1B 1R0SA 2G9NA 3M5CA 1ZH4A 4Q12A 5HJ7A 2BFMA 3H9QA 4JLNA 5EVJA 3SHVA 5HZGA 3ZJ5A 2KSQA 5DYGA 1XEAA 5TMBA 1TVMA 1L4FA 3PEYA 4BQRA 5L3RA 4YCMA 5ARDA 1BRTA 2DKOA 3PTAA 4I08A 2FI1A 3R9XA 5CH5A 2Y0CA 2I76A 4IH4A 1KOLA 3FR8A 2MCFA 3ET5A 2H5IA 3TE7A 1XTPA 4E0BA 1IQUA 1V35A 5ALZA 4V0MA 4MKFA 1Z13A 3GDWA 1U1EA 1NRJB 2VOEA 4F2PA 3UA4A 1TZKA 1QM5A 4GPBA 4RK0A 1P17A 4PG7A 1RAFA 2VT3A 3OZEA 4S35A 5B1SA 3K09A 3MPOA 1Y8CA 2VHYA 2W6JA 2YWDA 3A4YA 3K9WA 5BSFA 1EWVA 2IBTA 4NJOA 1CYEA 3A9VA 3N2GB 4LVCA 3A0RB 1TJNA 1O9HA 1X42A 2C8KA 1SBCA 1ZM3A 4A6PA 3OLXA 4ZCPA 1IG3A 4ED9A 1NNSA 1F8YA 4RABA 2E89A 4MLCA 3PSAA 5G1OA 3ZJVA 2XJ9A 1NMEA 4XD7D 3OTOB 5BV0A 4D1YA 2OXRA 4U7GA 5JI3E 1NLYA 4OK6A 1FTYA 1VJTA 4IDQA 1HDOA 1Z3CA 3TVYA 1BMTA 1BZYA 5HK8A 2OD9A 5KYXA 3ROEA 1BMDA 3MCZA 1T29A 1SURA 5J2UB 2ECQA 1Y3CE 3VX3A 4AZ3A 4ILKA 2I7DA 4DGQA 5K8TA 3COWA 1FP2A 5FCDA 4KGZA 4KUGA 3UT5A 3ABQB 1RYYA 3PXCX 1FRVA 1WVMA 2PAFA 2VNIA 4LHYA 2DBZA 4YNBA 3R7WB 4C2BA 3THXA 4XSHA 2NUPB 4A10A 1Q92A 2P1DA 5A4MS 1XEWX 2B5WA 3RADC 1L9KA 1XNJA 1D1QA 1EFRD 4QXPA 1QYDA 2NACA 1CR4A 3ENQA 1K08A 3QUTA 4HDSA 4K05A 5DXFA 6YASA 2I7XA 5IWCA 1C3EA 2VJMA 1G0NA 2A0UA 2Z09A 4YJGB 1GARA 2O8EA 4AY4A 2PL9A 4BXOA 1L5MA 5I7FA 4P7JA 4LRWA 5D5PA 2Z08A 3P9XA 3CUKA 3R6TA 2Q2WA 1SVSA 5F4BA 4RTQA 1E59A 1U0EA 1LGYA 3QPVA 1JMVA 1XA0A 1E3DA 2Q4BA 4AJIA 5JALA 2Q3LA 5TE9A 4RL4A 1M2GA 5A9SB 3VU8A 5FOUA 1E7SA 1B6SA 4FFBB 4JYCA 1GEGA 2NZXA 3PHJA 1IMOA 1RCUA 2AC7A 2EBWA 2QYSA 2A2ZA 3V2IA 2Z2JA 3PC2A 2KLBA 1KARA 2PU5A 4QDZA 5HGXA 3AL2A 3EAGA 3OFNA 4MR9B 1F1JA 1JJVA 2RGNC 3PFBA 3HUDA 4R16A 1WSAA 2BFFB 3M0EA 4R2WA 3V9AA 5TC4A 1OBCA 1Y3BE 5IC4A 2CCJA 3GLHA 4RHEA 1ZVKA 2XQJA 2V4MA 3ZZTA 2NAFA 1NZFA 1G16A 3GAMA 2BFNA 3IQWA 3PB3A 3EEFA 3LO5A 3GNTA 3O4RA 1REQB 1OFUX 2QX6A 2QU7A 3CH6A 1GRRA 2HMUA 3K70B 5G1NA 4TKUA 3CWQA 3GRYA 2HIAA 3Q7RA 1IBCA 1E2MA 4X44A 3IMEA 4AS2A 2Q3MA 2ACEA 3AI1A 4XOIA 3IB3A 3HE3A 2ID4A 1N7HA 3CE6A 3FPLA 4Z9XA 2I7VA 3ESZA 3ICEA 3J7AC 5TSDA 3ODGA 5JZMA 4G24A 2H4JA 1OX5A 4B45A 3COVA 3D8TA 3GZJA 1EWYA 2Z95A 3IP7A 2SKEA 4QL3A 4YDRA 2NZUG 2BGLA 2BRUA 4DV5B 3NB0A 4CIYA 2XD9A 4RY9A 1E6KA 4HVCA 3WMWA 2QAJA 4QJ5A 7ABPA 1RMQA 2GN6A 5D6OA 1WV1A 4BBAA 1WB6A 1T1GA 4JKYA 4AY6A 2V4UA 1J8DA 3C7CB 3I4LA 4HEA1 2GZSA 1SKYB 4GR9A 2W9XA 1SBYA 1M0WA 1NXOA 3EIOA 2YHBA 3QA9A 1AKWA 1Q77A 1OW3B 1SIWA 4OAOA 3PLNA 2AJLI 3ORRA 3H42B 4LJ5A 2OPHA 4J07A 2KBEA 1QIKA 2JFHA 3PNSA 4KR2A 1J25A 3AVPA 1USWA 4JA0A 4KBYA 3BHNA 3DKKA 3A6KA 4KGVA 3E81A 2IYUA 4GI1A 3VR4H 1ZRHA 4JBGA 2HLDA 3CRQA 2P67A 3EGOA 2P65A 3HCEA 4HZUA 2BFDB 1L2TA 1NULA 4RHUA 3SS9X 4FWBA 4IS2A 5K3DA 5K8JB 4DM3A 4ATNA 1O6CA 1WD7A 3HDQA 3OCVA 3VZRA 4HNAA 1B0AA 1U7OA 5CDYA 4CQLB 4ISCA 3FSEA 2UV8A 1RCTE 2I55A 1UT6A 3HBJA 5D2CA 4RJIA 2ZSJA 3MWDB 1RZUA 5KMGA 2AX4A 2ZSHA 4O4HA 4MGEA 4TT3D 2BF4A 2WJ4A 1GPBA 3H6HA 1Y8AA 2XUQA 1JAHA 3C6XA 4Y1EA 1RR6A 3RKUA 3QMVA 3GAFA 4JT2A 2WM3A 2DQYA 4TRJA 1HOXA 2F1IA 1Z06A 1Y4ZA 2ZAIA 1EE9A 4RC9A 4IWXA 4E5KA 1FRQA 2K2QB 3A70A 4PCUA 5LA6A 3ETHA 1TB4A 2VSNA 3H19A 3KYDA 4CLOB 4C3ZA 1QNLA 3OT5A 1EFDN 1GL6A 4NC9A 3QU2A 3GVPA 4YDHB 3CUYA 2FQ1A 3CRRA 4G3XA 4A0GA 3GFGA 1PFQA 2I6XA 1KO5A 3BIOA 2ZTSA 4X94A 3CGGA 4JSTA 1PQYA 3PRJA 3LTEA 1BU8A 2AJCA 5JJLA 5L4NA 4C0LA 4BZXA 1LBQA 3SX4A 2H08A 1RYEA 1FYXA 3RWBA 2C7VA 4JJ7A 3O3CA 4YJ2F 4GE3A 3L0SA 3Q7PA 4UUAA 1MH9A 4EQZA 1Z5PA 4NR0A 3UWDA 5DW3A 1E3IA 1QVRA 5H9VA 3IVMA 4GP6A 5TQ2A 2ZE7A 5JNLA 4UNNA 4ASUA 1MO5A 3L6CA 1XSEA 1A2KC 3GRCA 2M98A 3K9BA 3RUDA 4D25A 1KAGA 3K4HA 5A02A 2D5AA 3AKDA 4CEIB 3JQFA 4XDZA 5CB4A 5K3OA 3K73O 5CM9C 2QKYA 3KU1A 4YJ2A 1FF9A 4K6KA 4EG4A 4ZQBA 