5FR1A

Double acetylated rhogdi-alpha in complex with rhoa-gdp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
190
structure length
184
Chain Sequence
IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQASGCLVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSFORMING PROTEIN RHOA
publication title Rhogdi Alpha Acetylation at K127 and K141 Affects Binding Towards Non-Prenylated Rhoa.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 62
structure length 184
sequence length 190
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fr1A00
1Z6GA 4A8JC 2I3BA 1NP6A 4V0NA 4GZLA 1NG9A 4MGYR 3JVUA 5FR2A 5FOUA 2ZE5A 4M1MA 5DGXA 2O8DB 3T61A 3HPRA 1W2GA 3QEJA 4B33A 4DLVA 4EPXA 3GLIE 1LF5A 3R7WA 4Q03A 2PT5A 5F9FA 3LAWA 2V1XA 2WVJA 1WF3A 1IJEA 4BGDA 1XMJA 3A1WA 1TADA 4IFBA 1CP2A 2FEMA 4FW9A 4TTPA 5L8VA 2YWEA 3I3SR 2C78A 2JJ2D 4RJLA 4C9BA 4PSAA 2D06A 4F38A 5FPHA 4EPWA 4F4JA 2BMEA 1TQ6A 5DI9A 1OIXA 4AWXA 1KJWA 4CT4B 4QJ3A 3VMFA 4C0QC 1RRGA 2QENA 3W6NA 3MG9A 3X1XA 2FSHA 2ZRCA 4FCWA 3B2EA 1KKMA 2BCGY 3M4YA 1XMSA 3BC1A 1G21E 3TAHA 2W6IA 2V9PA 2E9SA 4KSBA 4HAYA 1YZNA 1Z08A 4DDTA 4LJ4A 2FX3A 2G0TA 3GJ3A 3MWJA 3X1ZA 2ATVA 1M7BA 4R2IA 5AWFC 5JJIA 2VSXA 2ZUCA 4P33A 4ZCMA 2A3RA 1CS4C 3B60A 3JZAA 3L2OB 3O8BA 4EFMA 2NO6A 2P2LA 3QIAA 4KLNA 4NKRA 4DB4A 2NGRA 1W46A 4BLSA 5DH9A 3I61A 2G77B 3QXCA 3QPWA 1UJ2A 4BEJA 2VP4A 3U6KA 3DZ8A 3SBDA 3WBJA 4MRSA 3BWDD 5KPDA 3GLHE 1JXOA 3MAAC 2REOA 2ZR9A 3OESA 2VP5A 3TR0A 2O8EB 4WA7A 4ACAA 3NKVA 1KY2A 4JBYA 3WHKA 3ZJYA 1VCNA 3IQXA 3TUZC 1X86B 4PPNA 3K70C 2O8EA 1X1RA 1SQ5A 1E0SA 2IYTA 1W47A 4DLXA 4PAQA 3JZMA 1UKVY 3MCAA 4BZPA 3I4LA 3RWMB 1QRAA 2CXXA 3CPJB 4BRUA 3K8YA 5EP2A 5JRZA 4R71A 5JLJA 1JAIA 1KJYA 1ZCAA 3BXZA 4LUCA 4BECA 2AXPA 3QVVA 4I1SA 1DPFA 4RKEA 5JI3E 2BKUA 4E07A 2NOAA 4HSEA 4ZI3A 1ZNXA 1TQDA 1UKEA 1WCV1 3TQFA 1TAGA 1YR8A 1ETUA 3B1VA 3A6PC 4POAA 1CR0A 4QM7A 1NLFA 3I5YA 2VP2A 1E94E 2P5SA 1BOFA 3K09C 2QAJA 4JLPA 3EA5A 2F43B 3FMIA 4URXR 2CHVA 4TSFD 2JEOA 1U99A 2G0NA 5C2JB 2PZEA 4KVGA 4W5HA 5E7MA 3RVBA 1AS3A 4WBSA 4EPRA 2ZROA 1G64A 5SZIA 1M7HA 3QG1A 4XSGA 2RB4A 4A15A 5TMPA 1VHTA 2CMKA 2AK3A 3H1TA 5DN6D 5IRCD 3PFIA 1E1RA 3KXIA 3TK1A 1KY3A 4TL6A 1II8B 1YKSA 2FG5A 4HZIA 1E2PA 3UG7A 2QTHA 1XZPA 3HYTA 1VIYA 4D4KA 1QHGA 1KSGA 4V0ME 1II8A 4D80A 5CIWA 5JWHA 2OT3B 2V1UA 4UNPA 4KSCA 4CDGA 1J8MF 2PEYA 4C0KA 4QKQA 2JLQA 1CU1A 1W4AA 1XX6A 3KJIA 4LCBA 4TMVA 4ZCLA 4YMTA 1KDRA 1Q1QA 2BBWA 1G4UR 3K0CA 3L0PA 3MFYA 4JVLA 4Z1MA 4BEBA 4Z51A 3U4QB 3SBEA 5C4MA 2QUZA 1E1QD 5E95A 2ORWA 3NWJA 3KKQA 4Q18A 1S0UA 3U4QA 5B58C 1SHZA 3SYLA 3D8BA 4GNKA 3T1TA 3ZVMA 4B3DA 2OFXA 4XH9B 1J7KA 2W83A 4Q1DA 3P1JA 1NVVR 1EX6A 2GRJA 1NVVQ 3WXMA 2D74A 1RFLA 4WW0A 4PANA 1IN4A 2QSZA 5KU1A 1OFHA 4K81B 3KFXA 3JVVA 2BM0A 4IXMA 4OI0A 2IEZA 1KO1A 2JDID 2QQEA 3QXXA 5AJVB 3UG6A 4BUJA 4R2HA 5KNDA 1W5SA 3LNCA 4KFUA 1GAJA 2Q6TA 2OCAA 2XNSA 2ZRNA 1KZGB 2OFWA 2J9RA 2H92A 621PA 2EFDB 2CNWD 2GILA 2R6FA 2V6IA 3D31A 3FKSD 3M6AA 4D6PA 1W2HA 1LS1A 1KI9A 4LC0A 4PXAA 3QQ5A 1OYWA 3THYB 2A5DA 4ZO4A 5UKDA 3SFZA 5EP4A 2BKEA 1JQLB 4NE2A 4NU0A 1X3SA 1MV5A 1Z2CA 4M0LA 1P7CA 3THYA 2HJGA 5JSZB 4NPHA 2YOFA 4PAMA 3D7MA 1GVNB 3NDBB 3EA0A 1FQJA 1NN3A 2B6HA 5D3MA 1ZUHA 2I1VB 2OSBA 3SEAA 3DKVA 2HLDA 4TLBA 2NZ8A 4LV8B 3CW2A 1G8GA 3HU3A 4QGFA 4LDJA 3R20A 4AIIA 4PPQA 1XJQA 3TAUA 2CLSA 3WMFA 3FE2A 3W8NA 3ICEA 2PLRA 1IHUA 1E79D 1XXHE 5KTYA 2WTUA 1GL9B 1E6CA 4W9MC 3THWA 3FTQA 3E70C 3NVAA 4JZKA 2VO1A 4Q1CA 5HZHA 2CVHA 3ZS9A 4RD6A 1ZNZA 3A58B 4A1FA 4JYBA 3K0CC 1PVOA 1ZU5A 3B1ZA 5AJYA 3RS7A 5K8UA 1Z83A 2PL3A 4MDEA 4PZYA 3OFNA 2EFHB 4JYCA 4JJKA 2G6BA 5JBQA 1XNJA 1KIMA 4YMSA 4IHQA 5FH9A 4E09A 2HT1A 4JJZA 1VG8A 5CB8A 4BPBA 1ELOA 2XJ4A 4MH0R 5DI3B 3RS4A 4TMKA 4YXWD 2BJWA 3EG5A 1CXZA 4JVNA 2O8CB 3REGA 2IF2A 2C95A 5HKKD 1Q20A 3WNBA 1P9WA 2AK2A 1JR6A 4KODA 2WSMA 5IK2D 5IT5A 3CNNA 2O8CA 1NJFA 1EFRA 1GFIA 4A0RA 4ESHA 4EUNA 3GMTA 1Q0UA 3TIFA 5CITA 1MKYA 3CNOA 5KSYA 5BW8A 2C98A 2JJ1A 1R7RA 5FL7A 3FHTA 2WMOB 3LWNA 1W36B 2QQ0A 2QPAA 4AKEA 3IEVA 1YU9A 2XZPA 1M34E 1PLKA 1G7TA 3GLFB 2ZI7A 3EZ2A 2LWIA 2OLKA 4LJ6A 5CLLA 2IS4A 1EFHA 4F92B 5J4YA 3OAAD 1XEXB 4FMDB 5DHFA 3GLHB 3GLFA 3K0FB 2VYFA 1T5IA 3RABA 5J47A 3EC2A 5LD2B 2R44A 3EWAA 2EFGA 3A4LA 2WWIA 2JJ8A 3K0FA 1ODFA 3TMKA 4B76A 4DJTA 3SJAA 3P26A 4IDOA 4R98A 2OLJA 2VSFA 4HDOB 3KKNA 3QXSA 5C1BA 3RS3A 2BBTA 2ORIA 4C0AC 3V4FA 2CL0X 1G8FA 1JPNA 2HEIA 4UNSA 4V02A 4DSNA 5JRJA 1KO7A 3RC3A 1VYTA 3L0IB 4PO9A 5GJVC 3PXGA 1FUUA 4US1R 1C1YA 1W0KA 2RGBA 4DLSA 2R65A 2HF9A 1Q3TA 4OL0A 1X8KA 1RRCA 3LBNA 2X1VA 1MRNA 4HAXA 3W5IA 4FMBB 4CRWB 2RCNA 4JLJA 2G9NA 4XVRA 2WOJA 2IHBA 5H1YA 1U8YA 3RYTC 2BVNA 1NSFA 2Z5FA 2ZRAA 5CK5A 4HUTA 3I8XA 1CR4A 2OHFA 3SQXA 3HU1A 1NF3A 1NMZA 4L9WA 4HYYA 1M74A 4FI3C 3LQRA 4XVUA 3KKOA 1RW4A 4UXHA 2ZM5A 2ZAOA 4N0DA 1O3YA 1UBGA 3LXXA 3ZH9B 3A4MA 2FSIA 4LJ9A 2CJWB 3ADBA 1S1CA 2C03A 4L16A 1LTQA 3U3RA 2C2HA 3ETLA 4D4JA 4HATA 2N1BA 1WRBA 3EPLA 2ZREA 2CJWA 3LV8A 1QHXA 4OQFA 3SR0A 5EUQB 4M1TA 5M04A 2QP3A 2GTPA 1OXXK 2VQSA 1R0WA 3FKQA 3VR3A 1AA9A 5CK4A 2F1RA 1NY6A 