3TCKA

Crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis - form 4
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
188
structure length
188
Chain Sequence
AEPLLVVGLGNPGANYARTRHNLGFVVADLLAARLGAKFKAHKRSGAEVATGRSAGRSLVLAKPRCYMNESGRQIGPLAKFYSVAPANIIVIHDDLDLEFGRIRLKIGGGEGGHNGLRSVVAALGTKDFQRVRIGIGRPPGRKDPAAFVLENFTPAERAEVPTICEQAADATELLIEQGMEPAQNRVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of new crystal forms of Mycobacterium tuberculosis peptidyl-tRNA hydrolase and functionally important plasticity of the molecule
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords Peptidyl-tRNA hydrolase
total genus 54
structure length 188
sequence length 188
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 3tckA00
4DHWA 4Z86A 3VJRA 4FOTA 5B6JA 4QD3A 4FYJA 4YLYA 4QT4A 2Z2JA 3TCKA 4JWKA 3V2IA 3KK0A 3P2JA 4ERXA 1RYBA 5IVPA 4JX9A 4LWQA 4OLJA 4JY7A 2Z2KA 1RYNA 4QBKA 4HOYA 4DJJA 2MJLA 2PTHA 4FOPA 4ZXPA 3TD6A 5EKTA 3TD2A 3OFVA 3TCNA 3NEAA 2LGJA 4P7BA 2NAFA 4QAJA 5IMBA 3KJZA 4JC4A 5IKEA 4IKOA 2JRCA 1RYMA 2Z2IA 4FNOA
chains in the Genus database with same CATH superfamily
1KI2A 4O2BF 1MIOB 1RHKA 3HB5X 2XDQA 1WO8A 4OMCA 4LZZA 4MW7A 4LHXA 4NZYA 1XPRA 5EINA 4QOEA 2XQKA 3I1IA 4QEKA 5K7SA 4RZUA 5E4YA 3TB6A 3AEZA 1XMOB 4ZDKA 3U3DA 2GARA 3UWOA 4BCDA 4I55B 1XAHA 3PX3A 4CCSA 4P86A 3ICEA 3NU1A 1ZU5A 4QUBA 1NVWQ 3EXG2 3KYDB 3H1EA 4WKOA 1V37A 4ZOLF 3FH0A 2OV8A 3AHIA 3PC3A 3NO4A 4WJLA 4DV7B 3NOXA 2BR4A 2TS1A 4MJ7A 5H3LA 4C4ZA 4RVCA 1OA1A 4I0WB 3FNRA 3VR0A 2OK7A 5F77A 3HUFA 3KJZA 4UBMA 2ZVDA 1CRZA 3LGSA 5E9JA 4INPA 1EFRD 4DLUA 1Z2CA 3LZ6A 3H9UA 3KQTA 4MRRA 1MC1A 2CYAA 2EG5A 3FZGA 2CF5A 3UH1A 1PJBA 1MBZA 5TPZA 5I7VA 2WTBA 3AW9A 4HB0A 4I50B 4N8SA 2JCXA 3OHSX 1NZFA 2W22A 2PMEA 4NBTA 3RYFA 1AKUA 1YOBA 2E5LB 2PZAA 2H4FA 2HIGA 4DJ5X 1GGHA 3VOAA 4EUFA 3KHUA 3PNBA 4U2CA 1DADA 1ACJA 3EVFA 3FVRA 3RS3A 4BNUA 1K8QA 4J8PA 4U7TB 4C0QC 4NS4A 3GIWA 1VBKA 3I5MA 1VXOA 3R0QA 4Q1BA 1P9NA 3PF9A 4ZAZA 1PJCA 5F73A 3CLSC 3L7CA 4ALNA 1WETA 5JH7F 4JVMA 3G89A 4H31A 4ZYLA 4K05A 1G8FA 3KFXA 1J8YF 1E1LA 2C58A 3V1UA 3JZIA 1VJ5A 3GEDA 5JZ9A 5FI0B 2CVFA 3A7DA 2NQ8A 3PQ5A 5EJ2A 2IXEA 2P6NA 2RCNA 2CNWD 2EQBA 3HXPA 3PXEA 4WGFA 5BQPA 5LBUA 2F90A 3PUJA 1AM4D 4AUEA 2AX4A 5K6AA 2QV0A 4ZO4A 4DGQA 4EY6A 1E6MA 2OHXA 3OE5A 5JD3A 2EXXA 4MW1A 1EWTA 5ALDA 4E2YA 4CLRA 3AOEA 4CM3A 3BDVA 3ETDA 3WFZA 3NG1A 4F85A 3DF9A 1B15A 4G97A 3LHKA 1MJHA 1J9GA 4KI7A 2FEOA 3NHYA 5CX1B 1B43A 4GSKA 4FSXA 3HBMA 3AJ8A 5EKDA 5JD6A 3T99A 4DNPA 1NAHA 4XB1A 4CNQA 2R86A 1QVWA 2V4ZA 1UK7A 3FUXA 4DIKA 1CJKC 5GV8A 5JUWA 3N2GA 1H2AS 1U1EA 3WLLA 4AUNA 3RFUA 1K97A 1FDUA 4UBJA 4TKVA 2D54A 1Z13A 3WYEA 5L4LA 1J22A 3CBGA 4BFSA 4C7XA 1EMDA 3I52A 3UWPA 3FTFA 2IE8A 1XZDA 1TPZA 3HV2A 4LSMA 3IPCA 1XYGA 1JSXA 2C5EA 4PLZA 4QBTA 4L4RA 1LDNA 1NI4B 2ANCA 4NCNA 3EZ2A 1MT0A 3B5EA 4QRIA 1SB9A 3MXTA 4C2AA 5JQGA 3PLNA 1Y6FA 2CXPA 1M0EA 2HO4A 5AKYA 4NNPA 4Q7JB 1E20A 1E1CA 4H3KB 4H3HB 2X86A 1VQ1A 4NPAA 1K8RA 5FWDA 1E3WB 1M74A 2QL9A 4QJ5A 2ZTSA 3INRA 1AJEA 1UJMA 1XAIA 2R6GA 3GLHB 5KOHB 2VVTA 3AESB 4LDJA 2QX6A 3OUUA 4E03A 1CYEA 4OLAA 4FW9A 1XRPA 4BLQA 2AW3A 4J29A 1L5WA 3CINA 2Q0QA 1FFXA 2AF3C 4MRMB 4GOOD 2ST1A 4RC9A 2I29A 4W5JA 4P3KA 2QROA 1FPMA 3REQB 3U56A 2B9VA 2QT1A 1J0XO 3PRHA 1U7TA 1TGYA 2VN8A 2VTDA 3GLIA 2BFFA 2OBYA 3UMGA 2AXPA 4BMVA 1EWKA 5KWIA 2D5AA 4LZOA 2BKLA 3C74A 1EBBA 3AR7A 2WYHA 3MFYA 1NUUA 3JD0A 2AIRA 3RT1A 2V0NA 1X6VA 4MI9A 1RXVA 1FTQA 3MUFA 1AQ6A 3O8QB 4M38A 4PSUA 4DBVO 1VOTA 3NNDA 5I9BA 5TR9A 2Z57A 1PJ2A 3HU1A 3IA2A 2H18A 4J0HA 2Q8PA 2X41A 1UF9A 2XVAA 4F93B 4I5GA 2AUNA 3U5ZB 1DWQA 5H68A 4MR8B 4A10A 1TZMA 3NBAA 4YCAA 5I7SA 5H1YA 1O9BA 1RKQA 1QGDA 4UMDA 1QB7A 3V8EA 1YZNA 4MSUA 5L45A 1ZK1A 1ODLA 2DOKA 5JSUA 3O21A 2ZYGA 4XTRA 2BBTA 1FP6A 2YJZA 3EC7A 1WCWA 1SEVA 3FFAA 3AVOA 3TRFA 5KJCA 3JR7A 4FUTA 4OY3A 4TVBA 4OBXA 1EZZA 5AK4A 5EE5B 1RHQA 3PGKA 2O5EA 5G02A 2PKCA 2ZW9A 1FEZA 5AIAA 3I04A 3GP8A 1V5GA 3M0EA 3CYFA 1QG6A 3W8NA 5EZ5A 1RPNA 1VJTA 4O4IA 4WL0A 4BZZA 3D4NA 1ZYUA 1O95C 4RE5A 3H97A 2JJ2D 1X86B 3F6CA 1NW4A 3PFNA 3GCXA 5D8DA 4QDXA 3G8CA 3BWDD 1ZOPA 2BDUA 4I1YA 3AEUA 1K06A 3GJ4A 1IMOA 2NTNA 4FR5A 4MCHA 4X91A 4HGRA 1W9MA 3F74A 4QDTA 4XFKA 1S3SA 3DVQX 1Q0TA 3EIXA 3QOXA 1SCUA 4M8NE 1K6JA 4PRKA 3F3KA 4EITA 3A6PC 1G4UR 5L4NA 4G84A 4ARCA 1WXEA 2OCLA 5JQGB 4BV8A 3W8EA 2HU8A 1BX3A 2V4MA 1F8GA 3GEPA 3N28A 1BCRA 2XHEA 3N2NA 1GZVA 1DX9A 1O57A 4IQFA 5CLLA 4BX8A 5LD2C 4OXQA 1JHVA 4ENUA 3QBJA 1V3TA 1U2TA 3SM3A 3IUNA 4CUZA 3OJFA 4EB8A 1N3IA 4YMLA 2ZATA 3OOJA 1KY5A 3D7LA 3PPVA 3UEOA 4Q3BA 2VXOA 4F60A 3GCDA 3QLVC 3WJ2A 2QKYA 3LQFA 5IKOA 1UPCA 2O05A 3C87A 2NT4A 1DAEA 1OBFO 3P2JA 3R9IA 2JFQA 1GA1A 4QBGB 2IEGA 4PC1A 4QJBA 4YT8A 5TGTA 4UE6A 1FJHA 1Q50A 3CPSA 3JQ7A 3QXSA 4M7WA 4Q16A 1NRWA 4ZTUB 3GF4A 3ONFA 4UAUA 3X2EA 3R9XA 1WS6A 3L46A 4X3CA 3I32A 4DE5A 4MI3A 1EWYA 1Z0KA 2GEKA 3BILA 2ZVQX 3KRTA 3JSXA 2M32A 1L7RA 4WPGA 2CLKB 3D2BA 4JMLA 3T8YA 4ERNA 1SRRA 3QF7A 1AQNA 1BH2A 3GH1A 4EW1A 4KIGA 4FGJA 2NYVA 1OFTA 4LRXA 3MAJA 1OSNA 3Q15C 4R84A 5C1IA 3UXEA 3NRBA 3H1AA 1KPHA 3TLKA 