4C7XA 4MO9A 3UFBA 3CISA 3WGOA 1VFNA 1L9XA 2FWMX 2BFPA 2CL0X 4P38A 2OCGA 1SXJD 2HOQA 5L3QA 3DMGA 3MZ0A 4DB4A 1DAFA 3OLVA 2NSHA 3NTQA 3PWKA 3OTIA 2BJHA 4TWJA 3ZGNA 2R48A 4V0SA 3ZV6A 4NU8X 1JLMA 3DHWC 2RARA 4J4TA 4Q34A 4CMJA 4S1TA 4F5ZA 5C7LO 5CEFA 3KDAA 3EF1A 4YLGA 4TOIA 3HJCA 3ZX4A 1D4FA 3V1LA 2XPCA 5FB3A 2JVIA 2ONCA 1G5QA 3E6AA 3UXEA 1ILWA 3ZE0B 2V65A 1QNFA 4LZAA 2X4LA 5K4HA 1J0CA 1L5GB 3B6EA 3I5AA 2C96A 3BCHA 2NU9B 3WK7A 1I0LA 4PAOA 4F9TA 4JOSA 5BQFA 1KZYC 3G9UA 3S1LA 4B8WA 3W77A 3IAM6 5IM4F 1OFIA 4LFCB 1H2WA 3LCVB 2V7UA 3S5JA 4ZGGA 3BZUA 4J90A 4LDPA 1TIKA 2AUNA 3QLVC 3VC2A 4NE9A 4D4KA 1H6AA 3P2EA 4QBTA 1YNSA 3PNVA 5JCJD 1SPXA 1MQAA 2GD1O 4Y2QA 1XTVA 2DJ5A 2PD6A 2VTEA 5H70A 4YB8A 3DULA 3MFYA 2IZOA 3CTPA 2NXJA 3OQ6A 5T8KC 1F0PA 3DVQX 1DFHA 3FETA 4E3WA 2GH1A 5J4LA 2BFCB 4LWPA 1DCMA 4U9IS 2Z6VA 1JFRA 3NVAA 2EOAA 3OOSA 3OFJA 4AKTA 5EHXA 4XRRA 2WF7A 3ZBQA 3G0HA 4B47A 4DV4B 2WT4A 4JASB 3FYUB 1Y6GA 3SKVA 2A3NA 3RRBA 1BS2A 1TW3A 4OJMX 4P2GA 4Y2VA 3KS9A 4WFIA 3E84A 4J49A 5EJ2A 1L1FA 1RKBA 1R7RA 5EJ4A 2NADA 3AFOA 3C8DA 3ETEA 1UINA 1YS2X 4OMDA 5TQ0A 3T94A 2VK1A 4B6QA 4ENQA 2CF5A 2GPAA 1J0EA 1R0RE 3RVPA 3RAFC 1CVRA 3FWPA 2XXBA 1GGMA 3K5HA 4Q0MA 2PLAA 4I1UA 3UW3A 1RHQA 2CN1A 1HE8B 2D2EA 4E2ZA 4E7OA 1R12A 1VLLA 1TVEA 3MRVA 1RIIA 4HRVA 2VDRB 1OFUA 5JSUA 3U7GA 5JS8A 2I6UA 5LN1A 4IIDA 5KCMA 5DSTA 5ESWA 1ITZA 2QNBA 4OV6B 1IUKA 2C7BA 5LQAA 1FS6A 1RQPA 3E3NA 1CK4A 1T4DA 4NU6A 2C8LA 3AP1A 1FJGB 1XJCA 3I5MA 1P4HA 3IMGA 4NS4A 4PNHA 5CM8B 1BKSB 3L6OO 3O8NA 3PD7A 4FS3A 1KEKA 2QRQA 3W5IA 4CI9A 1V1MB 3PDHA 4G63A 4LBYA 1MO4A 4X8HA 2B0JA 5EIFA 2R47A 1V7PC 1DKOA 1G63A 3CEJA 2PD4A 4O4JF 4BHTA 1QCZA 1V41E 2BHSA 1FUYB 2OBLA 3V4VB 2VH1A 1Q17A 1SQSA 1WXIA 3MS2A 5CNIA 4XWTA 3WRWA 5DM60 4BO2A 1RWPA 2WSMA 2ZRKA 1LZKA 1MRNA 5B1EA 1O95A 1QHFA 1SCUB 2IYVA 1K66A 3NG1A 3PUYA 4IUDS 4D56A 1XDDA 4OB7A 1NA5A 1J06A 1VA5A 5AM5A 4AJKA 1OVGA 4J16A 3KP1A 3KUDA 4BBJA 4EHNA 4BQEA 3R6WA 2CE2X 4G1FA 1T2AA 4ILEA 4PYLA 3WXMA 1JQAA 1AXRA 2VQSA 4LV8B 2CSXA 3E7FA 4B3GA 3VJMA 3FUCA 3IX7A 5K45A 5BY2A 3IKJA 3VR2D 2PX0A 2KLHA 2VAPA 2FV8A 1NYQA 4KO4S 1L5YA 4FMDB 3Q5DA 2IF2A 4MRSA 1QAQA 4B2IA 1K92A 4TQUS 3EGIA 3M5PA 3O8LA 4R8RA 1YB2A 1RPTA 3FCCA 5B7NA 4E14A 4HNQA 3NOOA 5BR8B 2OHJA 3EVGA 4L6AA 5DI3A 4Z51A 4W9MC 2I80A 4IKOA 5DK4A 3IVRA 1RRKA 3CVVA 1O0SA 2KS6A 3TH5A 4HBGA 2RD2A 4ZHSA 1LBEA 3L7MA 3OEHD 3O8OA 2P8JA 3OSUA 2Q45A 4PBRA 1YR7A 2V5VA 3IGFA 3NPMA 3P19A 1NC3A 3AVXA 2TRSB 3MAJA 1Z2PX 5CBPA 4P08A 4ZREA 3R0JA 4HRAA 4PZCA 3SEZA 4J0CA 4CW7A 3Q6NA 4I1PA 4P4UA 3RG8A 2LXNA 4QUAA 4O29A 4HDQB 1F17A 3BWVA 1EFRA 1G0OA 3IKVA 4TXNA 1SXGA 5SV2A 1JXOA 3F46A 4RGQA 3SCZA 4C5BA 4QICA 5LZ8A 2EKQA 2WDZA 1J0DA 5FDFA 3HEAA 4DEVA 4Q01A 4TTJA 5AT1A 2X2FA 4P7FA 3AL3A 3RTBA 3TOVA 5KTYA 4NJEB 1CRZA 2HTFA 2SKCA 4G6ZA 4EW6A 3WLIA 3RVSA 5DMXA 3W06A 4HDRB 3KQSA 4CCYB 3JZIA 3LXMA 2Y2VA 2ZJ5A 3FHOA 2WTAA 2P9GA 4Y7DA 2F43B 5IC6A 2ZQYA 2ZATA 5I7VA 3D6HA 3F1KA 4WCFC 2XMDA 2K5UA 4O1HA 1L7EA 2EF1A 5EXDA 5GJCA 2XUPA 4BFCA 2QPOA 1JDSA 2ETXA 3C15C 4FK8A 5IBQA 4Z2YA 4B6SA 4LX8A 3HVRA 2FWPA 2DULA 1HWYA 3TLKA 1N5JA 4IM7A 5DKFA 3SZRA 4MWTA 5TPZA 4MYCA 2IXGA 4N49A 2EW2A 2XQVA 3EPLA 1PYOA 3LP5A 3RYIA 3S4YA 3IR7A 1Q1GA 1TGYA 2DSTA 2G8LA 1CUDA 1Z7EA 2DBRA 4QG7A 4CIXA 2V7BA 2VS1A 2IYTA 1MJ5A 1EZZA 4B9AA 4BGDA 2Q0SA 1JF8A 1W0KA 2AD5A 2RKOA 4AN0A 7GPBA 4WLUA 2HY7A 2OP0A 5CK5A 5D85A 4KPYA 5T4HA 3D54D 5F1YA 1IEXA 1Z33A 3L4BA 2VDUE 1SUDA 4LGVA 2OQ2A 3BYZA 1PUXA 3GWGA 4N54A 4ZO9A 4ZO6A 5HRCA 1TMKA 2L69A 2IEIA 4JEIA 3T34A 3E7DA 5SY6A 3WIUA 4X90A 4DV0B 1RXCA 4MVJD 1OX4A 2HSDA 2RFLA 2EJTA 5GONB 1XU4A 