3WP1B 1L4UA 4DRZA 1RIFA 2WBLC 2EU8A 1FMJA 4QBIA 2FNAA 4BLPA 3E5HA 4YMUA 2XTNA 5GVSA 4Q7JB 2H57A 4LJ7A 3MWLA 3T15A 1VKJA 2J7PD 1W36C 4JT2A 4QFMA 2C77A 1CJUC 3AF1A 3L0OA 3QJYA 1IM2A 4KLZA 2I4IA 4OQMA 3W6PA 4MGKR 2ZS7A 1SVLA 4LHWA 4A0GA 2A5FA 3T1OA 4WOPA 2BEKA 3DMDA 4ON9A 3A1VA 5LD2C 4Q7LA 1DS6A 1R10A 2ASEA 3NEJA 4L4UA 1OH6A 3ECCA 3NDPA 1R5BA 1KJZA 5HTKA 3PJRA 3O47A 3MSXA 2G3YA 3KDSE 3A8TA 3OZXA 1DAEA 3GEEA 4U00A 1DELA 1CRPA 5F3WB 421PA 3WNDA 4TYWA 3LD9A 2QU8A 4H1VA 4G5QA 3ZZ0A 1OB5A 1IN8A 4RD0A 4BFTA 3QEOA 4YMVA 1XTRA 1LNZA 4B3CA 1OFIA 1QVAA 2PZFA 4URYR 1S1MA 5A4JA 4Q4HA 4Q5IA 5EE1A 4LRWA 1Z0FA 1N6NA 1LVGA 2G1JA 5E7JA 1RC8A 4M9XA 1G3RA 3H0KA 2ZETA 1P2SA 2UKDA 2IYSA 2PEZA 1UEJA 2WSSA 1SKYB 4PQYA 2BMFA 1II9A 2QBYB 1KI7A 2BEJA 2QSYA 1ESMA 1W4CA 4UQOA 2QRNA 1O87A 1EFUA 1NKSA 2HXSA 4NCJA 2QG6A 1W1WA 3BH7A 5BN4A 2J59A 2XOKA 2GJ8A 2LCFA 2OXCA 3PV0A 4JLNA 2PMDA 4LHXA 3U3KA 2GXSA 2PCLA 2WJGA 1VDZA 3UXMA 4LYHA 2JIZA 5B30A 4WAUA 1OSNA 1F2TB 2D62A 2IK8A 2QGZA 3CF0A 1F2TA 3BFVA 4DB2A 1NIPA 1YZKA 1XXHB 4C7OB 1N5JA 3HDTA 2YWGA 5JHGB 1G8YA 5AJWA 2QE7A 4GDFA 1JEDA 4C7OA 1XB2A 2WPDA 3CRQA 4IDPA 2R2AA 4FMCF 1E98A 2EQBA 2CBZA 4PAOA 5F2EA 2QEQA 1TTTA 2FZLA 1ZM2A 2QTFA 2BJVA 3ZZTA 4UNNA 2ZRBA 4FCVA 3PUYA 1SVMA 1H65A 2IYVA 1FTNA 2H8KA 3ZQJA 4NONA 5GJBA 2RGCA 2QGNA 4B44A 2JLXA 5AUNB 2RMKA 4RZUA 5FI0B 1JI0A 2OFOA 1E2KA 2ZR0A 3ZDQA 2NZJA 4MYUA 1NN5A 3T35A 1J2JA 1XD2A 1DAHA 1IY1A 2JAQA 3F0TA 4HLDA 4ILEA 4HAZA 5EQTA 5BYKA 2VH5R 1P2VA 3TSZA 3ADDA 2ORVA 2OE2A 3B13B 1PLJA 3IGFA 4P3YA 5JCPA 4NP6A 1OKKD 1OYYA 3AF3A 2VHJA 5C4GB 1AS0A 4LX0A 4OQLA 1ANKA 1D8TA 3RRMA 4TZ6A 4P31A 3LDAA 1FTSA 1GNQA 4NCKA 5EE9A 4D25A 4EDHA 3CZPA 5JZVA 2DY1A 4Q21A 4GSYA 1VCMA 1MO4A 1DAIA 1XWIA 2FF7A 4JVMA 1HQCA 3DMNA 2QL6A 1TX4B 3U2QA 2JATA 1BYUA 1MABA 3CWQA 3QKUA 2B7CA 1N2CE 2YYZA 2XNDD 2ZJ8A 4M9QA 4TT3A 3B1WA 2FSFA 3T06B 3T5DA 2PH1A 3NH6A 5FL3A 1VG9B 4WXPA 2GK6A 3THXB 3F5FA 4B3GA 2FDCA 1KI6B 5EXPA 3BBPA 4B3FX 4QC2A 5JFGA 4KVAA 3MUFA 2VSOA 3N5CA 4IDQA 3GJ8A 4KCGA 1QBKC 2GZDA 1KI6A 4NTZA 5EE5B 1K5DA 3VX4A 1JR3D 2GCPA 1UM8A 2AX4A 1Q12A 2FFHA 4UXJA 1CJVC 4DCNA 1D2MA 1U81A 2WWWA 2H16A 2BOVA 4ZCIA 4L5BA 4EAQA 1KK3A 2RGEA 1IAQA 2DHRA 2H17A 3K1JA 4Q9KA 4C0JA 4L15A 4MKHA 5K8IA 1E9AA 3LVQE 1CULC 1OHHA 3C14C 1YHNA 5CJPA 4AD8A 1JALA 3MJHA 2V7QD 4WXRA 4ZKEA 4DBLC 3MGCA 1OFUX 1P2TA 4OQNA 1NVXQ 1CBUA 4QGHA 5CJ2A 5KSPA 2W6JD 3DHWC 3FVQA 1TQ2A 4ABYA 5CLQA 1E2FA 2FFAA 1KK2A 4ASUD 3TW8B 5BXQC 4RCZA 3FFBA 1OH5A 3EWSA 3U7GA 1BO6A 1OIWA 1GSIA 3FPAA 1E2NA 2JLRA 2O8BB 3HP1A 1Z28A 1H8EA 1KSJA 4TQAA 1FUKA 4W5JA 4PPFA 1TUIA 3L8ZA 4XVQA 1ZUNB 1B0UA 1XTQA 4QGGA 3EPKA 2AWNA 1NMYA 1E3MA 4O2RA 2CL7X 4TMZA 3EARA 1NBMD 1HY3A 1MO6A 2F55A 1P72A 1COWD 3UWKA 3BB1A 4V0OA 5DSZA 1IQPA 5KPJA 2YZ2A 1H8HD 3R7WB 4LJ8A 3WMGA 1I2MA 2CLCX 3NG1A 3DEFA 4AG5A 4AY2A 3HR8A 2CCJA 4YONB 2Y8EA 1P6XA 1R0YA 3SJCA 3VR5A 4B2IA 2ZSFA 1RRFA 1P73A 3WHLA 3BAFA 4DLZA 1Z07A 3FHOA 3K9LA 4G01B 1E9BA 1D6JA 5KYKA 3TH5A 3CO5A 2O0JA 3AV0B 3OE7A 4OYHA 1E2DA 1E4VA 3KZ1E 3HWSA 4NH0A 4B71A 4HLCA 3SN6A 4IXNA 3EZ9A 2YINC 1QG4A 2DFNA 3SHWA 4LPSA 1EWQA 4PHGA 3KKPA 1UPTA 3PR1A 3TVTA 3KJHA 4G0NA 4DSUA 4OKSA 4TZ0A 1HQYE 2VTKA 2IF0A 3C5HA 4FIDA 4HZUB 5P21A 3U3OA 2P0EA 2ZRDA 4Q7MB 1OXTA 2JJ2A 1YE8A 3CKLA 4HZUA 3GLFE 4RD2A 3EIHA 4WZ6A 4LJYA 1SULA 4QBHA 4KXFB 2GJAA 4M1YA 5J4LA 2B8TA 3BH0A 1UKZA 4HI0E 1W7AA 1XD9A 1R4AA 2R6DA 5FOSA 5B57C 4OHZA 4PQRA 3W6OA 4A4DA 2ZSAA 2W2VA 1NLZA 1XZQA 4QJ4A 4JMPA 3CPHA 3UIEA 3A37A 5KNBA 1R5OA 1LF0A 2QMEA 5KNCA 3VX3A 121PA 1S2MA 4FXPA 2YVUA 4K46A 2C5LA 3SQWA 4CT5A 4PR0A 2CHQA 5G3YA 4B6EA 2IYZA 4JLMA 1DO2A 1JQJC 1RJ9A 3KQNA 3L82B 2J0QA 3U44B 3NH9A 1Z6AA 3I1FA 3N2EA 2L0XA 3PEWA 3K0SA 3SS8A 4EIWA 3U44A 4HAVA 4CYMA 1HEIA 2WJHA 4R9UC 1G3MA 2IUUA 1NN1A 2FU5C 1VCIA 4W7SA 4JS0A 2J45A 4ZDKA 1AK2A 1XCMA 3K9GA 5SZKB 1E9DA 1CJTC 1EG7A 3OIVA 1D5CA 5EXXA 3MWYW 4CEJA 2X8AA 4B74A 4PC1A 1ZUIA 1HE8B 2GEUA 3A1SA 3I8SA 3ZD6A 2E1RA 3NC1C 1Y63A 1AKYA 2P6UA 1ZIPA 3CR8A 4LY6A 4JLVA 2YWHA 4MDFA 1S8FA 2IYWA 2O5VA 2W0MA 2ZQ5A 2ZI4A 3THOA 1JAHA 5A0FA 4QHTA 3TKLA 4F93B 1ZINA 4D82A 2GZHA 2P6NA 4NYJR 4RVCA 3QBTA 1G7SA 4NYJQ 4C30A 4PPGA 4A6XA 1ONBA 2FWRA 4MRRA 2F1HA 5GADl 5DLQC 2AFHE 2RGAA 3BJIC 4HAWA 1NN0A 1TF7A 1U98A 3NC0C 2OZEA 4URUR 1FPMA 4PQFA 3RNLA 5JS8A 1GRQA 1KNXA 2OAP1 1BYIA 2HF8A 2RKOA 1UBCA 2B92A 4HDCA 4TTRA 3BD9A 2GK7A 3VAAA 1XDBA 1L7VC 4JSTA 3LFUA 1FMLA 1SHKA 5FR1A 1E9CA 1M8PA 2Q21A 5FBWB 4R7ZA 5DN6A 2V3CC 1KDOA 1DADA 1NI3A 1TUEA 4Q48A 1U0JA 3MD0A 4UJ3A 5IDVA 4DDUA 2QZ4A 5TXGA 2FMXA 4Q01A 4DEYA 8OHMA 1AQYA 2V4ZA 3B6EA 3LX8A 4PO1A 3GJ0A 4AYTA 3P4YA 3VFDA 1IY2A 2OO7A 3TUJC 1Z0AA 1Z3IX 2DB3A 2NMVA 1FP7A 4RY2A 2OBNA 4X8OA 2ZAMA 3HR7A 2P65A 3BE4A 3CX8A 1QG2A 1HYQA 1N6HA 4QBGB 4GL2A 2C9OA 2BIFA 3C8UA 1G16A 3KUCA 4IOKA 4NCHA 2JLUA 4XTRA 2OM2A 1G1MA 1ZC3A 5AJZA 1W0JD 1YZTA 3DZDA 2ECKA 5G53C 3GJ6A 4KYUA 1GOTA 3WYGA 1E99A 1E1QA 1XBTA 3LW8A 1I2DA 4TL9A 4MRNA 1P2UA 1CIPA 1QF9A 2N42A 4P4SB 4JIMA 3DL0A 2IHYA 2FFQA 1W4RA 4A6PA 1GM5A 4LJ5A 4AG6A 4MITA 4P4SA 1E2JA 4MYCA 1SKYE 2Q9CA 