5FR1A

Double acetylated rhogdi-alpha in complex with rhoa-gdp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
190
structure length
184
Chain Sequence
IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQASGCLVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSFORMING PROTEIN RHOA
publication title Rhogdi Alpha Acetylation at K127 and K141 Affects Binding Towards Non-Prenylated Rhoa.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 62
structure length 184
sequence length 190
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fr1A00
4HLUC 1CRPA 1PLKA 1WE2A 3AUYA 1IOZA 2WJYA 1WBBA 2ZJ5A 4FWIB 4B73A 4BLTA 3FHTA 4E09A 5JZVA 1OPXA 1VTKA 5K8TA 2BMEA 1T6NA 2HCBA 4NCIA 5EZ5A 1YRAA 1ESNA 1RE0A 4GMDA 2MMGA 1N2CE 1L7VC 1XP8A 5DLQC 4KYUA 4D4JA 5IT5A 2PJRA 4DSUA 5FPYA 1DBSA 1E1RD 1LF0A 1UBFA 3RC8A 4EPXA 1OXVA 1R0WA 2AL7A 3LO5A 1KOFA 4LJ7A 4JLJA 4QGAA 1JR3E 3A36A 1T0HB 3OZXA 4A4DA 3C7KA 3C16C 3GLGA 3IEVA 4M21A 5BN4A 3ZDQA 1VIAA 3GLFA 2J0VA 2ODBA 1E79A 2JDIA 3PXGA 1DAHA 2JLZA 2J41A 3L0OA 3TKLA 4BFZA 3IHWA 2NO6A 4WBSA 5LDDC 4LHZA 2D7DA 4G01B 3K70C 2XXAA 2HXSA 3CR8A 3K9GA 1TNDA 2WIBA 1YR8A 4YONB 2Z4RA 1KDPA 2QPAA 4MYTA 2IYSA 4PHGA 1G4UR 4EIWA 2FEMA 4DDUA 1CP2A 4M2LA 1W4CA 4WA7A 4AKEA 3QG1A 3N70A 5FFMA 1VIYA 4GDFA 3B85A 3X1YA 3U61B 3AP3A 3MWKA 1MRNA 2BEKA 4CGZA 3NKVA 1NN1A 3UPUA 1Z3IX 4NYIR 4JLPA 1Z63A 2X2EA 1XMSA 1HQYE 2OO7A 2XSZA 3RLFA 4HUTA 1K8RA 1E69A 3OE7D 3AVTA 2P65A 4L9WA 5AJXA 5SZIA 5SZKB 5AUQA 4D0NA 4IJMA 3JVUA 3ZH9B 4URVR 1AJEA 4V03A 2RB4A 1N5JA 4LCBA 1ODFA 1AGRA 2ZM5A 2FX3A 3SDZA 4HAVA 5CLLA 2J0SA 4BEBA 4Q1FA 1P2VA 5TARA 1W0KA 2BHRA 4HDCA 4US1R 5AJYA 4DJTA 2PMDA 2X77A 2H18A 4Q9LA 3K0SA 3B6EA 3PEUA 4Q00A 4HB0A 1F60A 1SXJB 3HP1A 2W2VA 2WJIA 3JVVA 5EE1A 2Q3FA 5P21A 3AH8A 2C9OA 4B2IA 5HR5A 3W9YA 2BCJQ 2WICA 3ND8A 3DKVA 3UWKA 2VP6A 2FSGA 3OEED 3I61A 1RJ9B 1DELA 2HV8A 3PEYA 1XNJA 5C4GB 4A0GA 4EUNA 3DO6A 2R6FA 4ZIRA 4YDSA 1EFTA 2IS4A 3SQXA 4UJ3A 1KO1A 1OH7A 1G8HA 2G83A 3X1ZA 4OHVA 4Z8XA 4PFSA 2AXPA 1KMHA 5EXSA 2KWIA 521PA 4GL2A 2VSOA 1W7AA 5CB6A 4YMUA 1Z0AA 1ZM3A 3CZQA 5DO9A 3Q85A 3SZRA 2P6RA 1YZNA 3SQWA 4OK6A 4CVNA 4R2IA 5EZ6B 1L2TA 2D7CA 3SJAA 3R9IA 4MYCA 1JXOA 2CHQA 5FTMA 2N42A 4HB4A 4KBGA 1J99A 3EIEA 1D2NA 4AK9A 2DBYA 3FOZA 1Z6GA 2JJ8A 4L9SA 3QF4B 5LB4A 2HXYA 2Y8EA 3GLGB 1GL6A 4BWYA 2ZREA 3RANA 1CF4A 4ON9A 2CLSA 1E9EA 3QQ5A 4OQFA 4NU0A 2JLRA 1SHKA 1CR1A 1GP2A 1OSNA 2W2TA 1RIFA 1T8UA 3ONWA 4G1UC 2FPLA 2G0NA 3B1WA 4US2R 1VCNA 3VU9A 2XXAB 1ZP6A 1SXJD 2EWVA 4FI3C 1OYWA 4LUCA 1Z29A 2DYKA 2WHXA 3B2EA 3UIEA 1RW4A 4C7OB 4FMBB 2LKCA 2H16A 1AZSC 4CDGA 3CPHA 3W8RA 5KSPA 3ZD7A 2FN4A 1SGWA 4D0LB 3WMFA 5H1YA 1F5NA 3G82C 1IN5A 1N6NA 2AK2A 2ZITA 4QJ5A 1XEXA 2LKDA 5C46F 1N25A 4PSKA 2OV2A 1XWIA 3TGPA 1S9HA 5SZHB 1YRBA 4Q02A 1A5TA 5KDDA 1JQJC 2XOKA 4DHEA 5AUNB 1NMYA 1VHLA 2IXEA 2VP2A 1YZQA 1G3MA 3FYHA 3K09A 1IXRC 1RC8A 1IN4A 2AR7A 3GFTA 3DMDA 4RD0A 3KQLA 3M1IA 1KK1A 1N0WA 3IBGA 2ODEA 3E2IA 3A8TA 1KKMA 2ZRMA 5BQ5A 1G7SA 3U3JA 4GZMA 2YWHA 5TMPA 1KSFX 3RRYA 1DAFA 1M6NA 3RNLA 4B34A 3SJZA 4XOIA 3BAFA 1E2PA 2D74A 4DIDA 2CLDX 4JLDA 4TYPA 3KKNA 4Q7MB 1D9XA 5CITA 4BECA 2BBTA 1E9DA 2YVUA 2VHCA 3EASA 1HT1E 5GJCA 4DEYA 3BGWA 4WAUA 4GT1A 4ZIRB 4DDWA 2IT1A 1D2EA 1DTSA 1L4YA 4HEJA 4NZYA 4US0R 1P6XA 2AFIE 4GRAA 2V6JA 3CM0A 3TSWA 1GWNA 3NBZC 2QEQA 1E4VA 1KMHB 3UKDA 3ZS9A 4DKXA 2PLFA 2Q21A 3I72A 5H8WA 1N3BA 1L8QA 2EWWA 1XMIA 1ZU5A 3C8UA 1CXZA 1UKZA 2MSEB 3QUSA 4A36A 3ZGXA 1KSGA 1ZINA 2OLJA 3I8SA 2ZR7A 2O0JA 1KO4A 2IHBA 1MABA 3LDAA 3N5CA 3K0AB 3SJCA 3VR2A 3WYAA 3LD9A 1LS1A 3MWLA 2IYRA 1XTJA 4PAOA 2G77B 2QU8A 3C15C 3I8XA 2ZIAA 1EFRA 4M0LA 2A78A 4QBHA 1FUUA 1S9DA 1YZGA 1FTSA 3A1TA 1JJ7A 4JT2A 3TH5A 5B64A 1ZUNB 6Q21A 1ZJ6A 1XRJA 2PZGA 2R62A 3CKLA 2P67A 4P4SA 1E2DA 3LRPA 4QBIA 2BM0A 1MV5A 4Z54A 4BZQA 3I5YA 3VU9B 4HAZA 4CYMA 4I81A 4QKQA 2RGEA 3AKCA 4ACBA 5C18A 2GHIA 2PJZA 2C03A 3TSZA 5EQTA 1XD8A 4PZYA 4K8OA 1KI2A 2IA5A 2HT6A 2J59A 1OIWA 2JASA 3VR5A 1IONA 2IEYA 3GJ6A 3RRNA 2GVZC 4PO8A 5JHGB 4M1OA 3T1OA 2C9CA 1UEJA 2QT1A 5AWFC 4DSOA 4Q1CA 3CR7A 4S2EA 5KNCA 2I1QA 3SHFA 4TQAA 5L8VA 3IILA 3PUXA 4CT5A 1W4AA 5IF9A 2D06A 2H17A 1Q1BA 2NG1A 4MH0R 3RS4A 4HAYA 2CHVA 3BFKA 1G19A 1ZIPA 2GWHA 1XD2A 1JBKA 2PH1A 3EAQA 3O8BA 4A8JA 5BN3A 1XTSA 4GSYA 3U7GA 4QHSA 4JS0A 4IDQA 1YZKA 3W5IA 1S2MA 1US8A 4RZ2A 4KU4A 3FHCB 3VHXA 1W2HA 4HAXA 1E2KA 1HE1C 3B7GA 2QMEA 5H70A 3UG6A 2KB0A 4YMTA 4C0KA 2D3WA 3K9NA 3IQXA 1Q44A 4G3XA 2WJHA 1TF5A 3RSLA 4ACAA 5LB2A 4NCHA 1ZUHA 4A8JC 3U60B 2WOOA 3K0FA 4XVUA 1UF9A 2QSZA 1VYUA 2ZAMA 3W6NA 1KI8A 2BKUA 3RDPA 3W8NA 1EFUA 1B0UA 1NN5A 3FKSA 2O8CA 4MRNA 3DHWC 3RC3A 4BFTA 4DVGA 4K81B 4LC0A 3KXLA 4IDNA 1KHTA 3RWOA 4C2TA 3KJGA 3TR5A 1P9WA 3DM5A 3T34A 5JHHB 2RMKA 2YOHA 3GJ3A 2V1UA 1XXHB 4A0FA 4BE7B 2PT7A 5J4KA 2XOKD 1KSJA 1KZGB 2F43A 2RGNC 1Z07A 3EZ6A 1MABB 3BH6A 3QXJA 1MH1A 3LX5A 1MR3F 1XCGB 2CL0X 5KYKA 3WRXC 1OIVA 4IEIA 2GCNA 2ZYTX 3IIMA 2REBA 4DSTA 2ASEA 2RH5A 1OW3B 1Z0KA 2HLDA 1RFLA 3AVWA 3ZVRA 3QY0A 2W6JA 4P4SB 3U3OA 3RS7A 2DFNA 2IS2A 2J9RA 3MWJA 3NBXX 3SOPA 4TTPA 