3UUEA 2PUAA 2EQ5A 4P7KA 5LZ7A 1XXHA 4BZQA 4BB0A 4ZVSA 1O2DA 2DYKA 3MRXA 4GW3A 2ZJBA 3EQZA 4GC9A 1P62B 1UM8A 2IEYA 4HDKA 3KKPA 4W7HA 4XJVA 1MR3F 5FYDA 2IX3A 2EV9A 4RD4A 4DBLE 2P2NA 3B48A 3GCDA 1X38A 1F7VA 4RKWA 1OJLA 1YH3A 4JB2A 4MXDA 1OZGA 2QW0X 4F3CA 1TAUA 2VSYA 5LA6B 4C4YA 1POWA 2G4VA 2V9ZA 1FNSA 3HJNA 3L1JA 3MTDA 4W1QA 2LCFA 1DZ3A 1GKKA 2HCFA 3AO0B 1XVAA 2BMWA 4UU0A 5PNTA 1DO0A 3HCFA 4PG5A 4AP6A 1K3FA 2C8VA 5D7BA 3UTCA 5KVSA 2QTTA 3JQBC 4O4HB 5ENVA 3TJMA 2HO5A 5FWNA 1FSPA 4YY3B 2XKJE 1Z4LA 3DTVB 3QA3E 1TPYA 1EVLA 1S8AA 2PLWA 1C30A 4S1NA 4O4LA 5E7QA 3IUJA 1YFZA 1J9EA 1Z29A 2VJLA 3GWZA 2ARKA 4ML3A 4RS3A 3BFXA 4LX0A 2E6KA 1LJUA 1JZTA 3OJLA 2GASA 2HQOA 1E8DA 1E5XA 4MRPA 1P72A 1YR8A 2DQSA 1A4UA 1GRVA 4G0QA 4LCEA 2JD2A 1VPDA 2ZJ2A 1VDMA 3QVSA 1H1LA 2ZRFA 1K8QA 4C07A 2IBSA 2UZ1A 2AJDA 2V7XA 1Z6TA 1RWBA 3PXXA 4PX9A 3O74A 3RJTA 1GPWB 2ZRPA 4IF4A 4Q18A 4BFVA 2N75A 1TM3E 1BVHA 4IGKA 1O3YA 2WOOA 2ZVQX 2NXNA 3TTYA 1V3VA 3IE2A 1Q7RA 4MMXB 5DNCA 1CC1S 4P32A 3R3XA 4CL2A 2YQ4A 3HFSA 1MDFA 5JAQA 1PJ8A 1SU6A 2J30A 3FJYA 3PC6A 1YL7A 3R77A 4OBXA 1KPIA 4CM4B 3Q9NA 3K7EA 3FOZA 3EZXA 1Z45A 4C0SA 1YWGO 1V7ZA 3GUUA 5KAPA 5LFAA 3G82C 4GBJA 1RM5A 4BEVA 2A5DA 5U4XA 1E4EB 4J29A 1EEXB 3N1UA 1VMKA 3DT8A 2R9VA 4F12A 3P5SA 5CITA 4U9UA 2DWOA 1EK0A 3BWXA 3K6SA 1A5AB 2HUNA 1LDBA 2XTZA 3CT4A 4Q3KA 5CBKA 3UFXA 5MN6A 4IWNA 1SMKA 3H13A 3NBYC 1W93A 3VPCA 2XXAB 3UCEA 4FE3A 3BFKA 4JBHA 2ACKA 4B33A 1E5VA 2HQ1A 3IPAA 3MOSA 5E2AA 2JLSA 4FFRA 3E3LA 2GHQA 3EMKA 4S0ZA 3RFXA 5B5SA 1M2VA 6REQA 4WSOA 4Z3DA 3AR7A 2KMLA 1QCYA 1C81A 1CZNA 2QA5A 3Q3VA 3GIDA 5K0GA 4GPIB 4TYMA 2E4ZA 3REQB 4Y6LA 3OQVA 2HLHA 3ND8A 2YWCA 1TM4E 5A1TA 2GOYA 2YFYA 3J80A 1CNMA 3FMPB 4GZMA 2WHRA 4DREA 5JECA 5KDOA 3EPJA 1RI5A 4EMSA 4MIEA 2DG2A 3BKXA 3L0OA 2LIPA 2BM9A 1V8BA 4K1XA 1O5TA 3DEYX 4GLBA 5CA1B 2WI8A 3LUHA 4RETA 3TOCA 2GPWA 1I9GA 3P1JA 3M4ZA 2C2KA 2G5TA 1CNEA 4N5LA 1O4WA 4BWGA 3ESAA 2WKPA 3HDVA 1SU8A 1P4JA 1ZCBA 4P8RA 1VSQA 3FPSA 5AKEA 3GVXA 4C6RA 2FG7C 4P4NA 3U13A 1LVUA 5FTMA 1R0XA 4K9OA 2D7CA 2YY6A 1Y5NA 3NTXA 3PEUA 2R4UA 3QWHA 3C3KA 5G3YA 1YE3A 3DB2A 2VYFA 4KBGA 1J8MF 4G1BA 2CBXA 3ED1A 1FU7A 1N6NA 2CB0A 3G0DA 3QUBA 2VDLB 4ESOA 1R1DA 4IVNA 1TPZA 4BEWA 2NUPA 1TUEA 1V11B 3L6EA 4JT9A 5ALJA 4FTWA 4WUVA 3JU3A 3ZJUA 1Q16A 4ECEA 5LB4A 4B4KA 1L7PA 1PWEA 2ACWA 3NS7A 2PUEA 1P80A 3A4MA 2C4TA 3Q85A 4R2JA 1BVUA 1RAHA 4Z2AA 3IESA 1UMKA 3M70A 5GWXA 3GBPA 3TW0A 2GAOA 3AUTA 3GJ6A 2VQ6A 3E2MA 4N4AA 3SX2A 3V7WA 4GP9A 1CJCA 1ZO8A 5EE5B 4PGGA 2QQ0A 4TQAA 3MCWA 3UG6A 4UEOA 2R65A 4CLDA 4RD2A 4W99A 2WWYA 2RMKA 3JALA 1NRIA 3PU6A 2BKVA 4ER5A 5B36A 2AF4C 1G3MA 3C74A 3ZZ1A 3BIXA 2RB4A 3W7BA 3OG9A 1CR2A 1T3SA 1DAPA 5FFNA 1XR3A 2O5RA 3PXBA 4F3KA 4R6XA 1GFWA 1QG0A 4YONB 2B69A 2D0IA 4M53A 3BK7A 4OB8A 1PEYA 3K0AA 3DF9A 4FOSA 4NFYA 1AM4D 2FZCA 5KI6A 5BWCA 5LZ5A 2DQ4A 3C5EA 4OQDA 421PA 2UXBB 2EBUA 2OV8A 3NKVA 3ZGVA 1AB5A 1RHKA 2IHTA 4IGFA 5HKBA 2DVMA 1ECJA 2G76A 2J6HA 5HUQA 1TAQA 2FE1A 4KZKA 2Z58A 5ABPA 4FSHA 1VKJA 3SZGA 4D8YA 3UJ6A 4YPOA 2ZTMA 5CDUA 2QVBA 3TRJA 2WPDA 1NSTA 4D3ZA 4XM0A 2ZB4A 2D1FA 2HJ9A 4IOMA 3O1HB 2PGXA 2FSHA 3UGQA 3TF5A 1PCXA 2H51A 4M1EA 3TDMA 4FFPA 3HRHA 1BFDA 3O7WA 2VPWA 2CXRA 2FSIA 2ZIAA 1KQNA 2ZP1A 4RKRA 1I1QB 1OFVA 2CC2A 3ENVA 4TKVA 5ITZB 2M32A 1P73A 4INZA 1GA4A 3FE2A 3IBGA 4UVEA 3R7SA 3X1MA 1ZFNA 1P7CA 1MA0A 4OA5A 3HEBA 4LW8A 4ZXFA 2IVZA 1XROA 4ZJYA 2JFBA 4G23A 4H4EA 1TZBA 4ECAA 1CIJA 3FKSA 1Z5VA 3WB0A 3QEAZ 1RLTA 2JBHA 4BKQA 4OBEA 4AK9A 3TR5A 1ADBA 5TQVA 4Q4JA 3MGGA 2JGKA 3Q9SA 1V26A 1HSZA 1C3VA 1P3Y1 2EWVA 2JH3A 3KKQA 2YTZA 3K0FA 3KTOA 3QEOA 1FOEB 4PSVA 5H3HA 