5EP1A 2F3RA 3GQBA 2CE2X 1JXMA 2A5YB 2AHOA 2GEVA 2IUTA 2JLWA 5D3MB 3EPHA 2HCBA 2NTYC 2HLDD 3K9HA 4NCIA 1NMXA 5CB6A 4QL3A 1CLUA 2DCUA 4C0SA 1KDPA 1RRPA 2KE5A 3PENA 1FX0B 1QHHB 1QVRA 4QXAA 2R9VA 3BOSA 4B47A 1TU3A 2IBMA 1VYUA 4YDHB 1NNEA 2FA9A 4NYMR 1TEXA 2JDIA 1FX0A 1PUJA 1QHHA 4NYMQ 3AP3A 4LI0A 2R8RA 1PJRA 1SVSA 1DAGA 3CR7A 1DG1G 1X1SA 2CNWA 3THWB 3FKSA 1P9RA 2EFEB 5FPYA 2O52A 3HU2A 4LZZA 2WWGA 1XJCA 1SKQA 4EJSA 1WB9A 2H1LA 4Q4JA 3FMOB 3QY0A 2VEDA 2ZIAA 3AF2A 3BERA 4ERNA 3OIUA 3OFND 4HDQB 1R0XA 1JEEA 2IYXA 3FYHA 1IJFA 5TB5A 2Z43A 4FN5A 4G5GA 1J99A 4PC3A 1MO5A 2F7SA 2ZYTX 4TN1A 2XB2A 4UXIA 4U7DA 4GOJA 1K8RA 1MT0A 1UEIA 1NY5A 1ZM3A 1VG1A 3OEHD 3VR6A 1SVWA 1Z6YA 4JSYA 4PZZA 1KO5A 1N5KA 1XMVA 2DWPA 3O8DA 4V0KA 1YVDA 1N6KA 2VP6A 2YJTD 1G17A 2IWHA 4KBFA 1E79A 3ZVNA 2BDTA 2QORA 2OCYC 2OCBA 3NBYC 3CRRA 4B3XA 4C0BA 4ZDJA 1G6OA 4IRUB 3O8CA 1G19A 1SXJE 2GKSA 4KO8A 4CW7A 4URVR 4RSGA 1P61B 3V4RA 3LRPA 4IVPA 4IFEA 4QNMA 2QY9A 3N70A 2CCKA 1OXVA 3QXHA 4B32A 3ZIAD 4AURA 4FD2A 4LOAA 1W36D 4DXAA 5TDHA 1C9KA 3AKYA 3AQ4A 2J46A 3IPXA 3GEIA 3NTUA 3SHFA 2DWQA 4DCSA 5J4HA 4LJAA 4DUGD 3VKHA 1I4LD 1LW7A 3BB3A 3L0SA 4X8MA 5EP3A 4YXWA 2SHKA 2Q0HA 1US8A 2CK3D 3IHWA 4B6FA 2BHRA 1E2QA 3TSOA 1KSHA 1QZXA 1YRBA 2FPLA 2RGNA 3KFVA 3W5JA 1P62B 1KGDA 4TYPA 3VTKA 3QUSA 2ZU0C 1OFTA 4Q47A 4RZ2A 2OEPA 3KTAB 2Q9BA 4S35A 3CZQA 3A1UA 1W0KD 3MWKA 2D4HA 4X8HA 1AQUA 3I72A 4KYIB 3UMSA 1N6OA 4EFNA 1FOEB 4OI4A 5JECA 2O8FA 1GDDA 4DDVA 3KTAA 3QBVA 1E0AA 2XTZA 1QHIA 1Z0DA 2Z4SA 4QHYA 3EZ7A 3AH8A 5GVRA 1E9SA 2OXRA 3OAAA 2OUKA 1T6NA 4EJSC 3KJGA 3GLGB 4PO8A 5FBRB 4MYHA 2CDNA 2D2EA 4ZDIA 4C3ZA 4JLOA 1U90A 1KMHB 4LBYA 4URZR 3LBIA 1CTQA 5LB2A 2QP9X 4J0QA 1NLYA 4US2R 3GLGA 1DE0A 1G8HA 2JASA 4IOJA 5KDOA 1KMHA 2J87A 4FCTA 1LB1B 3IPYA 4PHHA 2AD1A 3VR2A 3PEUA 1SVOA 1Q1ZA 2GCOA 1U0LA 1G3IA 3CRMA 3NBXX 4RZ3A 1S96A 3CX7A 1Z8FA 2QMUA 4LK2A 1RKBA 3KL4A 2GF0A 1QDEA 1DO0A 2GVZC 1XD8A 1YR6A 2F6RA 3LA6A 4URWR 2HJVA 2IS2A 2PZGA 4CIDA 2VP9A 1ZM7A 1HE1C 3AF4A 2JGNA 3U6BA 1KAOA 2B8WA 5AUPB 1A4RA 2GZAA 2IUSA 1CRQA 2CLDX 2ZJYA 1IXRC 3IO5A 3IBYA 4GP6A 2KSQA 4KI0A 5FOXA 1T4GA 1OT3A 1VMAA 2XSZD 3U5ZB 2UZ3A 2IXFA 2B7BA 3C15C 1X8JA 4B35A 2IX3A 5AK0A 5FUWA 3CF6R 2REXB 1VTKA 4HB4A 3U3MA 3AVYA 3KQUA 221PA 1AS2A 2ZRHA 1S9DA 4Q9HA 5DO9A 2JLYA 3MLEA 3EXAA 4ZKDA 2ZUDA 3PVSA 2J0UA 5HPYB 2IYYA 1UDWA 2ZANA 4KV9A 1MH1A 2YNMA 1F3OA 2RHMA 3Q5DA 2OV2A 4LHVA 2MSCB 1YR9A 1Z06A 2GAOA 3E2IA 4N0EA 4Y0VA 2ZITA 4XSHA 2NG1A 1N0WA 2G1KA 2VP0A 5FPTA 5K8LA 1FNNA 2F9LA 1N5LA 4N3NA 4G3XA 3W9YA 4QOSA 4PC7A 1XPUA 5JEEA 5EZ5A 4G5RA 3IBGA 4GMXA 2BV3A 4PX9A 1D9XA 3SYNA 2QT1A 3H86A 5KHOC 3ASZA 4Q4HB 2IL1A 1R8SA 2J7PA 2VHTA 1GRRA 3VQTA 1M7GA 2ODEA 2PJRA 4GMDA 4RZXA 2GJ9A 4I1OA 1HUQA 4DHEA 3AUYA 3MRSA 1Q22A 1E2GA 1Z0KA 1LV7A 2EW1A 3OEED 4KHZA 4B75A 4FINA 4M1SA 1TL7C 1JJ7A 2XZLA 1CJKC 3ZZUA 3NXSA 4M21A 1EK0A 1TEVA 3T1VA 2A78A 2FSGA 4II7A 2ERYA 3B9QA 1G4AE 5C46F 4A36A 2DR3A 4M22A 2WWYA 1T3LA 1GL6A 2V54A 2EYUA 2ZYUX 3AP1A 1W49A 3IIKA 1NVWQ 4U02A 3LQQA 3R8CA 4PHFA 1WQ1R 1UBEA 2ZPTX 1DAFA 2QAGA 2CHGA 3LX5A 5ANRB 4AKGA 5FTMA 5JMTA 4OK3A 1VECA 4P32A 3Q8XB 1E32A 3PCRB 4PTLA 2R6CA 2Z83A 4RCYA 2MSEB 2WMNB 3QKTA 2WM9B 4PFSA 1QHNA 1RVDA 1VPLA 3PUVA 4DVGA 4GOXA 3O8RA 2IXGA 2RGGA 2VRWA 1IXSB 1UF9A 2VF7A 4W5WA 2H7VA 2VIIA 3TE6A 3FMFA 1AZTA 3RSLA 2PMKA 2B21A 2EWVA 4DLUA 4JKYA 2GDJA 4B43A 3B7GA 3KUDA 3PITA 3IKJA 3AB3A 4GI7A 1TNDA 1BMFD 1R2QA 3Q7PA 4X8LA 3VHLB 1V43A 2ZRJA 1G18A 4C2UA 1XCGB 4IVRA 3SC3A 1XD2B 2ZTSA 4YQFA 3DVLA 1Z0IA 2GETA 3SJZA 3GFPA 3G0HA 4BLRA 2PLFA 5DNYB 3T34A 4XJXA 5CDFA 5LDDC 1P5ZB 3AVPA 3PEVA 1G291 3ZD7A 3B8HA 1SXJB 5B64A 5G40A 3Q85A 1AN0A 3PUXA 2RAPA 4XWKA 5JWOA 2NO9A 1V5WA 2WIAA 1U94A 4D26A 4FWIB 3TBKA 5JHHB 1FFHA 2VA8A 2DFKB 1SXJA 2LKDA 3CRVA 1EGAA 2XZOA 1XJ0A 2IT1A 1NG1A 4A2QA 5FI1B 1JJVA 1KYIA 1XEWX 4WVFA 4Z8XA 3SI7A 3T12A 4F7WA 5LB4A 1ZVQA 2VLIA 3U7HB 3X2SA 1UAAA 2QP4A 2DFLA 1MABB 2CL6X 2QM7A 3DPUA 2QNRA 2ONKA 5FBQB 2GA8A 3W3ZB 4FMDF 5KO2A 2XAUA 1U9IA 4YMWA 1OXUA 3P32A 2QRZA 5J4KA 3ZGXA 3CNLA 3SJBA 1OPXA 4GP7A 2QA5A 3IO3A 3VKGA 1AGRA 4TLEA 1TPZA 5DIFA 2PBRA 3R9XA 4LBVA 1ZD8A 4M9ZA 3RSOA 4MYTA 2CEAA 2FOLA 1OKKA 1N3BA 2FGJA 2QAGC 2P3SA 2O0HA 4NCNA 4DCUA 4Q4AB 4AYWA 2TMKA 4F4IA 1U0HC 2J0SA 4CVNA 5J5CA 5F9HA 2IXEA 1CEEA 1KZ7B 4H1UA 5BQ5A 4DCTA 4Q4AA 1WBBA 4DT1A 6Q21A 1J8YF 4DSOA 1LY1A 4Q1BA 4LBWA 4IEIA 3EIQA 2F1JA 3ZLJA 3NHBA 4Q9LA 3TVDA 4KITB 2DFTA 3HJNA 1GP2A 2BBSA 1ZAKA 4OI2A 4G1UC 4LYJA 2AKYA 4D0LB 1HH4A 1VG0B 3IDQA 3U60B 4HB0A 3FB4A 4XD7A 3K70D 4LV6A 3AVXA 3VR1A 1U8ZA 3U7EB 2BMDA 5L3RA 1H8ED 4OK5A 1JR3A 4E03A 3QKRB 5EXSA 3EZ6A 3ADCA 1M6NA 2D3WA 3AF0A 4KAXA 3EPJA 3PG5A 3UKDA 1OF1A 2W2TA 3RANA 3QKRA 5GJWC 4BFSA 4HB3A 3QE0A 3NHAA 4E22A 3OHMA 1N6RA 1FNMA 1RE0A 2PT7A 5E4FA 3FGNA 2YOHA 4WZBE 2V7QA 2VBCA 3ZS8A 3VNUA 2G88A 3LLUA 3AGQA 4I4LA 4EQ6A 3VHXA 4ZPXA 3QVUA 2ZRIA 5JJKA 1SXJC 1T3SA 2W6JA 4XWAA 5EE3A 4OHXA 4GFDA 4YLGA 1L2TA 4ZIRA 2QMOA 2WIBA 4BFVA 4C0HA 3DM5A 5L3SB 2WZQA 3Q7QA 3E1SA 4HEJA 2KJQA 1G7CA 2FV8A 5D3QA 3D6TB 5L3SA 1A2KC 2OILA 1TQ4A 