5FR1A

Double acetylated rhogdi-alpha in complex with rhoa-gdp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
190
structure length
184
Chain Sequence
b'IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQASGCLVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSFORMING PROTEIN RHOA
molecule tags Signaling protein
source organism Homo sapiens
publication title Rhogdi Alpha Acetylation at K127 and K141 Affects Binding Towards Non-Prenylated Rhoa.
pubmed doi rcsb
total genus 62
structure length 184
sequence length 190
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fr1A00
2IXFA 2WJYA 2IT1A 4KV9A 3KTAA 5FI0B 3H0KA 2ZUCA 2CBZA 1G291 4HUQA 3FHOA 1G5RA 4D2IA 1W2HA 2JLSA 3BB3A 3MUFA 1IXSB 2YWFA 2C8VA 5FL3A 1JI0A 3HP1A 1HURA 3EZ9A 4PC6A 1EFHA 1PUIA 2BOVA 1E3MA 2J0UA 4F93B 1GKIA 2GILA 4W5JA 3WNCA 5LBIA 1N6NA 1CR0A 2XXAB 3BB4A 3UG6A 4R2IA 4HAVA 4NE2A 3WHKA 1E2KA 5KNCA 2O8DA 1J70A 1UDWA 5IK2A 3U7EB 4I1SA 4XWOA 2IX3A 2GDJA 4Q66C 3EIQA 1MRNA 4XD7A 1KDRA 1G6HA 3D7MA 1YRAA 5CB6A 2R62A 4Q7KA 3O47A 2J1LA 1G4AE 5TDHA 3B2EA 5FOTA 3NBYC 4V0KA 5AWFC 4FINA 1I2MA 2F1JA 1KSFX 2DY1A 4AC9A 2EFHB 3THWA 2REXB 1RPZA 2AWNA 5DISB 5HKKA 1AQUA 4BRUA 1UBEA 2LCFA 2C96A 2QMHA 2IBMA 4M9QA 1OXVA 1SULA 3B9PA 1RW4A 1XEFA 3R7WA 1UKVY 1WCV1 4B35A 1AKYA 4PR0A 2I1QA 2JJ1D 3U6BA 2FSHA 3REGA 4FCVA 4D4JA 2V6JA 3QXHA 1YZUA 3X1YA 3ZH9B 2ZRPA 3B1VA 3UWOA 4LC1A 1ZC4A 2HEIA 2HJVA 2X2FA 1U0LA 1YR8A 3QBTA 2XTNA 4LRWA 4M1MA 4Q7JB 3BE4A 5FBWB 3THYA 1IHUA 1WA5A 3DHWC 2OILA 2A78A 3QE0A 3GLHA 1W36C 2WOJA 5C2JB 2ZS9A 1G21E 3AUYA 1ETUA 3OEHD 1I4TD 2HF9A 4P4TA 1RRFA 1XD9A 2HJGA 2WJIA 1MKYA 4BFVA 2ORWA 1VG8A 2QRNA 1KKLA 2HUPA 4ITRC 1WF3A 2P67A 3ND8A 1XMJA 2ZEJA 1FUKA 1NG1A 3SS8A 4FWTA 4UNPA 5BW8A 1E94E 3RS7A 4HLDA 4RD0A 1W5TA 3DDCA 3WMFA 5G3ZA 1P9NA 3AGPA 3C5HA 3VHLB 4V0MA 1E1RA 2AXNA 5IF9A 1KDOA 1G17A 2Y8EA 3M1IA 2WMOB 3CPJB 3QI2A 4M8NE 3ONWA 3UIEA 1U8YA 2OM2A 5G3YA 1KAGA 3I1FA 3AEZA 1JNYA 3X1ZA 3OIUA 3EC1A 1EX7A 4HDOB 3ZVLA 2ZI7A 4FMCF 4L8GA 4Q9KA 1ZYUA 5FBQB 3B1XA 4B2IA 2D2FA 3QF4A 1BYIA 1TF5A 1IN8A 5EE9A 1E2NA 4NCNA 3B85A 2XNDD 1CBUA 3KQKA 3Q5DA 1VHLA 4PAOA 2ZR9A 5AUQA 3GD7A 1P2UA 4A6XA 1GWNA 5AJVB 1Z0AA 3AP2A 2GXUA 1FTNA 1AN0A 4FMCB 4PPGA 5E7JA 2XX3A 2PBRA 1TEVA 3DMDA 1AGPA 4DLYA 4EIWA 3OHMA 1C1YA 4HB3A 3AVQA 2V8OA 4LV8B 5DHFA 3UK6A 3K8YA 3PEVA 3A58B 1KO5A 3TLXA 3ZVMA 1SVSA 1T3SA 3RNLA 1GITA 2OFWA 3K70C 4RZ2A 3L8ZA 4OQNA 3TMKA 1E1QA 5DO9A 2ZI4A 1G5TA 1DEKA 2FDCA 4Z54A 1AS0A 2ZSFA 2GETA 3O8CA 3DM5A 5AJXA 2ZJOA 3ZIAD 2RGAA 4NBSA 2GEDA 1T4GA 3QKTA 3AP3A 4KFRA 4WXRA 1G3IA 4B2LA 4DLUA 2YOFA 3THWB 3JVUA 5FPYA 5KU1A 2P2LA 1OH5A 3AH8A 3B1ZA 4M1YA 2FSIA 3BH0A 4BFWA 3AVWA 1DAIA 4Q1AA 1W44A 2WWGA 5E4FA 1XTKA 4GP7A 2W6JA 3R7WB 4A0FA 1NSFA 2QT0A 2AD1A 4KBGA 3TAUA 2FFBA 3F8TA 3VMFA 4D0NA 1T8UA 4IEIA 2HV8A 4QHYA 4HLQB 1A1VA 1RYHA 2FMXA 2XNSA 4HSEA 1Z6TA 4MDFA 3B7GA 2KB0A 2H16A 2VO1A 2VHQA 2IC5A 4OL0A 1G3UA 4NCIA 1ZUIA 1G3RA 1S1CA 1KGDA 1ZM3A 4PZLA 2ZI5A 4U02A 5TV2A 3K0EA 2F3RA 3RS0A 4IVPA 2Q9AA 5FPHA 3U44A 2BIFA 5FOVA 3A1TA 2JASA 3DKPA 2MSCB 2YJTD 3NVAA 5J40A 4B34A 3JZMA 1HYQA 4BFUA 3U7FB 1ONBA 1KO7A 4K8OA 5BN4A 5BQ5A 2IYYA 4LBZA 2UVQA 3BJIC 4ACAA 2W00A 1W36B 5B2ZA 3QG5A 1W2GA 2ZITA 1SXJA 3T1OA 1W0KD 4TZ6A 2BEKA 1II9A 5AUPB 4DDUA 2FWRA 2GVZC 1B23P 5F9FA 1NN3A 4DKXA 2A2ZA 8OHMA 2Q9CA 3QBVA 1JXOA 1G6OA 3C14C 3HPRA 3BB1A 4B3FX 3I61A 1II8A 1NIJA 1GL7A 4HZUB 2IXGA 1Q21A 4BASA 3AF1A 2D2EA 4NCHA 2GAAA 3H1TA 4QJ4A 2IUSA 1X1RA 2OCPA 1R8QA 1YZTA 2VIIA 2ZE8A 3MSXA 2BMFA 2ZJZA 3HPQA 2QGNA 2AL7A 5LB4A 1ZUNB 3RANA 1XRJA 2VPPA 4C9BA 1N3BA 2C9CA 4RZ3A 2LKCA 4M2LA 5JRJA 3RVBA 1S96A 4OI0A 3AKEA 2QSYA 1KZ7B 2XSZA 1UM8A 1NIPA 1TL7C 2F6RA 2GBLC 4G5OA 4JYCA 5FL7A 2PT7A 2PH1A 3ZQ6A 3HU3A 1P7CA 3SOPA 5EP3A 2P6UA 1KMHA 1MT0A 4URXR 5BN3A 3GLIE 2DBYA 3KQHA 1VG0B 2G6BA 4P4UA 3KKOA 3OZXA 1DG3A 3N5CA 5HE9A 2ZRHA 2CE7A 3O8BA 5CJPA 2NMVA 2X8AA 1VG9B 4OHWA 1YZNA 2C03A 2RGEA 4MGYR 4ABYA 1HQCA 2BCJQ 2FA9A 1CLUA 2Q6TA 2W0SA 2YV5A 4IOJA 5JWOA 1CJUC 1PUJA 4WZBE 4HB2A 1ZVQA 1CTQA 3B82A 1XB2A 2Q3FA 2QI9C 3ZZTA 5FTJA 5D3MB 5C1BA 3K0FB 1R0ZA 2R6DA 3A4MA 1UKEA 1G7CA 4DT1A 4C2UA 2D74A 1CJTC 1OPXA 3K9NA 2DB3A 4KJZA 2O8FB 3TJZA 4LV6A 3SYKA 1GKUB 4LJ7A 3NKVA 1Z0DA 1GILA 4C0SA 1T5IA 3EZFA 3U3OA 2QORA 1E2JA 4JVMA 3RHFA 2XZLA 4CDGA 3QXJA 5L3RA 4AYXA 5JHGB 1HQYE 1GFIA 1L7VC 5BYKA 1I4LD 1ZMXA 1SVOA 4JIMA 2AFIE 3FHTA 821PA 4KLZA 1GG2A 3I92A 4L15A 1TU3A 1E96A 3VNUA 4GOXA 4GOKA 4R98A 2JLZA 2DWPA 3X1XA 1MO5A 1N6IA 2W2VA 1E4YA 5C18A 4AG6A 1N6LA 1YRBA 4UNRA 2QM8A 3EC2A 4LDJA 5JECA 1O3YA 5JS7A 2VHUA 2QTFA 2CL7X 1XF9A 1KY3A 5KTYA 3Q7PA 1NMXA 5CITA 1GP2A 1E0SA 2NPFA 3LY5A 1ZU4A 3IDQA 2V4ZA 1XX6A 3V4FA 5HZKA 2D7CA 4MGIR 1CS4C 1N6HA 1Z29A 3H84A 4MYHA 1ELOA 4TN1A 1GNPA 2RMKA 2CVFA 1KI8A 3MWLA 4P4SB 4MUAA 1EFCA 2HLDA 1YE8A 1MRSA 3TIFA 1XJQA 3RRZA 2IHBA 4JT4A 2QAGC 3AF2A 1ZM4A 5ANRB 1HEIA 1SZPA 2GK6A 2B7BA 3CRVA 2N1BA 1CJKC 5UKDA 5CB8A 2RAPA 4ON9A 5JWRA 1UBGA 3CNLA 3VFDA 5L3VA 1O87A 1E0JA 4DRZA 2H5EA 4I1UA 2AN9A 1G4UR 2NQ2C 4B3XA 1IN4A 4M9ZA 5EXSA 3H4MA 4OQXA 