1EWRA 3P20A 3U2QA 4R2HA 4IXNA 1W2GA 2GVDC 4FMCF 4D80A 2ANBA 4IHQA 4RD1A 2ZJZA 3B1VA 5EP3A 5GJBA 1UDXA 4A15A 1II8A 1FUKA 2ERYA 3H4MA 2RCNA 3AKEA 1XCMA 3CLVA 1KO5A 4DT1A 3KJIA 3GFOA 1MO4A 4M4SA 4DRZA 1QHYA 4BQSA 2QP9X 1R5NA 2Z6VA 1ZYUA 5HE8A 1WF3A 2C96A 3AVYA 1E2JA 4NL4H 1NP6A 2QT0A 2QRZA 2X2FA 3B78A 2G6BA 3FDIA 3W90A 1TQ4A 3QENA 1D5CA 1GUAA 1BOFA 2X8AA 3TQFA 1CBUA 1OT3A 2DWQA 3WYGA 1X6VA 5KTYA 1US8B 2P2LA 4GPTA 2IYZA 2ZRDA 5FUWA 1E1QA 4RVCA 2KBFA 4C30A 2XX3A 4MGYR 4IFBA 2XZLA 2ZRNA 1T3HA 2AD1A 2EVWX 3IKJA 1E9FA 1RZ3A 3W3AA 2O5VA 1WA5A 1M7BA 4LWZA 1OXTA 1J90A 3EC1A 3W3ZB 1AIPA 4LJYA 3MFYA 4W5HA 4KVAA 1JECA 1W0JA 4NE2A 3A58B 2NPFA 4NHOA 1YKSA 2GEUA 2ZJ2A 3T1QA 2ORWA 4PR0A 5CLQA 3H0KA 3LBNA 1P75A 3AM1A 4U5XA 3GJ5A 1IN6A 4B2PA 4AC9A 1LW7A 1C1YA 1AM4D 1NY6A 1OB2A 2XNDA 2H92A 3OF5A 1JPJA 1P9RA 1D6JA 3QXCA 4HZIA 2F43B 1E32A 3LXRA 1OIXA 4MKGA 4R7ZA 3PUZA 1KO7A 2C77A 2GJ8A 3EIHA 3GJ0A 4L5BA 2WWHA 3P4XA 1N6RA 2QRNA 3D31A 1NRJB 3L0SA 1SQ5A 2QTVB 3SJBA 3QKTA 4MYUA 3PITA 3AEZA 4PQRA 3GEIA 4XWAA 1OJLA 5FL3A 4QGHA 1CJKC 5J4LA 5E4FA 1S1CA 1A4RA 4NTZA 2L0XA 1RRPA 1E1RA 1FPMA 2AD5A 4MGKR 3P27A 5KPJA 1G17A 1G6HA 1K6MA 4NCJA 4NYJR 1SZPA 1A82A 4GZLA 3ZS8A 2R6DA 4BLQA 3AVXA 1E3MA 2VIIA 3DM9B 3LLMA 4DLZA 4A0RA 3NEYA 4B3BA 3RABA 2QAGB 4X8HA 4RZ3A 4B3CA 3RS2A 3CW2A 5L3RA 2OEPA 5KUTA 3NHBA 2F3RA 1II8B 2J0UA 3SU8A 4LBZA 3P1JA 5FBWB 1IQPA 2MSCB 1G8YA 3FKSD 4Q9KA 4AWXA 4DT1B 5K8LA 1TU3A 3TUIC 2VF8A 2FA9A 1T0JB 1N6LA 3HU1A 3E1SA 4I1VA 1LB1B 2ZYWX 4I4LA 1AS2A 4Q4LA 1NLZA 2ZAOA 3REFA 2NMVA 4QG7A 2FEOA 4TMZA 1HE8B 5BYJA 2B8TA 2R6CA 3KFXA 3X1DA 2IS1A 3W6PA 4JKIA 4QRHA 2OM2A 1KI9A 3CH4B 2GXSA 4PZZA 2G1JA 4DIEA 4KBFA 5AUOB 3TMKA 3OE7A 4ESVA 1YE8A 1F3OA 1NVVR 3GJ8A 3K1JA 3R8CA 2W6JD 2ZRAA 4GP6A 4Q9JA 1Z2AA 2EU8A 4JVLA 2OFXA 1MO3A 4G5QA 2QQ0A 4LPSA 1E2IA 4F7WA 1J70A 1IN8A 5BW8A 1KJZA 4TL8A 1P72A 2LWIA 4LYHA 5CYPA 4E5UA 5E3HA 2FFBA 1WMSA 2ZJAA 5UKDA 3DZDA 1PLLA 1IXZA 4M53A 3A4MA 2B6HA 2QORA 3TK1A 4ZKEA 3QPVA 3PUYA 1SVKA 2P5SA 1Z06A 4B3GA 4HDQB 1NBME 5F98A 1VCMA 3CNLA 3TLXA 2GBLC 1NJFA 1LY1A 2ZANA 4UQOA 5G41A 2OCYC 3WYFA 4EAQA 3GLFE 3PFIA 1SXJE 2QMOA 1S96A 1E2EA 3CX8A 4JLBA 5F9HA 4LBVA 4TL9A 2QP4A 2OESA 4L4UA 4C0JA 2Q3MA 2BJWA 2CEAA 4EDHA 3A4NA 2ZI3A 1AK2A 3ZIAD 3FTQA 4AD8A 2QM8A 4HDOB 3ZZUA 4DZZA 5KPDA 1E1QD 2HEIA 2ZXUA 1E2NA 1PUIA 2W00A 2BDTA 4QBGB 3ZVLA 4G5SA 5JI3E 1T91A 1KNXA 1ZM9A 4MDFA 1F2TB 3HWSA 3G0HA 1S3SA 3FMIA 2YV5A 4LYAA 2DWOA 3AF0A 4KI0A 4W5JA 4YDHB 2DWPA 4G5RA 1M8PA 3SC3A 1U0JA 2RHDA 2NIPA 1JR6A 2IYQA 4CT4B 2GEVA 3BXZA 3DOEA 3L8YA 4DWJA 1P2TA 2J7KA 1DPFA 5CM9C 3L2OB 4M9XA 4MKHA 4KSBA 4PC7A 4PC1A 3HU2A 1BYIA 4TYWA 4C0AC 4EQ6A 4ARZA 3T06B 4FINA 4DEXA 3CF0A 3C5CA 4GMXA 4QJ3A 1J8MF 4O2RA 1GITA 1AA9A 3IIKA 3IPYA 2GILA 1RJ9A 5GJWC 3GLGE 4JSTA 2XNDD 1ZUIA 2CE7A 4LK2A 4G0NA 2OSBA 4O25A 2F1IA 4N0DA 2GJKA 2ZS7A 5J5CA 4PAQA 1KDOA 3AB3A 2BEJA 3CH5A 1W4BA 1VCIA 3GJXC 4PC6A 3C4JA 3KX2A 2ZVQX 3OAAD 4IDOA 1SXJC 3U44A 4KLZA 2WKQA 1UJ2A 2ZUDA 2FDCA 4GOXA 3GFPA 2XZOA 4UNRA 1GKIA 3W5JA 1T8TA 1CRQA 4DCVA 4KVGA 2OCPA 4F91B 1SVOA 2PX0A 4O0MA 5JJIA 3O47A 4KXFB 5AUPB 3JZMA 5LD2B 5JWRA 3V4RA 4R9UC 2QROA 3TBKA 1Q12A 2KSQA 5GADl 2OFOA 3QF4A 2ANCA 4KJZA 4QHTA 5LPNA 2WJJA 1YVDA 3LW7A 3WBKA 5FI0B 3T1VA 2BKEA 3C14C 4H1UA 1XFAA 2Z4SA 2VSFA 4GP7A 3PG5A 3BB1A 4WZAE 1WP9A 4PPQA 4NCKA 1W1WA 4MRRA 2ZR9A 1UBGA 3LNCA 2EFDB 3MCAA 4ZO4A 3RS3A 4RJLA 2ZS8A 1DEKA 4D2IA 2QMUA 4C7OA 2J45A 4RD6A 2A7QA 2EFEB 2OBNA 5CDFA 1E9BA 5ELXA 4RD4A 2JLXA 1EX6A 4B75A 4BLPA 2E9SA 1U98A 2AK3A 3T5DA 2W0MA 5J47A 1NN0A 5JWHA 1G3UA 1S1MA 5FBRB 3REGA 4GOKA 3AVOA 3SYKA 5B58C 2C2HA 4WW0A 3MJRA 1KK0A 3D7MA 1RYFA 3AV0B 4XWOA 1T9HA 2FFHA 2O8DA 4A82A 4D4MA 2GTPA 1ZU4A 2BBOA 2PX3A 3NIBA 1WXQA 3LV8A 1BH2A 1VG1A 2GXUA 4RZXA 4M1KA 1VCOA 1KAOA 3Q9LA 2ATXA 3OESA 4N3NA 4YMSA 1NL3A 1WRBA 2GJSA 2QE7D 2G9NA 1SVLA 2B8WA 4TL7A 4YMVA 5LBIA 2QM7A 1GTVA 3N2IA 4B48A 4EQ6B 1MO5A 3VR3A 4ARZB 1I2DA 3I32A 3T5GA 4FXPA 3H2YA 4DLSA 1PV4A 1TTTA 1PVOA 1C9KA 2KJQA 1XTIA 1ZMXA 1TU4A 2K5UA 2ZE7A 3TUJC 4AY2A 2Q0HA 1NLFA 3NBYC 1GNRA 3BERA 2FPKA 2RGGA 4TN1A 4W5WA 4OHZA 4TTQA 3WP0A 3CUEF 4LJ6A 1GG2A 2H8KA 4LJAA 3B13B 4TMKA 1IHUA 4YC7A 2O8EA 5FR2A 4Q66C 1AKYA 1ZIOA 4PC3A 1DAIA 4PHHA 3G5UA 1YJ5A 4MKFA 2JJ2D 4QNRA 3GEEA 3QI2A 4HZUB 5FUYA 3U44B 1CLUA 2GAOA 1E2LA 4L15A 1YZLA 4F92B 1QHSA 2CDNA 1ZD9A 1CR2A 1KK2A 1G64A 2F9LA 4DDVA 5KSYA 2BBWA 1Z5ZA 3K0AA 1EFHA 3CO5A 1N5LA 1KI1A 3W34A 2EFGA 3BIFA 1RKBA 1E9CA 3R9XA 1FOEB 2WJVA 1R8QA 3ICQB 3BFXA 3K0CA 2WOJA 4IDPA 3B1YA 2WMNB 4LV8B 4TLDA 4WZ6A 4KSCA 4AKGA 1N6IA 2KBEA 1GRRA 3DZ8A 2NO7A 3PR1A 3GLIA 2YC4C 1KMQA 2A2ZA 3CNOA 1E94E 4AYWA 3QIAA 3SFVA 2ZSAA 3BRWD 4BLRA 4BLSA 2G3YA 4TL6A 4IOKA 1E9AA 3KB2A 5E7IA 3EZ2A 3GD7A 2WPDD 4BRWA 4JLAA 4QL3A 5J4YA 2DB3A 2J0QA 2IUTA 5EE0A 3N2EA 1ZD1A 2ZRGA 4LHYA 4FMDF 1Z83A 4P33A 4JT4A 4AKIA 2GXAA 3PENA 2W6ID 1KAGA 3CRVA 3K0CC 4C0LA 1U0HC 1CJUC 2C8VA 4Q1BA 3TSOA 2ONJA 3SBEA 1NVWQ 1O3YA 1VG0B 2V1XA 3NC1C 2G1KA 2O8DB 4B2LA 1U2RA 2QN6A 3Q7PA 1KIMA 2F6RA 1KI3A 2XB2A 3B1ZA 4PPGA 2JLVA 2VL7A 3CX6A 5TY0A 