5FR1A

Double acetylated rhogdi-alpha in complex with rhoa-gdp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
190
structure length
184
Chain Sequence
IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQASGCLVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rhogdi Alpha Acetylation at K127 and K141 Affects Binding Towards Non-Prenylated Rhoa.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords TRANSFORMING PROTEIN RHOA
total genus 62
structure length 184
sequence length 190
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fr1A00
1FP7A 4OK5A 1CS4C 4R98A 4C0QC 2OM2A 2G9NA 1NNEA 2DR3A 2W58A 4PZZA 2VQSA 2DB3A 1KI9A 2REBA 2PLFA 3TNFA 5LB2A 4GP7A 4LV6A 2GCPA 4ZDJA 2ZTSA 4JJZA 1Q1EA 3AB3A 3BWDD 1IAQA 1X8KA 3O8DA 3WMGA 1XTKA 4Q7KA 3KKQA 5EE0A 1XTJA 3I5YA 4PSVA 3OF5A 4B76A 2J0SA 2FSFA 2OLKA 4S35A 3IQXA 1NBME 2ORIA 2QP9X 3BD9A 3ZVNA 2IS2A 2VP6A 3LBHA 1QHIA 3N2IA 2FFBA 4DLUA 2ZSDA 4CYMA 1II9A 3PEUA 3RABA 3HU2A 5DIFA 4AWXA 2VSOA 1D8TA 2XSZA 4DHEA 1SVKA 1ZRHA 1F60A 1PJRA 3VR4A 1ZM9A 2O8EB 5HCIA 3ECCA 4MDEA 2ZUCA 4FMBB 4D0GA 2GAAA 1OXSC 4DSOA 1TUIA 5CB6A 3M1IA 2JEOA 2G6BA 2WWFA 5EE5B 1GG2A 3A8TA 5C1BA 1U9IC 2ZI7A 3SJBA 1U8ZA 4TTRA 4DB2A 5FI1B 1P60A 3G0HA 1E94E 4BFVA 721PA 3RAPR 1MABB 1A82A 3TJZA 4LSGA 1NP6A 1KNXA 4QC2A 4QHTA 3MMPA 4HB0A 3VNUA 2O8CA 4C2UA 3CX8A 3K9GA 4B3DA 2ZSAA 3A4MA 4IOMA 4NKRA 1VG1A 2ZRCA 5KNDA 1H65A 2YWGA 4B3XA 2HJGA 1M7HA 3DMNA 1C4OA 3BRWD 4FWIB 1AK2A 1K8RA 1E1RD 2JJ1D 2DFKB 2IF2A 4HLCA 4HZUA 1SGWA 4P3YA 4XIGS 4ZDWA 1BOFA 5J40A 3G82C 4Q1EA 1US8B 4C0AC 4A36A 2WIAA 4DB4A 1KI4A 2ZS9A 3UANA 1IXSB 1LVGA 3QKTA 4NYIQ 2PCLA 4ESVA 2A5GA 2GDJA 3K0FB 3PV0A 2YNMA 3I8SA 1S1CA 1N6IA 1NSTA 2NZ8A 4LV8B 4Q9KA 3SOPA 1UDWA 4RD3A 2QAJA 4DLRA 1U98A 1J2JA 2IYZA 4JLMA 5GADl 2EFGA 3KQHA 4KFSA 1R0WA 5G3ZA 2IS4A 2NPFA 1LS6A 3PCRB 1Q1QA 2CBZA 4IOLA 2IC5A 4PHFA 1CEEA 2IYQA 2FN4A 2QMEA 3R20A 1XBTA 2WJHA 1IY1A 2BKUA 2C04A 3QBTA 2ZRPA 4R71A 3GLGE 2HUPA 2PMKA 1X3SA 5E7MA 2HCJB 4C30A 1W47A 2AD1A 2REOA 5DH9A 2FX3A 2HT1A 1M34E 3Q5EA 4MUAA 1GL7A 3HP1A 4JJKA 3AGPA 3ZS8A 1NKTA 4JVNA 1KMQA 2KSQA 1AKEA 2C8VA 3KX2A 3OEHA 3MRSA 3RRYA 1ZD1A 2EYQA 3LH5A 1HT1E 5C18A 3GJ8A 4NDZA 1YRAA 3LXRA 4PC6A 2AL7A 3H84A 2HF8A 3K09A 1LF5A 3L8ZA 3CPEA 5CM9C 4IDHA 2XITA 1T3SA 2OUKA 4JBWA 2ZETA 3LA6A 5E7IA 1VHTA 5DI9A 1G16A 1XD8A 2P5TB 2ZJZA 4TLEA 1IY2A 3QIAA 4AD8A 3AVYA 4PQFA 5DYIA 4PSAA 2ZJ5A 3LD9A 4EQ6A 4P4TA 1Q3HA 4KFTA 3CRQA 1M6NA 2GZHA 1T3LA 2WAXA 3UG7A 4MRRA 1Z47A 1NL3A 3T12A 2XXAA 4JL5A 1NMZA 5G3YA 4XVUA 4LHYA 2ONJA 4X8HA 2JLVA 4GMDA 4O2LA 1LTQA 2A5YB 4L4UA 1Q57A 3BAFA 2E9SA 3SYKA 4M2LA 4M1KA 4BLPA 4UNQA 2C9YA 2J59A 1CP2A 2CL7X 3U3RA 3EC2A 2FPMA 1JAHA 1VCMA 2VP2A 3OAAA 1E1QA 1KIMA 4YMTA 2CVFA 4CRWB 3PJRA 3AVUA 2BMEA 2O8DB 3BORA 4IOJA 1NLZA 3KQLA 2JJ2A 1U8YA 3GLIA 5KDDA 1KSJA 4CEIB 3Q85A 1TMKA 2XZOA 4RKEA 1AZTA 4CDGA 1E0JA 4HZUB 2W83A 3CNNA 4B75A 3GJXC 4JBYA 2OFWA 1YQTA 3LQQA 5CDFA 2H92A 2EFHB 1GL9B 3NBZC 4TWZA 3NH6A 3WYAA 2R65A 4NPHA 5LBIA 3D3QA 3NTUA 5BN5A 3GPLA 2A78A 3KXLA 2X2EA 4XD7A 3SNHA 4PSKA 5G41A 2A30A 2X77A 1OIXA 2F1JA 2ZVPX 3KJHA 4PPGA 1Z0KA 3VR6A 1DE0A 4MITA 3BXZA 4OJQA 2YWFA 4Q7MB 2GEUA 1YR9A 2HEIA 1HYQA 1E2PA 3TUJC 1KI6A 4OBEA 4C7OA 3M6AA 2YWHA 3TR0A 5A4JA 3EZFA 1Q21A 2O8CB 2DCUA 5FPKA 4HB4A 4RJLA 5AWFC 4UJ3A 1ZW6A 3BBPA 3F5FA 4TLAA 4BFTA 4RKFA 2QUZA 3K9LA 4CF7A 2ZRBA 2AKAB 3CPJB 5EUQB 2RGXA 4TMKA 3Q3JB 1G19A 5CDFE 4RD1A 1R0XA 5JEEA 5CYPA 3CR8A 1E2FA 3SR0A 1N6RA 1PLKA 2GILA 1MV5A 4A4DA 1LY1A 2P0EA 2ZEJA 3CB4A 4IVRA 1JPNA 2QAGA 3HPQA 2OE2A 3B7GA 1MH1A 3CF2A 4LRWA 5HTKA 5GJBA 3B1YA 3PVSA 2QNRA 1A1VA 2FOLA 1NG1A 4JZKA 4DXAA 4EAQA 2QA5A 2ORVA 2DFNA 2EVWX 2WJJA 2JDID 1N0VC 3PG5A 1ZCBA 1DG1G 5B30A 4LJ9A 3CX6A 3JZMA 4DLTA 1BO6A 4G3XA 3W8NA 1LNZA 3L8YA 4WW0A 3UMFA 1E9DA 4A8JC 4B44A 4EPYA 2EFCB 4RSGA 4BZQA 3KTAB 4NCHA 1W1WA 4PZLA 4BLTA 4IOKA 4C0SA 1XNJA 2PT7A 2FU5C 4XWOA 1OKKA 2XB2A 2CEAA 4L9WA 2HLDA 2ZE8A 3OFND 1R7RA 2NMVA 4NL4H 1ZU5A 1KI6B 1MRSA 4MA4A 5HZHA 1K5GA 5JRZA 1LF0A 4PO1A 1OKKD 4Q1AA 3B9PA 3WP1B 1Z5ZA 3X1XA 4LJ8A 4LPSA 5A0FA 1AQUA 1M7GA 2PX3A 2WBLC 2CL0X 1KK3A 3VR1A 2D7DA 3KXIA 3CRW1 5BW8A 1OV4A 1YZQA 4D80A 4LOAA 1FQKA 1AZSC 4KYIB 3W5JA 1EX6A 2GEDA 4Q1CA 1Q44A 5FOXA 3X1DA 3FHCB 3MUFA 4N3NA 1W0KD 2DBYA 4DCNA 3ICQB 5JI3E 3Q7QA 2R6DA 2PBRA 2RB4A 2HLDD 2F43B 1UF9A 2QEQA 3AVQA 3OFNA 5JI2E 3THYB 1PV4A 4R2HA 3A1TA 5IDVA 1NSFA 1COWA 2JLUA 1T5LA 4XWKA 5FBRB 3QBVA 3U3JA 2RGNC 1VG8A 3K9NA 2ZRFA 2FMXA 1KSHA 2VRWA 2ZE6A 3DM9B 4IDOA 4IEIA 1Q3TA 4JSYA 1T8TA 1XEXA 2N42A 2AWOA 4NYJQ 5HKKA 3OE7A 1P73A 2CLSA 2OAQ1 3DL0A 4WZ6A 5UKDA 2OO7A 5TB5A 3U44A 2GTPA 3I1FA 4LV5B 4EPVA 3SBEA 3KKNA 4NU0A 1KO5A 3EIEA 4HDCA 1UAAA 1GSIA 3MGCA 3MAAC 3RRZA 4L16A 4ZI2A 1WXQA 1H8EA 2WMOB 4II7A 4UXJA 4TLBA 2BMFA 4DCSA 1ODFA 2EWVA 4E07A 1AGRA 2BWJA 2OG2A 2BJVA 4W5HA 5JEDA 2JLWA 1WRBA 3QE0A 1LW7A 2YOFA 3TVDA 2ASEA 2QPTA 4RD6A 3LBNA 1RYHA 4JLJA 4KLZA 4AURA 5J4LA 4FN5A 1S9HA 4ARZB 4DCUA 4NZYA 1SXJA 4MGKR 2CNWD 1Y3AA 3GCGA 4TSFD 4RFVA 1HUQA 2LWIA 2J0UB 5AJXA 1Z07A 1KAOA 2QM8A 4B3FX 4ZIRA 