4C0BA 4IDQA 1D2EA 1KMQA 1E2DA 3SYLA 4AD8A 4MGZR 3T15A 4P4SA 1R0WA 4RD1A 4HB0A 3S1AA 1W0JD 2FFAA 5EE0A 1QBKC 1E1QD 4D80A 4DVGA 2JGNA 3GFOA 4M1WA 5JI2E 2O5VA 1RRGA 2CEAA 5JSZA 1VG1A 2ZXUA 1Q3TA 4DLWA 3EAQA 2PZFA 4CW7A 5LD2C 3AKDA 5FL7D 1UJ2A 1H65A 2QE7D 2V7QA 3WRYC 4OKSA 3BD9A 1U9IC 1XTQA 4FWIB 4LJYA 2IUTA 5DIFA 3PV0A 3PIRA 4QXAA 3UPUA 1KIMA 1R5NA 4NMMA 5JJIA 4WIAA 2G77B 3MAAC 3ZJYA 4E5UA 4AURA 4B73A 4QBHA 4KCGA 3PENA 3BGWA 4OHXA 4CIDA 4RFVA 1KJWA 4LGMA 2BMEA 2CLDX 1DG1G 3DPUA 3W3AA 4M9XA 2ZAMA 3KUCA 3HYTA 4MRSA 4Q02A 5GJWC 4TTPA 2ZE7A 4XWAA 2YWGA 4LSGA 3GCGA 2HDNB 1XTSA 2ZANA 2NGRA 3MJRA 5F2EA 1OV4A 2I1VB 1XEWX 1PZNA 2ANCA 2F1HA 1MV5A 2VP5A 3ECCA 3VR4A 5EJEA 2IYSA 1KI9A 4FW9A 5JHHB 1Q1EA 5L3SB 2GCPA 3EZ7A 3U7GA 1EK0A 2IEYA 2P65A 3CX6A 3QKSB 4JT2A 4ZDIA 5B57C 1EWRA 1G3QA 1DAHA 2B8WA 1ESMA 2JAQA 1Z0KA 1SHZA 2ZS7A 3AUXA 3LO5A 4JKIA 4LK2A 3RS5A 2GRJA 4PHFA 3RSOA 4F92B 5B58C 1M7GA 1Q1QA 4JLNA 5CM9C 2GK7A 5CLLA 2JLYA 4W7SA 2GBLA 3A36A 3GLGB 4B3CA 2ZVPX 1HA3A 1QHXA 4EPWA 3IUYA 2KBFA 2CL0X 2WWIA 1VCMA 2PEZA 1EFTA 2WJGA 4N1AA 1OE0A 1OIXA 2CNWA 2R2AA 4NH0A 4V0ME 3SDZA 3OEHA 1OH8A 3MWYW 3TSWA 3X1DA 4EPXA 2VP9A 2NZJA 1LS1A 4M1TA 3QPVA 4X8MA 4W5HA 1P4SA 3SFZA 3GEHA 3KXKA 2C9OA 4V0OA 1IN5A 3OIYA 1U0JA 1V5WA 2OSBA 4DEYA 2QM7A 1CRPA 2IYZA 2WHXA 1BOFA 3HU2A 3SU8A 5J4HA 4HZUA 1Q0UA 4TYPA 4HLUA 3TNFA 4A15A 4Q5IA 3RABA 3TE6A 5J4KA 4LHZA 2RB4A 5KPJA 1NLZA 1P75A 2A3RA 2H1LA 4MKIA 2ZVQX 2G0NA 3EZ2A 4XWKA 3WRXC 1S4QA 1NF3A 1IN6A 3RS4A 4B32A 2AD5A 2BJWA 1G18A 3IO5A 4G5SA 1XMVA 3Q8XB 1EFRD 5FOWA 4IW3B 3DOEA 3N70A 4Q4AA 1B0UA 4TYNA 2YC2C 3N2IA 3GLFB 2OCBA 4JMPA 2DFNA 1XCMA 4TMXA 5AK0A 4UXIA 1Z0IA 1U98A 4TL7A 4UNSA 1E79A 4CGZA 4LHVA 1YU9A 3KFXA 1SXJD 2WBLC 1Z0JA 2UKDA 4IJMA 4PZYA 2Z83A 5TVKA 3SBEA 3EASA 3SQXA 3VR3A 2GZDA 4A0GA 5H1YA 3UXMA 3A6PC 1US8B 3B8HA 1TQ4A 1XPRA 2FJUA 5JI3E 1E2GA 2XTZA 2IF0A 4OHVA 3CZQA 5EZ6B 2J45A 3K1JA 3TUJC 3CKLA 5FR1A 2W6IA 5IDVA 2WJVA 2ZRCA 5DI3B 3U4QA 4JLVA 4C0QC 2QBYB 4BUJA 2ZR7A 1P2TA 3UWKA 2JATA 4IOLA 4LJ9A 3GLGE 4KU4A 2OHFA 3KKPA 5CIQA 1OHHD 1YQTA 5AJYA 1NG9A 2ZS8A 5L3QB 4LI0A 4MH0R 4V0LA 4W5WA 5JJLA 1GVNB 2OV2A 2ZJ5A 1JJ7A 2NO9A 3B13B 4ESHA 3BOSA 1M8PA 2ZRAA 3QKSA 4JBWA 5FBRB 1EFUA 2ATVA 5KPDA 1E0AA 3GP8A 1N5IA 3SEAA 4I1VA 3SE0A 1CR2A 2QZ4A 2ZJ2A 5EP1A 4CZ2A 2Q9BA 4IDNA 1VKJA 4DDTA 5D3QA 1E0KA 1DO0A 1QHIA 4QGGA 3L82B 5LDDC 2DFKB 2VEDA 1FP7A 1FUUA 1CR4A 2GJ8A 3BK7A 3CPEA 1ZW6A 4RKEA 2O0HA 4Q1DA 4YDHB 2W2XA 2FF7A 1AGRA 4WA7A 5DI3A 1DE0A 2GHIA 1J8MF 4RD2A 1Q44A 1EX6A 2YOGA 5IRCD 4DWJA 4HZIA 4UJ5A 1CRQA 3P4YA 3MFYA 4QBFA 1AIPA 1YR7A 2C78A 2GJKA 2QU8A 3MJHA 2ZRKA 1G8YA 4J0QA 2OFXA 2C9YA 3K9GA 5P21A 1K5GA 2CK3D 4ILEA 1G20E 2CMKA 2CK3A 5J5CA 1XCGB 5AJZA 2CDNA 2BV3A 1T0JB 5B30A 1AM4D 2D7DA 3DM9B 1SVLA 2BBOA 4EPTA 4TLEA 4C7OA 2VHTA 5K8LA 2VP4A 3UATA 2AKYA 4YMWA 5FUVA 1E2IA 2WV9A 3M6AA 4HUTA 2PMDA 4BFSA 5KSPA 1F2TB 2C04A 5BWMA 1E2HA 5FH9A 1A4RA 3Q72A 3MLEA 2YWHA 1M1YE 4EDHA 1ZM2A 1E9CA 1VYUA 3IPYA 4DLRA 2QRZA 4LX0A 1N0VC 1M6NA 4G5QA 3KKQA 4OYHA 4QJ3A 3CRMA 5GJVC 4UKDA 1YZKA 2JCSA 2VHJA 1KJZA 4OI4A 1DAGA 2OAQ1 1FX0A 4HDCA 2ZROA 2FFHA 1OW3B 4AKGA 4TLDA 3EPHA 4LYHA 1AQYA 4D82A 1VECA 1XPOA 4YQFA 4WVFA 1CR1A 2G0TA 2GTPA 4TMWA 1N25A 1NBME 3ZD6A 4TL6A 3KFVA 1KNXA 4HLCA 1VCIA 2V9PA 3DO6A 2IK8A 3LXRA 4Q4LA 1T0HB 4UQOA 3QUSA 3OF5A 4LJ8A 1AJEA 1PVOA 3L2OB 3QF7A 2RKOA 1IN7A 4LPSA 2R44A 4A92A 4TMVA 4CYMA 4EPYA 3AF4A 1Z3IX 1TMKA 3QNUA 4A2WA 3T1QA 3J81k 2OEPA 3WMEA 3WP0A 5JWHA 3R8CA 2FPKA 3LQQA 4Q9LA 5E3HA 2EYQA 3DL0A 3Q85A 2FSGA 1GRNA 4YDSA 4L5BA 4A36A 1VMAA 3PXGA 1IY0A 4YXWD 4YMSA 3T12A 5FBLB 5A5GA 4H1UA 4LY6A 2F1RA 4UXHA 3I62A 3THXB 2NO7A 4D25A 1FFHA 2ANBA 2QQ0A 4BLSA 3K0CC 1RYFA 2FZLA 1S9DA 1Q3HA 2GAOA 2ODEA 5EUMA 1IJEA 4PHTA 3CLVA 4IOMA 1OKKD 3QEJA 4L4UA 1W4RA 3QJYA 2R6CA 3CH4B 4LZZA 1H8HD 2ZRDA 1LFDB 4B33A 3GJXC 3PUZA 4A8JB 2FEMA 6Q21A 1IAQA 3EPLA 4JS0A 4L9WA 3U4QB 2FN4A 5EZ5A 2PX3A 3QSYA 1F2UA 4UNQA 2C5LA 1KSJA 1VIYA 1KDTA 3WP1B 3ADKA 2QEQA 4ZDWA 4PO1A 2GCOB 4Q9HA 2ZE6A 4JLPA 1TQ2A 1Z6GA 4JZKA 5HR5A 4E07A 3GLHB 1E9DA 2VRWA 1KI4A 1YZLA 4LJAA 1P9RA 4JLAA 2MSEB 2ERXA 2O8EB 4DEXA 3ZQJA 3TAHA 3TUZC 1NBMD 4LJ4A 4RY2A 1XBTA 1ODFA 2J0VA 3QENA 3UKDA 3WY9A 4LBWA 1U9IA 3AF3A 2QROA 2OLJA 2ZSDA 2QTHA 3VHXA 4JYBA 1S2MA 1JAIA 4V03A 2PX0A 1WDTA 3I8XA 1MH1A 5EE1A 3TR5A 4B48A 2JLUA 3P27A 4RCZA 3W5IA 2IL1A 1OXUA 2F55A 2JJ8A 1NVXQ 3HWSA 2CNWD 3SN6A 2AWOA 3UMRA 1KI2A 2N42A 2ZRJA 2GEUA 3GLFA 5GADl 2QAGB 2GJSA 2LKDA 3B60A 4OQFA 5CIWA 1NN1A 4F4CA 2HYDA 3GQBA 4BLPA 3ETLA 3ASZA 3AKYA 4TMKA 1KYIA 3A1SA 3DZDA 4F7WA 5HZHA 1OB2A 4QC2A 5FOXA 2XZPA 2HLDD 2F43A 3MCAA 4Y0VA 2JJ2A 1LF5A 2FX3A 1D9ZA 1JEDA 1F2UB 2GJAA 2WAXA 3D3QA 1RVDA 4TWZA 1HUQA 3HYRA 1DAEA 3LRPA 1UEIA 5FPSA 4A4DA 1G16A 2RH5A 3EIHA 3P4XA 4OK6A 3KZ1E 1K6MA 4JLJA 2V6IA 4ZIRB 4MITA 3LFUA 1IBRA 4HAYA 3W34A 5AUNB 5D3MA 3NDBB 3ADCA 3C8UA 3M0EA 4GDFA 2VYFA 1T5LA 4DCNA 1TADA 5KNBA 5KSZA 2VSXA 2FZ4A 2FGJA 1IOZA 1UEJA 4B71A 1U81A 2ZREA 5AR1A 1CIPA 3NIBA 4EJSB 1EGAA 3RDPA 1ZBDA 5KSOA 3CIOA 3QEOA 3QXXA 3EG5A 3SI7A 1D2MA 3UMFA 