4DM7A 4G63A 1B8UA 1W1UA 1B0PA 2W93A 5FO0A 1JNYA 3RS7A 4TWZA 1PCXA 4C5CA 3AOGA 1IBSA 1CQWA 2H9YA 3GC6A 3O4RA 3PB3A 4OKSA 2AR0A 2VDOB 1JVBA 2ECFA 2PGNA 3G2IA 1HDGO 1A0OA 1T36B 1BHSA 3KHKA 5C0OE 3RIYA 3DFUA 1KXZA 2J3LA 3UFXB 1UJ2A 2JCVA 4IV8A 5G1PA 2BFNA 4DCMA 1JLRA 1WUIS 4TYNA 1WUHS 2WJ3A 3CUSA 4E5UA 5LOVA 3I72A 4OHUA 1RD4A 2CLHB 4PIVA 4YRZA 2HRQA 2WSSA 4L27A 4NZZA 5WRFA 1VYVA 2EFJA 4JELA 1N2ZA 2ESRA 2F1IA 4RNDB 4ZRMA 3SFZA 4I1PA 3S7TA 4EO9A 2B35A 1WRBA 1ESMA 2HIMA 1JB9A 3HFJA 3JD1A 3KQVA 3PDWA 3RUCA 4AKEA 5AW1A 5K3EA 2IHVA 2HREA 4JBGA 3G2HA 1PFVA 4RNCA 1O6FA 3FCAA 3R5XA 5D01A 3X1MA 1TMGE 2B2NA 1YRHA 2BMEA 2PL5A 3BWCA 5AVOA 2CDBA 1XX6A 4EYKA 3USZA 3DDCA 4TYQA 4G5YA 1DUSA 4WASA 3UT6A 4FKMA 2CJYA 1E92A 3VDXA 1PFQA 3ZV7A 1DFHA 4RY9A 5KQLA 4M9ZA 3EPHA 3K1AA 3KJNA 4Q7EA 4NYJR 5C8VA 4G0UA 4BP8A 3ZCTA 4LHYA 1A82A 3HI4A 2OWDA 1JPVA 7REQB 1H1LB 2OLEA 3TFWA 2YZNA 1J21A 3VR4A 1ZJWA 4W1QA 3EVZA 5ARCA 3ZGOA 4BKQA 3O3OB 1RPAA 3PHJA 3U9TA 4U8GA 2OTCA 2GK7A 4F71A 1AMNA 1EE1A 1Z74A 4J9VA 1HRKA 3MB8A 4AF6A 4CV0A 1VKJA 5EEGA 1U8UA 4LHZA 4MX8A 3X43A 4C01A 3HBJA 2CDAA 1BO6A 1VRWA 1U8XX 2QTMA 4F46A 4FB4A 4HS9A 3H05A 3IAAA 5KYXB 8OHMA 3ELUA 1MX5A 4REOA 1NWCA 3CIOA 3EPLA 4PYRA 5CX4A 5AESA 3KB2A 4AJJA 4RF3A 2QVGA 3NTUA 2MSLA 4DY6A 1KYVA 3C5WP 3V3TA 3ZE7A 2PUJA 3LKVA 2UZAA 4IDQA 3FCOA 3YASA 1FTSA 3DV0B 1O87A 1X8XA 4N48A 3B48A 3OCUA 4MIOA 2ZBPA 2IXTA 1OHHA 4JBLA 3CNEA 4UHBA 4CZ2A 2QGZA 3LAWA 2CN1A 2FR1A 3Q4GA 3M3PA 1YGPA 2XGOA 3SZRA 3STWA 3N7AA 5KQGA 2B1IA 3BQ9A 2XITA 4IY1A 4ASUD 2JEOA 2X3YA 1AGYA 1Q7RA 2ZXFA 5AYVA 4FTWA 1GU0A 2A5LA 3DZDA 2CHQA 2J7KA 2IDJA 1T2AA 4ZARA 2ZRBA 1GPYA 5G0WA 4BO9A 3ND5A 2RJNA 1ZH2A 3IUEA 1G98A 1MUUA 1MF7A 3IHLA 4JLJA 2O8NA 1UBSB 2J09A 3P9ZA 3FCYA 1I2MA 4ZVUA 3D1JA 3FB1A 1KQPA 1BVYF 1E62A 2JFYA 3HABA 4N3AA 5CPFA 3C5VA 3A7EA 4FN5A 4BNJA 4D44A 3QBEA 2QS9A 3MVEA 2Q2OA 2L42A 1SFRA 3L6CA 1WXFA 3B1YA 1QF6A 3THRA 3T5BA 4L5AA 1UFRA 2A5YB 2YHSA 4LYHA 2PEZA 5ALYA 3UCFA 2O7RA 3J80A 1V5IA 2ZTVA 1U0GA 1WPGA 1OXBB 2JHPA 2VHVA 2X9LA 3PGVA 2OUIA 1FFDA 2C2ZA 3MIZA 2CFCA 4M3NA 2PFSA 1E69A 4AKTA 5LZ2A 4YK7A 2YMPA 3HGQA 3WLRA 3GR6A 4R81A 1N2BA 4ZEMA 2OZPA 1KI6A 4UHKA 4YMIA 2DQ4A 4BV3A 3SC2B 3KTFA 4YRBA 5F23A 4YIKA 3MBKA 1W2GA 1N7GA 6ADHA 1OT5A 2FMHA 2QTCA 4RY8A 2X8LA 3PXGA 3FMFA 4LOIA 1SY7A 4MW6A 5KI6A 4L78A 4B3BA 4MW5A 1MVLA 3RU7A 1CUDA 3D2AA 4AN4A 4LF7B 3HM2A 4YBZA 2ZIAA 2OE2A 3MGKA 5CXSA 3ITNA 1E7QA 4PZ9A 2BM8A 5EZYF 3SFTA 3STXA 3ZDRA 2YJGA 3DCYA 4JBYA 4WBSA 2A0YA 3V2IA 1SZDA 1YAJA 2BZSA 2D1SA 3P1JA 5BR4A 2G1AA 1FU8A 1PP4A 1DP4A 4C1BA 3AO0B 4I4IA 5CK5A 3DAOA 1P29A 1QO9A 4YDHB 3TZQA 1DPGA 2FX2A 3PC7A 2O7QA 4LCBA 3GAFA 4BNGA 4U8HA 4ZHQB 3RC8A 2I6TA 3IBTA 2Q49A 1H4TA 1NR1A 3QFCA 3OFVA 4ZJYA 1CZOA 1MKYA 3OQNA 2ZU0C 4HFNA 2V1UA 4ZCQA 3T3DA 4Q3NA 5E9WA 2GJSA 1IFXA 3QWFA 3C3JA 2WM2A 4B3JA 4DNFA 4OXKA 1K8ZB 4E5KA 5B58T 2Q9UA 4BTLA 4AJPA 3DV9A 3HB1A 1JHQA 2ARKA 1O89A 5KYVA 2CNKA 1P81A 3W8RA 1YTLA 4IIHA 2OCBA 4Z4GA 2OYSA 2OV3A 3A9WA 1YL6A 1AQIA 1JJAA 1PNRA 1UZUA 3DKKA 3GJRA 3HBAA 2WY2D 3KM0A 1XZPA 5FBWB 1X8JA 4IDAA 2JFNA 2CLEB 3MTBA 1E58A 1OXSC 3JYOA 1WW3A 3NQ41 4JGBA 4XEUA 3R5SA 2YS6A 5DISB 5E6UA 2FEAA 3AETA 4Y2HA 3RARA 3HDVA 4F9TA 1HYHA 4OJNA 2ORIA 1DWOA 2EBUA 4IKOA 4OMDA 4KXVA 1L4MA 2VDJA 3L8HA 1E5VA 4IIXA 1SVIA 3OO0A 2AN3A 1WSDA 2DC1A 1J1UA 3VR1A 1PT5A 3Q5EA 1AF4A 1UOQA 3AL3A 2JD2A 1E2FA 1WUYA 3GLVA 5JROA 3G79A 3U09A 2YIVX 1FFWA 5FTKA 3SEQA 4NATA 5L3QA 1U8TA 3LQYA 3LWZA 4KO4S 4QTUB 5C31A 3VVCA 4A8TA 2HJVA 2G1KA 4G1UC 3SC3A 4OI4A 3OWOA 3GB9A 4HXFB 4PWZA 4U2GA 2YYSA 3A9VA 1WCV1 3I1JA 1KK0A 3VR3A 4KXYA 1P5JA 4XPIA 2QQGA 2WNIA 1QRSA 1QV6A 1XG5A 1YQDA 4TMVA 4B83A 4ZI2A 3DH0A 4KE8A 1XNJA 2UYYA 3TI7A 2GM3A 1E7YA 2ILVA 1G5QA 1HKHA 1IK4A 2HNAA 2ILTA 4GQBA 5C3UA 4AF8A 1KZ6A 5K01A 3ZHVA 3CO5A 4Y2YA 2BEUB 4JJEA 5FADA 2QVLA 1C3OA 1GO2A 4F2DA 2B8EA 4FSDA 5F2NA 3E8SA 2YXBA 2R6AA 1RYHA 2P6MA 4ER3A 1CY8A 1YQ9A 4GRDA 4R1TA 1ZDMA 2D13A 3O1HB 1N2CB 3VO9A 1T35A 2Q5IA 4G1MB 4JJ7A 3FGZA 1M2OB 4GR4A 4LYYA 4PV7A 4YS6A 1XGKA 4CYMA 3ZD7A 1ZMBA 2H2HA 1CQZA 1KARA 4RXMA 1U8YA 3OD1A 5E3JA 2DFDA 2WJPA 3I45A 3VYVA 3QELB 4D1YA 2VWPA 2ZVJA 5EQTA 4Q1EA 5CA1F 3UHOA 3EXFB 2PN1A 5AUOB 3A6JA 5ICCA 1SBCA 1BS9A 2XTMA 4J7CA 3CWZA 1S7GA 4FHEA 5HE9A 3W6OA 4MICA 5BQFA 3KKKA 1WNTA 3EBLA 3B6IA 2QMEA 3M4ZA 3PZBA 4BKPA 4UQOA 2XZDA 1OZHA 2H1OA 1D1QA 2RGNA 3BQMB 4AIIA 2PG3A 5U1PA 3OMWA 2JI4A 3DDZX 1DV1A 4RVDA 3FUTA 1D4ZA 4GR5A 4YCBA 5JD5A 4YB8A 3JALB 5HBGA 4HAVA 3JATA 1OJ7A 5MF6A 2ZXUA 1MQ9A 1VKZA 3A4MA 4OX9B 3JYLA 2YFKA 5C32A 4CIVA 3PQ7A 1C1DA 3BK2A 4RY2A 1A4IA 1LFDB 1JLLB 2CB0A 5DX0A 1KEEB 1CY7A 4DJDC 3Q0TA 4EG7A 2GZSA 5D86A 4GP9A 2ZBQA 3DLPX 1GAQA 3H0KA 4JLPA 2YWBA 4CETA 3B2EA 1UBUS 4FEEA 1MJGA 4JYCA 1FS6A 1YOVB 2G06A 1JPJA 3OM8A 4FNMA 5TIIA 3B9QA 2YXDA 2POCA 5CR9A 4YXWD 1F0PA 1NKVA 2PX5A 2I03A 2A5GA 3MRSA 3D7SA 3GMIA 4OKNA 4YJDA 4HYTA 3OOHA 3RO7A 3S2SA 4P0TA 3R7NA 2WDPA 3AUTA 2BMWA 3L7KA 4JLDA 1G60A 4U00A 4ARUA 5YASA 2CK3D 3TG2A 1UUFA 1PI3A 4KIWA 4F8EA 2G4VA 3KR1A 2IU3A 3IYLW 4TQ9A 2HA7A 4BO4A 1SUAA 4S04A 2ZFUA 5A1TA 4ARVA 