5CK5A 5DHFA 5FR1A 4B32A 3DM5A 1KI3A 2F1HA 4HAUA 4PO9A 5EE3A 3V00A 2WTUA 2H7VA 2GBLC 5EZ6B 2RGCA 1OLOA 3JVUA 4RY2A 3AKYA 2V1UA 2BOVA 4FMDF 2Q9CA 4MYCA 8OHMA 5G53C 3ND8A 4W9MC 1OH8A 1SXJD 4CT5A 3TH5A 2AK3A 4ZIRB 2GZDA 4C0KA 4ASUA 4B73A 2OFOA 3GFTA 2GCNA 4A92A 4Q4HA 4N0DA 1TF5A 2O8FB 1N2CE 4I99A 2F7SA 1MO6A 3K0CA 1GVNB 2ZUBA 3B6EA 1G18A 1FNMA 4QBFA 3BOSA 5K8UA 3EASA 1NN1A 2IHBA 1IY0A 1I4TD 2JLQA 2VP5A 3QXSA 2W6JD 1E9SA 3C14C 3U3MA 3P4YA 2ZR9A 1KYIA 2ANCA 4A2QA 4LC0A 4PAQA 1BH2A 3FE2A 821PA 3SFVA 2F9MA 1NMYA 2XTMA 4KBFA 4M1TA 3ZVMA 2ZIAA 2D2FA 5BQ5A 1XJCA 4B3BA 5F9FA 2OLJA 1TL7C 2QENA 1G3UA 1A5TA 3EW9A 4KJZA 4MUBA 5H1YA 1DAGA 2CHGA 5FBVB 1CTQA 2O8EA 5GVRA 3FHOA 3PENA 1WCV1 4HYYA 4UQOA 4M1YA 3O8BA 4DZZA 1GL6A 1I4LD 4PAOA 3D31A 1S9DA 1G5TA 1ZM2A 2BEKA 2QTHA 1EXMA 4DT1A 1P2TA 4UNRA 2JLRA 1SULA 3GFPA 1M7BA 4RZ2A 4HAWA 3W9YA 1GTVA 4LHWA 2J46A 1H8HD 2NO0A 2QI9C 3FVQA 3R8CA 4Q9IA 1E2IA 2JA1A 4Z54A 1J90A 2GCOA 3QKRA 4C0HA 2V7QD 3GJ4A 1YZLA 2BBOA 2XXAB 3CO5A 2A5JA 4LX0A 4UNNA 3PEYA 3AVPA 1NY6A 4JLVA 3I3SR 2YVUA 4A0GA 2NQ2C 3PEVA 3OIUA 1UFQA 4DLVA 1VPLA 3K0CC 1G6OA 3AF4A 4M8NE 4D2IA 4LCBA 3LQRA 4W7SA 4NYMR 1QG2A 1E69A 2NO9A 2ZRKA 2JLXA 4G5OA 5HE9A 4YLGA 1OH5A 4P33A 1KJZA 2YOHA 1KO4A 2GK7A 1XPUA 3GEIA 3ICEA 1ZJ6A 2QE7A 3DKPA 1IN4A 3EPLA 1W0JD 2KI5A 2BEJA 4UXIA 3IEVA 2V8OA 1KDTA 1JR3E 1W44A 1WE2A 2JDIA 2V54A 4IEEA 1R5BA 3SJZA 4L9SA 1N3BA 1ZM4A 1W4AA 1G291 5KHOC 1XF9A 2J7PD 2DFLA 4US1R 3AP1A 4I1SA 5L3QA 4K46A 4KAXA 4OYHA 2RH5A 3EIHA 1G9XA 1XJQA 2V1XA 1NN0A 2ATXA 4K81B 4Q66C 1QHGA 4DLSA 5C2JB 4F4CA 3GD7A 4Q01A 5FFMA 4URXR 3VKWA 4KFUA 1W0JA 3QVUA 2V9PA 1ZNXA 2H16A 4ASUD 1XXHA 2L0XA 3LW7A 3OZXA 3QUSA 2IYRA 2GWHA 3VR5A 1J8MF 1E2NA 4TYPA 3BJIC 5P21A 1SVWA 1E1RA 1ZNWA 4F38A 1KAGA 2IEYA 4JYBA 2CCGA 2O0JA 1ZBDA 1KDOA 2YZ2A 1N5KA 5DE3A 4IRUB 1JALA 1YZUA 5IRCD 4A8JA 5B58C 4NHOA 3EA5A 4M1WA 1AQYA 3A1SA 3P26A 5TDHA 1E32A 4TTPA 3I8XA 3W6NA 1P2SA 2GZAA 1ZCAA 2IUTA 2VF7A 4YMVA 4PO8A 5DISB 1E2GA 2GF9A 2WJGA 1XD9A 3EPJA 3AVWA 3QVVA 4H1VA 4TT3D 3TAUA 1FZQA 3EPHA 3TSWA 1KO8A 4YQFA 4F7WA 1FFHA 3W90A 4E22A 1U8AA 1NVVQ 1HURA 1OHHD 3X2SA 1JB1A 4RFSB 4FCWA 4HUTA 5CLLA 1IQPA 4Q9HA 1Q22A 3RRNA 4QFMA 4ERNA 2VH5R 3ONWA 4TQUS 2VA8A 2V55B 1O3YA 4FI3C 1OFHA 4BWYA 3CM0A 1N6OA 3FWYA 4FMCF 4A82A 4DDVA 3GQBA 3K1JA 3U7HB 2G1JA 2QMOA 1K5DA 4PC3A 3C4JA 1JPJA 4IFEA 1W36C 1E9FA 3MJRA 4H9GA 3C16C 3RS5A 2G83A 3I72A 4JT2A 2KJQA 3RRMA 2J5XA 4BFWA 1NLYA 4ITRC 1E0AA 3SHFA 1WF3A 2FSGA 3AUXA 3ADCA 3K0AA 1CIPA 1E2MA 1NVXQ 2W2TA 3IBYA 2PL3A 2PMDA 4P4SB 3TQFA 1E9AA 1N6HA 2ZRGA 3BFVA 5FBWB 1L8QA 2QL6A 1NN3A 2D4HA 4Q4AA 3CRRA 5EXSA 2Z4SA 4A6PA 4YMSA 3B1XA 4CEIA 1XB2A 4JYCA 2JLYA 2ZRLA 1A2BA 5E3HA 1G1MA 2AN9A 1EK0A 1ZC4A 4V0NA 2BIFA 1AIPA 4Y0AA 3S1AA 3QJYA 1XTSA 3B60A 4GSYA 2BJWA 1KI1A 1D2MA 1TU4A 3FKQA 1FUKA 1G5PA 1QRAA 1T3HA 1G3RA 3HYTA 2I1VB 1S0UA 2WWYA 3KQKA 5FTLA 1IN5A 1XU4A 2YOGA 2ZM5A 2WZQA 4FWTA 1CU1A 4URUR 3DMDA 1NF3A 1EG7A 2FFHA 2RGBA 4KXFB 3QPUA 3GLFB 4Q7JB 1RIFA 2EFEB 4JS0A 4EKDA 2OAP1 2Q3FA 2VIIA 4XVRA 1L4YA 2ZE5A 5EXXA 4B34A 4E03A 3H0KA 2A7QA 3NXSA 3Q8XB 5KSZA 1X86B 2OHFA 2ZI3A 2ZYTX 3C5CA 4FINA 3BB4A 1TNDA 1N5IA 2ZQ5A 2I4IA 4JL8A 4Q18A 4US2R 1GZSA 4LC1A 4XVQA 1X1SA 2GVDC 2PX0A 3L0PA 4PFSA 3A58B 2EYUA 4DDTA 5FTMA 5EP2A 1G7SA 4NYIR 2XX3A 1UKEA 3R9WA 2CDNA 1QDEA 5JJIA 3DVLA 1XEXB 3O8CA 1ETUA 3ADKA 5KU1A 3A6PC 3VX3A 2WSMA 2IBMA 3DO6A 3ND9A 1EWQA 2WHXA 3TQCA 3A1VA 2ZUDA 3LAWA 2HXSA 2WOOA 4BFZA 5BXQC 1G6HA 1Z0IA 3LRPA 3AP3A 3I61A 1P9NA 1YR7A 4N1AA 3LW8A 3RNLA 4XSHA 3CH5A 4RZUA 2QM7A 2DHRA 2FFQA 4CEHA 1YZNA 2BM0A 4NYJR 2E1RA 2CCJA 4GOKA 4PHGA 3THXA 1UKVY 4PPQA 5F9HA 1U9IA 1IXRC 3TKLA 3I62A 5KTYA 4ZKDA 2OT3B 1S8FA 1BIFA 3KUDA 1W4RA 2OILA 5JHHB 1K6MA 3KJIA 3RS7A 4Q4JA 1UADA 3A4NA 1N5JA 5JWHA 3UWOA 1KKLA 1RJ9B 1VECA 4JVSB 4A15A 3THXB 2IT1A 5CIWA 1G4UR 1MO5A 1RZ3A 1LV7A 1ZC3A 2HDNB 2IL1A 3CIOA 3IHWA 3MWKA 4Q47A 1R5NA 1XRJA 3A1UA 5JCPA 3SQXA 5FL3A 4KLNA 4Z51A 1CJUC 1OXUA 1AA9A 2ZS7A 3W3AA 1KZGB 3GLGA 2JLZA 2GXUA 4P31A 1NG9A 3KKMA 4HSEA 4RD4A 2D2EA 1UBFA 3T1TA 5CYOA 3RS0A 4LYAA 3KJGA 1SHKA 1GAJA 1N0WA 4M9QA 4V0ME 5FL7D 1Z08A 5JMTA 1E2KA 1E2HA 1E99A 2QSYA 2IYUA 1OH7A 3SEAA 4B2LA 1UKYA 1SXJB 4BFSA 3B13B 3NC1C 3I73A 4JLNA 4DEYA 4ACAA 1GDDA 1P4SA 1RRCA 2NGRA 2DFTA 1S1MA 4H1UA 3FMIA 2IK8A 2Q3HA 2BM1A 4Z1MA 2J3EA 4A0HA 3NH9A 1Z8FA 2YJTD 2AFHE 3QF7A 4BZXA 3EZ2A 2XZLA 1BYIA 4NTZA 5FH9A 3WRXC 2LKDA 1RC8A 2YINC 2WJYA 3BS4A 3SE0A 4LYJA 2OBNA 1KMHB 2KBEA 3O8RA 1QZXA 4TYNA 2G88A 2B6HA 1P7CA 2ZJYA 5EE1A 3E1SA 2CNWA 2X19A 4P4UA 1G5RA 4DLXA 4ZV4A 2PZEA 1BKDR 1W49A 1P3JA 1TF7A 2CE7A 1QF9A 4E5UA 5CIQA 3NG1A 1GUAA 1EFRD 5AUQA 1H8ED 2G77B 3EZ9A 4Q4JB 5FUXA 4W5WA 1HEIA 3M0EA 1BS1A 2XTNA 4R9UC 3FHTA 3R9XA 2GJKA 1AJEA 3UMSA 5FTKA 2MSDB 4V0LA 5C4MA 5IK2D 3UWKA 1JECA 4AKIA 3GJ5A 2XSZD 2BC9A 1VG0B 2PZGA 1G7TA 4C2TA 1G8YA 1DO0A 5AR1A 1RKBA 1G8FA 1Z0JA 5B2ZA 1QHNA 2WKQA 1TADA 1E9RA 4OI1A 4D25A 2AHOA 3QXJA 3SS8A 2NO7A 1OFIA 3TE6A 2TMKA 5AK0A 3L0IB 1VCOA 5JZVA 2CLCX 3GLFA 1LS1A 1TTTA 1ZUNB 1VYTA 1QG4A 3TUIC 1WB9A 4ZCIA 4RCYA 1NN5A 