2HF8A 2WKQA 2BMJA 4TYQA 3PUXA 3T34A 1JR3D 4Q4HB 1VCNA 3K09C 4AKIA 2NPIA 3GJ0A 3P26A 4AIIA 4KYUA 1ZP6A 1T6NA 1NLFA 4XVRA 2KBEA 4OI1A 1P5ZB 4TLBA 5KSYA 2OLKA 5CYPA 4EKDA 2JEOA 3H86A 1R8SA 3NHAA 1JQLB 3W8NA 1EWQA 2J9RA 1YKSA 4M4SA 4C0JA 2A5FA 2G88A 3R9XA 5JJKA 2HT6A 1NKSA 4QKQA 2J7KA 3E5HA 3MGCA 3RRYA 3R9WA 2OE2A 1KI6B 5C4MA 1OFHA 1ZNWA 1WMSA 1C4OA 3OE7A 3LX8A 1P3JA 3NTUA 4BE7B 4JSYA 2GZHA 3LBNA 5FBVB 4W9MC 4PPQA 5J47A 5G41A 3ZS8A 5GJCA 1U99A 4XH9B 1S9HA 1UBFA 5ELXA 2FG5A 2UZIR 2NIPA 3G82C 4Q4AB 3EA5A 1G7SA 4NYMQ 5DHAA 3RS3A 4B6FA 3NH6A 2A30A 1AKEA 1XNJA 1XD8A 1Z5ZA 4NCJA 5SZIA 3LW7A 2IXEA 4PC3A 4JL6A 1QHNA 3W8RA 4B6EA 4DCSA 2CLSA 4Q1CA 2OCYC 4PTLA 3D31A 1ZJ6A 1GUAA 3R9IA 3TBKA 1JBKA 5EE5B 2G1JA 1AK2A 1W49A 4Q4JB 3W5JA 4OHZA 5HPYB 2QBYA 5DYGA 2ECKA 1FL9A 3VTKA 1L2TA 1IONA 1E2QA 1P62B 4LPKA 2ZYVX 1D6JA 3ZZ0A 2BM1A 1CF4A 4AKEA 3SQWA 5J4LA 4Q01A 1RKBA 5TXGA 2K5UA 4U7DA 3BH6A 4AI6A 3U3JA 2ZUDA 2ZQ5A 1I2DA 4JSTA 3PEWA 2GXSA 1T9HA 1KMHB 2G9NA 4PZZA 1NMZA 3TUIC 5JEDA 2QQEA 4R2HA 4II7A 3CONA 4MA4A 4TSFA 4BFYA 4GZMA 2D06A 2ZU0C 2DYKA 5JCPA 2FH5B 2C99A 1XEWY 3ZGXA 4D0GA 3NWJA 2WPDA 4Q00A 3WYGA 2PEYA 4JJZA 5J4VA 5FTNA 4FMBB 1P73A 4G5RA 4WXPA 5KDLA 5JSZB 1RC8A 1J2JA 1XJCA 3TGPA 4HLUC 1XU4A 2O8CB 4MRNA 4AKHA 1LF0A 5J4YA 2OAP1 3IPXA 2R6FA 3VAAA 3W9YA 4RSGA 5A0FA 1X3SA 1XDBA 3PVSA 3VU9B 4BLRA 4DSNA 5FPKA 1T91A 3ZVRA 3KXLA 4ARZA 4YMVA 2BKUA 5FUWA 4FXPA 2W6ID 4QRHA 4QGFA 2B8TA 4ZV4A 3NC1C 4DCVA 2OFOA 3WBKA 1IY1A 3L8YA 3ZLJA 3GLFE 4M22A 1LW7A 2IYVA 3SHFA 3B5JA 3KQUA 2C2HA 4DLZA 2W0MA 2WZQA 1R4AA 3LA6A 2X1VA 1SVIA 3LVRE 4JLBA 3W6PA 3IEVA 2YNMA 2O52A 4PAQA 1FNNA 3PUWA 3TKLA 3UG7A 4KO8A 3KQLA 5BXQC 1XTIA 3FFAA 2GCOA 2J3EA 1NBMA 4B47A 4GSYA 3ND9A 1RJ9B 3P1JA 4LBYA 3GLHE 3QKRA 4FMDF 1E79D 2RHDA 4F4JA 3L43A 1D9XA 1G3MA 3VR2A 4G3XA 1OF1A 1LY1A 4MYUA 421PA 2JJ1A 2EYUA 3CF6R 3AVTA 4BZPA 1G64A 5GVSA 1Z06A 2BCGY 2GF9A 3F5FA 1D8TA 1NVUQ 3R8FA 4WZ6A 2PMKA 1WP9A 2GF0A 3OIVA 1LNZA 4V0NA 2AKAB 1ESNA 1WBDA 2XTMA 2ZJBA 5TARA 1JALA 1XCPA 2ZAOA 2NG1A 4GMDA 4C7OB 2GXAA 2VSFA 4Q9JA 4GI7A 3PITA 3AVUA 2IS6A 4Q48A 2ZRNA 4BWYA 2VTKA 2ATXA 2WAYA 4DC9A 4CEIA 1KSHA 3EWAA 3Q7QA 4A1FA 4PHHA 4XD7D 1I4DD 2J0QA 2IYXA 1Y63A 121PA 3GFPA 2RHMA 4XIGS 2VQSA 3KJGA 1KK1A 2QPOA 3N2EA 3NXSA 3EX7C 2P0EA 5JS8A 1X8LA 4IOKA 3PFIA 5K8IA 2IS1A 2YZ2A 2FOLA 2D62A 1QRAA 4WOPA 3V4RA 4G0NA 2HXYA 1LVGA 1A7JA 5CDFA 1IXZA 3BFXA 2O8BB 1VDZA 4KAXA 4FN5A 4PHGA 2RGCA 4TMZA 4PPFA 5BYJA 3DZ8A 4TLAA 5EXXA 4AK9A 1RZ3A 2WPDD 2YWEA 3I32A 2QPTA 3K09A 2JDID 4M1KA 1R6BX 3K0AA 1W4BA 1M2OB 1R5OA 1PLJA 1ZUHA 2J0UB 1WQ1R 4NYJR 4QBIA 4QNMA 4B76A 3BFVA 3ZS9A 3O8RA 4UXJA 2IYRA 4D0LB 4LC0A 2WWHA 4TSFD 1QF9A 1QVRA 3IIJA 3AKCA 2CXXA 4DZZA 3OEED 4GNKA 1W4AA 1TU4A 3LH5A 5CK4A 1N5JA 5DN6A 5HCNA 1DADA 2NO0A 5TY0A 4URZR 4KVGA 3WYFA 3I5YA 2ZM5A 1KOFA 3Q5EA 2WKRA 1JECA 4UNNA 1Q57A 1TNDA 2AK3A 2AX4A 5HTKA 4C0LA 3T5GA 3NEYA 2WJJA 4URVR 5JLJA 3SHWA 3IO3A 2FPMA 4KHZA 4OQLA 4TQUS 2WWXA 1E2FA 2B21A 2ZPTX 3X1WA 1IXRC 1FMLA 1C9KA 2J0SA 4Q7LA 2QSZA 4OK5A 3CO5A 2C77A 2V7QD 1IJFA 1ZD1A 1XWIA 4IDOA 1GTVA 4EJSA 1GNRA 1ZU5A 3B9QA 1U0HC 2VP0A 2YC4C 1E9RA 1F48A 1XXHE 3RLFA 1HE8B 3CB4A 2ZRFA 2YVUA 5CK5A 4C0AC 4ERNA 2UZ3A 4TQ9A 1FX0B 2CJWA 2VH5R 2MMGA 2O0KA 2EWVA 3NHBA 3EZ6A 2GZAA 1N6OA 3BC1A 1SGWA 3TK1A 1KK3A 4LYAA 4IEEA 4MDEA 1RIFA 2H8KA 3CR8A 2PLRA 4TZ0A 1KTVA 1HH4A 1ZD8A 4BLTA 1S3SA 3I72A 1KJYA 1RJ9A 3QPUA 2GNOA 4B44A 3RC3A 3C7KA 1BKDR 1OFTA 4KFUA 4R7ZA 3HU1A 2FFQA 2DR3A 4HAZA 4I1OA 3OE7D 2QAGA 5IK2D 2XJ4A 4LUCA 1E69A 1W0JA 3FKQA 521PA 3GJ5A 4XVUA 3FHCB 3L0IB 4I99A 4CEIB 1G8FA 1KKMA 3IQXA 4BFTA 1FW6A 5TB5A 2FPLA 4MKGA 2ZETA 4ZDKA 3H2YA 3IQWA 2R6AA 3EWSA 1COWA 4QJ5A 3KQNA 4RKFA 1BMFD 1MR3F 2ZYTX 1DAMA 3CH5A 3CNOA 1J8YF 3CWQA 1P61B 4A82A 3SC3A 1ZM9A 3T06B 2XAUA 2QMEA 4POAA 1NKTA 4K46A 3WXMA 1R0YA 1DELA 1N6PA 5HCIA 1U8AA 2AXPA 4YXWA 4ZPXA 1N5LA 3SBDA 3SFVA 3E2IA 3K0SA 4LHWA 4A8JC 3KKMA 1M34E 1OYYA 1NVVR 1VYTA 2OZEA 4TMTA 4URYR 1R10A 3OAAA 2JDIA 1G19A 2B6HA 4JVNA 4Q1EA 3ICQB 3FVQA 4I81A 4PPNA 1CU1A 4C30A 1XXHB 1ZNYA 4KFTA 3QOFA 5EP4A 4CT4B 4DIEA 1YZGA 2QY9A 4DSOA 2GWHA 3K9HA 4XTRA 4MRPA 3U5ZB 1QZXA 4KFSA 2VL7A 1QHSA 1Y3AA 4IDHA 2CCJA 3GLIA 1KHTA 2WSSA 3CX8A 3HR7A 1VYVA 4ZCLA 1XTRA 1UKYA 1OIWA 3GJ7A 3OEEA 4P3YA 3VX4A 4KXFB 1OT3A 4PXAA 1MABB 2Z5FA 1GDDA 2PT5A 2ZE5A 1XMSA 3TQCA 4B2PA 3B1WA 5SZJA 1U2RA 2CE2X 2RGDA 2IYQA 3LXXA 4TYYA 1UF9A 3VNVA 1JPNA 3G5UA 2OBNA 1M74A 1Z22A 4EPVA 3MWJA 4NPHA 1W47A 4M53A 4EQ6B 4M1OA 1E9EA 2EFDB 1XPUA 4XJXA 4TYWA 1CKEA 4BRWA 1TTTA 3CZPA 2F3TA 3KL4A 2Z0MA 2CCGA 1G1MA 4YC7A 3AB3A 1TF7A 2REBA 4YLGA 4A9AA 2QUZA 4QM6A 2SHKA 3TSZA 1KK0A 5EE3A 1GIAA 2CJWB 3MD0A 1F5NA 1GAJA 3PUYA 4BQSA 3BRWD 2XOKA 1M7BA 1N0UA 3GLGA 4URWR 2E1RA 2OO7A 1JAHA 4B43A 2J46A 1UKZA 3K9LA 1TUEA 1HV8A 4DJTA 3B78A 1H8EA 1QHGA 1NNEA 2BBSA 2DWOA 3THOA 4M9SA 3CR7A 1KAOA 5H70A 1SVMA 4WBSA 5FTLA 2CCKA 4U00A 4A2QA 2FSFA 1KI7A 3KB2A 5AJWA 3GJ8A 3REFA 3LDAA 1Z2CA 4DDVA 3SYNA 4GL2A 3EARA 5KHOC 2RGNA 3LWNA 1GZSA 3D6TB 1DPFA 2ZJAA 3F3YA 4C0HA 1ZAKA 2ZTSA 5HE8A 721PA 3U7HB 2G3YA 