3KOWA 1W0CA 5AXAA 1C9MA 2VXYA 3EIHA 3KUDA 4MUMA 5HSGA 3OSUA 4W9NC 2FX5A 1GWNA 3O1JC 1XRNA 5T5QA 2H00A 4CQLB 3VUFA 4UCQA 1XWIA 3T7SA 1E79D 3RTDA 2PL3A 1AK9A 4FYVA 3KAQA 2YWHA 3SU8A 2CKDA 2A0KA 2R25B 3NP9A 4R68A 1X15A 4Q9LA 2QUAA 4CW7A 4S24A 2GPTA 1A76A 1P2FA 3KETA 3WGNA 1F48A 2YZMA 5HK8A 1VMEA 3NVDA 2FZ5A 4FZVA 4E22A 1PAUA 3EJ6A 2PQ0A 2H9AA 1PEDA 1J8FA 4V3BA 2LE0A 4LYAA 4FMCB 2BHSA 1HR0B 4G0XA 1L1EA 3WMXA 1W5EA 1LK7A 4KMSA 4X5OA 8LDHA 1T6NA 4D0NA 2RK4A 2HRBA 4FMBB 3G2KA 4MVJA 4EUSA 2JFVA 4BKRA 7YASA 5LNK6 4NNOA 4NU0A 4OOFA 4UREA 2I1WA 4D3FA 4QNRA 5HILA 4JJ8A 4UZEA 2QUBA 4JEMA 3OLQA 4MLPA 5SZKB 5DWVA 1P5FA 5BT9A 2P5YA 3TOSA 3FWZA 3LDAA 3TIFA 1CLEA 1WMSA 2A9RA 1NY6A 3HLYA 1DU4A 2F64A 2H1FA 3PSHA 2MMGA 5D3KA 2YHIA 3Q41A 1W8DA 3ROGA 3ZDEA 2P2CA 1SUEA 3PV0A 4MKGA 2XYHA 1JDNA 3MINB 1QTIA 1EFAA 3ABIA 2E21A 1Y8RA 2L19A 5IBCA 4DDWA 1DE0A 4ZGGA 2VHEA 3AIKA 4GF5A 4MARA 4PGHA 2B7LA 3WX0A 2M1XA 1AKTA 3VZCA 3AVVA 2Z1MA 4IFEA 1T29A 3GLHA 2H85A 4GHWA 4UVGA 4W99A 5DLDA 5DGCA 3R3XA 4Y2XA 5JMOA 1XMJA 1MD9A 4KXWA 4RMGA 3C3XA 1UT5A 4DC1A 2B99A 3GEBA 1Y5RA 4GVLA 2DKFA 2KX7A 1ZN8A 2HU7A 4Y30A 4U9UA 3UOGA 4N39A 2CXUA 3A1UA 5JJ5A 1EB9A 1TU3A 1UPBA 4B80A 2LCIA 3IMGA 1QTRA 3AF1A 1HTBA 4L6CA 1FDOA 1PK8A 2AEJA 4RVNA 1MIHA 1I3NA 3DOJA 4AG3A 5AK0A 1QK3A 3I2FA 4ZT3A 4TPKA 2GHIA 3X0DA 3K0CA 4MDFA 4BE7B 5A5FA 3N2YA 1PE0A 1S89A 3B6KA 4KVGA 1KAOA 1XU4A 3G0DA 4PPFA 2DTXA 5LQAA 2XBMA 3ZV3A 3AEYA 3UMJA 3WC4A 3FFWA 1D2EA 3MGGA 4KWIA 4R51A 1OY1A 3B12A 3H5VA 4Z2YA 2ZYVX 4YONB 2JNWA 4BS9A 5K0JA 1YBVA 4IUBS 4DC0A 4AXXA 1Y6GA 2VHZA 1WA5A 3KFVA 4OO3A 1NM5C 1EA5A 1V1MB 4EMTA 5JCOC 3UK0A 4WLEA 4C7OA 1Y9DA 1ZI8A 3D8TA 3BRQA 3E7PA 2PE5A 4X65B 1VPVA 1RHJA 1YRLA 3EDYA 4IJ5A 3NAGA 5EAIA 3JQ9A 2AOWA 3UPTA 3L5KA 2QMZA 5ISMA 2WTXA 2ZRGA 1TVMA 5IKXA 4MGYR 1Y63A 3Q9NA 4UNQA 3O8OA 1LTKA 1HM5A 1UBKS 3ROKA 1G3QA 3VHRA 4JX9A 3I9NA 3JD3A 5J47A 3ONDA 5AK6A 5TS2A 2C7VA 1N9ZA 2HL6A 2Y0CA 3QENA 4HSGA 4PZAA 2EAUA 2ATVA 1Y9ZA 2I6UA 2ENUA 3TQTA 3JWGA 1FFSA 1YI1A 1ZL0A 1Y9AA 3BWXA 3JVEA 2DUJA 3D2LA 4QYIA 3ADBA 2R6CA 5K3FA 4F3TA 4LDRA 3KR2A 3HDJA 4OSOA 3RTEA 3ZHYA 4HI0E 4IGIA 3OCYA 1UCFA 1R27A 2E4UA 3KZXA 4O4JA 4W8GA 4AUMA 1FU4A 5IJWA 3C2QA 2WA2A 5DGTA 3ZWYA 2W90A 4ZI3A 2HSGA 1RJEA 1L1RA 2ZRAA 1FFEA 3DL7A 1VIDA 3LBNA 1KOFA 4P22A 3WWYA 5DOVA 1FW6A 2V97A 2E49A 1TEZA 1U1FA 3GBPA 4HX5A 4K03A 2D2EA 1VI6A 2FZKA 4CIAA 4FYHA 2CXTA 2W6QA 3ZXIA 1F9EA 3AKYA 3VKHA 5CP8A 1Q0RA 3DLIA 4FMCF 1ZVQA 4UXIA 4JOSA 5H3HA 3WB1A 4A6PA 4OLHA 3EF0A 1OFGA 2ZITA 4IHJF 3BMXA 1D9XA 3OLXA 3GUYA 4ZZ2A 2BSXA 1H2YA 2Q5FA 2J9RA 3IAEA 5JPDA 1HE1C 3DMYA 1G8YA 4J90A 5KVVA 2H6EA 3KPUA 1NRIA 1QDEA 2UVQA 4QYSA 3WLNA 4NXNB 1L5HA 1M2GA 5ERYA 1SCDA 2DFLA 3KS9A 4MQEB 3T5MA 5BVGB 5BSUA 1HE5A 2DR3A 4NECA 5DM0A 5FLYA 3TZBA 5JISA 5LVAA 5GONA 2PRYA 4KN9S 3W06A 1VE3A 1YQQA 3QYJA 1XTZA 1SVOA 4AAYA 4TT3A 1OB2A 5LBIA 1H9CA 1YK0A 1YIOA 4JFRA 2JK1A 1LLDA 5HPYB 4J1TA 4NCKA 5HNKA 1OWOA 3EUFA 1ZR4A 1H05A 1FVXA 1DJOA 4DUGD 4KNYA 4ZANA 4X63A 1VL1A 2ECQA 3FKQA 2NU8B 4NQRA 1E2PA 1Y34E 4INJA 3P9NA 1E2GA 4L0CA 4QBKA 1CHNA 1Y0BA 2HQ1A 4QUIA 4WY2A 2NP7A 3I12A 4ZCRA 2JAUA 1NMSA 3QWAA 1BX0A 1TM3E 3ER9A 3C3MA 1PGPA 4R8MA 2I3ZA 1NW3A 1SHTX 3EW9A 4LOLA 4MWZA 4WXRA 5HS6A 1QOQB 4J49A 4C6TB 2H31A 2HA6A 3ACCA 3BVPA 1DIOB 4FNOA 1KI8A 1OXTA 3EG9A 1Y81A 2YFQA 5MN5A 1KZ4A 4CMHA 4Q4DA 1F38A 2FSIA 4NBWA 2JD1A 3KC2A 3E9NA 1YR1A 3GLFB 4XYEA 5BURA 2F6RA 2XE6A 2D2VA 4R9UC 1I1HA 4G5QA 1NVDA 5ALOA 2FZ4A 1PL6A 3KDPA 4KPUA 3V8QA 3U7HB 4DMCA 2WE7A 1X1AA 2VT7A 5BWMA 2E4XA 7GPBA 1A98A 2VAWA 4Q82A 2XKKA 3D6HA 3GMDA 4JMPA 1PW5A 1CS0A 2Z2ZA 1Z5VA 3NEAA 3Q9SA 4GYYA 2IP2A 1UBNA 1Z37A 3F7MA 4FXOA 5IZCC 1XJWA 3EZ7A 4M21A 1NE7A 1D2CA 3ESYA 3JVDA 4XASA 4WVFA 3IP8A 2HCJB 2P3QA 4UUPA 3VBEA 2XGSA 4G85A 1JQKA 3DQQA 5DKFA 2P9BA 2C5AA 1R5JA 2BHTA 3LKZA 3W0LB 4LJ4A 3OCXA 2FPWA 1JHOA 2DBQA 2O2XA 2X22A 1ZKMA 1SZJG 2V55B 1UKVY 1CETA 2XAAA 1G4AE 3KUKA 3SZOA 4A0FA 4H6XA 5CJPA 4F5DA 1YZLA 2I2CA 2VPXA 1YZUA 3DV0A 2D5IA 4K1XA 4Z51A 4HWGA 3ZWMA 4YAOA 4E31A 5HQTA 4AMBA 1W2HA 2I80A 5K4HA 1NR7A 4DMGA 1H23A 4HLUA 1GFZA 1YCHA 2BBWA 3NH9A 3PXXA 4JVLA 4M0PA 1JBQA 2WWTA 2H0RA 1YIAA 3R6WA 4XAQA 3TKAA 5HR5A 1PJLA 1PJZA 2WV7A 1E5TA 3PJGA 4PLCA 2A84A 3L40A 3KWFA 3S5UA 1UKBA 2E4ZA 2FFHA 5BRNA 1K4KA 1I3LA 2GCPA 5ES3A 5AXBA 4DWWA 3WIUA 1UEIA 3QMWA 3VMMA 4ZAFA 1J42A 3QVGA 4AG6A 3RRYA 1RR6A 2AHRA 1EI9A 2FH5B 3IOEA 8MHTA 2I4IA 4EUEA 3RTBA 1B1AA 4CG1A 1NJGA 4WZ6A 5EMJA 2QLTA 3R2JA 1TQ2A 3AESA 4I5EA 3AM4A 3ABZA 2OCPA 4K26A 1M2JA 4EHNA 8ABPA 1B76A 1N8SA 3CH6A 2GLUA 3HYTA 3K9WA 4NAHA 4INZA 5EZQA 1E4VA 4PBRA 4Z3KA 3E27A 4J4BA 3E3NA 3GZJA 1JDTA 1OTYA 4YREA 5ERGB 2P75A 4OP1A 1VSTA 4FHGA 4OJMX 2K6GA 4FX5A 4QOGA 2V54A 2X14A 5JS7A 1Y5IA 1E4EB 4J03A 3M9LA 5CB4B 1USIA 3JZDA 1UPTA 2C29D 5HKAA 1J49A 4G0NA 4RHCA 2ID7A 1Q57A 1F8FA 3A1WA 3TD9A 1T2CA 4TVSA 4NMXB 2RGXA 1TA9A 2ZK7A 1QGYA 1ADCA 3TSZA 3D3KA 1P62B 4PLPA 3M81A 3D3EA 2FEKA 2FQYA 1T5SA 1VFNA 1E1QD 1C4OA 3C1TA 1WTAA 3K2IA 2QF7A 4G86A 1ZISA 2JFHA 3PENA 2DLNA 1XCGB 3IEMA 4EHFA 4D9JA 4MMZB 3PHGA 1Z0IA 2AJTA 3EX7C 3CF2A 