4BLTA 4G5SA 2WWXA 5CIQA 5L3QA 1AKEA 3ONWA 1K5GA 2ZE8A 2QI9C 1U9IC 3BIFA 2IC5A 2W58A 3LO5A 3ND9A 4XOIA 3TSWA 1CF4A 1RYHA 2D7CA 2ZI5A 2ZYWX 3B78A 1NBMA 2AKAB 5CM8B 3K09A 2W6ID 5FTLA 1COWA 3ND8A 3SOPA 4F91B 2ANBA 3B9PA 3IIJA 4AI6A 2O8DA 2IYUA 1CR1A 2AN9A 5FTJA 1H8HA 1Z63A 4D4LA 2YWFA 3Q72A 4OJQA 5TY0A 3UPUA 2AL7A 2ZRMA 3LVRE 1IY0A 3B82A 3X1YA 1MO3A 2CVFA 4NL4H 4OQXA 1ZNWA 5JEDA 5DYIA 5KOYA 2DBYA 4RFSB 5AJXA 1E2IA 2WJJA 3AKDA 3SZRA 4ZI2A 3GD7A 2PJZA 2ZS8A 3B85A 2QMHA 4RFSA 4NBSA 3K53A 4G5OA 4JL6A 4KFRA 3KB2A 4B73A 1B23P 3NIBA 2DWOA 3CB4A 1JB1A 4QG7A 2JLSA 3BRWD 1XTKA 3P20A 1ZJ6A 1KI1A 4XWOA 1ESNA 2VHQA 2GAAA 2BCJQ 4IEEA 1IN6A 4JBXA 1FL9A 4BASA 5JJLA 2QT0A 5J4VA 3H84A 5EUMA 3W3AA 1UFQA 2WJYA 3T1QA 1T3HA 4O0MA 2C9CA 2Z4RA 4B3BA 2GJKA 2IS6A 2LKCA 1RJ9B 3AEZA 1AZSC 1ZM9A 4MRPA 4M1WA 4NMMA 3LBHA 2AFIE 1IN7A 4YC7A 2GF9A 4GBMA 4Q19A 4A9AA 2XTMA 3FMPB 4BWYA 3WYFA 3K0AB 1KO4A 1GL7A 3CX6A 1YQTA 5DYGA 1KHTA 3GLGE 2WWFA 1Q44A 4ACBA 3U7FB 3Q9LA 3K0AA 4BLQA 3GJ5A 2ODNA 2ZI9A 3AVWA 3REFA 4CEJB 2OAQ1 3GP8A 4QHSA 4D81A 2QPOA 2A7QA 1BIFA 4N1AA 2AXNA 3TW4A 4AKIA 5F98A 2QM8A 2ODBA 3CM0A 3FFAA 2ERXA 4MUBA 2JLZA 2ODWA 2EWWA 4L8GA 5EE0A 1E1RD 2HT6A 2ZRPA 1QHYA 3WRYC 1YRAA 1BS1A 2EFCB 1UDXA 2UVQA 2OBLA 2HDNB 5FPSA 3PUWA 1CR2A 4LHZA 2KB0A 3QF7A 1TMKA 1L4YA 4LGMA 4MKGA 4I81A 4US0R 3RS2A 4D4MA 2FN4A 3B5JA 1GNPA 4TLAA 5AUOB 4TL7A 1W4BA 1JBKA 1HT2E 2ZJ5A 4TLDA 5KUTA 2F43A 1XEFA 2NPFA 3P4XA 4TSFA 1E2MA 3LY5A 3K9NA 4LWZA 2XB4A 3BK7A 3MJRA 1XMIA 3AVVA 4Z1MD 5JS7A 1S3SA 3HYRA 1I4TD 1S9HA 4MKIA 1N0VC 4OHVA 1N6LA 2OBMA 1DVRA 3GFTA 2ZRLA 4DSTA 2WKPA 2YKGA 2RGDA 4JLAA 3TUIC 4TYYA 2NIPA 1XFAA 4DZZA 2H18A 4I1VA 1OLOA 5K8TA 1RYFA 2WKQA 2NPIA 3TRFA 1DOAA 4DDWA 3DO6A 3L8YA 1HV8A 2R6GA 2C96A 3I73A 3CIOA 3M0EA 4KFSA 4QBFA 1TF2A 5G41A 4Z54A 1RZ3A 5FTKA 1G5RA 2CE7A 2NO1A 5JWRA 2X19A 4MRVA 2JCSA 1LS6A 1GRNA 1Z6TA 3FWYA 4AKHA 2NQ2C 1DAKA 1GUAA 3PIRA 2QPTA 1KMQA 1P3JA 4TQUS 3NEYA 1Z6XA 2VF8A 3S1AB 3B1XA 2FE4A 1G3UA 1Z2AA 4P0TA 1C4OA 1YR7A 4RKFA 5CM9C 5GJCA 4TL8A 3EZFA 1ZD9A 3I92A 1R5NA 2ZSBA 2W00A 3IILA 3S1AA 3DDCA 4B2PA 1S4QA 1YJ5A 2VPPA 2VL7A 4IOMA 4TLCA 4BQSA 1A7JA 4EPVA 3N2IA 3EIEA 5BN3A 2GVDC 4PC2A 1IBRA 4JLDA 2ZU6A 3A36A 4FWTA 4GZMA 1EX7A 1N6PA 1ZYUA 1XPRA 2JLVA 1IONA 1S3GA 4D0NA 1E4YA 4ESVA 2K5UA 3AKCA 2IYRA 3G82C 2HCJB 5HE9A 3QPVA 1Q21A 4K8OA 1FW6A 1W0JA 4E5UA 1DEKA 2I1QA 2NO0A 4HLQB 5AR1A 2WKRA 4Z8YA 2O0KA 2ZUBA 4S2EA 1GNRA 3Q3JB 2FZ4A 4GPTA 3UMRA 4D0GA 1D2NA 4TWZA 3AM1A 2JA1A 3TJZA 4EJSB 4Q4JB 1T9HA 2C8VA 1GKIA 1AJEA 3V00A 2KBFA 4WIAA 2WJIA 1K6MA 4M8NE 2ZR7A 4Q4LA 2DYKA 4Q9JA 1ZRHA 1YZUA 3I62A 4BE7B 2HUPA 5JSZA 2AD5A 3WBKA 2WJVA 1EWRA 2QTVB 1F5NA 4UNRA 3VKWA 5FOTA 5HE8A 1G5PA 1YZQA 5EXTA 4P4TA 3GEHA 1ZM4A 3H4MA 1JECA 2XX3A 2C04A 2PX3A 1PUIA 5L3VA 1XRJA 2FPMA 4ITRC 4DLTA 5CYOA 3AKEA 3F8TA 4IW3B 1GILA 3OIWA 3A1TA 5CDFE 4A2PA 3GLIB 4XTCS 4I99A 3DOFA 2MSDB 4QNRA 3P27A 1E9FA 5H8WA 4FMCB 1EFRD 4HAUA 3I5XA 3RAPR 2R62A 2D7DA 3KKMA 3GLIA 1KK1A 2Q9AA 4AK9A 5LBIA 1I4DD 2DPXA 1E0JA 1HURA 1P4SA 2JJ1D 3KB1A 2Q3MA 4IJMA 5FL7D 1OXSC 4QJ5A 3UATA 3EASA 1GZSA 3EAQA 2IEYA 4RD3A 4DLRA 2J0VA 1G9XA 1TF5A 3CF2A 4TMWA 1T0HB 3RRNA 2GNOA 3QPUA 821PA 2ANCA 5KSOA 4TMTA 3BGWA 2GXAA 4DC9A 3IQWA 5DI3A 3OEHA 4MGIR 2IWRA 1US8B 4B48A 3RS5A 1P75A 4O2LA 4BFYA 2FGKA 1ZD1A 2FH5B 2GCNA 4MA4A 3KXKA 3TNFA 4LBZA 3W8RA 1G41A 1E2EA 1Q1BA 4NZYA 3RWOA 5HKKA 5HCIA 2W2XA 1G20E 1G7RA 3EW9A 5IK2A 2YV5A 3BFXA 3QKSB 2C99A 4LV5B 3U61B 1EFTA 1PV4A 1KO8A 2Q3FA 3LW7A 3AVOA 4WZAE 2O8FB 3QKSA 4QRHA 4PHTA 4YDSA 5HCNA 1X8LA 4DKXA 3R8FA 4UJ5A 1WA5A 3B1YA 1J90A 4OJKA 3ZIAA 4BZQA 1OW3B 5TV2A 3DM9B 5C18A 1M1YE 3TQCA 5EZ6B 4DCVA 1NL3A 4PZLA 5FBLB 3MMPA 1X6VA 1KI2A 2ZI6A 1KI8A 3OIYA 4V0LA 1XU4A 1MRSA 1VHLA 4C0LA 2VHUA 4DUGA 4EPTA 5EJEA 3KQHA 1XEXA 3GJ7A 1R0ZA 3C4JA 1KOFA 3GLHA 4TYNA 1NSTA 5BWMA 2FPKA 4A0FA 3X1DA 1E9EA 2CK3A 3VU9B 3KXLA 1Q3HA 4Q00A 1GIAA 1LFDB 2ZRKA 2KBEA 1BH2A 4RD1A 4XIGS 2EVWX 1XPOA 4TQ9A 2P67A 3QENA 5FUYA 3VU9A 2HXYA 4GT1A 4PSVA 4KJZA 2J7KA 2E87A 1JR3E 2GCOB 3M1IA 5DE3A 3L43A 1XCPA 3ZYCA 5TVKA 2GXUA 4O25A 4AYXA 4UKDA 3BORA 4JL5A 3BB4A 2G83A 5J40A 1GG2A 1W48A 4P4UA 1U2RA 2H5EA 4L9SA 2AR7A 1W44A 1FZQA 2ZYVX 3EC1A 3IHLA 2ZSDA 1KI4A 1GWNA 2RHDA 1UADA 4CZ2A 1AGPA 2GXQA 1XF9A 1XTIA 2J5XA 3KQKA 4MGZR 2P6RA 2A5JA 4NHOA 3CBQA 2GJSA 2HYDA 4OHYA 2QROA 2BM1A 2YHSA 3FOZA 1FQKA 1GTVA 2WICA 2RGXA 3H2YA 3ICQB 1DTSA 3ZVLA 1A1VA 3R9WA 3GCGA 1II0A 1SVKA 2Z0MA 4EFLA 4IVQA 2KWIA 3U3JA 4RD4A 1F2UB 1G3QA 2F3TA 5A5GA 2VHCA 4KBGA 3UK6A 2J0UB 2ZS9A 2GWHA 4HLUA 1NJGA 1SVIA 3C5CA 1F2UA 1NBME 2V6JA 1YZLA 2AWOA 2RGNC 4HUQB 2J1LA 5FPKA 3WP0A 5DISB 1G5TA 3CH5A 4OBEA 4V0MA 1CJMA 3NBFA 1NKTA 4HUQA 2BMJA 3QF4B 5KDDA 3GPLA 1KAGA 4KU4A 3QG5A 3VR4A 5JCZA 1OE0A 3ZVRA 3QF4A 4OHWA 1F60A 3SYKA 1D9ZA 2XSZA 5FUVA 2FJUA 4JLBA 4Y0AA 1XP8A 4HB2A 3CWZA 2GBLA 4BLOA 1KKLA 2IYLD 3IEUA 4LSGA 2XXAB 2ZSEA 4B2LA 3QNUA 5BYJA 4D2IA 2WOOA 2ZE6A 2IA5A 2ZJOA 3CRW1 4CEHB 3UANA 5E3HA 1FP6A 1T0JB 5SZHB 2XXAA 3AP2A 1GKYA 2WSSD 5FOWA 4TMXA 1WDTA 4JT4A 3WMEA 2MMGA 5HZKA 3KJEA 1CKEA 3QXJA 