4NTZA 1KSGA 4CEJB 1DVRA 4M21A 1CEEA 2R8RA 2A5JA 1DTSA 2ZI6A 1R7RA 1S0UA 4MRRA 1EXMA 2IYTA 5G40A 2PCLA 3FGNA 3GEIA 5TMPA 3IEUA 5KO2A 2XITA 4EUNA 3FOZA 2HCJB 4CRWB 2ZRGA 2AR7A 3WNDA 4X8HA 1X86B 1FOEB 4JKYA 1TEXA 4DCTA 1QG2A 3BERA 1ZIPA 1GRRA 1F2TA 2NO1A 4TTQA 1XZPA 5KYKA 4FCWA 2J5XA 5F9HA 4Z51A 2JLWA 1Z83A 2KWIA 3CF0A 3W90A 3A1WA 3TH5A 4U5XA 3IIMA 2WM9B 4GZLA 4RZXA 2OG2A 4XSGA 2OXRA 1WBBA 2XB2A 1DOAA 3ZDQA 2J87A 4R71A 3AGQA 4EJSC 4CEHB 2IS2A 4WZAE 3K0CA 1OH7A 4BFXA 4I4LA 4JVSB 4CT5A 1AA9A 4O3MA 1G7TA 4XSHA 1TF2A 3FMPB 4JVLA 4YMTA 3UANA 1NN0A 2QAJA 1NY5A 4IDPA 2B7CA 4KVAA 2BVNA 2YKGA 2F9LA 2KJQA 4TL8A 2CLCX 5G53C 4BECA 2WICA 1T8TA 3RYTC 5B64A 2W2TA 2XB4A 3QG1A 5FTKA 1FQKA 1OYWA 5M04A 2IYLD 3K0AB 4X8OA 2V3CC 2MMCA 2JA1A 4CVNA 4LWZA 1NJFA 3KXIA 1II8B 4MQBA 4OQMA 2IWRA 1R0XA 1X6VA 3U6KA 5DH9A 3I3SR 2D3WA 5FUXA 2XXAA 1EG7A 1X1SA 1Z6XA 1ZRHA 1JEEA 3CW2A 3VR5A 3GJ3A 3LBIA 5L8VA 3FPAA 3DEFA 2XSZD 3T1TA 1TAGA 1XEXB 4B3BA 1N2CE 2EWWA 2ONKA 1GL9B 2PCJA 2Z6VA 1PLKA 5K8UA 1IY2A 3GJ4A 3AP1A 3FTQA 3VX3A 3BFKA 4E22A 4NYMR 4N0EA 5IHPA 3G0HA 2OCAA 3CRW1 2PZEA 2QT1A 3DVLA 2WIAA 4WW0A 5GVRA 1QHYA 3RAPR 4QM7A 2XNDA 1A82A 1NVWQ 2MSDB 2Q21A 2ZRLA 1CXZA 2IW3A 2QGZA 3FKSD 3QVUA 3MMPA 3U3KA 2R6GA 3T5DA 4O25A 4AG5A 4GT1A 4S2EA 1F3OA 4QHTA 4EFLA 4ARZB 3FMFA 4US0R 2QPAA 1E99A 5C4GB 2QP4A 4NONA 3VU9A 1SKYE 1H8HA 4Q18A 3X2SA 4EPRA 2BWJA 5F3WB 1NMYA 3GMTA 2O8CA 5JFGA 1II0A 2H18A 2J7PA 2G83A 4PQRA 3QXSA 3HR8A 1CJVC 3L0OA 4OBEA 3BORA 3GJ6A 2QENA 2HYIC 3IKJA 1J99A 1RFLA 2KSQA 2O8FA 4JBYA 2YOHA 4DT1B 4AYWA 3AVXA 4Q03A 4S35A 3K0FA 1OHHA 1ZC3A 5KUTA 1XP8A 2BMDA 1JXMA 2ZI3A 1NSTA 4GRAA 2O0JA 4JL8A 4OHYA 3IILA 4IRUB 1P6XA 2ZIAA 2CHGA 3ADDA 4LHXA 4RFSA 1G5PA 5EP2A 1PJRA 1G8PA 5FI1B 4MRVA 4KSCA 3K53A 4NYIQ 5E7MA 4TTRA 3CRRA 4HATA 3PJRA 2JLXA 3QVVA 5JMTA 2QL6A 2BBWA 2EVWX 4KODA 4QOSA 2E9SA 4BPBA 1XFAA 3LBHA 3E1SA 2X19A 4XOIA 1E6CA 1E98A 3T61A 4F91B 4A6PA 3F0TA 2GKSA 1UFQA 1WE2A 4HDQB 2A5GA 3I73A 1NP6A 1K8RA 2QNRA 1JR3E 4MYTA 2BKEA 3FMOB 5CLQA 1OFUX 2ERYA 2J7PD 3VQTA 4LJ5A 4BGDA 1GM5A 4NL4H 5FPTA 2Z4SA 2HXSA 1K5DA 2ZSBA 3A4NA 3KJIA 1ZM7A 4PC2A 4Y0AA 5A4JA 1BH2A 4PFSA 2RGXA 1FZQA 1TUIA 5C46F 2ODWA 2RGNC 2ASEA 4Q4HA 5EXTA 1F60A 4DXAA 621PA 2CHVA 1NJGA 3I5XA 3NH9A 1Z2AA 3ZIAA 5F98A 2I4IA 1BMFA 1ZINA 3QXCA 3U2QA 1Q20A 1W4CA 3TRFA 5JRZA 4PSAA 1F6BA 4IFBA 3PEYA 1XEXA 3NG1A 4BLOA 4PC1A 4Z1MD 3V9PA 5HKKD 2FGKA 4EFMA 4IKEA 2YINC 3RWOA 3CPHA 4Q1BA 1P2SA 4NYJQ 4MKHA 3U3RA 2XOKD 3KJHA 4ZCIA 3FKSA 1OLOA 2CL6X 3WBJA 1JJVA 1DO2A 1M7HA 1J90A 2XEXA 5JEEA 4Q1FA 2ZYWX 4BLQA 1P9WA 2GA8A 4K81B 4QHSA 5H68A 3LVQE 5DGXA 1ANKA 5LPNA 4RFSB 3U61B 4JJKA 1E2LA 4LJ6A 1SXJB 4Z8YA 3HDTA 3GLIB 4DLTA 2YHSA 1KI6A 2IYWA 2ORIA 3VR1A 3WMGA 2F1IA 3M4YA 3MG9A 1ZCBA 3Q3JB 1J7KA 3PR1A 4MUBA 4CEHA 3AVVA 4RCYA 4C4PA 4GOJA 3IHWA 2VP6A 2BJVA 4RJLA 3KDSE 1TQ6A 2WIBA 4FD2A 3FFBA 1Z6AA 1A2BA 4DSUA 3QF4B 1N6KA 1E2PA 1YHNA 2OBMA 1KK2A 1N6RA 2PJZA 2WOOA 2X77A 2ZYUX 2R65A 4EQ6A 4P0TA 1XZQA 4AYTA 2QMOA 4O0MA 3VKHA 2NOAA 1SVKA 3HJNA 2BEJA 4HAWA 4X8LA 5KDDA 2P5SA 5KDOA 5FTMA 1FTSA 2E87A 1W48A 3SZRA 4DSTA 4B74A 3ADBA 1HTWA 1QHHA 3BH7A 4DUGA 3BXZA 1Z0FA 3OAAD 1AS3A 1WRBA 4GBMA 2F9MA 3EA0A 4P32A 3BS4A 3W6OA 1NRJB 3DOFA 3SJZA 4C2TA 4LOAA 2Z43A 4US1R 4PO8A 5FUYA 4A8JA 4N0DA 3FE2A 4OJQA 4MYCA 4DLVA 1Z8FA 2HT1A 2OESA 4ZIRA 5H8WA 221PA 4PAMA 1G8GA 3W3ZB 2RCNA 2VF7A 1OJLA 1RRCA 4D4MA 2V54A 3LLUA 1L4YA 3P32A 3RC8A 2ORVA 3C41J 1Q1ZA 4JLOA 2QP9X 4NHOA 1JPJA 4PQYA 4XTCS 4D81A 1P60A 1W1WA 4TT3D 1OXXK 5FOUA 3D8BA 3ZVNA 3KTAB 2IS4A 4NU0A 1R5BA 1HY3A 1US8A 2QP3A 2IHYA 1SXJC 1L4UA 2QE7A 1TPZA 4KITB 1EESA 2W58A 1A5TA 3SR0A 2A7QA 1OSNA 2KE5A 1QG4A 3E70C 5BN5A 1BS1A 4NCKA 2IWHA 4RZUA 3AVYA 1QDEA 1OXSC 2VHCA 5CYOA 1E9SA 2P6RA 1ZNXA 3OFNA 4Q9IA 4E03A 4D26A 3UMSA 1QHHB 5CM8B 2XGJA 2W83A 1XTJA 3PCRB 4ZO4A 3SJCA 1E9AA 3ZZUA 4FI3C 5AUOB 1GOTA 4HAUA 1YJ5A 2P6NA 3TW8B 4RD6A 2EFGA 1T3HA 4BFZA 3U60B 1SKQA 4HAXA 1ZCAA 2WSMA 3CNNA 2BM0A 3NBFA 2V1UA 4NP6A 1OKKA 4NZYA 1BYUA 2AFHE 1NN5A 3K70B 3A4LA 1JB1A 4LHYA 1AS2A 1U8ZA 2IYUA 3WHLA 4L9SA 5GJBA 2PL3A 4HYYA 1P2VA 3TVTA 3QY0A 3PUVA 3QKUA 1L8QA 4JLKA 1KNQA 2QN6A 1S1MA 1LB1B 1P72A 1LS6A 5EUQB 4WAUA 2AK2A 1VTKA 2ZJYA 1TQDA 3GFTA 1V43A 1N5KA 2V55B 2VLIA 3OESA 1D2NA 4P31A 2EU8A 3A8TA 1CULC 3LX5A 4G5GA 4DBLC 2GESA 2N46A 5EXPA 4ZI3A 2ZI9A 3L0SA 1ZD9A 2GEVA 4BZQA 5L3SA 3FB4A 4RD3A 2JLRA 1AZTA 2WWWA 2EFCB 2AHOA 3AVPA 4UJ3A 3SJAA 4EAQA 1YR9A 1YVDA 3C5CA 3W6NA 2L0XA 4HI0E 5IT5A 4GFDA 3IIKA 4Z8XA 5EQTA 3VR6A 2VA8A 1PLLA 1JR3A 2WKPA 2Q3MA 3VKGA 3CX7A 3L0PA 3NBZC 1VCOA 2JJ2D 4BZXA 3JZAA 3LQRA 2BDTA 1G9XA 1W36D 4FIDA 4DUGD 2ZR0A 1Z28A 2ZSAA 1Z6YA 1FMJA 5K8TA 5DNYB 4BEJA 5DLQC 3O8DA 2ZU6A 4JBXA 3WNBA 2A5DA 2NZ8A 3K70D 4AY2A 2OBLA 2YYZA 4JL5A 1YZQA 4EFNA 3SJBA 2G1KA 5E7IA 1KY2A 4GP6A 2IA5A 2ZRIA 4Q47A 4B3GA 4XVQA 3RRMA 4A0RA 2RGGA 4NYIR 2FV8A 4PO9A 2P5TB 2EQBA 1JQJC 1Q1BA 3PG5A 2WTUA 2VP2A 2IF2A 1ZIOA 2KI5A 3JVVA 1YR6A 3OIWA 3FYHA 2GXQA 1BO6A 3BIFA 4ZI2A 2WMNB 2Z4RA 3S1AB 1QVAA 1COWD 4KSBA 4DIDA 4DB4A 5LD2B 4JLDA 2WVJA 5LB2A 2TMKA 2BHRA 3TR0A 