5TT0A 1CIVA 3CQ9A 2I4MA 3VZDA 4FILA 4MYDA 4RH3A 4O5AA 3I6BA 4H7FA 1OTHA 3WGJA 5L9AA 4TLEA 4IH9A 1FU7A 1Z6QA 3WO1A 3TTTA 4OFZA 3ZJYA 3IO5A 5B5SA 5BSKA 3EY4A 2AI3A 3IQFA 5IBPA 5KSWB 3NHSA 4WDQA 4YMWA 2Y2UA 3I42A 5J1TB 3RE1A 5K8JB 1RPJA 3PVSA 2FJUA 3NBMA 3S7ZA 4KOEC 3SS8A 1N77A 2PUEA 2C00A 2Q2VA 3C5CA 3G5AA 4IPTA 4R2JA 5HP4A 3G1UA 2OXFA 1B4DA 4LC1A 1NVKA 5KSYA 4MB0A 4FD3A 4D0RA 1JA9A 1BHQ1 3IQZA 1DAOA 3K9NA 2CHFA 2W6ZA 3QXGA 2RBKA 3WY9A 3L1IA 2H5EA 5T3UA 1GPWB 3WYDA 1RRMA 4NL4H 4KGZA 3I6QA 2EEZA 2NAFA 3HZRA 1NV9A 1LSUA 2JKVA 1X7YA 3C24A 1T34A 3JQFA 3SG0A 1ZM9A 3EMDA 1P2SA 3JTEA 4NJMA 1BDMA 3NAMA 4E30A 5AW3A 3F3MA 3WQRA 2O8FA 5DIFA 4HR7A 4CIBA 3BE5A 1E1CB 1NE2A 1L5VA 4Y0NA 3A32A 5CTJA 4E5YA 2BAGA 2OHFA 2WMNB 3LT4A 2RMKA 2ZB7A 1IMJA 3CEPB 1LVUA 4MWBA 4RHXA 1GA4A 3U17A 2P40A 4L5CA 3TXXA 1J5PA 3ZKWB 2J3IA 2XWSA 1H2XA 1W25A 2PM8A 4TRMA 5EWLA 3RHSA 1N8NA 3DA8A 4LNHA 3SHTA 4BQRA 1IIRA 2D1RA 4EG0A 1PV2A 3HJCA 5F64A 4OLFA 2IHJA 2PRZA 3TVDA 3UICA 4I5FA 3BWEA 3E58A 1TD1A 3UJAA 1ZN9A 2BEVA 1N2JA 1OILA 1M9NA 4P54A 3VJMA 2PV0A 3Q8WA 5LXTA 3N0RA 2OILA 2WYVA 3BJIC 4RSMA 4XQ0A 1NXOA 2PXXA 3L4BC 3UAOA 4QU8A 1YFLA 5EWMA 2XCIA 4CE6A 4DMUB 2OUKA 1GRCA 2ZBEA 3W5DA 3GJ7A 3ZNNA 1K63A 3WL5A 4J2HA 3QHPA 3L1VA 2E4YA 1R1DA 2XNCA 4DMHA 5HZKA 4MV6A 2QY9A 4LA4A 1KHHA 3AZOA 1UQRA 4O4IB 3E8MA 2C99A 3SJUA 3E9EA 3HSYA 3I30X 3P4YA 4J0QA 4MGEA 3AVUA 2Z4SA 1C9YA 3GVIA 3KE9A 1VIMA 3LUPA 3SDBA 5C1BA 3UT0A 4XVCA 2G9NA 1F9AA 1RLOA 4CLOB 3IPLA 4BY9E 3DEHA 3WBBA 1UMCB 1R8QA 3F7OA 3HJGA 1XBTA 4LC9A 4R1PA 5FF9A 4X8OA 5A4AA 3BS4A 1DKUA 4CODB 2W2KB 4DA9A 3RC9A 3R9WA 1FSFA 5IPFA 1KRWA 2ZAMA 1CQPA 1N8KA 3FNBA 1B0ZA 1XZCA 2IU4A 2WM8A 1LF5A 3R7AA 1KGSA 1VL8A 2W8BA 2IQIA 3CN9A 4HDSB 4R16A 3JWHA 3GYGA 3KZMA 3RUIA 5J4HA 3K1AB 4XX0A 3VV3A 2FOXA 2QDKA 3KT3A 1OGJA 1SHJA 1BN6A 2Z2XA 1Y42X 3SN6A 4NICA 4TQUS 2WWVD 2BT4A 3DWIA 4X1KA 4BQSA 4MYTA 3LD9A 4YPOA 1UQTA 1KMMA 2IF0A 3ROMA 4OX9Y 4J1SA 5KYYB 2ZJ8A 5B3AA 4DXDA 2GEJA 3KO8A 1DEHA 2NLOA 1Z8FA 2PRKA 1RC1A 1Y5NA 2HDHA 1TF7A 4RPHA 3DPIA 3N05A 3HKEB 3PUWA 3ZTTA 1EM8B 4OU4A 1NX9A 4EHHA 1B2RA 1TC2A 4I36A 4QGBA 4YPVA 1Z17A 1NNUA 2IYQA 2JDID 3MMXA 3MWEB 3ZGLA 2CMDA 2D3TA 3WB9A 2RHDA 4KQ1A 2WKRA 2AZXA 3TRHA 4NH4A 3WB0A 1UANA 4N5MA 3ZDFA 3CUWA 3V6LA 2EDCA 3OJCA 3C39A 1V3QE 4YJ3A 1GNSA 4JJKA 3GZTB 5HCIA 1IB0A 3UFXA 3ZGXA 1XL0A 3VU9B 1ULBA 4YP9A 1RC8A 1F4LA 1G7CA 3EWIA 2PSJA 2A58A 3DHEA 2PWAA 3P32A 1EK1A 4IDOA 4V0ME 5G41A 4UFPA 4A15A 1RZRA 4GL2A 1W44A 4IUCS 2VSXA 3FZYA 3LYAA 3LHFA 1AF7A 2XQJA 4K6MA 4QXQA 4UBKA 4BJ5A 2IHNA 5J2TF 4JLVA 2XCRB 4M8SA 2CE7A 2QTGA 2WHYA 4M6WA 1CRLA 1WB6A 3NBQA 4FGKA 4L8FA 3UPDA 4AICA 3FHOA 2DWQA 1CZLA 2GN0A 3HUEA 5JDCC 3RAPR 1JFTA 4ZU3A 3IAS6 1Y4UA 3L92A 1CUYA 1VIAA 4WJZA 4IZOA 4MPTA 2B1GA 2YFHA 1I0IA 4P92A 4ZAXA 3WLSA 3HK2A 3HA5A 3OPVA 4M87A 3UJ3X 5FXMA 1SU4A 1D09A 3T3EA 4B33A 5HJEA 4X7MA 2PL1A 1LU9A 1TIBA 4ARZB 2Q3CA 4V03A 4QQNA 4I9UA 4UEKA 1PJRA 3SD7A 3GFSA 1Q0UA 3KQNA 2BOVA 3E3AA 2AOXA 4BO1A 2P65A 2EFEB 5AVXA 5I7FA 4RLFA 1N5JA 3LM8A 5DTIA 3SZLA 4HDMA 1C9JA 4FNGA 4UOZA 4DXHA 3AF4A 1ZLXA 1G1MA 3E3LA 3ZBUA 1TYCA 2ZQZA 3TW6A 2C98A 3CVJA 3L82B 1JKJA 3RDPA 1WKBA 1MGPA 1GFIA 5FWNA 1JXOA 3PR2B 2CXSA 3DMRA 3K3PA 4YJ2A 4MS3A 2A78A 1ONBA 2Y77A 3CH4B 4DQXA 3DAGA 1JU4A 4JLNA 4M9RA 3BCHA 1M75A 3BXEA 3LFUA 3LNCA 2BONA 2LVBA 4E1VA 3D3WB 1UM9B 3OF3A 4H59A 3HO6A 5KCZA 1ZZEA 3FOBA 3LPMA 3HI6A 4Z0PA 1DJPA 1RYFA 2V1XA 3D81A 4FJ0A 4YO7A 2CFIA 1D4OA 3KP1A 1N9KA 3GO4A 1P72A 1H93A 4E2ZA 1AK1A 1EBFA 2FRXA 3FNEA 3OQHA 5TRTA 3CRNA 3HKDB 3JWJA 2FUNB 1ZCZA 1FJGB 3TDNA 1AE1A 2QTNA 4UM9B 4Q15A 3D1LA 3TR5A 1AU9A 2P4EA 4EKNB 1QHHA 1J20A 2VYCA 4IBOA 3F96A 4TZ0A 3RBZA 3BH7A 4DLVA 1P91A 3E81A 2ZG6A 2H1WA 1R6TA 2GEDA 5G0UA 1JKIA 4XM2A 1V6CA 3V9PA 2J5RA 3MWGA 1FUEA 3I4LA 1VCHA 2PKXA 3MTDA 4BP9A 5K0FA 2O3RA 2XSZD 3FDZA 1RRGA 3UMSA 3ZW7A 3K6RA 4CKCB 1CZUA 2ZYDA 4S1NA 1XKQA 1HE4A 2NO1A 4F2WA 2WT9A 3WGVA 2A67A 3EGEA 3FGPA 2H7YA 4LWOA 2H54A 5TQ2A 3A36A 3T7TA 4OSEA 3MWEA 2VWHA 1JEJA 2R3SA 4B48A 3O8NA 4HGOA 3KKPA 5AKXA 3V42A 2PZLA 1PWHA 1YS6A 2FZGA 1VHJA 1QRDA 3L8EA 4NENB 2LKCA 3BGVA 2BFFB 4DLWA 3M7IA 1WY7A 4URFA 4XDHA 3QSYA 1HLDA 4AJ4A 5KOIA 3HJNA 2H2DA 3HS3A 1P4JA 4QXOA 1PSZA 1Q77A 4UPDA 1DC8A 3A28A 3MOSA 2O5VA 2JAQA 3TUIC 4RTNA 1RXEA 1JR4A 2JRCA 5KOHA 5AW7A 1WXDA 1USGA 4Q4JA 5J59A 3QVJA 4RSRA 1MAUA 2GXSA 4WK2B 1ANKA 3AKDA 4PCUA 4UMVA 5A4DA 1U0BB 3Q3EA 4HDNB 3ZKAA 2H7CA 3QU4A 3HXLA 4L5IA 2F4VB 2KSQA 1T9BA 3LV8A 3DOHA 5AK3A 1QV7A 4G9BA 2HF7A 2R1ZA 2PYIA 4OU5A 2P0EA 2GD0A 2OWEA 4JYMA 4LXYA 1OVMA 1DG3A 2D4HA 3UIEA 1YKSA 4M0CA 4YRDA 2QZPA 2XUAA 2RHCA 3G49A 1NFQA 1H65A 5TGDA 3V7FA 1L7AA 4R2HA 5EE3A 4HQ6A 3GGSA 1DC4A 2RK6A 2O19A 5AW6A 3TIXB 1RM3A 3WL6A 1M0TA 1X7ZA 2VPQA 3ZZ0A 1C8BA 3IESA 3HN7A 1LTQA 1KKUA 3NX4A 3AEKB 3GQVA 3WIEA 3JWEA 4CWAA 4RXTA 1W93A 2DT5A 3CW2A 4WOBA 2FMXA 4HFRA 4YFYA 5EVJA 2OXTA 2QRVA 3EUWA 2CV2A 2XUIA 5GY7A 3FF4A 4RVUA 2QL7A 1OYOA 3MN1A 3U80A 5IK2A 3KJFA 3ZQKA 3GFTA 2GX6A 3SHFA 3NB0A 1ZIXA 1TAQA 1T8RA 2WPNA 1XA4A 3AW8A 4IUYA 4YVFA 4E5DA 2NYRA 3KPYA 2OY0A 3DLTA 1IBRA 2J3MA 