4CEHA 4OK6A 1XTSA 3DKPA 4Q02A 3J81k 4DIEA 1SGWA 2PX0A 1KI3A 4Q66C 2XOKD 4NDZA 5H70A 1OH7A 1EESA 3WNCA 2GEDA 4JKIA 2YOGA 4B34A 4O3MA 3ASYA 2J3EA 2JIZD 3DOEA 1G8PA 2QAGB 5B2ZA 1Q1EA 2F9MA 3OF5A 1T5LA 4GOKA 4LC1A 2XGJA 2PCJA 3AGPA 3HPQA 3RC8A 5CYPA 1ZC4A 2F1IA 3A4NA 2FFBA 2ZEJA 2X2FA 1DARA 3LXRA 5IF9A 1NIJA 3V9PA 4M4SA 3TGPA 4DLWA 3OEEA 3CUEF 4M2LA 2QE7D 5KDLA 4M1KA 4AC9A 4JVSB 1N0UA 2WPDD 3AVUA 2QBYA 4DIDA 2A30A 4Q7KA 4U5XA 1E9RA 3RDPA 1WXQA 5AUQA 1NRJB 4TYQA 4BRWA 1JNYA 3BH6A 1XTJA 4Q1AA 4RFVA 4LHYA 1RPZA 4HLUC 5G3ZA 2ZXUA 2ATXA 5FTNA 5LPNA 1F6BA 2D2FA 2OESA 1ZW6A 4A92A 1ZCBA 1N25A 4BFZA 3TR5A 1KSFX 1HTWA 4BFWA 2REBA 1J70A 2J41A 4LYAA 5E7IA 2C9YA 3LH5A 3KQLA 1UBFA 3QOFA 4H9GA 1ZU4A 3W34A 4GRAA 4PSKA 3RRZA 1XXHA 4IKEA 4Q9IA 1VIAA 5ELXA 2WHXA 2X2EA 1ZNYA 2ZRFA 3Q5EA 1T91A 4DLYA 3AUXA 1Y3AA 2V55B 3CLVA 1SXJD 3ADKA 2WAXA 1Z5ZA 1DG3A 3IUYA 4IDNA 2GBLC 1E2LA 2NO7A 4ZDWA 4A82A 2ZJ2A 4A0HA 4DEXA 3PUZA 2ZJAA 3WRXC 3K0EA 5FBVB 1YZGA 1Z29A 2A2ZA 4JBWA 1G6HA 1JPJA 3BS4A 3SFVA 3ZQ6A 5FFMA 1UKYA 2R6AA 1BMFA 1A82A 4TT3D 1Z22A 3T5GA 5FOVA 1HA3A 1P60A 3EX7C 4A8JB 4JL8A 2BWJA 1T8TA 4M53A 2XEXA 3SE0A 3GJXC 1GITA 1T8UA 2N46A 3WYAA 2W0SA 2YC2C 3WY9A 4A8JA 1ZMXA 1PZNA 721PA 4LYFA 2X77A 3C41J 3QSYA 1E69A 1WBDA 1SZPA 1WMSA 2ZJZA 1IN5A 4DWJA 1DAMA 3UMFA 3G5UA 5DHAA 3RS0A 1F48A 1L8QA 3X1WA 3TLXA 1A5TA 1OIVA 3KX2A 4M9SA 3SNHA 4Q1EA 4DT1B 1GKUB 1OHHD 3FHCB 4EKDA 1WE2A 1OV4A 3R9IA 4EPYA 3BFKA 1IXZA 3PEYA 5FUXA 3RRYA 1M2OB 1ZBDA 5H68A 4A2WA 4BZXA 3C16C 2KI5A 5TARA 1OJLA 4ARZB 2IS1A 2YC4C 3GJ4A 4MQBA 1HT1E 2BBOA 4XD7D 2XJ9A 1PLLA 1A2BA 4ARZA 2Q3HA 1QHSA 1R8QA 2A9KA 2XNDA 3THXA 3CH4B 4BFUA 4MUAA 3SU8A 2ZVQX 2ZI3A 4BFXA 1AIPA 1N6IA 2RH5A 2XITA 3RLFA 3UWOA 5BN5A 2ZRGA 2HV8A 1OB2A 5KSZA 2MMCA 1BKDR 3LLMA 2ZE7A 1Q57A 4CF7A 1KDTA 1MOZA 1KTVA 2BC9A 1E2HA 4CGZA 2ONJA 3GFOA 4IDHA 1E96A 4CEIB 1VYVA 1D2EA 1AM4D 4QM6A 1ZP6A 2EYQA 2OG2A 1IOZA 3FDIA 5HR5A 3PQCA 2HYIC 1R6BX 3AVTA 4CEIA 2WWHA 1U8AA 1DBSA 4I1UA 1VCOA 4M1OA 2ZJBA 2UZIR 5SZJA 1P9NA 4EQ6B 3NBZC 2CCGA 2ZVPX 2IW3A 2WAYA 521PA 4OI1A 2QN6A 3VNVA 1NVUQ 1EFCA 3W90A 4LPKA 1W5TA 3K70B 2P5TB 3D3QA 4Q1FA 1TU4A 4C4PA 4ZIRB 1MR3F 5IHPA 1OH8A 1KK0A 3F3YA 4KFTA 2GESA 4F4CA 1E0KA 2FEOA 4JLKA 4TTQA 4C2TA 3CONA 2WV9A 1KNQA 3AVQA 2A5GA 4ASUA 1N5IA 4IOLA 1ZIOA 2Z6VA 3QI2A 3RHFA 3SDZA 4V03A 4MKFA 4NYIR 5L3QB 4QGAA 3I32A 2O8BA 1WP9A 1XEWY 3IIMA 4NYIQ 1Z47A 4PC6A 4UNQA 1EXMA 1Z0JA 2V8OA 3CPEA 3OE7D 5JI2E 2IYQA 2OCPA 4ZV4A 3C7KA 2GHIA
chains in the Genus database with same CATH superfamily
3GEBA 2AC4A 3Q0IA 4FJ1A 3TE7A 2JFUA 4PHCA 4B74A 2GN1A 4GUDA 5AI9A 5FR2A 4F60A 5KB3A 1NG9A 4M1MA 2MCFA 2Z5LA 3HPRA 4HGYA 3KOZA 4ZAVA 4CL8A 1C0PA 2C5BA 3EBOA 4RWEA 5IC5A 3WGTA 3RLIA 4EG3A 2QJTA 4EZBA 4JV5B 4PGHA 3R7WA 1RXSA 1FFXB 4ZVPA 4XDHA 5TQ2B 2CLMB 2PT5A 3HBJA 5F9FA 5K3CA 1WF3A 1IJBA 3TNJA 3A1WA 1Z0SA 1JLRA 9LDTA 4TTPA 2H7CA 3AW8A 4FW9A 5B6IA 4IDAA 2X13A 3PQ4A 1KBZA 3IXMA 4KDFA 5I8WA 1JEQA 2FG6C 4PSAA 2I2BA 5FPHA 4XYBA 1KE2A 4F4JA 1A8IA 1OJ7A 5EKSA 4FFPA 5DI9A 5HSGA 1CUIA 4W7IA 2NU9B 1NHWA 1M8KA 2PGJA 3NHKA 3VMFA 4CT4B 4D81A 4QJ3A 2QENA 5JZ9A 5JE8A 3MG9A 4CNQA 3Q41A 4PIMA 2XRZA 4JSRA 4ZQHA 4F6LA 2J6IA 1V7CA 1FJXA 1X80A 2EATA 3G5AA 4TXJA 3Q88A 5FWYA 3MCTA 5JLAA 1QAOA 2V6BA 3OCCA 3MIIA 4KE8A 1YZNA 4I4CA 4M0UA 2FW7A 4X94A 4JN6B 3WQBA 4PN7A 4UTPA 1F14A 2FX3A 3MWJA 3CUSA 1Y0BA 4K9NA 1M7BA 3B6IA 4QPZA 4R2IA 2VSXA 2ZUCA 5AWFC 5JJIA 3O4FA 2PX6A 3B60A 3BF8A 1RWKA 3QVWA 4EFMA 2P2LA 3H04A 2R1UA 1UAYA 4HH3C 4NJMB 3VSDA 2WQ7A 1W46A 3EVFA 2CY0A 2VPQA 3VXKA 4BEJA 4KTVE 2VP4A 4EG6A 3DZ8A 3SBDA 2WQ6A 3SHTA 1NUAA 1ZQ1A 3ABQB 1VKZA 4PCAA 2VP5A 2IPLA 2W8BB 2D1FA 4ACAA 3DEKA 1QIKA 4G0PA 5E8RA 3I62A 3IQXA 4PPNA 2IYTA 4DLXA 3JAKB 1SQFA 1UKVY 3VU1A 1AH2A 4FEYA 4CNBA 3R09A 4WNYA 1DWQA 2CHUA 3O8OB 3V42A 1XR3A 2JAOA 4IIDA 4OV6B 3CPJB 1HRKA 5FQOA 3SOZA 4BRUA 5JRZA 5D5QA 2B8JA 2YIDA 4JCCA 2PG3A 4NV1A 5AVVA 2I65A 5ICSA 4AXBA 1GUYA 4MGEA 1I7NA 2AXPA 3L7NA 5DTQA 1BEEA 4JK3A 3W06A 4B4VA 4OY3A 2NOAA 4PICA 4RZIA 2BCEA 1HF3A 1OWMA 1QGDA 2I9KA 3D2AA 3GVXA 1YR8A 2CDAA 1CR0A 1ZEMA 2VJOA 1GSAA 2H59A 3P2JA 5BORA 5BWLA 1CZOA 2OUIA 2HWWA 3UT5A 2F9FA 1P1IA 1MIHA 4D8UA 3FMIA 4HXFB 4CIBA 4EYGA 1SC3A 1A8UA 4F71A 1PYGA 1QOQB 4QQRA 4KVGA 4W5HA 5D00A 2BF7A 3RADC 1RE1A 4L3WA 4UMVA 3SX0A 4UD6A 4BXOA 2ZROA 1Y8RB 2AJ8A 1G64A 5ITWA 2J67A 4CN9A 2F8MA 3QITA 1U7OA 5EERA 5KVQA 4N76A 2H08A 2GCGA 4BX9A 1WQ4A 2RB4A 4AWAA 3MWGA 5E4YA 1VHTA 2J9ZB 5GIPE 2G40A 1DHRA 1P6QA 3DONA 5DN6D 3PFIA 1RT9A 1Z6ZA 2IZ5A 3JXEA 4Y9RA 4DZTA 2XOEA 4DAEA 3BRCA 2GVNA 3Q9UA 2FG5A 4GR5A 2Z8ZA 4HZIA 4BV3A 4D4KA 5B6PA 1KSGA 1UMDA 4V0ME 5A4DA 1CRZA 3PEEA 3DFZA 3IVCA 5HQTA 5CIWA 2OT3B 4ECAA 4UNPA 1EK6A 4LGVA 4KSCA 4CDGA 4OHKA 1J8MF 3UOGA 3CVJA 1WAMA 5JFTA 1ZJ4A 4PWZA 5EVJA 2HA7A 4DDHA 1QB8A 4TMVA 4BJ5A 3WDLA 4ZAXA 3RK1A 3L0PA 2BBWA 1DUSA 2HK7A 3U4QB 1KFEB 3NHPA 3SBEA 2QUZA 1WPXA 3MRVA 1E1QD 1FSZA 5E95A 4NXNB 1TA0A 3WQQA 2ORWA 3KKQA 2G17A 4KIFA 4BN0A 2QD4A 3KQOA 4YV0A 3S7ZA 1ORWA 1PBTA 1X9HA 4F3TA 3DXXA 3G1WA 4IQ4A 4F1JA 5BW6B 2WJ6A 3TSYA 