1UBGA 2QRNA 4BASA 4KO8A 2RGDA 4Q48A 4B6EA 4AIIA 2ZSEA 1P72A 4HAYA 4DBLC 3DOEA 2P65A 4DLYA 3QPVA 3E70C 3FTQA 3CH4B 4KVGA 2XNSA 2PEZA 1N6NA 2H18A 3HWSA 4GFDA 3SJAA 1OF1A 1TEXA 1YHNA 3QEOA 5IHPA 1G21E 3UKDA 1F2UA 2CK3A 3K70B 3C7KA 2FV8A 3VR3A 1F6BA 3FB4A 4PTLA 4KU4A 2V4ZA 2NOAA 2QBYA 4DSUA 1B0UA 2WAYA 2ZRHA 3IPXA 1X8LA 4BE7B 2JASA 3L43A 3ASZA 5FOUA 3TRFA 4HB3A 1S4QA 1QHHA 3R9IA 5GJVC 4TZ0A 1IJFA 3KQUA 2Q0HA 4XTRA 2RHDA 3HU1A 3L0SA 1A4RA 3HU3A 1XMJA 4U5XA 1UEIA 1U99A 3BH0A 3JZAA 1NIJA 2FZ4A 2CK3D 1DPFA 3PXGA 4WAUA 1JR3A 4AK9A 1W48A 2FJUA 4M0LA 5GJWC 2CJWB 3RDPA 1T4GA 1EFUA 4TYYA 1IONA 3CF0A 3SDZA 1II8A 2C2HA 2EFDB 5KO2A 4W5JA 4LI0A 4BLQA 3U3OA 3REFA 2JJ8A 2MSCB 3FMPB 1LFDB 1OSNA 4QBGB 3QXXA 1I4DD 1E4YA 2VYFA 3VQTA 121PA 5GJCA 1SKYB 4ILEA 4HAZA 4RFSA 1W4BA 4MGIR 4TMXA 3CR7A 2QY9A 1JR3D 2C03A 5TVKA 4IJMA 4TQAA 4GRAA 3QKSA 3WBJA 2NTYC 2WKPA 2GXQA 2J0UA 1ONBA 4URZR 2CL6X 1VHLA 1E96A 1GITA 4A0RA 1EFTA 3VMFA 2A3RA 1TAGA 1D6JA 1KI7A 1N5LA 2GXSA 3CX7A 3K0AB 1RRFA 1U2RA 1U0LA 2HXYA 2ZS8A 4BFXA 4C0JA 2OFXA 5CK4A 4CW7A 5SZJA 2AWNA 2ZSBA 4V0OA 5B57C 3OIYA 2QU8A 4KCGA 4LBZA 1KJWA 2ZRJA 2ZREA 3MWLA 4HAVA 1DAIA 2QRZA 4I1UA 4LBVA 4RZXA 3U7GA 1KTVA 1TQ6A 3WMEA 3ZIAA 3U61B 1R10A 1U0JA 3W34A 3ADBA 2ZI4A 1JEDA 2IHYA 2W00A 1FX0A 5G40A 2P3SA 1BMFD 1XZQA 4LWZA 1HQCA 4KVAA 4Z8XA 2IWRA 3K09C 4KHZA 3BIFA 2GEVA 4TMTA 1N25A 1P2VA 5L3VA 3U6BA 5EP4A 1GNQA 5K8LA 2AKYA 1VG9B 1XCPA 2A5FA 2PLRA 3E2IA 2CHQA 3EZ7A 4MH0R 3T34A 2Q21A 4LUCA 2RHMA 1UBCA 4JT4A 3THWA 2O8FA 4FCVA 1WQ1R 3LDAA 4Q19A 1MOZA 2IEZA 3K8YA 3EWSA 4C4PA 2O8DA 4NONA 1PUIA 2VHQA 4LYHA 3VX4A 2QMHA 5TMPA 4OQNA 4FW9A 5H70A 3LLMA 3T5GA 2FFAA 3NEJA 1E2LA 3B2EA 2H1LA 2G0TA 2OCAA 5DO9A 3SN6A 1GNPA 3H86A 3OEED 3X1ZA 1KI2A 1T5IA 4TL8A 2WJIA 4OHXA 1R5OA 1OHHA 3AVXA 4ABYA 1P5ZB 2R44A 1C9KA 2B7BA 5EZ5A 1RYFA 3QOFA 1VTKA 4JMPA 4XTCS 5HR5A 4A9AA 1DADA 1H8HA 4JLPA 5EP3A 5AJVB 3KTAA 3WBKA 2D06A 2P2LA 3RS3A 3RS2A 1SVLA 4DVGA 4DIDA 5KSPA 4NCIA 1JEEA 1KI8A 1P62B 1I2DA 1UEJA 1E0KA 1AN0A 3CPHA 2A9KA 1U94A 2W2VA 4NH0A 4P32A 5EUMA 1E2QA 2WM9B 3ZZUA 3TMKA 1MT0A 5EXPA 2XOKA 4NE2A 2XJ4A 4GZLA 3UPUA 1ZP6A 3N5CA 4ZPXA 3B9QA 2ZI6A 3LX5A 2CXXA 1TEVA 3NIBA 3P20A 2QP3A 2HYIC 4I81A 1G8HA 2OXRA 1KSGA 1JQJC 5EQTA 3ZS9A 4AKHA 5AJZA 3FMFA 1W2GA 2JCSA 1Z0FA 4DUGD 2V7QA 4KI0A 3VNVA 3BC1A 2FH5B 5FR2A 2D7CA 3MCAA 1JJVA 1WA5A 3ZJYA 3ADDA 1JI0A 2WSSD 1TQ4A 2O52A 2QTFA 3EARA 1NRJB 5FPSA 3CRVA 2JJ1A 5KOYA 4BZPA 2V6IA 1WBDA 3EXAA 1S96A 2E87A 2XNDA 1G8PA 1ZIPA 3B85A 5AUOB 4JLDA 5KSYA 4OQXA 1Z6TA 1W46A 4I1VA 1T0HB 3TGPA 3KB1A 3K70D 2HCBA 1XMSA 1OB2A 3UATA 4AY2A 1Z63A 1XCMA 1KHTA 5F2EA 1NIPA 4V03A 1QHHB 1WDTA 1E2DA 4CZ2A 2G0NA 2VHTA 4DKXA 3AF1A 3AQ4A 2WWGA 3W5IA 4C3ZA 2MMGA 1BMFA 3EIQA 3PUVA 1KK1A 2O5VA 4JVMA 3DOFA 1O87A 3EA0A 1E2JA 2ANBA 3K0SA 4GI7A 1ZAKA 1D5CA 1UDXA 1Z3IX 5K8IA 2Q3MA 2X1VA 3AVVA 1KK0A 1XZPA 4MYUA 1AS2A 1NVUQ 3BGWA 1D9XA 3RANA 1S3GA 5DN6D 1Z0AA 4HAXA 4ZCLA 2AXNA 3SU8A 5KSOA 1NJGA 1MR3F 3KDSE 1XEWX 2QT1A 2P6RA 2VF8A 2YKGA 3G5UA 3BH7A 1XMIA 1KOFA 1JAIA 1IOZA 1CULC 3GMTA 2QAGC 2HJVA 3LY5A 2C9OA 1XFAA 3U4QA 4A1FA 4A0FA 4DJTA 3SBDA 3T1QA 3SYNA 2BV3A 2F6RA 1OYYA 4KFRA 1IN7A 1II8B 4XWAA 4U00A 2WPDA 2MMCA 4C7OB 4YMWA 1ZNZA 4U02A 4QJ4A 2XEXA 4WA7A 3T61A 1ESNA 1FTSA 1Q20A 1Z2CA 5JJKA 2CCKA 3QENA 3E5HA 3PQCA 2F9LA 1W36B 1W2HA 1XXHB 4G1UC 1G7CA 4EPRA 5CM8B 3IIKA 4RCZA 4DSNA 4QOSA 1CLUA 1HV8A 1FX0B 2HF9A 3DHWC 3GEHA 1FMLA 3K0EA 3OIVA 3OEHD 3KB2A 1HE1C 4NYMQ 4EQ6B 5D3MA 1GM5A 3QXCA 5EXTA 4EUNA 1J7KA 1CJTC 2ZRAA 4MGZR 1DARA 1YZTA 2OBLA 4B2IA 3IKJA 1TPZA 3L82B 3V4FA 2OEPA 3WRYC 3TW4A 4YDSA 3NHBA 2FGKA 5F3WB 2D74A 1PLJA 1JBKA 2RAPA 3FDIA 1GILA 1EWRA 3GEEA 4TZ6A 2J9RA 1CXZA 2XZPA 4URWR 2KB0A 4LJ4A 4HLQB 1ZYUA 1NBMD 1EESA 5D3MB 3RVBA 5JLJA 1XEWY 1OE0A 3D8BA 3Q9LA 4MKIA 4D82A 1J70A 1CJMA 3RSOA 1OW3B 5CJPA 2GAOA 4LZZA 1ZUIA 2FF7A 1KY3A 1QVAA 2OV2A 3DZ8A 4EJSB 3AKDA 1YU9A 3CF6R 1P9RA 1VMAA 2RGAA 1OXTA 1KY2A 5KPDA 4IHQA 2N1BA 4TL7A 5C46F 1RVDA 1WBBA 1SVOA 1XTRA 3U2QA 2ZRNA 4FMCB 3THOA 3WNCA 2GJ9A 4ZCMA 5JFGA 3KJEA 1R0YA 3W3ZB 1G8GA 5FOSA 1S2MA 4M21A 1Q12A 1S3SA 1DELA 1DAKA 5L8VA 4BPBA 3IEUA 2IYTA 4PC1A 4Q02A 1XTQA 2OBMA 1FUUA 3ZDQA 3IDQA 3O47A 2DYKA 1E4VA 3L0OA 5JS8A 4TL6A 3AUYA 1OIWA 4RD0A 4TQ9A 1DO2A 1E1QD 4B47A 5JCZA 1TQ2A 1D2EA 2V6JA 3LXXA 3QNUA 2BBWA 3QEJA 2XB4A 2QBYB 3T1VA 2ODWA 4JLKA 4LHVA 2J0QA 1X8JA 2IYSA 3CWQA 1QBKC 2QPAA 3IPYA 4JVLA 3I32A 2H8KA 1FMJA 2V3CC 3RC8A 3VKHA 3CNLA 2IA5A 4WZAE 4PHHA 421PA 4YMUA 4MKFA 1G7RA 1GWNA 4TN1A 2JIZD 2BDTA 2ZI5A 4HLDA 5FPHA 3U5ZB 3GLFE 2RGGA 2W0SA 1Z28A 3RS4A 4OQMA 1Q0UA 3TLXA 2ZJOA 4M9ZA 1Z06A 2IYXA 3F3YA 1YRBA 3P27A 6Q21A 4D4KA 5LD2C 2VTKA 4Q21A 1AKYA 4HDOB 4F92B 5F98A 5L3SA 2QGZA 3QG5A 4B3GA 4UNSA 2ODEA 4RZ3A 2NO6A 4PZYA 2VP0A 1VKJA 2ZJ2A 2G3YA 5HCNA 1ZUHA 4UNPA 1W0KA 2J1LA 1VCNA 4LK2A 4NP6A 3X1YA 1E3MA 2A5DA 1IN6A 1Z6GA 2A2ZA 2DWPA 2FSHA 4WIAA 2RGEA 2FSIA 4YDHB 5FOWA 4FIDA 1XTIA 1MO4A 4HUQB 5JECA 2IWHA 3BFXA 2OXCA 1ZMXA 4K8OA 2O8BB 2EWWA 2J0VA 2WJVA 4TSFA 4TL9A 5AUPB 1UM8A 4IDNA 2FPLA 3V4RA 2EQBA 1E9CA 4M9XA 