1OZGA

The crystal structure of klebsiella pneumoniae acetolactate synthase with enzyme-bound cofactor and with an unusual intermediate
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
549
structure length
549
Chain Sequence
PVRQWAHGADLVVSQLEAQGVRQVFGIPGAKIDKVFDSLLDSSIRIIPVRHEANAAFMAAAVGRITGKAGVALVTSGPGCSNLITGMATANSEGDPVVALGGAVKRADKAKQVHQSMDTVAMFSPVTKYAIEVTAPDALAEVVSNAFRAAEQGRPGSAFVSLPQDVVDGPVSGKVLPASGAPQMGAAPDDAIDQVAKLIAQAKNPIFLLGLMASQPENSKALRRLLETSHIPVTSTYQAAGAVNQDNFSRFAGRVGLFNNQAGDRLLQLADLVICIGYSPVEYEPAMWNSGNATLVHIDVLPAYEERNYTPDVELVGDIAGTLNKLAQNIDHRLVLSPQAAEILRDRQHQRELLDRRGAQLNQFALHPLRIVRAMQDIVNSDVTLTVDMGSFHIWIARYLYTFRARQVMISNGQQTMGVALPWAIGAWLVNPERKVVSVSGDGGFLQSSMELETAVRLKANVLHLIWVDNGYNMVAIQEEKKYQRLSGVEFGPMDFKAYAESFGAKGFAVESAEALEPTLRAAMDVDGPAVVAIPVDYRDNPLLMGQLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords Acetolactate synthase, catabolic
publication title The Crystal Structures of Klebsiella pneumoniae Acetolactate Synthase with Enzyme-bound Cofactor and with an Unusual Intermediate.
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 199
structure length 549
sequence length 549
chains with identical sequence B
ec nomenclature ec 2.2.1.6: Acetolactate synthase.
pdb deposition date 2003-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain
A PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
A PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ozgA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ozgA01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1ozgA02