2XJ4A 1GDDA 2E1RA 1JJVA 2GF0A 1C4OA 1OFHA 1P7CA 1Q21A 2JA1A 4GI7A 4MGZR 1H65A 3EC2A 4Z8YA 2XTNA 3W6OA 1WBDA 4F38A 4IXMA 3KTAB 4HATA 4ZKDA 2O8BB 3CRW1 4F4IA 4JJKA 1N0VC 3PCRB 1Y63A 3U7HB 3UMFA 121PA 4EFMA 1KY2A 3K09C 1XU4A 3CBQA 3D6TB 3GPLA 1XJQA 2D62A 5EUQB 2H57A 4IVPA 5DN6A 1COWD 4B32A 2FE4A 4F4CA 3TUZC 2XTMA 4P4TA 2O8EB 1RVDA 3B9PA 2YWGA 3RHFA 4MKIA 1R5BA 1GFIA 1CU1A 4LOAA 1AZTA 2OAP1 5FPHA 3ND9A 2CNWA 4JLOA 2WZQA 4B3FX 2Z0MA 2AHOA 3THXA 5EXTA 4GNKA 2O0HA 4OK3A 2OFWA 3GEHA 4ZCMA 2IX3A 1XXHA 4OKSA 1AGPA 3J81k 2F55A 4JVMA 4XD7A 4UNSA 3AVUA 2GCPA 1LVGA 5JCPA 1D9ZA 1G6OA 2ZSEA 1ELOA 2ZU6A 4RD3A 2F1HA 3BK7A 1QBKC 2XGJA 1WQ1R 1ANKA 3D8BA 2ZQ5A 4DLRA 1SHZA 3EPJA 1Z2CA 2PBRA 4EJSB 1AKEA 3CX7A 2ZRCA 3GLIB 3U4QB 4M1YA 2ZI5A 3B9QA 3BB4A 3TAHA 1DAEA 2P3SA 4O2LA 4XIGS 4Q48A 2V54A 1A2BA 4K46A 1VKJA 3AP1A 3GP8A 1K5DA 2WTUA 1GAJA 2OBLA 1Q3HA 1EESA 1UBEA 1JR3D 5FTJA 1BMFD 3MAAC 4BRUA 1KJYA 4ITRC 2ERXA 5FL7A 3UMRA 3I3SR 2QY9A 1LF5A 1E2HA 2HCJB 2GAAA 3VKGA 3BS4A 4PAMA 4YQFA 1R6BX 3HYTA 3BBPA 4DLVA 1Z0IA 2CHGA 4TSFD 4OI2A 4PXAA 4J0QA 2YOGA 3UK6A 3NEJA 1E2FA 3DDCA 3HPQA 2YHSA 2YINC 3F0TA 3IO3A 3KQKA 1YU9A 2EFCB 3FE2A 2A5JA 2GETA 3AF2A 4X8OA 3WHLA 1XTQA 1ONBA 2ZRPA 1NKSA 4BFXA 2QSYA 5KNBA 2CVHA 4QM7A 2R65A 4OL0A 1UADA 4I1SA 1ZD8A 1UKVY 2QAJA 1VDZA 4N0EA 4D26A 4C0SA 1NF3A 1GM5A 3B82A 5FR1A 1NNEA 2ZROA 3NXSA 4LZZA 4TMVA 2FMXA 4DBLC 1OB5A 2VLIA 5CYOA 4BZPA 4AG5A 1E0AA 1D2MA 1G8GA 1DARA 2A5DA 3Q7QA 4LI0A 4Q7LA 3RWMB 5FBVB 3V4FA 1CJVC 3ZYCA 1X8KA 4TMTA 3MLEA 3KQUA 2DY1A 4DCUA 1OH5A 4JYCA 1FTNA 2BMFA 1TL7C 4Q03A 4C9BA 4LPKA 3QEOA 1XF9A 3MJHA 2WSSD 2Q6TA 4MA4A 3TJZA 5CJ2A 4QJ4A 1QHIA 1TEVA 3QOFA 2C78A 2ZJOA 1CR4A 1YQTA 4RFSB 3FWYA 1CKEA 3KDSE 4TZ6A 3BH7A 1RRGA 4DLUA 2NOAA 2FJUA 4R98A 4DLYA 1G4AE 2CJWA 2I4IA 5EXXA 4LYJA 4L16A 1DVRA 2VP5A 3DEFA 5D3MA 5KDLA 3THXB 3TW8B 1P4SA 2IBMA 4N1AA 4QHYA 3CRQA 4LY6A 5D3QA 3CNNA 5AJZA 1P60A 3K9HA 2XB4A 3WP1B 4ZDJA 1ZCBA 2FZLA 5GVRA 5KU1A 3BC1A 3PUWA 1IM2A 5FOUA 1QF9A 2SHKA 1TQ2A 1QHHA 3O8DA 4F93B 1SVWA 3LVQE 2GEDA 1D8TA 4WIAA 1TUIA 2NO9A 2WBLC 3AUXA 3NHAA 3SFZA 2HYDA 2RGAA 1NIPA 3PEWA 3QKSA 4CEJB 3BH0A 3T15A 5B57C 5HKKD 1E0KA 1GSIA 3AF4A 2C98A 4HB2A 2IHYA 4M1MA 1VYVA 1SKQA 4A2QA 1R0XA 4M9QA 3ZD6A 4A2PA 5DHAA 3QKUA 5HE9A 4EPYA 1PUJA 3TVDA 3FVQA 2ATVA 2ORIA 4OI4A 2QAGA 4ZDIA 3IGFA 4Q4JA 2IF2A 4EFNA 2P5TB 2UKDA 4NPHA 4DSNA 5DN6D 1CTQA 1HQCA 2IYVA 4BPBA 4Z1MA 1EK0A 4Q4HA 2RAPA 4A9AA 4JVNA 2DPXA 5IK2A 1FX0B 3V00A 5FUXA 1P62B 2Z5FA 2CCGA 3PJRA 1AN0A 2CNWD 5A0FA 4V0NA 3A1WA 4D81A 2JIZD 4Q9HA 1U94A 2FSIA 4XSGA 2B7CA 4JKYA 2QAGC 3CRMA 4XD7D 4ZDKA 2J3EA 2AWNA 2W58A 1UFQA 1R4AA 3ECCA 4JBXA 1YHNA 2IXFA 1GKUB 3ZIAA 4CIDA 1KI4A 2JATA 2ZJBA 1OXXK 3BORA 3K53A 5EE3A 1E0SA 2ZRFA 2V7QA 4URUR 1V43A 1Z08A 1Z6TA 4M9ZA 5IRCD 1TAGA 4R71A 4I1OA 1G3QA 2QPTA 4FMDB 3ICEA 1XEWY 1GL9B 1NG1A 4Q19A 4ABYA 2FGJA 2IS6A 4OI1A 5J4VA 1A7JA 1QHXA 1U0LA 2OE2A 2ZJ8A 3NC0C 4RSGA 5FL7D 5E7JA 421PA 1G8PA 5C1BA 2JEOA 2OT3B 4ILEA 1V5WA 2CJWB 2ZR0A 3E70C 821PA 2JLUA 1GZSA 2VPPA 2HYIC 1SVMA 2OCBA 4JLMA 1LFDB 3I92A 5D3MB 5DHFA 4TLEA 4HLQB 1YR7A 2AXNA 3KKOA 4FN5A 5L3QB 2QMHA 4OHXA 3LA6A 3OIWA 2OXRA 1M7GA 3HR7A 1QHHB 4KODA 1XCPA 3IBYA 1GILA 3OAAA 3TRFA 4YXWD 1Z0JA 3DOFA 2BJVA 3K8YA 3LW8A 1P5ZB 1CJTC 2IUSA 3QKSB 1P2SA 2RGCA 1ZC4A 3BE4A 3JZAA 3K0EA 1ZM2A 3TQCA 5JS8A 2C99A 4BFVA 1H8HA 3A1SA 2NZ8A 1Z0FA 2Z83A 3IHLA 1UKYA 1PZNA 4KO8A 1NLYA 4UXHA 1P3JA 1GRNA 2V3CC 1F2TA 1F2UB 1IXSB 4JIMA 2W83A 4D25A 4Q4JB 4A1FA 2EW1A 4TQ9A 3GJ4A 3FFBA 1BIFA 4V0OA 4TMWA 1KTVA 1EX7A 2AN9A 1O87A 3SBDA 3WNCA 3EG5A 4BFYA 4UNPA 4Q4HB 1JAHA 1TUEA 4W9MC 4E07A 3OFNA 4NP6A 3AF1A 1G291 2ZRIA 4Z51A 4MRSA 1U81A 3RSOA 3B5JA 1JALA 1XD9A 2FNAA 1XJ0A 2REXB 2W2XA 3M0EA 1W5SA 4UJ5A 3VKWA 2ODWA 1W4RA 1EG7A 3C41J 4KITB 3NDBB 4Q18A 3ADCA 1AQYA 2RGXA 2WWXA 4CRWB 3DVLA 3S1AA 5KDOA 1LS6A 2PL3A 3L82B 4DC9A 2J7PD 2GRJA 2F3TA 2EQBA 2QA5A 1FP6A 4OQMA 1HYQA 3ASYA 5H68A 3U5ZB 2BM1A 2D4HA 5HZHA 4IW3B 4DXAA 3EZFA 4KFRA 3E5HA 1FQKA 3KQNA 2QE7A 2A5YB 1E2GA 4DDTA 2NO0A 2JLWA 3THWA 2XAUA 3HJNA 5JRJA 2AFHE 4DLTA 3AGPA 5L3SA 3KKMA 5KSOA 3Q72A 3MWYW 1DAGA 4I1UA 1LTQA 1Z8FA 4OK5A 4KFTA 3TE6A 1OLOA 3ADBA 3F8TA 5DI3A 1G41A 3WNDA 2PT5A 2REOA 3FMFA 2P0EA 4NKRA 1BYUA 1UPTA 2YWFA 2AKAB 5ANRB 3X1XA 4Z1MD 2ZJYA 4CEHB 2V8OA 1XZPA 4DCTA 4LBWA 1ZNZA 2VHTA 3MMPA 5IK2D 1NY5A 1G21E 3UANA 3IEUA 2QL6A 3BD9A 4KAXA 5GVSA 1B23P 3QVVA 2JJ2A 2AWOA 5LD2C 2ZPTX 2QTFA 2ZE6A 1BO6A 3GMTA 5KO2A 1TQ6A 2IYWA 2ZE5A 4FCTA 4TZ0A 1ZAKA 1E2MA 3PV0A 4OJQA 2FV8A 2XNSA 1MOZA 1XJCA 1QG2A 4CZ2A 1MO6A 1TADA 1I4TD 1G5RA 1XPOA 1NG9A 5JMTA 5DH9A 3A6PC 3GLHA 4URYR 2W0SA 3T35A 2V7QD 1II9A 1T3SA 1TMKA 1Q0UA 1LV7A 2I3BA 3PQCA 1S8FA 4LGMA 4V0MA 1Z47A 2FH5B 4EFLA 2FF7A 3LXXA 2V4ZA 5AJWA 1IJEA 4TQUS 5DI9A 3WY9A 2ZYVX 1G5TA 1OF1A 2YC2C 1EWQA 3BJIC 4MQBA 4XSHA 5DNYB 2WPDA 1F6BA 3QJYA 2Q9AA 1CJMA 2O0KA 2OXCA 2ZE8A 2IWHA 2ZUCA 4RCYA 3WXMA 1KDRA 3DPUA 2HDNB 4JVSB 4EPWA 3LAWA 1FZQA 3B60A 4NH0A 4RKFA 2W6IA 1R7RA 1JEDA 3H84A 3MUFA 1OYYA 4YMWA 3ADKA 3S1AB 4QFMA 3PEVA 5FOVA 1W36B 4PHTA 3WNBA 