3CZPA 1F3OA 1ZM3A 1FP6A 2I3BA 4PPFA 4DUGA 4BEJA 1NLFA 2FGJA 5LDDC 1G17A 2ODNA 3KL4A 4JLOA 3U4QB 3CZQA 2X8AA 3LV8A 3TK1A 4BLOA 4MRSA 1ESMA 5BN4A 4IW3B 2P6NA 2ZANA 3LWNA 2IXEA 1EGAA 4WBSA 2BMJA 4G5SA 2SHKA 2ZROA 3W6PA 3OAAD 4A2WA 2GESA 5BYKA 4BQSA 3NDBB 3VR2A 2FPKA 3TIFA 1OT3A 3ZIAD 4AG5A 4D6PA 1GKYA 4EFLA 2ZRMA 2QT0A 3THWB 1AS3A 3A36A 3Q7PA 4M1SA 5FTJA 3ZZ0A 2QROA 5KUTA 3BE4A 3ZZTA 1COWD 1E98A 4TLDA 2NIPA 3ZQ6A 1YE8A 2B8TA 3RSLA 1EFHA 3GLHB 2WICA 3MD0A 1TQDA 1N6PA 5CLQA 3PR1A 4IKEA 4OK3A 1P61B 2WWWA 3NKVA 3C41J 4LJAA 5KDLA 3B1ZA 3EX7C 5SZKB 2WPDD 3IGFA 1GNRA 4D4LA 4L5BA 4TMVA 1Y63A 4QJ3A 5DN6A 3PUZA 4GOJA 3FFBA 1IJEA 1N6KA 4Q5IA 4JSTA 3SZRA 1AS0A 3OIWA 1NY5A 5FUVA 2ZAOA 4KV9A 4Q00A 2WV9A 1IN8A 3HPRA 2H17A 3PIRA 5E95A 4QBIA 4DCTA 3QSYA 2ZJ8A 4DRZA 1TF2A 3WP0A 4XH9B 1AGPA 4GMXA 4JBXA 3IIJA 2IUUA 4QM7A 1W5TA 2Z0MA 3B82A 5FOTA 4CVNA 1N6LA 2CLDX 5GVSA 1ZD8A 2AFIE 3ZH9B 2O0KA 3BB3A 3UG6A 4L15A 2B8WA 2CVHA 4QRHA 4QNRA 4NCJA 2AX4A 4NCNA 3IBGA 4KSCA 3OHMA 5EE9A 2GVZC 1M74A 3RHFA 3X1WA 1II0A 4N0EA 2BCJQ 2EU8A 3CNOA 2VO1A 3GP8A 2GETA 2C77A 2ZYUX 2JATA 3HYRA 1KSFX 3FYHA 5H8WA 4JLBA 3WYFA 3DDCA 3HDTA 1VYVA 2QQEA 3CBQA 2NG1A 1E0SA 3VHLB 2KE5A 4BRUA 4BECA 2R62A 3UMRA 1NBMA 2ZITA 3FKSA 1G64A 3K70C 2OESA 3QI2A 1QHXA 3NHAA 2XTZA 4IVPA 1EFRA 3CKLA 4Y0VA 2C96A 1XDBA 4DWJA 3RLFA 3AF3A 4XJXA 1NKSA 3MWJA 4OHWA 3VFDA 1CR2A 1DS6A 4EPXA 1OXXK 5EP1A 1U81A 1X1RA 4PQRA 5L3SB 2WKRA 3DZDA 4Q1FA 3CWZA 4Q7LA 1DAMA 1GRNA 2DWQA 3AGQA 2WOJA 2ZJBA 1WP9A 1ZU4A 2IXFA 1FW6A 3WY9A 2CHVA 1T6NA 3I4LA 4R2IA 4DDUA 3C5HA 2ZAMA 1W4CA 4HDQB 5FUWA 2IW3A 2JGNA 3PFIA 4O0MA 4Q9LA 5J47A 2W2XA 2ZYVX 4IVQA 4QBHA 4OHZA 3TW8B 1SKQA 1ZNYA 5IF9A 3NWJA 1F5NA 2F43A 4HLUC 3THYA 1CJVC 2GNOA 5JJLA 2IUSA 1IXZA 5DHAA 4B43A 1T8UA 2K5UA 4MRNA 5J4KA 1YZKA 2QAGB 3NDPA 5BYJA 2QG6A 2Q6TA 5E7JA 1R8QA 4BLSA 1NVVR 4B48A 3F8TA 4OQLA 4QNMA 5B64A 1VIAA 4UJ5A 3TBKA 4IDQA 5SZIA 5DNYB 3P1JA 1L4UA 1SZPA 4WZBE 5C4GB 621PA 3LBIA 1F2TA 2BBTA 3HR7A 4JLAA 4D0LB 1SVIA 4L8GA 4F93B 2PCJA 4CIDA 3U6KA 1PLLA 4D81A 2OSBA 5DLQC 4PAMA 3W8RA 5KNBA 3VTKA 2ZE7A 1IM2A 4EJSA 4F4JA 2IYVA 2XNDD 4Q1BA 4QM6A 2R6CA 4GP6A 1DTSA 3MJHA 4LBYA 3TAHA 2WWIA 4CEJB 2FZLA 3M4YA 2ZYWX 4LJ7A 2MSEB 2VHCA 3IIMA 4PPNA 3MLEA 4RD2A 3R7WB 4OI0A 5HZKA 2ZSFA 1UJ2A 2IS1A 3U44B 3FPAA 1IHUA 2RKOA 1D9ZA 2VLIA 4B35A 2IXGA 4DSTA 4OL0A 4B3CA 1W36D 4GL2A 3D7MA 4X8MA 5JBQA 2ZU6A 2P6UA 4TT3A 3EPKA 1M8PA 4CEJA 4QGAA 2PJZA 3GFOA 4AYTA 2QQ0A 3U7FB 1JQLB 3R7WA 3OE7D 3ZQJA 1A7JA 4G5RA 3QKSB 2P67A 3ZVRA 1US8A 1U90A 3MWYW 3AV0B 3AVOA 2QPOA 4QGFA 2WSSA 4ARZA 3QF4B 4JIMA 2PEYA 3EAQA 3KUCA 2I1QA 5JSZB 1YJ5A 2ZPTX 4M1MA 2UVQA 4MKHA 4EFNA 1MKYA 2AD5A 4ESHA 1DEKA 2FA9A 1U0HC 1JR6A 3Q72A 1RJ9A 5TXGA 1T91A 2O0HA 1ZINA 3DKVA 3PUXA 3IQWA 4IXNA 1A2KC 5E4FA 3MG9A 3PEWA 1R4AA 4S2EA 3NBXX 5SZHB 2ERXA 4ZI3A 2NPIA 1P2UA 2R6GA 2WIBA 4A6XA 2B92A 1OB5A 2RMKA 3GLHA 5L3RA 3T06B 2JAQA 2Z4RA 3AEZA 2P5SA 5CITA 4GZMA 2BBSA 5FTNA 4ZDKA 5JS7A 2QE7D 3H2YA 3ZLJA 2VBCA 4B6FA 1OFTA 2GCOB 2Q9AA 3QKRB 4EPTA 1MRNA 4GPTA 2R6AA 4Q03A 4GDFA 3BB1A 3LLUA 4DIEA 521PA 4DLWA 2REXB 1V43A 2J7PA 3REGA 4EPWA 4I1OA 1P75A 4PX9A 4NBSA 5LB4A 4M4SA 1L2TA 1VYUA 3GJ3A 3KXKA 3U60B 1DOAA 1X6VA 2VHUA 5FBLB 3KQNA 4HUQA 5FPTA 1EX7A 1FL9A 4XSGA 3GLHE 4FD2A 4LYFA 5IT5A 2ZU0C 1CR0A 2IYYA 3A1WA 2F1IA 1LB1B 1GIAA 1Q1BA 3AVTA 4E09A 1SQ5A 3AH8A 4TLCA 2XAUA 4P4SA 5M04A 3CONA 4CT4B 2BKEA 2ECKA 1NVWQ 2WVJA 4GNKA 1M2OB 1VDZA 2YHSA 1JXOA 3SJCA 2QN6A 1XMVA 3LNCA 1Q1ZA 1SKYE 4POAA 2WWXA 3F0TA 4Q4HB 3TR5A 5K8TA 4HEJA 5DSZA 3FOZA 4C9BA 1FTNA 1E9EA 4OI2A 4PXAA 2YYZA 3Q5DA 4XOIA 3B78A 5ANRB 5LD2B 5CJ2A 3UIEA 1QHSA 2Z6VA 3FMOB 3OEEA 2XOKD 1Z6XA 3WHLA 4TMWA 3ZVLA 1XJ0A 4NMMA 5J5CA 4LJYA 2J45A 4AKGA 3BFKA 4TYQA 1T9HA 2RGNA 2W0MA 4MKGA 1L7VC 1KGDA 3I92A 1CJKC 1R0ZA 2PJRA 1E79D 4PHTA 1Z83A 3KKOA 4TTQA 1XP8A 3DPUA 4IDPA 1G3MA 3IO5A 2YV5A 1JXMA 1YR8A 2BVNA 1PVOA 5TY0A 2FEMA 2ZJAA 2C9CA 2CE2X 3IUYA 2H57A 3D6TB 2ZVQX 4Q4AB 4BLRA 5KNCA 2ORWA 2IYWA 2QTVB 2ZRDA 5IK2A 1DAEA 1SVMA 5CB8A 2FDCA 3PITA 2D3WA 1DAHA 2ATVA 2ERYA 4GT1A 1GP2A 2X2FA 1E79A 1T0JB 2R9VA 2WWHA 2HT6A 5JSZA 1FOEB 2FG5A 2OCYC 2VL7A 1OPXA 1Z0DA 2CJWA 4QL3A 5JWRA 1Z2AA 1KO7A 1J99A 5JHGB 3GJ7A 3SQWA 3QY0A 4B71A 1SXJC 3NBFA 1HE8B 1KK2A 4O3MA 1FQJA 2PT5A 1HTWA 5FUYA 4C0BA 1C1YA 3KFVA 3A4LA 4FXPA 4JKIA 3VU9B 2GJAA 1ZD9A 4HLUA 3QPWA 1GKIA 3PUWA 1OH6A 4MGYR 1HA3A 1G41A 5LPNA 1MO3A 2R2AA 1XEFA 1E6CA 1F2UB 4AYWA 4QHYA 4US0R 4OJKA 5L3QB 4AI6A 4D4JA 1RPZA 5JRJA 4PR0A 1CKEA 2C99A 4LHZA 3QG1A 1GKUB 4HZIA 3BK7A 1KKMA 3LO5A 2W6IA 4D4MA 4HATA 1YVDA 2VHJA 4A8JB 3K9HA 2G1KA 4G5QA 1QVRA 3AP2A 1CF4A 2GA8A 3B8HA 1KZ7B 3CW2A 4JKYA 4F4IA 1RRPA 4LJ6A 1W5SA 4EJSC 3CRMA 4MRVA 4MDFA 1F2TB 2J87A 4IFBA 4MRPA 3TSOA 1SVSA 3AF0A 4LHXA 3RWMB 3UXMA 5AUNB 1G3IA 4ZKEA 2VP9A 2LKCA 3L2OB 1HH4A 1QHYA 4BEBA 3NC0C 4IXMA 2IYLD 4KODA 1KDRA 2GK6A 4M22A 3WXMA 5AJYA 4CGZA 5J4HA 3FGNA 1TX4B 3N70A 1M1YE 2GKSA 3GJ0A 3RYTC 3T15A 5HPYB 3J81k 4DT1B 4WOPA 4V02A 3ZYCA 1Z6YA 3H1TA 2NO1A 1YZGA 3GJ6A 4M53A 1TUEA 5FBQB 1XWIA 5HKKD 4OHYA 5FL7A 3QF4A 2PZFA 