4O8ZA 1UPBA 4MPPA 3F6EX 1OLSB 2BP7A 4BVFA 4MQ5A 3EY9A 4R8MA 2VJYA 4RMGA 1UM9B 4KXWA 2J9FA 3D4BA 3PKJA 1U5BB 4V1CI 1T9CA 5BWNA 3AHJA 5HGXA 1DJLA 2OD7A 3RIYA 2IHUA 4F56A 2W93A 4K9NA 3M6LA 3D81A 2Q28A 4C7XA 3M49A 2QQFA 3ZGVA 4BVEA 1BFDA 1Z8NA 2BP7B 4L2IA 2FR8C 1Q17A 2H2GA 2WVHA 4TWJA 3EYAA 2J9FB 4BV2A 3IAFA 4JD5A 2EZTA 1U28C 1W88A 2H2IA 4XEUA 2Q5JA 4F4UA 1OZHA 5DEIA 5MF6A 5EXEA 4Y6QA 2R8PA 2R8OA 1L8AA 4IF6A 2DJIA 1WCIA 2Q5QA 5EJMA 1OVMA 4C7BA 1W85A 5I4IA 2H2DA 3GLUA 1MA3A 2JI8A 1V16A 2XT9A 4RMIA 1YHZA 2FWNA 1UMBA 1UMCA 1W88B 5MFZA 4TWIA 1S7GA 1PYDA 4KPUA 2VBIA 5FYQA 3ZGOA 2FRDC 5K2OA 1N0HA 2BFBA 1YBHA 3LQ4A 1UMDA 1OZFA 1OLXA 1TRKA 3AHHA 2A1TR 5I5GA 4HDAA 4KXQA 3GLSA 1NGSA 1WCIB 1NI4A 4JSRA 4Y6OA 3EXG1 1W85B 2H4JA 1YC5A 1V16B 1PTJC 5FEMA 2B4YA 2NYRA 3EXHC 4RJKA 4FEEA 1IK6A 5D7NA 3GLTA 3MOSA 2JI6A 4HD8A 1UMBB 1UMCB 2O1SA 3LQ2A 2OO5C 5ERXA 4JUCA 2H4HA 4QPZA 2OZLA 4KXXA 1POWA 2BFBB 3L84A 1UMDB 1OLXB 2BFCA 3HWWA 3UK1A 5I5EA 1RP7A 4GM0A 4RJIA 1NI4B 3U3DA 1UPCA 1Q6ZA 3ZHTA 4Y6LA 2C3UA 4GG1A 3ZHVA 1V5EA 5MGNA 2VK4A 4KXUA 1DTWA 4QELA 4ZZIA 2BEVA 4BUZA 1ZPDA 4JUBA 2YIDA 2IEAA 2OZLB 2H59A 2YICA 5DGDA 2BFCB 2X7JA 5ERYA 1B0PA 2A1UA 4UTZA 3LPLA 4JUDX 3AHDA 3EXFA 1Q14A 2Q29A 2BFEA 1U31A 2H2FA 4JU8A 3EA4A 3K35A 4GM4A 4JU9A 2PDAA 1O97D 4K9LA 4C78A 5I51A 4GP9A 2G67A 3D7KA 4JT8A 2HJHA 1X80A 5EJ4A 2XTAA 1AY0A 5BWOA 1DTWB 1OZGA 1R9JA 3RIGA 1XLTC 4K9KA 2BEVB 4UTXA 3AI7A 1QPBA 1POXA 4BVBA 1M2JA 3AHCA 1MCZA 5AHKA 3FZNA 1D4OA 4K9MA 1YTLA 1KEKA 4D5EA 3EXFB 5EJ9A 2BFEB 2BEWA 4UTVA 5IMSA 2C3OA 3CLRD 1SZDA 1X80B 4BVGA 4IG9A 5BWLA 2C3PA 4X3PA 2Q27A 3EXEA 1YI0A 4GM1A 5C4IA 4JT9A 4WBXC 3E9YA 1YC2A 4ZP1A 1ICIA 4D5GA 4X3OA 2BEWB 4MPJA 2JGDA 4MZXA 2FSVC 1E3TA 4C7VA 2IHTA 4FEGA 5HJEA 2OORC 1X7YA 2C3YA 2EZ4A 2O1XA 1X7XA 2JIBA 1T9BA 1V5FA 2G28A 3CLUD 3FLMA 3EXEB 1PO7A 4RMJA 2C3MA 3M34A 4UTNA 2JLCA 3RIMA 1T9DA 5K3SA 1V1RA 2VBGA 3AHEA 2Y0PA 3EXHA 2OD2A 1T9AA 1U2GC 2BRUC 4Q9DA 4J1TC 2JGDB 5HYVA 1JSCA 3ZHQA 2C31A 1X7YB 1EFPA 1X7WA 1M2KA 1X7XB 1PNOA 2VK1A 1PNQA 1M2GA 4G1CA 3GLRA 3F6BX 