1KI6B 3F5FA 1IAQA 1L4UA 3IDQA 1U90A 5JWOA 4HYYA 3CIOA 4HZUA 5JI2E 4LHWA 3EPHA 5CDFE 3EIQA 2MMCA 2GXQA 1A2KC 3FFAA 3RRMA 4FMCB 4II7A 2DR3A 2VO1A 1XX6A 4Y0AA 3OIYA 4Q7JB 1TF7A 4LV6A 1H8HD 4C3ZA 1DOAA 1HA3A 4LBYA 4IDHA 3KJHA 5CK4A 4EPRA 3THWB 2NZJA 2VP9A 3KL4A 2BWJA 5G53C 2HT1A 2WSMA 3F3YA 5L3SB 1HV8A 4WZBE 1MT0A 2QBYA 3TAUA 2GZHA 1CULC 3LH5A 4BASA 3CPJB 4ZI2A 1IY0A 5DI3B 4RFVA 2WV9A 4BFSA 1QVRA 1NMXA 5TXGA 5A5GA 4MRVA 2UVQA 1NJGA 5FUVA 3P4YA 4LRWA 2P6UA 1XPRA 2IW3A 1COWA 3OFND 1OFTA 1WCV1 3PUVA 1ZW6A 4A92A 1DS6A 2WKRA 1M34E 3B1XA 2UZ3A 2YKGA 4YLGA 1U9IA 3TR0A 3ZZTA 4HAWA 5EP2A 1TPZA 4CF7A 2WAXA 1ZRHA 3NG1A 4PX9A 2GF9A 2FG5A 2IYUA 1Q1QA 4NMMA 4RD2A 1J8YF 1DE0A 1W36D 4QXAA 4DLWA 4PZLA 3RYTC 3GLHB 3IO5A 1Q1EA 3U3KA 2VQSA 4IOMA 2MSDB 2B92A 2B7BA 3T12A 5C4MA 5JEDA 2VF7A 3VQTA 1M7HA 1FW6A 2NO1A 4PHFA 3QNUA 1RRCA 3EARA 1M2OB 4QBFA 3DMNA 1U9IC 1G16A 2V55B 3X1WA 3UMSA 3EPKA 3KTAA 2Q3HA 1HY3A 2FWRA 2QP3A 3SHWA 1W47A 2JLYA 1BS1A 2XTZA 1FFHA 2O8BA 2IUUA 1DG3A 2BVNA 4IEEA 1OXUA 2VHUA 4M1TA 3U6BA 1GNPA 1JR3A 1BMFA 1R0ZA 1WDTA 2VBCA 4XTRA 2GK7A 2JCSA 2ZRLA 1YZTA 2QGZA 3AKDA 4LC1A 3OIUA 2ZU0C 3THOA 4ASUD 1IY2A 4XJXA 2FZ4A 5EXPA 2YWEA 1JAIA 3NTUA 3C5HA 3GLIE 4PSAA 4P0TA 1ZBDA 4TSFA 2VHJA 4I99A 1GL7A 4P3YA 2D2FA 1BKDR 1G7RA 2E87A 3SI7A 2FPMA 1JB1A 2D2EA 2ZRHA 3GLFB 1I4LD 1JPNA 2R6AA 3AVPA 3WMEA 3VTKA 4HLCA 2QQEA 1X8JA 2IXGA 2YJTD 1HUQA 5JJLA 5TB5A 3FB4A 2QUZA 5KHOC 1J2JA 1X1RA 2IL1A 3I5XA 3AVQA 1FNNA 5DSZA 4HB3A 2R6GA 1OH6A 4D4LA 2GJ9A 1W46A 2KI5A 2BMJA 3LFUA 1Z6AA 2C5LA 3PIRA 1AS0A 2RKOA 3VHLB 2ECKA 2ODNA 2RGDA 4H1VA 1FMLA 5DE3A 3VNUA 2QTHA 4Q7KA 2GK6A 4HUQA 4AYXA 2QBYB 3SEAA 4DUGA 4IKEA 4EJSA 3SYLA 2GA8A 4TT3A 3QKRA 2J5XA 5DYGA 3U4QA 2DHRA 1T4GA 4Q4AA 4LJ9A 4HAUA 2J87A 2VYFA 2WSSA 4KFUA 3K70B 2R8RA 1VPLA 4TWZA 1S3GA 1XMJA 1R5OA 2OILA 4JL8A 2IWRA 2VHQA 1ZC3A 2WKPA 4POAA 3CRRA 4PQFA 5E95A 5FTKA 5G40A 2WWIA 3A37A 4PSVA 4Q1AA 3U3RA 5DIFA 4W7SA 4H9GA 4F4JA 4WXRA 3HR8A 3AQ4A 1ZVQA 3ZJYA 4TYNA 1U8ZA 1SKYB 2Z43A 1E4YA 1F48A 4NCNA 5FPKA 1NBMD 1YR6A 4EJSC 4URXR 3EW9A 4OI0A 1K5GA 3AP2A 3VX4A 2X1VA 3VR6A 1RPZA 2G88A 4LJ4A 1OKKA 1ZNWA 2GZDA 2VSXA 3EZ7A 4P32A 5HTKA 3U7EB 3TW4A 1CEEA 4NYIQ 4JYBA 2CK3D 4QGFA 2YYZA 4C0BA 3I1FA 4NONA 5IDVA 4URWR 5TV2A 2DFKB 1ETUA 1HTWA 2DFTA 2R44A 621PA 2ZI7A 3GQBA 4UKDA 4NYMR 4GFDA 2NTYC 1X86B 5E7MA 1XMVA 2GESA 2ONKA 4Q1DA 1XXHE 4RZUA 1UKEA 1N6HA 2ZSFA 5HKKA 5KNDA 4JLKA 3LQQA 3LWNA 5BWMA 2X19A 1KNQA 2C04A 4V0LA 3BB3A 3FKQA 3R7WA 2V9PA 3A4LA 4E22A 1XB2A 2HJGA 1Z6XA 1G1MA 1KO8A 4ZV4A 2QNRA 5JFGA 3EPLA 5F3WB 1VG9B 3I62A 1VECA 2CE2X 1G7TA 2JLQA 2UZIR 3KFVA 3K70D 2CL6X 5FOXA 3MG9A 1QRAA 2F7SA 3CPEA 4AURA 3KXKA 5CK5A 1CIPA 2XITA 4RFSA 3FMOB 2KE5A 2NQ2C 721PA 3ADDA 3WBJA 4PC2A 1S0UA 2R9VA 2VH5R 3IIJA 2JGNA 1T5LA 2A3RA 4DCSA 4M1WA 4B3XA 2YNMA 2BCGY 2A5GA 4DLXA 3B8HA 4ERNA 5F9FA 3Q5DA 1Z0DA 3KXIA 2JDID 1E0JA 1E79D 2JIZA 3WRYC 1QZXA 3T1TA 2OHFA 3KKPA 3SR0A 2IC5A 2Q9BA 5FPSA 1W49A 2VP0A 4G5OA 4HUQB 2C9YA 4Q01A 2ZI4A 4B44A 3KUCA 3BOSA 1R10A 5FH9A 5FOTA 1J7KA 3LY5A 3QKRB 3V9PA 2FFQA 2VTKA 4Q4AB 1VHTA 4CEJA 1G5PA 4NDZA 4UNQA 5EP1A 1EGAA 3EA5A 1NVXQ 2BMDA 2XSZD 4BUJA 5CIQA 4GOJA 1E9SA 5FTNA 3K9LA 1Z22A 4ZCLA 1NMZA 2CCKA 5FBLB 2YOFA 2R2AA 4ZCIA 3R8FA 4Q9IA 1E98A 3KJEA 4OYHA 1XTRA 1N6PA 4UXJA 4EKDA 1LNZA 2ZTSA 4QNMA 5JBQA 3FPAA 1MRSA 3OIVA 1W0KD 4NYMQ 1JNYA 1Q3TA 1OH8A 2WWYA 4JLNA 2WWGA 1G7CA 3H86A 1UM8A 1RRFA 2HUPA 1GIAA 4TYYA 2A9KA 3M4YA 3PVSA 1JI0A 2ZRBA 3Q3JB 4MGIR 1HURA 2CBZA 1FX0A 2ZI9A 4OQXA 5EP4A 1UDWA 4BFWA 1KY3A 3VR1A 3NWJA 4YXWA 2FFAA 5KSZA 3AVVA 4PPFA 2O52A 4PANA 2N46A 1XEXB 5J40A 4GBMA 2FOLA 4B35A 4KLNA 1U8AA 1E2QA 3OEHA 4DUGD 1G9XA 1X3SA 2ZVPX 5K8IA 1XEFA 1ZNXA 3VNVA 3R7WB 3RVBA 3EWSA 4TT3D 2JLSA 3QXSA 3TNFA 3IQWA 4IVRA 4OJKA 2DCUA 1Z6YA 2PCLA 5HZKA 1NI3A 4TTRA 4B33A 3P32A 4QM6A 3CB4A 2IK8A 1Q1ZA 4XH9B 1S4QA 2ZI6A 4M1SA 1TEXA 4TLBA 2TMKA 2OBMA 4B74A 1XEWX 2QGNA 2FU5C 1W48A 2VP4A 1QHGA 1X8LA 2AKYA 3L8ZA 5JEEA 4MYHA 2DFLA 3MGCA 4OQNA 4TLAA 1JXMA 2ZSBA 2RGNA 1OKKD 1E96A 4IRUB 5L3QA 3UXMA 1VMAA 4A0HA 1XZQA 1T5IA 4B3DA 1NN3A 4ESHA 4AG6A 4B6EA 2CLCX 1R2QA 2J7PA 4JLVA 1DO2A 2WVJA 2YZ2A 4LSGA 5FOWA 1DADA 1HH4A 3NDPA 4E03A 5IHPA 2JAQA 3CWZA 1H8EA 1I2MA 3TIFA 5FBQB 4FCWA 2ZEJA 2IYXA 4QOSA 4Q21A 3SS8A 3EWAA 8OHMA 3VKHA 5HCNA 3T61A 3AF3A 3U7FB 1UEIA 1II0A 4AKHA 2PCJA 5JSZA 3DKPA 3NBFA 3SE0A 2FSFA 3LLUA 2PEYA 2EFHB 1F2UA 4LYFA 3QEJA 4HI0E 2WAYA 1KI7A 2A5FA 2P6NA 2QG6A 4CEIA 4KFSA 5BYKA 2OLKA 3LX8A 2BV3A 2ZSDA 3QXHA 4JBYA 1G8FA 1RYHA 3M6AA 5CIWA 5JJKA 4HLDA 4MRPA 1M1YE 2HF9A 3IPXA 4PQYA 1ZM7A 5DYIA 1CR0A 3LQRA 1Y3AA 5M04A 2XEXA 4DB4A 2VRWA 3CONA 3FHOA 3NH6A 3ZZ0A 4O3MA 4LJ5A 1OHHA 2PEZA 3LBHA 1JQLB 4X8MA 1KZ7B 4OBEA 2AX4A 5B2ZA 2WM9B 4OQLA 1ZCAA 4FW9A 3L43A 3ZQJA 4M9SA 1KK3A 4KHZA 1IY1A 2XJ9A 1Z28A 4IOJA 4D6PA 1U99A 1XPUA 2ZUBA 1FMJA 4JSYA 5BXQC 3KKQA 2RGBA 3IUYA 3X2SA 1DAKA 4UNNA 4U02A 2IYLD 2ZS9A 4ZI3A 4DB2A 3QF7A 1NKTA 4U00A 4A8JB 1XD2B 4Q5IA 5TDHA 4L8GA 2EYQA 3BFVA 4JL5A 2HF8A 2ZRJA 4OHYA 1HEIA 5FI1B 3QE0A 3LVRE 3GJ7A 3U3MA 1YZUA 5GJVC 3Q5EA 3OHMA 