3QKUA 1RE0A 1WMSA 1FNNA 5EJEA 2HV8A 5DI3A 3TUZC 1KMHA 3PUYA 3R8FA 2GHIA 1OIVA 1DBSA 1SXJE 3C15C 3MSXA 3EC1A 2KBFA 4EFMA 1HY3A 1Z29A 1DG3A 1ZVQA 2QGNA 4U7DA 1OJLA 4B74A 2RCNA 1UKZA 3MFYA 4TYWA 4A2PA 3B5JA 1FPMA 2BHRA 4URVR 1CRQA 3SC3A 3VU9A 4EIWA 3C8UA 3UK6A 4AC9A 5KPJA 1EFCA 1PZNA 4KYUA 3GLIE 2B7CA 4YXWA 221PA 1G4AE 2XJ9A 3TSZA 1XD2A 2AK2A 1YR6A 3AKEA 2N46A 2VSFA 3IO3A 3LVRE 2HYDA 4WXPA 5DYGA 1RRGA 4MYHA 2PH1A 3JVVA 4TMZA 2CMKA 4V0MA 3DEFA 2IF0A 3KZ1E 2YC4C 4QG7A 1N0UA 1E2EA 1NMXA 3V9PA 2UZIR 4DC9A 4B33A 1ANKA 4GBMA 4GOXA 4HB2A 2QZ4A 4XD7D 1JJ7A 4DLZA 2OZEA 3BERA 4F91B 3EZ6A 5FPYA 2DWOA 2ODBA 2VSXA 2F3TA 1JNYA 4AYXA 4G01B 2QSZA 4EDHA 5TV2A 2IX3A 1G20E 1IBRA 2C95A 2J41A 4DDWA 1R6BX 4PQYA 1UBEA 1P6XA 4PC7A 4DEXA 3ZD6A 1CRPA 3S1AB 3WYGA 4BGDA 2OCPA 1DAFA 4X8OA 2VPPA 3GLGB 2D62A 4LDJA 3NVAA 4LGMA 3RWOA 4V0KA 4BFYA 1GFIA 5BN3A 4MYTA 2GJ8A 1CR1A 4ZDIA 4NCKA 2JIZA 3B1VA 1P9WA 2W6ID 2ZR0A 2KWIA 3SI7A 4LJ5A 1MABA 1DVRA 1OXVA 1VCIA 2W6JA 4OKSA 4QKQA 4CEHB 2UZ3A 2YC2C 3ZD7A 5J4YA 2GBLA 2QMUA 1Z22A 3FKSD 3SFZA 3SHWA 5D3QA 3I5XA 4J0QA 1R2QA 1ZM7A 5JWOA 1V5WA 2BMDA 1HT2E 4P0TA 3IHLA 3ZGXA 2BCGY 1B23P 2JLSA 3QXHA 1PUJA 1W7AA 3AF2A 1HQYE 2F3RA 4X8LA 2B21A 2FWRA 3LVQE 2EW1A 5FOVA 2F55A 4I4LA 1NI3A 4Z8YA 3HJNA 1D2NA 4OK6A 2Y8EA 1GOTA 2VEDA 1CR4A 3TVTA 3GLIB 1G3QA 3WNDA 2OCBA 2GRJA 1XXHE 3LX8A 5DGXA 4Q1DA 4D26A 4YC7A 2AXPA 3CLVA 2DY1A 3A37A 1XPRA 1GRQA 3P4XA 4KBGA 2IS6A 4DCVA 2FEOA 4BRWA 2GXAA 4D0NA 3ASYA 5J4VA 3FFAA 3VKGA 4FMDB 4QGGA 1GRRA 4HI0E 2GJSA 4G5GA 4PC2A 2H5EA 2DPXA 3SYLA 5AJWA 2ZRIA 4O25A 4AKEA 4ZO4A 3T35A 2O8BA 4AG6A 1BYUA 3VAAA 2C98A 1RW4A 4KSBA 1XPOA 3QQ5A 2VP4A 4ON9A 5ELXA 1OYWA 4OHVA 3HR8A 4Q9JA 3U7EB 5BWMA 3WNBA 3LFUA 4UXHA 2WMNB 4FCTA 5KYKA 4YXWD 1KNQA 1XX6A 2YWEA 2FNAA 3B1WA 4QHSA 2Z43A 3AM1A 1NJFA 2Z83A 3WMFA 4ACBA 2ZR7A 4QXAA 2XGJA 4OI4A 1ELOA 1F48A 2NZJA 4WVFA 2QORA 4URYR 3CUEF 3N2EA 4MQBA 1KJYA 4QJ5A 4BUJA 4O2RA 3BH6A 2GF0A 2Z5FA 2FE4A 3KFXA 5KDOA 3K0FA 1OFUX 2Q9BA 3AKCA 1CBUA 4G0NA 1VIYA 2AR7A 1R8SA 2C78A 5DI3B 3ETLA 4M9SA 5A5GA 1RFLA 1Z6AA 3T1OA 4UKDA 3T5DA 3KKPA 1XCGB 2JJ2D 3H4MA 1AM4D 2LCFA 5FI0B 3RC3A 4PANA 2C5LA 3EG5A 4KITB 2ZXUA 4WXRA 3NEYA 1I2MA 3NBYC 3VHXA 3IILA 1E9BA 5HE8A 1YKSA 4LBWA 4QGHA 2QP4A 4M1OA 3OESA 4LY6A 3P32A 4RVCA 4YONB 3EWAA 2ZI9A 4LPKA 3U3KA 3W6OA 1XD2B 4B2PA 4C0LA 1ZIOA 3K53A 4Q4LA 4JL6A 3WHKA 4R7ZA 4Z1MD 4BFUA 1TU3A 2R6FA 1J8YF 1KO1A 2J7KA 2UKDA 5TARA 2F1RA 5H68A 2ONKA 1UPTA 2R8RA 1KDPA 1SHZA 4OQFA
chains in the Genus database with same CATH superfamily
2R8YA 1HLFA 1RPJA 4IGFA 2ZIVB 1CS4C 2R79A 2BFAA 5AVKA 4TLLB 2G9NA 3B6IA 4D45A 3RH0A 4PZZA 4JHLA 2VQSA 2QZPA 3LDFA 2XQIA 3O4RA 1QGUB 3F7NA 2RDMA 5GONF 1V4NA 4HNVA 1ZSYA 1A04A 1RLMA 4EKNB 2JW5A 2OORA 1CY8A 1GPLA 3BGIA 4JJZA 4MI9A 3TZCA 2HOQA 1T43A 3CFYA 2W2LD 3LGAA 4RORA 4O1MA 1XTKA 4RJTA 3I5YA 1XTJA 1EG2A 4J1TA 1KJQA 4RSMA 5JAZA 4B6QA 4KN6A 5DSTA 2PHZA 3CW9A 1NBME 2O2ZA 3BDVA 1PD1A 1B8OA 2VP6A 3HCWA 3PK0A 4AKHA 4FYVA 4P5PA 1C8KA 5L53A 2OQVA 1ZL0A 3FYTA 3T1HB 3BTSA 3CZAA 2CT8A 3I5MA 1XA3A 3PEUA 5K1ZA 3HU2A 2P1DA 3TW8A 3MB5A 1D8TA 4QA9A 1SVKA 1XZDA 1ZICA 3WAJA 3VKUA 3WQBA 1VZ3A 4A0SA 2LR0A 1LJ8A 1YTLA 4MW0A 1YMUA 1VC2A 4FMBB 3ZWKA 3HWX1 4DSOA 1OXSC 2DBVO 3A2NA 1T2DA 3IHKA 4UTVA 2JEOA 4FQ5A 3DH0A 1ISSA 1INLA 2G6BA 3H9EO 3ER8A 4I9FA 1Y34E 2N0SA 1P8JA 2ZI7A 5FI1B 4MULA 5TQJA 3G0HA 4OFZA 3GR6A 5ALGA 1O94D 4LSGA 1KNXA 3IYLW 3WRWA 3K1AA 4KUHA 4HB0A 1XXLA 1E3WA 3MPUA 4UASA 1NYTA 2GPBA 3K9GA 5T3UA 4B3DA 2ETVA 3MBOA 2YQ5A 4O4LB 5JNTA 4JB3A 3A4MA 4E70A 3M6XA 2ZRCA 5KNDA 5JISA 2HJGA 4X3PA 5KYVA 1M7HA 2VTEA 4FWIB 1AK2A 1VM6A 4XIGS 1C1HA 1B3BA 3JYHA 4M8SA 4MQEB 2R86A 1NVEA 3DEJA 1WAMA 1VHQA 2P4UA 2RCYA 2ZIXA 4GNRA 4L8LA 1UAGA 5J40A 2VA9A 2NUAB 3DWFA 4A36A 1S3IA 4DB4A 4PVDA 1N1DA 3F1LA 3UANA 1LVGA 3QKTA 4JC4A 2PCLA 3AL3A 1I0IA 1K7EB 1WEHA 5HIKA 3TW6A 4ESVA 2GDJA 3K0FB 2YNMA 3C1TA 3I8SA 1YB1A 1NSTA 3LC1O 4GLJA 4HGYA 3K31A 4Q9KA 1G63A 4MWCA 1BVUA 4PYQA 2EFGA 2QRLA 5J63A 3JS5A 2VBFA 3ZWQA 1L7NA 3UCEA 1TYZA 5KX5A 4CLDA 4FYWA 3FNBA 1F17A 3DFMA 1H2YA 3HRHA 2REQB 5U4XA 3V1UA 1DIOB 5I3ZA 4Z4FA 4ODIA 1C3OA 3PCRB 4D8TA 4DR2B 2I4NA 3UAYA 4PHFA 1N32B 1OLSA 2IYQA 1LWOA 3D6VA 5IX8A 5K45A 1CEEA 2GSWA 1X80B 4MRAA 2C04A 3QMVA 5ALNA 2ZRPA 2HO4A 3GLGE 5A5VA 3L18A 1CNEA 3PNKA 2X6RA 4KMSA 1Q6ZA 4C30A 1BZYA 1W47A 1GQQA 3GC6A 1J5EB 2HT1A 1QE3A 1LSUA 1LDEA 3Q5EA 2ZK7A 4WD3A 1HDCA 4YMGA 1WZEA 2KS6A 3ZS8A 4JVNA 1MJNA 2KSQA 3D2AA 1FIUA 1AKEA 1VFNA 2C8VA 2C3PA 2VF2A 4O4JB 1Z4QA 1Y8AA 3BHIA 3UKJA 3UJBA 3LH5A 5C18A 5KKCA 1LNQA 3HGQA 4EW6A 4NDZA 4GZ6A 1TTQB 2ECOA 4PC6A 3X43A 4FHGA 4HWOA 2B1IA 1LF5A 2XWPA 4F5WA 5F35A 2VI5A 2XITA 1YS2X 4I1RA 3TD2A 2X0DA 2PLWA 3DGEC 4W5QA 4J0FA 3VVCA 2H4YA 3VXKA 4LKRA 2ZCJA 3HHEA 4NFYA 2WU8A 3LA6A 2XUGA 4W9NC 2H59A 3Q6NA 3F46A 4RWZA 3DLHA 1G16A 1H6AA 4KAAA 1JTEA 2FSUA 4AMYA 5HWSA 1VPDA 1IY2A 4PQFA 3CXUA 3SG0A 5DYIA 4EQ6A 4IIBA 5IARA 2HMWA 2HX1A 3B7PA 4MEBA 4ZYTA 5HJEA 5A6SA 1QZ3A 1THGA 1Z12A 3CRQA 4GBJA 5JCOC 4R0VA 5TJHA 1T3LA 3UAOA 1E6LA 1Z47A 1NL3A 1GT6A 5HVNA 2FUG1 