4UU8A 2EZ9A 4UUBA 1UPAA 2G25A 1M2NA 3CLTD 3EXIA 2BFFA 5EJ6A 3PKIA 1OLUA 2WVAA 1V1RB 2PGNA 3EXHB 4UUAA 5DGTA 2Q5OA 1PVDA 1U2DC 3AHFA 4IAOA 5EJ7A 4K9PA 3ZHUA 1X7WB 1V1MA 3PDHA 3AHIA 1J8FA 1YHYA 2VBFA 2R5NA 1GPUA 4UTRA 3DVAA 2Q5LA 2UZ1A 1TKCA 3U31A 3CLSD 4BV3A 3EXIB 1QS0A 2BFFB 3ZG6A 4KGDA 4COKA 3ZHSA 5HHTA 1OLUB 5EXDA 1HZZC 1EFVA 1SZCA 5MFPA 4K9OA 4RJJA 1S5PA 2JI7A 3JR3A 2EZUA 1V11A 4JUFA 4K9QA 5K6RA 1V1MB 1YI1A 1PT9A 2AG1A 2WVGA 5EJ8A 5EJAA 2H4FA 3KOMA 4BN5A 3DVAB 3FSJX 2JLAA 2UZ1B 1ITZA 2BFDA 1O96B 4KXVA 3CF4G 1QS0B 1V5GA 4BVHA 3UPTA 1M2HA 1X7ZA 5ESDA 3OE1A 4BN4A 2FN3A 2BEUA 4L3OA 1V11B 4FZ3A 3DUFA 2H2HA 2NXWA 2QTAA 4JUAA 2VK8A 4V1CA 2QTCA 5EJ5A 2EZ8A 2PANA 4I5IA 3HYLA 2BFDB 2XT6A 3DV0A 4GPEA 2AG0A 1YD7A 1PI3A 3AHGA 1NM5C 4J16C 2UZAA 3OOYA 2V3WA 1QGDA 1X7ZB 3ZHRA 1YNOA 1OLSA 1Y9DA 1Q1AA 2BEUB 2QQGA 2JI9A 3M7IA 3DUFB 1TKBA 1UM9A 2PGOA 4MPRA 2C42A 4RMHA 2OD9A 1U5BA 4UU7A 4V1CB 5K6TA 3LQ1A 3HWX1 1TKAA 4FVTA 3EXG2 3IAEA 2E6KA 3DV0B 4KXYA 4QQ8A 3JWPA 2IHVA
chains in the Genus database with same CATH superfamily
3CWZA 4ZZ2A 4ZEXA 4ECAA 2BRUA 3HVUA 1PUJA 2PU7A 3PWTA 5CLLA 2O50A 1NKVA 5EZ6B 2PJDA 1KWGA 4MZDA 2C7RA 4NJOA 4HEJA 5G0WA 3FYHA 1G2IA 4JI3B 3QEBZ 5CB4B 4GVPA 4OIMA 1C0PA 5CPFA 3WWYA 2CFRA 2N1BA 2OG1A 3CONA 3ETLA 4WCFB 3RT9A 1AKEA 1AUOA 1TM1E 4PR3A 1F5SA 2W4MA 3C24A 3OX3A 4GLBA 1HSZA 3GDFA 3TDKA 1I33A 2YJZA 3CNLA 3HB9A 4IKPA 4R6WA 3T41A 1FBTA 4NE7A 3RAJA 3V1LA 4V1CI 3F49S 5ENDA 1OAAA 2FPUA 2J8ZA 5EWJA 2VCEA 3NT2A 3D8TA 1YZHA 3JRWA 4LDQA 4AJLA 2PXCA 4F56A 4OK5A 3S1LA 3ZK9A 5BSVA 3QPVA 1RZVA 4OBXA 2REBA 1YAJA 3LP8A 3AR5A 4OB7A 3D81A 4C7KA 1GYPA 2E5LB 5B1EA 4KR6A 2EYQA 3HR4A 1EVKA 3MT0A 3QG5A 4CM1A 1NXTA 2QV7A 4IS2A 5JNTA 5DHRA 3B89A 4NESA 5DM1A 3CW9A 3O8CA 1Z8NA 3N0WA 3O3MB 5B3JA 4ENTA 5KOJA 4F9EA 4LOHA 2BP7B 3IP8A 2BC9A 