5FR1A

Double acetylated rhogdi-alpha in complex with rhoa-gdp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
190
structure length
184
Chain Sequence
IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQASGCLVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords TRANSFORMING PROTEIN RHOA
publication title Rhogdi Alpha Acetylation at K127 and K141 Affects Binding Towards Non-Prenylated Rhoa.
pubmed doi rcsb
source organism Homo sapiens
total genus 62
structure length 184
sequence length 190
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fr1A00
3AKCA 2ZSBA 4DLRA 3VNUA 1LVGA 2V6JA 1WF3A 1E32A 1WQ1R 3QY0A 2OFOA 2WSMA 5JRZA 4D2IA 4US1R 3I5YA 3DMNA 4IDOA 1NY6A 1E99A 1F60A 2CJWA 2CVFA 1OIWA 4AY2A 2EFEB 4MITA 1TUIA 3CB4A 2GXUA 4XVUA 3Q9LA 2W6ID 4Q00A 1TEVA 3PXGA 1TL7C 4UNQA 2FJUA 1E9AA 3BORA 1KI4A 1GG2A 4Q5IA 3O8DA 4TMXA 4MDEA 1YZLA 4A2QA 3PEVA 1A5TA 3U7GA 3UK6A 2J0UB 3P20A 2QI9C 2G3YA 3GJ5A 1IONA 3OAAD 3RC8A 3K0CA 2ODWA 4I81A 4HZUB 2D62A 2ZR7A 2CEAA 4I1UA 1ZUNB 4Q4LA 3D8BA 1DELA 2QENA 2YHSA 1DO2A 1M7BA 3IEUA 1K5GA 2HF8A 3MFYA 1KGDA 3OEHD 2K5UA 3DKPA 4S35A 4CT5A 2IYRA 2YVUA 3A1WA 3M1IA 4ZDJA 3TSWA 4B47A 1X1RA 1A2KC 2NG1A 2RKOA 3SFZA 1Z5ZA 4AWXA 4TYYA 4W9MC 521PA 3C4JA 2VRWA 1RE0A 2F7SA 4A0GA 5BW8A 3LLUA 2YOHA 3KUDA 2AX4A 2WKQA 4K81B 4MUBA 4QBFA 2ANBA 1YZTA 2ZVPX 3X1WA 1G9XA 3I92A 4OJKA 4FW9A 1CIPA 3CRRA 4B35A 4ZCMA 3VR4A 2IS1A 3WYGA 2ZRBA 3T61A 3VKGA 4ESVA 3JVUA 1RIFA 3Q5EA 1YR8A 5B57C 3GLIE 1W48A 2OESA 2QGNA 1E1RA 2XJ4A 4L4UA 3RDPA 2GXAA 4PC7A 4OK5A 5FI0B 1HEIA 4WIAA 2WWGA 1IN4A 2L0XA 2W0SA 2B92A 5J4VA 1JJVA 1AN0A 1GTVA 2C03A 3TQCA 5G53C 5HZKA 2GXSA 3SDZA 4I1SA 4C0KA 5DIFA 2ZE5A 2WIAA 1BO6A 3UPUA 3CUEF 3MLEA 3QG5A 4LI0A 1P2SA 5FH9A 2QE7A 1YR7A 2XB4A 3U5ZB 5C4GB 3L0OA 1KMQA 4F4JA 1FPMA 2IC5A 3X1YA 4UXJA 2QM8A 5FPYA 3SR0A 3ZVRA 2XNSA 4TYWA 3HP1A 5FFMA 2ODBA 5LD2B 2QG6A 3UG7A 1FZQA 4YXWD 2YYZA 3K9LA 4BZPA 5EE3A 5J4LA 1G3MA 4TLEA 3RS5A 4PSVA 1IOZA 1AIPA 3GD7A 3W6PA 1R5NA 3VHLB 3RWOA 3EAQA 2YJTD 5EP3A 2ZEJA 1A82A 2PMDA 1W5SA 3ICQB 2HT6A 3GLHA 3BBPA 1E2EA 1Z6AA 1ANKA 4KVAA 1KO4A 3T1VA 4XSHA 3LRPA 3SNHA 5J4KA 4GOXA 1MO6A 1Z0DA 3TJZA 4F7WA 2XZPA 4LHVA 2IYLD 2VP2A 2ZXUA 2H92A 1COWD 5L3QA 4E5UA 4B48A 3L82B 1FP6A 3U61B 2XEXA 1IN6A 4C0HA 4ASUA 4D82A 1VDZA 3W8RA 2ZYTX 3A1VA 2MMCA 2UZIR 3CWQA 3I32A 4MRNA 2O0HA 3L2OB 5JCZA 4P4SA 3RRMA 1XCMA 3F0TA 5BYKA 5TY0A 1XXHB 3V9PA 3EZ2A 4ABYA 1WDTA 1DS6A 3BB4A 4D0LB 3L0IB 2AFIE 1AS0A 3JZMA 1N5JA 3I3SR 1HA3A 4O2RA 1W49A 1AK2A 4PR0A 2VO1A 4EFLA 2JJ1D 2Z43A 1PJRA 5AUNB 2RCNA 4CT4B 2Z5FA 4YLGA 3S1AB 1PLLA 5K8IA 2CHGA 3OIVA 4FD2A 4QGHA 2PLFA 5FR2A 4FI3C 5KDOA 4WZAE 3RVBA 4PZLA 3KB2A 4TMTA 4V03A 2NIPA 2OBMA 1L8QA 2QPOA 3DO6A 4QGAA 1NMZA 2WAYA 3WRXC 1YU9A 1ZJ6A 1WE2A 4CYMA 1UEJA 4DT1B 3PJRA 1L2TA 4EPYA 4KXFB 4NTZA 4NE2A 1QVRA 4RD1A 2V8OA 4DSNA 1VIYA 2PLRA 4JSYA 4NPHA 2KBEA 1S3SA 1ZRHA 3H1TA 4XD7A 1AZTA 2R62A 2ZQ5A 4P4TA 1OXUA 4TLDA 3WNCA 3DMDA 4PC6A 2W6JA 3R9WA 3I62A 4RCZA 1I4LD 5EZ5A 3OFNA 3VU9B 4DVGA 3R9XA 2WJVA 2GDJA 1RKBA 1YR9A 2ZSFA 3B7GA 3ZZTA 2NPFA 1KYIA 4G5GA 4PAQA 1G3IA 4PQFA 1II8B 3GJ6A 4IDNA 4XVRA 1ZM4A 4HAXA 2RGBA 2RGNA 2B8TA 2V54A 1PUIA 1U8YA 2F55A 4DCTA 4MDFA 1QHHA 4URZR 1SXJE 5E4FA 1QZXA 1EFUA 3DEFA 4W5HA 3C8UA 2V6IA 4US0R 1JI0A 2BMJA 4YQFA 3F8TA 4URYR 4A4DA 1QDEA 2ZU6A 3DDCA 4F38A 1GM5A 1G64A 1LS1A 1M8PA 1LS6A 3IBGA 2GVDC 4CF7A 2VHJA 4NYJQ 3KKPA 4EPXA 3Q3JB 4Q7LA 3GEHA 2GJ9A 2YINC 2NZ8A 3PITA 1QG4A 1VIAA 2CE2X 3EX7C 2DWOA 3CPJB 1QHGA 3HU1A 2BBWA 2OFWA 4GMXA 2ZJZA 5E7JA 2CNWA 4RJLA 1NI3A 2FWRA 4MUAA 4S2EA 1YVDA 5CIQA 5IK2A 2VQSA 4IOMA 1NN1A 2DY1A 2O0KA 4XWAA 2IXEA 5AWFC 3UXMA 2C04A 5DLQC 4OYHA 1D2EA 1EFHA 2FZ4A 4UNSA 4ZO4A 4DKXA 2CL0X 1E1RD 1N6IA 4K8OA 1W36D 2QTVB 1MRSA 3CWZA 1U94A 1XCGB 4TSFA 2O8FA 4PAMA 4RFSB 3IKJA 1UPTA 3G0HA 1OKKA 1R8SA 2NO9A 2VL7A 3RYTC 1KNXA 4Z51A 1XTKA 3FKSA 4LHWA 5J5CA 3UATA 3CF2A 4B3BA 4A8JC 4D4LA 1P75A 1JXMA 3BD9A 2WIBA 1XXHE 3GFOA 5BXQC 2E87A 2OG2A 2FE4A 2ZROA 2GA8A 4CIDA 1NVWQ 5JS8A 2OCPA 1E9SA 2PZGA 1Z8FA 2QE7D 2WJIA 3F5FA 1II9A 4KFUA 4MKHA 2OCBA 1OIVA 1G18A 1RRPA 5TXGA 3T5GA 4EUNA 1S9HA 4BFSA 3B5JA 4EJSB 4DIEA 5L3SA 4D26A 1KI1A 4LJ5A 4JIMA 4EFNA 1J99A 4HAZA 4PZZA 3TIFA 4ZI3A 3TR0A 1UBEA 2RGCA 4KU4A 2VP4A 4DSUA 4AKIA 3BAFA 2GZHA 1E4YA 5AUOB 2BJVA 3OE7A 1KZ7B 4PANA 4MH0R 3VR5A 1OFHA 3CR7A 2RMKA 2V4ZA 4P32A 5BN5A 5JZVA 4PPGA 1CJMA 5FPKA 4JLVA 1OW3B 4HB2A 3N70A 4BUJA 4CEIB 2HV8A 1N0UA 5KPDA 2GEVA 1OHHA 4BLOA 2GZAA 2JJ2D 1W0JA 2RGDA 5CK4A 1XZPA 5FTKA 3BC1A 3IO5A 1T3HA 4M21A 4ASUD 2O8EA 1N5KA 4ZCIA 2CJWB 1G16A 1Z6XA 2RGAA 4V0OA 4XTRA 4KFTA 5FUXA 5G3ZA 2AD1A 3SS8A 5EJEA 4JLOA 4DRZA 2ODNA 1KK2A 3TSZA 3EC1A 1Z07A 3NXSA 4KHZA 1XJ0A 2A5YB 4LJ9A 4L9SA 2KB0A 3A58B 1D9XA 2WICA 3DL0A 3K9HA 3UG6A 2XX3A 2GJSA 4KBFA 3LFUA 5HR5A 2BHRA 3OIUA 4JLJA 2GEUA 1XTSA 1E2PA 3U3MA 4GP7A 4POAA 4MGYR 3QBVA 1RRCA 4V0MA 1XTJA 3RSLA 2J41A 3I5XA 2JLVA 2ZI3A 1GNRA 1UEIA 3TUJC 4AIIA 1E9CA 1KI6A 3W3ZB 2OLJA 1PLJA 4Q01A 5FTJA 2QP9X 1G3RA 2PX0A 2WHXA 5L3VA 4OHZA 1KJZA 4EDHA 1N5LA 3L0SA 1L7VC 1YRBA 