3ZYCA 4A0HA 4DLXA 4DLSA 5KNDA 3T35A 4E09A 3U44B 2H7VA 1DBSA 2VF8A 2VSOA 3A1UA 4C3ZA 4DB2A 4HEJA 1GNQA 1NLYA 1Q12A 4H1VA 1NY6A 3TW4A 4CF7A 2A9KA 1W5SA 2WWFA 3ZD7A 3MWKA 4NDZA 2H92A 1X8KA 2FNAA 1FP6A 4AWXA 3AQ4A 1KI1A 1UPTA 4LV5B 4QGHA 5DSZA 1MABA 4KBFA 3IHLA 1MO3A 4TQAA 2RGBA 4KI0A 4O2RA 1DS6A 1Z07A 3R20A 4IVRA 4KLNA 4F38A 1H8ED 1SXJE 3KB1A 4H9GA 4DCUA 4Z1MA 1TX4B 4ZKEA 4D4LA 2ZUBA 1VIAA 2DFTA 2GVDC 3CUEF 4NKRA 3BWDD 2NTYC 3LAWA 4ESVA 1FNMA 1XXHA 5JCZA 3I4LA 3AV0B 4OK3A 4PANA 3KUDA 5FR2A 2DFLA 4D4KA 1RE0A 1UBCA 1XJ0A 2A5YB 4QL3A 3EPJA 3I8SA 4ZKDA 1DAFA 3IGFA 4LBVA 2ZSEA 5DE3A 3NDPA 4TL9A 5FFMA 4QBGB 3U3MA 4YONB 5FOSA 3IBYA 3BBPA 2D4HA 3NC0C 2GJ9A 4B75A 4TLCA 2PLFA 1HT1E 2OXCA 3PQCA 4PC7A 2CHQA 1IM2A 2HCBA 2XJ9A 4Q21A 2O8DB 1UDXA 4FCTA 2EW1A 1KZGB 4DDWA 4FMDB 1DARA 1E4VA 2QTVB 1PV4A 1HT2E 3EIEA 3CF2A 2ZRBA 2Q0HA 1UADA 1Q22A 4ACBA 5JZVA 2WWYA 2VBCA 2O8EA 2BBTA 1S3GA 4N3NA 3RS2A 4ASUA 1U90A 4LYJA 3NEJA 4ASUD 4MGKR 2JIZA 1G41A 5L3QA 1SKYB 1W46A 3NBXX 2DWQA 4HUQB 2BC9A 1BIFA 3EPKA 1WXQA 2PJRA 1G7RA 5E95A 2C95A 2QMUA 1KO1A 4KYIB 1SVWA 1E2MA 4B3DA 1KO8A 3AM1A 1ZNZA 1OFIA 1VPLA 5SZHB 3LV8A 3MRSA 2IUUA 2CVHA 2P3SA 3C16C 1SHKA 1G8HA 3QQ5A 1JR6A 2REOA 2XZOA 1GRQA 2DPXA 2ODNA 1GKYA 4QG7A 1KO4A 3DKVA 3THXA 3RRNA 2FU5C 4LYFA 4PQFA 3TSOA 3CRQA 4ZDJA 2WJHA 1UAAA 2OT3B 1S8FA 4R9UC 2I3BA 3GPLA 4IXMA 3EW9A 4MKFA 1SQ5A 2B92A 1NVVQ 3CWZA 1AZSC 1EFRA 1MO6A 1NI3A 3AF0A 1XMIA 2V1XA 1KDPA 3DMNA 4D6PA 4JLMA 3Q9LA 4G01B 1RRPA 4ZCMA 1XD2B 4Q4JA 3OFND 4LCBA 4A2PA 3KKNA 2LWIA 3QIAA 4DHEA 3TVDA 3P20A 1KI3A 2ONJA 5DI9A 1MO4A 1Z47A 1LV7A 2IEZA 1OIVA 4Q7MB 2H57A 2ZRMA 3QPWA 3KJEA 5CJ2A 1OXTA 4P33A 1E9FA 1Z08A 1OH6A 4IXNA 3GEEA 5JBQA 3B1YA 3ICEA 2ODBA 3FWYA 2Q3HA 3SNHA 1OB5A 1GL6A 1X8JA 4F4IA 1HE1C 3FMIA 4BEBA 2OUKA 4PSKA 4V02A 3BAFA 1Z63A 1W0KA 3B6EA 2J59A 3ASYA 4OJKA 2QA5A 1VHTA 1T3LA 4IVQA 2ZJ8A 4CEJA 3LW8A 4IHQA 3RSLA 2PZGA 3THYB 1N0WA 3CBQA 2QG6A 2X2EA 3LNCA 1MOZA 1W7AA 1U94A 4Q19A 2O8BA 1E32A 3V00A 1XD2A 4TT3A 2WSSD 1LTQA 1D5CA 3WYAA 1NL3A 1IQPA 4RVCA 4YMUA 3IBGA 2FE4A 4HB4A 1DAKA 1FPMA 2J41A 2JLVA 5DN6D 4OI2A 2EFEB 1CP2A 2F43B 4PSVA 2R9VA 1GSIA 4URUR 4M1SA 5DYIA 1FQJA 4PX9A 2NO6A 3CM0A 2DHRA 3T1VA 3A1VA 2FEOA 4C0KA 3LD9A 4QGAA 4RD4A 4O2LA 3RWMB 3PEUA 1CJMA 4GPTA 2JIZD 4M0LA 5SZKB 1E9BA 3KX2A 1R2QA 5KOYA 4US2R 2F7SA 1A2KC 4G1UC 4IFEA 1WB9A 3AVOA 2C98A 4QFMA 2JLQA 1E2EA 5CDFE 3VKWA 2DCUA 1E1RD 2H17A 3LLMA 3FDIA 3A37A 3QKRB 2GCNA 4L16A 3C15C 3C4JA 3TQFA 4QNRA 4GMXA 2W6JD 3EXAA
chains in the Genus database with same CATH superfamily
1CUJA 4XB6B 1VRCA 3E3MA 2HHJA 3FHOA 1PQWA 3JY6A 3ITNA 5H3LA 5HUQA 3OZEA 1IXSB 2VDKB 3ESAA 2V7EA 3HP1A 1B0AA 3LRXA 1T8RA 4F11A 4DA8A 3G1TA 2R1TB 1GKIA 5CA1F 3KEOA 2GILA 1RPNA 1DIOB 1KVUA 1ZVKA 3BREA 5LBIA 2IZ6A 1VPEA 4YLEA 4R2IA 2RGRA 4HAVA 4Q3KA 3BE8A 1T0UA 3IPAA 3A2KA 5DXFA 2O8DA 1J70A 1SU8A 1UJBA 1ZVVA 3V3TA 5M2QA 2GEBA 2Z30A 4Q66C 1XU7A 4BGUA 1I7SB 4J07A 3L4JA 3IIIA 1OLUA 5CDHA 3VBEA 4N39A 1G6HA 1P2FA 5FLEX 3GVCA 5JS1A 1YRAA 5CB6A 1AMUA 3BFJA 1G4AE 5TDHA 3VH1A 4YT4A 2Q4RA 3OOWA 1H22A 4MV1A 3KJQA 2IXTA 2FQWA 1IWBB 1GGKA 2F17A 4DWWA 4HH3C 1I2MA 3FGOA 2H29A 5LQRA 3MYYA 2QTRA 2REXB 3ECSA 3KDPA 4F4DA 2AWNA 3DGFC 4FHEA 4E6PA 2OV8A 4CM1A 1GQRA 4HOYA 1EDOA 3A1DA 4QGBA 5DTMA 1KMCA 1UBEA 3CSDA 3COZA 4M9QA 4KNVA 4PQGA 5DBFA 3KB6A 2R1VB 4EW1A 1UKVY 4FHCA 1ZA1A 5JZBA 3LUHA 3DAGA 4PR0A 2I1QA 2DR2A 1FP1D 4DLBA 1JILA 2VHVA 3REGA 4V24A 2K7ZA 1EDBA 4D4JA 1YZUA 1YD7A 1I4EB 3RUAA 3ZH9B 4NZ9A 3BHMA 5JNSA 1FSGA 1H2ZA 4DQUA 4M98A 1GG8A 2UZAA 4KIGA 1B4DA 2HJVA 5INTA 5C53B 2F2TA 4Q7JB 5HWSA 5JAOA 3BE4A 3H0CA 3G6KA 3NLLA 5D8DA 3D3WA 1A5SB 5DP2A 3VPDA 2W98A 3THYA 1PGOA 2C4TA 3QE0A 3GLHA 2G4CA 1G21E 3R74A 2C0PA 3OEHD 4UEWA 4FZRA 4ZAZA 2OYSA 4K9KA 3ZXYA 1RRFA 2H3HA 2Q50A 2HJGA 3ASVA 1GDTA 4BFVA 1S8NA 1ZK3A 1ECCA 2QRNA 3I8OA 2DPLA 4DMGA 4ITRC 4O8ZA 3RWBA 1M75A 1YAHA 4DL9A 1G59A 1TVKA 4HJXA 4QRDA 4OMCA 3ETCA 5E8RA 4HLDA 3ZV6A 4OGKA 5FQOA 4O1HA 1W5TA 4J6EA 3JAWA 2UYOA 4O63O 3A28A 4Q37A 3WMFA 1P9NA 4DPMA 3AGPA 4JDPA 1E1RA 1YDHA 3TW8A 2NUPA 4MR7A 2VPWA 5IF9A 1KDOA 1GHTA 2RHOA 1OTYA 1HDYA 2FQ1A 5LU8A 3CPJB 2AT1A 3KEFA 5K3DA 5KS2A 3UB4A 3GARA 5AJUA 1HMPA 3MTQA 5KTRA 1HSZA 3PJFA 4J1NA 5KC8A 2GEJA 4KC0A 1N78A 3R2JA 1T15A 1IY8A 3AEZA 1JNYA 3BTOA 1L5RA 3OH8A 3EC1A 1D8AA 2ZI7A 1F7VA 1VCHA 3W1WA 4FMCF 4L8GA 4Q9KA 5DTJA 5TPWA 3FX2A 3GHHA 3B1XA 1KE2A 1DUVG 2D2FA 3U17A 1ZHFA 2HH9A 3C4VA 1T4CA 2PX2A 5AKKA 1TF5A 3JQGA 3TPZA 2FW7A 5D3KA 4KN8A 2Z09A 4E5SA 4B84A 3FUXA 1JIVA 1CBUA 1NQVA 3OX1A 3OOJA 3KQKA 2VZEA 2ZW9A 1NONA 2P7IA 1GAQA 2JCVA 2ZR9A 3Q11A 4CTMA 2XKKA 1K5PA 3DPSA 1MC8A 4RGQA 3U48A 3M4NA 4XRRA 1Z0AA 4CEJA 1AN0A 4PO3X 4IWYA 5E7JA 4IIJF 4RENA 4EG6A 2DXIA 1TEVA 2I66A 4OHFA 4P7FA 4RVUA 4CQMA 2OM6A 3OHMA 1C1YA 3OKPA 2V8OA 1AB5A 1PNOA 1PZGA 2AC4A 2EKPA 3GDGA 1GUDA 3DBOB 5HK8A 4D97A 3T94A 1J00A 3A58B 3NC4A 4NV3A 2CW5A 1I2AA 1KO5A 4JROA 4YMIA 5DRTA 3T99A 4AZ0A 1SVSA 3NHKA 4RTJA 1U2EA 5LNK6 1WTCA 4NBNA 5DTQA 4TRMA 5EEHA 1OU0A 4OQNA 3TMKA 1E1QA 2PMCA 4P22A 1DPGA 2G36A 3ZBQA 3D1LA 1UZAA 