1OZGA

The crystal structure of klebsiella pneumoniae acetolactate synthase with enzyme-bound cofactor and with an unusual intermediate
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
549
structure length
549
Chain Sequence
PVRQWAHGADLVVSQLEAQGVRQVFGIPGAKIDKVFDSLLDSSIRIIPVRHEANAAFMAAAVGRITGKAGVALVTSGPGCSNLITGMATANSEGDPVVALGGAVKRADKAKQVHQSMDTVAMFSPVTKYAIEVTAPDALAEVVSNAFRAAEQGRPGSAFVSLPQDVVDGPVSGKVLPASGAPQMGAAPDDAIDQVAKLIAQAKNPIFLLGLMASQPENSKALRRLLETSHIPVTSTYQAAGAVNQDNFSRFAGRVGLFNNQAGDRLLQLADLVICIGYSPVEYEPAMWNSGNATLVHIDVLPAYEERNYTPDVELVGDIAGTLNKLAQNIDHRLVLSPQAAEILRDRQHQRELLDRRGAQLNQFALHPLRIVRAMQDIVNSDVTLTVDMGSFHIWIARYLYTFRARQVMISNGQQTMGVALPWAIGAWLVNPERKVVSVSGDGGFLQSSMELETAVRLKANVLHLIWVDNGYNMVAIQEEKKYQRLSGVEFGPMDFKAYAESFGAKGFAVESAEALEPTLRAAMDVDGPAVVAIPVDYRDNPLLMGQLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Acetolactate synthase, catabolic
publication title The Crystal Structures of Klebsiella pneumoniae Acetolactate Synthase with Enzyme-bound Cofactor and with an Unusual Intermediate.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Lyase
total genus 199
structure length 549
sequence length 549
chains with identical sequence B
ec nomenclature ec 2.2.1.6: Acetolactate synthase.
pdb deposition date 2003-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain
A PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
A PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ozgA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ozgA01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1ozgA02
1QPBA 1QS0A 2XT9A 5EJ6A 2EZ9A 1WCIB 4MZXA 2IHUA 1YC2A 5EJ5A 5DGTA 5I4IA 4COKA 2BFBA 4F4UA 2BEVA 1U5BA 1O96B 3PKIA 1UMBB 2H59A 1YI1A 2UZAA 2JGDA 3LQ1A 3KOMA 1L8AA 4TWJA 3UPTA 2IHVA 4O8ZA 1V1MB 4UUAA 3M34A 4J16C 1WCIA 1E3TA 4FEGA 4X3PA 4JU8A 1KEKA 1POXA 1POWA 2Y0PA 5EXEA 2Q5LA 1UMBA 3GLTA 4RJIA 4RMGA 1DTWB 2VK8A 2C3OA 4KXQA 4JSRA 2AG1A 4QPZA 2XTAA 5ERYA 4V1CI 4Y6LA 2H2GA 1V1MA 2Q5OA 5FYQA 3F6EX 1V16B 1PNOA 1EFVA 2B4YA 3CLTD 3LPLA 4WBXC 1NI4B 4D5EA 1MA3A 4BV2A 3PDHA 1UPCA 5K6RA 2H2DA 4UU7A 1PYDA 5BWLA 3HWX1 1DTWA 1V11B 4RMHA 1OZGA 2FWNA 2G28A 1ITZA 4QQ8A 1XLTC 4RMJA 4JT8A 3ZHRA 1J8FA 5MF6A 3CLRD 1V16A 4IF6A 3HWWA 1M2JA 1NI4A 3JWPA 4K9PA 1MCZA 2BFDB 1ICIA 4GM0A 4BVEA 2EZTA 1X7XB 4ZP1A 1TKCA 3M49A 1M2HA 4K9NA 2Q28A 2G67A 4MPJA 3RIMA 1SZCA 4K9MA 4UTNA 2QQGA 1RP7A 2JI6A 1X7YB 2BFDA 2EZUA 5EJMA 4V1CB 1X7XA 1T9AA 3CLSD 5K6TA 3MOSA 2O1SA 1BFDA 2WVHA 2O1XA 5MGNA 4FZ3A 1YHZA 4MPPA 1Q17A 5C4IA 2AG0A 2R5NA 3M6LA 2UZ1B 3HYLA 3F6BX 5HGXA 1X7YA 1UPBA 5HHTA 4UTVA 5I5GA 3ZHQA 3EXG2 2JLAA 4V1CA 4L3OA 2VJYA 1UM9B 1V5EA 2Q29A 2HJHA 2H2IA 4Y6QA 4FVTA 2UZ1A 4K9OA 4I5IA 4Y6OA 4C7BA 3AHJA 3FZNA 3U3DA 4KXXA 4UTRA 2BFFB 4BVHA 1OLUB 4GG1A 4JUDX 2FSVC 4K9KA 1Z8NA 1D4OA 1UMCB 4KXWA 1UM9A 2FR8C 1S5PA 1M2NA 2IEAA 2NYRA 1OLXB 5K2OA 5K3SA 2BFFA 2YICA 1HZZC 4J1TC 1OLUA 3D4BA 3GLSA 3CF4G 4G1CA 1UMCA 1PTJC 1U2DC 3UK1A 3GLRA 1JSCA 1NGSA 1OLXA 1PI3A 2PGNA 2C31A 4X3OA 1B0PA 5EJ8A 3AHFA 1Y9DA 5MFPA 5ESDA 2EZ8A 5I5EA 1T9BA 4TWIA 4L2IA 4JT9A 2C42A 3AHGA 4K9QA 5BWNA 5EXDA 4GM1A 4K9LA 4HD8A 2C3MA 2BFCB 2JI9A 2DJIA 2PANA 4UTZA 1SZDA 2VBFA 1W85B 5EJ4A 1OZHA 4IAOA 3U31A 3EYAA 2BFCA 2BP7B 2OORC 1GPUA 3EXEB 2BRUC 1YD7A 1R9JA 5HYVA 1AY0A 4KXYA 1TRKA 2OO5C 1OLSB 1EFPA 3M7IA 2C3PA 1YI0A 1ZPDA 4BN5A 1W85A 1YBHA 1X7ZB 5BWOA 1X7WB 3ZHTA 3D7KA 1PT9A 2BP7A 3EXEA 2FN3A 3RIGA 3IAEA 1OLSA 5IMSA 2H2FA 4JUAA 4QELA 3DV0B 3CLUD 1X7ZA 3DVAB 4Q9DA 1X7WA 4C78A 2VK4A 4JUFA 2A1TR 5ERXA 1YHYA 4BV3A 3DUFB 4BVGA 3AHHA 2QQFA 4C7XA 1TKBA 3ZHVA 1YC5A 3DV0A 3DVAA 2Q5QA 3K35A 5DGDA 1U28C 2R8OA 3ZG6A 4RJJA 4D5GA 2OD7A 4BN4A 2WVGA 3DUFA 1PO7A 4UUBA 3AI7A 4C7VA 4MPRA 3AHEA 3EA4A 4JD5A 2QTAA 2G25A 2Q27A 4HDAA 2H4HA 1N0HA 2PGOA 4BUZA 3OE1A 3ZHUA 2PDAA 3AHCA 2R8PA 2FRDC 4UTXA 4KXUA 5MFZA 3OOYA 4MQ5A 4JU9A 4RJKA 2JI8A 3IAFA 4KPUA 2VBIA 3FSJX 2VBGA 2C3YA 5FEMA 4FEEA 1V1RB 3GLUA 4JUBA 2JI7A 1V5GA 2OZLB 2VK1A 1TKAA 2JIBA 2H4JA 4BVFA 2XT6A 1V5FA 1X80B 1Q14A 3EY9A 1UPAA 1YTLA 2YIDA 3LQ4A 3RIYA 1QGDA 3D81A 1PVDA 1V1RA 1PNQA 2E6KA 1W88B 2W93A 3AHIA 2BEUB 5EJ7A 2H2HA 1Q1AA 2OZLA 3EXIB 3PKJA 1X80A 2Q5JA 1T9DA 5I51A 4ZZIA 1UMDB 4UU8A 2J9FB 2V3WA 3EXFB 1V11A 1U2GC 3ZGOA 3JR3A 1O97D 4F56A 4RMIA 2WVAA 2BFEB 5HJEA 1W88A 2EZ4A 2BEUA 1M2GA 2BEWB 3EXIA 3AHDA 2X7JA 4GM4A 4GP9A 1DJLA 4R8MA 4IG9A 5EJ9A 3E9YA 3ZGVA 3EXHC 3L84A 3EXHB 1UMDA 2J9FA 1YNOA 2NXWA 3EXFA 1NM5C 2OD2A 1QS0B 4KXVA 2IHTA 2BFEA 2A1UA 3ZHSA 5AHKA 4XEUA 1IK6A 3FLMA 2BEWA 2H4FA 3EXG1 2C3UA 2BFBB 4GPEA 2OD9A 5DEIA 1M2KA 5EJAA 1U31A 2BEVB 1Q6ZA 1U5BB 3LQ2A 1OZFA 1S7GA 5D7NA 1OVMA 2JLCA 2JGDB 3EXHA 4BVBA 4JUCA 1T9CA 4KGDA 2QTCA
chains in the Genus database with same CATH superfamily