5IF9A 2XZLA 4TN1A 3LY5A 3MD0A 1W2HA 3K09A 3KZ1E 1OJLA 4MKGA 2ZAMA 2JGNA 1GRNA 2WJHA 2GKSA 1UDWA 4GP6A 4Q9HA 4XD7D 1VHTA 5HZHA 2W6JD 1CU1A 4ARZA 5A0FA 1VKJA 2RH5A 3OFND 4HEJA 5EQTA 3AF0A 5H70A 5HE9A 4TMVA 4FMCF 3AB3A 2HF9A 3ECCA 4DZZA 3FMIA 1N6NA 3AKEA 1OH8A 4E22A 2V1UA 3FWYA 4PPFA 4FINA 2IXGA 1CJKC 3LXXA 1XP8A 3HPQA 8OHMA 1IM2A 3B9PA 2R9VA 4MQBA 4QOSA 5KDLA 4BFWA 3SJZA 1GL6A 2YKGA 2D2EA 2G1KA 1VPLA 2ZI7A 4Q9IA 2OBLA 1GSIA 2Q3FA 1W36B 4BLQA 2JEOA 1FX0A 2ZR9A 3B85A 2YWHA 3PEYA 1ZM3A 4Q66C 1ZC3A 1RYFA 2GK6A 4LY6A 1UFQA 3GPLA 4D25A 3SN6A 5JMTA 1XX6A 1B0UA 4XH9B 1SVOA 1KJYA 3A4NA 3NBFA 2WV9A 2ZS9A 4Q7MB 3TMKA 4HZIA 2PL3A 1G8HA 4LPSA 4OHXA 2R6FA 3RS2A 4IOLA 4B3XA 3PR1A 2Q0HA 2ZS8A 1T91A 1SXJC 1X86B 2C8VA 1MO5A 4HATA 4BFYA 3U44A 2CNWD 3SEAA 1AGPA 3GJ0A 2LKCA 1G1MA 1ZM9A 3AVQA 4NYMQ 4Q18A 2BKEA 5FOVA 1RW4A 4JS0A 5IK2D 3MG9A 2BEJA 1U2RA 2YV5A 3EA5A 3UANA 4CGZA 2ZJAA 1Z0JA 2WPDD 1CP2A 821PA 4F93B 3K1JA 3CIOA 5J4HA 4U00A 4PSKA 4QBGB 4HLUC 2PCLA 4TSFD 4B33A 4NU0A 2JLRA 4O3MA 1DAFA 2C5LA 3PUWA 4LJ4A 4OL0A 1OKKD 3M4YA 1ZAKA 3UWOA 4IOKA 2ZRDA 4Y0AA 4QFMA 3E5HA 1GILA 2YWFA 1FOEB 1NNEA 1S96A 1N6PA 3OIYA 2P5TB 4PFSA 5BYJA 3ZVNA 2VHTA 1CF4A 4YDHB 4WOPA 2EWVA 5F3WB 2NMVA 2R6CA 4GOKA 3CX7A 3GLHB 4QHSA 2BV3A 2GBLC 4QGGA 1GWNA 3O8BA 1X3SA 2W2VA 1SVLA 2AN9A 4URVR 1E6CA 5L3QB 4A2PA 1ZMXA 4X8OA 3H0KA 4LHZA 2YC4C 2ZAOA 5FOXA 3B1XA 4P4SB 1ESMA 2D7CA 2YWEA 4FCVA 4BGDA 5G40A 2RGGA 3AF3A 2VHUA 1JB1A 3CR8A 3GCGA 3GJ7A 3OE7D 3PG5A 3B6EA 4YONB 2XOKA 4RD2A 1PZNA 4GFDA 4Q4AA 3UMFA 4UKDA 2ERYA 1XZQA 1XEWY 2Q9CA 2ZYUX 3IO3A 1AA9A 4JJZA 3HPRA 4IVQA 4FIDA 2ZRCA 3KJHA 4DDWA 5AUPB 4JLNA 2AWNA 2CL6X 1WBBA 5JSZA 1OHHD 1IXRC 3GFTA 4WW0A 2PT7A 2QROA 4TWZA 2ZE8A 3KJIA 4C0AC 4C3ZA 1U9IC 2I3BA 5CYPA 2ECKA 4B73A 5FOUA 4KO8A 1QVAA 4IEEA 3CNOA 1NL3A 2QA5A 1OXXK 2QU8A 2GZDA 1JR3A 3FOZA 4PHHA 2HYIC 1JBKA 1T8UA 1HH4A 2ZJYA 2CMKA 3C15C 2IA5A 4NCJA 1Z0IA 3B13B 3A1TA 4KAXA 2ORWA 1QHSA 2QQ0A 3BH7A 4M0LA 3SQXA 2OILA 4BFZA 3KJEA 3AVOA 3THWA 1IXSB 1CLUA 4G0NA 4UJ5A 4GDFA 3QF7A 3FGNA 3QI2A 1D8TA 3LLMA 3SBDA 4TL6A 4MYHA 4TMKA 2IX3A 2D06A 3UIEA 2OCAA 2QT0A 1R2QA 1RVDA 2X19A 3QPWA 4RD6A 4HUTA 3N2EA 1J2JA 4WZ6A 3AKYA 5A5GA 2HCJB 2DFNA 4BLPA 1BH2A 2ZRNA 4JT4A 3KKOA 1QHHB 1P9RA 1MR3F 3TGPA 5DSZA 2OCYC 2ZI4A 3REFA 2BJWA 2Z4RA 2QRNA 1E0SA 2EFHB 2ZJBA 3EG5A 1WRBA 2WKPA 1NN5A 1TU3A 4NCIA 3X1ZA 5F98A 4Z54A 4JLMA 1E98A 2I4IA 2D2FA 2NOAA 3FMPB 3LVQE 5FOTA 4GMDA 1R0ZA 4PSAA 1W7AA 1FP7A 3V4FA 3LDAA 2FH5B 4BEJA 1FTNA 2QNRA 2ORIA 4UXHA 5C46F 2FSIA 3MRSA 4HSEA 5CK5A 5H1YA 1BMFA 1B23P 2NO0A 2PZFA 1OH6A 5JRJA 2HJVA 2EYQA 3TK1A 1EFRD 1CJVC 2FFBA 3NH6A 4U02A 3GLHE 3B9QA 1YKSA 3AM1A 5DYIA 1SQ5A 1W47A 1TPZA 3MJHA 4L16A 1SVMA 1KAOA 2QMEA 1TQ4A 4C2UA 3D31A 2O8FB 4ZDIA 1TF2A 3KJGA 1X8JA 3C14C 3SOPA 1FFHA 3MWKA 3DZDA 1WMSA 5M04A 4H9GA 1U81A 2WWFA 4JT2A 4OJQA 1NLZA 3MCAA 3GLFA 3M0EA 1E2HA 3HJNA 3RC3A 4LJ7A 1EGAA 1AS3A 1DAEA 2B6HA 1OFUX 2W2XA 1U98A 4C0SA 2WKRA 4Q02A 3CRMA 3K0EA 1AS2A 4HDCA 1XNJA 1LY1A 3PUZA 2DB3A 3WBJA 3FTQA 4OBEA 4B2IA 5TV2A 1RJ9A 2DWPA 3OIWA 2ATVA 3QF4A 2MMGA 4B6FA 5AUQA 1UKVY 2PEYA 2IS2A 2GJ8A 4ZV4A 3VR2A 5JJLA 3UMSA 1GZSA 5AJWA 2Q3HA 4HAVA 4MRSA 1OXSC 3WP1B 4G5SA 5L3SB 2G83A 4P31A 4KJZA 1J7KA 1FQJA 1HE8B 2JA1A 4R98A 1TUEA 5DI9A 2BC9A 2JCSA 4W5JA 3TKLA 4JJKA 3BOSA 1F2UA 4HLQB 3ZQ6A 4B34A 3TVDA 1OXVA 1K8RA 4MKFA 2VH5R 3FKQA 1NG1A 3PFIA 3CRVA 1JJ7A 3ZZUA 1VCMA 2VF7A 2BCJQ 1KHTA 1X6VA 4Q9LA 3CPEA 4HUQA 1JEDA 2WAXA 1IBRA 1Q21A 3QVUA 4Q4JA 3ZJYA 4N0DA 3RS4A 3G82C 5G3YA 2O8EB 5HE8A 4Q9JA 3IQXA 4LDJA 4O2LA 1KK3A 3H2YA 1FTSA 4HLDA 1NVVR 3NBZC 4TYNA 3CRW1 3D7MA 1OIXA 3P32A 4EPVA 3T1QA 1E9DA 3NEJA 2XOKD 4LWZA 2F3RA 3UWKA 1BYIA 2YOGA 3QXXA 4B32A 4F92B 1EWQA 3Q7QA 721PA 3OHMA 1TTTA 4DUGA 2FU5C 5FBRB 1QG2A 4LV8B 4LYAA 3LW7A 3T06B 3KQNA 5KTYA 5C18A 2A5JA 2ZANA 3B1WA 3I73A 1EX7A 2IUUA 2GJKA 4F4CA 1ZIPA 1ZNZA 3IIMA 4YMVA 3W5IA 2XGJA 5JEDA 2VA8A 1UBGA 3SYKA 2HJGA 4RY2A 2CXXA 4B6EA 4DLZA 1KI6B 3ADCA 1OV4A 2ATXA 4A6XA 4XVQA 3ADDA 1JR3D 4B3CA 4PXAA 4M9XA 4ERNA 1Q1BA 3SI7A 5FR1A 2DCUA 3IHWA 4DCSA 4M1MA 3TQFA 4WXRA 1OYYA 2JATA 1HY3A 4UNPA 4PHTA 1VHLA 1RPZA 1ZC4A 4ACAA 4D4MA 1L4UA 3WYAA 2IYZA 2XTNA 4QG7A 2ZUDA 5TARA 4KODA 4ARZB 4ACBA 4JLAA 3VKWA 3ZS8A 4NYIR 4DB4A 2P6UA 4MRRA 1KK0A 1DAKA 1OSNA 1FMJA 3T34A 3AF1A 3Q85A 3J81k 1P60A 1MO4A 4URXR 2P67A 4IDPA 3CONA 2WWYA 5JBQA 1Z6YA 1ZUIA 3MWJA 1E2QA 2IUSA 2DR3A 3NH9A 3SJBA 3R8CA 5DO9A 5B30A 3CNLA 4PQRA 4HDOB 3HDTA 4NCHA 1FX0B 1Z6GA 3QKRA 5GJWC 4H1VA 3GLGA 1KI2A 3NDPA 4DIDA 4JVLA 2AWOA 2RGXA 1E79D 5DH9A 4B2LA 4ZDWA 5CYOA 5B58C 1TF7A 1XJQA 3AV0B 1YZUA 1HYQA 1QHNA 1BKDR 5CDFA 2FEOA 1BOFA 4M53A 1Q12A 1II0A 5J47A 5E3HA 2IF2A 4LHYA 1W4AA 2A2ZA 4QKQA 1UJ2A 5F9FA 3IHLA 2ZJ5A 2X8AA 3CF6R 3RABA 3U44B 1KO1A 2REXB 1SZPA 1BMFD 2XNDA 3QNUA 4O0MA 4Z1MD 4HYYA 4IKEA 1SKYB 5FL7A 1T9HA 1AQUA 2AKYA 1XDBA 2H7VA 3QPVA 2IYSA 1ZNYA 4C2TA 1H65A 2QUZA 2FDCA 3SE0A 3B2EA 4WAUA 1MRNA 1CKEA 1KK1A 4HI0E 1P62B 2H8KA 2QSYA 5LDDC 3I4LA 5SZKB 4BECA 1NRJB 4Q1AA 2KSQA 1MOZA 3A1UA 5FPTA 1I4DD 3AF2A 2ZE6A 1R4AA 3R20A 2ZYWX 