1FQKA 3GLFA 2O2EA 4MVJH 7ABPA 3JWIA 3UUEA 1U6JA 4G81A 3KYCB 1A9OA 2GCGA 4CXMA 2XUDA 5LZ9A 5FWXB 1G64A 1QLHA 3VOSA 4W9NA 1G8JA 4AECA 3O8CA 2Y4OA 2JG3A 5EQDA 2VSYA 1DZIA 4R1SA 1W5BA 1PLLA 4ND5A 1H4QA 3JS5A 4GLJA 1MC5A 1E9VA 4NSNA 3RAJA 4LMRA 3U81A 5CM8B 1UWVA 2EFHB 2J3QA 3BSSA 4GYWA 1C0EA 4QUJA 2P2YA 2C57A 5FOQA 4CCAA 2DPLA 2ZRDA 1GZ4A 3SS9X 3T7JA 1U7ZA 4Q3DA 4DMRA 1CDZA 1G1AA 4NG4A 4EG1A 3AL0C 3BZBA 1DG9A 4I66A 5K2OA 3E1GA 2V3VA 4M0EA 4QVGA 5IKEA 3THSA 1KI3A 3NPAA 4BB0A 3FVWA 1YNSA 5AXCA 2VK8A 2ECKA 2FP4A 4YA6A 3TGWA 2J08A 1ML3A 3QVUA 3P2KA 1ZJYA 2A7QA 2YQ5A 3GUUA 3OIUA 1HTWA 1S4MA 3NV7A 3KKMA 3IVAA 3WZLA 4RACA 5DM1A 4RENA 1S96A 1QMPA 3GGCA 5ALZA 2Q62A 3GIDA 2NOAA 1E1MA 3WNZA 1HG0A 3BTSA 5KNCH 1E8DA 3JAKA 1TJYA 1I3CA 3RWOA 3FPKA 3PNOA 1XN4A 1HPLA 2MJLA 2EBHX 4M98A 3M6UA 3NZEA 5LJIA 3K32A 1OC2A 1NGSA 3BHJA 3S68A 1ZAYA 1Y9EA 2E2WA 3JV7A 2IYFA 5CD1A 1VP3A 3OI7A 3OT4A 1H2WA 2NUPB 3NDPA 4P4SA 2IYLD 1TQ6A 1YDHA 2O7SA 1JHDA 2ORWA 4A8JC 1RIFA 3SQXA 1XRJA 3DHYA 2KHZA 4IV5A 3UKOA 1ODKA 3RYCB 1LJUA 2YIJA 4Y2UA 2A3NA 1U63A 4B2PA 4DV3B 5KJ6A 1QGUA 2OCXA 1AA9A 4EBBA 3ZNOA 3ILSA 3TM5A 1E6WA 1KP2A 2VTBA 1C14A 1JGTA 3DTVD 3I5AA 5DYWA 3MPUA 5KTRA 3TS1A 2IEZA 4O4HF 4JLMA 5IEBA 4KWEA 4CM4B 4GYJA 4W1PA 2FW7A 5HIMA 4CMBA 4WCFA 3DOIA 4WFJA 1DRUA 1VLQA 4EY4A 5DPMA 1HDXA 4FDTA 4A16A 2NUAB 4MWSA 5JSYA 3WYNA 4RA9A 5LB2A 5DNWA 1DC6A 4U6SA 4AJLA 3R9KA 5B1YA 3IQGX 3LXRA 3ZWQA 1MOZA 5L4SA 3PNQA 4QGGA 3EARA 1R3UA 3GROA 1EDDA 5DP2A 2OYRA 1P19A 2GFQA 1GR1A 4FX2A 1Q2XA 5DW3A 4C0JA 2RB5A 3HKBA 5I5GA 1N32B 1M5RA 3CT4A 3KXPA 4BEWA 1X42A 1BRMA 5A62A 3IBGA 3N87A 2HMWA 2BTQA 3ZE8A 1AVTA 3IKMB 1YFJA 1Z6AA 2AH5A 2GUGA 2UZ0A 4II3A 3VRHA 4LF8B 1O5TA 3QKWA 4KE6A 3O6VA 4P32A 4R2LA 4WNAA 1XYVA 2XCTB 3DFMA 3TM4A 3FNFA 5HZMA 4L8LA 3MYYA 4TKMA 3F2VA 2FUEA 2GN4A 4B6SA 4QJIA 4O3FA 3TOXA 5LQDA 1DTEA 1LS1A 3C3BA 3IP3A 4ZQCB 5J2UB 4EHIA 3BAZA 1ENYA 3UV3A 5ALIA 1YNOA 4LJRA 1EFKA 1PG0A 2OXCA 3CONA 2WIGA 4I5IA 2BGWA 4MKRA 1VG0B 2CC2A 4CG2A 1WCYA 1SK9A 3I83A 2RIPA 3M9WA 1M73E 4P5PA 4EY8A 1UAAA 1A2QA 4FR2A 2EATA 5DULA 2HRZA 2QTTA 2VJQA 1ZNZA 5K0SA 2NVOA 2VYNA 4HDNA 4XKJA 4FFOA 1QQBA 4D80A 1M2VB 3WGIA 3OE4A 1Q20A 4U7JA 3WK6A 3TMYA 2HRCA 1Y82A 4FIDA 5CJ2A 2VXCA 4N47A 2D2IA 4HPWA 2PJZA 3ZE9A 4F21A 5JBQA 5JH7B 1PUIA 4G3XA 1EVZA 2PZKA 3P8ZA 4BNHA 1GGKA 2PPLA 3L4KA 4RJLA 3HRKA 2FYTA 5B6JA 1G9TA 4AZ3B 1JG1A 3OX1A 4HNRA 2OZVA 2P2NA 3ESDA 4H1VA 4YALA 3URMA 4BB9A 2H51A 1DJMA 1V39A 4IO0A 4CV2A 3PYMA 5CXXA 3IAM1 3DUWA 2C4HA 1I9GA 1TA0A 5IHXA 4KRXA 4NBUA 4AJOA 3I3SR 1K2VN 2Q50A 4KNVA 4A2WA 4OV6B 4AYXA 1GSAA 2QY6A 3KT0A 4U2KA 1ZITA 5JS1A 5KVAA 4OI0A 4TXHA 3OU6A 1ZL2A 2X5JO 2YXLA 1A9ZA 4BO7A 4KU4A 2CL0X 2YHIB 3L7NA 5JALA 3FPSA 4HUQA 2Q8QA 3FTQA 1XSEA 2NVWA 1YMQA 4HADA 4X85A 5EIBD 1RQNA 3AUXA 1B16A 2AR9A 3D02A 3PTLA 3UMFA 3UWMA 4GG1A 1C3LA 3V4FA 4BX0A 4BWFB 4EKDA 5BN3A 2EKZA 5F52A 1XMIA 1EJBA 3DFFA 2CLDX 5F1YA 5H83A 4C0WA 4P8RA 1S2NA 4CN9A 2OGSA 1QZTA 2Q3HA 3G5LA 1UXHA 3PXCX 4EPRA 3LO5A 4GGPA 4BFWA 2VNAA 5DGXA 2IELA 3LIIA 4XW2A 2BFAA 3D6NB 1Q3TA 3DFIA 4A9AA 2AQIA 1A9XB 4G0OA 4LVCA 4PTLA 2Y1DA 5C1PA 5IKMA 1H0SA 3BKWA 1OXXK 3BCRA 3EAFA 5C5IA 3KSBC 2K7FA 1SKBA 2HK9A 5MDHA 1B14A 4S0XA 4C1NA 2IT1A 3CXRA 4RV5A 5L7YA 4KE7A 3WLEA 5K4AA 3ZZNA 1OLUB 2HMSA 3AEQA 4XOUA 3DMHA 1UKCA 5CT9A 2F3PA 2COUA 2J41A 2SHKA 3PJDA 4MUFA 4PZPA 4YJ2F 2WFLB 2QLNA 3AY0A 5JR3A 5H80A 1IBCA 1A72A 1KE2A 5A06A 4ZJPA 3ET5A 1HDCA 2F8MA 4QFBA 1KK2A 2ZYTX 4TMWA 1M6EX 5REQA 1U2GA 2YWXA 2FK7A 2V6GA 4HAIA 4KDRA 2Z9DA 1I2ZA 3SP1A 4UW9A 1SKQA 5FV7A 4EO7A 4BQFA 4CF3A 4OK5A 5DM70 1HQKA 5K8TA 3GN2A 4GT1A 2AFHA 2V59A 2C8LA 4QOJA 3IT3A 2QAGB 3LWNA 5BWOA 1KORA 4QC2A 4YRRA 2X1MA 3UW3A 3V9AA 4PRZA 1YA4A 5H81A 1C9EA 3S2IA 1BXRA 3DKPA 2D1TA 3MF4A 1J0BA 4E07A 4EI7A 4DLBA 2ISSD 2OLJA 2YBEA 4CL0A 2HTEA 1J5XA 4EJSA 1SD5A 4XX0B 2HEIA 2GJ4A 2WVJA 3OZEA 5JECA 4C2BA 1SKAA 4ID3A 3K1YA 1ONSA 3G1WA 4V38A 5KTKA 3G2OA 3QBDA 4OYHA 5DJ5A 5EWJB 3OPYB 3L8YA 1ONNA 3CO0S 5KNLA 1YJQA 3K31A 5ALUA 2WABA 2QRLA 2WG0A 4QRDA 3DVLA 2X0FA 3UOAB 4K2AA 3I9OA 4UXJA 4DZRA 2J1LA 4NBNA 1X1SA 3RUAA 4KIFA 1VLMA 1L6RA 4X3OA 3F1LA 4QULA 3NASA 1V8BA 1N6LA 3MQ2A 1SUCA 1R9JA 2R11A 4IVRA 4FHCA 4DV5B 1LI7A 4A27A 3DEZA 2G5CA 3DONA 4ZAYA 1IULA 3Q0IA 1Z56C 3BMNA 3QKUA 3OT1A 4IWNA 2ZIXB 3FGOA 5IYZF 5A02A 1Z4PX 4EI9A 2NUTA 3IDAA 3K4HA 4BPBA 2FWJA 1IHXA 4MI6A 3Q3GE 4LN1A 3S8YA 5C7LO 3HUUA 3NHZA 4Y6RA 5AKEA 4E46A 3PK0A 5CYFA 1OV6A 1X7XA 1UOEA 2B83A 2ZAYA 3N2LA 4YJ3B 5DBFA 5IT9A 3PC4A 1C8VB 4FQ7A 3TW8B 5BXQC 4FOOA 1DIHA 4PYKA 1C30B 1M83A 1ZNYA 4RDCA 5CT4A 5J2UF 5DX8A 1EK0A 2JIRA 1F1BA 1UWKA 1PT7A 2ZJYA 2UUPA 1B6SA 4OM8A 2XT0A 5FJIA 3ZD9A 4D46A 1GDTA 4HTFB 4QICA 2NG1A 1RM0A 4GM1A 3M1YA 2Q3EA 2Z2YA 2BFPA 3DAFA 1E8MA 1NVXQ 4TSKA 3KXLA 5DTRA 3SZ3A 1Q0SA 2IH2A 3B3FA 2HA3A 1OV4A 4DAEA 4C05A 5GZ6A 3Q2OA 4P4GA 3M5WA 1U3WA 3QMMA 2I8LA 2Q2NA 3NR2A 1EGAA 1FJXA 3N07A 1TM1E 1N5IA 2IZZA 2NT3A 1IRIA 2O1EA 2X5OA 3BMOA 3QE0A 5GVRA 4YQFA 3GJ6A 4ZDWA 4IQ8A 3FWYA 3QTTA 3OZUA 1M8FA 3K0AB 1VBMA 1U04A 1GRVA 3LBIA 2Z58A 4A8JA 4N5HX 2ZM6B 2A88A 4UHEA 3PUXA 