3JRNA 2GAIA 3O90A 4EGCB 4XVUA 3ZUPA 2PGXA 1NGSA 3EOBI 5CEFA 1SEVA 2QN8A 4LTDA 1YS6A 4FOLA 3ASUA 1I9GA 1ICEA 4O2LA 5LYYA 1ZCJA 1E4EB 1ECLA 4LECA 4EA8A 4M2LA 4PWZA 2BONA 4J7CA 2C9YA 4FYMA 3COSA 3FPFA 1G9TA 5AHXA 1WUTA 1JFFB 1P45A 3NJRA 3PXUA 1D09A 1KJ9A 3ETNA 3JVIA 1X77A 2DWUA 2DBRA 4M8IA 5ALRA 3QX9A 3IP6A 1FJXA 4DYHA 2FPIB 1NLZA 1IOWA 2JJ2A 2ES4A 5EKSA 3KQLA 5ER9A 1U8YA 4Z53A 4ZHQA 1KSJA 1H0RA 3TM5A 1XDSA 3G2HA 3Q85A 4HQFA 4L4ZA 3E7WA 4PN3A 1L7QA 1TMKA 2JFBA 4KGDA 1CQIA 3D3WA 1XEAA 1YASA 3HJAA 2UXBB 2X4LA 3GJXC 4JBYA 2OFWA 3KZNA 1BQ3A 3H65A 3OZSA 4Y2XA 1VPWA 3WYAA 3A04A 2DQYA 4B6RA 1XPJA 5LBIA 3D3QA 3HKEB 1JL3A 4J7AA 5SICE 4WK6A 3PD7A 3H5LA 3RTDA 4NQRA 1LW6E 2X2EA 1D3AA 3L0YA 2PFKA 3IR7A 4QSHA 1Y5LA 2ZVPX 4PPGA 5BT9A 1R9JA 4W9NA 1NC3A 2OV3A 5CVEA 3A0RB 2ORYA 5C5IA 5ADVA 1FFGA 1MB4A 2TS1A 2XCLA 2GEUA 4ZQHA 1M2VA 1T26A 2PS3A 2R4QA 2HEIA 1HYQA 2QD5A 3FSGA 3IVCA 1AQLA 2EJCA 1I3CA 2ISSD 2R8ZA 4MXDA 2WM8A 4EYQA 1KI6A 1NUUA 3F47A 3IS3A 4OBEA 1SZDA 1JP7A 3M6AA 3TR0A 5E6RA 1Q21A 5KX5B 2WF7A 3QWAA 4CDNA 1PR6A 2J6BA 4UU1A 5FHQA 3P0IA 3Q8WA 1ZW6A 3BBPA 3EYAA 3I9KA 3QA9A 4NZ9A 3HBJA 2HD4A 3IPCA 3W77A 2WT9A 3WB1A 3K9LA 1VPVA 2AKAB 3CPJB 4MS1B 5EUQB 2XCQA 4G89A 3HGMA 3UB4A 1MB9A 1AZWA 2Q3CA 1R0XA 1TPYA 1DMSA 3Q5GA 4RD1A 2NU6A 3CR8A 5CYPA 1PGQA 2EDAA 3CLUC 1PLKA 2WP8J 5DWQA 4KX5A 3QMWA 4D6XA 1O8CA 4A4DA 3DL7A 3HKBA 4RTJA 5EUBA 3CB4A 3E9ZA 1T34A 1KQ3A 2QAGA 3CF2A 3K9QO 2WU4A 3RU9A 3D7SA 3ND7A 1U6KA 1T15A 4E7OA 5KTNA 3B1YA 3TWOA 3WQSB 2QNRA 1SELA 2FOLA 4KMOA 3UAGA 1P17A 4R2LA 3R1IA 4ZCQA 2BSQA 2EVWX 1DEHA 4DC0A 1TE2A 3P19A 1QMGA 1REQA 1JVSA 3D0QA 1YZFA 1V6CA 5B30A 4I1PA 1OGJA 2ZOSA 1VE9A 1TEHA 3ONFA 1K7CA 1PR1A 3ICWA 1I4WA 3FLAA 3G8CA 3LI2A 3LUJA 4LAFA 3KOUA 3IMCA 2DECA 1MD9A 1EJ0A 3DTTA 4G3XA 4JEMA 4W8OA 1LLDA 1M33A 4ADSG 3MILA 1M2NA 1QQ6A 4FHEA 2G09A 3MTAA 3VJLA 4F6LA 4LMRA 4B44A 3GRVA 2EFCB 1YOVA 4HAOA 1QXSA 3DLIA 3VR4H 3KTAB 4OHRA 5FWAA 5C9ZA 4BLTA 2R25B 1R9MA 1XNJA 4XWOA 1C9EA 3EGXA 2XB2A 3GO4A 4YJGA 2HA7A 3L0DA 3ZU4A 2BLLA 2HLDA 3OFND 4LJLA 1R7RA 3RYIA 1KAMA 1MRSA 1PQPA 1TJYA 4WFJA 5E1MA 3IEMA 3EWIA 4PO1A 4ZV7A 3MIIA 4XQGA 3ZWNA 3B9PA 3QX7A 4O4IB 2QRJA 3WP1B 5A0FA 4NABA 4ZJPA 5I45A 1AQUA 1Y9EA 2WBLC 1DKMA 1E63A 2CL0X 3R8XA 3VR1A 1UIRA 1OV4A 2R7KA 3G8DA 1YZQA 1GN9A 3R5JA 4OATA 2PUFA 1AZSC 1L5ZA 4KYIB 1T9BA 1D4AA 4Q1CA 3HZHA 1BCRA 2RH4A 1IL0A 3MUFA 5E2AA 1IJKA 2DBYA 1E5TA 4E2WA 3K6RA 3Q7QA 2HRZA 1J42A 2YV3A 2X9LA 2RB4A 4H7JA 4HVCA 1ENYA 1UF9A 1XN4A 2HWWA 2IXDA 2NYVA 1Y1QA 1H5UA 2QEQA 1UMBB 2WMYA 3A1TA 1NSFA 2IP1A 3NRBA 2P8SA 1T5LA 3IQZA 4XWKA 5IBQA 1B2LA 4JUIA 2PZMA 1VG8A 2P2CA 1FQOA 4N5MA 2VRWA 5TMBA 4UCWA 4JNKA 4IEIA 3CEAA 3CR3C 3QLUC 1QSGA 1XEXA 2N42A 2Q1WA 3FCEA 5FT9A 3TE7A 3QNMA 4OSOA 5T4FA 1P3Y1 2CLSA 5B7GA 1ZL2A 4YYEA 2I76A 4AWAA 3TTSA 3R7DA 2OO7A 3E84A 3P2YA 4MUEA 1EK1A 3I1FA 1F4LA 1U7WA 5IKOA 2FKNA 4Q9NA 4EPVA 4U6SA 5LKRA 4NU0A 1KO5A 1JDJA 4HDCA 1GSIA 1E66A 1Z9BA 2H6EA 2HIMA 4UZEA 3RRZA 3RT7A 3DGFC 3HBAA 4J2HA 1WXQA 3SOZA 3CG0A 4TLBA 3DCYA 2BMFA 1ODFA 2EWVA 1AGRA 2BWJA 3D0RA 3PGVA 4RVSA 4W5HA 1A5SB 4E13A 4DA4A 3FSGD 3W5AA 4G1CA 5COBA 3B6KA 3BWVA 4L8WB 4OHKA 4WNAB 1L5HA 1G2QA 1POXA 1P0CA 1HM5A 1PAUA 1P8AA 1RYHA 4AURA 4BO2A 1S9HA 4GYYA 4P6VF 4ARZB 1U0FA 3GQBB 4NZYA 5CLGA 1T2CA 2JI8A 5E9AA 4TSFD 5C52B 1XYYA 4H60A 1K66A 5AJXA 4DKJA 1J49A 1KAOA 4IGKA 3MTGA 4ZIRA 2I8CA 4K26A 3NANA 5FR1A 4BQNA 2H2AA 3H87A 2OP0A 4X7MA 1KI3A 2C8KA 3BILA 3VSCA 3ADPA 2ZM6B 1SA0A 3HB5X 2H7VA 4ZO6A 5M2QA 3U5TA 1ECPA 2BH2A 1USIA 3VI4B 4C4AA 2BOVA 3ZEAA 3D2LA 2WF5A 4UMEA 3H9UA 2XMRA 4J94A 3BCHA 2FPIA 5H3LA 4ZC1A 4W9MC 3PLNA 5AM1A 3RIHA 3TH5A 2AK3A 1UPBA 4F72A 1UT8A 2OFOA 3BF8A 3QV2A 1TFRA 2I3ZA 4X90A 4IJUA 3A6KA 3VU8A 2HB6A 3OCVA 4NG4A 4P0QB 1C8LA 1VLVA 4M0EA 1MQ9A 3OZIA 1GVNB 4WN3A 1JDNA 3H8SA 3AUSA 1ZN8A 3FVWA 1WDWB 3S1SA 2YTZA 4UTNA 5EHZA 1NBHA 5BNIA 3KJQA 5ES4B 1EP9A 2ZR9A 4J2TA 5ISMA 2VPXA 1EK5A 4A2QA 2HK6A 4LC0A 4PAQA 4CTOA 1XDDA 2NQ8A 3SZUA 3E22A 2G80A 2XTMA 3UJ6A 3FNGA 2YRFA 2FUNB 3NASA 2EZ4A 4LXXA 3WLTA 1XL0A 2D2FA 2WABA 5BQ5A 4B3BA 1EQAA 1MEOA 2NXWA 3NRJA 1RHRA 2OLJA 3KFLA 4AY3A 5MF6A 2DCMA 4GLLA 3EW9A 4KJZA 3E1KA 4LDRA 1N8TA 4MUBA 1DAGA 1JFSA 3CH6A 1FDTA 1LPSA 1MG5A 1WCV1 4HYYA 3WL4A 3RW9A 2EJWA 2IHVA 2XRYA 3SQMA 3X2EA 4PAOA 1GA4A 5ALDA 4N49A 4AZ0B 1PHPA 4RV4A 1QIFA 1C7JA 3O7MA 1ML3A 2GK4A 1EXMA 4HEHA 1XWFA 2PYDA 2QQGA 1P2TA 3AUKA 5K0LA 2DLDA 2ZB8A 3QU7A 4HH3C 3U4AA 3W1WA 3L4EA 3DYIA 3I09A 4LZLA 3RSZA 4DVJA 3W9YA 3CKYA 2XUHA 1DFHA 3L6DA 4B8WA 4LEIA 4DV0B 1EGMB 3OJLA 1U2SA 1C1DA 1MF7A 3R8CA 3RKUA 2WYUA 3PDIB 4X1YA 3JTMA 2OCGA 4KOEC 3KBBA 4ZYZA 3L8DA 1DFIA 5JXHA 3EGXB 1Z74A 3DMPA 2V7QD 1UXOA 2JD1A 3E7PA 1YZLA 2RHCA 2CDAA 3TZEA 3LCVB 5C3MA 4RMNA 2XXAB 3CO5A 3CV3A 3P5BA 4R1LA 3KHUA 4TQGA 4UNNA 4ZEWA 3T0IA 1NY6A 9GPBA 1T9AA 3I3SR 3KXDA 3PEVA 4G9GA 4YT5A 5G4LA 4DLVA 2GZ1A 3ORFA 1V26A 3HB9A 1PL0A 2BGTA 1V37A 5HRAA 3I04M 2NO9A 3COZA 2O2CA 4K9LA 1X94A 3KU4A 5HE9A 3A26A 2DSTA 1W8IA 3EGCA 5CYGA 4P34A 2YOHA 4LQLA 1VJCA 3GEIA 7REQB 1ZJ6A 4HWKA 4LDPA 1MQ8B 2QE7A 4WADA 1IN4A 