3B1ZA 4OQXA 1EX6A 3IUYA 5GJCA 5AJZA 1W2GA 3P26A 3T1TA 2IWHA 1NIJA 1M7GA 2OLKA 5HCNA 4LPKA 4Q1EA 3QIAA 5EZ6B 2WZQA 3SJCA 3W5JA 4M1TA 4M9QA 4JSTA 1XD2B 3KXKA 3D3QA 4QRHA 1U8ZA 3MMPA 4UQOA 3JZAA 5H8WA 4DLWA 3ZH9B 5P21A 4BLRA 5GADl 4A0FA 5JI3E 4KSBA 4JVSB 1ZP6A 5DHFA 4U7DA 2CE7A 3L8ZA 2LCFA 1GNPA 3BJIC 1XB2A 1GKYA 2JDIA 3E70C 3QXCA 2G9NA 5E7IA 5HKKA 1DAIA 2X2EA 1P4SA 3EWAA 1EFCA 1XMVA 1OB5A 2OO7A 4V0ME 3NEYA 4KYUA 5G41A 3GQBA 2A5GA 2NO7A 3REGA 1EESA 2IBMA 1R5BA 4Q4HA 4FCTA 2E9SA 5K8LA 2VP0A 2SHKA 2ZRGA 3CPHA 3NG1A 4Q4AB 6Q21A 2QP3A 2V3CC 3U6KA 4RZXA 4GPTA 1FW6A 1GDDA 2F9LA 4PAOA 2QMHA 4XWKA 1UM8A 1KDRA 1OT3A 2A7QA 2Z0MA 3KL4A 2F1RA 1Z28A 4M1SA 4TT3A 3W6OA 5JSZB 3FHTA 3TR5A 4AC9A 4P3YA 3ICEA 2EVWX 5GJBA 4OQFA 3OESA 2BKUA 4TL7A 3EPLA 1W1WA 1XTRA 4MGKR 2GJAA 1C1YA 1N6RA 1A1VA 1GL7A 3NHBA 2KE5A 3WNBA 1KO5A 1G291 1Z0FA 3U7FB 4BE7B 3T5DA 3NHAA 4G5RA 5D3QA 4LYJA 4DC9A 4CEJB 3EW9A 3PVSA 1XEXB 1DO0A 3DHWC 3Q7PA 4JKYA 2QAGC 1OH5A 4TZ0A 1YR6A 3THWB 2H16A 5H68A 1UKYA 3RLFA 2LWIA 4LV5B 1XTIA 2AK2A 2Q9AA 4DUGD 4JL5A 1DAHA 3ZLJA 2J3EA 3AGQA 4C4PA 1G7CA 1G5RA 1IXZA 4X8HA 2NO6A 2RGNC 3P1JA 3AVYA 3ZZ0A 1JAIA 2PMKA 5FTNA 1HQCA 5HTKA 1KSJA 4LC0A 3VFDA 2HT1A 2DPXA 4DHEA 5JHGB 4G1UC 1A2BA 1VG1A 1E69A 1HUQA 5GVRA 4YMTA 1SKYE 1W44A 3MJRA 1QF9A 1DBSA 4TYQA 1VG9B 2I1VB 2JLWA 3PENA 2JLSA 3AVPA 4ZKEA 2CLDX 1M7HA 2X77A 1N0WA 2YOFA 1ZVQA 2BDTA 4Q19A 1LF0A 4QJ4A 1NN0A 3TW8B 2QMOA 1E0KA 1PLKA 2G0NA 2JIZA 1ZCBA 1SVSA 1DG3A 2DYKA 3VR1A 1XMJA 1ZBDA 1IQPA 2VP9A 3WXMA 1E9EA 5EE1A 4A1FA 3KDSE 1IJFA 3VHXA 3A4LA 1MO3A 4EPWA 4JLDA 3T35A 4P33A 1SHKA 4PZYA 3TAUA 1G8GA 3W6NA 1S8FA 4HLCA 5FPHA 4L8GA 4IJMA 2YWGA 3KUCA 1Z2CA 4A2WA 2R2AA 3EXAA 3QEJA 3ZVMA 2BM1A 1Z0AA 1T0HB 2QM7A 1V5WA 1S3GA 2D74A 2ZRLA 1LB1B 3LQRA 5EP4A 3WMGA 2YZ2A 2C98A 4R2IA 1CEEA 3ONWA 1T8TA 2NTYC 3KQKA 4EIWA 2N46A 4LOAA 5UKDA 4DDVA 1UDXA 1KZGB 2QAJA 1W46A 5BWMA 2R6GA 2F1IA 3NC0C 3NKVA 3VQTA 2CLSA 1A7JA 1G4AE 2EFGA 3O8CA 3GLFB 1DVRA 1XCPA 4IVRA 1Z6TA 4JBYA 3CM0A 2PZEA 2FGKA 2ZI9A 3HU3A 4KFRA 3K70D 1R8QA 4I99A 3N2IA 2ZPTX 2FX3A 5FTMA 1I2DA 5DI3A 5FL7D 3AVXA 4OHYA 1MKYA 3QXJA 3RHFA 3W90A 3AVTA 3SFVA 1ONBA 1NLFA 1RJ9B 3QF4B 1CR1A 2DFTA 2ZITA 1NKSA 1O87A 3U3KA 1Z29A 1NVVQ 5CIWA 1E2MA 4DEYA 1F6BA 3SYLA 1ZD8A 2C77A 3AVWA 4FMDF 2DBYA 2QRZA 1FNMA 4WXPA 3O8RA 4ZKDA 4Q03A 1ZYUA 3EC2A 1G7SA 5FBQB 4LBYA 1X8KA 5JHHB 3BH6A 3PIRA 4KYIB 3LBHA 1F2UB 1TU4A 4QL3A 1JR3E 2KJQA 1H8HA 3FMOB 1RYHA 4ON9A 2G0TA 3MUFA 4X8LA 5CM9C 4PPNA 3ETLA 3CNNA 2XXAA 2AHOA 5SZHB 4DLYA 1E2KA 4Q7JB 2XJ9A 4HUQB 4Q4JB 2OZEA 1G20E 3W9YA 1J8YF 1NVUQ 4RCYA 3AKDA 2JDID 2Z4SA 2UVQA 3R7WA 5HKKD 1D9ZA 2HLDA 2G6BA 2VSXA 4JMPA 1PUJA 3PV0A 3QKTA 1AZSC 3I72A 4CZ2A 4E07A 3G5UA 1CRQA 3IIJA 1DPFA 3KKNA 1NKTA 4QC2A 2P3SA 4R7ZA 5B64A 4CEIA 2GF0A 2DHRA 4NYIQ 2J0QA 4XSGA 2IWRA 2F1JA 2QTFA 4ITRC 1MT0A 5TB5A 3B8HA 4DJTA 4EPTA 3EIQA 1OLOA 3AVUA 3LVRE 4DCUA 1XBTA 3NC1C 3AUXA 1Z3IX 4L9WA 2WVJA 4TT3D 3WYFA 4CDGA 4DSTA 2A5FA 3QBTA 4AG6A 1KY3A 1M74A 1HT2E 1RZ3A 2XSZA 1DG1G 3KKQA 2VYFA 4ZDKA 2PJRA 5CJPA 2J1LA 1KI7A 2ZU0C 1GRRA 1F5NA 3U3JA 4NP6A 2GBLA 1V43A 2IYQA 3HR7A 5EXTA 4B74A 3U4QA 2IYVA 1R6BX 1AJEA 4GRAA 2ZIAA 4KBGA 4OQMA 4PQYA 4YDSA 3AUYA 5JWHA 1P73A 1G6OA 3BK7A 1M1YE 2ZI6A 3P4XA 5LB4A 4C9BA 4D0NA 4GOJA 5GVSA 5KNBA 5LD2C 3P4YA 4OK3A 4C7OA 2IYUA 2X1VA 4IVPA 2C99A 2W58A 1YQTA 2ZJ2A 1J90A 4IW3B 2GESA 1KO7A 4TMWA 1FNNA 3FKSD 2FV8A 3L8YA 3QKSA 2ZYVX 3FDIA 1HQYE 3AVVA 1W4CA 3L0PA 1Z08A 3GLFE 3LBNA 2F43A 3U3RA 2QGZA 2ZRJA 2REOA 1XD2A 2R8RA 3MGCA 1Q44A 3VX3A 4KLNA 3EWSA 4I1OA 1GIAA 1JALA 3LQQA 2GTPA 1Q20A 1ZIOA 1VCIA 4CEHB 2F1HA 1KI3A 2J0SA 4LJAA 3QKRB 3WMFA 3GLGB 4ZIRB 2Y8EA 1XEWX 1U9IA 1I4TD 5FUYA 1NN3A 2MSEB 4X8MA 4DDTA 2ZS7A 4GBMA 1LW7A 4M1YA 2OHFA 2ZSDA 1WP9A 3RRZA 5F2EA 2HXSA 2PH1A 2JIZD 1KMHA 1W5TA 1E96A 1U90A 1T6NA 2ASEA 1Y3AA 2OUKA 3K70B 1G7TA 3T12A 2EWWA 2RGEA 1IN7A 1KI8A 4GNKA 1CTQA 3L43A 1P2VA 1G8PA 1LTQA 3AQ4A 1KSFX 2C2HA 3EASA 2WWIA 1XEFA 2GVZC 1N25A 3FB4A 5J4YA 3U60B 2H1LA 4G3XA 4TTQA 2ZRAA 3THXA 1T5LA 3BH0A 3SQWA 4A9AA 2C96A 2V9PA 5EE0A 2CVHA 1W0JD 1XPOA 2HCBA 4MA4A 1IY1A 3B60A 2XAUA 2GF9A 4AKGA 3KTAA 4TQ9A 3BRWD 3A37A 1GL9B 4OHVA 4TTPA 3KFXA 1GUAA 1GRQA 1ZD9A 1Z83A 3TSOA 2PCJA 4AKEA 4K46A 1CBUA 1DTSA 4DCNA 2PT5A 4BASA 1GKUB 1U8AA 1XEXA 4KCGA 2CHQA 2LKDA 3QE0A 1G4UR 4QBIA 1J8MF 1AQYA 3GJXC 2FPKA 4BFXA 4RFVA 3PEWA 1NJFA 4B44A 1ZCAA 1XU4A 2GEDA 4KLZA 1R0XA 2IYTA 5FOSA 4C0QC 3QPUA 4RKEA 1YZQA 4Q21A 5FBLB 1X8LA 2WSSA 1K6MA 1OYWA 3A4MA 4MGIR 2GCNA 4IRUB 2GETA 2WOOA 2F9MA 1YE8A 3RRYA 1LFDB 4LBWA 4ZI2A 2H18A 3F3YA 4LHXA 1ZM2A 3QXSA 2IEZA 3CX6A 2R65A 3QVVA 3AH8A 2Z83A 2OSBA 1QHIA 3K9GA 4Q4HB 1Z22A 1SVKA 5DGXA 1E94E 1SVIA 3B1VA 1N0VC 1YZGA 4JVNA 2ZRPA 2MSDB 1H8HD 5DISB 4DLVA 3SHWA 4Q1CA 1KDOA 4P4UA 1KJWA 1S4QA 2GXQA 1VMAA 1KNQA 5C2JB 3O47A 1R0YA 5CB6A 3GLIB 1NBMA 2WJYA 3MWLA 4LC1A 4BFVA 3T15A 3LV8A 4DBLC 1CS4C 2FFHA 4Q1FA 4QXAA 4GZLA 2B21A 1U0HC 1NIPA 3K0FB 2C78A 1KSHA 2ZR0A 2OE2A 3H84A 4EQ6A 2CBZA 2CCGA 2MSCB 4RD0A 2J5XA 2Z6VA 4TMZA 3KQLA 4B43A 1IY0A 2J7KA 1OFIA 2IEYA 1D2NA 2WWWA 