3AGQA 2CL7X 5A4JA 2F1RA 2H5EA 4A2WA 2ZRKA 5FTLA 1EFRD 2ZYUX 4JBWA 4DCNA 1KJWA 2O8FA 4B47A 4CEHA 1R8SA 3RS5A 2CXXA 3SNHA 1PLJA 4RY2A 3ASZA 4D4KA 4B76A 3K0FB 1M74A 2WWWA 4M8NE 1TF2A 3EA0A 2GDJA 3CF6R 4XVRA 2QI9C 4OHWA 5KOYA 4RCZA 3A1UA 4KCGA 4WXPA 5JRZA 2O8CB 5J4HA 1IJFA 1FL9A 2JJ1A 3NVAA 5SZJA 3SYNA 2F9MA 2V6IA 1EXMA 4JMPA 4AYTA 1IBRA 3QSYA 3QPWA 4LV5B 2CVFA 5JS7A 2PZEA 3ZVMA 1GOTA 1R0YA 3CZPA 3UWOA 3P26A 5BN5A 2WWFA 3OEHD 3HPRA 2GZAA 4U7DA 3HU3A 4XWKA 2H1LA 1NSTA 5JSZB 1U8YA 1QHNA 1T3LA 2OZEA 1MKYA 5CM8B 3O8RA 4AI6A 1G3RA 1IN7A 1ESMA 1CS4C 4CEIB 3EXAA 1QG4A 4BLOA 1XDBA 4A6PA 3TVTA 5EJEA 3KQHA 4IFEA 4ZDWA 5JECA 5L3VA 1KKLA 1N6OA 1SVIA 5EE5B 5K8UA 3O8CA 1GNQA 4MITA 5HPYB 4P4UA 3QBTA 4TMXA 1G20E 1G18A 2NGRA 5JCZA 1PJRA 1W5TA 2GJAA 1FQJA 3FMPB 4JL6A 3NH9A 1KDTA 3THYA 1QDEA 3BWDD 4QC2A 2BOVA 2WJGA 4URZR 4Y0VA 3MSXA 1N6KA 2F1JA 2GCOA 4PO1A 3L0IB 3EX7C 4FWTA 1DO0A 3ZVNA 1UAAA 1HT2E 4NBSA 5DISB 5F2EA 5G3YA 2N1BA 2WIAA 1EFCA 3VAAA 1XBTA 2I1VB 4LHXA 1KI6A 5HCIA 1SVSA 5CB8A 3KUDA 4C2UA 3AKYA 1XTKA 1OE0A 4G5GA 3VFDA 1UBCA 4MUBA 1TX4B 4LX0A 1Q22A 4B43A 1H8ED 1OV4A 2QPOA 4BEJA 4BZXA 4KYIB 5CJPA 2IYTA 4LHVA 2B21A 3L0PA 4BGDA 5AR1A 5JLJA 4XVQA 4BFUA 1FP7A 4FD2A 4S35A 4V02A 3MRSA 4AIIA 3R9WA 4MDEA 3WMGA 3ETLA 1DG1G 4QGGA 3CF2A 3EZ9A 5DGXA 2BBSA 1OXSC 3HDTA 1FNMA 1NIJA 2IEZA 3GLHE 3SN6A 1W36C 4KV9A 5TVKA 4CW7A 2O8FB 2CMKA 2PLRA 2QZ4A 4ASUA 2HLDD 4V0ME 1WB9A 2QENA 3UATA 5C2JB 2GBLA 2FGKA 4XTCS 4RKEA 2IF0A 2VEDA 1A1VA 1KGDA 1NVUQ 2RHMA 4TLCA 4D82A 1W44A 1E6CA 1Q20A 1E9RA 2G0TA 3QBVA 1OHHD 2IYYA 4JZKA 5FPTA 4C0QC 1P73A 2OUKA 3DL0A 2XZPA 3HYRA 2OAQ1 3QPUA 4WVFA 4Q47A 1GRQA 3OEEA 2WMOB 3A1VA 3Q8XB 4UXIA 2J1LA 1Q57A 1NSFA 2J46A 2CCJA 1KYIA 1I4DD 221PA 4M22A 2H7VA 3VR4A 3WHKA 2VA8A 2HJVA 1SULA 4ZPXA 5AK0A 1TQDA 3MD0A 2PZFA 4NYJQ 3U6KA 4C4PA 5EE9A 3QG5A 4V0KA 3ZLJA 1AS3A 3VX3A 2LCFA 1N5IA 3QVUA 4A6XA 1G3IA 4Q1EA 1X1SA 2GNOA 2GKSA 3H1TA 4EPTA 2BIFA 4FCVA 3LBIA 3RS0A 4LJ8A 1YR9A 3I4LA 5B30A 1GKYA 1ZNYA 2Q9CA 2OG2A 4C0HA 3D3QA 4IOLA 2ORVA 1ZM4A 1QVAA 1N5KA 4P31A 2ZETA 3FGNA 3ZQ6A 1OFUX 3THYB 4PPNA 3GCGA 2BC9A 1VYTA 4HLUA 1GVNB 1N0UA 1E99A 1OFIA 2GCOB 2OCAA 2C95A 1NBMA 4B71A 5EUMA 3R20A 4WOPA 2J0UB 4B6FA 4X8LA 1P2UA 4FIDA 1JEEA 3CWQA 1W0JD 3KZ1E 2FSHA 1P9NA 4MUAA 2CK3A 2PMKA 4PO9A 3RAPR 2JJ1D 1SXJA 5AJVB 3KB1A 3UG7A 1P61B 4EPVA 4TYQA 3I73A 2A30A 4LDJA 4JJZA 1AQUA 3QXXA 1SKYE 1DAMA 1NVVQ 4HSEA 4PTLA 3VMFA 1KSHA 2EYUA 3RRZA 1VG8A 5FOSA 5G3ZA 4IVQA 2NPIA 4D0GA
chains in the Genus database with same CATH superfamily
4IG9A 1D4ZA 3UJ9A 1CRPA 2AW3A 1H94A 2WI8A 3AUYA 3GNQA 5ARCA 4HDSA 3HFJA 2GM4A 3C6YA 2Z3WA 1WBBA 2ZJ5A 5HG0A 3LXMA 3OM8A 1PJZA 1P1HA 3DFIA 5IAKA 1XNRB 2O5CA 1X92A 2COUA 3B6ZA 3EDCA 2B99A 5E9WA 2C2ZA 3M6LA 4E09A 3R09A 1EVQA 1OBFO 1NAIA 4NCIA 2XE6A 1RE0A 1DP4A 2A1IA 4GMDA 4I9FA 4Q15A 1Y37A 2LP4Y 3QEMA 1DBSA 1E1RD 4YRTA 5FPYA 2NZUG 1U4SA 1RU3A 3IT0A 3OZSA 1YO6A 4KWHA 2IZOA 3VYVA 3LO5A 5JCJA 4G6ZA 4JLJA 4HDMB 4QGAA 5FQOA 3GGCA 3UGJA 4JVOA 3OPXA 3L9WA 2DT5A 2E18A 3V32A 3C16C 4JI6B 5KOHA 3KTOA 1B74A 1PHRA 1ZDMA 3ZDQA 1C4KA 4BCDA 2J0VA 4WJLA 2Z6UA 1DAHA 3PRKE 4CM3A 1THTA 1HC7A 1TOAA 3OTOB 4BFZA 3IXQA 3GW8A 1FBNA 4LHZA 4EB6A 3PRYA 4D8WA 2D7DA 5HJ5A 4ZEVA 3S8YA 1IVNA 4RW0A 2ZSUA 2XXAA 3CR8A 1B2RA 1EXWA 1ID8A 4J1TA 3V3KA 4AMYA 5LMNB 1KDPA 2ZJ0A 2RHWA 2B1RA 5HFJA 4QARA 2FEMA 4PR3A 4O1IA 5HXAA 1CP2A 1J97A 4LDQA 4KNWA 3DLHA 4X7RA 1WD5A 1Y1KE 3N70A 5FUQA 4Z3OA 1PJQA 1B4DA 1O95C 4FS3A 3DL2A 4N7BA 5LYJB 4IHJA 3U61B 3MWKA 3FN4A 1JQDA 1XZMA 3T9EA 4F5EA 2QNIA 4R8VA 3PDIB 1L7MA 5JXGA 3WKDA 3ENZA 2ENUA 2PO5A 3RLFA 2OO7A 1BE0A 1ZITA 1I32A 2P65A 3DQZA 3F9CA 3HFRA 5SZIA 5AUQA 3O1HB 5SZKB 3ZE0B 3AR3A 4BMCA 4X92A 3ZH9B 4URVR 1NXVA 3MILA 2RB4A 3WFIA 3ZQUA 1N5JA 2Q9UA 4XYEA 2E82A 2ZM5A 2HJRA 3F98A 5CLLA 5JAPA 3VZCA 1L7AA 2AR0A 3VPBA 3DCIA 4UHCA 3S1SA 2R7MA 4FT4A 5H0IA 2BHRA 4DZRA 5JQWA 3H8VA 1I6KA 4US1R 3R5HA 4MVXA 1PWYE 1DWQA 4HQKA 1XZFA 3V1KA 2H18A 3H11A 1E20A 4JOSA 1ZXBA 2IP1A 4L5AA 5HF5A 1SXJB 3HP1A 2FMKA 4RJKA 2EC5A 5P21A 3M34A 2A0WA 2IZ1A 5TQVA 2B34A 3ESXA 5FJIA 2FPIB 3P2OA 3U0BA 4F45A 1YR3A 1IL0A 1V1RB 2P9YA 1Y6GA 3DKVA 3LBYA 1COZA 3EZLA 3WRWA 4MB2A 5ARDA 4Z7JA 2CT8A 3RYHB 3EXIB 1PT7A 4CI9A 3ROTA 1ZZGA 3PEYA 2CN1A 3PHCA 3DVAA 4HX5A 3LPDA 4JP8A 3WIVA 3HV2A 3VOSA 4C87A 4TYYA 2R6FA 3HC7A 5J2TB 1T25A 4YDSA 1U2EA 2G09A 4P86A 2ENWA 2G83A 1I3OA 2D5IA 3NIGB 3GRFA 4GOOD 3VVLA 3EPRA 5HIKA 1DJPA 2KWIA 4TKMA 4PCVA 3HFGA 1NXXA 5DSTA 1J1IA 2IDMA 1L3BA 3KQPA 5CB6A 5I5EA 1W7AA 2OP1A 1Z0AA 2KX7A 1R88A 3ZR4B 3OM1A 1J8FA 3A6JA 4MLCA 4NCBA 1YZNA 4IO1A 2YW2A 5J58A 1DTWA 3M8KA 3LYUA 4BFCA 4DA9A 4MYCA 4ND2A 2J9FB 2N42A 2UUAB 1J99A 4JD5A 3EIEA 1D2NA 4AK9A 1KEWA 3ZU5A 1UQTA 4MQ4A 3RRBA 1VCHA 4KN9S 3DNFA 2NNLD 4KN6A 4PFJA 5LDHA 5LB4A 3FZGA 3V48A 3GLGB 1UIMA 1YV9A 5HMLA 1ADJA 2NAFA 3HB0A 1J2RA 3WLEA 1EEXB 3ZC3A 1GP2A 3EMKA 4NE9A 1TKAA 2G0NA 3JQ9C 3B1WA 3ZHQA 3NM4A 1XGKA 3BWEA 4WNYA 4LVCA 1HPLA 1QFJA 4N4AA 1DJNA 2PJUA 1RW4A 4FMBB 4S24A 3DBRB 1ECFA 4CDGA 2OTCA 3ZJVA 5KSPA 1E7MA 3FPSA 1SGWA 3NV7A 2JHFA 