4GSLA 4IIJB 4Z54A 4UHCA 1FVFA 1AS0A 3EXHC 3VVMA 4XWWA 1QZTA 4BKOA 3D2BA 3ZIAD 2RGAA 1QPBA 5HGJA 4MWCA 3ZJVA 2GEDA 5ALUA 1T4GA 2VATA 2XQGA 1M8KA 3AP3A 2YDYA 1G3IA 4S1TA 4XZ3A 3ZWWA 4B2LA 2YOFA 5E6RA 2H4FA 2WUVA 2R7AA 1YQ9A 2PS3A 4EI9A 5KU1A 1VFNA 4M1YA 3HXKA 1WQ3A 4RK0A 3SC2A 4CIAA 4D8VA 4H2DA 4QFDA 4CG0A 4XEHA 2F90A 2B1IA 4BYMA 3I5UA 1CB7A 2W6JA 3DONA 2FN8A 4J3FA 7ABPA 3SLGA 4KBGA 2EGHA 2O05A 4DIUA 4MVCA 1N2HA 2QB5A 4ND3A 1GV0A 4EENA 3I23A 1NPYA 1PX0A 2GQ0A 2V59A 3KWFA 2FMXA 3L8FA 4UMDA 4V0RA 1Z6TA 3QVXA 3WA7A 2PNJA 3B7GA 5EOVA 2UYQA 2HRZA 4UC0A 4CM8B 2I2AA 2IYOA 4CV1A 4BGEA 1OLXB 1IY9A 1ZUIA 1Y9DA 1ZM3A 2FSUA 3A4TA 5DT2A 2G9QA 3HUUA 3DL2A 2ZI5A 2Q6IA 2IHVA 5CD1A 2Q9AA 3KPVA 4GX0A 4NR0A 5FPHA 1NDHA 2HPVA 8GPBA 1YA6A 4WI1A 2YCLA 2MSCB 3SQNA 3AYXB 3NVAA 2EL7A 5IS2A 4DV0B 1OFVA 2HIGA 2QL9A 4BFUA 3U7FB 1GJRA 1ONBA 5FJJA 1KO7A 4P3PA 2MSNA 4ZZ2A 3R7NA 1AV6A 4E5KA 1J33A 3VH2A 2I4MA 2EHJA 1YOVB 4TMYA 3HO6A 3QELA 4D3SA 3DBIA 5I45A 1XT6A 3WGTA 4CLRB 5EKUA 4U5QA 1SXJA 5KQSA 4QU5A 2W6PA 3JQ7A 2L2QA 3K6RA 1II9A 3F6PA 4AMYA 5BNTA 5IFLA 3K96A 3PXEA 1TT5A 4JP3A 1NN3A 2FJ0A 5L4SA 2BEUA 1ZVMA 3M49A 1IHYA 2VOJA 3WQRA 5L4LA 1JXOA 5CDFA 4J2TA 1EPUA 1V48A 3KUXA 1ONSA 3BB1A 1GFZA 1NM5C 1NIJA 1IWOA 5I7AA 3ZW9A 5WRFA 4B3FX 5B7PA 4C5BA 2IXGA 3U56A 3C3WA 1J8DA 2OZPA 2WE7A 5D01A 4RU1A 2IBTA 4YIKA 4OXXA 2D2EA 1PT9A 2PL9A 2GAAA 2ORYA 3H1TA 3KTOA 4XYMA 4Y6GB 4ZVNA 2XYPA 2IUSA 2HRCA 2OCPA 3AM4A 4MQFA 2BMFA 2WTMA 2ZJZA 4U2KA 4E88A 5LB4A 4ENUA 3W4JA 4Q4DA 5SYNA 1ORIA 4B5KA 3RANA 4V1CI 1XRJA 2Q3BA 1U8FO 4JT9A 3SKXA 4C9BA 4CUKA 1N3BA 1YB6A 1EXDA 2HCRA 3IX7A 3BUSA 3ED5A 2IGBA 3PKZA 5BWLA 4HYEA 2Q7DA 3AKEA 3O91A 3K1AA 4KK3A 4TLMB 3U0BA 4N65A 2F59A 2XSZA 5L7TA 2F6RA 2I7XA 4G5OA 3E23A 3R5HA 5FL7A 3T3NA 2PH1A 3DUFA 2WHRA 4ZQHA 5KTKA 1CF2O 2P77A 4D46A 1PV1A 4TTAA 1I5OA 3ENZA 3WYNA 2P7HA 1QJCA 2OZLB 1JT9A 3H1GA 3KQHA 1CY0A 4MR9A 4CKEA 3A3OA 4KZPA 3JD0A 2B30A 1C4WA 2XDWA 5DYTA 1MMFB 3OD5A 3H1EA 3M9LA 4QT0A 1SBQA 3TIVA 3G23A 5BSTA 3H05A 1CE8A 4MGYR 1IHDA 5E6SA 3R3WA 2PVSA 4LXIA 2Q6TA 3BJEA 3KWJA 3LUKA 4IOJA 4PONA 3I34X 2BFBA 5G4KB 5KQPA 1LA2A 1SCQA 1O9GA 2AJTA 2VJAA 3C97A 1CTQA 1SUWA 2WFZA 2Q3FA 4WKBA 2ZBPA 3JZFA 4FC6A 2IVZA 4P4NA 4EG7A 3H6KA 4XJVA 2XW6A 1OD6A 1LUAA 4QTZA 1G7CA 2JGMA 2PK3A 4ZC1A 4C2UA 1CJTC 3DDOA 4OFBA 4BMSA 4LJ7A 3FPGA 1DKUA 1XAGA 4IH9A 4YACA 1GILA 2JFOA 1T5IA 3G89A 4FYMA 2QORA 4C0SA 1CUZA 2O5EA 1AGNA 3QSGA 4QDZA 4X63A 3ZV4A 3BZUA 4G1FA 5A0VA 3MC1A 3E7FA 1ZZGA 3UVEA 3F8SA 2IPMA 1UK7A 2IVFA 4TXJA 3GVXA 1L7VC 2VJCA 3IERA 1VFPA 4JIMA 4B46A 821PA 3RAEC 2YFQA 3LY8A 4L15A 1A04A 4LTMA 1I7QB 3RVJA 4GOKA 3EXG1 5DM60 2EIXA 3TRJA 2DWPA 3R9XB 3U9LA 4H3SA 2E4AA 2OWEA 4EG0A 3ORFA 1E4YA 4AS2A 4R2JA 5JVDA 2X9NA 1PJ2A 5C18A 2EBWA 5KJCA 1RQRA 1YRBA 1MJFA 2V5AA 3O38A 3T5CA 3V97A 1U0TA 2ONZA 5CRIA 3WL7A 5JECA 1NPTO 1ZUNA 3WXBA 3OTWA 2XA9A 4EWLA 2CL7X 4LGCA 4L0CA 4TVBA 3Q7PA 3GRZA 2GK3A 2BR5A 3X43A 1N2JA 2NPFA 2BDUA 1FYVA 1FS6A 1KZ6A 2FCAA 2V4ZA 1XX6A 4F72A 3WB2A 2DQSA 5HZKA 1M6YA 2P2SA 1WDMA 2ZQZA 4HX5A 2GTIA 3H84A 1HF3A 3IVMA 1XYGA 1EINA 4MYHA 4Z9FA 4TN1A 1GR0A 2M6RA 4LDQA 5GGYA 3T5MA 2KS6A 3NVKI 3WK4A 1CY4A 3WK9A 3M1LA 2HLDA 1PG2A 1YE8A 2YXEA 4LWOA 4XIJA 3KLBA 1GYPA 3QOYA 3N5KA 1CZUA 1P44A 3L0DA 4XX1A 1DX9A 1F6DA 2C2XA 5AKLA 5D51S 5HZMA 3KKLA 3F4KA 5ARBA 2G1PA 1PGJA 2B7BA 4KWIA 5CLIA 5TT0A 3D0QA 2RAPA 1T5BA 3CNLA 3VFDA 5ERYA 1P18A 2A14A 2H5EA 1L4FA 5J5AA 3P96A 4G0VA 1G4UR 3JPWA 2I67A 1VIDA 3N3AC 4OQXA 3D4BA 4Q05A 3MZ0A 1T1SA 4G0OA 2AZDA 2FTKE 3H3JA 3G2KA 2P90A 5BOVA 3CA8A 3BWVA 1GFWA 3KO8A 4HB0A 4TV8F 3DLHA 2FFAA 2HWKA 4I3HA 2P2ZA 5IVPA 1QBKC 5JNLA 5BW6B 5U9CA 3HG7A 1BQ4A 3JALB 1NX9A 1BKSB 3SHQA 3EC7A 3ZY2A 5DEOA 4M83A 4IQ8A 1QQ6A 2GLTA 1PZMA 4M9RA 5FL7D 2JFNA 1LQ2A 5KTNA 4CMCA 3JYNA 2WU0A 3C8MA 3LQ4A 3R41A 1W5AA 3T7AA 3FSGD 1G2IA 3EAFA 5K4HA 2VDMB 3LG2A 1DC3A 2P69A 3WRYC 2I91A 1UWLA 1U9IC 2Q1WA 4H4CA 4ABTA 2KW5A 3I58A 4YYZA 3GB9A 2IOHA 4HAIA 1R8XA 4QXAA 3UPUA 2AYXA 1ORVA 2VAMA 3WLPA 2G77B 4UBLA 2B4KA 3IQIX 2Q46A 4I5DA 2R11A 3Q9NA 3KIPA 5CVUA 4QO8A 4RFVA 1Z6QA 1UXKA 2BMEA 1EB8A 2V4MA 3DGEC 1GGJA 2AMLA 3W3AA 4P7KA 1R88A 3TL6A 2HFKA 3KUCA 3T3GA 3WJ2A 1I0LA 3HYTA 4OGLA 5GJWC 3ZHBA 1I2BA 2Q49A 4TTPA 1Z2EA 2IRWA 5KKCA 4P58A 4ERXA 2Q2WA 4LSGA 2BZSA 1YASA 4PCAA 1MG5A 4OLAA 3H8WA 5E1BA 1R6VA 2ANCA 3VR4A 1GGHA 1UT6A 4FW9A 1TE2A 5L3SB 5GMOA 3EZ7A 2C2YA 3LT4A 4PG5A 2F3UA 2P65A 4QDKA 1NW8A 3CX6A 4JT2A 4ZDIA 5B57C 1ZOLA 1G3QA 3NWEA 3WAGA 2B8WA 3ST7A 2QI9F 2ACEA 2JAQA 3M34A 1AU9A 3G2QA 3QPCA 1ZK4A 5E6SB 3ZZMA 4DQVA 1VOTA 3K4PA 4F04A 4JKIA 3O3MB 4ISCA 3HP7A 3EEYA 3PRKE 4F92B 3UFBA 5B58C 4IBOA 1Q1QA 1IL0A 5K05A 3W1EA 4ZTZB 3P2IA 3UCXA 3N0RA 3LZDA 3GLGB 5J63A 3TLGB 4B3CA 2ZVPX 1HA3A 1HDEA 2Q62A 3CURA 3LX6A 2B83A 4J1SA 3BSWA 2I29A 4B80A 1C0KA 3T3EA 2V3WA 4TV9F 1Q0ZA 4CM4A 3F97A 2AFVA 2CNWA 3ZNNA 1NF9A 1OH8A 4IFTA 3TSWA 5A1TA 2OCXA 2VP9A 1YFJA 2W5UA 2X8JA 2NZJA 2ODTX 1FTYA 1LS1A 1J1IA 2IY9A 3EQ2A 4WK4B 1YJBA 1C0IA 3V7FA 4W5HA 1H9AA 3KXKA 4DGSA 4BTVA 1OILA 1IN5A 2VDLB 4WCFA 4HN9A 5L3ZA 4WFJA 1Y6GA 