4TL8A 1E0JA 3QUSA 3MWYW 4YMWA 3GLGE 2QMUA 1DARA 2OFXA 2ZREA 1Z06A 2JAQA 4OHWA 3PUYA 4HAUA 4TLBA 1IN5A 1RFLA 421PA 4D6PA 2O5VA 5CDFE 2BIFA 4D80A 3P27A 4PC1A 5AJXA 1VECA 2O0JA 2VSFA 3QENA 2G1JA 4FN5A 1VYTA 2XSZD 4AK9A 3ZQJA 2CDNA 2AXNA 4XIGS 4V0LA 5FTLA 3ZIAA 4Q9KA 2BEKA 4R71A 2HYDA 1W0KA 5DNYB 1ZU4A 3X1DA 2JLQA 4WVFA 4D4JA 4EJSC 3ZS9A 3DZ8A 5IRCD 1XTQA 3EIEA 1LF5A 2AL7A 2OBNA 3R9IA 3FHCB 2QZ4A 2FOLA 2O8CA 4LJ8A 1UAAA 2DFLA 5FOWA 1P61B 4XTCS 1U0LA 4TYPA 1MABA 3U7HB 5KHOC 3DOEA 4LX0A 4J0QA 2W00A 2Q3MA 3OEEA 3H86A 5KO2A 2Q6TA 5SZIA 3RANA 3TW4A 4FWIB 1SVWA 4CVNA 1KI9A 3K0AA 4D81A 5CB8A 3KQUA 4Z8XA 3CW2A 2QN6A 2QQEA 4HAWA 2V55B 3LXRA 1F2TB 2ZETA 3EZFA 4Q48A 1E2DA 1G8YA 3CKLA 1VCNA 4CEJA 3GFPA 1ODFA 2VEDA 4PHFA 3UMRA 1EWRA 1QHYA 1WBDA 2VTKA 4NH0A 5JS7A 2HXYA 3RS7A 2JLZA 3CZQA 1T5IA 4NZYA 4PC3A 1DOAA 4BLSA 3VAAA 1N6OA 4TQAA 1G6HA 3THYB 2ZVQX 5JJKA 3FVQA 1RRFA 5IHPA 5FL3A 4A0RA 2XTZA 4A0HA 3A1SA 3AP2A 4KFSA 1T0JB 5BQ5A 4C0JA 4DLUA 5E95A 2AXPA 5TMPA 2BWJA 1ZD1A 3LX5A 5DHAA 5DI3B 3K0CC 1P2TA 4LK2A 4RSGA 5AR1A 3W34A 4JL8A 5J40A 3PUXA 4M1WA 4KITB 2RB4A 1G19A 1TQ6A 1SGWA 2J9RA 3RNLA 3K53A 3SBEA 5EUQB 4BFUA 1E2GA 2OEPA 2ZRKA 1L4YA 4DLSA 2ZUBA 1P3JA 1FMLA 2ZRHA 1TMKA 3HR8A 3IIKA 2O8BA 4H1UA 1E2JA 1NMYA 4MYTA 2YNMA 4AYXA 3B1YA 5C4MA 4C0LA 3C5HA 3E1SA 4AYTA 4DXAA 2WM9B 5CITA 121PA 1X1SA 4XWOA 2IT1A 5EUMA 4FXPA 3TUIC 1XPRA 3W8NA 3CBQA 5KSOA 4Q1DA 2ZRFA 4GSYA 1G3QA 3FMFA 3K9NA 4XJXA 1R7RA 1P2UA 4MKIA 2XXAB 1E9RA 2GCOA 4PO8A 1SXJB 3CO5A 3TRFA 2V1XA 1JECA 3JVVA 4BLTA 2N1BA 3PCRB 5L8VA 4F4IA 4OI1A 1RRGA 3R7WB 2WSSD 4A92A 3EZ7A 4RD4A 3RSOA 5KSZA 2FNAA 1W36C 3TUZC 2W83A 5F9HA 2H5EA 4QM7A 1VCOA 2I1QA 3KFVA 2EYUA 3BERA 4NONA 2A3RA 4LUCA 4B76A 1ESNA 3NWJA 4D0GA 4CEHA 4MYCA 2QBYA 4FMDB 2FF7A 4DCVA 2IS6A 1ZU5A 2NZJA 2OT3B 4ZIRA 5AJVB 1XFAA 3RRNA 4Q7KA 1UBCA 4LJYA 5KYKA 1WXQA 3Q5DA 4EKDA 1S0UA 2A78A 5FPSA 3WHLA 4A36A 1KDPA 2A9KA 5IDVA 4DEXA 3H4MA 1QRAA 1N6LA 1Z63A 4PO1A 1Q0UA 2XTMA 3EZ6A 2ZSAA 3CRQA 1NBMD 1HTWA 4PTLA 4B3FX 1HURA 4LRWA 2JJ2A 1IY2A 3QEOA 4FMCB 3K0SA 3U7EB 1AGRA 2QL6A 4NYMR 4TQUS 4Q1BA 4WA7A 1FL9A 5DYGA 3X2SA 1P7CA 2ZTSA 3U4QB 4ZCLA 1BYUA 3AEZA 5EXSA 4DB2A 5HPYB 2O8DA 4QHTA 3WRYC 4GI7A 3VTKA 4QNMA 1JAHA 2PEZA 1C9KA 2J59A 3WHKA 5KDDA 1JNYA 4C7OB 3HWSA 1GAJA 1TF5A 2VPPA 4M9ZA 1OPXA 1OF1A 2HEIA 4UNNA 3ZD7A 2FPMA 5JFGA 3PQCA 2QORA 1N5IA 3QKSB 1ZM7A 4NKRA 4NBSA 4QJ5A 1EG7A 4TLCA 2H17A 3HU2A 3ZD6A 3VMFA 2JJ8A 4KV9A 4PX9A 2F43B 4JBXA 3IBYA 2GNOA 3FE2A 1GVNB 4G5QA 2OV2A 1IN8A 1N3BA 4LSGA 4RKFA 1N6KA 2DWQA 4V02A 4A6PA 4DLXA 2R44A 3BS4A 3IGFA 3ZIAD 1W0KD 4BPBA 1KO8A 1TQDA 2F6RA 2EFCB 4JYCA 3A36A 3IPYA 2KBFA 1GP2A 1UADA 3I1FA 1JPJA 3EA0A 4JL6A 2IW3A 3SU8A 3K70C 3GJ4A 4UNRA 1GKIA 1XJCA 3RS0A 3I61A 1KMHB 1Q1ZA 4DDUA 1Y63A 3V00A 4M8NE 2OAP1 2FFQA 3ZVLA 2QSZA 2VP5A 3OEED 4N1AA 1ETUA 3LX8A 2ANCA 4OQNA 1QHXA 5D3MA 2QAGA 4EFMA 4QJ3A 1AKEA 3BIFA 4QBHA 5E7MA 3QQ5A 4QNRA 1R5OA 1ZINA 3IDQA 2IK8A 2P0EA 4A8JA 1E3MA 1Q22A 1RC8A 4QM6A 2J87A 4D4KA 1D5CA 3AP1A 5EP1A 3THXB 3GLIA 1XD9A 5ANRB 3NDBB 3WMEA 2G88A 2E1RA 1CXZA 3CH5A 1UF9A 2FG5A 3CLVA 4IEIA 2V7QA 3SHFA 2RHDA 3KTAB 4JYBA 2WJJA 3K0FA 4G5OA 4PHGA 3IEVA 1US8A 4TZ6A 1JXOA 3VX4A 4A82A 5KNDA 4AYWA 4BQSA 1XMIA 1U99A 5KOYA 1E2NA 3DM9B 4L15A 3BXZA 2BBOA 1IAQA 5TVKA 3GEIA 3X1XA 1HE1C 5BN4A 3HYTA 5KSPA 2ERXA 2IS4A 4LJ6A 2B7BA 3WP0A 1NF3A 1ZNXA 4OK6A 2IUTA 1BS1A 2PBRA 4BEBA 5CM8B 4EAQA 4RZUA 1KKMA 5EXPA 1NP6A 1T4GA 2IHYA 1E2LA 3LO5A 2CK3A 4TLAA 3DPUA 4UXIA 4U5XA 5C1BA 2WPDA 1E0AA 2Q21A 4LYFA 1KKLA 1P9NA 1NLYA 2IF0A 2BM0A 4OI2A 2J7PA 5KPJA 2IXFA 4BRWA 3MSXA 2AFHE 4HB4A 1E1QA 2C9CA 3GEEA 1CJTC 2VBCA 3PEUA 4MRPA 4V0NA 1CR0A 1KOFA 3KQHA 3THOA 5IT5A 2XITA 2G77B 1G41A 2JASA 2C9YA 3RS3A 3SC3A 1NJGA 2B7CA 1D6JA 4R9UC 3M6AA 1DE0A 3WBKA 3IQWA 2NGRA 5DN6A 4AI6A 1Z0KA 3C16C 2J0UA 1P72A 2CCKA 2ONJA 2UKDA 1CRPA 2N42A 3OF5A 3QOFA 1F2TA 3I8XA 4HZUA 4EQ6B 2BMEA 4FCWA 5DE3A 5JLJA 4JZKA 3N5CA 4B71A 1OH7A 2EU8A 3ADKA 3FHOA 4JLPA 3DVLA 3K8YA 4I1VA 4I4LA 4JLKA 3IILA 1E9BA 3AGPA 4IFBA 3V4RA 1E9FA 3LNCA 4RVCA 2GAAA 3BB1A 1NMXA 2P6NA 1P9WA 3AP3A 4BZXA 2QP4A 4XOIA 1G5TA 5JEEA 5JWRA 2AKAB 4NCKA 2PX3A 2QEQA 2GK7A 3ND9A 3EIHA 1T3LA 1YZKA 4JVMA 2J46A 1Z2AA 1N6HA 2QPAA 3EARA 2RAPA 4BFTA 3THYA 1DEKA 1XRJA 1TX4B 1F3OA 4IFEA 3QXHA 2XNDD 5GJVC 5ELXA 1ZNWA 5AK0A 1YHNA 3TH5A 5JCPA 4NCNA 3TBKA 1GFIA 5JECA 1MH1A 5JJIA 3FFBA 2B8WA 4HDQB 3CZPA 3GJ8A 4BWYA 4TL9A 5HCIA 2ONKA 2ZI5A 4LBVA 2AD5A 1H8EA 2VIIA 3W3AA 5CLLA 3R8FA 3QG1A 2WMNB 3LAWA 1ZUHA 2O8CB 2FA9A 3CX8A 3KB1A 2JLXA 1GITA 1J70A 1S2MA 1TAGA 2R6AA 2VHQA 1VTKA 1MABB 1UKZA 5JWOA 2C9OA 3C41J 1KSGA 3VR6A 4II7A 1SKQA 4US2R 1T3SA 3BWDD 3K0AB 3CF0A 2QTHA 4P0TA 4IHQA 1EFTA 5EE5B 2CCJA 2FSFA 3SZRA 1KIMA 1UKEA 3I8SA 4C0BA 2FN4A 3DM5A 4Y0VA 4AD8A 4DLTA 2XZOA 1SXJA 5LB2A 2EW1A 1C4OA 3LBIA 3NVAA 621PA 2XB2A 2ODEA 5LBIA 2WBLC 4M9SA 2ORVA 4JKIA 4WBSA 4JLBA 4QHYA 1Q57A 4PO9A 4NHOA 4NMMA 1HV8A 3KXIA 1CR4A 1DAMA 2ZRMA 1PV4A 3GMTA 4CW7A 1P5ZB 2CHVA 4FWTA 1G3UA 2CLCX 4YC7A 4URWR 2ZRIA 2FMXA 4V0KA 3E2IA 5FUWA 4L5BA 1R0WA 4AURA 4B2PA 1G21E 