1EVZA 4L8VA 4MKRA 1DRWA 1I7DA 4MKZA 1S2LA 3P0JA 4L4YA 4CF3A 4JIGA 4E31A 2FHSA 4Q4AA 4MZXA 2XX3A 4C1NA 3ZN2A 1FUIA 2BHNA 1NLMA 5I4IA 4BYMA 2C96A 3RV3A 4C0BA 1F8XA 5LOVF 5DGIA 2BE7A 3AI2A 2VN8A 5EHXA 1AVTA 2OGZA 3LQKA 3PEEA 1YFLA 1H3NA 1O6ZA 4KSYA 4AIIA 1YI1A 2YV4A 5FQNA 3T3NA 3K2IA 2JGDA 2W6IA 4OB6A 2CUZA 4UHHA 2BR5A 1CR2A 5IKPA 5BURA 1XU9A 3VR4A 3HP7A 2V0CA 5H81A 1M34A 4B6GA 3FGPA 4F6RA 2PGLA 2C5BA 2QX4A 3NUQA 3OA2A 1E9VA 2JPDA 4RY8A 5FUWA 3EEQA 4M98A 1RE1A 1WSDA 4EGJA 4OQMA 1ACLA 2OO7A 2AUNA 1GQQA 3PHLA 4JITA 4U6NA 4FFWA 4QBIA 4W63A 2QTLA 1ULBA 1AUPA 1F3OA 1BQEA 5CFQA 1FRZA 3VC3A 1VLVA 1JR2A 4F3RA 2Q9CA 3GNSA 2RIPA 5CNIA 5EWMB 3WGUA 4BFLA 4QJ4A 5CW2A 2A5FA 3D8HA 4P5PA 1VJ0A 2VK8A 1FLDA 4UZSA 5DSXA 4H1WA 4ATNA 4BLSA 4UD2A 3W5UA 1YQQA 3PXBA 3TEJA 1IG3A 4EF6A 3LT1A 1VBKA 4JNKA 4LJYA 2QTMA 9LDTA 3L77A 4WVFA 3OY7A 1J2EA 1LDMA 1EFVA 1TYBE 2EW2A 1SULA 1JEOA 1WHTA 1EQAA 2GNPA 1XFAA 1QH1B 3LPLA 1KA9H 2VKQA 3NPMA 2CK3D 3QXJA 4UARA 4MSUA 3GHYA 1PNRA 4WESA 4HXGA 2YBEA 3KYDB 3V4OA 1LBTA 3ZHZA 1W4LA 2QI9F 4G5QA 5TF0A 2HMWA 4HVTA 4S1NA 4G37A 2Z58A 2P0AA 3RFCA 1PJ4A 1J8VA 1HC7A 1L7MA 4ZK2A 1J06A 1IZYA 1XIVA 4KLAA 4O5AA 3LQRA 3K9GA 3T5TA 4B1FA 3GBVA 1X87A 3OZXA 3DMYA 1J8YF 2FWPA 2EBHX 3MJDA 4BDSA 2VP0A 4W5RA 4OLFA 4GOMD 1H2XA 1UWCA 5A5VA 3WB0A 5I01A 3AERA 3RRBA 4A0FA 4KC0A 5JPCA 1MO3A 2RHMA 3B85A 3F9IA 4INJA 5CA0F 4M1MA 2Z4TA 1NXXA 3EZNA 2AT1A 3KDPA 1ICIA 2A9VA 2VCHA 2NYVA 2QTTA 3I76A 3IBFA 4WFQA 1MVNA 2GD0A 3WYBA 5L9AA 1WB4A 3OQIA 5AI4A 4FB5A 1H4SA 2I87A 4MYTA 1Y0BA 2FA9A 5DEOA 5I7WA 1JFRA 3BWXA 2X0JA 1K0FA 3KEMA 4FYYA 4Q9HA 4RIFA 3PFFA 1A82A 4BRUA 3V1YA 1V8FA 1YIDA 1MGOA 2PUHA 4AZSA 3RG8A 4JX9A 2CNKA 2G67A 4B34A 3BWDD 1J2UA 3O1IC 1K1EA 1A7UA 3GI1A 3K32A 4G01B 3NXSA 4KO4S 4LKRA 6CHYA 3EQ7A 3HBFA 1D4ZA 4UBOA 4CCAA 2X3YA 3WJ1A 3V8NA 2JAXA 3EQ6A 2EZUA 5EJMA 3ROFA 1E8MA 4YV2A 4R1QA 2NXNA 4BFUA 2QKYA 2MSKA 3BJIC 2E6UX 2Q50A 1Z56C 3H2SA 4ZZ0A 4DV6B 3NKVA 2CMFA 2IBMA 1A76A 4AK9A 1N8KA 4WK0B 1L7QA 2Q21A 3MUNA 1E1YA 3TZBA 2D2FA 4ZRNA 1C14A 1Q17A 4R84A 5ALLA 2NNLD 4CIAA 3WX0A 5LNK1 2YJ3A 1YDMA 4NAUA 4PFSA 3G0HA 4Y1RA 2WSYB 1T35A 3HYLA 2E3JA 4OP2A 5GP1A 5HGXA 1O57A 1ABFA 1VHLA 1Y4ZA 3EOAI 1RC8A 1H6AA 2OKCA 4DB2A 4WKCA 3DEIA 1CP2A 1FFXB 1ONSA 3IJPA 5DGXA 1CX9B 2H5EA 3RF6A 4AYXA 3CC8A 2Z1NA 3BL8A 3HY3A 1U8CB 5F1KA 4GBGA 5BUSA 1NR7A 2ZVDA 3P97A 5JISA 3WIDA 2EARA 3IOCA 1ACMA 4OKSA 3IUBA 1REQB 1R8JA 1KI3A 2ZWIA 4YUXA 4QSHA 3TL3A 3IURA 2UDPA 4D7AA 1RI1A 2AVNA 4K6GA 4EAQA 5KEIA 3KQHA 1AN9A 3EFOB 4DABA 3ZY5A 3CE9A 4F21A 2C61A 1NWCA 4QXRA 3QFHA 1YVDA 2VOEA 1E3MA 1FNSA 3U3DA 5JYBA 1P44A 3CVXA 1AKNA 1W29A 2ZRPA 2B1QA 5JMTA 3D64A 4PX5A 1U63A 1WKVA 2EJWA 2R6GA 5LP6C 5A1TA 5BYKA 4B76A 5KDLA 4AJKA 1C81A 2AMYA 5BYJA 1WS6A 2C0QA 1DBQA 1A8IA 2O7SA 2Q3CA 4K9KA 1H2AS 3S29A 4YEDA 4MK4A 4YALA 4DLLA 4HFRA 5IDWA 2ZJ3A 3PQCA 4DWOA 1DL5A 1BCRA 3AI1A 3QKUA 5DCUA 2XXBA 3UXEA 1L8LA 4Y2RA 1SUWA 1V2GA 3NVAA 4EYSA 3WV4A 1GNQA 5CNJA 5AWFC 5DK4A 2HWUA 3R4CA 4RDHA 4BZZA 3SJUA 3JYNA 3WWEA 421PA 2I91A 4KKVA 2WZCA 2B1IA 2ZYTX 1CJVC 1KJ9A 3CH7A 4ZV7A 3WSVA 1AF4A 1G7TA 3QEMB 5D6NA 1Y6QA 2R00A 2EX4A 3FVQA 4PAQA 1W7AA 5JZVA 4O6VA 3HK2A 4ALLA 4P3YA 1IMOA 1Z6ZA 4MA4A 3L2OB 3W8NA 2IP2A 1T6YA 1CVLA 5CM2Z 4H08A 2X13A 1HYHA 4KEAA 3PNSA 3RSFA 3LHIA 1PG0A 3DDWA 4FXOA 3KU1A 5AVTA 2YZKA 3K9LA 2GAFA 2H7XA 2VRNA 3U61B 3IRUA 5FUMA 3KCQA 2EZ8A 4N3GA 2Q7OE 4CTOA 1U7XA 1RYHA 2CNNA 5I8WA 2IYWA 1R6DA 5DRTA 1A04A 3SHFA 3ZS8A 4WL0A 4FE4A 1JG3A 3W6OA 3H17A 1AS2A 3SHTA 1TJ3A 5D00A 3U56A 2YWDA 1G8FA 4ZDWA 2P30A 1C1XB 2WAOA 5DV9A 4KXFB 5J63A 2AR0A 3D54D 5AOCA 1LU9A 3LRTA 1WMSA 5EWJA 4U02A 1YE3A 1KI4A 2BR3A 3GT0A 4FT4A 2V3VA 1AU9A 2BI8A 4G1FA 4IGFA 4OSPA 4UAJA 2V6MA 3EGEA 3QX7A 4JKYA 2CZQA 2RGRA 2QL5A 4E94A 3KR1A 3EN0A 2NO9A 4OMUA 1IN7A 3CCCA 1QMPA 4LWOA 1IBMB 2AZ4A 4KX3A 1YJAA 3FMIA 3GLHE 2A7XA 4PHTA 1PNTA 4W6ZA 4WZAB 5FQOA 5L45A 1OTHA 4BNDB 2HA0A 3IKJA 2CLFB 5AHRA 1MQ8B 2XCUA 4ZN6A 3BT7A 1FC0A 4QT4A 1U3FA 4X1OA 2P4HX 2QLTA 3K9WA 4L0QA 4U6SA 3RVBA 1C7FA 4MWBA 2AMFA 3UYLA 1AN0A 3EDOA 4YRMA 4XR9A 4MKGA 2VJDA 3FKSD 3RUIA 1YZUA 4P4NA 1RWWA 4ZYUA 2AZDA 1PKXA 4LV6A 1KJZA 1U7WA 3BREA 1PZNA 4FHEA 2WFZA 2Z83A 3NNDA 2PWBA 2O52A 3Q5EA 1A4UA 1NQUA 4UCFA 4WPGA 2D1QA 3TRDA 3UJ3X 4D8VA 3TJZA 1A9XA 4H4EA 3S1AB 5AR1A 1OWMA 2Z4SA 2ZYHA 3RVKA 3S81A 1JJ7A 5I8PA 4PYOA 3G2JA 1GPYA 3UC9A 2R6HA 4UUQA 4HZGA 5F3DA 2WAMA 4RIEA 4AUNA 5DNCA 1Q0UA 3AINA 3KYCA 2I2XB 9ATCA 4P38A 1IVSA 5KOHA 4BMVA 2IA5A 2XEXA 3DMHA 4XYMA 5JQGB 1JSZA 2ZREA 1K5GA 1OHHD 2OECA 4DDKA 2BGGA 4EW2A 4Z7JA 2J4DA 4MQFA 3IAS1 1VQ1A 3L9WA 4B3DA 1OV6A 4ZHSA 4M7OA 1KI6B 1AV6A 2BMVA 3E23A 3LY9A 4UHDA 5H0IA 3RIEA 4PRZA 1AGRA 2R68A 1TEZA 3DV0B 4UDYX 4BLQA 3WLLA 3PUXA 3T6KA 2O7VA 3MS2A 4XM0A 2XT0A 3KVYA 2PGDA 3SXPA 1ATZA 2FSSA 1SCNE 2WOOA 2FMFA 4N0PA 1R4ZA 4X20B 2ZIVB 1I32A 5FHQA 2X9GA 1O95C 3A1NA 3JZAA 1J21A 3OLWA 4G0YA 1NLUA 1U0NA 2OOSA 4U63A 5EE3A 3X43A 3Q88A 1QGUA 3T41A 4PINA 2BFOA 1TOAA 5CD1A 1CQIA 4WKBA 2W2XA 3S4YA 3LUDA 3CYFA 1K97A 2HRZA 2CJFA 3A3NA 5EL0A 2R8YA 4MJXA 4CR6A 1UJ4A 3BCSA 4BP9A 3ANNA 4YLGA 4DUGA 1TU0A 5TQVA 4X8HA 4BV8A 4HNVA 4ID3A 3FTFA 5H80A 4C0JA 3BMNA 3K5PA 4V02A 5C80A 2OZPA 2R96A 2X5NA 3BIJA 2B2CA 4C22A 1KWGA 1TPZA 4IXDA 3AHEA 4JD5A 2YV1A 5BUQA 4PPGA 5A6SB 1P74A 2A92A 3E70C 4KI0A 4F4HA 3NOOA 3DLAA 3KO8A 3EF0A 3FOAA 4ZAGA 3BK7A 3NVDA 5T6BA 3LAWA 2ZI6A 4TTAA 5ILQA 4UEOA 3RC9A 2CVQA 2FZ5A 4GXQA 3RJTA 4HTFA 3M6MD 3T1VA 2ZSHA 4RKQA 5EIAA 3RABA 4E5UA 4W1RA 3H19A 4QGFA 2PKQP 1HYEA 1SXJB 1H23A 3CUSA 2HDOA 4FCTA 3HKCB 4L02A 1RW4A 5DSTA 1IUKA 4F3KA 3SFTA 3SEZA 4FWBA 4IHAA 1DAFA 4WNAA 3P19A 4TYWA 