1EH5A 5BWMA 2Y1WA 4XCQA 1TJYA 1B15A 2XWBF 4RY8A 5F23A 5TVGA 1IVNA 2PMCA 2BMAA 2XJ4A 4NKRA 5SYMA 4BWFB 4YV1A 4K0KB 2NU6A 1VPEA 3Q15C 3LRTA 1CDOA 1HRDA 4DJTA 4RIGA 1GL3A 1V95A 4X6UA 1K5PA 2LTAA 1IXKA 1Z2NX 1CUAA 3OTQA 4N65A 1VRCA 4RIIA 4OA8A 1RMYA 1D8AA 1SC9A 2JAOA 2KW5A 4MGKR 4EEZA 1XMJA 1WG8A 3F73A 1JFFA 5E4TA 3PYXA 2X7HA 3P2IA 3FLEA 2P5YA 7REQB 3BTOA 4EARA 3OQ1A 1XTZA 2GM5A 2Q5CA 2YMLA 2W2KB 4IV5A 4PZPA 3DLAA 5F2EA 3LTNC 1KI1A 3ADCA 1GQSA 1ANKA 2H9IA 1P4RA 3CX3A 4PC1A 1R88A 3ILHA 3DCNA 3OZAA 4TLEA 1JXAA 5FA6A 3WRVA 5JJBA 1CDEA 1M0EA 4BBZA 2XIJA 1RLUA 1H4VB 1PDWA 3I9FA 5TY0A 4QKQA 5L7YA 2G6BA 2LKDA 5ALKA 2FCAA 2ODBA 1USUA 3LPMA 2N9UA 2VTDA 4TMWA 2O7VA 3OOYA 4JWKA 1IPFA 1IIRA 4HWKA 3HL0A 3L4JA 1T6BY 1SN7A 4AQDA 5EJEA 5KU7A 1I32A 3OQBA 4WN9B 2J31A 3LLMA 3WIOA 4D42A 5I9TA 1M0TA 1R6BX 1TEZA 2OAEA 2JD1A 4RIHA 2DU8A 3RIGA 1ENZA 3B36A 4IDPA 4FR0A 4XTCS 3KHTA 3PVSA 5FFFA 3K1ZA 4MVJA 5CA0A 2PKRA 3JQDA 1KHTA 1SHLA 4MMZB 2WUVA 2WVAA 3A9WA 3E9ZA 3P9RA 4NABA 4Q1VA 3UMVA 3SMQA 1MC8A 4QBFA 4BC0A 4F9EA 3P0JA 4B44A 2ZRDA 3AKCA 2PR2A 2B7CA 2UVQA 4IIFA 2O06A 1VCHA 4MW1A 1IWBB 1M2EA 1IN6A 5U1PA 5FBQB 1KEVA 3DGFC 2QR3A 2E4VA 2QRLA 3R4VA 5HIMA 3UMSA 5KOIA 3KWFA 3NP7A 5F2OA 1DKNA 5KVCA 4A2PA 3D8SA 1M2OA 1DXYA 1OV6A 3GGOA 3NP9A 1QU3A 1GTVA 2ZTHA 1WDMA 4I4TF 3LUKA 3MGKA 4PC3A 3BXPA 4PX3A 3PL5A 3K6RA 2W2QA 1KO8A 2B98A 2QVLA 3AEQB 4EENA 4KMRA 3BIFA 4YQYA 3U6KA 2IY9A 1IXYA 3OPYI 2WB2A 4WA8A 2PGNA 3FH0A 3CW9A 1MD9A 4AO6A 2EBHX 4GKKB 1YS4A 1G3UA 2E0IA 3GEBA 1I6MA 3D3WA 1U11A 4Q9JA 3Q88A 2WQZA 4MKRA 3RS0A 3LV8A 2C58A 2DTXA 2ET6A 3NVMB 3VO8A 1EG7A 2P1ZA 3LWDA 5CAEA 2BI7A 3ZNNA 1JHRA 4ID3A 3H6KA 4V38A 2FPMA 1Z73A 3WBKA 2D1RA 3L6BA 4QHTA 3FG9A 3MTJA 4B31A 5BURA 3ASVA 5DX0A 3FWHA 4NWIA 4W7IA 4A16A 4G84A 4KN8A 5IF3A 1P9OA 1YE8A 1P1CA 2PFSA 1VFPA 1XZLA 3PWZA 1Z75A 4FYXA 1N92A 1C9JA 4DPMA 8ATCA 1JA1A 1W0CA 2P5TB 3NBQA 2REQA 1P2UA 2H3HA 3QWIA 4IHAA 2NOAA 1X7WA 4TWAA 2ZRHA 3R5FA 3SFTA 2CD7A 3TGLA 3LLVA 1I7DA 2HK9A 3GRRA 3WGKA 4PVDA 2R8PA 1R4ZA 5L45A 5KCZA 3DCIA 1SKQA 2WWHA 4TTIA 1LDMA 1GGFA 3QKUA 1A96A 5HXAA 1CT9A 2B4RO 4IY1A 4NYJR 3DE6X 1BGVA 3KG2A 4S2UA 5D3MB 3FZYA 3L9XA 4EGJA 3TR0A 3OJFA 5KPDA 3ZD7A 4Z9BA 4P98A 4QM6A 3DW1X 4DNPA 2QAGA 3EVTA 1E3MA 1NDHA 1R4AA 1T8TA 3AF3A 3AUUA 4GFDA 1XWWA 3AJ8A 5B2ZA 3R7DA 3UK1A 4ENTA 3RSOA 4AC9A 4IIJB 5IKMA 1WP9A 4ND3A 5BSEA 4NENB 1D2EA 5KNBA 2HA4A 1IHYA 3O1LA 3FSGD 1E2UA 5ER6A 3EQ2A 4QRDA 1S2DA 3R23A 2YV1A 2DE0X 4WH0A 3INYA 2CLLB 4REQA 3UBTA 2IS2A 1YSCA 1ZKMA 3ZJTA 4TLCA 2D1YA 1ENPA 2NPFA 3N2NA 4Y9SA 1XZBA 1L8XA 1KF0A 1QE5A 1GAJA 1WA5A 1IOLA 1DRJA 1XTUA 2Q3CA 3BH0A 3HGMA 2H1VA 3PNQA 2XVXA 2YHSA 3AIMA 5DHSA 4NEQA 1EP9A 5FI5A 2QU8A 4FONA 5HUHA 3HB9A 2HUPA 1PP4A 1W48A 1G20A 1P2TA 2OV4A 2ZGVA 1GNRA 3DZDA 2IV2X 2O3UA 3BULA 3GLQA 1R10A 3SC2A 4BVHA 3SKYA 3D3JA 4DMCA 1X8LA 3BRSA 4PGMA 1GKYA 4AKGA 2B4AA 1UBLS 1E58A 1WLYA 3OJCA 4NECA 4RW0A 4AQ7A 1E2HA 3VZQA 1I51A 3GLUA 4Y30A 2GHTA 3EIUA 2CZQA 5EMLA 3EVFA 3PGLA 3ZHQA 4ZZIA 4HD8A 1X1QA 3N05A 4PIPA 3FFBA 2XT9A 4NFHA 1BA2A 2XCTB 2BGUA 3KAQA 1AKVA 4X7PA 2ZAGA 1EINA 8AT1A 1A8HA 3OIVA 4WOKA 4EFKA 4CT4B 3MSXA 1JR4A 2WAXA 3NDRA 5BMVA 4RXUA 1Q2UA 5ECDA 2W43A 5B6JA 2GXUA 1GCAA 2UVPB 3IMKA 3SS8A 4TRMA 5JLAA 5BW4A 5FUMA 1J1ZA 3I9KA 1R0YA 4RNCA 4U9HS 5JRJA 5T3YA 1RXWA 1TIBA 3FR7A 2ZTLA 3VV3A 5BPHA 2W6ID 4XYBA 4YRJA 1T9GR 1UMCA 5HCUA 3I37X 3QG1A 3STUA 1DC4A 3ZS8A 4W7SA 1U8AA 1NXXA 3LGXA 3P97A 4MTCA 3IR6A 2VLIA 3LW8A 2GCGA 2QBYB 2ZT7A 1ZJWA 4CMEC 1NIPA 3A1SA 4OG2A 4P5DA 2F8MA 5EKXA 4LF9B 5T41A 1Z34A 4JLSA 4TTSA 3BK2A 1KZ4A 2FMUA 5IJ0A 1JWLA 4G0VA 1X7XB 3OLCX 