4HLUA 5KU1A 4PC2A 2OXCA 2W0MA 4B3DA 4DSOA 3NTUA 3EPKA 2BMFA 2FSGA 5FUVA 1TEXA 1VG0B 2WJGA 1E2IA 4G01B 4Z8YA 3GP8A 3QKUA 4KI0A 1D2MA 3FYHA 1TQ2A 1Q1QA 4ZPXA 4GL2A 1LV7A 3KXLA 2FGJA 3VKHA 1EFRA 1M6NA 3ASZA 1NG9A 2H57A 4URUR 4YMUA 1EXMA 1Q3HA 4TTRA 1E2FA 2GRJA 1DAGA 2O52A 5BN3A 2BCGY 1NY5A 2UZ3A 1NBME 1YRAA 2V7QD 1Q3TA 5CLQA 5EE9A 4EPRA 2IYYA 3C7KA 5EP2A 2EFDB 2VP6A 5SZJA 4BZQA 2IHBA 2O8BB 4LBZA 4LGMA 1XF9A 1M2OB 1M34E 3CH4B 3K09C 4IXMA 2WWHA 2VF8A 2NO1A 1GNQA 1MV5A 2ZM5A 2WMOB 2W6IA 2WWXA 3VNVA 1XXHA 2BOVA 5LPNA 2IL1A 2HDNB 1P6XA 2A30A 1OB2A 2D7DA 1IHUA 5A4JA 1IJEA 2QPTA 1UBFA 1JQJC 2EQBA 2GCOB 3LD9A 2C95A 1E4VA 1SHZA 4FMBB 2ZJOA 3LH5A 2VHCA 3ND8A 4AG5A 3C5CA 3LA6A 2DFKB 3KX2A 1GOTA 2CK3D 1YZNA 4N3NA 3S1AA 3OAAA 3UKDA 3BGWA 2BBTA 2ZJ8A 2GHIA 2J7PD 4NL4H 5KSYA 3QJYA 1E1QD 3SJAA 5KUTA 1U0JA 1TNDA 2P2LA 4RZ3A 2QBYB 1JQLB 1VG8A 3TAHA 2FPLA 3TVTA 4WZBE 1PVOA 4DT1A 1G8FA 1WCV1 2QT1A 3OEHA 5CJ2A 2CL7X 2X2FA 1SULA 4M4SA 1KY2A 1XPUA 4MGZR 2BMDA 2JLUA 1I2MA 4GZMA 4OQLA 3PUVA 1JEEA 5EXXA 4LCBA 3A8TA 3SYNA 5AJYA 1G17A 3GJ3A 2NQ2C 221PA 3LWNA 1YJ5A 3B78A 3A6PC 5FBVB 5DN6D 1CJUC 1VYUA 4HAYA 3VU9A 3QSYA 2FZLA 1FUKA 1G5PA 1WA5A 5B2ZA 1O3YA 4DWJA 1BIFA 1S1CA 1II8A 4CRWB 2P65A 3FPAA 2O8DB 2JLYA 2PJZA 3NIBA 4QGFA 1AKYA 1R10A 2GCPA 1XWIA 2ZUCA 3AF4A 4LV6A 3KKMA 4IOJA 2ZE7A 1S9DA 2GWHA 1NVXQ 3LW8A 4UJ3A 3Q8XB 1KTVA 1VYVA 2AR7A 2GAOA 3BFXA 3RWMB 4C30A 3BFVA 1JR6A 5K8UA 4AKHA 1EK0A 3U3OA 4MYUA 4ILEA 2GILA 1OFTA 3VR3A 4A15A 5FBWB 1TADA 2P5SA 2FEMA 4B75A 4M1KA 3MAAC 3ADBA 4IXNA 4R2HA 2W2TA 2ZSEA 3TE6A 5TDHA 3BB3A 4YMSA 3U2QA 2IYWA 4OI0A 2RHMA 3FFAA 4RD3A 3TNFA 4HB0A 2TMKA 4Q47A 5KNCA 2VLIA 1CR2A 4OI4A 4KSCA 5L3RA 1XD8A 3ZYCA 4IDQA 1H8ED 3EPJA 3EZ9A 4E09A 1W4BA 4JBWA 1N2CE 1ZW6A 1JPNA 3B82A 2F3TA 3DKVA 4O25A 4GT1A 4RFSA 2QY9A 4M1OA 1S1MA 4F91B 2J45A 1ELOA 4HB3A 1Q1EA 1A4RA 1DADA 4M22A 2OM2A 2REBA 2YC2C 4YXWA 2FSHA 5D3MB 2QAGB 2D4HA 4OKSA 2WTUA 3ASYA 4NDZA 3ZGXA 4BRUA 3OZXA 2NPIA 4NYJR 4N0EA 4A8JB 3RAPR 3DOFA 2R6DA 1NSTA 4KVGA 4E03A 3IPXA 1SXJD 3TLXA 3WY9A 2KWIA 2AK3A 2BBSA 3NBYC 1AM4D 1OE0A 1W4RA 2OAQ1 4M2LA 1OXTA 2IYXA 1COWA 2HLDD 3ZDQA 1HT1E 5JI2E 3EPHA 4IDHA 1NSFA 4W5WA 1G7RA 4MRVA 1E79A 1US8B 2J0VA 4B3GA 4EJSA 1KAGA 4LZZA 2BVNA 2FFAA 1FUUA 1QBKC 2OXRA 1KDTA 2D3WA 2WOJA 3Q72A 4RZ2A 1K5DA 1XMSA 5K8TA 2HUPA 2P6RA 4ESHA 3WNDA 2A5DA 2VSOA 3NBXX 4LYHA 1WB9A 1LNZA 4Z1MA 1Z47A 3BFKA 2JJ1A 3BE4A 2Q9BA 5FI1B 4PPQA 3HYRA 1CULC 2KI5A 4W7SA 3T1OA 3D6TB 1F48A 1FQKA 3U6BA
chains in the Genus database with same CATH superfamily
3UBTA 3AKCA 3ZCQA 4RPLA 4BV9A 4RY9A 1C3VA 3CJQA 4JI1B 2V6JA 1IEQA 1OX4B 4Z53A 4TXLA 1NBAA 3WKCA 4US1R 2NSHA 1SB9A 3DMNA 2P8JA 3GCWA 5JDIC 1MC4A 2B1QA 3G1UA 4F6RB 2CJWA 3PFNA 3QU9A 2XWQA 3ROXA 3THRA 2EFEB 3JWGA 4ARAA 1KR2A 3P2YA 1NOKA 3CB4A 4XVUA 3DVRX 1TAQA 3H0EA 2W6ID 1GUBA 4ZEVA 2VG8A 1UP4A 1YUNA 3HA7A 2D8AA 3V8QA 2W71A 1JV2B 3AHJA 1EFVA 2ZJ4A 2YJNA 3RIGA 4ZZ1A 1GG2A 3HKCA 4G0OA 4O4LA 4EUFA 1YRWA 1H2ZA 3ZCTA 1A8QA 5ITVA 2BE9A 2IHKA 3U7GA 2ISSD 1E62A 4WNAA 3N2KB 1GAQA 3H6GA 2H1OA 5F5XA 3EF0A 4YS6A 3RC8A 2VHVA 3K0CA 3BIJA 1KFCB 4N49A 4I81A 1OR8A 4HZUB 1GPAA 1ZD3A 1ZUNB 2QENA 1I0ZA 2JI7A 2I99A 5BO5A 4TKVA 4ZHSA 3SYMA 1YK0A 2GPTA 1O9BA 4RK5A 2JF0A 3V8PA 4L50A 3OU6A 1AO0A 5B6IA 3P9XA 4PNZA 1ZIYA 3MFYA 3SWWA 3DKRA 1Z26A 4JEUA 1SUSA 4EFKA 3LYLA 2YDYA 2K5UA 1UFRA 2COEA 4XWTA 4RUKA 1Y8RA 2DBVO 1RM0A 2OAGA 4NABA 1IPEA 4NU6A 5KVQA 1UR5A 1GYQA 4B47A 1DWPA 4R0MA 5KMGB 1M75A 1ECCA 5MHTA 1X1RA 2X5XA 3SFZA 1G55A 5DB4A 4J4BA 1UJ5A 4W5OA 3MBIA 4MK4A 1XZNA 3B52X 2DWCA 4A0GA 4WJLA 4YCMA 2BH2A 2JFUA 2BMVA 2XUGA 3LLUA 4ARBA 2WKQA 3SQNA 1I3CA 3M4JA 4WOKA 1PT8A 1MJHA 1E6LA 5D87A 3X1WA 1G9XA 3B6JA 3OZUA 4JDUA 4F2WA 4K2HA 4L0MA 1CIPA 1RWMA 4LRXA 4ZCMA 5A02A 4LOJA 5T3YA 2LRHA 5REQB 3DTVB 2CNKA 3TFQA 3EG9B 1E7QA 2O7SA 1RIFA 4HWSA 4KOAA 4PEVA 1VB5A 5BR1A 3H2SA 4MCJA 3SR4A 2QGNA 4U7HA 1H6BA 4L4UA 1IBLB 4W63A 4MWBA 4CHGA 1NUUA 3DOHA 3E9YA 4B45A 4X1KB 1YBHA 1M2VA 3CE9A 5DNAA 3STHA 3EZLA 1IZ7A 3ETNA 4EARA 2L0XA 3VR3D 2W0SA 2B92A 1AN9A 2C03A 2PGJA 4L8YA 4EW2A 5HCUA 2WYHA 3GRRA 1DCTA 1CR6A 3R3ZA 2XLBA 2YH2A 1GSHA 5G4KA 2C4HA 3QVOA 5BSGA 5HIAA 2XZTA 4YPVA 1ULBA 3K2QA 3OA0A 2GFIA 1RAAA 1YR1A 1LRLA 4D79A 2WIAA 3RTCA 5LOVB 1U3TA 3PYLA 5HHTA 2ODAA 3E58A 1PWYE 1GCAA 3P9SA 3QG5A 5H02A 1K5HA 1NBWB 1O94D 3HNOA 4LQLA 1D2GA 1T2DA 2UVDA 3K92A 1E4OA 1FPMA 3M5CA 4EHAA 3D59A 3DT9A 3PF8A 1Z34A 2Z09A 4UBNA 4H3KB 4UXJA 5IUNC 5GAJA 4L5IA 1C5KA 1EZZA 1MTZA 1E6WA 4MNTA 1VJ0A 1WKVA 2XYQA 4BP1A 1Q0SA 3FWPA 1MVOA 5EWJB 4ZPJA 2WF5A 3IJRA 2D5LA 4AY6A 4IG9A 3PJGA 4TTTS 4N7BA 4YXWD 4R2LA 4CL3A 4GX0A 5J4LA 5A71A 4C4YA 1YMUA 5EWLB 1Q16A 2PT6A 1IOZA 3JD2A 5LR6A 4J1TC 2I66A 2IODA 5ER9A 2CWDA 3PICA 4MKZA 4EA7A 4F6LA 2X8LA 2XWBF 1X1CA 2YJTD 2ZEJA 5EP3A 4C88A 2P7HA 3RADC 1QPZA 2ARKA 3BT7A 2BDUA 3C6QA 3SD7A 3O4JA 1ANKA 4V2UA 4RWEA 4GOXA 1MO6A 3TJZA 1TK9A 2HA3A 3NQ41 4LHVA 2YNMC 3BREA 1IG0A 2IYLD 2VP2A 5LIPA 2ZXUA 1P8JA 5G0SA 2AS0A 5EKXA 5HKLA 4B48A 3I53A 2FZWA 1HTTA 2BI4A 3FDFA 4DA0A 3W8RA 3A1VA 3P2OA 2MMCA 3CWQA 