2B3TA 2A78A 3RTAA 2QTWB 1V8ZA 4QG3A 5B53A 4QDXA 1X19A 1L1RA 4CV0A 4TWBA 4NU0A 2X8JA 3NEPX 1DJNA 1VCHA 2PIDA 2KBEA 2VJOA 1K6XA 3L8YA 3QE3A 5FEMA 3SXUA 3V32A 4DPLA 3BD6A 3OU2A 2HJVA 2OEPA 1UEJA 3CPEA 4HNAB 4TXHA 4OHYA 2D5IA 4RJLA 2DETA 4ZKEA 2IJGX 1GQSA 2HX1A 3QVGB 4GW3A 4J3JA 4LBWA 3TNFA 2GH1A 1KI9A 1U9CA 3VBEA 1L9KA 3IHLA 4N7MA 3FIJA 4NYMQ 4WEQA 2C4HA 3FKSA 5CCXA 4Y6GB 2C7PA 3V97A 1F7UA 1ND6A 1ZD4A 5A0TA 2NP6A 3UAZA 2H9AA 1JG6A 2ZJ8A 3IHWA 2R79A 3L04A 4JT2A 3AP1A 3FUVA 3EDCA 4D9JA 1AKRA 3HVJA 4UVIA 3UT5A 1V1RA 1BRTA 1I4WA 4KACA 4MR9B 3DYVA 4AZ3B 4B3XA 1G3IA 2NSJA 5EJ7A 3JX9A 2OZLA 1OFUA 3VO8A 3P94A 5B3JC 1L5OA 1C2TA 2PLNA 3BMCA 3D8SA 2IPLA 4K40A 5EWLA 2XDWA 4DLBA 3E1KA 1O9GA 1ULZA 3ZD9A 4RNCA 1USWA 2FPPB 3FR7A 4NENA 2ZQYA 4A1FA 1RPTA 3NBZC 1OHHA 1CUVA 4AZ0A 5CBPA 4NYIQ 3DKIA 4N5HX 3D3WA 1DMRA 2GM9A 3GFOA 2J32A 3FZEA 3I1FA 4F56A 4RDXA 4NH0A 5KQMA 3MK31 2X41A 3OT1A 2WVAA 4Q47A 1C9YA 4AN4A 1SU4A 2O2YA 3ENKA 3FDZB 3GP5A 3IB3A 3OOSA 3K0CC 4QARA 5EXPA 5HOQA 1AKWA 5DBOA 2W7TA 1W94A 1KK3A 3FHTA 5CJ2A 1LBEA 1R64A 4LOHA 1S8AA 4R6WA 4AKSA 1ZH4A 4G0NA 3L7NA 5FPSA 4KWCA 2QUJA 2O8FA 3RRXA 1FPMA 3I92A 4ODIA 5JCOA 4ENPA 2QMZA 3B1VA 3QVTA 2WUEA 4FFNA 4LOKA 4ND7A 4EL5A 5KQGA 1J2TA 2V7EA 1FFWA 2HMVA 2HRRA 2ZSAA 1WXQA 4JJ8A 1HE1C 3E2IA 4FR2A 2FVYA 2RCYA 4YP9A 1HE8B 3DFUA 2AJLI 3HE3A 4BFYA 1DC5A 4MP6A 4MW2A 4NBUA 3IKTA 1P7YA 1SEPA 2I33A 2WM3A 4N8DA 1NRWA 2DWPA 3COYA 5DN9A 2CJWB 2VDRB 2BEWA 2ZBFA 3FLMA 3GJ5A 4MQLA 5KJ1A 1ZCJA 3MTIA 3NKLA 1KF0A 1J0BA 3RHFA 3IHTA 2V45A 2F6RA 4QU8A 2I4RA 2X0IA 1U6IA 3ICVA 2F1RA 2TECE 3B5JA 3OZGA 1OVMA 2WUFA 3A28A 3LQFA 3R5XA 2PQ6A 4A82A 3H97A 1ULTA 4UE3S 5CYPA 2B2NA 1NR5A 3HCOA 2H1VA 1V9CA 3OJOA 1YC2A 4WLEA 4WKOA 5AW2A 4OX9Y 2QTCA 1T34A 3E35A 5AOVA 4AKEA 3ORHA 2VUTA 1NYRA 2X1HA 5BRNA 5AW0A 2JLWA 4FMPA 5FLEX 4R41A 2OP0A 1FJXA 5BQ3A 1WP4A 3RYHA 1L1EA 4B44A 1BDIA 1M10A 3BRCA 3FSRA 1DXQA 1N5KA 5HUHA 1BMDA 3O4JA 1C30A 2BEVA 1HDOA 3OPYA 1DQNA 3L7CA 3N2GB 3SM3A 4DC1A 4DW8A 4TZ0A 1PQUA 1RLIA 3NHMA 3PWTA 1IH8A 2QY9A 1CLUA 5JECA 3KL4A 2MWMA 1HR0B 3FTPA 2GHIA 1PT8A 3MWLA 1UXJA 5AVXA 4L7QA 1IONA 1NQAO 1BEUB 2IEGA 3TWOA 1Q7BA 2FPGB 3T1QA 1M73E 3P2JA 3QELB 4RYDA 2OHFA 3I28A 1PS0A 1R00A 1COWD 3OT5A 3SBEA 1E3TA 2BL4A 2CCGA 1KE1A 3J80A 4B0OA 3EBLA 3AJ9A 3AUXA 4UM9D 4LVUA 2LP4Y 1AQIA 2AEMA 2SNIE 3WMGA 4RJIA 2RGNA 2LVBA 2VAMA 2JA2A 2XUKA 5HQTA 5DX8A 1Z2CA 1PEAA 1QE3A 2DUMA 4AULA 3HFRA 1VZ3A 3NRCA 2CJYA 1A88A 1CQJB 2WPDD 3E8XA 4KVZA 2O4CA 1YMVA 4QPZA 3MJFA 5ERYA 4G1BA 1DE0A 1GAEO 4AZWA 4HXEB 1X15A 1Z4LA 3HXPA 4PXAA 5AKLA 3RFTA 1NQOA 5LQAA 4BB9A 1WZNA 1F9AA 1ORDA 2QBYB 2Q4OA 1FTQA 1EFHA 3G5TA 4YVFA 2C2BA 1YQUA 2XNDD 1QVAA 4NZZA 1UPCA 3B60A 5HMLA 1DBPA 2A0UA 2FQQA 2OPBA 1N9ZA 1NVAA 3DR5A 2O1EA 1QVRA 4MS1B 4W7SA 3R0QA 3SIXA 1NVMB 1TO2E 4K9RA 5ALQA 4EGAA 1G59A 3WKCA 4HDQB 1CQWA 1P75A 5IUKC 2D0DA 3UKJA 4BS9A 4TVBA 5K0CA 4AAYA 1HMYA 2O5CA 2HDHA 3H9UA 3AJEA 4JT8A 5EA2A 3Q8WA 1MOSA 3CV3A 3EG9B 4RE6A 1V16A 3WAGA 2EIXA 5JSZB 4EA7A 2WJ4A 2XVMA 4WOBA 3KELA 4YRPA 2ODQA 1RBYA 4XUCA 2CV2A 2OAP1 4YNBA 3KOXA 1MCZA 1Y1QA 2IW3A 5CFPA 1DKMA 3QSGA 3NG1A 4JAVC 3D8TA 1I9CA 1UK6A 4DADA 3M49A 2Q7DA 4YR7A 1XXLA 1PJLA 2D5AA 4EY3A 1JMKC 5DWQA 5EQTA 4F1WA 2PX2A 1Y63A 1KYXA 3T1YB 2AFIA 1BMTA 2G07A 2REQB 4HLCA 5FD8A 1G8MA 2PLWA 3WGTA 3WWDA 3TD9A 1SZCA 4RKRA 3KJQA 5I9LA 4Y1GA 2BGLA 2H54A 2V7TA 1ENPA 1FRQA 4UTNA 1P2UA 1RXIA 2EGUA 4KOEC 1YRAA 2EF1A 1U8ZA 3AZQA 3RC3A 1V3TA 2P3SA 2NWQA 2PWPA 1XMSA 1JFFA 3KE8A 2DBZA 1TO1E 2RH8A 4OLBA 2P8SA 5D8DA 2JIOA 4DBZA 3BIWA 3PSAA 4RZQA 3TUJC 3T52A 5SZHB 4GZ6A 1TUIA 2V4ZA 3VDXA 3HEAA 4AS3A 4TMWA 3JQGB 3N58A 1Q84A 3TBFA 1TFUA 3FI9A 2C95A 2MTBA 3I0NA 4CQNA 1EXMA 4M9QA 2VP6A 1KOGA 1UKBA 4DIUA 1E2GA 3K5IA 2AOXA 2OBNA 3E7DA 1NXWA 3MA0A 1PW7A 2KX7A 5DF1A 4D9EA 3KQTA 3IKMB 3PI6A 4RK6A 1OH6A 1ADJA 4YX9A 2GSWA 4PLFA 4G0XA 3RI3A 3I64A 3VV3A 4H0CA 3Q9UA 5A05A 3JXEA 5J58A 5CX4A 3C5WP 3HCAA 1D1PA 3EARA 3PK0A 1UXIA 4ENSA 4F3CA 4WXPA 2A67A 3WFIA 3TZEA 1FYFA 1RLJA 2BC9A 3KWMA 5LMZA 5D84A 3VR0A 1ZRMA 1U5AA 3H05A 3W2FA 1SIOA 4LJ6A 1TLLA 2WWTA 4FYWA 1MAHA 4I5IA 4RPKA 5HPYB 3OQNA 4HAOA 3OVMA 3AL2A 4OOFA 2ONYA 3DE1X 1GDTA 3OZIA 4NI5A 1KS9A 4CPDA 2QAGC 3VSBA 2BFFB 4OGWA 2ACVA 3WHPA 1DOAA 1T8YA 2JFUA 2OBFA 1JQBA 1ISIA 2PGAA 2VYFA 2I62A 1GCUA 2M9MA 3CLHA 3KQQA 5JNWA 4LBYA 4UQLA 1IM5A 2C5FA 3QUTA 4KXWA 4B3HA 2YN4A 3LM8A 1QQBA 2IWRA 2W71A 2Y8EA 3KXPA 4PCAA 4X90A 2A0FA 4PR3A 5FOXA 4DCOA 4I5EA 2WPDA 4MQEA 4P4UA 3WLSA 4M9XA 2I7VA 3U4HA 4PF1A 2ZR9A 1X1BA 3MG9A 4FFBA 3K5HA 4R54A 3AMVA 5CVCA 4ARIA 5BT8A 1OLXB 1P61B 2VRCA 3W8FA 3DGFC 3LGAA 5B30A 3KOUA 5TGZA 3INYA 4QLOA 3ZOZA 1XHFA 2DLNA 3E5NA 3IEPA 1FFEA 5JBNA 1E20A 2AUTA 3ACBA 3HCDA 3K3PA 3TRFA 3WE7A 3OC0A 3ROGA 4DQDA 1Y1SA 4BY9E 4BAGA 4P83A 1XZ8A 3WRYC 2DCUA 3OLYA 2NSLA 1PTJC 1M8FA 4L22A 1JZQA 1MKYA 2DG2A 2PKCA 3HN7A 3WISA 1UKEA 3GLIB 1H69A 3TSAA 1JFSA 3BILA 4CTKA 5B2EA 3I2KA 4P81A 4XE5A 1YVRA 1U6KA 2OAQ1 2WZDA 2OYSA 4NABA 4BMSA 3I8OA 4YBRA 1F06A 1AG9A 1TLFA 1TYAE 1JYSA 2N42A 2NXJA 4ZVUA 3WC4A 2I0FA 3UK7A 3NHLA 5HRUA 4HDSB 3KQUA 1JDZA 3LS2A 3FBTA 2Q0XA 2B0CA 2DXIA 4EBFA 1B26A 3C6ZA 1GFSA 1QRAA 3I8SA 2YXDA 5B37A 2HRCA 4XD7D 1Q5PA 2DERA 