1SXPA 3WVNA 3ZJ5A 1Z88A 3G82C 4RDXA 2HK7A 2SCUB 1EIZA 5A9SA 5C46F 1N25A 3OX3A 2OV2A 3N8IA 3FJOA 2OAEA 3ORRA 1SHJA 1JQJC 1H0HA 4OHBA 4Q02A 4G5XA 4DHEA 1UM9B 2VP2A 4W5TA 4DM7A 1SURA 3OUZA 3QVGB 3QX8A 4RF5A 3A26A 3W2IA 5JAHA 1N32B 4RD0A 3DMDA 1QF7A 2VWQA 1DSSG 4OPMA 4ER7A 4PZUA 3QKWA 1A50B 4MV4A 3C0KA 1MX3A 2F00A 4KPUB 3F74A 3HR4A 5DGCA 5HIAA 3IBGA 2W8BA 3GCXA 3EQ8A 4DV1B 1PO7A 1KKMA 1G7SA 3RF6A 1JVSA 2H4FA 1IMJA 4YJDA 4HDKA 1HT3A 1V96A 4ND1A 4P82A 1DAFA 4GVLA 3UJBA 3FZQA 4BMDA 3S8EA 3WGJA 5AOCA 4C7MA 1EUDB 4GR9A 2GPYA 2HMSA 2EXXA 3BAFA 4RPCA 1WNFA 5LXTA 1YQWA 3FWHA 5A4AA 2PG3A 3E48A 1WSAA 2CLDX 1SQGA 1QU3A 1NC3A 1PBTA 4TYPA 2XLCA 4Q7MB 3UHFA 4BECA 2BBTA 1DCFA 1E9DA 2A1UA 1IZ7A 1M1ZA 2FB9A 1AXGA 3GWZA 1FYDA 1HT1E 3Q12A 4JT8A 4H18A 5CT6A 2IYOA 2AJBA 2R7LA 2PUDA 4FWBA 1O54A 2I6FA 4Y9RA 5T67A 3CTMA 4DDWA 1BA2A 1Z34A 1S2GA 1CUEA 1HDYA 1NUUA 1P6XA 2LNDA 1MAUA 3UJ7A 2V6JA 3RFFA 4C4OA 3LKZA 3JATA 2QEQA 1G5FA 1E4VA 1X19A 2ZUFA 2X8LA 3IVCA 4BQPA 1RS0A 3H6HA 2X22A 2C8JA 1Y7PA 2FE1A 2P7IA 1CE8B 1XCJA 2BGMA 3TLAA 5IKXA 1FRQA 2G71A 2MSEB 1T8SA 1UMCB 3OTGA 3QUSA 5CT5A 3ZGXA 1FMTA 4A36A 4OHMA 4I8IA 3EQ9A 4BATA 4DV2B 2BMVA 4TVBA 4X1OA 1CRLA 3S27A 1A5BB 2CDBA 1GKKA 2HK9A 4QQNA 3VYSB 2O0JA 4R81A 2VKTA 2ODAA 2W37A 4JOCA 1YBHA 3BA6A 1RWQA 4X7PA 2UZ1A 1MABA 3LDAA 1CLEA 3K0AB 4ZVKA 3WIDA 1UMBA 4XVHA 1YUNA 5AK4A 2G77B 1PR3A 2B30A 1NJ2A 3E4DA 1BWSA 3HJCA 1S9DA 4KWIA 1LNSA 2PD3A 2IOHA 1FTSA 1T34A 1JJ7A 4OGLA 5B64A 1H0SA 1ZJ6A 2R62A 3CKLA 2B83A 1KVSA 3ZBPA 4E2WA 3E3MA 4I50A 5DCUA 1NVAA 1P8AA 2C4UA 2PMCA 2WZBA 1TMOA 1I4OA 2ODPA 2QLLA 5EKSA 3I5YA 1OVGA 1C0LA 4CYMA 1OASA 1YDEA 2BGLA 3R0JA 3CUKA 2IZ7A 2R1TB 5C7IO 2GHIA 4Z4QA 5SYAA 2HMWA 4B09A 5ICSA 3O7WA 2ILTA 1XTPA 1TXGA 2H2DA 3TOSA 3VDXA 3ZWWA 4K8OA 1JA9A 4P98A 1YBFA 1KJ9A 4HDNA 4MIYA 3ZQKA 5ES3A 5ILOA 1CY1A 2Z4TA 1E8MA 4L5IA 3D1VA 2G5PA 5C8ZA 1EGQA 1CRZA 5JHGB 4N3BA 2BUAA 2C9CA 4OOEA 5C5DA 1M76A 5IG2A 1C3OA 4S2EA 1XZNA 5L8VA 1P19A 1J0BA 1CFZA 1W4AA 2D06A 2H17A 3NBKA 2NG1A 5K0TA 2DLCX 4YP0A 2C94A 2CHVA 3BFKA 2VBGA 3FUUA 4FYMA 1XD2A 1JBKA 2PH1A 5BN3A 4YT8A 3U7GA 3EK2A 2YMPA 4QHSA 4WD3A 4JS0A 2I33A 5ECWA 5FO0A 3NRJA 1WULS 2QL7A 3PNKA 2H59A 5JAQA 4EI8A 1W2HA 3CLTD 4HAXA 4U9IS 5FO1A 1GNVA 1ZMRA 2QMEA 5H70A 2KB0A 3AR6A 3LT5A 2HZ7A 1NBAA 2X1MA 4BO0A 1PT5A 1VLHA 2RBGA 4M86A 3IQXA 1FBTA 2PX2A 1PIWA 2CJYA 5TGZA 1RZRA 1TF5A 3MRVA 3RU2A 3CLRC 4XM1A 1GZ5A 3D5QA 4QUKA 3O2SB 1T2UA 2WOOA 3K0FA 1TVCA 1UF9A 4XVUA 4YCSA 4C5CA 2QSZA 1B1AA 1QUFA 3IAHA 3LOQA 4J0IA 3W6NA 2HW8A 4EHIA 4IMPA 2OR3A 1EFUA 1B0UA 4CLRB 5BW5A 2J67A 2IH4A 4MUKA 3AY0A 1PS9A 2ON6A 4EL0A 1QPBA 4BFTA 4K81B 3KXLA 1KPHA 4C2TA 1UKBA 4D9FA 4BV9A 1JHZA 3DM5A 3VXKA 3GJ3A 4HGZA 1JSCA 1X7YA 5AK3A 1O77A 1SUIA 1EXNA 3A06A 2PT7A 5T6MA 3WA7A 4HV4A 4K6KA 3KQQA 1MB9A 2QKYA 4BKOA 1UDRA 2FP3A 3RSZA 3UJ8A 3QXJA 1MH1A 1L6RA 1LJUA 4PS0A 5JVDF 4LMRA 3RRFA 1CY6A 5CVUA 2QTVA 3ORFA 4TZTA 3AW9A 3NWBA 1NC1A 2GCNA 2ZYTX 5DGHA 2REBA 2YBEA 4S1TA 1BRTA 4DSTA 6ADHA 1E5DA 1OW3B 2YMMA 1DXHA 1U0OC 3MF4A 2HLDA 3ET4A 3H7IA 4JYMA 2M6RA 4JLWA 2RDMA 2ZLBA 1DDIA 2JBAB 1XG5A 2C2MA 5EGNA 1FRNA 5MHTA 2V65A 4DNOA 3I2KA 3O94A 4DRXA 4G0YA 4I4CA 3VHQA 2JVKA 4L3WA 4D80A 2ANBA 3OZFA 4IHQA 1E2BA 4EY6A 4PGAA 5EP3A 1BCSA 2VRBA 1IY8A 3GVCA 3ITEA 1YRHA 1F1BA 1U2DC 3P9ZA 1BGXT 1GTJ1 4JCOA 3KQSA 3MOSA 3DE1X 2Z2KA 1GXSA 3AKEA 1XCMA 3CLVA 3FSEA 5DWQA 3WGOA 3CMMA 4G56A 1QHYA 3TRDA 3I6MA 4QYIA 3G7NA 2C2BA 4DRZA 2I4NA 4EF4A 5K01A 1WF3A 2C96A 2EFJA 3VDRA 1GPYA 1RAFA 1Y9EA 2FW0A 2QT0A 3JZFA 4EW3A 2AE2A 3GG2A 4NBVA 3IE2A 5CMLA 1TQ4A 3QENA 4QWWA 1BOFA 4H77A 1VSVA 4MEBA 3ZJ4A 4BVJA 4UCQA 1CBUA 2HK8A 3HCFA 3DKKA 3O2NA 4GX2A 2DWQA 4Q3AA 3STXA 3WYGA 4PLZA 3LGSA 4V1CI 1IBMB 4YI3A 1UFKA 4K6CA 1DHTA 2QUHA 5BMVF 3WWPA 2PK3A 1SOMA 2ADOA 3FUXA 4IICA 4O2BA 4BMXA 2KBFA 2W6ZA 4F7DA 4RH3A 4C30A 1OD6A 1T2FA 2AD1A 1UMKA 2GMWA 4WINA 5LJLA 2FZVA 4F9EA 1X2EA 3INGA 3JWJA 1RZ3A 3L01A 4LRSB 4JUCA 5IVKA 4OYLA 4UREA 1XFDA 4ZV9A 3HWWA 2F62A 1J90A 3DJYA 1O03A 4BVAA 2YUTA 5AKGA 4MVJP 1GGVA 2VJKA 4G81A 3W3ZB 2I7VA 1DKQA 4LNUA 3A4YA 3K1AA 3ISJA 4JH0A 4F4HA 3DVRX 4AFNA 1GQYA 3CEPB 2NPFA 2W93A 2JIPA 1B93A 1FY2A 1L7RA 5HIMA 3ZLUA 4BU1A 4EMSA 4Q3EA 3H83A 5HRAA 4PR0A 3FI9A 3H0KA 3PRHA 3ESCA 1E1MA 2J85A 4Y30A 3WS7A 5MN5A 2J5QA 1LW7A 4AC9A 2GERA 5LA6F 2XNDA 2H92A 4NAHA 1DX4A 4HGQA 1P9RA 3UAVA 4OHCA 4HZIA 2VP3A 2NV2B 3WLOA 2F43B 2DPHA 3ND7A 3TQTA 4P0QB 2GJ8A 1OTHA 1R9MA 1BHO1 3NB0A 3G9QA 3HG7A 2FQWA 2WWHA 3O3MB 3P4XA 1N6RA 4X20A 3D31A 5AP9A 4EY8A 1KYTA 3SJBA 3TCNA 3QKTA 4U9UA 4HS9A 3PITA 1E92A 1VA4A 4XWAA 5EHXA 1PZGA 1IZ8A 1TLTA 2EW2A 4HFRA 3E9MA 5FL3A 2E2WA 3ZKWA 1V8PA 4IWXA 3S6JA 2ID9A 2IGTA 1M0EA 4Y9UA 1KR5A 3KJFA 2P9HA 2XUAA 1A1SA 4MGKR 2RKBA 1K6MA 3AHJA 4TWIA 4V38A 4Z99A 4XW2A 4HN4B 1A2OA 1A82A 1H85A 1QGED 1I80A 1XIVA 2BJHA 2R6DA 3EGDB 2Z5LA 4JFRA 3DV2A 4P2BA 3TZHA 4EZIA 5JU6A 3LLMA 5AKZA 1U7WA 4O4JB 3CW2A 3IVGA 2OEPA 5L3RA 3ZCVA 5KUTA 1DKRA 3NHBA 5BSUA 1QV9A 4AJIA 3CJQA 1UZNA 4H6XA 2GB4A 4HPWA 3G0IA 3MC1A 3GZTB 1IQPA 3ILHA 2MSCB 1C3JA 4OM8A 3NUGA 1G8YA 4E2FA 