2ZJ1A 4LVCA 3L2OB 1JHOA 4DMLA 5JCZA 3W04A 3N2GA 3K9WA 3JVDA 3HM9A 3Q9NA 2AEEA 3EZ2A 3BB4A 1DS6A 3AUJB 3HFSA 4D0LB 3O74A 2DBQA 1H1LB 4B84A 2N1MA 4RA6A 4MUJA 1N5JA 2A5LA 2W2LD 5F1YA 4BMZA 3KSBC 1W49A 4EFLA 1ILEA 3JSXA 4LMPA 2BP7B 1U8FO 4MQMA 3N2ZB 2Z5FA 3BGOS 4C08A 4GWGA 4L0CA 4XQGA 3KB6A 1YVRA 2ESRA 2CFRA 2ZSUA 5K8IA 2CHGA 4PPYA 3EZYA 3OE1A 1EA5A 4PU0A 3OIVA 4FD2A 3GD5A 4QGHA 3S2EA 4FI3C 4LK3A 3SE7A 3WFZA 4N5DA 1GPNA 3KB2A 3OUZA 4ER6A 2JFPA 3H8VA 2WYUA 4BMXA 5EPEA 2QPOA 1G60A 2CNNA 3U7JA 4QGAA 4HSGA 4PVDA 1DBVO 2WAYA 4MPTA 1WE2A 5C5EA 1HEYA 3PJRA 4K0KB 1O5TA 4ZP1A 4EPYA 4GWKA 4KXFB 4U7GA 4O02B 1CCWA 1RQGA 2V8OA 4PAGA 4PTZA 3UEOA 1M6HA 2KBEA 2B8NA 2R96A 5EMLA 3B5EA 3KQOA 4J03A 4QPDA 3PWKA 4TLDA 3WNCA 4GXQA 4GYWA 3R9WA 1WMBA 2IPNA 1T9AA 3CUYA 4YK7A 4DVGA 2H63A 2Z1NA 1QNLA 2GDJA 2H9IA 5CGZA 3DO8A 4UAGA 3ZZTA 3MRXA 1KYIA 1MX5A 4PAQA 4M76B 1II8B 4DR5B 1E1NA 3NOOA 4C4AA 3DV2A 1HL3A 4XPIA 2RGNA 2V54A 1Z13A 3FBTA 2L17A 1NE2A 5AK4A 5DHUA 4IDEA 2BGIA 1AQJA 4U5QA 3J7TA 2CYAA 4IM7A 3KSRA 3H5VA 3A9CA 3C8UA 4JCOA 4EOGA 2BMJA 4IDGA 1Q0HA 1IAVA 3Q0TA 2XMGA 5ULLA 3F8TA 2DTDA 4URYR 1N8TA 1QDEA 2ZU6A 3DDCA 1GM5A 3WNVA 2P78A 1C81A 3GK3A 3TW6A 5LLTA 2FQQA 3IBGA 1F3LA 4H7KA 4K1LA 2I9KA 1Z3CA 2CNBA 4F46A 5TR9A 3GEHA 5BNTA 2YINC 3GW8A 1NUSA 4F9FA 3I9JA 2PN1A 2WLSA 5THKA 3UWPA 3EX7C 2BUAA 3HU1A 4GMXA 3EPRA 4D9EA 3MWEB 1A9YA 2R1UA 1SU8A 2YWRA 4DREA 1KXJA 3I3OA 2FWRA 2QYOA 4S2EA 4Y9TA 3I76A 4ECAA 2E7ZA 1HYBA 4IOMA 3IALA 1KEEB 4N6NA 4XWWA 2IXEA 2NSJA 2C04A 1GGEA 3LQ4A 4MJ7A 4FYPA 4OYHA 1EFHA 2BUCA 1EDDA 1E1RD 3F1KA 4L76A 4MWGA 1ENOA 4K8OA 2QTVB 2CVOA 2X9QA 3A27A 3W1WA 4PZAA 3WLHA 4DTIA 3N8GA 4PAMA 4PLYA 2JFWA 3ZVKA 3CLSD 2BEWB 1JHQA 3NTOA 2E55A 5CCEA 4TVBA 1R8SA 3UOGA 1Q0LA 4L0QA 4E15A 4LHWA 3EF1A 4UEWA 4N4AA 1E4EA 1XZIA 3CF2A 3H9EO 4B3BA 5JNVA 3H4TA 3M81A 1U2QA 5EYPB 2H7YA 4INZA 1DAPA 3KOYA 1P2BA 4W7HA 1W9MA 1JXMA 1W88A 4OG2A 5EKDA 1TXGA 4EBFA 3GFOA 3FSRA 1TD9A 1H9CA 2OG2A 4ZYXA 1HX7A 2FE4A 4BGVA 4KQ1A 1UOQA 3FNQA 3DHYA 3E3MA 5C5DA 1TQ8A 1YUMA 3GPCA 3NRCA 1NVWQ 2VYCA 4YT5A 2OCPA 4RA9A 1JYSA 3CF4G 4WESB 1JFFA 1UWKA 2WJIA 3F5FA 3NDJA 2ZWPA 3NNSA 4WTOA 3CWCA 5AHKA 2O7RA 1FC0A 1QUEA 4MKHA 4ETNA 4YRSA 2IOQA 1VJDA 2B69A 5FD8A 4HD8A 3H5LA 4X1IA 1DPGA 3C24A 3MWFA 2H31A 2ALJA 5AVOA 4FE3A 3T5GA 4B6QA 4O08A 1MEOA 4BFSA 1NDQA 3M33A 4FX2A 4YDQA 3A6ZA 2VDKB 4HAZA 3TIFA 3HGTA 2K2WA 1YHYA 4LYYA 3WVNA 5KJCA 4DSUA 1HRKA 4AKIA 1E1KA 2H1RA 5AUOB 1RPJA 3A14A 5BOSB 4PANA 2PUVA 5ILQA 1ZZEA 1EKXA 4G09A 4K3UA 2V0GA 2NNWB 2WAOA 2RMKA 3WB1A 2V4ZA 3ZCSA 5IMSA 4UVDA 3FPHA 2QR3A 3QJ5A 1TM2A 5FRDA 4DZZA 3ENVA 5A9SA 3ZHVA 2HMYB 5FPKA 1U3WA 3RQSA 3EWIA 1RM4A 3LBFA 1LSOA 3LP6A 1YKGA 2AR0A 4FHEA 5JE8A 3OT4A 4H7DA 1C1XB 4G86A 1MZPA 1E7SA 2ZWOA 4DSZA 4Z5XA 5KPDA 1THTA 3I37X 4BLOA 2RGDA 3MTEA 1XZPA 2CB9A 3EVDA 5FTKA 3BC1A 4PM4A 3IO5A 1I0LA 4M21A 4YMHA 5JANA 2O8EA 4KTVE 1Z0UA 1EB8A 4R7TA 1Z6XA 1ADJA 2FR8C 1D07A 5T57A 3GZNA 3DAYA 4ZCQA 4TV8B 2ETXA 4UEQA 1DQZA 4BQIA 4S12A 4YT8A 1ZGBA 4GPBA 3RQIA 4GGMX 4JLOA 3SXPA 2ODNA 3ROQA 5LQCA 3EC1A 4ZI5A 3ELYA 3FPCA 1P1RA 4X6LA 3LYUA 3OMXA 4CL8A 1Y3BE 2HKIA 3B2QA 3FYDA 3FPLA 4LJ9A 2Z6AA 2X13A 1UBNA 5L9AA 1LNSA 2B5VA 3FVTA 4FQ8A 4CQMD 3SEZA 5DMHA 5K0TA 1MQAA 3GFBA 1X1DA 1MJ5A 3DMPA 4Z4IA 3UG6A 1OLXB 3W2FA 3L1IA 1H0SA 1SK8A 2R84A 3URKA 3LFUA 3V1KA 1OZFA 3OIUA 1PL8A 2WF9A 2JHFA 3FCXA 3FNHA 2Q4EA 5LLSA 2V7VA 2PZ8A 5T64A 1XTJA 4EECA 2JLVA 5EIBD 3UGTA 1GNRA 4GECA 5DSXA 4BNZA 1KI6A 1N9KA 1YJBA 2NPOA 5LA6B 1PLJA 1LDEA 3HEMA 1X7WA 4Y0NA 1G3RA 2A1TS 3K73O 3KOWA 3ONEA 5L3VA 1AV6A 1HE2A 2QXYA 4EDHA 1QQTA 4FC6A 4Z9XA 4C1NA 3LY5A 1PNRA 4I8DA 5FAXA 4EUKA 3KZ1E 1N9GB 4HFMA 1UAYA 2XZDA 5CPBA 1ZG3A 1X74A 1JSXA 4KX3A 1GTMA 1SO8A 1VHTA 3R7BA 3UMVA 3CY6A 2W6JD 5DTIA 5HZHA 4UARA 1YC5A 3GAAA 2RH5A 1SJ9A 3OFND 4V0RA 1I6WA 5EQTA 5HE9A 5K05A 4M38A 2JHAA 5C52B 4GKBA 3PNVA 3ECCA 5CTJA 3AHFA 1N6NA 3CUTA 1K6JA 2AT1A 3DYIA 4H27A 4H7PA 2H4JA 4E22A 2ZAIA 3ZWNA 2X2OA 2HCFA 4FINA 4PPFA 3CPSA 3LXXA 1R9NA 3KP1A 3LVFO 1JW9B 3ECAA 4WOJA 4MQBA 3RT1A 4FX5A 3SJZA 2F2TA 1PNQA 1YNSA 2FMIA 1AC5A 2YKGA 1R4NB 3R0VA 4QIHA 2NP6A 3AKZA 5CVUA 4IJKA 2OBLA 4QVGA 1PL0A 2Q3FA 1FJ2A 2HDHA 4GLBA 1FX0A 2NTEA 2ZR9A 3C2QA 3CX3A 4ZAVA 3THSA 3EIXA 3UK0A 4LMRA 2C4WA 1MTOA 2GMWA 4E32A 5JH7A 1RYFA 2B35A 1WW8A 1GUZA 5JMTA 1B0UA 2BGWA 4TYMA 2LVBA 1NR1A 2QPLA 2ZRQA 1JG6A 2WV9A 3NBFA 4RK0A 3TDMA 1JS1X 3RS2A 4LPSA 4OHXA 1EVLA 2IP1A 3RO7A 4ZK6A 2ZS8A 3PDCA 2DEUA 1MO5A 3U44A 4Q37A 3L8DA 4CLRA 5IUJC 1TA9A 3H11B 2CMGA 1Z73A 3QV2A 3GIDA 4M7WA 2Q3DA 1G1MA 2Z8XA 2CMDA 4F3TA 3E61A 1ZK0A 3MG9A 3OLWA 3A10A 3V8BA 5IK2D 2ABWA 1U2RA 2PM8A 2ZBDA 3EA5A 4UOEA 1KE1A 3K16A 5F64A 4J4TA 1DMRA 2WPDD 4F93B 1R0LA 3K1JA 2Y6UA 3CIOA 4YJ3A 5HIMA 1RWVA 1UQTA 1JKFA 3QVLA 4QLAA 1QQ5A 2REQA 2P3LA 3QTTA 4YFVA 1X7ZB 3NT2A 5EXEA 1JG3A 3AF5A 2JCXA 4NU0A 4F72A 4NJMB 5CUQA 2FQXA 2JGAA 3PUWA 2P6PA 3JVEA 3QZUA 4IUYA 3P9YA 1L7PA 2GM5A 4DNPA 4YMIA 5K03A 4JJIA 2A35A 3TS1A 2YWFA 2JGLA 3F6YA 1J1ZA 1S2DA 2D2IA 3D2AA 4C87A 2P5TB 5BYJA 3OIFA 3PC2A 4CKCB 4QELA 3WBFA 3AR4A 1JJFA 