4NBSA 4W5TA 1JIXA 3A0UA 2IW1A 2VPXA 2AZXA 2O8BA 1HL3A 2H7VA 4H6WA 4UFOA 1AGRA 3C3BA 1NRIA 1GFSA 1G41A 1KFCB 1ZU5A 2AJDA 1WVGA 2DHRA 2H57A 3KYCB 3N6RA 4INJA 5I9TA 3TBHA 5AVKA 4YAIA 3A6PC 1F0KA 3I4FA 4IM7A 4DBLE 2C7BA 1ODIA 1VHJA 2XWJI 2GR9A 5IDWA 3W05A 4HAVA 1IIBA 2ZI3A 2VJPA 2ID7A 2WA2A 4JAVC 1GNPA 3RI3A 4AF7A 1PR3A 1FDUA 1OYYA 2QDKA 1XTTA 2BGLA 4M22A 3GZTB 3K5IA 4EEKA 4IRUB 1B7GO 2QHXA 5DX8A 4BS9A 1TTHA 5TV2A 3CZMA 5AW9A 3THSA 3RRMA 2C54A 5HOEA 4S1PA 3CW8X 2FR8A 4GZ6A 2FDCA 1RQLA 3ETNA 4AZ0B 2H2AA 3E5RA 3HUDA 3M3DA 2BKEA 1L8AA 1KK0A 3IERA 1CQXA 3O2QB 3VM6A 5FWXB 3L41A 1SXJD 3AJDA 1JRLA 5BUZA 2NPIA 4MUJA 1TEHA 1U28A 4Y2SA 5AKJA 1EFDN 2XT9A 4Q47A 2MU1A 1O58A 4QECA 1ZQ9A 4OMUA 4RY2A 3I37X 3QPWA 1A8QA 4EQ6A 4D4HA 5EGSA 4NJEB 1BD4A 4LTDA 1J0BA 1L4BA 3RHSA 2KI5A 4E88A 4WBSA 2Q6KA 3RSHA 2I80A 4WERA 3T8YA 3VH4A 1HQKA 1OXKB 1W88B 1ZJ4A 3LY8A 3NW9A 4N5NA 1UBNA 3G7NA 1IPFA 2O4CA 4TWIA 5SZHB 3ZS9A 4U1RA 4ZCTA 4D0SA 4GKJB 1FU7A 1E7SA 4N48A 3Q5GA 5KC9A 2ZROA 1HI9A 3Q40A 1TLLA 1NNEA 4P0QB 2Z1NA 4A16A 1Z6AA 1HE5A 1JFRA 1ZZEA 2QLMA 3N2YA 3NQ41 1DARA 2BVNA 2VL7A 3JD0A 4LZLA 4TROA 4DNQA 4RKRA 1OZFA 1NBWB 2B7BA 3IQGX 4FILA 4DCPA 2NG1A 2XGSA 5L95A 4RFLA 3LO8A 3ZDZB 2CFTA 1WCIB 4HTAA 2BFPA 4JSRA 1MB0A 1OKKD 2P4QA 2XEXA 4Y6OA 1XI2A 5DHTA 5E38A 4BB5A 4B3TB 1OQAA 5AI5A 3GPLA 1T26A 4RZQA 1TMOA 1C9DB 5FEMA 1YMQA 4YYEA 5FUQA 1DBRA 3TIIA 3TRDA 1CUGA 2WIAA 4H3SA 4XLTA 2W2OA 1ZN7A 5DOZA 4FQ7A 4E14A 1Z34A 4UNQA 5AFSA 1I7DA 3UJ8A 4O2BA 4RVSA 5EHIA 1IEVA 1RJFA 1HZJA 1UEXC 2QQ0A 3GAFA 3VV2A 1AZLA 1OGYA 4F11A 5IRCD 1US8B 3QGMA 4OTZA 4Q4HB 4B3GA 2X77A 1J25A 2B25A 2FMFA 4IGIA 1CQIA 5ITZB 1YZTA 3G3EA 1POWA 2BHTA 1L7MA 1HYEA 4CLHA 4CGYA 3VI3B 2NUTB 2HV8A 3JWIA 4B4DA 3VNAA 1ZA2A 3PWKA 4D25A 3P2OA 2Q50A 4AL4A 1SC3A 4FUTA 5AVOA 3VJKA 4UHEA 4QUIA 4D45A 3ODPA 