2HU7A 3N8KA 4LC9A 4B3DA 5FEUA 5K0BA 1KQOA 4N01A 1W88B 4OCZA 3A0UA 2W83A 3KQPA 1ATIA 5BN3B 3FG9A 1FDOA 3FMVA 3MQ2A 1N2CA 3CZCA 3P1JA 5F3DA 4GBED 1P1HA 1NVVQ 2PKQO 5H81A 5KTSA 3LPAA 5EAIA 3S29A 3GRYA 2D74A 4WW0A 3PDUA 5KU1A 4O2BF 2BP7B 1NW7A 1Q5PA 4C5AA 5GV7A 3OT4A 1D3AA 4QGBA 4MV8A 1VBKA 4PG6A 3DZBA 4PLTA 4ND2A 4IXMA 4OI0A 4WFJA 2IEZA 1KO1A 1RZVA 1UOPA 1YQGA 3BMQB 3FLAA 3PICA 3N8DA 4QRDA 2BFFA 4KFUA 1KOGA 2XNSA 1ILWA 2OCAA 5LP1A 2OFWA 5CXUA 3SAJA 1QX3A 2Y68A 2ZK7A 4MI3A 3M6AA 2BGNA 5D86A 3K70C 3W5DA 3WQHA 2C0PA 2PT6A 3I1IA 5IBQA 4OHOA 3QA9A 2PIDA 1OYWA 3QQ5A 1OFUA 2A5DA 4UFNA 1QU3A 3SFZA 3FLEA 1E1KA 4MLDA 4G89A 1TZBA 1C9EA 2YJ5A 4Y6LA 3A2LA 1PQ4A 1MV5A 4CG1A 3THYA 3BE6A 4ZI7B 3RROA 5KYWA 1QP4A 4ZOLF 3NDBB 2PKQP 5D3MA 1NN3A 3UKOA 3LF1A 2OSBA 2CFTA 4Z9XA 1F3LA 4MVJH 3C8DA 2OZLA 4CMIA 4QPPA 1RJGA 1YBFA 3DFFA 4Y1GA 1A71A 2OV8A 4QGFA 5EC8A 3F4BA 3OCVA 4H1WA 4AIIA 3GAFA 2CLSA 2XDQA 5KCMA 1V5FA 1SK8A 2AJBA 1HDOA 3VR6D 1Q0TA 2EWMA 2VRCA 1TA9A 5I7OA 2AF3C 2PKCA 2OCKA 3ECAA 3KPUA 4U63A 2E4XA 4ZVLA 2MSNA 1FP4A 1IHUA 3VI4B 2C4WA 2GZ2A 4CF4A 1UP7A 1BU8A 3QW2A 4BV8A 1E6CA 5LQNA 3THWA 3FTQA 3WGNA 3CNBA 3ZWNA 3EZYA 2WYHA 2YHBA 3TLGA 1AUQA 1IK6A 5HZHA 4Q1CA 2XCRB 2V98A 1GG8A 3CCBA 4Y0NA 2O2YA 1ZNZA 3ZS9A 4WK2B 3O2QB 4N8DA 4WSOA 2NVUA 2XZDA 3WWCA 5AJYA 1C7QA 1N2OA 1ZKDA 2VN8A 4P3KA 4BKMA 5KHLB 5FIUA 1J09A 2HDOA 3ROPA 2AVDA 3MB8A 4JJKA 4O4HB 4D57A 4DWWA 4NATA 5E2AA 2FK8A 2XTAA 3QELB 1GTJ1 1XNGA 2I80A 3EMVA 3LA8A 5DHPA 4YMSA 1KYQA 3AF6A 2G4LA 3U13A 2P2ZA 4E09A 2IQ5A 2HT1A 1VG8A 3HJBA 4BPBA 2J9GA 4MH0R 1R8JA 4LZOA 4ZVQA 4QPNA 4YXWD 2AQ8A 4DANA 3EG5A 3ML1A 2Q29A 2D3TA 4MAFA 3RYFB 2JIOA 4BAZA 4P3PA 2HNBA 4G9EA 3MJEA 1M5RA 4B7UA 3KHTA 2ZKLA 4KODA 3U31A 5JASA 3EODA 5IT5A 2AN4A 2QUBA 2VNJA 4K1LA 2ZYSA 4RVOA 3LUJA 4ZN6A 3OT5A 1NLUA 3WB1A 1GFIA 3AT1A 3BSSA 4ESHA 2BEWA 4I5EA 3TIFA 1Q0UA 3ZY2A 3HBLA 3IUQA 3MT7A 2WY2D 4K6FA 4H6WA 4CKCA 1MEEA 5KSYA 4DPKA 3A6KA 2Q5OA 3AM5A 1C9DB 2AMLA 2P2YA 4C5BA 2QPAA 2UDPA 4AKEA 2MHCA 2XZPA 1M34E 2ZYRA 1WS6A 3ZZMA 1YQDA 3EZ2A 5ALMA 1A5SB 5C52B 1SUDA 3S27A 3S0JA 5CLLA 4L7VA 5BSHA 3BRSA 1I7LA 1RBMA 2GD6A 4F92B 5J4YA 3OAAD 4FUTA 5DHFA 3GLHB 3EDOA 2Q5CA 4JXKA 2VYFA 3RABA 4CKBB 1O95C 1Y81A 3EC2A 3ICOA 2IDJA 3VTFA 2WWIA 2C3YA 1E3EA 4UBJA 3UWSA 3K0FA 3ELUA 4LTMA 4WK0B 3TMKA 3TNLA 4B76A 4L3VA 4X45A 1CHNA 5FUQA 2XYQA 4RVUA 5ITZB 5CLJA 5T41A 1BJKA 1RYBA 2OLJA 4RZHA 3W9UA 1JBEA 3KKNA 3QXSA 5AI5A 1QF6A 3RS3A 2IIVA 5AW9A 3V4FA 4BV9A 2HEIA 4DSNA 1ND6A 5JRJA 1Z4OA 2ES4A 5GJVC 3M5CA 6ABPA 2G8LA 1FUUA 5EFZA 1W0KA 4W1RA 2O2GA 3WLRA 2RGBA 4QU0A 2R65A 1IUPA 4HXGA 1QS0B 3ORYA 1JLSA 1FRVA 1AUPA 1MA0A 2VYVA 3GPDG 3PFGA 4R51A 4YJ2B 5I9MA 1ZITA 1J0DA 1STOA 2FPGB 3IP1A 4FX2A 2JPDA 2X1VA 3FD8A 1MRNA 3NAMA 4D4HA 5FBWB 3URKA 2UVPA 4ONEA 5F7JA 1H6CA 1DXYA 3TBHA 2F3UA 7MHTA 4JJ7A 1U8YA 4DTCA 2K87A 4H7JA 1NSFA 2GN0A 3JTEA 4OXXA 1T8YA 1RABA 1CR4A 2OHFA 1N9ZA 3C6ZA 1L1RA 3V1NA 3BGIA 3VO9A 3QVXA 4L9WA 4TKLA 4EG7A 4HYYA 1KH3A 2HA4A 1M74A 4RMNA 1WEKA 2JB9A 3LHIA 1FSGA 2GHRA 3EXHA 4XQEA 2IXDA 4L0MA 5DFAA 4D6XA 1XZJA 1TC1A 4LSWA 4PRLA 1F12A 1WDMA 3EFEA 1CQIB 1RIIA 3A4MA 1L4LA 4JNCA 3RTBA 5HKBA 2EIHA 3C6BA 3HXKA 3ADBA 1S1CA 1QO0D 3F6CA 1LTQA 4XYEA 5CHEA 2Q3JA 1LUAA 3A31A 3GG2A 4MUGA 3IOMA 5ALZA 5C8VA 2ZREA 3C7AA 3LV8A 1RJFA 1NW9B 1XJWA 1QHXA 2P4UA 3KQSA 3QU4A 3PUJA 1M1XB 1ODTC 2Z2KA 3F7NA 4M1TA 4Q93A 5EUQB 3TECE 1SR8A 4Q3AA 1R0WA 3GGSA 4BMZA 1AA9A 3H3JA 4X1IA 4YRSA 3ZHOA 4OJNA 3WP1B 4Z6KA 2AFHB 1L4UA 1HQDA 2PWZA 1QKJA 1XZEA 2G25A 2W2LD 3RVJA 4DRZA 1B93A 1FMJA 1FLAA 5E4JA 4JJEA 4BLPA 3W6UA 4YECA 2CLIB 2P68A 4X63A 4BP9A 4Q7JB 4CF6A 3T15A 2HPZA 1WJGA 1V8ZA 1ZK1A 2CD7A 2CMHA 4QFMA 2O7NA 4CCYA 3LDGA 1PR9A 3GJTA 2I78A 3COYA 3KTFA 2QN8A 4JJFA 4YUWA 3QOXA 4OQMA 4F4DA 4JEMA 4EJMA 2OQ2A 4LHWA 3U9SA 3NIFB 3O2NA 3NRJA 2A5FA 3QE2A 4NVRA 4F56A 1V1JA 3A1VA 3ILVA 4BC1A 4GPAA 4Q7LA 1ILEA 1Z88A 3K20A 5TPZA 3CVWA 3ECCA 2PZMA 3RF7A 3ZXIA 2F8SA 1R5BA 1KJZA 5BV8A 3PJRA 3O47A 4FZRA 2JFOA 2HIAA 2G3YA 4RVFA 1G9TA 2BFEB 3ANMA 1Y8ZA 1KBQA 3DFKA 4UMEA 1DAEA 2AH5A 1X15A 1Z73A 2CKMA 1DELA 2DMRA 3E35A 3LKBA 3L7IA 5DW3A 3CF4A 4QFCA 4UCFA 3VO8A 3ZZ0A 2NSDA 1OB5A 1CNMA 4A26A 5EI5A 3RT7A 2O1WA 2J3DA 4FPXA 4IM7A 5DTMA 4LF4B 1OFIA 4WXYB 1J0XO 3DE6X 4HCJA 3ZWAA 1Z0FA 4RABA 3L8FA 4X20B 5E7JA 2V97A 1RC8A 5IVDA 4M9XA 2YBDA 3MUOA 2ZETA 1C7FA 3R41A 5ALNA 3OICA 3GZTB 1AY0A 5A4KA 1F2VA 2IYSA 2PEZA 1UEJA 2RIPA 3PNYA 4DQXA 1HEYA 3I5UA 1SAYA 1H2FA 4KPUA 4PGFA 4BX0A 1ZVKA 4AZ0B 2QBYB 3FNGA 5A02A 1KI7A 4RCVA 2BEJA 5EYPB 3WB9A 3EXG1 1ESMA 2IU4A 4DV6B 1LNQA 4I4TF 4CJXA 5CH8A 4UQOA 3T38A 5EHNA 5SY4A 1KAQA 2AX3A 2RGYA 3L0CA 4BGIA 2LTAA 2QG6A 2VI5A 1TXGA 2J59A 2GJ8A 2GPWA 4AZVA 3IBSA 4JLNA 4NABA 3U9TA 2JZCA 4LHXA 5C1IA 1SPBS 3L8EA 2GXSA 2OC4A 2QYTA 3OY7A 4BB0A 1NE7A 2JIZA 4WAUA 4BQNA 3JQFA 3ZDZB 2YW9A 1R64A 4JWTA 4AO7A 2IK8A 1ZL0A 3JAWB 5KYVA 4DB2A 1F2TA 3BFVA 4YAOA 3KIPA 4MLPA 2C58A 4AVYA 1NF2A 2P9BA 3DTVA 4HS4A 1XXHB 4C7OB 2FWMX 4FGZA 2ET6A 4QDXA 3VC2A 3H9EO 1B42A 2H4JA 2R751 4LTNA 5AJWA 3EY4A 1ZO8A 4QJBA 4COKA 2HLHA 1M6HA 