4YDHB 3EEOA 3ETGA 1NP3A 4WOPA 1U7TA 3U17A 4BEVA 4LOKA 2G80A 5LD2B 2AOVA 2JS7A 4Q3EA 1YQDA 3VI3B 2ZBEA 5ALLA 2IY7A 4QHSA 4CM8A 3ZI4A 1Q0QA 5LXTF 3BHJA 1GLVA 1ZUWA 1XZGA 1IJBA 1WDLA 3C98A 3LCMA 4DGSA 4EHLA 1NURA 2YV3A 5KX5A 3HYNA 1KWGA 4TUYB 5L3QB 2XDQA 3DEYX 1IEWA 4P54A 2O5RA 4X8OA 2DU8A 2XVAA 2K7ZA 4W4TA 2ZIXA 4LHZA 4ESEA 4CV2A 3ZGZA 2YC4C 4IIUA 4BMDA 2ZAOA 1T29A 1T1SA 3B1XA 1RJEA 1XVAA 1PHRA 5HJ7A 4FCVA 2VJLA 4ILKA 4WBNB 3PTAA 3EDMA 1N32B 1KZ6A 2RGGA 3VR0A 3EZXA 5JOQA 1JB1A 3CR8A 1E6UA 3OE7D 2JRCA 3OCCA 4I1YA 1H22A 3QELA 4YONB 1BXGB 2BM9A 2P9FA 5T4FA 1PZNA 1XVVA 4GFDA 3UMFA 5CG1A 2H5JA 5I4KA 3PP8A 3U62A 3ASVA 1XEWY 3FYUB 1XZLA 1Z12A 2ZRCA 4DDWA 1AGXA 1RKQA 3FFTA 2DT5A 1WBBA 2H1VA 5LXTA 1EK2A 2P4EA 1IXRC 1UC4B 1A8IA 4WW0A 4BJ1A 3DXFA 4TWZA 3C3MA 4F9TA 4NOKA 4FHGA 4UASA 5CYPA 1PQYA 1S6YA 5IM5A 2ZTMA 5BVGA 3SIXA 1M2NA 5CBPB 2YS6A 3BXHA 1NL3A 2G8LA 3FBWA 4DFDA 2QU8A 2GZDA 1YZVA 4PHHA 1JBKA 4KQJA 2WYWA 1IL0A 4MGHA 2IA5A 3B13B 3OM0A 4MI6A 2DPHA 1GPKA 2EHDA 1YQEA 4EATA 1WETA 3H9GA 1IEVA 2NU7B 1WMAA 2QQ0A 2YIMA 3ORHA 3OX2A 4M0LA 5EIOA 3GVCA 3GRZA 3AVOA 3HHEA 3VUFA 3IAM6 1CG6A 3QLUA 3BUSA 4DF3A 4MHSA 5FO1A 3I64A 2FPPA 4R1OA 1G20A 3R9XB 4RF5A 3SBDA 4RYLA 4TL6A 4TMKA 2IX3A 4HFJA 4HUTA 1EK1A 4OXNA 2FY8A 4AJEA 4N41A 3L18A 3VM6A 1G0NA 1H9BA 2OPBA 3CC8A 2BI8A 3Q4GA 4FEEA 4B87A 4BLPA 1OLSB 4ND8A 2ZRNA 3KOMA 4Q3KA 2GK3A 4OYLA 5LNK1 3TGPA 1DIBA 1E3IA 2V3WA 1Z5GA 4YI5A 3UICA 4B0PA 3L6UA 4ZVMA 3REFA 3AM1A 2HRCA 1UMCB 1W96A 4XX1A 2IXTA 2ZJBA 1E0SA 3B6KA 3B53X 4K9LA 1NN5A 5F98A 4NSNA 5L6LB 2CDAA 2JIPA 1RXYA 2P1RA 1THGA 1ZI8A 4XQCA 5EMMA 3JQBC 1YSCA 1SBNE 3KUUA 5C31A 3PL5A 3M2PA 1YB5A 4EY5A 2HPHA 1W4LA 3FMPB 3LVQE 2JGDB 4ZVSA 3REQA 1FP7A 1WJGA 3MJVA 4BEJA 2RJ3A 1U8EA 1FTNA 2QNRA 1SIWA 1DJLA 3DUFB 2PRIA 1BXZA 1A1SA 1BMFA 2GO1A 3AJRA 3OY7A 1U4NA 5H82A 2OGSA 2BISA 3A6HA 4KQ2A 4CTNA 4E5KA 1T13A 9ATCA 1E7YA 1OLUB 4JC0A 4OUDB 1AZWA 1CJVC 1M34A 5JD4A 2JG3A 2D5IA 1M1YA 1I5OA 1VI5A 2HGSA 3KCQA 3V80A 1MJFA 3UJ9A 5T7BA 3JQ9C 3CKKA 2FETA 1W47A 1TPZA 4L16A 4CMEA 1ZH4A 2ZUSA 4KFCA 3D8RA 2WABA 5HF8A 3HI4A 1KQOA 2PLWA 2O8FB 3KJGA 1TMOA 1TYDE 2CXQA 2WZBA 1JFSA 2WZCA 3DZDA 1WMSA 3K15A 3UXEA 1PVVA 4JT2A 2SBTA 4H4CA 3M0EA 2I2DA 3HJNA 3JQFC 4LJ7A 3WOHA 5KAMA 1YL6A 2B6HA 1DAEA 4FR0A 5K6TA 2K4MA 3E35A 1W35A 1U98A 4ENQA 2RONA 1UT6A 2WKRA 3FOBA 3O9MA 4Q02A 1AS2A 4CQLA 4ETIA 1BE8A 1X9IA 3WBJA 3JPYA 2WW8A 3EEIA 4G1EB 1NLUA 1UMDA 2ATVA 2MMGA 1TC2A 3LKZA 3N8IA 1Z88A 1UKVY 4K9DA 4BIIA 3FTDA 2QLFA 2GJ8A 5BQFA 2IS2A 2ZG6A 3OQ1A 3ZLUA 1FFYA 1UT5A 2W8BA 1FP4A 1OU0A 4DYDA 5LMUB 2HWUA 3DMYA 2QTRA 3EGDB 2G83A 3ZY6A 4DLAA 2PBLA 3ZLTA 2D8MA 4KJZA 4XM1A 3KR1A 1N1EA 2HZBA 2LUOA 3ANMA 3D6NB 3OPVA 4P93A 1N2ZA 2FK7A 4R98A 2AMLA 3SVTA 1L5HB 1IMOA 5KKAA 3AOGA 4DV5B 5JFTA 1OBFO 1HGXA 2NU9A 4UCWA 2QYTA 1F2UA 4KHPB 1ENPA 3PSHA 7YASA 5LQRA 4UZFA 2C3PA 4FFNA 5BN5B 5L6MB 1IY8A 2D0DA 3T9CA 2GPJA 2OP0A 2VAXA 4TSKA 2VF7A 2NLOA 4OHFA 3QU7A 4I9NA 2ZBQA 4C3VA 1V95A 1CEXA 4AMGA 3RT7A 4DAEA 4C5BA 4KQFA 1MGPA 4KPUB 2OD7A 4JR2A 3QWHA 4KXLA 4N0DA 3LCJA 5H7XA 1QAOA 4EUEA 2RDMA 3L6RA 1SUAA 1QE3A 5JFOA 1QIGA 3COJA 5AJHA 4MVJA 5DF1A 5ERGB 3BPSA 3E18A 5DASA 3VISA 3ETHA 2GLUA 3E3OA 3ZCXA 4HTAA 3NBZC 4TYNA 3IELA 3MMSA 3P32A 3ZZNA 4NATA 5KWIA 1NRWA 3A28A 1B43A 1LDGA 1SKUA 4P53A 1LLQA 2XOKD 2YRWA 3B2NA 4LWZA 4EG3A 1REQB 5IBCA 4B6PA 4KR2A 2YOGA 4B32A 3QXXA 4IQ4A 2B2CA 2P2ZA 2PLAA 3Q7QA 3R7NA 4X84A 721PA 3MIIA 2HN9A 4DUGA 1KH1A 1MCZA 5FBRB 5JTUA 1Q11A 4YR9A 2IH5A 1QG2A 2ECOA 3D0RA 3JZFA 2O3RA 5JVDF 1JLLA 4Z4QA 4KR7A 3HK2A 1JXQA 4OLHA 3I73A 4QXRA 1B2LA 1PSZA 4FBMA 2R7LA 5I5GA 4FK8A 3W5IA 5JEDA 2PAAA 3EODA 3MM4A 2ZYGA 3TMAA 3SX4A 8ATCA 4BNTA 2Y9MB 5JO9A 4YYEA 1RTKA 3I83A 4UDNA 5IDYA 1LBIA 1ONNA 2FAXA 3S27A 3VPDA 3H5AA 2ZJ6A 2HBRA 1SVNA 2VHZA 3EFBA 4BMYA 1X1TA 2HZ7A 4ERNA 4JYMA 4JR1A 2WKSA 3GYGA 1LEHA 4M1MA 5ILGA 3SZLA 1AF7A 2BHLA 1OYYA 1H2WA 3KU4A 2YQ5A 1CUFA 1TK3A 3IBTA 2WEKA 2VF2A 4D4MA 3QYFA 3WYAA 5AO9A 4QG7A 1ECFA 3AESA 4BV3A 4DDHA 2PWZA 4XUGB 3QFHA 4JLAA 2QRKA 1QYXA 3ZS8A 1RI3A 4NYIR 2JAOA 1CEYA 3OETA 3T34A 1RC0A 2G1UA 4MQFB 2DE0X 2WT4A 2I8CA 2JNWA 1U1IA 1HBJA 1MO4A 3LXUX 1RR6A 2OHJA 4IDPA 2ZJFA 1RM3A 3UT6A 4YAIA 3ZWQA 3MWJA 1AU9A 4BXOB 1DX9A 2VRBA 3VZPA 5A3SA 2Y0BA 1VFNA 4QOHA 3R8CA 1TQHA 4OYYA 4CHTA 2IYAA 2Z1MA 1DIHA 2ZIWB 2E5LB 3W2GA 2F8SA 5A2QA 3HDTA 3WWYA 1Z6GA 3QKRA 5F52A 5GJWC 1H2XA 4AZTA 3CLHA 1HTBA 3NDPA 3LQ1A 2HFKA 1ZHHA 2AQKA 2ZWMA 3KD2A 4HXYA 3PIDA 2QR2A 5DH9A 5CYOA 4UHEA 1TF7A 3AV0B 4ZDWA 1EP9A 3RU2A 4F3NA 1GGFA 3KPJA 1Z4PX 3IUPA 1HDIA 5CDFA 1Q12A 3KT6A 4CIVA 1QX4A 2BGTA 3HVUA 4Q05A 1R6UA 3PX2A 4LF5B 4QKQA 2PD3A 4IIGA 3ZWBA 1QIFA 1UJ2A 4RXTA 3VDQA 2SCUB 3FDJA 5C9ZA 1UP6A 1E1LA 2REXB 4Y1EA 3FNGA 2XNDA 3LHIA 2PRJA 4LWPA 4R5MA 1EIWA 5IP5A 1X38A 2R751 5F5LA 4RPHA 1BWSA 2H7VA 1BEEA 1XDBA 3LJKA 3QPVA 4N54A 2ADOA 4CKWA 5F33A 1JSCA 4EWLA 1Y8QB 1CS0A 4YBZA 1NYQA 1MRNA 4F3YA 2DPGA 1O97D 5LDDC 5U4XA 3SZUA 5ADWA 5I45A 2P1ZA 2KSQA 1LQ2A 1MOZA 5FPTA 3ZV5A 1I4DD 2ZYWX 2AJ8A 3SC6A 3ADOA 1XR3A 2CSUA 2X4IA 1E63A 2QTLA 3M2TA 1S2OA 