3GAAA 3HQ4O 3SX0A 4DT1B 5JXJA 1FJXA 2VATA 1LLDA 5K8LA 3TUIC 1XJWA 4RMNA 2O3SA 5T4BA 5CA1F 4FE7A 4WFKA 1NX6A 3HU1A 4I1VA 2ZYWX 4P5EA 4Q4LA 5KYYB 1MIOA 4Q6BA 3REFA 1WF6A 5FI1B 1JLMA 4ENPA 4HWRA 2FEOA 5BYJA 1RTTA 4A16A 2CV2A 5AW0A 2B8TA 2QB5A 3LQ1A 5C81A 2R6CA 3DSRA 3FUWA 4ND4A 1FXSA 1RJWA 2IS1A 4QRHA 1YZHA 3V9AA 2E48A 3CH4B 2GXSA 2YN4A 1GGKA 1LBTA 5AUOB 3TMKA 1K5PA 1YQ9A 4UHBA 1NMEA 2CFSA 1YDWA 2VAXA 5B3AA 4UW9A 2J6CA 4BPRA 3T5AA 4UZFA 2W2PA 1EFAA 4ND6A 5ALIA 2AEEA 3SX4A 2Z98A 4IWNA 4R9NA 1YE8A 1F3OA 1CR6A 2VT6A 1Q7CA 3B7WA 1RLJA 3GJ8A 5FI5A 2J3JA 3COZA 3PUJA 4DG5A 2GS9A 5BSMA 4GP6A 3GP5A 3FPGA 2R84A 1W94A 2VBFA 3AM5A 8ABPA 2R8PA 4LPSA 4OB7A 1E2IA 4MVCA 1DX6A 1JW9B 2XUPA 3VZRA 3OOJA 4F7WA 1J70A 3EGOA 1VMIA 2QV7A 1ZVJA 5BW8A 4BNVA 1O0CA 1LWOA 4BMSA 1RQGA 4RC9A 2QD2A 2FZCA 4Y67A 3KVYA 3KOMA 3EXHB 2KHZA 1DL5A 1QONA 1FFBA 4ZKEA 3QPVA 2ISCA 2P5SA 3U17A 4K9RA 1NBME 2P6MA 3CNLA 3OVMA 3RVOA 3TLXA 5I9LA 1LY1A 2P6PA 1JDVA 2ZANA 4I4NA 5IMBA 3VUFA 3U80A 1TKCA 3PDCA 4MVJE 5G41A 3NBUA 4D92A 3WYFA 1THZA 3IAFA 2HSJA 4YO8A 1WEHA 2XYPA 3W5BA 4TV8A 1FSZA 1Z4OA 4LNAA 1IUOA 2YWDA 4EF6A 4EARA 2QP4A 3J7TA 4L4UA 1KJJA 3II6X 5HS6A 3SKXA 4EDHA 2PS1A 3SZ3A 3TPZA 2BISA 4GG1A 3VYWA 5EC8A 1PBNA 1RXIA 2H5LA 2QM8A 1KYVA 3ZIAD 4AD8A 3FCEA 5GINE 5KPDA 2HEIA 3IEXA 3L6RA 2ZXUA 5KYXA 4G0VA 1Y80A 5ALUA 3ZV4A 1PUIA 3C45A 5LZ4A 4WH0A 4YCDA 2VDWA 1QH8A 3C7TA 3CF4G 2V4UA 1TW3A 4LF6B 5ALXA 2ONYA 5IANA 3FMIA 4D44A 4QULA 3WLKX 4F8JA 3G0HA 4TLLB 3F1KA 3M9XA 5KOJB 4HT3B 1Y8CA 3AF0A 4KI0A 1RZVA 2FRXA 4W5JA 2DWPA 3NEPX 1P44A 2WJ4A 1NVEA 3EH2A 2IYQA 1JR6A 4CT4B 1P3DA 2FF5A 2PUWA 3I30X 2GEVA 3BXZA 1EK6A 1NUAA 3DOEA 3L8YA 1ZSNA 5JRDS 4M9XA 4MKHA 4N0MA 3L7AA 1DKMA 4CL8A 1HLDA 4LJRA 4EQ6A 1L6IA 5EMHA 4ARZA 3NPMA 1JMYA 3KVOA 1P33A 3C5CA 4ZT4A 3CX4A 4R9RA 3UXEA 2FR8C 1GITA 4O2RA 4ZC8A 3IIKA 4CMEA 3IPYA 2GILA 5KX5F 5GJWC 2B1IA 4HQNA 2XNDD 4GZ3A 2DG2A 4BO7A 1ZUIA 2HB6A 1QC5B 3JQAB 1BXRA 2WAAA 1O5OA 4V0RA 2ZS7A 5J5CA 3W5DA 2AJCA 3UENA 1ZGAA 4P3NA 3TFQA 1G42A 3EQ7A 2EJWA 4MYDA 3CH5A 3EEBA 3VTZA 1VCIA 2QQ5A 2XV1A 1PR9A 1VP3A 2X8BA 4IV8A 4PC6A 1JHPA 4WPGA 3TD9A 3WG9A 4DC1A 4ER0A 3OY7A 4KLZA 1HLPA 2R6ZA 3KYBA 3WKBA 3I2FA 3Q6MA 2ZUDA 4GOXA 1FFWA 3GFPA 3P2JA 2C3YA 4OUKX 4MV3A 3UAGA 3C85A 2Z1MA 3FUVA 1T8TA 4WN9B 3PHIA 3A70A 1R16A 3MCVA 3FVRA 4DCVA 2HPHA 4KQMA 5LMZA 2Q5JA 1BTOA 3G5LA 4IF6A 4LQDA 3ZI7A 2DPGA 1MJNA 2YYYA 1L9KA 1BFUA 1E1LA 3T7IA 4F60A 5JWRA 1TECE 3VNBA 3IDOA 2D3TA 3OCYA 2BM9A 1ODSA 3QF4A 4J6FA 5JQGF 3B3AA 2FVYA 4NJMB 1I8TA 1YVDA 2CFIA 5DOZA 1PF7E 3GWGA 5B3KA 2ZB2A 3T1VA 3KHKA 3FYCA 4KXXA 1BU5A 1DEHA 3C14C 4MI3A 5E9QA 3BB1A 2FMHA 3K92A 4WZAE 2WWVD 4LTNA 2OG1A 2R00A 4NCKA 2JHAA 4MRRA 4ZA2A 1NNI1 5K3EA 1HXHA 1DEKA 3VSBA 4D2IA 4Z5XA 1X7ZB 4IWYA 1CJBA 1FNBA 3F6PA 4Z7QB 1HNNA 2FSVA 3EGVA 4QDOA 1E9BA 4XD2A 4R40A 5IW8A 3TJMA 1SQ6A 2E9SA 2AK3A 4I5EA 1KU6A 2E4YA 2W0MA 3ZKAA 1JKFA 1RTKA 1B16A 3ENWA 5JWHA 5FBRB 4Z7OB 3GFBA 3C3DA 3MD9A 1RXVA 3RHZA 2GN0A 3QVWA 5IBRA 5B58C 1XCBA 4W1PA 2PZAA 3QYFA 5D86A 1ESDA 2JGKA 3D7MA 4PBSA 1XOIA 1FFGA 2UUPA 4MCAA 4UCWA 4CIXA 4XWOA 3L1KA 2CVZA 4RHEA 5DK6A 2WF9A 2MYPA 3TIGA 4A82A 2BBOA 2YJ4A 3H1BA 3NIBA 3D2LA 3QRWA 5BQ3A 1GG5A 1QVWA 2CBGA 1BH2A 1GR1A 2O2GA 2X5KO 3LV8A 3AL0C 2GXUA 1ABEA 2NSHA 4RZXA 2BSAA 3RWBA 1J2YA 2G76A 2BZ1A 2VG8A 1CF2O 2BEUB 4M1KA 4S0XA 1SOUA 1B0PA 1RQRA 2ZOSA 1UK7A 3V97A 1E66A 3EGXA 1WRBA 3I4FA 3GVIA 1VPTA 2B8WA 2C4TA 2Q1UA 3QVKA 3PLAE 2CF6A 1NVBA 5I7HA 2QM7A 1T9GS 1M2VB 2D2IA 3L4BA 3N2IA 4JDPA 4B48A 3COWA 3RSCA 4RHFA 3PK0A 3L4KA 1BMQA 4M0DA 3T5GA 4FXPA 3TN7A 3H2YA 3ZXSA 1C9KA 2KJQA 1PZHA 1B6TA 1TU4A 2K5UA 3JQGA 4FK8A 3HXTA 2Q0HA 3KEFA 2Q3BA 3TUJC 4PYQA 4EHHA 4AY2A 1L3CA 1GNRA 5ALYA 3SR3A 3BERA 2B7LA 2FPKA 2RGGA 3OSZA 1J4AA 3DZFA 3X1KA 4CMHA 4LJAA 1GG2A 5D5PA 2H1WA 5H80A 3AI3A 5CM2Z 1IU9A 1SC3A 2D59A 4NARA 4Q66C 3TQIA 1DAIA 3HBFA 3KOXA 4R1OA 1HZZC 1YJ5A 2PSJA 2OBFA 2PKYX 1E1DA 2WP0A 4LGYA 4HZUB 5FUYA 4YP9A 3DTYA 3UMVA 4F1WA 3U44B 4WUVA 1E7YA 3EWNA 4I55B 1E2LA 1WKBA 2N75A 3I9MA 4L15A 2MYTA 1JBEA 1ZXXA 1FSSA 1QHSA 3KE8A 2PMEA 1C14A 3RC2A 3IAAA 3V33A 3L4JA 1CR2A 1KK2A 4IZOA 2EJCA 4LF4B 1QOZA 2BBWA 4OGKA 3SFTA 4P22A 3MHPA 3LUKA 2W2NA 1K6IA 2Y0DA 4DSZA 3W34A 2BFFB 2EFGA 5DB4A 1BX3A 4ZYVA 1N5MA 1JHQA 1FOEB 4QRDA 3H6KA 3N74A 4RTSA 3K0CA 3ICQB 3B1YA 4G5HA 4WZ6A 4EGSA 4ZHQA 1RAEA 1N6IA 4Y6OA 4JI1B 3W0LB 1YMVA 2BMAA 4X63A 4Y2JA 2OZPA 5E1DA 4OLAA 3QWIA 2DETA 1E94E 5I6DA 3LKDA 5HKBA 2PUAA 2RHHA 2YRFA 3SFVA 3P5SA 1HQKA 3JU3A 1U7TA 1JRLA 1YJCA 2G3YA 3DR5A 4DR6B 4L1KA 5ICFA 2R6R1 3EZ2A 4BRWA 3KR9A 2DC1A 4JLAA 4QL3A 5A4IS 3ZYZA 5AK6A 3GEMA 3FGOA 4GWKA 4KR9A 3TD6A 2DB3A 4AXXA 1ZD1A 3T9DA 2ZRGA 5IM4F 1PTKA 2R0QC 4RPIA 4XGKA 4FFBA 1J9ZA 1OUMA 5ALGA 2YHAA 1YZ3A 3HVUA 1BZYA 4ZOBA 3N75A 1KAGA 4UOZA 4X66B 1LLCA 3WTBA 4LXUA 1U0HC 3OG9A 3ZE7A 4Q1BA 4TKUA 1P4RA 1P29A 1VG0B 4ZICA 1WPGA 4WZBB 3EZXA 2G1KA 2O8DB 4FFMA 3L6UA 1GGNA 1JEYA 3PFGA 3JS5A 2QRQA 2HSWA 3B1ZA 3A3OA 3OIDA 1OX6A 4PPGA 2XB2A 3CX6A 1GDDA 3BHNA 3D9QX 4EJ6A 1JJVA 1V3UA 1C4OA 2IOFK 3DXYA 4GI7A 3BJRA 1H65A 