4GDFA 5IBCA 3CNEA 1MO2A 3MQFA 1SWVA 1UT6A 1UK6A 4YI5A 2I87A 1YK1A 3GT7A 2CZCA 1OXKB 1I3KA 3HCRA 1E98A 1JILA 2DGDA 2EQBA 2XDWA 4G09A 3J80A 3VTZA 5HP4A 1TTTA 1ZA2A 2BJVA 2Q0QA 4IS3A 4RLHA 4UNNA 4YPOA 3DQPA 3KCQA 4FCVA 1SVMA 3C3YA 3O82A 4F84A 4CMJA 3Q3EA 1F8XA 2BHNA 2H8KA 3CEJA 3GUHA 2FSVC 4NONA 2WVAA 1YRYE 3R1IA 5TMEA 4NSNA 2IY7A 3A2NA 4GZ5A 2RGCA 2JLXA 2RMKA 4JHXA 4QWMA 4RZUA 3JAMA 3U9LA 1U6JA 4O4JA 1QC5B 3INYA 3AB8A 1E2KA 1E4OA 1QTNA 1TKRA 2ZR0A 3ITDA 4HH0A 4RE5A 3GJYA 1TYAE 4MYUA 5CXXA 5TGZA 4U0JA 1XQXA 4RNDB 1ZNQO 1UXIA 3WHPA 4Y6PA 4ILEA 1RRMA 5BYKA 1O6GA 1B6GA 2NUPA 5FHQA 2FN7A 1P2VA 3CO0S 3ADDA 3CA8A 3PQ6A 2ORVA 3ZNOA 1XZ8A 2OE2A 1PLJA 1P2GA 1V9LA 2CLEB 1V25A 2W4QA 3B13B 4WLOA 3UJ6A 3ZXXA 1OKKD 1XKTA 2I8CA 1NONA 4K6CA 4P38A 1YQXA 4II3A 4EA7A 1AS0A 4TUYB 3DHNA 4TZ6A 1MD9A 2GGSA 2COKA 4GBJA 1NXTA 3LDAA 4L7QA 4P31A 4W4TA 1FTSA 4FSXA 4Y1RB 1KDYA 1X7YB 4QTTB 4ZZIA 4W5QA 4TVSA 4QIHA 4EDHA 2DY1A 5BUQA 1DAIA 3AEXA 3SF0A 3AEUA 4JVMA 1HQCA 4DV2B 4Z2AA 3DMNA 4F3RA 4NOJA 1XIVA 3U2QA 4P0PB 2JATA 4WESA 2NV2B 1MABA 4OSEA 3M3HA 3DDNA 3QKUA 1N2CE 4OMFG 2XNDD 4TT3A 2WDZA 1ZCJA 1Y4ZA 3Q0TA 4ZWNA 5FP0A 5I7VA 3NH6A 5F52A 4QYMA 3EC7A 5MF6A 3THXB 2PUBA 1K6JA 4XX1A 2FDCA 5EXPA 4DT1B 1T2DA 2XD9A 4KXUA 1ZL2A 2G72A 3MUFA 4KVAA 3N5CA 4GU5A 1JG2A 1FZTA 1QIFA 2PUEA 1K3TA 1X2BA 5AKKA 4KPYA 3KD2A 3CFYA 1KR5A 4G0MA 3GUUA 5IDXA 3G17A 1TO2E 1JAZA 3HZZA 1L7PA 2XY4A 2PPLA 4DCNA 2H16A 1Z36A 2CVZA 3W8EA 4Y7DA 1NQUA 4MQFB 4ZCIA 5I47A 1YVUA 2RGEA 1IAQA 3X44A 5IWCA 1JQBA 2WG2A 2GERA 3JSAA 5KYXA 1YS4A 3AESB 1NNUA 3CS3A 3FUUA 4IF6A 4BO2A 1C8BA 2PA3A 2V7QD 1NF8A 2XIQA 4P5PA 4Y2SA 2HA2A 4RW0A 4WXRA 1LJUA 5EZYA 1K06A 2AUMA 4ZKEA 2Q7DA 2GN6A 3QTTA 2BZSA 4N8EA 1XN4A 4B6JA 3S6JA 1SKUA 4KQJA 1RWBA 2ZIXB 4YRKA 5TEVA 3LVBA 4ABYA 5CLQA 4X93A 3C1UA 5J5AA 3ZGNA 4EP1A 2C2KA 4KGVA 4B8ZA 3PKIA 1SC6A 1N8TA 3FRIA 1RP7A 1UL1X 3KJZA 4H6XA 3TW8A 2NM0A 1GSIA 3NBQA 1E2NA 5AVTA 2O8BB 3E7PA 2DE0X 3EQ8A 3FYCA 4MAMA 4XQGA 4S04A 4YP7A 5C1PA 2XCUA 1R4MB 1QRDA 4PPFA 1U2ZA 3L8ZA 1TO1E 2J9FA 4C88A 2AVNA 5JROA 1S8NA 3UTDA 1ZUNB 3UHJA 4I9UA 2R86A 3VSBA 4HX5A 2P9QA 2M6KA 4R7TA 3FR8A 4ZVUA 4O2RA 2IW1A 1FXUA 5M7EA 3T7SA 1HY3A 1W85B 3UJAA 4ZT5A 3HEMA 3I9FA 4RKWA 1UK7A 5DSZA 1JE0A 1N1DA 4BX3A 1H8HD 1C4WA 2CVPA 3GDWA 3TOVA 3H2BA 1SBCA 1I2MA 3HYNA 4MUIA 4QYIB 4RDIA 4R1UA 3AEKA 3DEFA 4ZOLA 1XWFA 3REQB 3WK7A 5C81A 3PPIA 1NM5A 1I80A 2VTDA 4D7AA 2Y8EA 1P6XA 4KI7A 2PVCA 1QDUA 1R0YA 2HRZA 3SJCA 4BE9A 3R6WA 3VR5A 1TGYA 4B2IA 4E2ZA 1RRFA 3PVCA 1P73A 2J3QA 3WHLA 2HSEA 3I04A 2V6FA 3R23A 4NFHA 1T3TA 3HJUA 3K9LA 2JD0A 4BKUA 5JC1A 2KLHA 1Y5MA 5K0TA 3HJFA 3CCFA 2O2EA 2XA2A 2ZPAA 2O0JA 3OX4A 1K7FB 4QICA 4EZIA 1R0CA 5F7OA 3HWX1 4FQ7A 4B71A 1E3WA 1FFBA 2DTDA 2PL5A 3EZ9A 3CN9A 1YF3A 1EWQA 3CSDA 1D7AA 4XIYA 3W3AD 3KKPA 2XYRA 1SD1A 2OGTA 1QX4A 3HLKA 3RODA 3E9ZA 3JVDA 3U40A 3IEKA 4HNAA 4XVCA 2P40A 5DN9A 3JQDA 3KJHA 4MIEA 1R1DA 1M2VB 1SBQA 3MWFA 1HQYE 4MPPA 3CLRC 1JTVA 3LP5A 2BFMA 1WNTA 2PJUA 3F6BX 2P0EA 5E0KB 5EG5A 1T5BA 3ZBUA 2RB5A 2ZZNA 1PS9A 2Q7XA 4I08A 1QDLB 1VBFA 2ZRDA 4AX4A 3CKLA 3S2FA 3ZHSA 5ADUS 1GARA 4WZ6A 2QRUA 2GJAA 4YNBA 4C2BA 1R4NA 1G6Q1 2Q5EA 1KZ1A 2VZEA 1AE1A 4HWSA 1W7AA 1XD9A 1DIAA 4WJLA 5FOSA 4PRYA 1KXZA 3W6OA 1D0SA 3GYGA 3V7YA 5TGDA 3FGOA 5AM4A 3MN1A 4F72A 4LNAA 3UJCA 2W2VA 4CU5A 4DM3A 3G5LA 5KVSA 3DLPX 1K27A 4Q3NA 4HMOA 1XZQA 3SQLA 3FVRA 1W1UA 4B4KA 2WTBA 2XCTB 5G0SA 4NNJA 3UIEA 4WD3A 2O6HA 3DAYA 3HV2A 2C1XA 3A37A 3FPJA 4UZEA 2Y1GA 1MAWA 1LF0A 2W2PA 1NYLA 4FFBB 2OWDA 121PA 1NUPA 2QRVA 3MEQA 2YVUA 3LLVA 1R0BA 1WSAA 2C5LA 4KWEA 3STTA 1V45E 3BK1A 2YIVX 5E9QA 4BVJA 3SQWA 4MINA 4CT5A 4PR0A 2CHQA 4FJ0A 3V7UA 3LU1A 1DO2A 3I1JA 1JQJC 4CV1A 3KQNA 5IMBA 1I32A 1YDHA 2G9RA 3GRPA 1YB6A 3L82B 4R41A 3U44B 3NH9A 1H22A 1Z6AA 4YGYA 1HMYA 3WISA 5JANA 3PEWA 2B2CA 3K0SA 3SS8A 3CRZA 1NXQA 4ICIA 4NENB 4EIWA 5I7UA 3ZJUA 2ZIEA 1L5QA 1SZDA 1OLUB 4PZEA 4J0FA 1ISIA 1QCYA 5GOZA 1ZESA 4NLLA 4JU9A 4Z99A 4JS0A 1DZIA 4RTMA 1Q11A 2RK6A 3K9GA 5SZKB 5FLXA 5IM5A 4C4RA 1E9DA 1QYIA 4MICA 5ALFA 3ESAA 5FWXA 3IB6A 5HVNA 4L57A 3AJ9A 2IY8A 4PTYA 4PC1A 3WS7A 5B2EA 4BOYA 1HE8B 3A1SA 2V3VA 4WZZA 3DXYA 5LNK1 1AKYA 4WKOA 1ZIPA 1T10A 3OJLA 4LY6A 3RI3A 1FRNA 1YGPA 4ED9A 5IUJC 4MDFA 2O5VA 4YJ3F 5KTPA 3PC7A 1PK7A 3TQTA 1KJIA 1BAPA 3SVLA 1OAOC 1WTCA 3NOXA 4S1TA 1Q50A 4V2UA 3ZGLA 4D82A 4DY6A 2P6NA 1ZG3A 4R9SA 3SM3A 4MYSA 3UMYA 3QBTA 4JJGA 1G7SA 3LQFA 4NYJQ 4RHUA 4PPGA 5TQ2A 4C30A 1YNOA 4Z9FA 2FWRA 4A6XA 5A4IS 1TIKA 4HAWA 3RIEA 1TF7A 2VTBA 1FPMA 4PQFA 5HWSA 1KNXA 1VDMA 2C92A 5ESDA 4F97A 3N3BC 1BYIA 4HDCA 5COAA 1UBCA 2O1EA 2OVBA 4DOMA 4G86A 1A4UA 5TT1A 4JC4A 3EQ7A 1ZI6A 4QYSA 1CF9A 1F0PA 1WXIA 2H1VA 1EZ1A 3GEDA 3L3BA 1QB7A 2NSHA 4HD8A 5FR1A 1T9KA 3D2LA 1XZAA 2W4MA 4R7ZA 1P9LA 1NI3A 3VZPA 4OLBA 1U0JA 4ZGGA 5IBRA 4KTTE 4WOJA 5KYYB 2NSYA 5AW3A 2FMXA 4Q01A 4KR7A 3BXPA 1XUOA 1MAHA 5IM4F 4PO1A 3ER6A 2Y1KA 4UQLA 1I6WA 4HC4A 4D43A 3P4YA 4CTJA 1GPMA 1SEPA 1IY2A 2IE0A 1JEJA 1JU9A 1TCUA 3UMBA 4HEHA 2OHXA 3WGQA 3HHPA 2DB3A 5ER9A 1WXDA 2PPVA 4XASA 1AO0A 5DSTA 1R9GA 4MP6A 4RY2A 