1SQ5A 1VYVA 2CT8A 4G0VA 3BF7A 3EOZA 1SIWA 2Y1XA 4IJKA 1GU7A 5H59A 4NIMA 3DMFA 4KQ2A 1FXUA 1KU6A 4CMIB 2B3TA 2YZMA 3L6UA 2IE8A 5E3JA 1D0IA 4O0MA 4EZIA 1E63A 4NVRA 3PNYA 4KDRA 1AQJA 4MCAA 4OQZA 3Q1KA 1PS8A 4AZTA 3L7NA 4CV3A 2IX9A 4QELA 4KYUA 4BUZA 3TLKA 4HVTA 3G2PA 2H1CA 3QVOA 4F1KA 2D8MA 3E9EA 4DHEA 3T1YB 2PRKA 1NF8A 1TQ2A 4LOLA 3W04A 2RK3A 2A0UA 3U7QA 1L5KA 5B3AA 4DVGA 2BI8A 3E9QA 1OIWA 2FXIA 4MMYB 1L7VC 2CMKA 4HLDA 1TJNA 4HNUA 1G8JA 4B3IA 4BMVA 2V7QD 2RIRA 1WBJB 3MGKA 3GJQA 2Q2OA 4G5GA 1RSZA 2V7PA 3PPXA 5CT5A 4EVIA 3FYUC 3FOAA 4NHOA 5BN3B 2FQXA 4IDAA 3RC2A 1E1QA 1F6WA 4M0MA 1M3SA 1AZTA 1MU0A 4UD2A 3WL6A 5L3VA 5HX7A 5LP6A 2A92A 4L9WA 4UUOA 3PEVA 2JFXA 4H08A 1TTPB 1UP6A 2YVAA 5CH8A 4DV1B 3OUZA 3PP8A 1J42A 1ESZA 1H2WA 1LK5A 5JO0A 1QC5B 1HUQA 1PQWA 4B09A 1LSJA 1T3ZA 2BEVB 2JPDA 4BGIA 2A33A 5AJHA 1DMRA 3N0RA 2BT4A 4YV0A 3KQVA 1B0AA 4OV6B 4F91B 1NQOA 5K0CA 2RE8A 3G59A 1DPFA 3NYRA 5AI9A 4QO8A 4EHNA 5JLAA 2B1RA 4JBNA 4E2XA 3TG8A 2XCRB 1DRWA 1U04A 1QHGA 1T3LA 1CZNA 1XZHA 2JIZD 4K9MA 4M8NE 3HXKA 3N5CA 2I4TA 1DKLA 3NU1A 3EGDB 1SB8A 3QPAA 5HKKD 1ZJZA 4KSBA 2FPSA 5FA5A 4YMSA 3ROMA 1KZYC 3FTNA 3ZU5A 3WQRA 4Z51A 4Z3OA 3LC1O 1IHXA 2X5OA 1NRJB 2ORWA 1VPLA 2X0EA 4JLUA 4AP9A 2AR7A 1GLNA 3T54A 1SHJA 4EMUA 1DOZA 1X80B 1GDTA 2IYXA 4GPD1 1OT5A 1J39A 2GHTA 3MC1A 3GA5A 3ROTA 3EZ7A 1DUVG 3KYDA 1HDCA 1GRQA 2FFHA 4QSMA 5DK4A 3ZJ5A 3NIWA 3AOEA 4LNAA 4NCKA 1E4VA 1K3TA 2GJ4A 4YJ3A 5BW6B 3ZDCA 3IESA 5HCUA 3P0FA 5JAZA 1BDJA 4IJQA 2FCRA 4JI2B 3OETA 3FVTA 3MPOA 5IEJA 3F2VA 4HDSB 4XR4A 2BZSA 4Z9YA 4CJXA 2XMCA 3LUPA 5HS4A 2XNDA 4JJZA 3X1JA 4BFWA 1QOQB 2NSYA 2ORYA 1E7WA 4DREA 1ZVQA 4P82A 3ER8A 2RJ3A 3AFOA 2EX1A 1UCFA 1A7JA 4MZXA 2V96A 4TTTS 1QO0A 2R5FA 1X7YA 3QVXA 4DFDA 1VJ0A 2X6RA 1J8YF 2JIOA 2XB6A 5HPYB 1WB6A 3QLTA 5BNZA 5JC8A 2Q4TA 1KSHA 1I13A 3AEUB 