4D57A 3D4LA 3R7AA 3MTBA 2EP5A 4CUJA 2BFCB 4MOWA 5I4KA 1SG6A 1VL1A 5DT9A 5GMOA 4CV3A 1TMYA 2M1XA 2VPZA 3UNXA 3P4XA 5EZYB 5CH5A 4WLVA 1RADA 1T9ZA 4JBLA 3RGWS 4QM7A 3LL4A 1SHUX 2C2MA 4IEEA 2A9JA 4JFAA 4TLMB 3T9CA 2ATEA 1KXJA 3RIXA 4OQXA 1XRJA 4HQKA 2FE1A 4L6CA 3I53A 3V1LA 3MS4A 2PPVA 3WQSB 3C5HA 3A31A 2IHKA 1T4CA 1XLVA 3KZVA 4JHXA 2ZITA 4XGNA 1QX3A 5CG1A 1KJ8A 1NKTA 2CLHB 4I6JA 3DJFA 1G2QA 1O7JA 1MEOA 3H1PA 3LUBA 1G42A 4IUDS 3DFMA 4V39A 4ZOBA 4BNMA 2OORC 5M5BA 4BEWA 3ZZMA 1NI3A 2QUKA 5I6DA 5EERA 1QZTA 3N86A 4W5HA 3QUCA 2A1IA 3A10A 4XWKA 2ZRFA 5IT5A 1Y7IA 3MQ2A 3DBOB 1YI0A 3I2GA 3K72B 1ZPDA 3OG9A 3QI2A 4LW8A 4M9SA 3TBKA 1AKQA 5AW4A 1I5EA 2ODNA 1ZJ4A 2SHKA 3IVMA 4BLRA 1ZJ5A 1M76A 3JAKA 2FPKA 1YZYA 2UYOA 3ELBA 2J67A 3TSWA 4IIYA 1PD0A 4WOJA 4QNMA 1CFZA 4GRAA 4BUJA 3PQ2A 3TI9A 1WDKA 2WSLA 4IRUB 5IVPA 1VLZA 1I9GA 5C8ZA 1M0EA 4FJ1A 3TCXB 4PO8A 1PT6A 1B76A 3HL0A 1SBTA 4PONA 3JARA 4L8WB 5T3UA 1STOA 1L4KA 3NHJA 1E2QA 4PLPA 2WB2A 3SOZA 3VAAA 2YINC 3FNGA 4MYSA 5TQ0A 2C92A 1QRRA 1OBVA 1P9OA 2CLIB 4WZZA 1RQPA 1JMVA 3CKKA 3L46A 5JBQA 3BQMB 3R3JA 4R71A 2W2PA 5H5JA 1DHRA 1YGYA 4JENA 5ALFA 3LBFA 2XDAA 5DPMA 3CNQS 4Z1MA 4KMMA 3NORA 3DHVA 1CIPA 1T1IA 3WK9A 4TXNA 2L69A 3O7WA 2JAHA 2RGWA 3LUPA 1KSGA 1M74A 1KJJA 3QBDA 2YJ4A 3E4DA 1GUBA 1I3LA 1NURA 1SB9A 3I30X 4QUIA 1VI2A 3RBZA 4FKZA 2IK8A 3H3XA 4W8OA 1U7HA 4NTZA 3ZHVA 4FINA 4HAVA 3CNOA 4CL8A 2YHAA 2Z9DA 4RQBA 4KRGA 4RTPA 4I55A 1OT5A 3L6RA 4JYCA 4HQOA 4GQAA 1XSEA 1SXIA 3UB3A 4G86A 4KHPB 3RVMA 2E4UA 2V7UA 1WXFA 3FTDA 3LHSA 4BN4A 1A7AA 2O2XA 1P1FA 4Q01A 2QRZA 3G2PA 4E07A 4Z86A 5FL7A 1NPYA 1UK7A 3M3HA 4QWWA 2YHIB 1S2IA 2PZAA 2XGGA 3AI7A 4C7VA 1OD6A 2O2EA 4WEOA 3DO8A 1VHDA 2BDUA 1MHPA 3NOXA 1TFRA 1K4YA 4ZDJA 3PFKA 2ZB7A 3OZFA 2RHCA 4IJQA 4OV6B 5AQ1A 3O94A 1XPJA 2C7VA 4E5SA 3OE1A 2PDAA 4DFDA 3BBLA 5E3HA 3AHCA 4LXQA 4N3NA 3G89A 4YV7A 3OTHA 4OHKA 3ZJVA 4UTXA 2JCYA 2YYYA 3B51X 1O4VA 4BGDA 2YZMA 3DKVA 2QF7A 3GWGA 3OLVA 4I1RA 1QH9A 3TTUA 4B87A 1II9A 4TYNA 1WPRA 4XD7A 3SF8A 1R4MB 3O4GA 4A8JA 5A3QA 5HRAA 2ECOA 3LBYA 1JTEA 1L7DA 3DDOA 3ZZ0A 1WCWA 4LOLA 4KN8A 1GEGA 2JHCA 3OX4A 4UBMA 4XSHA 4GZLA 3DL7A 1MNAA 3LJKA 4OGKA 3UWOA 4A8TA 4PFQA 1Z5UA 5HUQA 4M54A 1FP6A 2JD0A 3MMPA 5HILA 1ADFA 1S2OA 4KQWA 3ON5A 3QTLA 4BUCA 5CDGA 2OZVA 5JD5A 4BEVA 2Q1YA 3F1KA 1W1IA 2FXIA 1RLOA 2IIBA 3D1VA 4S0ZA 1IAQA 1DELA 2WSBA 4CKYA 4DAEA 1ISSA 2VK1A 2PX5A 3OZEA 1ZDMA 3UKDA 4E1BA 2JIBA 4P7KA 5FUXA 1G38A 3C3CA 4Y67A 3CVJA 3GL9A 2ZULA 3DT9A 1VP9A 3IBYA 3MT7A 2HLDD 1DSSG 1CZUA 1DDIA 5K3FA 1Y3BE 3U13A 3PYXA 2EGGA 1JIQA 4LC9A 3WYGA 2O5RA 4EHHA 1JQJC 1W35A 4EGQA 4I4TA 2AI1A 2JJ1D 3HXLA 3SSNA 1UEIA 2II6A 3CA8A 1PNQA 1O2DA 2R86A 2AFIE 2W93A 4H6VA 1Z6GA 4O33A 2H2HA 1A8UA 1L5VA 1WOYA 3TEMA 5EIFA 2JIRA 4MYDA 2Q07A 2Q3BA 3ZV7A 2CMKA 4HH3C 2OMKA 2B30A 3K15A 3N53A 4GGMX 1GADO 2R8RA 2Z57A 4U4AA 2QHXA 3RK4A 4CCSA 4FHCA 1XMPA 4JOBA 1IXYA 3G2IA 4FPXA 5EP4A 3V00A 1ZGHA 3UJBA 1CRWG 1OXUA 1FNBA 2AFHB 1YFZA 5FNVB 1XZHA 4Z3OA 4KH0A 1NUAA 1QFSA 2AK3A 2EF0A 5FV4A 1XJ5A 5DBGA 4TM7A 5ITWA 1JTFA 1SUEA 5DYIA 1NJFA 3GLQA 4CIXA 4LYHA 2Q1UA 1F4VA 3CGGA 4RDIA 1J00A 2GBCA 1N3LA 3LV8A 3N39C 4ND2A 1NPDA 2Q0HA 3VBCA 1K5PA 1N8TA 4YFYA 5B3KA 4TVSA 2RHBA 1LPPA 2J7PD 3L3BA 1WBJB 3PDWA 4CT5A 5IJ0A 2ZSUA 3ELDA 4RK5A 2GKOA 4HLUC 4GP9A 5DNYB 1QQAA 1I1QB 1QONA 1LCIA 1T5HX 2EFYA 3KXKA 4P5EA 1K08A 1UWVA 1I24A 3MCVA 4MVJH 2CD9A 5BSEA 5KWVA 1XAGA 1L7VC 4NJEA 2ROQA 4G1MB 1F2TA 4KWEA 4E6EA 4MA5A 4MWSA 4PTZA 5KQLA 2JARA 2NU6A 2VHEA 2Z56A 5K0GA 5KYWB 1GRNA 1WF6A 1R88A 3SZLA 3WYFA 3B1XA 2NNWB 4C06A 2Z6UA 2GBGA 2XQFA 1ZRHA 3I04A 2LV8A 1A72A 3CVUA 2OCAA 5CURA 3H1EA 4A9AA 5BOSB 4P9NA 2SCUB 1Z6QA 1S7GA 2XVYA 3COVA 3M3PA 4HLQB 4YJHA 3SQMA 3TOZA 3V33A 4AZVA 1MPTA 4J0IA 4TYQA 3W6NA 1J8QA 1GU7A 3NASA 3RAGA 3WGGA 4QPNA 2A5DA 4B6QA 5H3LA 2WKRA 3A4NA 4D3XA 3CURA 2WIAA 2HA2A 5F35A 5E1DA 2A57A 4ZIRA 1COZA 1UP7A 1CUHA 2IHUA 4CFZA 1MC1A 1B8UA 3MQ4A 1JG4A 1JLHA 1BXKA 2WTMA 4RK0A 3OZVA 4DJAA 1VYUA 2HMUA 2AKYA 3QOYA 4AY3A 1PN3A 4UQPA 1HZJA 4YP7A 1XEXA 3DWIA 5FTKA 1C8LA 1O96B 1TE2A 3EULA 3HWSA 3DBLB 5TRTA 1P5FA 2WHXA 1ZIOA 5JRJA 1C9MA 3G6KA 3FZQA 4BQRA 1RM4A 2DAPA 4HAYA 4YPVA 4WZBA 3EZ9A 2P9CA 2UUAB 3FKQA 1Z68A 2Y1DA 3UPTA 4MITA 3TFWA 2FZKA 4B3SB 2VH1A 3FRHA 3MQFA 3TLKA 3VMFA 3UFXB 1IN6A 1WU7A 1OIWA 1QIEA 2NV6A 3A9VA 1QLJA 3C6BA 4DMUB 5KTNA 5KTOA 1YR6A 2QTGA 2XKBA 4BO3A 3U6KA 1PS9A 3GAFA 4ZCTA 3OJEA 2O0MA 4YMVA 2XYHA 4M46A 3BHIA 1E4VA 3E9NA 3VKVA 3WLFA 4WZ6A 3RVOA 4ZQEA 1MZVA 3AUSA 2KB0A 3OQBA 1KEVA 2IIQA 3UAGA 3D59A 1C3XA 2FF5A 1QZXA 2R87A 3RARA 5LXTF 4MPTA 4TL8A 1GUFA 4JHLA 3PPYA 4DCCA 8ATCA 1J56A 4IDDA 3BA6A 3M0EA 4J7CA 2WD9A 1W8DA 3CZ9A 3EQZA 1XXHA 3X1YA 1VCMA 3F6EX 4UTPA 2ZJ5A 5IH7A 3O8RA 2Q4DA 1B1AA 2WTEA 1AE1A 4US2R 1IZ0A 4UUOA 1NVFA 5A5GA 3EMVA 3QW4B 3WKEA 3T38A 1P80A 1SKBA 1S7CA 4MAMA 1A4XA 2XWQA 4IJKA 4N5MA 4MEBA 1D1SA 5H4HA 1N5RA 1D2CA 1U8YA 4C4PA 4ZK6A 1MC8A 2HO4A 2W2KA 5C8YB 3QF4A 4C07A 2JHPA 3GLHB 3W5AA 1SD2A 4NQRA 4TTTS 5KOYA 1GPDG 1Q2UA 3IO3A 5ALXA 2XBLA 2Z1MA 3NP9A 3U17A 1E2JA 5BORA 2X86A 4TKUB 4OK5A 1JYFA 2BGKA 2PLFA 3DP7A 3EOZA 3SDZA 4QPJC 3ZHRA 5BUCA 1B3RA 4JJKA 2P1ZA 5FBQB 5DSZA 1BIFA 2W9XA 5CVTA 5FBZA 3A4VA 3PZRA 