2IWHA 1ZGZA 3G2LA 2IIVA 4FILA 4XJTA 4N0QA 2HPVA 4XI9A 4Q1EA 5GGXA 1H2RS 4XARA 5EZSA 4AF6A 5HUQA 4NRDA 5EZ6B 2OCKA 3DT8A 4M1TA 1BU5A 5TS3A 2V4UA 3KXDA 4UQOA 1KRXA 5AVYA 3AR2A 4BBAA 4DLWA 4KDRA 2OORA 4NULA 5AHOA 3WK4A 2CW5A 3ESAA 4ITVA 3CQ9A 1FXWF 4JQZA 4L8VA 3BAZA 3RU9A 4DJDC 2G82A 4RXUA 1N5MA 4A0FA 2WQ6A 1CFJA 3PDHA 3S7ZA 4D92A 2CE7A 2JW5A 3ZXYA 1MLDA 2QUKA 3VZRA 3NCHA 1H3NA 2LCFA 1GNPA 3ORRA 1XB2A 5J5AA 1HLDA 5IXYA 3VR2D 4PV7A 4D97A 3ZW7A 5H9WA 1SA0A 3CGWA 3SIPA 3GX1A 2FX5A 2ZCUA 1XMVA 1L4FA 1AUQA 5AHWA 3VSBA 4DA6A 1WZNA 3O75A 4WXHA 1LUAA 4DR4B 3IPRA 4KYUA 4Y7DA 4AMUA 5G41A 4A5SA 4F5ZA 2P41A 4B31A 2Y1WA 3P4UA 1KGSA 1RAFA 4Q4HA 4X1OA 2E9SA 4EI9A 4ETMA 5K8LA 1RQPA 1N7IA 2ZQZA 4IDFA 4Y2UA 1KIAA 3T9DA 4F4UA 2SHKA 2ZRGA 3HUFA 4YWHA 3NG1A 2CXPA 2EX1A 1A7UA 4AJKA 4RX1A 4PG8A 4FIZA 4IXTA 3NMUF 4KXNA 1DFGA 2Q6KA 3N1UA 1SBCA 3EXIA 1FW6A 1K1EA 1UJBA 2J8ZA 3HY3A 4LNUA 4XWKA 1DKLA 3KL4A 2Z0MA 4MZDA 3E82A 2P9GA 3PPWA 4G81A 5WRFA 1QGUB 3AIOA 5IZCC 1N78A 1GLNA 3PA6A 3TR5A 1X1QA 1N33B 2Q0XA 4IJQA 4Y1RA 2IZ0A 4XUDA 4Z4EA 3ICEA 5IAEA 4YAFA 1DHTA 4ZO6A 3OESA 1PS9A 4DR7B 4W8GA 1L7NA 1PR1A 1VJCA 1W1WA 3ZQKA 3LWDA 4ZK2A 1QYRA 2BFEB 1N6RA 4UEOA 3UAYA 2J5KA 3HYSA 1AQLA 2KE5A 3WNBA 2VK1A 4CKBA 1KO5A 3U7FB 2OV4A 5JC1A 1ODSA 4RXMA 2QW8A 3MHPA 1FE8A 4FR2A 2Q5EA 3EW9A 2DT8A 3SSOA 1XEXB 4QEZA 3AY3A 1P5FA 1RBYA 1SFRA 3KLPX 5EAIA 3V4PB 2H16A 2F48A 3N0WA 2Q4RA 4QLOA 1NV8A 1HG0A 1OZGA 1DFIA 2JD2A 1L4HA 2LWIA 3JX9A 3RLFA 4JI0B 2R8PA 3O3OB 3TLAA 3E03A 3F73A 2J3EA 3DR3A 1OBVA 3DE6X 4JQYA 1RZUA 2M6KA 3P1JA 4YR7A 2PUJA 1NTRA 4YJHA 4BNJA 2Q5CA 2XCRB 4NFLA 1SN7A 1YDFA 1A71A 2Y4OA 3MSCA 4LCJA 4DHEA 2HT1A 3H0CA 5K3AA 1OC4A 5FDFA 1A2BA 5HM8A 2HMTA 2FN8A 3QVTA 4YMTA 3NUGA 3WGMA 1N2GA 2YHAA 1W44A 3MB5A 4OSPA 2FPXA 5FWAA 4EI7A 1Y3HA 2JK0A 4IH1A 3PQ6A 3CVWA 1WDKA 2IYNA 2XUZA 2NYRA 3JRNA 2BDTA 3U6BA 2OMKA 3L3BA 4HRXA 1NN0A 4BKOA 1BVRA 2R0QC 2QMOA 3O4RA 1E0KA 1PLKA 1TJPB 2G0NA 4KZKA 4HDNB 4U2FA 1SVSA 3VR1A 3RJMA 1TMGE 1X70A 1ZBDA 1UP7A 1DU4A 4E4YA 5EE1A 1WZCA 3A3PA 5E9JA 4CR8A 3KDSE 1RPNA 3IKLA 3VHXA 3GNLA 4BN0A 5GV8A 3T35A 4P33A 3C70A 4PZYA 4YBRA 3TAUA 1G8GA 5HDBB 4BIMA 5JAUA 3FGPA 3NDIA 4JT9A 4A2WA 3ELWA 5HM6A 3T7TA 2J07A 2ZRLA 5F7ZA 1EXNA 2D74A 2IHUA 4GYKA 4HXGA 2YZ2A 4MS4B 3CCCA 2MR5A 1F2DA 3OCVA 1GAWA 4RH0A 3G6KA 4YRTA 3SDBA 3SNKA 1T1RA 4LOAA 4EIWA 5UKDA 2Q1TA 1L7AA 1XZAA 3GRAA 1U1FA 2PZAA 1IWBB 3NVDA 1W46A 4UHKA 4R1PA 4YP6A 1Z33A 2AXEA 5SY4A 3U4CA 1MEEA 1IB0A 2F1IA 4I55B 4BNYA 3EGWA 2ST1A 3NKVA 2CLSA 2FUEA 3F7OA 3WGOA 1K9SA 1F4VA 2EFGA 1DVRA 1XCPA 4JBYA 5EFZA 3HCCA 3PC3A 2PZEA 4KFRA 2FP4B 3K70D 1G4HA 1R8QA 5FYDA 2FZCA 4HC4A 1HSZA 3PXBA 4MR7A 5LOVF 4D56A 4JB3A 5HBRA 1DRUA 2HX1A 2ZPTX 1KARA 2FX3A 3BWVA 4PYIA 4CIBA 4YCJA 5DI3A 3DLPX 5FL7D 3VJKA 2EKQA 4CCSA 4HK4A 1ONBA 3E3AA 2VPQA 1I8TA 3HZRA 3MERA 3FHJA 3JYQA 1QTNA 2B5OA 1IRXA 4YJ2B 3B7WA 2BR3A 4C3OB 5IEJA 2CLLB 1PEAA 1VLJA 3I9MA 1MJGM 4L95C 4Z7OB 2PUAA 2FZEA 3Q2KA 4WXPA 1FUEA 3VPHA 4QTTB 4FGUA 4Q03A 4UBJA 4BYMA 1CUJA 1G7SA 2I4TA 2O7NA 4J0IA 1MX9A 1Y4DE 3KJNA 4LBYA 1K7CA 4OPMA 4AFNA 5JHHB 2EBUA 2OBYA 1LJLA 2I62A 2WIDA 3H2HA 3IUQA 3LBHA 3QWBA 4KYIB 5L40A 2KJQA 1T0UA 4PN3A 3BULA 3NCTA 1EEHA 5JU6A 1U3FA 3GF4A 3MUFA 2C5EA 1IRIA 4H18A 4UBMA 4IZOA 3ETLA 4ER3A 1RE1A 3OPQA 3BTVA 3PX3A 4MEAA 5HBGA 5SZHB 1CHDA 3AQIA 2VUSA 4Q7JB 1VC2A 3LOPA 4HUQB 4EABA 2OZEA 1G20E 1CQZA 1J8YF 1KVSA 3AUTA 3C5EA 5CT4A 5TC4A 4OXYA 4CM7A 2ZT5A 2UVQA 1ZEMA 4KAFA 5GIOE 1L5NA 1Y6QA 2I80A 3GUUA 3T5CA 2HLDA 2XXBA 2J3KA 3PV0A 5EIFA 1AZSC 7REQA 1RXUA 4AJPA 4YCSA 1ORTA 4CZ2A 5TJ9A 1VMDA 3RCBA 3D3WB 1CRQA 3JQGA 3AERA 1DPFA 1NKTA 1D6NA 2P3SA 1QONA 2WZDA 4DARA 3WRVA 1HYHA 1UOPA 2WD9A 2ZXEA 4G4JA 2GT1A 2JGRA 3HWWA 3DWGA 1XC7A 5LP6B 3L7CA 1MRZA 2Q5FA 2YHIB 3M4ZA 1BD4A 4R68A 3LVRE 4QBTA 3RIEA 1UDCA 4B3HA 4Z7JA 1XBTA 2VT7A 1KC3A 3G49A 4N7RA 3E1GA 3DLBA 4EZBA 2AZ4A 3LZCA 3BCHA 3QE2A 4CDGA 2A5FA 1R6DA 3G6WA 3QBTA 3MOIA 1HT2E 4QYWA 3TNYA 3TXXA 2VYFA 1XSEA 4NR0A 3C43A 4DPLA 5DLYA 1KI7A 1T9BA 2QRMA 5EQJB 3JQAB 2CMHA 1GRRA 1F5NA 4OOEA 5C5IA 2B0JA 4ZU1X 3GU3A 4GVLA 3RREA 2ZBRA 4A5OA 2ZIAA 4KBGA 5JAPA 1NJ2A 2W4QA 2NXNA 5ENDA 1P73A 5AHXA 4C9BA 1VZ3A 1M1YE 2ZI6A 4D0NA 5KKNB 2V6GA 4GOJA 3WLRA 4BUCA 1YFJA 1MNQA 1X15A 3D7RA 3P4YA 2IYUA 4FNOA 4I2NA 2A1UA 2X1VA 3D3NA 4IVPA 4DDMA 1KWKA 4RTSA 3BMOB 3I1IA 4UTNA 1K08A 4BPRA 2NZVG 3P19A 3HCBA 1ECBA 2ZJ2A 4PW0A 1E8MA 4MS3B 2GESA 2OZVA 2QLBA 3O2JA 5CDUA 3KYCB 3FKSD 4AQ7A 3TNLA 1FDSA 1NM5A 1RQRA 3IEXA 3E15A 3S8EA 1Z5UA 3VC7A 1WKBA 3DEAA 3FDIA 1AMOA 1A9XA 3IX7A 1J24A 1CRLA 1UDRA 2NXEA 2ZRJA 3UGKA 3S2IA 2HCRA 5JAHA 2I7DA 3WIEA 1F0KA 4BBZA 2R8RA 4WCFA 4KRFA 3HP4A 3BF8A 3EWSA 2R47A 1LGYA 4OM8A 4XCXA 1GIAA 5EJ8A 1JALA 1EIZA 3CNQS 4XX0A 4H6VA 5D7NA 3TJRA 1D6MA 3HJGA 3AG6A 1JRLA 2JIBA 4EY6A 4R9NA 2J0SA 4LJAA 2VJCA 5TXGA 3GLGB 3AZOA 5AXAA 1OYVA 3DL7A 3WLIA 1ATIA 3FUTA 3WMRA 2MSEB 5CX1B 4EJ6A 4DDTA 2DPMA 4GBMA 2ZSDA 2X7JA 1PNOA 3F4BA 1I01A 3JW8A 3RFTA 2VH1A 2I8AA 2WQ7A 2A1IA 1G1AA 1UDBA 2FR0A 3C97A 3NBAA 4IEFB 5EHIA 4ZT4A 3ZU5A 2IIBA 4AP5A 4D0SA 5ALTA 4EHNA