1IN5A 3I45A 3HBLA 5EZQA 3CH7A 3SHOA 3ZQ4A 4F4IA 5KMGB 3JALB 4CDGA 3EAQA 5H80A 2JG3A 3ET5A 1JI0A 5AW2A 2ZIEA 1WRBA 2FPLA 5C8XA 3QU9A 4IP0A 5JD6A 1XZ8A 3CM0A 3D7NA 4KWCA 4X00A 3EDCA 4Y8VA 3V4SA 1Z4MA 4NOMA 1L6IA 2C3MA 3QWHA 1LNSA 4OJQA 3LBFA 1RRGA 2C5EA 1KS9A 1PGJA 2JFYA 2ZE6A 1H2EA 2C1ZA 3HFRA 3HNOA 3LQYA 4PCUA 2WQ7A 4URFA 5INTA 4X0EA 1ZCBA 4ZRNA 2VBGA 1LDMA 1YS6A 2A5JA 1QCYA 1DJOA 3I5MA 4E08A 2WTEA 1T2NA 2BRUC 4ROTA 4MHOA 2ZIVB 1UJ4A 1JSCA 1RQ7A 4C7OB 2IWHA 3AR8A 3VUFA 1RRPA 1A7UA 3PUZA 2NACA 1HKUA 1S0UA 4Q3OA 1KRXA 1HMPA 1PNOA 2AJLI 4DAEA 721PA 4UASA 5MN6A 5JMPA 1M2GA 1XCOA 2WHEA 3QKRA 1T3SA 4JLOA 4XCVA 5GWXA 5HRCA 4UCQA 4A10A 3ZJVA 1N9GA 2YCLA 3N9IA 2FHPA 3B6IA 4YBZA 3OFVA 6CHYA 1QRUA 4HLUA 1G0OA 5EHGA 3ND7A 2IY8A 2XE4A 4QEKA 4BXOA 1HE8B 1UKVY 4AMZA 2CNDA 3E2IA 5HZHA 1QZXA 3GLFB 4I1PA 1BEEA 3VOAA 4M7RA 3LA6A 3AM1A 4L08A 1JR2A 2BV3A 4N5LA 4XIJA 1E9VA 2OCAA 1WQ4A 3I76A 4PPNA 2IBTA 4TVSA 1EEHA 3T3MB 4RSGA 4ER6A 4XJSA 2QN7A 3R76A 4P93A 4UUAA 3AY7A 4DUPA 5DGTA 2H52A 3F5DA 4HGNA 4MKGA 4Z86A 5AVJA 3SYMA 3VHLB 5ITVA 1HT2E 1U2DC 3SEFA 1JHDA 4WBNA 1JYSA 2CDNA 3NOQA 4NCHA 3O2SB 3SVZA 3QBTA 3AR7A 3DT9A 3F74A 1ORVA 1ADCA 2IYPA 2AG5A 2QSUA 5COAA 1L4HA 2V8OA 5G40A 3KYJB 3ON5A 1QYIA 3RVQA 1O0BA 1BVUA 5JAIA 2XQJA 2VBFA 4LX8A 3ULKA 2H85A 5JS1A 1DAEA 4WZBB 2R6DA 4ZC8A 4CI9A 2ZJ2A 4JZYA 1A5TA 3ODGA 3BN3A 5IAOA 2COEA 4O8CA 4U39A 1YKGA 5HIIA 1IVSA 4NFLA 3QQPA 4YASA 1CD5A 2ODTX 5JAUA 1M54A 1O96A 3C97A 2OHGA 4NBTA 1NF3A 2DHDA 3WL7A 3EFHA 4ZYXA 5JWHA 1R5NA 3SC3A 4RQUA 3TRIA 5AUOB 4M99A 4AKSA 4M9QA 1G20E 1AQUA 4F93B 1EP1B 4O2AB 4ILKA 1BN7A 2VF4X 2IXAA 1WP9A 4HXGA 4XTCS 2OB2A 3D5EA 4V0MA 5AOBA 5JAQA 1J99A 4P22A 5BWMA 4A73A 3PFKA 5TS3A 3HE3A 3GCXA 5ELMA 3QUTA 3X2FA 1EKXA 2I99A 4ALJA 3EHDA 3CLKA 2OB1A 1ELOA 3MFQA 1V48A 4XFDA 4PHHA 2W4QA 4DV4B 