1J5PA 2R11A 4LF9B 4E08A 3NOVA 4BO1A 1RBMA 2IPXA 2W2TA 3HKBA 3SYRA 3ZJ4A 1XTJA 3DMRA 2J7PA 2XD4A 4MS3A 1NFQA 1FBNA 3ONFA 5GONA 1NA5A 1UDAA 5AJZA 1RRFA 1JE1A 3OLCX 1P7PA 3Q3JB 3VHXA 4HUJA 3VV2A 5LQNA 4MHOA 1C1DB 3TCNA 2CEKA 2O1WA 2ZAYA 3NTRA 4F11A 3HJRA 4JXJA 1SG9A 1T3HA 2OYCA 2DEUA 2HA4A 3BRWA 1NVVR 1QNLA 3GWZA 4WJKB 2Q62A 2YV5A 4XVRA 1ZEJA 1FU8A 5LU9A 1L5ZA 3OZWA 1FK8A 1DVRA 4ZGGA 5I9IA 4QYXA 4YHHB 1S9DA 2OHVA 3L8GA 1SC9A 3AR5A 4LI0A 2WSSA 2ZAGA 3EISA 5DE3A 4AMYA 4C05A 4V1CB 1CY0A 3JQBA 1LSJA 5HIAA 4WA8A 4DY4A 2XE6A 3IQZA 3S2ZA 1FFCA 1XZBA 2XIJA 3HDGA 3IXMA 4HZUA 3HGTA 4BQFA 2YOHA 5JDIC 3AO0B 3CUUA 4RTRA 1VI6A 1DRVA 4JR2A 4LTMA 2J3HA 1KK2A 2GMWA 2NX2A 4Q4AB 4R8VA 2G4CA 8AT1A 2IIVA 4RFSA 4D25A 5FWXA 2QG6A 2WIDA 3H0KA 4XYLA 5K4GA 1E2NA 4X8LA 3QVKA 1SC3A 2VJAA 4URYR 4F5DA 5CTJA 5AYVA 5E7JA 3TLGA 2R6ZA 1NY5A 4HDRA 3JPYA 4L7VA 4XVHA 4US0R 1JKJA 3FFXA 4Q5IA 2ZTUA 3LECA 4QUHA 3BYZA 4LWPA 1Q50A 2FP4B 3Q7EA 4JBIA 3K2BA 3QV2A 2PUBA 2OCYC 1KTVA 4DANA 4F6RB 4IEIA 1GRRA 4EEXA 1V5EA 1CUWA 3C85A 1JLKA 1GAWA 4BQNA 3FOFC 1RWVA 1SWVA 2J0EA 3FYDA 4DXHA 3MYRA 2VDWA 3C3BA 4D82A 3HTXA 4K9OA 4GBMA 4JGIA 5ALUA 5CDHA 3AG6A 4J0CA 1EUZA 1Q7TA 4L9RA 4KYTA 3G0DA 4RFLA 3RKRA 3T0IA 4I1SA 1ZUNA 2CZGA 3ZGYA 2VPTA 3WS7A 1HOXA 5FTMA 1Y81A 2DY1A 2ZJ1A 4UAUA 1H22A 2ACKA 1HPLA 3AJ8A 3B53X 3BCUA 2G36A 1JKXA 4GF5A 4I4IA 4JNCA 4P92A 4PQEA 5ALWA 1MFPA 5F21A 2PLAA 1DG3A 1NJ5A 2Q8NA 2Z3WA 1GZ7A 3B3AA 1B41A 4AYTA 2B3DA 4MWGA 4DLSA 4JJZA 3AONB 3CX6A 5K2MA 4QBGB 1NXSA 5CDYA 1G2IA 4EJSA 3ZZNA 3BIOA 1MB4A 1ZJ6A 1SOVA 4K6HA 3NHWA 1C3OB 1MC4A 2G5PA 1EEXB 2Z8ZA 2NGRA 5LDGA 1YDHA 4X00A 1E0DA 2QAJA 3KSRA 2DWOA 4KUEA 4I55F 3V3KA 5FX2A 1I4DD 3L6CA 1RYBA 2ZWPA 4Y7CA 4GO1A 3T3DA 1SKYE 1WSWA 1V39A 1OLUA 4UCXA 3UMFA 4OJNA 3MTDA 1TT5A 3IFSA 5KYGA 3UBTA 3LLVA 4KO1S 2B0JA 3MLAA 3W5HA 3EBPA 1QRTA 1SU7A 3A26A 3KALA 3MJ4A 2QORA 4J0EA 4J16A 1ZR4A 2IUEA 2AUMA 4NEQA 1FYEA 3SC6A 3AERB 2VXBA 5JH7A 1PI3A 2VUHB 5FDFA 3O3NB 3RSSA 2QRUA 3PLNA 3TUIC 1R6VA 3G85A 4PAMA 5FFFA 3LC1O 4GOND 1EK2A 3BJMA 5DTEA 1QWOA 4EHNA 3CG4A 4OXRA 3O8QB 2XOEA 4DA9A 4HGRA 4MLZA 5K99A 3KHSA 4YO8A 4WXEA 4J1TA 3TQHA 3WWPA 3T7SA 4BZWA 3U5ZB 1NUHA 4IKPA 2C2XA 1JT9A 2JFZA 4IVPA 3RTCA 3CM0A 3QVVA 3AHGA 3U49A 3GZNA 1MX3A 2PXCA 1JU3A 2PQ0A 3LKDA 3QLVA 4PIPA 4R9NA 5E6UB 3ZDRA 3AEYA 4K9LA 3PF9A 1S02A 2EJVA 3ZIAD 1XCLA 2C3MA 2QVZX 1BW9B 5ADHA 3OWHA 1W4RA 3FFTA 4MUNA 4PCUA 4YCJA 3TL2A 3CF6R 3TCKA 4GOLD 2PANA 4B6SA 2G1JA 2O8DA 1F0PA 2CL5A 4XQ9A 1JHZA 3ZCSA 3DMTC 1JAYA 3CUKA 4EG4A 4UBKA 3L0CA 5LBIA 4QULA 1Z0JA 4EYKA 2ZI4A 1RPNA 4ERXA 1I3CA 3KXIA 1AH2A 3ROPA 1RE0A 1XLTA 4F06A 1TYZA 1U9YA 3JWHA 5EINA 1Q57A 2P68A 1IXKA 1HYQA 1RJWA 4URZR 3PGVA 5LUBA 1USUA 2PQ2A 4ZFNA 2Z8YM 4KXYA 1TAGA 4G81A 3ACDA 2OO5C 4MUIA 5K6AA 5AJWA 4GPTA 3PNBA 3M7IA 3P2YA 4FCWA 1JHUA 3E48A 1WDMA 1A4IA 2NACA 2R1ZA 1VYVA 3ZI7A 4X61A 1NX9A 4YREA 1XPRA 4TSKA 1E32A 2G5CA 4LSMA 2JLXA 1E1KA 1PEDA 4QDJA 4AG5A 5K20A 4IIBA 4C0XA 3H4IA 4OQQA 1UBUS 4PC2A 1D6SA 1MVLA 1Y1PA 3HCPA 1HY3A 3TLXA 3PUHA 3ETCA 4FYIA 5B7QA 3KB8A 1GNPA 2JCSA 1F20A 2BRUA 4YRCA 2HK8A 4D8YA 4YLYA 2H51A 2ECPA 1U0GA 4LJ9A 4N18A 1JTVA 3X2FA 3O4HA 4IQ0A 2BJWA 4X6UA 4R3NA 5JCJD 3C3YA 4WY5A 1U2EA 2BVNA 4IGAA 3SCZA 2W8ZA 4FMCF 2Y0EA 5FBLB 3KHTA 3TB6A 1NNEA 5C9ZA 1SVNA 1W36D 2X8WA 4JLVA 1IN4A 1FA9A 2XBMA 1K75A 1UODA 1JHPA 3OF2A 4AROA 3PQ4A 3DUFB 1A69A 2FW0A 3KJHA 5A0FA 1B93A 4KXMA 4YIHA 1JALA 4QJIA 4BRWA 5KYXB 3PUIA 4KGXA 1IN5A 3C1AA 3I9JA 1YJXA 1JL3A 2C7GA 3CF2A 3LUHA 1C9DB 3M6VA 3O03A 4IEFB 1KJYA 1II8B 1VCNA 5TC4A 5AVJA 4C14A 9GPBA 3AHHA 1BD4A 1WCV1 5FUYA 1HE3A 3ZHXA 4INAA 1TTTA 3GJ0A 5D6OA 2PRKA 2O0JA 3A37A 2HU7A 4C87A 4BMOB 1W52X 3AM5A 3DVAA 4WZBE 2A5GA 2GLXA 1QRDA 2G0TA 1BGVA 2Y0DA 3SYNA 2OQIA 4HEA1 2WDPA 2XNJA 3PICA 3QJGA 2B8WA 2IHYA 1QP8A 5I4CA 2G1AA 3B8HA 3DFIA 2QIOA 4ZOLB 3FYUB 1KS2A 3SZOA 3UOGA 3X1DA 3G8CA 5GM1A 2I54A 4WBNF 1GCAA 5BSGA 2XXJA 5T57A 2UXBB 1UM8A 2YMPA 5ENVA 3S5JA 4HS9A 3D7MA 4KPUB 1V5IA 2IRWA 1V3UA 2H4HA 2JHAA 3PGMA 3RSLA 4C0QC 2PGOA 1GKKA 2ADFA 4UM5A 3SI7A 5K9ZA 4WLNA 5CFMA 2PD4A 2X3FA 4GMXA 1VA5A 2R97A 1TEVA 3L5KA 3NHBA 3N3BC 3DHYA 2G3YA 4TRMA 3VR4H 1XQ6A 4IUYA 4KXUA 4JCCA 1NRXA 5HF5A 2BMEA 3ET4A 3MXOA 4A23A 1E1CB 2W2OA 2IY7A 1EG2A 1LPAB 2G8NA 2V7QD 4NU8X 1QYWA 3CX4A 3OCUA 5T3YA 1XJQA 3KSAC 1FVFA 2HCFA 3K0FA 1WABA 5J4YA 5K0ZA 4OB8A 4O4IA 4J4BA 2GRJA 2VBIA 1ZCZA 2H08A 3PXXA 4HN9A 4D42A 2WI8A 3CPHA 3WSTA 5KHOC 3GIWA 1BD3A 1BE8A 1ZI9A 3B8EA 1QZZA 2B2XA 4KH1A 3UENA 1GCIA 1ZAYA 5H3HA 3F7NA 2FRDA 3ZLBA 4YRGA 4FEEA 4CCYA 2LXNA 3EA0A 1UZMA 3EF3A 4ZMSA 1WXHA 3INNA 3NETA 4Y3UA 1RQ2A 1J49A 4CQMB 4TVKA 2NVUA 2V6GA 2YFYA 3D31A 4FFLA 5DJ5A 4M6WB 1NW3A 2NO5A 5E38A 3S28A 1QFZA 2H4XA 4I1IA 5ITZB 1HDRA 3S8EA 2H1FA 5ESXA 3H86A 5BNWA 4JLJA 3KWJA 1XTKA 3RAJA 4MJ7A 5I45A 5IKMA 2J9XB 1UBJS 3H2HA 5EVJA 2VDQB 4ESOA 2XGOA 5IX8A 2HPAA 4FIDA 1ZISA 3ODGA 1YS1X 1S3IA 1ZR2A 1SKAA 3N2YA 1XDBA 3NOQA 4CDNA 3NMUF 1PUXA 2CBGA 1J0XO 1NMXA 5FLKA 1V6SA 1EFDN 2FF7A 3CLUC 1RQRA 1J33A 1XL1A 3OT4A 3O84A 4IJ5A 4J07A 1M2FA 4CM5A 4NHEA 1IPFA 1RRPA 1VKJA 2P9BA 4IDOA 2A9KA 1F3LA 1IHPA 1Q1AA 1U6JA 1AQ6A 1CRZA 2BF7A 2CWDA 2JD1A 2VWQA 3WGVA 3GNQA 4CMGA 7YASA 5JJLA 