1F2VA 2VWHA 1MX5A 2R1TB 4FYKA 3EH2A 3TL2A 3NUQA 3FCOA 3OLCX 1QH9A 3NBMA 4Y2TA 1Y42X 3DLAA 1QB8A 4LISA 4NC9A 4KJXA 3M5DA 3QHQA 1ZM4A 2HHCA 5HUJA 1QS0B 3B9RA 5KHOC 2J7PD 4US1R 5K4HA 2QTCA 1HE4A 4K46A 4OYHA 1JHQA 4XYEA 4YJ3F 3EIHA 5TNXA 2P4QA 1HX7A 1IWOA 2HMSA 1YHZA 5EHNA 5EJ6A 3F9RA 2ATXA 4PAWA 3PSAA 5C2JB 5A7FA 3GD7A 4Q01A 4URXR 1JE1A 4KFUA 4Y2RA 1C9JA 1E1CA 1W88A 1X8XA 2QVYX 3TD9A 3OWXA 4YRZA 2V9PA 4TZKA 4YYZA 5CDUA 3L92A 3FHJA 2ZIFA 1NFQA 1DUIA 1Y5MA 4N48A 2IEGA 2L0XA 3JQPA 1CD5A 1TC2A 4LIPD 5CT8A 3VR5A 1Z4MA 2XIJA 3BJIC 2PQMA 3OQMA 3IT1A 2H1VA 4CMCA 1PJ3A 1WB6A 4E51A 2BCEA 4JYBA 1G66A 1KDOA 1ZBDA 2PIDA 3TM4A 5GIPE 3W5VA 1FS4A 1YZUA 2WSYB 3E27A 3AO0B 4NHOA 3ZCTA 2H29A 2ACVA 1FP1D 4M1WA 1SURA 2PSSA 2V4MA 4GEKA 4RF3A 2IHZA 4TTPA 3I8XA 4MZXA 1RBZA 3V32A 1NYRA 2YHAA 4QQKA 3IDAA 4RS3A 3TXAA 1NMEA 1U80A 1T5SA 4C7VA 4ZEMA 2QMYA 2RAFA 5DISB 3RTEA 5JROA 4RANA 1XD9A 1BFDA 4N76A 3R5FA 1Z36A 1K0FA 4UREA 1VE5A 3OQVA 4HVLA 5F21A 3TSWA 2DTDA 1FFHA 4P7BA 1L1RA 3QMMA 3ABRB 4N54A 4HS9A 1AG9A 4AULA 3LZ6A 1U8AA 2WFZA 1NVVQ 2ODPA 1FDUA 1HURA 1OHHD 2NVUA 2R48A 2ZBUA 3ESBA 5JXWA 5INTA 2XGMA 5CLLA 4EUHA 1ZVKA 2AIRA 2VH5R 4QFMA 4TQUS 3G0IA 5KB3A 1PNTA 2VA8A 3UWMA 1JAZA 5IJZA 3WLJA 1LK0A 2HSDA 2ZIGA 2BISA 3HDYA 4FFNA 3FWYA 1DB3A 1O97C 4NNJA 4UOQA 3K1JA 4JX8A 4DDVA 4NE9A 4OQQA 2QTBA 4QGSA 3VYVA 4ZMSA 4PC3A 5CDYA 3W5BA 5JSHA 3MJRA 1X14A 4F6CA 3ACBA 1E4OA 4LWOA 2G83A 4BO8A 4QUJA 1S8NA 1JJFA 2XE7A 3MGGA 2HK9A 4PGMA 2DJIA 2H2IA 3FDXA 5BMVF 2WYVA 1XZEA 1AGNA 5BV1A 4C78A 1QIGA 4RIEA 1EQUA 1E0AA 2EGUA 2PL5A 3SHFA 1TYDE 1LD3A 4M1ZA 4ZO9A 3H9QA 3IBYA 2ILVA 1FLAA 4QQRA 1WABA 3ZUGA 4IUCS 2E1PA 2XMPA 2E2WA 1N6HA 2ZRGA 5FBWB 1L8QA 2QL6A 4OAPA 1NN3A 4MW9A 4Q4AA 1U8UA 2VXBA 4XEHA 2FN7A 3CRRA 1GSHA 1OWPA 3H1EA 3LC0A 3CGWA 3O83A 4ND2A 1I8TA 3DOUA 2NO4A 4A6PA 4ZI7A 1C3EA 3PPIA 3Q9UA 4RQUA 4GRIA 5FYDA 1WV1A 4NBLA 4FZRA 5DT2A 2H9YA 2O5CA 1Y7PA 5E3HA 4WHMA 3LL4A 4WBNA 2AN9A 4FFWA 4O4JA 1JDPA 2BIFA 3S1AA 1UBLS 1XTSA 1WCYA 3B60A 4GSYA 2BJWA 5GV7A 4BNNA 1QQBA 1TU4A 1BXZA 2WWVD 5BMVA 3T3IA 4P38A 1JSLA 1Z15A 3TIIA 4MS3B 2XUKA 3LVFO 4X94A 2WWYA 3VPHA 3IQIX 3KQKA 3GUUA 2I1WA 4RLQA 2O3JA 1VL1A 3GUZA 4R1TA 3WDMA 4O29A 4B7XA 4FWTA 2ATIA 3AOEA 1CU1A 3AM4A 4QOIA 3L1VA 1E7SA 1GHTA 3D6HA 1JLLA 1FU8A 2RGBA 4KXFB 3PZRA 3QPUA 3FPSA 4H4EA 1M6YA 2AQHA 4WK4B 4EL0A 4EKDA 3D4IA 5BSKA 1RWQA 5I7FA 1RHUA 2HNKA 4CKWA 3WFZA 4XVRA 4IZ6A 1L4YA 2V5VA 4B34A 5LZ8A 2B4KA 4KOAA 1DTWA 3OZ7A 4JX9A 2WT8A 4YCMA 2NTVA 2VDMB 3PGLA 1Y1RA 4GMHA 1JG7A 4MQUA 2FQ1A 2DUMA 2ZYTX 2HLNA 1VBNA 4QLBA 3KYDB 4RACA 1TNDA 2BTOA 4US2R 3PSHA 2ZWOA 4Q12A 2FWPA 4A03A 1IQRA 3SEQA 4PFSA 2IZ7A 4DDTA 5FTMA 2RHOA 3DCJA 4LYYA 3TRKA 3HCAA 3OUTA 2WNIA 1GPMA 1OC2A 1QDEA 5K3FA 1MJ5A 1EE1A 2ZWMA 3MF4A 1NJ5A 3TZ6A 5DP1A 1UH5A 1LRJA 3O8CA 5KU1A 4G4JA 4RAQA 3A6PC 3HCFA 2OHXA 1W85B 2WSMA 1I7DA 2IBMA 2OGZA 3KQTA 2WHXA 4V38A 2JFPA 1SUPA 1T1GA 3LOQA 3LAWA 5JMWA 4IM7A 3JATB 1KWKA 4BFZA 5BXQC 1ZCFA 4U0JA 3KQQA 1EUDA 2ACWA 5CH3A 4BJHB 5AK4A 3AI7A 1M34A 1P9NA 1S2IA 2H07A 3Q1KA 3HR4A 1YO6A 3KLBA 3LW8A 4UBLA 4B6SA 4BNGA 2J9YB 3PFWO 3WRXA 7YASA 4ABTA 3CH5A 3CZRA 2QM7A 2FFQA 2I2DA 5EJ9A 2HMAA 1YZNA 1L4GA 4E2YA 1ZN7A 1D1PA 1CLEA 1FX1A 5AI5A 5F9HA 1B6TA 1TW3A 1QFXA 1KKUA 2WPNA 2WVGA 3AR3A 3C8MA 1DBVO 3OBIA 2RFLA 5I6DA 4OCZA 1ZN2A 5KTYA 3QV1A 2Q2QA 5F7XA 1QF6A 1CC1S 1G2PA 2VK4A 1NJSA 1W4RA 1KJNA 2OILA 4UTXA 1VKOA 1GPYA 4QWWA 4QUGA 5KREA 3RS7A 3T9DA 4C6TB 1UADA 5JWHA 5DX8A 1KKLA 1G21B 1QK3A 1U5CA 1VECA 1A8SA 3EDCA 3ENVA 5KYGA 3KOWA 1N2IA 1ZC3A 3CIOA 3MWKA 4HH1A 3UJ3X 1XRJA 3O21A 1O4VA 1C7RA 2PWZA 4Q9DA 3P45A 3Q0IA 4KLNA 5B6JA 1CJUC 1P0MA 4LGVA 1KZGB 1MOQA 2GXUA 1DKQA 3AY3A 1KE1A 4F3TA 3KKMA 1I6MA 3TO5A 4HDAA 1JJBA 4TUYB 5ITWA 1ECFA 3SM3A 2EC5A 1UBFA 4PYRA 1JA0A 2XD9A 5KAMA 1MX1A 1CUGA 5BN1A 1YRYE 3VR5H 3PXXA 1N0WA 2O7NA 1SIWA 4V0ME 2GHTA 1P1BA 1ZGAA 3IAS6 1JNXX 4KXNA 5TVGA 4CKBA 1E9VA 4UUOA 4M49A 5EWMB 4HX9A 3SEAA 4B2LA 3HKDB 1UK8A 4IXTA 2Y4OA 3RHTA 2PBFA 5G1OA 1EA5A 5B3LA 2AR9A 1UXJA 3NC1C 3IP7A 5BW5A 3IBSA 2BKVA 4ACAA 3P0RA 1P4SA 4U7WA 3U5ZB 1M1ZA 5TEWA 2NACA 4H1UA 3GWGA 2PU5A 5CHYA 3E9YA 2GM5A 4RHXA 5HDQA 4A0HA 2YXDA 3D7LA 1VXRA 2I3DA 1B8NA 4PYKA 2IKSA 3E9QA 3NH9A 1Z8FA 2DFPA 3ZXUB 4QYXA 2DH6A 5BQPA 2HBYA 1N92A 2EBUA 4EB6A 1ZUWA 2V45A 3WRXC 1RC8A 2WJYA 2P5UA 3BS4A 2FEAA 2EHDA 3NX4A 3LQFA 3R4VA 1ZI6A 1Y98A 2VK8A 4KX3A 2GERA 4CR8A 1ZY2A 3SAJA 2A1UB 2DETA 1SVUA 3V7UA 3HKCA 3E3LA 4TYNA 2YJ3A 1P7CA 2X19A 4N0PA 1KVQA 3S2YA 2PZEA 2IODA 4YWJA 4Q9AA 1BKDR 4QPZA 3AFMA 1N2SA 5JUWA 5MFPA 2GHRA 5DMHA 1TF7A 2P9GA 5TS2A 5DLDA 5JDCA 4ND4A 4YJ2F 1ZXLA 5LQNA 2XCUA 2C1ZA 3UPDA 4E5UA 3JQAB 1NJ6A 1V35A 4KKVA 2DHCA 3A06A 5CIQA 4ZZIA 2FFJA 3AINA 1NSYA 4MYRA 2HF2A 5JCXA 3LFTA 3DXYA 1F8FA 4RW0A 4Y6RA 3DEYX 5FUXA 5FWDA 3UUWA 4M7RA 2Z2KA 3T0GA 2GJKA 1AJEA 5IK2D 2B3TA 2PU7A 1T5TA 2QRQA 1JECA 2VP3A 4AKIA 2HV9A 1VG0B 3K1AB 4R1MA 1G7TA 1FW8A 2VDUE 2I8LA 4LTMA 5REQB 5IFLA 5JH7B 3F98A 4C4XA 1HDIA 1BVYF 3FSJX 4ZVRA 1ZAYA 1U8XX 1V45E 4JOCA 4LY0A 3LF1A 4OI1A 3WLKX 3SS8A 3TE6A 4K0KB 5AK0A 1B6SA 