2BKUA 2D8AA 1G18A 3TNJA 1J06A 3QMPA 2EEPA 2BZ0A 1JQ5A 2YOGA 4HVAA 2ZUWA 5HDBB 1BKYA 4EX6A 2EQAA 3BKWA 4XCQA 2FTKE 1ZD3A 3QFSA 3SFZA 1O9HA 3BEDA 4AJOA 1SQ6A 1ZLYA 2WTAA 1H2FA 1AUXA 1HTTA 1TM3E 2H1FA 2CJXA 2HA2A 3Q8WA 4IRMA 2P2YA 4AIRA 4D02A 2WZBA 1E3EA 4YJDA 4DQUA 4BN4A 5CGZA 4WY5A 3PKZA 3PUXA 2WPDD 4HI0E 3C15C 4PS1A 4Q15A 2ZWAA 1TCCA 1NWCA 4GNKA 3IEIA 3MD0A 4N8EA 5CT8A 1P73A 1EXWA 5DU2A 4CM4A 3UJCA 4Z8XA 5BUSA 1JDVA 3FR8A 1AKQA 5AKZA 4NABA 2D6FA 3I23A 3TW8A 4C6SA 3R44A 3AUAA 2IA5A 4E2FA 5GJWC 1HG0A 2OCPA 3VU8A 4RTSA 3V9PA 2B92A 3PUIA 1EK2A 1DIHA 2VOJA 3ANLA 5FEUA 3OF2A 4DXAA 1K06A 1ZISA 3LC0A 4JLAA 2Q3MA 2PNFA 3EUAA 4TS1A 4DHWA 4JSYA 4NCBA 4EMBA 1DX4A 5DP1A 1BXRA 3LSYA 4AURA 2YMLA 3K8YA 4BEWA 2PL9A 3VX4A 4PZYA 1ZYUA 3FMPB 3MSXA 3E2MA 2E89A 4U5XA 3K9WA 2XYGA 3GW8A 4PSKA 5CB4A 3ZWWA 2FPIB 4V0KA 4POOA 2CMHA 3ELWA 2CKMA 2XYRA 1GNVA 1MV8A 2AOVA 2HSGA 1VGRA 2FQWA 2YZNA 3MRSA 4WCFA 4TN5A 5LQUA 3DUFB 1SEVA 1RM4A 2O3JA 4RMHA 1W4BA 4B2PA 1NLFA 3P9IA 3MJTA 2K4MA 3T38A 3IOYA 4G8DA 5IKXA 2P8JA 3F4LA 4RFSB 2J6HA 3OMXA 3PT9A 2A2ZA 4M21A 4ZI7B 1F8XA 2H4YA 1CNMA 2DAPA 2P2DA 2CL7X 4C4ZA 3LQ1A 3WR5A 3RC8A 3GVIA 3BXEA 2WYUA 2P9QA 3MOIA 3SC6A 3MGCA 4BFTA 4C0WA 2YZKA 4ZCPA 2OA0A 4HX9A 4O3MA 1ZVMA 5FJJA 3ZJ4A 4GOKA 2C59A 3PFNA 2J1LA 3KQUA 3IB3A 3B1WA 1B0UA 2PJUA 4QRIA 2QGNA 2XGGA 5B1SA 5AVWA 4D6XA 3CYFA 3ZHOA 1L5RA 3NP7A 3EUEA 1OB2A 3K70D 4FNMA 1EG7A 2BP7A 4ODIA 4X1IB 3OF5A 3S7ZA 1Z12A 4YRMA 1JEOA 1FEZA 2QD2A 4FN5A 5LJIA 5DV9A 2P4UA 4JB8A 1XE3A 5K3AA 1JDJA 1KJWA 3AG6A 3KYCA 4DSTA 3OIDA 5ER6A 3NBKA 2UZ4A 4LOAA 4B6SA 5IN4A 5KSPA 4PEVA 5BWNA 2VRWA 1XCBA 4IWXA 4FM9A 1UBLS 1EVLA 4JJ6A 2GD6A 2YMPA 4I9HA 1YJ5A 2W0MA 4QQFA 5LP6C 5K8TA 3ZGYA 5REQB 2QTTA 5KNLA 5ED0A 2QMOA 5E1MA 2W93A 3BOSA 3H2IA 2HRBA 4HK4A 4KO8A 3TTXA 3ZD9A 1BDHA 3PRYA 4AZ0A 1EXVA 