4ZXPA 1V4VA 3ANXA 3L7YA 4HSGA 5BV2P 3IEMA 3VKGA 1HOTA 1PR9A 1W30A 2IKSA 4FNMA 2OYRA 4A4DA 2IZ6A 2QTRA 1A71A 1KH2A 3FWKA 3NTLA 1UDRA 3P9NA 3AKCA 3VPCA 3G9UA 4KR0A 5JCJA 5F98A 3IVGA 4IIGA 1E6CA 2CSUA 1X9HA 3GRRA 1RI4A 4XPIA 3WDSA 1E0AA 4PPQA 2A1UB 2RB4A 1B7GO 2XTZA 3DEAA 3MT0A 3QH4A 4K6KA 5T8KA 3RDPA 3WLMA 4MV4A 4TYYA 2FZEA 1QIMA 1QMGA 4QM6A 1BS2A 1ZOSA 5GOZA 2YVUA 3B38A 1WCYA 2HA6A 3LCJA 3KKKA 1ODIA 2XMZA 1EZZA 2IOQA 3KPWA 4JOCA 4K81B 4EP1A 5BR4A 1A5TA 1E0SA 1YB7A 3O8OA 1HDIA 2XVAA 4IVNA 2JFGA 4N5DA 5DTMA 1YQ9A 4OQNA 3SC3A 3V2GA 4O4HB 3GN2A 4GVXA 5BSUA 3T06B 1CEQA 1YNOA 5JROA 3UXYA 2I6XA 2RAVA 2I4OA 4G85A 1QS0B 3NV9A 1SVIA 3UOWA 5I7EA 1VECA 4HX2A 2CCKA 2DZDA 3D4NA 3F4LA 3SR3A 4K5QA 3MWKA 1WG8A 3S2FA 1E2HA 4G63A 3FNEA 1IY0A 3HY4A 3E6AA 1NUQA 1XVVA 1XELA 1EX1A 3C4QA 1GAQA 5FNVF 2FNAA 2MOKA 4G0MA 1DFGA 4JVLA 1M2KA 4QOHA 5KMGA 1I3OA 1Q6ZA 3I5AA 4QAQA 2OSVA 3LKVA 1J0AA 4HDMA 4JR1A 4N5LA 2CSXA 3K70D 3IELA 1JR4A 4O3MA 5CITA 3IGFA 4G89A 4IDPA 3S2IA 4W9MC 3SKXA 3NAZA 3OM8A 1EDOA 2OILA 4YRFA 4YS6A 2GN2A 2ILTA 1QPBA 2PL3A 3K53A 3M4JA 3NHKA 4MUYA 4UW9A 2X0NA 2PMEA 5KQPA 1UFKA 2JIDA 3U7RA 1H8EA 1J9ZA 1YUBA 3PNKA 1MB2A 4LXIA 2EZ9A 2ZTSA 1G8YA 2D8AA 4QREA 1OC2A 5AVVA 2IODA 1ZGCA 1L3IA 3PD1A 2ZETA 5F9MA 4DJFC 1BA2A 3W2TA 5KNCD 2GCNA 2P7HA 5AHWA 2QRQA 3LGSA 1P81A 1Q0RA 3AM4A 4Q1DA 1JR6A 2PMWB 1GZ5A 2GTIA 2MINA 4MGYR 2RDMA 4KQJA 3SXUB 5KDDA 3KUUA 1BOOA 3UMVA 4C01A 4TWJA 1U8FO 2BBOA 1C7IA 2DFVA 2O8VA 3DBHB 4DQUA 2DH5A 4EKNB 1QG6A 4QOJA 5ERGB 5L7TA 1WCIA 4OXKA 4ZAWA 1CZKA 1C3VA 3ES9A 1NNUA 4KE8A 4I3GA 2Q0SA 1WMFA 1ZK2A 2D5CA 2EFJA 2C8KA 3LWZA 4ZZ2A 3M5PA 3IB6A 1KEKA 3M5DA 1CIVA 1HFEL 3KT0A 1XNRB 2I2DA 4ISBA 3N0TA 1Z2EA 4OQFA 3AZPA 5JYCA 2QQ0A 4G5OA 1NVXQ 2MMGA 3DOFA 3A32A 5IAKA 1NG1A 1JR3A 3PXUA 4I08A 3ED1A 1Z88A 4QO8A 3OMLA 4P0QB 2HPHA 5C2JB 1DIOB 3B78A 2HIGA 3LA8A 1J1ZA 4JR0A 4CL2A 4QXQA 2WWGA 1N6PA 1WRBA 3M83A 4DEVA 4P22A 2RGCA 3S8MA 1JXQA 1F1BA 1WTAA 1CDOA 2AE2A 3H3FA 3JAWA 3G1UA 3W34A 5GZ3A 2E4AA 5AI0A 4BVJA 2ZUSA 1RM3A 4N8SA 4D6XA 3JQQA 2PZMA 1LDBA 5K3OA 4QICA 4D0NA 3DXFA 3BM5A 4J29A 3V2UA 3T99A 3VYSB 4YCSA 3QIVA 2B9VA 5BW6B 1DTWA 1VKNA 4QBKA 3I3OA 3JQ6A 2J59A 3NC1C 3LO5A 1A2QA 1E3WA 1UOOA 1GG8A 2J6HA 3D4IA 3OFJA 3WK4A 5ALEA 5JH7F 4IXWA 4XLTA 3ZU2A 4II2A 3HA5A 1EHCA 3IX7A 2P9QA 3CLRD 1CERA 3C6XA 3I9V6 4LI3X 4J43A 4M8SA 4V38A 4ILKA 1UBOS 4XWAA 4EI2A 1VB5A 5AW8A 1ZGBA 2ZAMA 4J2TA 1XX6A 3HABA 4GX1A 4HADA 4YXWA 3R9WA 2EHJA 3VNSA 2ZBGA 3ZQKA 1E59A 1D2RA 4LJLA 1PWEA 4IILA 4ZMBA 4BVEA 5C1PA 4L85A 3DM5A 1DO0A 4DVJA 2DY0A 5D87A 1E9CA 4RCVA 4DXAA 3GLFB 2OBMA 4HQ0A 1TKCA 3WAKA 1T1RA 3LRPA 4EKYA 1GNTA 1M1YA 3AIOA 4LWZA 3SQDA 3TM4A 3JYHA 2H07A 2QZSA 2G77B 1UKCA 2GGSA 2VF7A 4ED9A 2R7KA 3PVSA 2QS9A 2BMJA 3PIIA 3ORFA 5EKXA 3W7BA 1GKIA 1RCUA 4CMHA 4X85A 4EY5A 2FK8A 2BDTA 4X54A 2CD7A 5GJVC 3Q87B 4MUFA 2FDXA 2JI6A 1MOQA 1X7YB 3KKPA 1TQDA 4HFNA 3MWJA 3CBGA 4DQXA 4GE3A 3KV1A 1IOZA 1T2FA 3PE6A 1O94D 1EKXA 3E0QA 1T9AA 3G0OA 3PC4A 4X62B 3R9XA 1W96A 4U39A 2HEGA 4B3TB 2WJZB 5HIMA 5CFNA 3A3OA 1BFDA 1TC2A 5KYNA 3JQFC 1VCOA 2O1XA 4PU0A 1PZMA 4QPPA 2HA5A 4KDRA 4DB4A 1R16A 3N5KA 2QJTA 1J7JA 2NU7A 3C7AA 3CUVA 3FVTA 3RYHB 2WUWE 4MQBA 1HT2E 2VA9A 4RVNA 4GZ5A 4OBEA 4G5FA 5LB4A 4HX5A 3R7WB 1WW3A 2TMKA 4XQ0A 1U1GA 5ADUS 3I62A 5JFTA 5KNCA 1E18A 1P3Y1 2Z95A 3DKRA 4NJOA 2HUNA 4GPIB 1EJ2A 3GDGA 4Y2XA 1EP9A 5H82A 1UPUA 3AB7A 5IFKA 4UVDA 4YP1A 5AVSA 4YTEA 2YKGA 2ZS7A 3OKCA 3COZA 4M9CA 1S4MA 1K5DA 4FN4A 1Y4AE 5EPOA 1TM3E 1YL7A 2CN1A 2J8ZA 4I14A 5AUQA 3RVLA 4UUMA 1ZIYA 5EP2A 5TQ2B 1ENZA 1K06A 2HDNB 1W5SA 1JS1X 1ZNQO 2XCLA 2XMBA 2WWXA 4P80A 5EEHA 1V45E 1ZY2A 2HCRA 3L4BA 4FGKA 1KQPA 2XZDA 4GPD1 3ST7A 5DM70 2VI5A 2BTQA 3GR6A 1NP3A 4QRIA 3ENWA 1ZMOA 3WGQA 2RGYA 3SN6A 1JFTA 3B52X 2AFVA 2J33A 4JCOA 4XWYA 1Q12A 1YVPA 2J0SA 1R8YA 1MDBA 1IZ9A 2XAUA 3PEUA 4P36A 2W70A 3VVCA 4UM8B 3S70A 1P7CA 5IARA 2HCBA 1SVUA 2TMYA 3PWZA 4UMFA 5CA1A 2R00C 1LRKA 4I19A 1GQOA 3SX2A 4RWZA 1QFMA 1PQWA 3OKAA 4ALNA 4UOEA 4YT8A 2NZVG 1MG5A 3FYUC 2ZXEA 1BO6A 1JU9A 2N0SA 2WUGA 2Y67A 5JZ9A 3F49S 3Q3VA 4PBRA 5KJ6A 3K9HA 3PJEA 4OJQA 1QIDA 2WYOA 3VFDA 5BW4A 4H18A 4OP1A 3V4ZA 4GUDA 4DMCA 2DM6A 4EHAA 1KR2A 3KTAA 4UHBA 1XZFA 3VKWA 3BWCA 2OZEA 3TVYA 1PFQA 3KM0A 2WK1A 3WMRA 2H2AA 5DM1A 3RS4A 3CF4G 4HGNA 3U7QA 2I1VB 4UHFA 4WH0A 3OU6A 3K0KA 4PN3A 2GASA 4S1VA 2QJFA 3VAYA 1UWKA 4GXNA 4AW9A 1KP2A 3DXXA 4CXMA 4W5QA 4WIAA 2Z08A 1JSCA 1DRKA 2PMKA 2XTNA 3IPCA 1DUSA 1NC3A 2PSFA 4ZVKA 1I4EB 3UJDA 1HDZA 1CNFA 1K7YA 2NXEA 2PGNA 3NHRA 4FOLA 3IEKA 1AUOA 1XDUA 2QG4A 1KDVA 5IJWA 121PA 2VS1A 2WZQA 1N2CB 7REQB 3BZUA 1GEEA 5DFAA 3L02A 2XWSA 1S89A 2REBA 2ZYSA 3JASB 4O4JA 1EFKA 4FE3A 4UATA 1ZUWA 4N40A 2WLTA 2EERA 4BECA 5M2QA 1HGXA 4ZQCB 3EUWA 4O4IF 3TSCA 1SOAA 1NVTA 2H85A 1T4DA 3F5SA 4GM1A 3EA5A 2Q46A 4L5AA 5HGJA 5HE8A 4RANA 3WRXA 3X1WA 4M1WA 4B3BA 1CUUA 5K8VA 4YXFA 3THWB 1L9XA 3KQOA 1XI2A 4INPA 1E1MA 3MINA 1JEYB 1F6DA 4QUKA 2YY6A 4O25A 3L41A 4XIGS 3HJCA 1RM0A 1JFFB 2NOAA 5JLAA 3TIFA 1KEEB 5C81A 4BB6A 1CF4A 2QY6A 1W85B 1GJRA 2Q2NA 3IMCA 3RRJA 5F1YA 4ZI7B 4DV5B 4HNRA 1WPQA 2QM0A 4ASUA 3T7JA 2BN4A 4WAUA 4NARA 1PL8A 1OZHA 2JCXA 3B2EA 5AK0A 5DNWA 3WB1A 4B75A 1NQVA 2VBCA 1Y34E 