2QM7A 1UJ5A 2IQIA 1GO2A 2WHXA 3GDOA 1CUWA 1I13A 3OMWA 1I0IA 2QUJA 3IOCA 1O97D 3EF1A 4KGXA 3RT7A 1Q0UA 1VL8A 3WYBA 5IXJA 3E7DA 1SJ9A 4A15A 3UNXA 3DDWA 2Y67A 2XMBA 5EMNA 4AN0A 2EZ8A 1CQPA 1HE2A 5KPJA 2OR3A 1EHYA 1JXAA 4NMLA 4TOIA 2H1LA 1UAGA 3EXHA 4K87A 1MDFA 1YJQA 1UC8A 4RL6A 3X0DA 3K0KA 1X9GA 3DFZA 2VUHB 2Z9DA 3F7OA 1T9AA 4LZLA 1EAMA 3WRXC 2EX4A 2Q2QA 1QRRA 3HLYA 4MYSA 4B32A 2BJWA 2CMHA 3T52A 3OJ0A 4KXVA 4I5IA 4ARUA 4BBPA 1RHMA 1ZKDA 4Q4AA 2F8MA 2GD2A 2VZLA 2OCBA 4QFCA 1JKJA 3QU9A 3UXEA 4UXIA 1Z0IA 3INGA 2HO5A 3UJDA 1ZGBA 3PFGA 4CETA 3FAKA 3K9QO 1UQRA 1F14A 4D9EA 4UW9A 4EYOA 1Y4UA 2P75A 3KFXA 2OC4A 4KXMA 3YASA 4WBNB 5I7FA 2OO5A 3QBEA 1DQPA 4IJMA 4PZYA 3SBEA 5I7OA 1C8VB 1IEWA 3O26A 2OGUA 3EASA 3OZGA 4KK4A 4PS0A 5TX7A 3SQXA 1BCSB 3FLAA 1RHKA 1V11B 4JY7A 3BDVA 3ROGA 5DBHX 3C3JA 3AI3A 4XGQA 3MQFA 2PU5A 2C4WA 4J7AA 1PZXA 4L8WB 3VHXB 3CUTA 5FO1A 1E2GA 1VJTA 2A0KA 4OHVA 4R31A 1N1MA 1KQOA 1GPLA 1UT8A 4JA2A 3II6X 1D2HA 1UPUA 4KJXA 5EZ6B 2DWUA 1ZJYA 3WNQA 4X66B 2CSUA 3HGMA 2WAOA 4JOQA 5FR1A 2PXHA 2ZJ6A 5CLGA 2WJ3A 4WHMA 2WJVA 1IYZA 3KP1A 4LXYA 4WBNF 3NT4A 4JLVA 4PYNA 4HWGA 4UHKA 5LOVB 1K89A 4DCMA 4HX9A 4NOMA 4DPLA 4BUJA 2QBYB 8AT1A 1ZRSA 2OZVA 1MPTA 2ZR7A 3BSFA 3IIEA 3K8QA 3PD0A 4KXLA 4UHBA 4XR9A 5H4HA 2OHFA 5BN4B 5AJYA 1IVSA 2WF6A 4IZHA 3F98A 4MH0R 4JI5B 4ZHQF 2ZVDA 2FWMX 1G5FA 1NW3A 3I9V6 4Q3DA 1W85B 3OOSA 1E1NA 4L9AA 4BCBA 3I6QA 4RK5A 3HUFA 1WKBA 5TEWA 2EKQA 2QK4A 4JITA 3WRWA 3WV4A 4CN8A 3DOUA 5LQNA 4MO2A 1I7NA 2JC3A 3GUHA 4E4RA 3NGLA 1EFUA 2ATVA 4ADSG 2GTHA 5ENVA 3A3PA 3C1UA 5LQCA 2QN9A 1XZGA 3GGJA 2WHQA 4OBXA 3SE0A 4CZ2A 3HLKA 3BXEA 3V1NA 1VKJA 1L7QA 2XE8A 3PX7A 3GLTA 4GH5A 2JIBA 1E0KA 1DO0A 5F1YA 4C6SA 3MTBA 3A9TA 2G07A 4CQLB 2VEDA 4KHPB 1A9RA 3GGCA 4RKEA 4DR3B 1IQRA 4HXEB 4YDHB 2W2XA 2C4MA 3P9KA 3AESB 3L07A 3IUSA 5DI3A 4R9NA 1OAKA 3NYRA 4RD2A 4QQFA 4UTZA 3AZQA 3GUVA 5IRCD 3ENQA 3PDUA 2JFBA 1QUEA 2CJYA 1ECPA 2XUDA 3GWZA 2PLWA 4J0JA 1ABFA 4PVDA 1ZCFA 2QU8A 1CUEA 5G0SA 4BJ1A 2Z5LA 1KWGA 1KR2A 4DV4B 1HC7A 1TD9A 5AVQA 2GA9A 5K5EA 1RQNA 5DNCA 2AOVA 2BV3A 1T0JB 4B6RA 4AUMA 3LT2A 5B30A 1D0VA 1RTKA 5GOZA 3CSUA 2ZIVB 4M0PA 4UAVA 1SVLA 1YIOA 3L7IA 4C7OA 3OE5A 2VP4A 2JRCA 2AKYA 4YMWA 1DDGA 3DJYA 2YZMA 3MLBA 3VZDA 1FLNA 3M6AA 2PMDA 2ROQA 4KE6A 5H0IA 1FXSA 1ZDMA 1Q7BA 2XODA 4ZU3A 3UJ9A 3OETA 4GI5A 1QU2A 3VZPA 2E1PA 2V6GA 3BPSA 4R7GA 1T0IA 4DCCA 1DUSA 1M1YE 1NQAO 4DNFA 2Q3EA 1XJ5A 3BD8A 4Q9DA 3FWPA 2OQRA 1A76A 1V5GA 2BISA 1VYUA 2CDCA 2FPSA 2I4RA 3E0QA 4B40A 3TUJC 4XDYA 1BW9B 4Y1FA 1N0VC 3PGMA 4QJ3A 3VOAA 4ZRNA 5GJVC 2NSHA 3FLEA 4HC4A 1E8DA 4ARAA 4ZZ0A 5HF8A 1DAGA 3QW4B 3L4KA 2O7VA 1RJGA 5EYPA 4J3JA 2FFHA 4PINA 1OW3B 3EPHA 2D1YA 3MGBA 4LYHA 3SDBA 1IZ0A 4MYRA 2HLPA 3G6WA 1ZFNA 3GP3A 4X1IA 4WVFA 4ECEA 1CR1A 1PJ8A 4MW1A 1N25A 2P4QA 4I5EA 4TL6A 4TTIA 3KFVA 3CW8X 1Y8AA 3UJCA 1F0YA 4E5VA 3FTFA 4HLCA 2H2GA 5J58A 2BSQA 3B6JA 4Q4LA 1I2CA 3JR3A 4P36A 3QUSA 2ZUTA 2XCQA 3BXPA 3L2OB 4MI1A 3DWEX 2IDJA 5BN3B 4A92A 1PVOA 4TMVA 2OKGA 3EQ7A 5BWOA 3AF4A 1O08A 2NYUA 1XV5A 3IT0A 1Z3IX 2DUJA 4RKQA 4Y8VA 3SG0A 2FUKA 1PUXA 2OEPA 5A7GA 1IM5A 3VC7A 4Z7NB 1VHDA 1YVUA 3QU5A 2B36A 4KAJA 2AJCA 4G5HA 4XUEA 1GQFA 2A9QA 3OZDA 3CLRC 3MWEB 1JNXX 1RWKA 3DL0A 3Q5GA 1PEKE 3A3NA 5DU2A 2B25A 4NICA 2AMVA 2YN0A 5DHTA 3PXGA 4YXWD 3VSDA 3OIFA 1VYHA 4M0CA 5A5GA 3UY4A 4GEGA 1P77A 3UHJA 4XPIB 1P7ZA 3C6MA 4PGGA 5IDQA 1PU2A 4D25A 4EW2A 3QWAA 1LX6A 2ANBA 3EZNA 1W8DA 3ZY3A 4BLSA 3K0CC 3STVA 4BHTA 5IH7A 2VTDA 4YV7A 1AKTA 2FZLA 1S2OA 1DKMA 1TGYA 5JY1A 2I3ZA 3DD1A 3WRVA 3JU3A 2W8ZA 1Q3HA 2GAOA 4C07A 5D2CA 4LA4A 3RFTA 1N33B 3Q3HA 4L4UA 1T8PA 5COQA 3WLSA 2EF0A 3LUAA 3E9ZA 1S2NA 1H8HD 2B4AA 3DVAA 3P9IA 1NASA 4LEIA 1K75A 4C7KA 1EDDA 2C7VA 4CL0A 3M3DA 3U4MA 3H2IA 1EYZA 3GJXC 3PUZA 4GWKA 4II2A 3ROPA 2CXRA 1Z2NX 3WSTA 9LDBA 3DAFA 5JJBA 1M1ZA 1V2GA 2PPLA 1RM4A 2XUFA 4A10A 3QSYA 3A0RB 1N75A 4HQLA 1GU0A 4HWTA 3UGKA 4R1SA 5IAGA 4LMAA 8ABPA 1XDGA 3WP1B 3RJMA 2WV7A 1ZXLA 3RARA 2ZAYA 4Q9HA 1E1KA 1TQ2A 4TVSA 1X80B 5EL0A 5IJ9A 3DV0A 5TF4A 5KNLA 4CQMD 4YR7A 5ALHA 2UVPA 4JLAA 3W6ZA 4KO1S 4N76A 3OQ1A 5K2MA 2O8EB 4NFYA 2EJTA 3I6BA 3ZQJA 5BSFA 4ZO6A 1NBMD 2ZRQA 4LJ4A 4F1WA 3SC6A 3RJ5A 5CEJA 2YR0A 4FZ3A 4HGOA 4EJMA 1L9XA 5DEIA 3QU7A 1U9IA 4GKAA 4EEZA 2V97A 3AF3A 2HK6A 1VL1A 3LMKA 3VU3A 7MHTA 5IHPA 1S2MA 3I8XA 4PY2A 1MH1A 2RI1A 1K9SA 2FPGA 3GU3A 4RCZA 3PI7A 1J9ZA 3BRWA 3SN6A 2GFQA 1RCFA 2ZRJA 3K30A 3LBFA 4OREX 3NBQA 5U4XA 1FRVA 2LKDA 4OQFA 1OXKB 1NN1A 3NPAA 4RNCA 3UAWA 3EQZA 2V3CC 2UYCA 5BXYA 2IYAA 4G6ZA 1TUBA 4BLPA 5BVHB 1XWWA 1XZNA 3ASZA 4LYGA 1KYIA 2W2LA 3E27A 4F7WA 4AG3A 2JGDA 3IHKA 5K0SA 3RM3A 4LRSB 5F4ZA 1VBKA 1PT6A 2FX3A 3I9NA 4CR6A 3HWRA 3Q9UA 1F2UB 4N01A 2ZJ4A 4E33A 2DBRA 2P9FA 2OO3A 1HUQA 3IP9A 1PP4A 3LRPA 5AVKA 5FPSA 1P1IA 4TUYB 2RH5A 5KCZA 1FVXA 3O75A 4OK6A 3VUFA 4P53A 3C43A 3NDBB 1SK8A 4INOA 5AUNB 1GTSA 3E3OA 4IR7A 4O2BA 2XWPA 1Q6YA 5KSZA 3TPCA 4LF7B 2VSXA 3TTWA 3CVXA 1O95A 1IOZA 3M82A 3HXOA 1U81A 2NWQA 2VHYA 3FNGA 5TGZA 2FETA 4EJSB 4JFRA 1ESDA 1ZBDA 1SIBE 5KSOA 3CIOA 2IXDA 4WK6A 1XMOB 3EG5A 2ZUWA 4TM8A 3UMFA 4CG1A 