3GYBA 5COAA 2W2LA 4K2HA 3GT3A 2YIDA 2BGKA 1U0TA 1VCOA 5AT1A 1SBYA 2CLCX 3RTCA 1TTTA 4X9XA 3TLGB 5JALA 1IVYA 1VYTA 3DE2X 1DC8A 3M1LA 1QYVA 3OPYB 4KWHA 4H1WA 3RASA 4UPEA 1I94B 2B35A 3UUFA 3P2EA 3VBCA 4UBNA 4D4HA 3HXLA 2WUVA 1NRXA 4XQ0A 2J5BA 4DBLC 3QVJA 4DLYA 2O9JA 3OZGA 1P4HA 1BCSB 3A27A 3FTQA 2C2BA 4HR7A 4F9TA 4KVGA 5J2UF 3HXQA 3PQDA 3HWSA 1SUBA 1OF1A 2ID7A 2P78A 3LUHA 2HDOA 2FF5A 3PA8A 3V2UA 4XB2A 1YHNA 5LL6P 1G21E 1PHRA 3UKDA 1U5AA 3G13A 5ULLA 2JLBA 2Q29A 4S0ZA 1LA2A 4BVLA 1Z38A 1WUIS 1W1UA 4QO8A 1OILA 2QBYA 3TMAA 2BTQA 1B0UA 3CINA 5E8RA 4BU0A 2ZRHA 2QX9A 5D6NA 2EX0A 1RLOA 1DBPA 1NVAA 4YECA 1R5JA 3I45A 1M2HA 1G1AA 2PQ0A 5DN9A 5GJVC 4TZ0A 3G1WA 2P9EA 3PUIA 5DULA 5HA5A 2K87A 3ABOB 3U7QA 4XJSA 3QE4A 4BMPB 5MN5A 2JGJA 3L0SA 4FYYA 1DU4A 1EZ1A 1WO8A 4ZOLA 4U5XA 2ZZNA 1UEIA 1U99A 3RJMA 4YUXA 4OGFA 3V8BA 4RH1A 5LLTA 3QVLA 1XAHA 1H6DA 2VNSA 3ZQKA 4AK9A 3ZTWA 2QJWA 3RDPA 1GUBA 2CJWB 4CM6A 2ZBPA 1A7KA 3EY4A 4C08A 4Y9UA 3EMVA 2IDMA 5KTMA 3OT5A 1H22A 1JHDA 3AIIA 2H7YA 3F5DA 4JELA 1X7ZB 3VPCA 2C2HA 2BSXA 3I9MA 4YFVA 3PFCA 4IG9A 4I2VA 3IRUA 4ROTA 3RQSA 2Z2YA 2CLOB 1ZH4A 1CUVA 2H4FA 4LHEA 4MMXB 2JJ8A 2WD8A 3A6HA 4RLHA 4WY5A 3R3WA 3REFA 1JG2A 4GQBA 5T5QA 3ZWPA 5IFKA 4CV1A 3N53A 5IDXA 1E4YA 1SWWA 1GARA 4XDHA 5DYTA 4CM7A 1Z34A 1KHHA 4RMHA 5GJCA 1XJ5A 4WPGA 3CCCA 3G0CA 4HAZA 1W4BA 3USES 3I5UA 2Y6UA 1ZJ4A 2QY9A 3CR7A 2C03A 3G59A 4MVXA 4IJMA 5BMVB 2NTYC 1ONBA 2WQZA 3OOJA 4URZR 4I14A 5C3UA 2CL6X 1YR2A 4HADA 2WAAA 3KWJA 3FIJA 1D6JA 2Z57A 5LU8A 5EHGA 3EGIA 2GXSA 1RRFA 5I4BA 2ZS8A 1V7PC 1WSWA 3C3XA 3GNSA 4JBHA 5EN4A 3AL0C 5K6AC 2WTXA 1V3TA 1KJWA 1R6VA 3NHYA 3RARA 4OJYA 2QRZA 2QTZA 2YZKA 2RAVA 4MR8B 3SIXA 3WMEA 3ISTA 3U61B 3MWGA 5FI3A 3OSUA 2JZOA 3ADBA 4FNGA 2ZI4A 3BMOA 2W00A 4WFIA 5HIIA 4D41A 1IULA 1XP5A 3WMXA 4HEA1 1FSFA 4TVOA 1POWA 4PZEA 3BCSA 5DWDA 1HQCA 4Z8XA 2ZBRA 4N40A 1PYOA 5CCDA 3E5MA 3R7LA 3FPEA 5LU9A 4BV9A 1KOJA 3QLVA 4GX5A 1YJBA 2HA3A 3C1OA 4QDXA 4R2JA 3SHVA 3VO2A 1V1JA 1N25A 3MHTA 2Q4RA 2YN0A 1P2VA 1SFRA 1RJEA 3EQ2A 4HYTA 4ZAFA 1GNQA 5EP4A 5L3VA 3U6BA 3E2IA 4BX8A 3EZ7A 3SSNA 2Q21A 2ON6A 4RTOA 1YTUA 4KTVE 4O59O 3ULKA 2FZWA 2O8FA 1QP7A 1C5KA 1BWRA 1DLIA 1U3CA 1QGYA 2IEZA 3LDAA 3K8YA 4MIOA 3RC2A 4COKA 1LSOA 2IU3A 1A72A 4UUMA 1Z5UA 2N9UA 1GXSB 3HLTA 4LRYA 2AV6A 2PDAA 5JC8A 3MTIA 1PKEA 1YC5A 2I6FA 3N2KB 2BI4A 4JP2A 4KPUB 3KETA 5AM4A 3EISA 1E2LA 3O9MA 2H1LA 3PIIA 1BGWA 1CV2A 2WAOA 2AOTA 4IHJF 3OEED 3EZNA 1QGUA 1SPXA 1QG6A 1W93A 3DAGA 1NLUA 4UBMA 1XAJA 2WJIA 4OHXA 4X20B 3W5DA 1OHHA 5ERGB 4ABYA 2JI6A 3I42A 4EY3A 4NDNE 4PG6A 5LN1A 1UL1X 1NU6A 1PVOA 2JIRA 5EZ5A 2O48X 4JMPA 3EXEA 2B1GA 3K96A 2V5AA 1EVYA 4JLPA 4WKCA 1VJ5A 2G17A 3DDZX 1ABFA 2GDZA 4GDMA 4RYLA 5AW6A 1Y4DE 3RUDA 1ZPDA 1GADO 4JI8B 3RS3A 4MAMA 1SVLA 3B1FA 2KM1A 1YQQA 4HRXA 3LDGA 3PD0A 1Q16A 3OM8A 2GZMA 4HDNA 5KJFA 1EXNA 4G25A 1E0KA 1AN0A 4OBWA 1DNPA 4PQGA 4HDSA 4MVJP 1LZKA 1PSDA 5JZBA 1XRLA 2IEBA 2FDRA 4LVCA 4NH0A 3RC1A 4WCFA 3DYBA 5K09A 1M2OA 2FXIA 4QTXA 3ZZUA 4YBRA 5F2NA 1IZ7A 2R6HA 4NE2A 2OXIA 1JS1X 2XJ4A 1Q83A 3SHTA 4G1VA 3FWPA 3N5CA 1A5AB 5AOVA 3RD5A 4OXKA 2ZI6A 1FFDA 1GPNA 3LX5A 1UBJS 4UEKA 1O94A 1QRRA 4BN0A 1VYHA 3JQBA 4LXGA 3ZKWB 1JQJC 3ZS9A 3EFBA 5AJZA 1FB5A 3M4XA 3FMFA 3PTLA 3PNBA 5BQOA 1YAHA 2JCSA 1SZJG 1CEQA 1Z0FA 3PI6A 2GEKA 2GEJA 1QYWA 2WC1A 1MDBA 2A88A 2FH5B 2Q50A 3BC1A 3CISA 2D0OB 3UVEA 1YB5A 2P6PA 3EARA 3EGWA 4E1BA 3MOSA 3CRVA 3WK8A 5IM5A 3T9AA 3EXAA 5IS2A 2XKAA 2DHQA 1JVNA 1RHMA 2GNAA 3ILVA 1FUEA 2C5GA 3GQVA 5AKXA 4JLDA 5AUOB 2IIPA 1Z6TA 2A9PA 1W46A 2NVOA 4I1VA 1T0HB 2PUBA 1VL0A 5JSQA 4RKWA 3RSFA 2IEDA 2XV1A 2JZNA 1H2BA 4TMYA 5DEOA 4YPVA 2ENUA 1QNFA 1S2OA 2JFQA 2XUOA 3T7CA 3SXUB 3O9ZA 1KHTA 3UATA 4KO3S 4PGGA 1NIPA 3ETHA 1NAHA 4V03A 4NCAA 4AF8A 1O9HA 4H77A 3MELA 1FYXA 1T36B 3AF1A 2WWGA 2G70A 3AUTA 2FHPA 1KK1A 2C20A 2JCGA 2OORC 3HWWA 1Y1KE 2FWIA 1O87A 5BSWA 2WDZA 2J31A 5DW0A 3EA0A 1MO2A 4IX1A 4WH0A 3GB9A 3AHHA 3RK0A 1ZJWA 5IASA 1ZAKA 4B5KA 1ZXXA 1UDXA 3TFQA 1Z3IX 4K9RA 1MUUA 4AWBA 5ENDA 4RTSA 3WIUA 1J9ZA 4FDVA 4LYEA 3BGWA 4TRMA 3RANA 1CDDA 3LE8A 5AQEA 3SU8A 5IW8A 2VRNA 5KSOA 1MR3F 4GQAA 5KYTA 2VF8A 1ISFA 3HHPA 1D2RA 2J6IA 3ZHTA 4I2NA 2IITA 4XX1A 2YKGA 2OBFA 3SIRA 1JAIA 1MXFA 2WG1A 1CZRA 5HKOA 2GO1A 3EXFA 3PFFA 3H75A 3QM1A 2HJVA 3LY5A 2ONCA 4IUYA 2VOEA 1DBIA 4ZT5A 4P3NA 5T8KC 4FEEA 4A0FA 1SD5A 3NDRA 1GKKA 1H0KA 3PNPA 3QVMA 3OTWA 1QZTA 4GXNA 4RYDA 5AKEA 3PC2A 2ZUUA 3SHQA 1WETA 3EZLA 3RFCA 3L7OA 1BFKA 5JY6A 2X76A 4HXEB 3HKCB 1WXXA 4NBRA 1X7ZA 3QUTA 4XWAA 2QMQA 2MMCA 3AUFA 1N4AA 2GN6A 2PLAA 2POQX 4PNZA 4OY3A 4AMUA 1ZNZA 3KOOA 2VTBB 3DOOA 2XEXA 1KPGA 5I7RA 3CLSC 2NVBA 4WA7A 3DT9A 1ESNA 4EB6B 3RKSA 2QVZX 1Z2CA 5JJKA 2AMYA 1QLHA 2FPWA 1QH8B 5A3RA 4MR8A 2ZTMA 4M83A 1W2HA 4LTNA 4KO4S 1W36B 4EPRA 4D6YA 5CDHA 3WJ2A 3IIKA 4BLUA 4ZQFA 3TQSA 1UCFA 1NXTA 3DHWC 2J3DA 4FX5A 1FMLA 3G2OA 3OIVA 3LKVA 3MCTA 2VF4X 4KO2S 2BGGA 3OEHD 1NJ1A 4BKRA 1UBTS 4NYMQ 3TLYA 4DLBA 2X0FA 4EQ6B 3B6MA 2ZRAA 4JROA 2I2WA 2UZAA 3R5TA 4CDMA 1BXKA 4MKXA 1V8ZA 1VLLA 3R6WA 5DNAA 3WSTA 4XLZA 2HDHA 2OEPA 3WRYC 3BRCA 4YCCA 3NHBA