1VPTA 1Z4IA 4LJ5A 4RMNA 4QQFA 1DADA 1P62B 1OI3A 1RQLA 3GJ6A 5HKBA 4EMSA 3W4JA 2I1QA 1E63A 2JEZA 2AD5A 1D03A 4A0HA 4YROA 4Q00A 1Y7TA 4PPFA 3NT5A 3NC4A 4KO3S 3TX6A 2GNAA 4K2HA 1K86A 2J5QA 2WA1A 1HSZA 5BUZA 1XNJA 2C3PA 2OL4A 3RVPA 2WBLC 1GZSA 3HCEA 2A9PA 2Y4OA 2Z5FA 1V7CA 3AB3A 4ER0A 3TLAA 3STHA 2FSFA 4MUBA 2UUPA 5AW9A 2Y1LA 1CEXA 2IX3A 1UKYA 3IQHX 1RYZA 5JE8A 4ZAFA 1Z0SA 4C3UA 3RASA 4TTRA 4JLAA 1NOIA 2F3UA 2DU8A 4TVOA 4KE9A 4UASA 5DKFA 1KQ3A 3WLHA 2EFCB 1KRWA 2VC2B 1R4NA 4MULA 2FWAA 3KX2A 1LPBB 1ECLA 4JEMA 4BL5A 1OAOA 1RRKA 4FJ0A 4KRYA 3R0JA 1MQAA 4KWIA 4QUEA 3U3OA 3PGLA 3QYPA 5EZQA 1Y8AA 2Y0BA 1AZSC 3OHPA 4M0MA 4PLHA 1QB8A 1T5BA 1S2DA 4UHEA 5TPWA 4DLKA 2MSLA 4XDYA 5IMSA 3UGJA 2W6CX 2IYNA 2PRSA 3EYWA 1TQ2A 2HSEA 2FJUA 4WWHA 1Z0IA 1X7WA 4DSAA 1JZSA 2CNLA 3CH6A 3PT9A 3T1NA 3VPGA 1KP9A 3G49A 2GJ9A 1JQ5A 1AUVA 1N7HA 1Y33E 1ZN9A 2PX6A 2HRQA 3B6IA 1M1NB 3OQMA 1A5ZA 4RD4A 1YRLA 1UF9A 1V5WA 2EFHB 2R8XA 1YR3A 2CHFA 4CMKA 3KR2A 1F2VA 1AURA 1SUPA 2PO7A 2YHBA 4N0QA 4XYGA 4G6ZA 3W2IA 5AVYA 1NUUA 4N8EA 4ZWNA 4QYWA 1T6BY 3R7SA 4GSYA 4C0SA 1RQ7A 1TKBA 5IS2A 3UMRA 2NO6A 4L07A 3URMA 4YAKA 2CGEA 5AJXA 2B8NA 1GM5A 5JAOA 5GZ1A 4X92A 4GKKB 1GTL1 2DLDA 3IA2A 1Z4QA 3LDUA 1NDHA 1T5OA 3A9TA 4IGIA 5EXTA 3ZG6A 5I7RA 2WINI 4RIGA 1HMPA 4NC9A 3ZJUA 2Z2KA 4I8DA 3RM3A 2JGJA 4MEAA 1KXZA 1LTQA 1PR5A 2ZQ5A 4GR9A 4G4SP 4M37A 2H7YA 3UWDA 3M1AA 1S96A 3A7DA 2O54A 2C00A 3FZYA 3PP8A 1WNFA 2PMDA 4FBMA 4JI3B 3ZW8A 3C6YA 2X76A 2OWEA 4LJ4A 1OGJA 4MRRA 5H02A 1XC7A 1RZ3A 1BH2A 1KFBB 3L06A 2QR3A 3OQ6A 4CMEC 1N34B 1CZOA 1FLNA 1M9NA 1MU0A 4HDNA 3DPIA 4M38A 2O0LA 5U1PA 3TMAA 2V97A 1TNDA 1AKVA 3TQTA 4CR7A 2EHDA 3Q5GA 1Q2XA 2QUIA 3ETLA 3G5MA 4WOCA 5J4LA 3HXMA 1RQGA 3U40A 3DMNA 2C7OA 3VOTA 1ISPA 4MA0A 1TAHA 3AW8A 2WTUA 3JATB 1RI5A 1HL3A 1Z2PX 2NO0A 1MOPA 2BUBA 3MW8A 3O74A 4Q7LA 1RYMA 3OIYA 4F8YA 3ADBA 1K66A 1I5RA 3OLZA 3CRW1 2XWJI 5E8RA 3KAPA 1ILWA 4LUCA 3AILA 1DBSA 4N76A 2V74B 3I6QA 4NONA 2RHTA 1ESDA 1YXMA 1F6BA 3AOGA 3KU4A 5HUJA 2GJKA 4ZOLF 4QX6A 5TS3A 4P7GA 2J3MA 3G9XA 2JVIA 16PKA 2WAAA 4L57A 1U5CA 3S55A 2A88A 2E49A 3BB4A 3D3KA 5DOZA 3W9UA 2E1PA 4IJMA 3BTOA 4LNUB 2BTEA 5EKUA 2H4JA 2WM9B 4Y2QA 1RXYA 1QYVA 1IU9A 3EY9A 4PZZA 4JBGA 5DNAA 3RYCB 2VDJA 4MVXA 3ZZUA 4D4GA 3PCXA 1PVVA 3L40A 5J2UA 2AHRA 3WMFA 1UFVA 1W93A 1W34A 4E5NA 5I7SA 1QH8B 2BMFA 2JFYA 1VHTA 1Y4SA 1VE1A 4HRVA 3GXOA 1OASA 3ZGXA 4OBBA 1II0A 2E6KA 2VDNB 1VE3A 4HH1A 2BKXA 2OBBA 5EYPA 1MAAA 2FEAA 4F38A 4IUCS 4ZCLA 4B17A 5A7HA 3HU1A 5JANA 3L4JA 1H65A 1UDWA 2QSJA 8OHMA 4QVIA 1PT5A 2K7FA 1Q11A 3ZWVA 4RVSA 1XZCA 3N7UA 5JCOC 4BBZA 1JJAA 1YZTA 4DR6B 1XA3A 4MV8A 4LQ4A 1Z5WA 1QNFA 4HYTA 4CM4B 2CY0A 3EXFB 3OKFA 4L8GA 5EQDA 2GDZA 3JWJA 5JPIA 4AB1A 3SYTA 3TO5A 3BMQA 4EITA 1WZIA 1QKKA 4D4MA 3K6SA 4UEWA 5ER9A 3R7BA 1T3GA 2QOEA 2V1XA 5BRJA 5DYTA 2H0AA 1V41E 1UIRA 2W98A 3KS9A 2BEUA 1D5CA 5AQEA 3LYHA 3OOWA 4B83A 3U1BA 3HDYA 5EHZA 3J81k 2C2HA 3JYQA 4MP3A 2DPXA 3JRXA 1T3TA 5LMCA 1NP6A 2IXEA 4Q21A 2ZSDA 3WLJA 1L7EA 3VH1A 2UVPA 5J23A 4P98A 2GXQA 4MV3A 2NSDA 5LPNA 2NUPA 3AWDA 5KKAA 1W4AA 3OFVA 2CXPA 3EVFA 1IHOA 3GEGA 2JATA 5KB3A 3CNHA 1O0BA 4BJ6A 3D2AA 2RK6A 3QPAA 5JALA 2D2VA 5KYUA 2XNKA 3REGA 4YRBA 3AEKA 1XTVA 2PWZA 2WG0A 2Q8QA 3T3GA 1FS5A 3FMGA 3GFRA 2VQ3A 4Y9SA 3IL2A 2PKRA 3OZRA 1PQYA 2J48A 4LYGA 3EXG1 4G41A 5AXBA 1QKJA 5JJBA 1KJQA 2PN1A 4HAXA 3TOVA 5JAMA 3NHFA 5EJAA 3ZVMA 2IYEA 5ED4A 2RHRA 1XR3A 5IXJA 2HHJA 4PGGA 2XCIA 4BLUA 3S1SA 3MTAA 4D3FA 2D4AA 4NZNA 2ZE6A 5BXQC 3EEYA 1NVUQ 3Q6MA 2ES4A 2FUG6 4PLWA 2FEOA 5HJ5A 3IODA 1SZPA 4NECA 5IDQA 1RXEA 5TMBA 1W5AA 2ZCJA 2VG8A 3NIBA 1G21B 4LZNA 3GLGA 5GWXA 3SVZA 5JJIA 5CB4B 5FPKA 4XA8A 1E0JA 4TMZA 2K2QB 2OCLA 4DMFA 5J2TB 3LSTA 3SF8B 4BQIA 2X4GA 3HN6A 4RPIA 5JEEA 1AKUA 4OPMA 4LDAA 4COKA 1YS4A 3W5SA 3Q85A 2BFBA 4O4HF 4I4LA 5ESWA 1M0WA 1P9LA 3GDFA 4X1YB 2OUKA 2HR1A 3CZ4A 2W6OA 2WE8A 2YNMD 4E0BA 3KOMA 1SKYB 5F64A 4N01A 3S40A 3ICCA 3IQWA 3HS3A 4ZAZA 3I0ZA 1JDTA 5HEKA 3U9TA 1N78A 4D2IA 1G16A 1ZL0A 1WZ2A 3HM9A 3O3MB 2PGIA 1PEKE 3PLAE 1BG6A 4C4SA 1HRKA 4CKEA 1U99A 1EA5A 3N2ZB 5DGCA 1DPFA 1GG5A 4EECA 1KDPA 1E3LA 4O2AB 2XYVA 1PR4A 3ZCVA 3NEAA 1BROA 4DLNA 4Z4IA 1NQ5A 3BG5A 3GAAA 3ITDA 5C18A 3L7DA 4UHKA 2HMSA 4NY1A 5CA1F 3GIDA 3KDAA 3PTLA 4J0JA 3W8RA 4B6FA 1UMBA 1L1FA 2PKYX 4DA4A 4RMGA 1X74A 4EQ6B 2WKWA 3C24A 2P2GA 1IL0A 4IH9A 2QWXA 1P0FA 4OSEA 3TDMA 3TZHA 2VPWA 4K6MA 1CE8A 1YRQA 2W37A 3F7OA 3SJAA 5D85A 4EGSA 3BXFA 5IPFA 2F4VB 1V1MA 1OFGA 3UMJA 2FPIA 2O8EA 2FPWA 3R5SA 3ZVLA 1KQGA 2ID9A 5P8WA 4DV1B 4RTQA 4KQ1A 4EW1A 3NHUA 4R1MA 1VIMA 4NBWA 4WI1A 1QBKC 1ZYUA 1C0IA 3D1LA 1UAGA 2JCGA 3AV3A 1CZRA 1A9RA 4UU0A 4EG7A 5BNIA 5JJCA 5C5EA 3EPPA 3FSGA 2CNWA 4UPEA 3HWX1 3H2GA 1I36A 1LSOA 1ZD3A 4XYEA 4B3JA 4IOMA 4FLEA 1T8RA 3MWDA 4XJSA 4ZT5A 1IIBA 4CLDA 1VSUA 3SQLA 4A2CA 5AJVB 3VC1A 3NWBA 1UQUA 5AVOA 3K1TA 3LPDA 4XJVA 4JJ7A 1E64A 3LP8A 3N3AC 4KMRA 4XGQA 5A62A 1IK4A 2ZPUA 1NXPA 4YK7A 2Y68A 3HUDA 1BVRA 1T36A 2H0QA 3GP3A 4DQKA 1UBMS 1FU7A 1NI4A 3AETB 2P91A 5JDCC 3KRTA 1Z2OX 2EX0A 2X0EA 1OXSC 2XITA 4MX8A 4TYPA 4L75A 4CL3A 4IIDA 4D0RA 5L7WA 5EUQB 5THQA 3KQNA 1ULSA 4CEIB 2VDUE 4URXR 3LDAA 3SC2A 1PFYA 4ARZA 4PNEA 4EUSA 3QKTA 4JJIA 5A9SB 3ESZA 1QZUA 1C4WA 4J0HA 