4AZ0B 3THXB 1FRVA 1MHTA 5KYNA 1KDRA 3PFKA 3QY0A 1OU4A 2P78A 4WE3A 1GUZA 4M6WB 3ZVNA 4F06A 3HA3A 3LQKA 1VJCA 1X7XB 3QY9A 3S2YA 3GGDA 3MINA 4N0MA 1QCDA 3DT6A 5JYBA 3FTCA 4ER6A 1H3EA 1SU7A 2VPZA 2E48A 2AOUB 3L2OB 5L3RA 4DA4A 4NF2A 2B1JA 1HDOA 2CLCX 4X44A 5IW8A 3SVLA 1T0HB 3KD2A 3N75A 2LIVA 3HA7A 4NYIQ 3WNBA 2QYSA 1OBHA 1YUMA 2D5LA 3FMVA 2WAMA 2DFPA 3DC2A 3IEUA 1K7YA 3KXIA 3OPXA 4J0CA 4K9LA 2V0CA 4LCEA 4NLLA 5DI3A 4BB6A 5AW2A 1YONA 3KQOA 3QH4A 4EI2A 3A26A 3HGTA 2DM6A 2O06A 3C48A 3SDZA 5CCEA 4KQCA 1TCCA 3VSDA 5DRTA 2P62A 1W46A 4RKWA 3ODGA 1SZPA 3MCWA 2BGLA 3H1FA 4TT8A 3M3HA 5CVCA 3SKYA 3W8FA 2R8PA 2RH9B 3RREA 3RANA 5DWDA 1FQWA 5M2QA 1PR9A 1ZU4A 5BN4B 3LX4A 1KMCA 2PA3A 1CUWA 2QLBA 1TZKA 4QD3A 3WDKA 4AULA 5B57C 1VKNA 2VK1A 4RLQA 2QTFA 1V8OA 1OFUX 1OB5A 4AX4A 1IAVA 2IHKA 2IUTA 2DBRA 1ZSNA 4LYJA 5IVPA 2A9QA 1QVRA 2QNIA 3KQPA 2PY6A 4I4LA 1QU2A 5CNJA 1YBHA 2GPBA 4K3UA 5KKAA 4AJ2A 1OI2A 4E2XA 3KDAA 3V80A 3KQSA 2EOAA 4WFIA 3A1CA 1CU1A 2YN0A 1MZPA 2FGJA 3MQFA 5TXGA 2J0VA 2DSNA 2XWBF 4B85A 4PLTA 4XFDA 4B4VA 2WR8A 3Q3HA 4GVXA 2Y4NA 4JA2A 4JJGA 4JC0A 5CB4F 5KINB 2ZBFA 2IPXA 4DR3B 1XZHA 2B9EA 2JZOA 1E32A 2Z9BA 5CVDA 4DR5B 3D54D 2HFJA 1YJ5A 2NACA 2P67A 3HDTA 1JZSA 4X45A 4CTMA 1WKCA 3UPUA 5ILOA 3VNUA 4CTKA 1PBTA 2Z30A 3NM6B 4UUBA 4URVR 5AKJA 5DV9A 1OC4A 4EHAA 1JLLA 5DHFA 4LYGA 1I2CA 4HRYA 1SC3A 1M1XB 4QFMA 1CIPA 1A71A 3ICWA 2DFKB 3TR0A 2R5FA 1KZYC 5LWHA 1EE9A 1Q7GA 4FFBA 3HJTA 3WDLA 4BGIA 1H42A 1E9BA 1PO7A 2AOUA 4FOLA 4OM7A 3TRIA 3WQSB 1DARA 4Q34A 4DSNA 5LP6F 1KJJA 2ZBRA 3KJEA 1IVNA 3U49A 3HLKA 2GAFA 2GF2A 2DHQA 4M9UA 2BE7A 2OT3B 3TEJA 1T2FA 3WL8A 3ZD8A 3RYIB 1CWUA 3ZLTA 3MS7A 4TN5A 3D7KA 5DBIA 3DE2X 2DP4E 5ESXA 3ZH2A 4GE3A 1IBMB 2WD8A 1V47A 4FT2A 4DIFA 3U5TA 1NI5A 1BJKA 1Z08A 2QP4A 2WAXA 2QXYA 1NVAA 2OOKA 3EIOA 4WA7A 3RIXA 2D6FA 1J2JA 1MO6A 3K5WA 1SOWA 3ONVA 1VMDA 1Y3HA 5KJ1A 1EVIA 3DTTA 2YWEA 4ND8A 4RE6A 4NK4A 6YASA 4B40A 5JBNA 2IX3A 5IMSA 2B61A 4F3KA 4L0QA 2XXAB 1REQA 4P93A 4ZU1X 2CNWA 4JL8A 3CRZA 1BD4A 1F2UA 2O1WA 5J4LA 5CUQA 1C30A 4PN7A 3ZLUA 4PM4A 2IHYA 5J4VA 2J0UA 4M37A 3EVNA 4BNMA 3O91A 3N6RA 1PBNA 4Q4CA 1X8LA 4NZOA 2D0DA 1UMDA 1Y9JA 2FPSA 4IJMA 5H59A 3ZI4A 1II8B 3UC9A 3LKDA 5A3VA 3UAZA 4HDAA 5E6SA 4E88A 3GJSA 4LF5B 4DR6B 1AXEA 3ZDQA 3NHRA 3TRJA 3KV1A 3M5DA 4JXKA 1VM6A 2A8YA 3L49A 3OKPA 4K1LA 4BVKA 4C4XA 1GZDA 2BKVA 3MMZA 3P2IA 1A9TA 1WD5A 1S5PA 2AA3A 3IBFA 5AI6A 5LQSA 4BNXA 4PPQA 2FUCA 2CYCA 3O2SB 3PKZA 3RUDA 4AZWA 1JHYA 3CCCA 2D7JA 1PFYA 4YV7A 2BKXA 2WF9A 1C0KA 2II6A 3EUEA 4F4FA 4O2AB 5BVHA 3FTPA 3MMNA 4NESA 1K08A 2XXBA 3NHLA 2XZPA 3WICA 1L9XA 3IIEA 5ALWA 1K7FB 4EHJA 5G4LA 1Q95A 4QKQA 2JCSA 4LXIA 3RVQA 2W6OA 3EBOA 5AVQA 5JQWA 1X9GA 1AB6A 1JEEA 3AI3A 2J9FB 4LTNA 3ZDYB 1Y1SA 1Q84A 1UAGA 2G9QA 1CB7A 2RGEA 1UMBA 2F1HA 4RY0A 1XMXA 2O3TA 2QENA 3WIOA 4IDBA 3SR3A 2Y8EA 3EGXB 3CF4G 4HHEA 4IV0A 4BQIA 3FXAA 3TW4A 1U0LA 4REQA 3DBRB 1AKYA 5H3CA 3JARB 1PNTA 2QE6A 4TKZA 3WISA 2GN2A 4MWTA 4PSCA 4MK4A 3TLGA 3AUJB 4OHCA 2IODA 4GOLD 2F7SA 1B26A 1KSJA 1NUTA 2QHXA 2W83A 4N6OA 4QARA 3HRIA 3V8BA 1YQWA 3JW8A 3SLGA 4WY8A 1EYZA 1SR8A 3I58A 2NNWB 4EA7A 4ZK6A 1KIAA 3G8DA 3VHXB 4Q66C 1M1NB 3EH1A 3REQA 1ID8A 1JQLB 2J9XB 3N53A 3NXKA 1BFUA 2ZJFA 4J0KA 2H08A 2BEJA 2CLMB 2QTLA 1CY6A 2RGRA 3QVKA 1GYQA 4X1OA 1TADA 1WPXA 3ECCA 1VMIA 2ICAA 4GUDA 4NFSA 1ODCA 2V5UA 2GVZC 1XHEA 3MC1A 3OZGA 3L0OA 2PX4A 4Z3OA 1IM5A 4PZYA 2XDYA 3OOYA 2CUNA 2C97A 3JQFC 4RF4A 2HN9A 4PF1A 4U39A 1IEVA 2JLQA 4HXEB 3ZXYA 4AO6A 2P90A 4YCSA 1WLYA 4LJKA 4C7BA 2GLTA 1JIKA 2GM5A 1U5BB 1A7AA 2GPYA 2RH5A 1EFLA 4B76A 2VAXA 4XQCA 2C20A 4B87A 5K3BA 1GY8A 3I76A 2Y1WA 2JJ1A 3ZTYA 1T9GR 1DBWA 4ITVA 2H7XA 3FIUA 5JSFA 3IKVA 3OIWA 5CB0A 1YRBA 1YQEA 4QPJC 4KP7A 3CIFA 1FXSA 4MYCA 4YUWA 4BZPA 2PJUA 2A1IA 1QZXA 2WWWA 3KSRA 3OQOA 1I3OA 2FPPB 1XA0A 5KYWB 5EPOA 4XD2A 4BLRA 4J0JA 3DZHA 4WOCA 2JBHA 4TLMB 1H94A 3MXOA 4R0NA 2P9JA 3CVYA 1LTHR 1LCIA 4KE9A 1IWOA 4TROA 1Q0LA 1F3LA 2H5IA 3AWDA 3FB4A 1O6CA 5B1IA 2HEGA 3A70A 3F1KA 4MUKA 2ZUVA 4JL6A 4IF4A 1P6UA 1COWA 1RWNA 2BP7B 4L3VA 4O25A 1EB8A 4HNAB 4DDKA 4X7RA 2QPOA 1GZUA 2AT1A 1QS0A 3GELA 3UUWA 2L18A 5TQVA 1YZGA 1I6WA 4OYRA 4E33A 4NBSA 1GHTA 5IU6A 4B6JA 1CQIB 3KEQA 4LVUA 4TV8B 1P1KA 4DHEA 1C7RA 1JKJB 1H6BA 1YJCA 1MRNA 1IWBB 5B58C 5FPTA 4MROA 4EGCB 2IXAA 1VSVA 4F4IA 1XELA 4PICA 2G1JA 2Y1LA 2ZI4A 4OAPA 5HGJA 5I7EA 1SBTA 2E89A 3H2SA 3CKYA 5EXXA 5CCXA 5D3ZA 4BBZA 4YY3B 2A9JA 5H82A 2X9NA 4LWPA 3FWPA 5CG1A 1KTIA 2J6HA 4Q19A 2P27A 5CDSA 2GJ9A 2P8JA 4NBKA 4BFUA 4D0SA 3K5HA 3WLOA 3TX6A 1WHTA 2G7MC 4YUZA 1E0AA 3QWBA 1UEXC 4M1YA 3I73A 1FUIA 1QTQA 4YQZA 3IDFA 1XCLA 4HNGA 2P9QA 3RSCA 1EH5A 1ODSA 2QW1A 3DOFA 2D74A 1IOZA 2WJYA 3VR2A 4D79A 2PBRA 3RG2A 1G2QA 1PK7A 2MT9A 3ENQA 5IKPA 4A91A 3MWDB 3L93A 1T6XA 2J07A 2EYUA 2TECE 2Z43A 4GBJA 2DETA 4CM9A 1BS2A 4XH9B 5KNDA 4DCJA 1CF9A 4DV6B 1NXTA 3FFXA 3E6AA 1K6XA 3WA7A 3J7AC 3EIEA 3BWYA 3DVRX 4LHVA 1XAJA 5KUTA 4GZ3A 3AY7A 2DLDA 1N3BA 1Q0ZA 1T4DA 2B2CA 2PMCA 5AXDA 1K0UA 5BQ5A 4DIEA 4F12A 3TECE 4GI7A 1C0IA 1SWVA 2CD7A 2YH2A 4N18A 5FEUA 1SOAA 3MWYW 2ATEA 3L7DA 4LGMA 4RD1A 2B6HA 3H0CA 1U3VA 