4B6GA 3K32A 3ZXSA 5EEGA 1TOAA 1M0SA 2QTVB 1RAEA 3UHFA 3PEVA 5JV5A 3B52X 3ZWDA 2XTNA 1KI8A 2QTCA 1XN1A 3N6RA 3QOXA 3FHTA 1AUPA 1DDIA 4YMSA 1PR6A 3NYRA 2GJKA 1MJHA 1CXZA 1T0BA 1CB0A 2BFWA 2JGJA 2C07A 2RHOA 3A10A 3IEKA 2QN7A 3I8XA 3LCJA 2HBZA 1OX6A 2HLNA 5E1DA 2PX5A 7YASA 1RKXA 1AKRA 2W2OA 4JU8A 4U2EA 4Z54A 4GBED 4JUAA 3I62A 4WKPA 1KMHA 3MUEA 4B4OA 1B16A 3AG5A 1FVHA 2PO7A 2WYWA 3DBHA 3I05A 2QPLA 4YJFA 4YCAA 2XMRA 3W6ZA 4BMXA 4CMEA 2H29A 2I91A 1E1YA 4IMPA 1D07A 3D8UA 4MAFA 1M1YB 4I55B 5LC1A 4DJEC 2C4NA 2G83A 2G82A 5ENDA 5T8KA 4HDMB 4N9QA 3FFTA 5KOHA 4D0GA 2DKNA 5DOZA 1NBWB 4RFLA 2VWHA 2FFRA 1GV0A 2DFVA 2DR3A 3TGPA 1UMCB 3WYCA 1D6JA 5BO5A 4BNZA 4FC6A 4D97A 1X1BA 4FWTA 4QUKA 4ARAA 3ORYA 4D82A 1M1NB 2ZYAA 4RZQA 4EYEA 2FDCA 2V1XA 4PE5B 4RTSA 4RUKA 1WPGA 4J0JA 2G4LA 2XYQA 1Q83A 2C5FA 1ND5A 4AP9A 1VMDA 4M0LA 4PRYA 3ELWA 3MJDA 4OREX 4PXYA 4LFAB 1JJIA 4JUCA 4Q05A 1OKKD 1EWKA 2D7JA 5C2JB 1N7GA 1VKHA 1AMUA 1T5IA 1TKRA 2R97A 2I1WA 1PJSA 1QRTA 5AK5A 2DZDA 4LCJA 5L51A 4PQYA 2HJGA 1OROA 1UPAA 4LV6A 4KQJA 4REQB 2GXQA 3HWSA 2J3MA 2O7RA 4FILA 1WOYA 3H8WA 1E0SA 2HT1A 1T8SA 3PUZA 5ED0A 4MZDA 1SCBA 1J8VA 2QRVA 4W9RA 3IKTA 3SKXA 1THTA 3UAXA 1NPTO 5KHAA 3SYRA 2O23A 5FJJA 5I9SA 1TYZA 1OLXB 2BM8A 4FHGA 4R84A 5ALWA 4MLPA 4QOSA 4DCMA 4L9SA 2AHRA 3LA8A 3KCNA 3OWXA 1T25A 3PC4A 1GYQA 3GOQA 5H5JA 5JC1A 1SQFA 4YWJA 2RGGA 4ZPJA 4DLVA 1IJKA 1GZUA 3M5DA 4WZBA 4CCWA 2O6LA 4GDMA 2D2IA 4TLMB 3HC7A 4CKBB 4DTCA 4M1SA 3F71A 4JC4A 4BMYA 4ZMBA 2A14A 2B83A 1E1RA 3A3PA 3SVZA 4DV6B 2QDKA 4HX9A 4IG9A 1MKYA 1QTIA 2HPVA 4FHDA 5IRCD 3TIVA 2J7PA 3BB3A 4EB6A 1P9RA 2X9GA 4A1FA 3NHJA 5CVEA 2HB6A 3M34A 4IHKA 2VHWA 4OQFA 1FMLA 1RE1A 3IILA 2AG1A 4S1WA 3W78A 5GJBA 1BVRA 1NAHA 1ZISA 2R5WA 2V96A 2WIFA 3GH3A 4DCUA 4RSRA 1JDPA 4JB3A 1TZ2A 3DPIA 4LRSB 3UXYA 2XZDA 3I83A 2GFQA 3KHUA 5JXWA 5H8WA 1SVNA 1N6KA 1IQ0A 3EA5A 2O5VA 4UDNA 3JSAA 5C37A 3EPKA 5FA8A 5I7WA 5BP7A 1IUNA 1VE6A 5BQPA 4RO0A 3PEWA 4CETA 3UPUA 2H6EA 5DCUA 4LDQA 1FFGA 4PAWA 3LYHA 4ZO7A 1H2BA 2IY7A 2AR0A 2JAUA 3NDPA 3MT7A 5DTQA 3RREA 4CIWA 1E5LA 5KJFA 4DR3B 1T35A 2Q1WA 2SECE 5H80A 4CTOA 4EY5A 4YUAA 5HQJA 2YVAA 4JY7A 3B3AA 1A9TA 1ZGZA 4L7VA 1DELA 2ODQA 3LC7O 4OD0A 4R9UC 4NTZA 4BN5A 3KQHA 2GF9A 1M2OB 4Y2GA 2ZSKA 3ABIA 4FEEA 4Q3DA 4KX3A 3K2EA 4ZIRA 2PSHA 3QG5A 1E3WB 4RK7A 4KSYA 3OTWA 1YJXA 4UULA 3AEUB 3PA8A 1ISMA 1J97A 2Z8YA 1IJFA 4FCVA 4NZZA 3SXPA 1ECCA 2FQYA 1TL7C 1LJLA 1LSSA 5AVWA 2RDMA 1M6HA 2Z0MA 1IG0A 1YQGA 1EFVB 4H0FA 1T4CB 4POOA 5JANA 3PL1A 3A05A 1HNWB 2NW6A 2Y9PB 3DFIA 3W5JA 5C52B 3DFZA 1N9KA 2CE7A 4IDGA 2A59A 3A4LA 1LPOA 5DEIA 1N4AA 1T1SA 1IIBA 1FYWA 3OAAA 1ZN9A 4PSAA 3ZTYA 1VL0A 2XYPA 4BB9A 5DHAA 2Q2NA 3GFTA 3V33A 1BH6A 3CF4A 2CVOA 5KSZA 2Z5FA 1KI2A 2F3UA 2CEKA 3ROXA 1DIBA 2J0VA 2G17A 2DUUA 1W581 2WFLB 5K0JA 2WHPB 1DKQA 2P2SA 1Y1LA 2QJWA 4WN9A 1Q7TA 1J4AA 2PL3A 5ALPA 2NP7A 5KHOC 4KVZA 3IUSA 2PMKA 3NJ4A 3MRSA 4G67A 1Y5IA 3AHIA 3IALA 3KZXA 3EXIA 2P27A 3E9QA 3PNPA 4N7MA 5ECYA 3UJAA 3UK6A 3PQ8A 4AJPA 4EG1A 5CDTA 3NDIA 3V4ZA 1LRJA 1JKXA 1MLDA 2VRBA 4HJRA 2AXPA 4PCLA 4IIXA 1PW5A 3DAGA 4P82A 4I0WB 1UDCA 2PH1A 3GI1A 3PHGA 1LBIA 4ZRMA 1AGPA 2QAGC 4ZC1A 1P1KA 2PJUA 4DQ0A 1P7VA 4KOEC 1V4VA 1YIOA 1DT5A 2AC4A 5E6UA 3MBKA 3M9LA 5GZ6A 1SCIA 1NYLA 3L77A 3OZRA 2CNWD 3L43A 2KHZA 2PL1A 3A25A 4K9DA 4WKCA 2IS6A 5JD3A 4TN5A 5TIIA 1NBMD 3FFXA 3T99A 2GTHA 1R5JA 1CEQA 5BW6B 4Q66C 3OM0A 2QD5A 2UU9B 1BXGB 4XQCA 3PHHA 1YHNA 3SD7A 4GQAA 2FUEA 2J07A 2J9YB 5AXBA 1M5TA 2W6IA 2EEZA 1V6SA 3KXDA 2DERA 5BMVF 3OPYA 2PEYA 3L7OA 5A4IS 2ECKA 1PK9A 2IL1A 1THMA 3IT2A 1FFDA 2ZJFA 3LUDA 4MZXA 3VZDA 4FP9A 3D8RA 4EKGA 4BIMA 