3MOGA 2RHRA 3U26A 3AJ8A 4FOPA 3TGWA 1YKFA 5IBRA 1U02A 2Z8YA 3H2ZA 2HY7A 1JR3D 3OEWA 4Q4HB 1XA0A 3CZAA 3OPYA 1UR5A 3K09C 1O54A 1U7ZA 1Z16A 2GYYA 2NPIA 2HQSA 2Y27A 3GJ0A 3MGGA 1H0RA 2GBFA 3OCYA 3P26A 4NV1A 3TXAA 3WRYA 1IK6A 1U28A 1XLTC 3ZY6A 2O1EA 2EZUA 4EP1A 5KSYA 3RVQA 5EJ5A 2YH2A 4J90A 4X92A 4P7JA 1Z13A 3DCIA 1Z8NA 4BNNA 2NNWB 3RV3A 2QV0A 2DCMA 1EWQA 2J9RA 1J0BA 3N8IA 2ZM6B 1U2GA 2ZG6A 4M4SA 5CUQA 3GGPA 4C0JA 3E8XA 2GO1A 2HT6A 1QTRA 5JADA 3UB3A 4AQDA 5HJ7A 3MGCA 4PLWA 2NYRA 4YCDA 3DNMA 4WFQA 3R9WA 1KI6B 1X92A 4LOJA 1OFHA 5FOQA 1QYWA 4AY5A 2FSVA 2IPLA 4PYMA 2Y4OA 2XIJA 3O0TA 4AO8A 3QUBA 3LDFA 3WWZA 3ZWNA 2E49A 3F8WA 4JSYA 5FBVB 3NHUA 2QUHA 3WA6A 3MAJA 1FPQA 4XR4A 5IF3A 3PC2A 1ZK1A 4WRRA 4BB6A 2ZJ7A 2GCGA 3BCUA 1RYZA 4N9WA 2X6TA 4NYMQ 5AW5A 2QN7A 3CZ5A 3MBIA 3OPVA 3IODA 2IXEA 4PC3A 5D5HA 3ZGLA 4B6EA 4DCSA 1THTA 2WTNA 3TRDA 3OJXA 4PTLA 5A3QA 3WOVA 1VKNA 4OLBA 3UAVA 1GUAA 1NSYA 1JBKA 1QS0B 2GYWA 2R85A 2B61A 1W49A 4UASA 1JSCA 2Y6UA 5EEGA 4E11A 1ENPA 1C2YA 3UMCA 5D85A 1TCAA 1C3VA 3CZCA 4OXNA 2O06A 1N5OX 3RRJA 5HPYB 4YQZA 3BQ9A 3FKJA 1Z5OA 4TWBA 1ZH8A 2C2BA 1OBOA 2B98A 3TXYA 3VXKA 4MUKA 4EZIA 5E2AA 4D8UA 1P62B 4QZVA 3BMQB 1CF4A 2ZYVX 2A4MA 3ZZ0A 4AKEA 4CXMA 2PR7A 3G2NA 3LE8A 1FZTA 3G1UA 9MHTA 1VKHA 3M3HA 4GNRA 4EGCB 1O96A 4ZRMA 2ZQ5A 4DV5B 1F20A 2HBYA 2GXSA 2OQ2A 4PZZA 3IAAA 1XRLA 2JZNA 3M6LA 2C3YA 4EGQA 3FETA 4G26A 4II7A 3IDSA 4R2HA 4W5TA 3FBWA 3FUTA 3Q6MA 3NBKA 4TSFA 1QB8A 2D06A 1FTGA 2DYKA 5JCPA 2FH5B 4D0GA 2Z5VA 4RWZA 3ANNA 5TGTA 5I9IA 1XMXA 2WPDA 2WQ7A 3ZCQA 3WYGA 3RHTA 1WPRA 4ZYLA 5ER9A 4L74A 1PL0A 4LVCA 5AKJA 1K92A 5FTNA 5L95A 3PQ5A 2XADA 4FMBB 3OLXA 1P73A 4H6XA 4PM4A 3SEZA 3UGTA 3WL5A 5JSZB 3ROMA 2YY5A 1RC8A 2VWHA 1KE1A 1XJCA 2VHEA 3RT9A 4BU0A 2Q4OA 4JUDX 2RC5A 3CU5A 3RFXA 5C32A 1QFXA 2O8CB 3T9FA 2GN0A 5J4YA 5MFZA 4UHDA 3L7JA 1RADA 5A0FA 3IJEB 1WB5A 2XLCA 3ZHCA 5FPKA 1OTHA 2XQIA 1VMIA 4FMPA 4ARZA 4YMVA 1Q0RA 4OXYA 4D9KA 3OM9A 4KN6A 1UDCA 3F7TA 4QGFA 1UP7A 2B8TA 4O29A 3DE4X 3DZCA 1FFBA 1SEPA 4QATA 3LT1A 2DY0A 3WBKA 2RHBA 3MT9A 5TE9A 5GZ1A 4KLAA 3ZLJA 1U9CA 1QM5A 2E5LB 4N4AA 2AG8A 3B5JA 3UWSA 3KU4A 4YXFA 2AMYA 2VJBA 2W0MA 1CIJA 4RIHA 4DMCA 3TR6A 3W6PA 1K6IA 3VH3A 2Y05A 2O52A 3BHIA 3KJXA 2P3LA 2C8LA 4PAQA 5DHQA 3WLEA 1N3IA 1CJBA 4E5YA 4C08A 1FTQA 5FWDA 4B47A 4GSYA 4DRXB 3ROQA 1J5PA 3NASA 3P5BA 5HBRA 3BRCA 1Y1SA 3AETA 3QKRA 1KDVA 1RWVA 1K66A 2O07A 2RHDA 1M1YA 3JSXA 1Y3BE 3MA0A 3QQPA 2V5VA 4JEMA 1IQ0A 4MWZA 4PZDA 4YPFA 1ADJA 1D9XA 1G3MA 1R8YA 1SBNE 2F4NA 1WXEA 3L84A 2J5BA 2X0IA 4G3XA 4IF4A 2PWPA 5LLSA 4QXQA 4Q3EA 4TYYA 3MUNA 4A8TA 1EXNA 3CF6R 5I3ZA 4Q9NA 1LZKA 5GVSA 2BCGY 2GF9A 5ENDA 1D8TA 1NWCA 1ADGA 1A4IA 1WP9A 2PMKA 4V0NA 3D3JA 3C6BA 4HMPA 5AM4A 4ZHQB 2NG1A 1FFAA 1F2VA 3T7CA 1W87A 4ALMA 5BUZA 5DBOA 2VSFA 4YY3B 4YALA 1NYLA 4MCJA 3LCUA 3WQQA 2IS6A 5TQJA 4G41A 1N9GA 2R6R1 4PE5B 2WAYA 4EY3A 4CEIA 3CN7A 1KSHA 2VKQA 4TXHA 2NTEA 2QU7A 4QTXA 5A4KA 2F8TA 3CH6A 2UVPB 3B9BA 1Y63A 3BHNA 121PA 4H7JA 2I9KA 3GFPA 4Y1RA 2POQX 1AB6A 3TQOA 3KJGA 3RIEA 3NUQA 4KBYA 4D9HA 1ULZA 1W5EA 4Y9RA 4IRMA 1EUDB 5F52A 5JS8A 1TZCA 2J9FA 5J2TF 4YAWA 2YJGA 3IVGA 4XLTA 3RSZA 1NV8A 1XL1A 2IS1A 1O5TA 2GN9A 4WOPA 1TVEA 2NZUG 4EG1A 1KMMA 2ASVA 3V4RA 2HXYA 2AEMA 4IJQA 3SK0A 2BI7A 5KQLA 1MEJA 4Z0HO 4PHGA 2P8SA 5ALOA 4LC9A 1E1YA 1JEJA 3B3GA 2HNBA 1EVEA 2MR6A 2YZKA 2NZ2A 4YCSA 4B6OA 5L6MB 1AN9A 2CF6A 1OWLA 4R5HA 4TLAA 4M0KA 1LBQA 2XQKA 4L50A 1Z7WA 4OCZA 4TMFA 2ZYSA 1WPGA 1Z88A 2AZ4A 2YWEA 3D4IA 3V4OA 1Y7HA 2YMQA 4BY9E 1F1JA 1V4BA 2G40A 3JQRA 3O6VA 3MJTA 4RMJA 2V58A 1B8VA 2FP4A 2J0UB 1ZUHA 3BCSA 2H08A 1T9BA 3BFVA 4JI0B 4EITA 1DWOA 3WGGA 3WFIA 1VB3A 4D57A 1E3WA 4J4HA 2JA2A 3EGWA 5JSFA 5L45A 5CTJA 1Q50A 4GPZA 5IW8A 5ALSA 4QLBA 5JSUA 3FCUB 2WWHA 4TSFD 1XMQB 2OZKA 1JS1X 3NDJA 4YI5A 2CXXA 1AY0A 5K3FB 5FKJA 1W4AA 3LH5A 1I4WA 3MIIA 4RAOA 5CK4A 1CUXA 1E60A 1DADA 1JJIA 2QRUA 3C0KA 2JAUA 3PFNA 4XASA 3IDFA 3PHGA 4I9FA 5TY0A 3WYFA 1ATZA 1KOFA 1UPAA 5B2FA 2F3SA 2I6QA 1WUKS 1PJZA 3GCDA 1VE9A 1XZHA 4KZKA 4NENB 2WJJA 4BU1A 3KYCA 4RMIA 1TYZA 3BZWA 3M2TA 2FUG6 3DLCA 4L8VA 3AT1A 2FPMA 4XB1A 3PDIB 4OQLA 1X70A 4R1MA 4K3VA 3TTUA 4WK0B 2ZPTX 4Y6PA 5JTTA 1C9KA 2BSAA 2DUWA 4Q7LA 3UUWA 5DGHA 3RAFC 2G9RA 4LRYA 3CO5A 4WNYA 1QV7A 4BO1A 1L7PA 3OP1A 4HH0A 1YCGA 1KA9H 3CE9A 1I32A 1NU6A 3IPLA 3KOOA 4BQRA 4OVKA 3VSCA 1U0HC 1Z39A 3KLOA 1O77A 1HE8B 4CF5A 5CG2A 1AG9A 1OUMA 1EHIA 4K6OA 4J3NA 4H7PA 2NP6A 1ULHA 2BP7B 4TQ9A 5FWXA 2CJWA 2VH5R 1NFRA 2FRXA 2VCHA 2EWVA 3DOIA 4ZVLA 1PT8A 1F3LA 2RIPA 3WGIA 2GHTA 2PBFA 5ALYA 3TK1A 3CR3C 4H17A 1KK3A 3HN6A 4ZVUA 1V35A 2QOEA 4R68A 4RC9A 4R9SA 4CBVA 4F4FA 3PC8A 2X7XA 2ZIUB 3CR8A 1TC2A 1KVSA 4QD3A 1KTVA 3SGLA 4IVNA 4MUHA 1HH4A 1GPKA 2I8AA 4HGRA 4MUNA 5JAZA 3QPUA 1Y4ZA 1X7YB 3HY4A 2H8GA 3BMNB 5HQTA 4UUOA 1ESZA 4RE5A 1BKDR 1XRNA 3O90A 2B5OA 4QOEA 1G20B 2FFQA 3UWPA 2VDOB 1JTVA 2YWJA 1PEDA 4P2BA 2Z6QA 4RK6A 5IP5A 1XK7A 5A2GA 4V2IA 4YMLA 3FHCB 4BMXA 4D42A 3UAOA 3EH1A 4YWHA 2HOQA 4F2DA 4BO3A 5DHPA 2GLXA 4CEIB 1FW6A 3ESRA 5TB5A 4JGBA 3NOQA 1Z7BA 2UUBB 1NTOA 2DF8A 2Q4TA 2ZB8A 3GQVA 4ZDKA 3MJSA