4CT4B 3O94A 2BEKA 5BORA 3L84A 4FGLA 1VB3A 2KBFA 4WKGA 1E3TA 1GTL1 4FE3A 3LCVB 5LP1A 3DE3X 2ADFA 3UK6A 4MLDA 5G1OA 4B1FA 3ACBA 1NW8A 4UEOA 1DQYA 1PV4A 1T0JB 1AUOA 2Y1KA 3KBOA 5EY5B 1BU8A 2WKSA 1TW2A 2WJ6A 3F67A 3OTGA 1ID1A 4G4GA 4LW8A 2AMVA 5ARDA 3ZU2A 4YMVA 5IJ9B 5LZ4A 1FS4A 1UBLS 1Q1BA 1SXQA 1OI7A 4ESOA 4KIJA 4R8SA 5MGNA 4PSAA 4AN0A 1XDDA 1DIGA 1DTWB 3EDOA 7REQA 1P73A 3DE0X 1GTRA 1MXFA 1M1YB 3QKTA 3HCWA 2J32A 1E1DA 2C1EA 2HSWA 2NSDA 3WIVA 5CLIA 1T91A 1G42A 5EUMA 3TL3A 1PVOA 2ZYIA 2EFGA 1MW9X 1ZWLA 2XOEA 1E1QA 1DQRA 1DKOA 4WZZA 5DT2A 1JDJA 2I99A 4XWTA 2R7NA 1YA8A 4QTYA 4U7HA 1SZCA 2QI9C 4B4KA 1D6SA 3K9GA 3LF1A 2FG7C 3G9XA 2PR2A 3FR8A 3H7AA 1HEYA 1LKZA 4XDZA 5SY9A 3Q7QA 5CA0F 4P7JA 1M6VB 2VQ3A 2YN4A 3GDFA 4BVLA 4EQ6A 4HNTA 5JTUA 3KNZA 2F2TA 4RM2A 2VDWB 2EJVA 4PPYA 5TJ9A 2RBEA 5H7XA 3ZNQA 4W5OA 3ZU3A 5ADVA 1FFHA 5HOEA 3LDGA 4DA6A 1WW2A 1YZFA 4NI5A 4N0DA 5COBA 2R68A 2QTBA 3CW8X 3ESZA 4YT2A 3EPKA 2BMDA 1NJSA 1Z6YA 1JEQB 4Z4FA 1WV0A 3T5AA 2VP0A 5AVYA 3HCDA 1YR2A 4HQKA 4YRFA 4Z4HA 4GI3A 3GGPA 2H1VA 1G8MA 5DBEX 1DXQA 1S3GA 1MX3A 2VC2B 2AOVA 3BRWA 5EUBA 3ZBQA 2OKGA 4B46A 4E0BA 1VL6A 2GAJA 3L9XA 1HYEA 4IOLA 2YFYA 4K8OA 2W00A 4O63O 5EJ5A 1SQSA 2NX2A 3IHTA 4W5TA 1RC0A 1KYYA 3WL4A 1S1MA 2X6QA 3B1KA 3GX1A 2QMHA 1C7EA 4WJKB 3Q9UA 4RHFA 2H4HA 1N34B 3G0CA 3H5OA 2EKDA 2QN7A 1QQ6A 2NU6A 4WUTA 5TF4A 5IAGA 3AVYA 2SKCA 4TWIA 5FRDA 2GK4A 1CY0A 1F8XA 4BLOA 5HQ3A 3D8BA 1C0PA 1P75A 1X77A 2AQHA 2R8ZA 1E6EA 2I9PA 2VDRB 4LC0A 2EP7A 4YH1A 4B8WA 5FI3A 2C83A 2YZ2A 4RKFA 2I9KA 2QRGA 4PO8A 3OLVA 2EBFX 4XIFA 1JAYA 4JP1A 1CQJB 2VCHA 3X1XA 4KWHA 4GXNA 2I6XA 4FC7A 2JGEA 3NJ8A 2FWIA 4YAEA 5BPFA 1AXRA 1FUKA 3LBYA 4OG2A 1EXVA 4HN4B 1RAGA 1XO1A 4FMDF 3PTAA 5CMLA 4C43A 4GKVA 5C81A 3G8AA 5FD8A 1I1QB 3RSZA 1V7CA 1KIFA 1R88A 2KM1A 2QGNA 1F3OA 5LWQA 3NWOA 2DTDA 3L8CA 2EIXA 4IDDA 3WL7A 4WHMA 1ZN2A 5CEJA 5I47A 4PZDA 3T7DA 3AR4A 2WMOB 3PHBE 4W7HA 1T0PA 1U3CA 2EL7A 2FW0A 3VQTA 3OLWA 4GXQA 2E85A 4B3CA 1L5GB 5JAMA 5KNBD 3AB3A 1N2EA 5AW0A 4HZUA 2MINB 1NUAA 2EKLA 1BA3A 4UMFA 3T94A 3BT7A 2B36A 1CE8A 1MA0A 3FRHA 3O7MA 4Y8VA 3DJYA 1Z2PX 3TBFA 3R5HA 3U4DA 2VO1A 2BHNA 1P8AA 2XR1A 4N5DA 1WOYA 4HS4A 3UO8B 3O3CA 4N0PA 1RBQA 2RIRA 2HLDA 4QU5A 4RGVA 5CW2A 4L15A 3ZGYA 4CHGA 1QQTA 2BMFA 5KX5B 5IF3A 1Z63A 2GM4A 1RBZA 2JGMA 3OJLA 1VHTA 3OX3A 4GEKA 1K7CA 2OBFA 1GAJA 1FDWA 3GJZA 3IOMA 4PCAA 2IOQA 3VXKA 1D8TA 4F92B 1ZUHA 3Q6IA 4BO5A 3PDCA 1QP4A 1R6DA 3ASUA 3CEAA 1UT8A 2C9DA 1VA4A 4ZRDA 1VSQA 4BWVA 5M7EA 1EEXB 1VRCA 3D4PA 4FYXA 1XEXB 3JZMA 2C3YA 2KLBA 2QMQA 1K8XB 5FUWA 4KGVA 4ZVTA 3TL6A 2IUEA 3CSUA 3MFQA 4YRTA 2NO6A 3IDQA 1E2BA 2ALJA 5BQOA 4IXWA 5THQA 2X9VA 4OHPA 4E94A 3EHDA 4FHFA 5T4EA 2Q1UA 4D43A 1KFBB 1OZFA 2ZB8A 1U7OA 3LC0A 3MT8A 4MR9A 2HM7A 4FYYA 4M83A 5E0OA 1M54A 1N25A 2I7CA 2OBNA 3OOWA 4NFYA 3T9EA 1JIQA 4WCVA 5COQA 1JX6A 2ZSDA 4PBSA 3TFQA 5EYPA 4UDYX 2GUWA 2V7EA 3OOSA 5TVGA 5CCBA 1TMKA 4WBNF 3TQIA 4KV7A 4BBPA 1Q17A 4IJUA 3LK7A 3EZXA 3BD8A 4KMMA 3RG8A 3A3YA 2VWGA 1WX1A 2V8OA 2NXWA 4KQJA 4R2WA 3KAJA 1ZQ9A 5JAZA 1KXJA 4UNPA 2H1LA 2SBTA 1UBGA 3VVBA 3C8UA 4Z7QB 1LDYA 3K20A 3GRYA 3EZFA 3I1YA 4M7RA 3H7IA 1U1GA 1MAHA 3GUZA 2RONA 3PE4A 4D8YA 2FUG1 2OMKA 3FUUA 1ZQ1A 3DTVA 3I9V6 3MMPA 4JP8A 4YRJA 3ZHXA 1QPGA 3T3GA 1TIPA 1AXGA 3FDFA 4DCCA 5FPQA 3PHIA 4LDZA 1E2UA 3QM1A 3FOFC 2IYRA 3O03A 1FFBA 3TO5A 4ZHQA 1GUAA 2RGYA 4PGAA 1U7WA 3WLAA 2XXAA 3TR6A 1ZRSA 3Q5DA 2QK4A 3HB0A 2HB6A 1RI3A 1A4UA 4B71A 2BGRA 2DFNA 3VPBA 3LU1A 2GDZA 4LHEA 4OCZA 5HUHA 4NONA 1P5ZB 3ZNPA 3SQOA 3EIQA 1QUEA 2X0DA 5A4MS 5K0CA 2P9TA 4ER0A 1JDBC 1QTNA 4QDJA 4IGFA 4F6RA 1P39A 2Y93A 1GSOA 3HWWA 3RYIA 9MHTA 3U7GA 1UMCA 3FPEA 4EJMA 3TBHA 3SBEA 2V3WA 4S35A 5AW5A 4PIMA 2E7ZA 4RS3A 1TVKA 3SIPA 3U44A 3D59A 2VL7A 3E7FA 2UUCB 2EQAA 2BN4A 3UHFA 1ZXLA 4DCNA 4BQOA 5DMHA 2HWWA 2SNIE 3IQIX 1MGOA 2P7IA 2VS1A 3LDHA 1IEQA 3L0SA 3R3JA 4HDKA 1YKFA 4LNAA 4P2BA 4URYR 1EA7A 5IM4A 4K87A 3NEYA 1Q22A 1S2GA 5E1OA 3CJRA 1PR0A 2RH8A 1XQ9A 1IZ7A 2XNHA 2VA8A 5HJ2A 5BR7A 3IQXA 3TJZA 3R6DA 5AHRA 4JXXA 1DO0A 3G68A 4HDMB 4BGEA 3OLCX 3CZCA 3EDRA 3TXAA 3U31A 3LBAA 1H6AA 3ONEA 3P9SA 5E4JA 3VH4A 3RT9A 1SBHA 3VU0A 1ENOA 3AG5A 4OQZA 4X20B 2ZM5A 1Z4MA 3LLSA 5F2KA 5MFZA 2Q3DA 2PUCA 4EG4A 4MW2A 3EG9B 5JARA 4TUYA 1K92A 1M1NA 1XD8A 1QGAA 2FPRA 2HXYA 2YVKA 4HAOA 1RLIA 2P77A 5ITZB 1LBIA 4D56A 1OYYA 3C3WA 1EG7A 3P0JA 2RHLA 4HYEA 4G25A 1BCSA 5NLLA 3RROA 4IH4A 1UP6A 1IN5A 3QE3A 3OZ7A 4DSAA 1P2BA 4NHEA 3FHJA 1SB8A 1GNQA 3PNKA 4PC3A 2BHRA 2ACVA 4KL8S 3EMBA 2HMUA 2UV8A 1C7IA 2B4TO 4HVCA 2DG2A 4D6PA 5KPDA 5BW8A 2AZTA 3EXEB 2ENWA 3VZRA 1GEGA 5I3CA 1EX9A 2PLNA 3OOEA 3H16A 1FLDA 3FLEA 3V1LA 2XIJA 3GT0A 4TWAA 4IJVA 3CM0A 5H9WA 3FRIA 3WK5A 2GCEA 1TVEA 1XXLA 5DHTA 1F1JA 3OJWA 2VCYA 3I62A 2PS9A 1T2EA 1Z0JA 2YUIA 4BJHB 1QPZA 4C22A 4OIFA 4YUVA 3TWOA 5HJ7A 4WNAB 1JLMA 2H06A 3IHKA 3O38A 3DZ8A 3MCVA 3AUSA 3SYRA 4GGOA 1G8AA 2JFOA 3WGZA 2QRUA 1D4FA 3H04A 2YZ7A 4JC8A 4GM0A 3M1LA 3ZE6A 2IW1A 4JJ4A 3A9TA 5CIWA 2DF8A 2AFVA 1AUPA 3NYQA 4C2TA 4FM9A 1SK8A 4MV8A 4TX1A 4TZTA 5TMDA 4Z7OB 3VC2A 1Z4QA 5JNSA 5CTAA 1Y6JA 4GU5A 1LDMA 4TS9A 3R76A 