1RWWA 3P2OA 1N0UA 2AE2A 3IUBA 5EINA 3FIUA 3ZE8A 4MRMA 5KSOA 3BMQA 1XDGA 1Z6AA 4PGAA 1T3LA 1RD4A 2PGLA 3R75A 4BE4A 2OHHA 1M2HA 2F9MA 3BD8A 1SUBA 5L3ZA 2WA2A 2A1IA 4UDYX 3VR3A 4DDHA 1XD2B 4PONA 2XUJA 2BELA 1V6CA 3FOAA 4DT1A 4DCSA 4BDSA 2Q99A 5E3HA 3P9NA 3PNBA 3Q3JB 3PUHA 4CKYA 4ZODA 3DAPA 5LCXA 4YALA 3NTRA 3BRWA 4L08A 3QNUA 3CLTD 2P4EA 4NZMA 4YRZA 2HNAA 3SXJA 2Q4OA 4MA4A 5EUCA 1W47A 5AP9A 3RVKA 3K6JA 2WIKA 3BRQA 3RKRA 4R40A 2JGRA 2OFPA 3LQRA 3SVLA 1UDBA 3OPXA 1E9DA 4RKEA 3WRYA 1DQSA 1KJYA 4YLEA 1UWKA 4C22A 1Q7BA 4RIEA 4D7AA 3IEVA 2HCBA 5EJFA 3A2MA 4J3JA 3TRFA 2JI4A 2RH8A 5JAPA 4MV1A 3K8OE 5LQSA 4W9NA 1MZPA 2YUIA 1P0FA 3LHFA 3OPNA 5DHQA 3ZEIA 5THXA 1U8EA 1U4NA 3TIIA 3PJRA 2V6IA 1PWXA 3K9LA 4IH9A 3ZDEA 5K3EA 1IBLB 2O8BA 1J42A 1Y3DE 3F4LA 3V1TC 3V5NA 4OPMA 4FOLA 1I13A 1B6TA 2YXLA 4IVRA 2J87A 3AFGA 3QUAA 4HMQA 1U7PA 4IJMA 4KR0A 3WGTA 1FFYA 3DDSA 3KX2A 3VHXA 2BZGA 2EGHA 3H0EA 1NQVA 3R5JA 4AJHA 4QC2A 3IB6A 5BQ3A 5KB3A 2XDAA 3BGDA 2VHVA 3I2HA 2VDQB 1RZRA 1W19A 5DMHA 1IXSB 4BNDB 5TS3A 4LHXA 1EFPB 1ZA2A 1M73E 1NPYA 2G9RA 1AQYA 2GRUA 2J5QA 4FW8A 4V0KA 3SLKA 4JI4B 4UBMA 2V0CA 1VHWA 2XGGA 4KQCA 2HSWA 5JS6A 5AW7A 1GZ5A 4LXQA 4BQOA 4B7XA 4HUQB 1X7DA 1HDCA 1SK9A 3GUYA 4BCCA 3NTLA 2Y9MB 2Q29A 2BE9A 1PBTA 2VUTA 3PD0A 4NDZA 3COJA 2XNSA 4L7QA 1Y9DA 1FE8A 5E9AA 2PZLA 2JFYA 1XDBA 2VNAA 2WWVD 2BLNA 1PUIA 4HBZA 1GAXA 4NHOA 3R44A 3KUKA 3OQOA 1EUYA 5HKKA 5JCOC 1GRCA 1G60A 4MWDA 1X0VA 2IYNA 5GOTA 3U17A 1UQRA 3O8BA 5FA5A 4DLAA 1XZQA 2JAXA 1PX2A 3I9JA 2E21A 3OH8A 2EFHB 4WESB 1KERA 2AUTA 3TAXA 5U4QA 1N8SA 3NONA 3OP1A 2O1SA 4ZOLB 4W5WA 4YRDA 3ZZMA 4P7GA 2WAMA 4Z3KA 1JYSA 1JECA 2BMDA 3LSYA 2GZ2A 4X95A 1UANA 1X2EA 5CYFA 2WA1A 3B9PA 3AVTA 3JCZA 3PI6A 1MJFA 1V3UA 4KSBA 3GJ0A 1JG6A 2R751 4W82A 3OPVA 1XZCA 2EDAA 4CLEA 4HUTA 2I4RA 2KI5A 4BO7A 2BGGA 4MO2A 4Z5XA 1MAWA 2JJMA 1Z2OX 3IJ5A 4F46A 4OM8A 5LDHA 2J3QA 5CMLA 5HHTA 4Z99A 1OHHA 3ZE7A 4QRHA 3VC1A 4AJOA 5CNKA 3IKLA 3WGZA 4LNUB 2JDID 4E21A 4H18A 5IEBA 3D6JA 4KYVA 3R6LA 3U3KA 4B3XA 1CUZA 5FR1A 2DTEA 3KLBA 5HE8A 1V11A 3C4QA 3LZDA 4PSKA 4X1YA 5KQPA 2ZM5A 1CE8A 1U2DC 2ZAMA 1MH1A 3LECA 1RQNA 3P94A 4QQ8A 5TS2A 3E58A 2AZMA 2CLHB 4P6VF 3ZHBA 4N6OA 1F7UA 3GJ7A 3TQSA 2VYQA 4AM8A 4GRDA 1PG0A 2F4VB 1NQ5A 1Z5UA 2FHPA 4GMFA 2XSZD 3IDQA 4DIDA 1H8ED 4UTNA 1M1UA 3UGKA 1QOQB 1RRGA 3BZWA 1EDDA 2NO5A 3QVXA 6REQB 1RAIA 5F9FA 1Z0SA 2VT7A 3EY9A 2CDCA 2C4VA 2NU8B 1Q1QA 1JIIA 1JDJA 1A7KA 1PV2A 2XBUA 5JQGF 4CF4A 2JLQA 3CF0A 3HZRA 4AUEA 5IT9A 4QDUA 3M81A 4RXMA 1FJXA 1E5QA 1TD9A 2BCJQ 3NUZA 1MG5A 3ZKAA 2WKRA 1RRMA 3TUIC 1I1HA 1NJFA 4U7PB 1NVDA 1EFKA 1YI0A 4X0EA 5C8ZA 2WBLC 2OMEA 1HK7A 2WJGA 3BXXA 5F3DA 1QHIA 5B2FA 2M1XA 4ABTA 1QHNA 4JSYA 3DR5A 1UFQA 3U4AA 3QLUC 1TZMA 4X8OA 3WL8A 1P77A 4LMPA 5JAZA 2AXEA 4QU9A 3MB8A 2CFCA 3T0IA 4PWZA 3NR2A 1QOPB 4OH1A 1BS1A 1YO6A 3ROFA 1ULUA 3HP1A 5GY7A 1D2AA 2O57A 3Q9LA 1BFKA 1LNSA 1G8JA 4TTRA 5FAXA 5BN4B 1T0PA 4EI8A 4N6GA 5HIKA 4DPLA 3ONNA 1CETA 3NOXA 3KJEA 3B38A 5LU9A 2F6RA 1IYZA 2NP6A 3VDRA 2ODTX 2H4ZA 3EPHA 1JMYA 4PLFA 4EOGA 2ZITA 5KC9A 4U63A 3PNMA 3H1PA 4HRXA 2Q1UA 1L1EA 3T52A 1FDTA 2NZ2A 5KIAA 1OIVA 1HL7A 2PKXA 3FWKA 3NOQA 4FYHA 3FTDA 3Q2IA 2YKGA 3BL6A 1C9MA 1GRQA 3KEFA 3QFFA 2A9VA 1W5FA 2PRJA 1ZR4A 1VOTA 2ERYA 1Z0KA 2BP7B 4IGEA 4NBWA 1IN4A 3HTXA 1HQDA 1KS2A 2IPMA 3UQZA 2JARA 2Y27A 1XMPA 1GUFA 1C1DA 3LC2O 2PGJA 2A67A 1TE2A 2QF7A 5IDWA 1KBZA 1NOJA 1OWPA 1XRRA 1W8IA 2R7MA 1GP2A 5KNDD 4HH1A 4MQLA 3ZQ4A 1XLUA 3B70A 1Z39A 1AV6A 4ZT6A 4X65B 3MTAA 2ADMA 1PYGA 3BB1A 1LQ2A 2CBZA 1XL1A 2GAFA 2OT3B 5K3CA 3HBAA 3C45A 3RWMB 1WDWB 1ODTC 2NVUA 3SIRA 1UKCA 1VBKA 4DLZA 3EIXA 