4LBVA 2H4WA 3RFXA 1CXZA 2YY7A 3L0SA 1GLNA 1Z34A 4Q4JA 3QY0A 5AI9A 3WSWA 4XM2A 3ZWOA 2OQRA 3E7FA 3OD1A 3P9PA 4JASB 4IWXA 1Z7WA 2P2LA 3IP3A 4G5SA 3K73O 1TL7C 1ZZEA 2R8ZA 3E3OA 2J3EA 5HKOA 4WINA 3K4HA 5DM0A 1KAQA 2PK3A 5ED0A 5EKSA 4P08A 1E6UA 3KWLA 4FCCA 3S2SA 3PXCX 3DSRA 1X14A 3FUTA 1IQ0A 3W90A 3U4QA 1FUKA 2C4VA 4ZJUA 1WVMA 2GCEA 3TTSA 3Q2KA 4K2AA 3RW9A 1H5UA 4BX9A 2XCSB 3DMDA 1ZOLA 2ZG6A 5BN3B 2FMIA 1G8KA 3NV7A 1RJ9A 1LX7A 3VZBA 3B70A 3IXLA 4B31A 4YGYA 1EK5A 4Y9RA 1GNLA 4GXRA 4OA5A 1D1QA 5IBQA 1FDTA 4BNUA 1SNYA 1M72A 3TRJA 4RTSA 2QRVB 3ZQJA 1N1DA 2QLNA 4GVPA 4BAZA 2HTFA 1R0BA 1E89A 4Q66C 1JMYA 1XEFA 1OLOA 1T0JB 3R5TA 1NYQA 5EHQA 4XJXA 2R9VA 4BX3A 5DLPA 1RPAA 2YHUA 2AW3A 3JQ7A 3PPVA 1QE5A 2GB4A 4HAZA 2P9FA 2C2GA 4I4CA 4PICA 3ZV5A 3CMMA 2YNMA 2ONZA 4M2LA 1GZUA 1KP3A 2O2DA 2ZK7A 3CKLA 3ZCXA 4DVGA 5ILGA 2XCTB 3BORA 1XMXA 3DCIA 3FTNA 2JHFA 3CN9A 1L5HB 3BRQA 1EDZA 1TD9A 3HKDB 4KB5A 1FTWA 3C5CA 1BFUA 4MYCA 1RQNA 2QMEA 2RKOA 4XDZA 3TK1A 3JR7A 5BQFA 5ES4B 2VAVA 4DIDA 1CK4A 4KXXA 1FP4A 1OREA 2BAGA 2MU1A 5MDHA 1MPXA 1YRYE 4CF5A 4Z4CA 1K2VN 3ID6C 4NAVA 4D3SA 5LDDC 3P26A 4DLXA 4GIBA 3I52A 1KU6A 1QC5A 1UZNA 4GZ3A 4U3JB 3GJRA 4MIEA 3HCRA 5F7JA 1IY2A 1Z22A 2V3CC 4B6EA 1PFGA 3ND8A 1OFVA 4AJOA 2H57A 2X9QA 3DL4A 1R8QA 1S5PA 1XCJA 2JNWA 3PHBE 4NFLA 5IRCD 1ZVVA 4PSVA 2W2MA 3H9CA 4G2TA 4TKVB 3REQB 4EUNA 4HGYA 5TS2A 2WP8J 2ZT7A 4UNIA 2P1DA 4TTPA 3SPXA 3V80A 5JZSA 2G5GX 3MPOA 4BLPA 5C4GB 1U3UA 3E82A 2NZ2A 2J31A 1E4EA 1R0CA 2V58A 5EJEA 4EG3A 2BM0A 4U2BA 1ORIA 2R44A 2PXHA 3FIUA 2GX6A 3MD9A 1F2UA 2E4ZA 3P9IA 5LA6B 3ADOA 3LDHA 4NBTA 2NP7A 5EHGA 1N6KA 3NJ4A 3SZRA 2BBWA 3WRVA 1F2DA 1NKSA 4YJDA 4X1IA 1KO4A 4IJWA 4D8TA 1E6MA 2VJKA 4MMXB 4L5IA 5TARA 3RYFB 3GC6A 2OE2A 1FDOA 3NX4A 4IRXA 1F4PA 4X3OA 3PX7A 3I05A 1NFFA 2ZTHA 4OMCA 1XL0A 5DM60 2DOKA 4KI7A 3VU9A 3LX6A 5CIYA 2GWRA 1SVKA 3I9KA 4N82A 3C6QA 3VU3A 1IEWA 3HJGA 3AVXA 4Q6WA 3CT6A 5ARDA 1UJCA 2EVWX 4JP1A 5KWIA 1IXSB 3E1GA 5I9MA 4CCWA 5LM3A 5DH9A 2RGBA 3V8EA 5IZ4A 1XTRA 3BAZA 1U2DA 4H16A 4UFNA 2QD5A 3CBQA 4M0EA 2VOJA 3CSSA 4YMWA 4DDHA 2XECA 3RYIB 1RXUA 3IDAA 4IJ6A 1GO2A 2GLTA 1BMFD 3SF0A 5JVDA 2RHLA 1RIIA 2A33A 1PJBA 3KJZA 3BDIA 3NYQA 4NAHA 4WBNA 2WA2A 2DJIA 5ARCA 4IQGA 4NEGA 3C4JA 1W87A 3O2QB 3IEXA 1W8IA 3X3HA 4BVLA 3IIKA 1NBMD 4PV7A 2QPAA 3FDIA 1CHDA 1PL6A 4P7FA 1LBSA 2O0HA 1SQ6A 4WRRA 3PZBA 2DBVO 3ECSA 4KTVE 1RAIA 4HB4A 4UMVA 5EMHA 4EB8A 1FUUA 2I7XA 2E82A 3RVRA 1MBZA 2ZR0A 4HN2A 4NXMB 3BGVA 1C0EA 1U81A 3W9BA 3HU2A 1N5IA 1LWNA 2FTKE 4F60A 4D0SA 4Z4GA 5HOEA 3R24A 4JB3A 1NW9B 3J81A 3EYAA 3P45A 3U7EB 2PM8A 1EUDB 4TTIA 4YT4A 4TSFD 5J2UF 1FDVA 2P3LA 1KC3A 4GP6A 1XTZA 2WWHA 4OHVA 5D3MB 4OATA 3ZX4A 3UHPA 3HMKA 4QAJA 1SD1A 1PZGA 1ANKA 1GVNB 2O2HA 1VOTA 2I2WA 1OLSB 3BTSA 1EFPA 1ZCBA 2HK9A 2I03A 4RCYA 4E14A 4DUYB 4EEKA 1GUAA 1Z2AA 3C16C 3PTZA 3QFRA 2CLSA 4R31A 3BXGA 3SSAA 4ZEWA 3UA3A 1GNRA 4XGIA 3UW1A 5ICEA 2DTXA 3C1UA 1W2HA 3QENA 5EC8A 3H2YA 3ZE8A 2FFJA 4BQQA 3D5EA 4CG1A 1PE0A 2EJCA 2P9EA 2ONCA 2VJCA 5AVKA 3NGLA 5JG7A 1AGYA 4ZD6A 4OHPA 4EK9A 2CLDX 4MDHA 3SE7A 1DJQA 2BP7A 5KTRA 2EEZA 2EBWA 1C5KA 5DX0A 3VYRB 4ZANA 4GLFA 5KYKA 1LFAA 3H9JA 4PCLA 4BJ3A 3RTGA 1SA0B 5LQRA 1P5ZB 2EFEB 1Y4DE 4ZI7F 2WMDA 3A3PA 1M2OB 2NUAB 3HB1A 3LW8A 3ORRA 3IAEA 2BKEA 5F4ZA 2JKYA 1ZEMA 5DXFA 1O5TA 4OO3A 3AR7A 1KIMA 1WPGA 4HTAA 1FF9A 2GN9A 2F9MA 5D7BA 1DCTA 1U94A 4RLQA 1IDN1 3TGLA 5CT6A 2C9OA 2OHJA 5LWQA 5IAEA 3DKKA 2ZBPA 4MUGA 4ZOCA 3GLGE 5ICSA 2VK4A 4O4LB 3KNZA 4IV5A 2P79A 1T2NA 1Y3AA 2VJMB 3KZMA 3M89A 1TF2A 1QHFA 1QWSA 1N33B 1AGNA 2C0PA 4JOSA 3TM5A 2EFDB 1PGNA 4CIWA 1FTYA 3TE7A 3CZQA 1TMGE 1YFKA 4OXYA 5JIBA 1HNWB 1VJGA 4WXMA 5LYJB 3OH8A 1EWVA 4NNJA 3OE5A 1ZC4A 4ZVQA 4UBLA 4FWIB 3MGCA 1GY8A 2G82A 2I4MA 1MH9A 2P5TB 4MLPA 4WECA 1WXXA 3EIQA 5FR2A 3GUCA 1CUFA 5IYZB 4MUXA 2RH4A 3PF8A 2ZBDA 2Q8PA 3BF7A 4R40A 3VSEA 2JDIA 1B8VA 3HZOA 1VL8A 1LB1B 2JGRA 2QTFA 1U7TA 2FX5A 3LA6A 4RJJA 3TZQA 3GJ4A 2H92A 4UE2A 1GSIA 3VR3A 1A9PA 2QZZA 3SSOA 4CHTA 4X8OA 1TYEB 5TV2A 2BKAA 4DLPA 4WN9B 1QF6A 1BTOA 3C70A 5KNDH 4FT2A 3TPFA 1VXRA 2IHZA 2IZ0A 3GGDA 3LTEA 2ODPA 3MAJA 4IKEA 4AJPA 2O05A 2VT7A 3R44A 2AI2A 4B81A 5JD3A 2Q27A 1DQYA 3H8SA 5JTUA 1ODKA 3DZKA 3WZ2A 1OXXK 1OJ7A 1I14A 1Z6XA 2HF8A 1FDUA 3KPUA 4YP5A 1VLHA 3TSOA 2R8PA 2QP9X 3UAWA 5HQ3A 3CB4A 3E3NA 5KTTA 4CU2A 5D3KA 4WCFB 1WEHA 4BMZA 4HUQA 2DMRA 4GH5A 1QG2A 3UPUA 3R7FA 1G9TA 1OGIA 3I09A 4EA6A 1FTGA 3LT5A 2F55A 2YW9A 4LDPA 4QWMA 4DWJA 2XA2A 3GW8A 4JU9A 2R7AA 2O2SA 4EO7A 4GEGA 1U7PA 1T9GS 2YCLA 3OIFA 3P27A 4HPWA 4O3FA 1WVGA 1BMFA 2AX4A 5IWAB 5FULA 1LS1A 1DX6A 4OCZA 2VHQA 4TN5A 5ISMA 2YQ5A 2Z0MA 4BJHB 2I71A 3DB1A 1PAUA 3OOJA 4HDKB 3H11B 4NZYA 2GN4A 1QK3A 3HO8A 5CP8A 5I7AA 1JWLA 1GVHA 3WZLA 4P0TA 3EZXA 1KO7A 4DMLA 4RH0A 1YAJA 4H2DA 3ZDCA 2FQYA 3IDQA 3D6MA 3L1IA 3S2EA 1DAOA 4TWRA 1C3LA 4UFOA 3C7DB 1GL9B 3BERA 4ZVSA 1E7QA 2XUJA 3EGXA 3ICOA 1PG2A 4Q7JB 2DR2A 3HYSA 5JNTA 3AI3A 3PNOA 1FDWA 3NJRA 4FDUA 1QCCA 3C3DA 3MSXA 3G5AA 4J0KA 1F0KA 1F0NA 4QQKA 4EFNA 3M6WA 1E77A 4B3FX 2M6LA 1RWNA 4G8JA 1NXQA 1PX2A 4X97A 1C50A 4HDOB 4WA7A 4Y0VA 5HZGA 4N65A 1JWAB 2ZI9A 1W73A 2V4MA 4NOJA 3AT1A 2H3HA 4Q9IA 3PKJA 5BR7A 3JTMA 1NUTA 1IN8A 1J09A 3L8HA 3EWAA 2WHPA