4YCMA 2PUDA 3K6JA 3DXZA 1F2UB 3WP0A 3RNOA 4BFTA 5KC9A 5THKA 3B7WA 2XNDA 3SK0A 2PU7A 1KI7A 3EZ6A 3M6VA 1UADA 2OHJA 5JAUA 1VTKA 5DNCA 1CJTC 3FPLA 2A59A 3JU3A 5EYPB 3SNHA 4HEHA 3UVEA 3L07A 3RYTC 4BAZA 3GAMA 3BJMA 4URZR 1PJTA 4P3YA 4PNPA 1XQVA 4RHYA 5AM5A 1AGNA 4GOJA 1HNXB 1BRTA 4PG5A 4TS1A 1YJXA 4RXUA 2HNBA 4PO1A 1UPXA 3COZA 3G0GA 4V0RA 2PMKA 3ZJ5A 4KDEA 2JI9A 2CVZA 2ZCVA 1KI4A 1X7YB 3C6KA 4P5EA 4JB8A 2ZWIA 3EGXA 3LPDA 1OR8A 3CPJB 2XIQA 2AXQA 4X93A 5IABA 2VSQA 3QNUA 4XUGB 1TKAA 2CJXA 4RAOA 4EK9A 5K0LA 3MEQA 4BNIA 2KI5A 2W2KA 1HWYA 2YICA 2FQQA 3STVA 1JHMA 1ORDA 4QX6A 4R7TA 3QKRA 3CE6A 1N8TA 1J8MF 1NF3A 1R0SA 4LIPD 1BSVA 4BECA 1I5EA 1KGDA 1T5BA 5I4CA 5JASA 4KFCA 1E0DA 1SXHA 1KEKA 2EKBA 3L3BA 1IN8A 4PYJA 3EIWA 4YR9A 4IYJA 3UHPA 2PMBA 1NIPA 5EQFA 1W1IA 1N2XA 4D9BA 1I5OA 4QPDA 3F6PA 1MH9A 4V0SA 3ABOB 2HQRA 4P7KA 1PT6A 3TD2A 1NJ8A 4AG5A 2AYXA 2JFFA 1JDSA 4JYPA 4I81A 5TEWA 5IVIA 3W2FA 3HC7A 2GCNA 1BNCA 1NA5A 1L3BA 3IX7A 3V4RA 2AK2A 4D9HA 5E2IA 4D9CA 2AEMA 2ISQA 2GZMA 4Z7JA 1KTVA 2YV1A 1GU7A 4ECAA 3GDHA 1G6KA 5EWJA 4LJLA 5IAKA 3AYZB 1R0LA 3F2IA 4FYMA 2C9CA 2PU5A 4IRUB 1ZEJA 5AKIA 1X1TA 3GEHA 2P91A 5F5XA 4CI0B 3GD5A 1ZSVA 2CLLB 4UOEA 4QNNA 3K1JA 1HT2E 1KVQA 1RAHA 1ZNQO 4JQYA 5ENZA 3IVXA 1N2SA 4CF5A 4QDZA 1A95A 1AIPA 1SVMA 1Z4OA 3RASA 2HT1A 2GYWA 4HQRA 3SS7X 2RJ3A 3X1KA 1G5IA 3TW8A 1ZESA 3JQAB 4ALIA 4JEHA 1QZ3A 3H11A 5IAAA 5HUJA 4KO2S 3H6KA 4KV9A 4NJMB 4A6EA 4YC7A 4FOTA 4DARA 1N5DA 1IPFA 5GZ3A 3K70C 3BL5A 1C1HA 3H8VA 1PR3A 3UQYS 5F98A 2WMYA 1V11A 1VE9A 3HWRA 4KMRA 1JEYA 4D42A 3TZKA 1YZVA 4QWMA 2ZIXA 2ZT5A 2QVZX 3DD1A 1RRCA 2DE0X 2JJ2A 3TH5A 4RKQA 1U28C 3U7QA 2X77A 2HV9A 2IJGX 1AHPA 2HOQA 5AM4A 1GT91 4KLNA 4AUKA 2FOIA 2LW7A 5EIBC 3H4IA 4EZBA 3R40A 1E5LA 2XB8A 2ZJOA 1L4GA 1V5EA 4DILA 5LCXA 1Z0AA 1Z22A 2ZRNA 2F59A 1S2OA 1RM4A 1ARZA 1J2UA 3JQBA 2QD2A 1E2EA 1O6ZA 3HPRA 2R84A 1L4UA 4ZT2A 4F3YA 1R0YA 2DHRA 1ZH6A 4L0MA 5BV1A 2PZBA 2OORA 3EG5A 2N9UA 1VBNA 3C0KA 3JZFA 2JF0A 3K8ZA 1V41E 3E7WA 4IF6A 4IX1A 4M1MA 1CKEA 2FI1A 3L6BA 5JOQA 2FSHA 2CUKA 2P5UA 2XGJA 1K5PA 2PH3A 4FYWA 2HCFA 1NATA 4R05A 3AERB 3QITA 4RV9A 4Q9HA 1RQXA 1I1NA 5BW6B 3FPAA 3WYBA 4XTCS 4MDYA 3RIHA 3DKVA 3R3ZA 3HCFA 5E7IA 4DJAA 5GGYA 3IEVA 3ZTWA 1UK8A 3I05A 2AI2A 3RVBA 3FLMA 4F1JA 3W2IA 1K5HA 2ZYHA 4B2YA 4JSTA 4YV0A 4PC7A 3S3TA 1WXIA 2GJAA 5ABPA 1S0UA 2ZSJA 5ALGA 1ZY2A 2VOEA 1QH0A 1U90A 4U2FA 4WI1A 1CTQA 4LG1A 1SJ9A 3FMOB 2ZSUA 4OFXA 1UXKA 2P69A 3HYCA 4P84A 1DAHA 2OQVA 4RORA 1MN6A 2OGWA 2XKBA 4NYIR 1VSBA 2I8CA 1TUBA 3GRPA 4JODA 1KL7A 3PEUA 3QMVA 4B81A 1CEYA 1SUBA 4BO3A 3V33A 3W5CA 2YYZA 1T9AA 2VUUA 2IW3A 2WHPA 1YR9A 3ETJA 3LGAA 3QOYA 4MRNA 4F0JA 1ESDA 1QOPB 1QMGA 2X1HA 3DAHA 2YHAA 5FPYA 2ONCA 1HYQA 1C9DB 1RADA 2G4CA 4P31A 1G2PA 3RGWS 3BXHA 3LVQE 5E3HA 1SQ0A 1TLTA 2PD6A 3PQ3A 1QFZA 4KXLA 4EW3A 1AKWA 2DAPA 2I3GA 2R00C 3DHNA 4TXLA 4WGGA 5ECGC 5GJVC 4QHTA 3RI3A 1B8VA 2NTVA 1T3TA 2O0LA 5ED0A 1A5ZA 2HMTA 2X9QA 4LZAA 2FQ1A 3INYA 3WXBA 1LJLA 4EUKA 2WUVA 1FMLA 4BUCA 2GQ0A 3VDRA 1ZHOA 3PE6A 1JIUA 2YWDA 1NN3A 2W2QA 1XDWA 2W43A 3BN3A 1I3MA 3CLHA 4HRVA 5CBPB 4RHUA 3FF1A 5K99A 1F7UA 1KR5A 4EYOA 1Z4KA 1PGJA 2QX4A 3ACDA 4XM1A 4YEDA 5K8UA 1PQPA 1IJKA 4B3SB 1HBJA 1BH6A 4XEHA 1EP1B 3D1VA 2WB4A 1YZKA 2IV3A 2B7CA 3LL4A 2P4HX 1YB2A 1B8NA 2YBDA 4OK6A 2NPIA 3RU2A 3ZGVA 4D9GA 1C3OB 2XQGA 3KZVA 5ADHA 1JL3A 4FQ5A 3E03A 4PHGA 1KEWA 5BSTA 4HFJA 1SVWA 4F9FA 4MW4A 5EE0A 1BE0A 4B09A 4DCPA 3G85A 4YGYA 4L02A 1IOVA 3K30A 1RP7A 5AOBA 5CVVA 5EJ9A 5H4HA 3V4ZA 2XRZA 4NEGA 1NFRA 1Y7LA 2KWIA 4OJKA 5KTNA 3X3HA 4CDNA 3GFGA 4DSTA 3IKLA 4BASA 2Q4RA 1YB7A 1R2QA 2ZE8A 3EF3A 4R69A 4S1OA 3SXPA 3LHIA 4F5WA 4DUYB 1TDJA 1URPA 1NKTA 2VJOA 2DPXA 2EG9A 3CKMA 1MEOA 4KOAA 1TW3A 4NWIA 1TQDA 1D07A 1NJ1A 3F7NA 3KHSA 3O4FA 1BKSB 4RZSA 4FQ8A 3RODA 4ETWA 4DQ0A 1UXIA 4ZPJA 3EGWA 3Q72A 4HUTA 2FCAA 1XTUA 1CJBA 3GNSA 3CZAA 1NBHA 3G2JA 3I2KA 3L0BA 4HB3A 2ZBGA 4GZ6A 4Z7NB 2GKOA 5CH8A 3P26A 5CDFE 3G88A 1KERA 1GZSA 3EVCA 3Q2KA 4WZAE 2C7OA 2NU6B 4TTAA 2FETA 1X38A 2CJPA 4QUGA 3IILA 2DYKA 1GQRA 3IV6A 1G3IA 1U0JA 2FPPA 3A0RB 3E82A 6CHYA 4B3GA 1A9PA 3PRJA 3SPXA 2NO7A 4P53A 3TQHA 2FK8A 1Y1LA 3UMRA 4FEYA 1DCMA 2G9VA 1HSOA 2OL4A 3L79A 3VYUB 2VEDA 4CMEA 2OCAA 4ZZ1A 3QPWA 1D6NA 2CVQA 1TJNA 3AUFA 1AX9A 3EFBA 3EVAA 3LX6A 4UNIA 3M89A 4WV3A 2UAGA 2BMVA 1NONA 2HPZA 3O8BA 4K9OA 5EHIA 3NHPA 5JVDF 2ZVPX 3IBSA 1XDUA 5FBRB 4UTXA 2GBLA 3T3PB 2PFKA 5BUQA 1AK2A 3V5NA 2R2GA 2PYDA 1QGED 2VNJA 3KB8A 2HJGA 3A1TA 3AR5A 4H0NA 4N3GA 1XKLA 4ZC8A 5FX2A 2Z8YM 2NW6A 1DTSA 2W6ID 3OFSA 3VSEA 2BF4A 4ZZ3A 4JY7A 2EF0A 4DIUA 1P1CA 1GUFA 4YCNA 4LISA 5JH7A 1ZM2A 3IMEA 1DDGA 1ABEA 3QI2A 1PT8A 5JAOA 5JNVA 3BYZA 4XD7A 3O84A 3TLXA 1QIFA 5FT9A 2VIIA 1TNDA 4QECA 1FQOA 3HSSA 4ZO8A 3IRVA 3TOVA 1UIMA 2HV8A 2IYOA 4XUEA 1MQ8B 3PCXA 3PEEA 3UJBA 3VNRA 1E1NA 5C52B 5ALHA 4IS3A 4U7FA 3TZ6A 1SHZA 2I67A 4E11A 1LF0A 3K1ZA 3E7DA 4AZTA 3MJHA 1Y7IA 4JNCA 4HXYA 4CQLA 5IVDA 3CGGA 3ADPA 2R1TA 5C7OO 1N0VC 4HEA6 5IJXA 4UARA 1EZ1A 3Q10A 3UM9A 4PC2A 4IXTA 3WSVA 5EP1A 1KZGB 2J9ZB 1J8DA 2D8AA 1S8OA 1ZIYA 3WS7A 5BSVA 1UMBB 1LLFA 1V2HE 3W8DA 1L7PA 3ANLA