2VKQA 3GEMA 2CBGA 1GQRA 3R7FA 5A4JA 1Q21A 1WSWA 5IC5A 1PNQA 2C61A 4KZPA 2W70A 2XRZA 1MAHA 2VKTA 3O82A 2J32A 1WB9A 5JVDB 4HNSA 4Y98A 5CDSA 3G17A 1PG5A 3KC2A 1NVGA 4Z1OA 2NPIA 3TZEA 2C9CA 2AUMA 3QI2A 3DHNA 3HEMA 4QUHA 2AKAB 4DNFA 5IKPA 4TMXA 3GPBA 1ISRA 2Q3HA 1T9KA 1XX6A 3KOUA 1QKKA 3KWMA 1ISFA 1FNMA 3G2NA 2D54A 2QEQA 3MJHA 4NBKA 1BYUA 1ATZA 1XZEA 5DTIA 3NC4A 1KO7A 1X74A 4CNBA 3CH7A 1QYXA 2VN8A 4LPSA 3VVBA 4KAJA 4H1HA 4TV9F 4IIYA 5TX7A 4TTPA 4OLAA 2O14A 4B46A 1F3OA 4J76A 2Q7OE 1GEEA 1NSFA 1V1RA 1Z15A 2AW3A 4F3RA 3ZIAA 4EW1A 1C7EA 3OPYB 5ELLA 3MD0A 1T9HA 2QNIA 1XXHB 4RVSA 5KQMA 2IYYA 3KOMA 1BE1A 2O3JA 3H2KA 5IJXA 3T38A 3VHLB 3WVNA 1NVKA 2W5UA 3W5CA 3C8MA 4XUDA 3ET4A 1PZXA 2I4TA 1YF3A 1UEIA 1NR1A 2WJHA 3QTTA 4JLUA 4J2TA 1ZD4A 2OOSA 1EVYA 1SIBE 4WERA 1IY1A 1N2SA 5CVTA 3PENA 3CZ9A 5KYUA 4Z9YA 1YQUA 5JISA 3KSMA 2IPAB 2YFKA 3D6UA 3MCTA 4E46A 1RM4A 821PA 1XDWA 3OF2A 4Q37A 3T3IA 4EQ6A 2C4WA 2MTBA 3B6ZA 3KWLA 4NEGA 5C34B 1A50B 1ZJYA 2VK4A 3I53A 3O8DA 1P9NA 4RA6B 4ZV7A 1UOEA 2E3JA 3EEQA 3HUEA 1JE0A 2VBGA 5EAIA 2B9VA 5KDLA 1IE3A 5AI8A 4YP7A 3HPRA 5EE3A 4HN2A 1Q0PA 1HG0A 4FMBB 3ZWWA 3IULA 4BFXA 3F5QA 5H4HA 5K1ZA 1CD5A 3WO1A 4BV2A 1E1QD 2V9PA 4I9NA 5DWQA 3WWEA 2PK3A 1DX6A 5FUWA 2Y99A 1LKZA 2XDQA 2TMYA 4AKHA 3F8WA 4C1NA 4BQFA 2IHKA 2GHRA 1XVUA 1SWVA 3ZGLA 2VYVA 1X0XA 4MX8A 3I4CA 2YJ3A 3GJ4A 3N2KA 4UBLA 1B93A 1DKLA 1FFXA 3HSYA 3Q2KA 1XKLA 4OHXA 2V6JA 3L01A 2NO6A 1RQLA 1KMMA 2CJWA 1B76A 1EGHA 2FZWA 4MUNA 2O8FB 2PQ2A 1ABBA 1YQTA 5CT4A 5DF1A 1GILA 1HZZC 3N9IA 3OMXA 5KSYA 5LNK1 4LJKA 4UXIA 3OFKA 4KXNA 2V3VA 5FP0A 4EZBA 1U8CB 4MVJF 4F4CA 5H1YA 1YNOA 3I8OA 1GGVA 1WWKA 1XB2A 4WGFA 4DBVO 4IZOA 3LT5A 1K9VF 3DZBA 3VH3A 4L22A 4PHHA 1JJBA 1KHHA 1I4OA 1WUHS 2X6TA 4HAZA 1COWA 5KPJA 1RE0A 3NEJA 1K7CA 1GG8A 4ADSG 3RC3A 3MJFA 3PFIA 3AOEA 2HQSA 2FJPA 4DCNA 1TD1A 4DIEA 3MA0A 4ZIRB 3CPJB 3EVAA 1DUSA 4GOLD 2DBVO 1G8YA 5TGTA 3TD9A 4O4JB 2ATEA 1ISGA 1OYWA 2H65A 2WMYA 1QHHB 2YYSA 1M2NA 2Z2KA 2ZYRA 1LSOA 3HV2A 4A7PA 5LVAA 1EFTA 4P4SA 1XMVA 2H17A 4M9XA 4QT0A 3OIFA 4EYQA 1XCPA 3WFIA 5JW6A 3A27A 1IY2A 1WL8A 3IPRA 3IOYA 4KXLA 2FPSA 1F5SA 4E2XA 4G9GA 3A1FA 4IEIA 2POCA 2XKBA 3CSSA 1CUBA 3BSWA 1AD2A 4BVKA 1SB8A 4OOFA 2O3RA 1NMXA 3EDOA 5ECGC 4BYGA 5C1PA 4M8NE 5ALMA 2YL2A 3ESDA 4NZ9A 1D2RA 4C3OB 2F4NA 4QECA 4FI3F 2F1JA 4G86A 4P4TA 5T6MA 4G1VA 5LD2C 3SZOA 3T7EA 4H60A 1V8ZA 3RS2A 3NWBA 1H3EA 4Q9LA 4JQSA 4KHPB 1HFWA 4PZUA 1QV6A 4GYYA 1V47A 2CJFA 3R7AA 3LVRE 4XYEA 1PLJA 1YA8A 2YWFA 3DLTA 3ANXA 4D9KA 3LNCA 4BTLA 1C80A 1EM6A 5K9ZA 1VKOA 1Z07A 2ZBVA 1JJFA 1J1IA 4MI3A 4U02A 2B61A 4I2NA 3UJ7A 4XGQA 3BC1A 4WZBB 2CMGA 4DMHA 4CLXA 2YJTD 1U0BB 4IQGA 3K1JA 3QOYA 5TLSA 1ZY2A 1SEPA 3OTHA 4KIWA 5TV2A 3ELUA 1NV8A 3K94A 3C6YA 4NBVA 2FN4A 3COZA 4BAGA 5J4KA 3G7SA 3IBSA 4MR8A 5EQJB 3HVJA 3EZ9A 1N6PA 5LSAA 3USES 2FSGA 3TNLA 3G13A 1V45E 3AGQA 4EJ0A 3N2YA 1Z4MA 1J5PA 1MX3A 3NHWA 5CK4A 5HFJA 3L49A 2PAAA 4M87A 4ZQFA 4M98A 4X20A 3CSUA 3JQ8A 5DO9A 4A8TA 4DWJA 4E6EA 2BGWA 3CS3A 3O5AA 3LM8A 2GN4A 4URVR 2D0OB 1K6JA 4TL9A 3DEKA 3MNFA 1CY0A 3TLXA 2R85A 3VAYA 2ZUFA 1L3CA 4O2BA 4P33A 1YBFA 4RZUA 4BLOA 1GU1A 5EC8A 4BMCA 4KV7A 3BVPA 1PVOA 5AM0A 1CEXA 5FL3A 5FTKA 4PS0A 3EISA 2ECFA 4AUNA 4ENWA 1CP3A 4FI3C 2YWRA 1YKFA 4H3HB 5EHQA 3W5VA 3GJQA 3U5ZB 3ZJ4A 3HMKA 4UOQA 4YCDA 2IUFA 4XQEA 4JDUA 2QRNA 2QIPA 5EKSA 2OILA 1N2EA 5CFZA 1S01A 3IQGX 2O8FA 3HCRA 4KLAA 1DRWA 2W0SA 1EJBA 3BMNA 3KWJA 4XFKA 3NIWA 1JT2A 3JD1A 4A6XA 3A9TA 2DKFA 1TAHA 3HRIA 4FN5A 1B1AA 1ZGHA 4J7UA 4F6LA 3AUYA 3ZZNA 4R9RA 1JQJC 1TYEB 2JG3A 2ZPTX 3JQBA 5CHYA 1NQTA 2ZR8A 4A82A 2BKUA 2AOVA 3OIGA 3PLRA 4CTKA 2AVDA 