1DU4A 2FG7C 1EUCB 2OBNA 3Q6IA 3ZX5A 1IM5A 1KIAA 2FPIA 3UCEA 1FVXA 5B6JA 5BPFA 3CX8A 1QG2A 4V1CB 5I9NA 2JBWA 3L04A 3NT4A 4BVLA 2NNWB 4PYKA 4NCHA 3BE5A 4QOGA 4LFAB 2OM2A 5CT4A 2IU0A 1N9GA 3DZDA 2ECKA 1VGQA 2ECPA 2WU0A 1F8YA 1MQ8B 4KYUA 1H5QA 1GOTA 4XUEA 3T5PA 3UFXA 4PAGA 4MRNA 5CP8A 1CIPA 4L6CA 3MOIA 4K9MA 4JIMA 5GGXA 2IHYA 4GMKA 3WGOA 5CA1F 1E1CB 1K6XA 1PJQA 1EAYA 1GM5A 1CR6A 3KSAC 1Z6PA 5D6OA 4AJEA 3Q8LA 3DR3A 1NVKA 2Q4RA 3DDHA 2IH4A 2JGAA 4TV9F 4IHAA 3W9BA 4BV2A 1JB9A 1FU7A 2O23A 2RONA 4EGCB 1JXMA 4YN3A 3PWTA 3V4OA 1YDFA 3L8CA 4CIAA 1Y6ZA 4X7BA 4B6GA 4IKOA 2NTYC 2FTKE 4DYVA 4QL3A 3VH4A 4AZ3B 3DYVA 1KDPA 1SH7A 4QXAA 2W93A 4B4DA 4ZCSA 1UPAA 2AC7A 2HA5A 3NT5A 3S68A 4ZZ0A 4FZVA 3EMDA 3GROA 1PUJA 1QHHA 4UULA 3RYIB 4NYMQ 4AJJA 1TQ8A 1X1EA 4FDLA 5H3LA 4B3HA 5F1YA 3WG9A 1OCEA 1FP2A 3ITKA 1C8LA 1SVSA 4NAUA 1GZVA 3OJFA 4MZXA 3U4GA 4JR1A 5LN1A 3ZJTA 1ZVMA 4XPZA 4CUKA 1E92A 4NXMB 3UT0A 4OREX 3FKSA 1P9RA 3UHAA 1NW5A 2E4UA 1A50B 4RJTA 4CL2A 5DKFA 2R3SA 1IB6A 2VHZA 5KQSA 3TLEA 4M88A 2WWGA 3G85A 4EJSA 2R5WA 1U2GC 3K6KA 4I4TA 4L5AA 3QY0A 2WAOA 2PD6A 2P11A 3CR3C 3QH4A 3AF2A 1T0UA 3ITEA 3OIUA 3B8EA 1G66A 2PKWA 1P4AA 4OGFA 1JEEA 2IYXA 1I0IA 3KQMA 4OYRA 1XZHA 4M6WB 4AZWA 3ZKWA 3WK4A 2JLCA 2P9YA 4G5GA 4I46A 5I4CA 1J99A 1MO5A 2ZYTX 2D7DA 1PGQA 3LX6A 5IZCA 1I3NA 3QE9Y 4U7DA 2WKWA 4MSUA 1K8RA 1MT0A 4AECA 5C5CA 1ZM3A 3OEHD 5ITSA 1E3IA 1T36B 3A28A 3M6IA 4JSYA 4AS3A 3OM1A 5K4GA 3ILYA 2SKCA 4V0KA 5AW5A 1G17A 5AK4A 1NI4A 3B6MA 1WXEA 2R8ZA 2BDTA 5GQSA 3ZU4A 2OCYC 2OCBA 3CRRA 3ESDA 3HUDA 4C0BA 4ZDJA 1OZGA 4IJUA 2NU8A 1G19A 5E6UB 5ULLA 4CI0B 4URVR 3JWGA 3MRTA 1EQ2A 3DGFC 4RSGA 5DTIA 1SUBA 2RGWA 4IVPA 4ALNA 1QVWA 4QBTA 5EMKA 3P2KA 4E13A 5IASA 1JSLA 1OXVA 1W5EA 1X7HA 2QPLA 3CZ9A 3EXFB 3QVLA 4LDPA 1KZYC 2P3QA 4UVHA 4AURA 1PSDA 1GGVA 2P6OA 1BN7A 5LFAA 1C9KA 3VI3B 4AN4A 5I9TA 4E5NA 2A8YA 2JLAA 3NTUA 2A4KA 3PUIA 4DCSA 2NVWA 5J4HA 1K86A 4PZCA 4DUGD 1AGXA 1RLUA 1DCFA 3NAQA 1OC4A 3L0SA 5EP3A 3G1UA 3GFFA 4R3UC 1GCUA 4HDMA 4IV8A 3WKDA 5A62A 2WKSA 1US8A 4K6GA 4KWCA 2X0DA 4B6FA 2BHRA 1T0PA 2GUWA 4RIIA 1Y4DE 2O14A 2I7XA 3C5EA 5HIJA 3SICE 2XUPA 1QZXA 5FFFA 1BW9B 1ES9A 3BMCA 4F2PA 3BDIA 3IJEB 3HEBA 5BYAA 5ICMA 1J2RA 3W5JA 5A4AA 1P62B 1KGDA 4YRBA 5BQPA 3VTKA 1JZQA 2EBWA 1WXGA 2P2DA 1YVEI 1PO7A 4P0QB 2IP1A 1N0IA 1XZKA 4RMJA 1PJSA 1JHOA 3V80A 4D4GA 3BWXA 3MWKA 3EGXA 3I72A 4CMHA 4KYIB 4EFNA 1N6OA 4NFLA 4ZYUA 3QBVA 4JUIA 1XLUA 2XTZA 3H8VA 1ORVA 3B9RA 4BQIA 1UBOS 1KQ3A 5HS4A 1P77A 2DULA 4NBTA 3HTXA 1B8VA 3GJQA 1E9SA 3T6KA 4XYGA 4INAA 1ZOPA 3A4VA 3KJGA 4D0LB 1HM5A 4NJEB 3DE0X 3G2HA 2D2EA 1EEXB 3VH1A 4AMUA 4C3ZA 2ZWAA 1U90A 4MO2A 4URZR 5IJZA 3R5KA 4CEJB 1Z38A 1TZKA 1NLYA 1XHLA 2IY9A 3F5QA 1DE0A 4I5DA 4PTZA 4A27A 5BWOA 4MV3A 1O94D 2H52A 4HMPA 1NBEA 4FIZA 4H59A 4IOJA 4QYWA 2XW6A 2QUKA 5T4EA 1LB1B 4PHHA 3SYMA 1IU9A 3VR2A 4U3JB 1NNI1 3FDFA 4RS3A 4MW1A 2HU8A 5K6TA 2HW8A 3D81A 3CKMA 4DIOA 5JNLA 3FRHA 2YN2A 4RZ3A 3JQGA 3GK3A 1S96A 3I6YA 3DCYA 4HYQA 1LVHA 2GF0A 2XADA 4RH3A 1UC8A 2GVZC 1XD8A 3DVAA 4ZVNA 2Y2VA 5G2OA 3K6SA 3NNDA 4URWR 1UK9A 4RA9A 1OGYA 2HJVA 4JYPA 3GT4A 1HE1C 3IULA 1PG2A 1AKMA 1VBNA 2JGNA 4LQLA 1KAOA 1ODSA 1SOMA 3K9BA 4NESA 3DLCA 4I8XA 1IXRC 1COZA 4B3JA 2YY5A 3O94A 5BV0A 2HRBA 4GP6A 1MPXA 1L3CA 3JATB 4XM2A 3C2QA 1I7SB 5H82A 3PGA1 1VMAA 2XSZD 4R2KA 5TQJA 1GFSA 4E5PA 4LZJA 5BQ3A 1X8JA 1KFKB 5HBRA 5H4HA 3F96A 4MJ3A 5AK0A 5FUWA 2IX3A 2REXB 3NOQA 4YAFA 1S5PA 1BDBA 221PA 1OTHA 2WB2A 1VJRA 2I1LA 2QN2A 3AJDA 4J91A 2JLYA 1PR6A 1JX6A 1Z0UA 3CLTD 3V46A 5TGTA 4CHTA 2ZUDA 1GTSA 2J0UA 4JBIA 4QECA 5HPYB 3M2PA 1RSZA 5F1OA 1DCMA 4JA2A 2C2GA 4R2WA 5JISA 3CLUD 3ROTA 1PWEA 2ZVDA 1TM1E 3C6KA 1YVRA 2BRUC 2H2DA 2HF7A 1QGED 1NYQA 2YNMA 3O31A 4H3SA 4RJ2A 4LHVA 4MP3A 4RPKA 4ALLA 4BNVA 4Y0VA 4MS3A 4EFKA 1U7WA 4Z9AA 1KZ4A 3A26A 1LBHA 3WADA 2XRMA 4FYKA 3TD6A 1N8KA 2UXCB 2Q3BA 1XPUA 5JEEA 3E3AA 3F71A 3E9MA 3SYNA 3K35A 5KHOC 5MN5A 1UDBA 4MR9A 4TM8A 2J7PA 1GRRA 3VQTA 1M7GA 5HM6A 1N9KA 1LDGA 4CM7A 4GMDA 1EE9A 4MVJG 1QTQA 2VUUA 2AOTB 1HUQA 2JVKA 4ZI5A 1JLLB 4DHEA 3AUYA 5JT1A 1FTGA 1H0KA 2D5LA 2X0EA 4EYKA 3UC9A 1JG4A 1GSHA 2BI8A 1LV7A 1T1JA 3JYPA 3O0DA 4OOFA 2Q49A 4P36A 4WVLA 4X6UA 1EB9A 5EINA 4KHZA 4FINA 4I9GA 4PSUA 1JJ7A 3JQ8B 3ZR4B 1K3FA 3AM4A 1XZIA 5EPOA 1CJKC 3QI7A 1RLJA 3TNDA 3FYUA 2MSWA 1BVRA 3AFNA 3NXSA 4PFKA 1JVNA 1T6BY 5DU2A 2A78A 1OMOA 3AJEA 3HGTA 2X4DA 1XVAA 1PZGA 2CL5A 3A6EA 3B9QA 3OC6A 2R8XA 4KMSA 5BN4B 4GM0A 5C46F 1XLVA 4M22A 4IHJB 1DB3A 2J31A 2XLBA 4J07A 2EYUA 3R0JA 4ZI7F 1MNAA 1X94A 3OX1A 1NQ5A 3T9DA 4P7BA 5B1YA 4FOLA 3C7TA 3FNIA 3FWNA 4PHFA 4C21A 3G5TA 3E2PA 3V8RA 1UBEA 5KKNB 2ZPTX 5KHAA 2I2XB 2HX1A 3MXOA 4JX9A 1OZHA 5G0WA 3VV2A 1A96A 3ANTA 3ZBPA 5JVDA 2YV1A 5JMTA 1J5EB 3UWDA 1BE6A 4OK3A 3FPSA 1VECA 5EEGA 4FE3A 1E32A 3FDXA 1EK2A 3GMDA 5JV5A 5F2NA 1PZHA 3LT1A 4WERA 4R8VA 1LDNA 1XOIA 2Z83A 4E51A 1NQTA 2EKZA 4BNMA 5HTOA 4CIXA 4CLDA 2I4NA 1IZZA 5L9AA 1DDIA 1DKPA 2JH8A 1RVDA 4ZICA 4X71A 3PUVA 3D1JA 4GOXA 2EL7A 3GAMA 3O8RA 1YDMA 1NU8A 2IXGA 4GICA 5IFLA 5JQWA 1UF9A 1DCTA 2IDKA 1D4AA 1SVUA 1WV0A 1L3IA 1EA5A