3GN1A 2JS7A 1XO1A 3EC2A 4MGHA 3CW9A 4C7XA 4Z8YA 2IXTA 5JPCA 3W6OA 2BFBB 2J32A 5DHSA 2AX3A 4IXMA 4N8EA 4RZQA 4F38A 1DI0A 4AO7A 2AVDA 4MV8A 3WA6A 2O8BB 4YUYA 5LJIA 4JJKA 1SBQA 1M34B 1Y34E 2MDTA 4P4GA 1XCOA 1N0VC 2EFYA 2HPVA 4JK3A 4KLAA 3UMFA 3U7HB 1KY2A 2V96A 5KJ1A 3RIGA 2ACVA 3CNEA 4X3PA 2HU7A 2CB0A 3AC0A 3D6TB 4XQCA 2N1MA 4OFXA 4IUDS 5AW7A 2FRDC 4IHKA 4WMLA 2XGOA 3IJ5A 2H52A 4C20A 2X4IA 2WQ7A 1OBOA 4IVPA 2VDLB 1COWD 4X85A 3AJ9A 1LBEA 4L50A 4B32A 2XTMA 1NVKA 3HXLA 2CYCA 3V6MA 1QKKA 4D46A 1NM5C 1XAGA 3A6LA 3AOGA 4O4LB 1RVDA 3TB6A 4B5KA 2O8EB 4K2AA 2YHUA 1GFIA 2XB9A 2GEFA 1U7PA 1PDWA 4LOAA 4TRJA 4WDQA 1G2QA 5EKDA 3ZQ6A 3H8JA 5I7WA 2HCFA 1ETHA 4PYNA 5FPHA 2JFFA 2G8LA 3HCRA 3WZ2A 4C08A 2KYRA 1R8YA 3N8KA 4RTNA 2DCMA 4PG8A 4Y9SA 2OFWA 5A62A 2IX3A 3CWCA 2F55A 2V58A 3SLRA 5KQSA 4WXYB 5GIOE 3O8QB 4D8YA 4DBLE 1LVGA 5JCPA 4J0DA 1ELOA 2B8EA 4F6LA 4EY5A 2C2WA 2C2KA 1LTHR 3IMKA 1GEGA 5THQA 2BFOA 3UUEA 4RPJA 3D8BA 3I6YA 3O03A 4D9BA 4IJQA 1JFFB 2PBRA 1URPA 5JNRA 1XRSB 2FEXA 4J76A 1AKEA 2FEPA 3CX7A 2XQVA 5HA5A 3GLIB 3U4QB 4M1YA 1JMVA 1Z8HA 3UT0A 1VJTA 1HYGA 4MW4A 3ST7A 4Q48A 2V54A 4K46A 5H9VA 1NP3A 5LP6B 1PJTA 3GP8A 1K5DA 4M76B 1GL3A 2WTUA 2OBLA 1Q3HA 3IBCA 5FA6A 1E1NA 3A6FA 5DYNA 5A3JA 1EESA 1UBEA 1GZHB 3GAZA 5FTJA 4X24A 1BMFD 5FL7A 3UMRA 2MR6A 3QHPA 3VKGA 4YQFA 2E7ZA 2ZULA 4NIMA 1T35A 1PT9A 1NUTA 3Q0TA 3BBPA 2HSDA 4TM7A 3EEQA 2QI9F 1Z0IA 3Q7TA 4RDIA 2V7XA 2HD4A 4PXAA 1XQVA 3KLNA 4NEHB 4AWBA 2GARA 1OC4A 3PT9A 3TZCA 1PGJA 1PT8A 3OC0A 4I2NA 3EBOA 4AU1A 3W77A 5LP1A 1LJ8A 1B0ZA 2XWQA 4G09A 2BSQA 4X8OA 4EO9A 1YIDA 4U7GA 2FWAA 1GTSA 3UA3A 5K9ZA 1KEKA 4BV3A 4X64B 3GDFA 3PRJA 4QM7A 1BX0A 1UADA 3VI3B 3E1KA 4LEIA 3MBOA 1FLVA 1TIBA 3AOEA 3Q3GE 5J23A 1PL7A 1GM5A 4KUGA 1T5SA 5FR1A 1NW5A 1UBHS 5E1OA 3ABIA 4TMVA 4YGYA 1S3IA 4WZZA 3WLHA 1OT5A 2NZYA 1DC5A 4BZPA 2YH2A 4NOMA 4BNDA 1OI4A 2XGGA 3ZJTA 1D2MA 4U7FA 5CA0A 2A5DA 2PX4A 1Q92A 2WWRA 4RVGA 5IDQA 3MJ4A 1OROA 2CLIB 3RWMB 1PI3A 2H4YA 3ZNQA 3MLEA 4YO7A 2GGSA 3DFMA 3QE2A 4IRXA 4JYCA 5EJ6A 1FTNA 4NK5A 1TL7C 3L7BA 4RANA 4LPKA 1LXCA 3HRIA 2YZKA 2WSSD 3F5SA 4OMCA 3AV3A 3L5KA 3TJZA 1MG5A 2CEKA 4LIPD 4RIIA 5JZSA 1Z2NX 3QOFA 1RLTA 2AOXA 3P9NA 2XMBA 1CC1S 3K1ZA 3F5QA 1I13A 4MP8A 4B87A 1LSUA 4Y1GA 1WXWA 1VKZA 5DASA 2M2IA 1EWVA 1PR2A 2ZWAA 1RRGA 4DLUA 4R98A 5GZ1A 1XVIA 5IWAB 4HWOA 3RBVA 3TX2A 1BE8A 1A98A 1MQAA 4L16A 1D5WA 4H7KA 2VP5A 4AT1A 1GGEA 4AJLA 2ZIGA 3KZVA 4CNQA 2PSEA 4LJKA 1QQ6A 1V11B 4KIJA 4C6TA 7REQA 3WP1B 4ZDJA 5HUJA 3VHRA 3AR5A 3H18A 4J4HA 4JUAA 5DT2A 3Q0EA 2R96A 2FLWA 3TI9A 1U0FA 4JY7A 1TVKA 1VRVA 4IDBA 4F93B 5KTMA 1D8TA 4YJ2B 2XZLA 4WBXC 1Y1SA 3V7WA 3QYPA 1CJSA 3H4TA 2WBLC 2J4FA 3R9KA 1VFNA 3BKWA 3NHAA 5FIUA 3JARA 4B4WA 4OP1A 3E9CA 3PEWA 4EITA 2Y4OA 3NAGA 3ONEA 4BHTA 4P83A 3T15A 5HKKD 1U3GA 4GI2A 1JE0A 4CTOA 1IQRA 4QQFA 1EK1A 4Y2UA 4M9QA 1V7CA 2XMGA 1Z26A 5K0ZA 4IO0A 1ECLA 2AHRA 3LPMA 3C1UA 4P5PA 5CFOA 5FTWA 3R7LA 3I83A 1ZIYA 5LZ8A 2PN1A 2ARKA 4ZD6A 1HSOA 5H3LA 4GLLA 1SG9A 1Z15A 1ZONA 2QAGA 2XDAA 3TRHA 5EINA 5DRYA 2WDPA 4EEZA 2P2CA 4M8SA 4U2KA 2C5SA 1VLVA 5THKA 3VPFA 4NPHA 4DSNA 4DMFA 5KB3A 1CTQA 1U28A 1WXIA 1X1QA 5IH3A 4DKJA 2IYVA 3FTFA 2QRVB 2CSXA 5KKAA 4DMLA 1BJKA 5FKJA 2AFIB 3P0IA 1PGPA 1KDZA 4A9AA 2BEVB 2VPQA 1ZN7A 2Z5FA 2WNHA 1DINA 4JP5A 2D5AA 1ORWA 2CJXA 2I2CA 1Z17A 2WINI 3EDYA 2NAPA 4I66A 5A0FA 2G07A 2P9FA 3NO4A 3A1WA 5DBFA 4D81A 3RBXA 4RGQA 2YVAA 5I47A 3BD7A 1Z4NA 3NDIA 3WDMA 3I37X 2H6EA 3JVEA 3CRMA 4HQLA 2AWNA 3KBBA 2XVMA 2XMPA 2RK4A 3K1TA 3KUXA 4JBXA 4L7VA 2IXFA 2WF7A 4AKSA 2JATA 1IXKA 3BM5A 1J7JA 4GYJA 5FBHA 2ZJBA 3BORA 4OAPA 5E4TA 4DYHA 2DM6A 1E0SA 2GRAA 2GPNA 3HYNA 4C04A 1FZTA 2QX4A 1F4VA 1D2AA 1RXUA 3OJLA 3MUEA 1TAGA 1Y9ZA 4RA9A 1G3QA 1MNQA 2QPTA 4FMDB 4R71A 1XEWY 5I7EA 5JTUA 3ICEA 2DSTA 3D2AA 2UU9B 3X43A 3UFBA 4BNGA 2E49A 2WKSA 2NT4A 3LZCA 2FGJA 5KMGB 4ZI7F 5EWMB 2EERA 3DLPX 3OMWA 4OI1A 3W5VA 5DMXA 4YHBA 1T2EA 1U0LA 2G17A 2OE2A 1ESZA 2ZJ8A 1HFEL 2JHPA 5E6UB 5FL7D 5E7JA 3D6UA 4KSYA 2FXIA 3HBMA 4ILEA 1V5WA 3HVJA 1FEZA 2JLUA 1FJHA 2VPPA 1UDCA 2AQIA 4FFWA 1R0LA 3I9OA 2OCBA 3IBTA 3KSUA 5D3MB 4Y2PA 5DHFA 3OLCX 1TCBA 3OETA 3TRIA 4HLQB 1IM5A 1Z75A 2AXNA 2BHSA 3OQIB 5TJ9A 3OQVA 1JH9A 4L2IA 1VPWA 2NUTA 2OXRA 4LOLA 3HR7A 1D7AA 1ZRMA 3JD4A 3CA8A 4R54A 1E3LA 1Y1TA 5I9BA 4HWKA 4AXBA 3A6ZA 4B7ZA 3PD0A 3B5IA 4ALNA 3J81A 1QE5A 1D6MA 4XARA 4KO1S 3UTDA 3WYBA 4EMTA 3EIFA 3I1YA 4GPBA 1L5ZA 3FGPA 2WSBA 3T3PB 5FEUA 3ZDFA 4M0MA 5IULC 3JZAA 3K0EA 3DS8A 4M1ZA 4KX5A 1O0SA 4MVJF 4YMIA 2XOEA 5CBPB 3L7NA 3NT2A 4BFVA 2M6SA 4BEWA 3OSUA 1QBGA 1Z0FA 5IYZA 1UKYA 3T4XA 2H11A 2PH7A 3ANMA 4UXHA 4XJVA 4F11A 1F2TA 1DX9A 1R0CA 3E22A 1Q2UA 3MM4A 1RADA 3PJGA 4PIPA 4PRZA 3AR9A 3G9XA 3S2IA 4JC8A 1QIIA 2EW1A 3D0OA 4TS9A 3FFBA 2SICE 1A0OA 2UUBB 2QLJA 3WNCA 4BFYA 3AYXB 2Q6IA 3MIZA 4GRIA 1TUEA 3KEQA 2IIPA 4K2HA 2C7VA 4N5NA 3N6VA 4R0VA 2IIQA 3DTNA 1TPYA 2B25A 3NYWA 1O58A 3I34X 4Q12A 1NUQA 3AZPA 4UBJA 1T1IA 3IQHX 4EB0A 3B5JA 4DSAA 1JALA 3HMKA 2REXB 1PJSA 4B3SB 1PL0A 2NZVG 1EE9A 1A76A 5DEIA 1Y7LA 5MN6A 2XDQB 5BNIA 1A8UA 1BDBA 4UJ5A 2ODWA 4GEKA 1H0RA