5AKJA 1AHPA 4KRFA 1JXQA 2G06A 5JYEA 1BJTA 4MUFA 4AF8A 5CD9A 2FZKA 4IIJF 2OXIA 1F1BA 1GFIA 3WI7A 4CEIA 1VL2A 2NU9A 3OU7A 2PUCA 4O2AB 3B1ZA 1QQ7A 1BX0A 2UUCB 1OVMA 4RQTA 5DNYB 2H07A 5KVAA 1JQLB 3IAUA 4QD3A 2DPXA 1SVKA 2GZ1A 2NPOA 5ALEA 1EEHA 1GWNA 5EJ5A 1UXKA 1CS0B 1D6NA 3CV3A 3RVJA 2AHOA 4K6OA 4UW9A 2ZWAA 1RC0A 2WVGA 3RS4A 1EWTA 2GQ0A 2WJAA 4Q1AA 2VDOB 2QK4A 4EFLA 4J7AA 4PBTA 3X1YA 1EDZA 2IYWA 1QK5A 3GFOA 1FJHA 3F5FA 2H1HA 2HA6A 3N59A 3PNYA 1PFGA 3COPA 4Z9FA 3VA7A 1GQYA 1HDZA 2QN8A 3C4JA 3S6JA 4AP5A 3TRHA 3DE2X 1J9ZA 1FFSA 2X8AA 4J2HA 5LLDA 4RA9B 3M1AA 1ONSA 1PO7A 2W2NA 4KJZA 1C3JA 2V4ZA 3LJKA 2ZDQA 3DJYA 3PPYA 4WBSA 3U3DA 5IJ9A 1F2TB 1NZDA 4UEQA 3GEIA 1AKEA 1WXHA 2O0KA 5JROA 4HWSA 2JH8A 4Q3LA 4IGIA 4A8JB 1T6NA 1SULA 1U81A 3GPCA 1FDOA 1P4SA 2DPGA 2PA0A 3BA6A 4RZHA 5DTJA 4PZEA 2QRPA 1X9IA 4OO3A 3GZ4A 3L0ZA 3F6YA 4B9EA 4JI1B 2RJNA 3AUXA 1QORA 3M9WA 2DLNA 3DBRB 5J59A 1CUIA 2MSKA 4F45A 2E4WA 4EL5A 4ZK6A 2R1TA 3C16C 3UGTA 1ZN7A 1V1JA 3E1SA 3IP8A 3SJBA 2QXUA 4QYMA 1SCNE 4ACAA 4UU8A 3A3NA 3GGJA 4A8PA 2O2YA 2TSYB 3NHFA 4AF6A 1X7HA 2XRYA 1G20B 1J2JA 3HWX1 5I7EA 3EFEA 3BDAA 3UICA 2OKGA 1YZNA 4JS0A 3Q6MA 3VKUA 1VIMA 2VJBA 1WCIB 2Y77A 3DO8A 4MYDA 4AJJA 2D5BA 2ZRBA 4CRWB 1IB0A 2JGDB 4L15A 5ILOA 4GC5A 2I8CA 3MLBA 4N7RA 1MN6A 4M7OA 5AKZA 3SMVA 3UXHA 3WLRA 4EPTA 4UZFA 2GBCA 1FUIA 3AFMA 3SC3A 1M76A 2ZI4A 1EPUA 3O0TA 4WL0A 5GQSA 4XWWA 2P0YA 1I36A 4KK3A 2FXVA 2QYHA 1YR1A 2WSSA 4EK9A 2FWJA 1Z63A 1VP3A 3WKCA 2P3OA 3P4UA 1I2DA 1KORA 2X13A 2OG2A 3WZLA 4R2MA 4UBKA 1HT1E 3DOIA 2PT5A 3HU3A 3QHQA 4G5QA 3UBMA 1G6HA 3N2IA 1P5ZB 1SVUA 1N5IA 4I1VA 4X24A 4C43A 4C4ZA 4COOA 4M9SA 3NNSA 3GNSA 1IZ0A 3QU9A 5IARA 3TQRA 4YBRA 2NZVG 3WIEA 1OYOA 1FTWA 3QTLA 1DAGA 1P2DA 3ETGA 2GYVA 3H9JA 3L84A 1RXYA 4G0WA 5CXSA 1Z8FA 1FFEA 1ZZEA 5HUJA 1JDBB 1QVAA 3SZUA 1N2JA 1TGVA 1XF9A 4FNAA 4WJLA 3ITDA 3JATB 3WKAA 1O08A 3G59A 5B3JC 5JXGA 2OBXA 1XA4A 1T0HB 2IOHA 4Q00A 4F2DA 1RWKA 3LC1O 4DABA 5IBCA 3WISA 1KR5A 3NEAA 4CM5A 3LUGA 1DFIA 3CLHA 4G2NA 4Q82A 4HB4A 1FVFA 3HJRA 4P2BA 4TLBA 1ZUIA 2PSJA 1VXRA 2FMXA 1KSHA 1OY1A 3GGGA 3AH8A 4ZVOA 5B1DA 3JTMA 4FQ5A 1LPMA 4MV3A 5AXAA 3MGCA 3PVCA 2Z9DA 3I4FA 4AF7A 3NBMA 2OGTA 1R0WA 5LMCA 3OC6A 3PGVA 4RWZA 4NNOA 3V4SA 4WX2B 1B0UA 5I4CA 2BEWA 4ZQHA 3UHOA 1MXFA 1NY5A 1E4YA 4ER3A 5A6SA 5BXYA 1KJ9A 1QIFA 4LF5B 4MB6A 3NIBA 3EGCA 2Q5LA 2X2EA 2QX4A 2IZ1A 1QZTA 4WK6A 4BB5A 2X40A 4FC7A 1PIWA 3NFYA 4ENPA 3SG0A 4K1LA 5KYVA 3W7VA 5FTWA 4ZEOA 3ZNPA 5L95A 3TMYA 1Q0LA 4H31A 1H6CA 5CG1A 1OI3A 2IQ5A 2VEDA 4BV3A 4ZI7F 5JNWA 3NIFB 3QKSA 2QGFA 4NESA 4DIFA 3GBVA 4KK4A 1NQAO 5EP1A 2CHFA 1ONNA 4AJ2A 4N3GA 4KXWA 3VAZA 4MWSA 3FNHA 1SGWA 4IJKA 1W87A 2X2PA 4PHGA 1DDOA 4C14A 2GXAA 4JQZA 4HT3B 3JR3A 2NUTB 5JBIA 4OQPA 4OI2A 4C4OA 4D8WA 4X64B 1AV7A 1XZNA 2QVGA 2REOA 3AR2A 4TRRA 3ROGA 1VL8A 4OHRA 1HXHA 3A32A 4CFSA 5GJVC 4HNTA 2D2FA 2ZXUA 4FSDA 1BE8A 4K3VA 3IVXA 1Q14A 4QARA 1RJ9B 3TZLA 1I6LA 1SHJA 4G85A 5C1OA 1GLNA 1WCXA 3X0DA 1OQAA 4JI8B 4M83A 2AOUB 2VK2A 4MK4A 4BNGA 4DCVA 3RRFA 1P1JA 2QVXX 1E66A 5G0SA 3K9GA 4LSZA 4DAEA 3K92A 1UBUS 1O8BA 1QYVA 1Z5ZA 3L2OB 4MVJP 4EI7A 3L0BA 4EGSA 2P2CA 3L82B 4YP5A 1YS7A 4CV1A 4O5OA 3ZGZA 1EUCA 4YCNA 2MJLA 2NTYC 2UYCA 4IKPA 3QX7A 1J0BA 5AJUA 5AWFC 1X3LA 5FLEX 4EPRA 2IW1A 4KO2S 1LLQA 1ES9A 4Y8VA 4NU5A 4Q4CA 2A9JA 1C3XA 2FVXA 2ICAA 3VDNB 3LS2A 4WW0A 1VLMA 1VKRA 3M6FA 3UPDA 3S2FA 1JHYA 4K81B 3O6VA 3TCKA 3WL4A 4IRMA 3N07A 2DHQA 3W3ZB 4B6RA 1NKVA 3QEBZ 1OU0A 2OFWA 2AD1A 2EERA 3EWSA 4WDQA 1M2FA 1WMEA 1EUQA 1U4SA 4YV7A 1PQUA 3ZNQA 3LVBA 1QRDA 1VSVA 2X0RA 1C2TA 3U09A 5FLYA 4HFMA 4AMBA 2QZZA 2ZUDA 3PGXA 2C8JA 2JRLA