2PAFA 1UBCA 4GOND 4ADSG 1ZY2A 2GCNA 3CLTC 4F4FA 1UKZA 1KGDA 2PT7A 3FTCA 1Q12A 1DFGA 3G7SA 3P97A 2X5KO 1Y5RA 3JQQA 1QH9A 3HDJA 3ZZUA 4BC1A 3ZDXB 5CB0A 4A1OA 4HJRA 3UC5A 5FORA 2OPHA 1V2GA 1Q17A 4W5QA 1MNAA 1Q2XA 3DZJA 2NZWA 3P9XA 3OZFA 2EFEB 3R1IA 1RM3A 3MQFA 3PXXA 3S8YA 1H2HA 4NJEA 4B4OA 4GOJA 3IE2A 3HKBB 5T5QA 1Y5MA 2PKQO 4WX2B 2VCYA 2ZULA 1W88A 2VOEA 1HM5A 3NH6A 4Y1FA 5D1HA 3VUEA 4UARA 1XRNA 4NKRA 1C3EA 3C74A 4YP6A 4KVAA 2EGGA 1L5LA 3DLBA 3CZ5A 3L6BA 4YRGA 1T8SA 1LNQA 4BNJA 1WL8A 3URKA 5SV2A 2ABWA 3OTWA 1M7GA 3WBJA 3H2HA 3BCRA 3D8BA 1A9OA 2R8XA 3JYHA 4ZRMA 1WCIA 3AOEC 2LXNA 2JI4A 2XGOA 3AH8A 3C5VA 3L8CA 4NSNA 1BWQA 1NBIA 3H2ZA 4L2IB 5IZCA 1I6LA 3FVVA 4QBTA 5ECYA 2B2CA 4DSNA 1PL7A 3UCFA 2N3ZA 3KD3A 3TW4A 2RCNA 1WULS 3M9XA 1UWLA 4CMEC 1NN5A 4KIUA 4PQRA 3BE5A 3A2KA 3O3OB 3KKQA 1GZ5A 1D9ZA 2Y68A 1CUCA 3OPVA 4EMTA 2JVJA 4N3BA 2IYNA 4FCWA 4JJ8A 4RVNA 5K51A 2VRBA 1US8A 2BMAA 4Q4HA 3GDHA 3LNTA 4MWEA 3GJTA 4WEOA 1ZAKA 4W5HA 4CQNA 2DY1A 4HAOA 2MSEB 3O8DA 4XARA 5ITZA 4UE2A 1ZHHA 2FN4A 2P65A 1QP4A 5H8WA 2VEDA 3FPGA 2SKCA 3IJRA 3SE0A 1TX4B 4EY8A 1L7QA 4Z4GA 2NUTA 2UYHA 4MAMA 3OZRA 5I5GA 5JADA 2QTBA 3GLSA 1FFGA 4MR9B 4BKOA 3BXZA 2ZPUA 2FEAA 1EINA 3QJGA 4Y30A 4AJPA 4RCYA 4FDUA 1EUZA 4YACA 4RHYA 5AJUA 2VJDA 5I3ZA 3ZIAD 3ZW9A 1JA9A 1Z0DA 2OXTA 2AT1A 3UPUA 3L2OB 2ONCA 4MP6A 4MJ3A 4CMIA 3AEQB 4WAUA 3ZWKA 1B8UA 2WWYA 1CJCA 5L7YA 2QNIA 1CB7A 2W11A 3OP1A 3SN6A 2FG7C 2HJ9A 5LB2A 4QVIA 2QVGA 3GDOA 1ZL0A 2AZTA 3CNEA 3KZCA 2WAMA 2P91A 3RHTA 3VPCA 3HM9A 2ZBPA 1Z3IX 1TTQB 2O1SA 1SD5A 3A4TA 3C98A 3LS2A 4EYKA 5KNDD 1W36D 1YU6A 2CCKA 3EASA 3I6YA 3ZHXA 4AYXA 1JILA 2BMJA 5CIQA 2JB9A 2LCFA 1BDBA 1BX3A 2GYUA 4A5SA 2GLUA 3WSVA 1LLUA 3DHNA 4NYIQ 3PC2A 1LK0A 1FSZA 5G2OA 2OXIA 1RQPA 4W8OA 4RH0A 3AVUA 1ZNZA 4XIFA 3E1GA 2O57A 1HMYA 3EPRA 1CPYA 3I62A 4EFDA 1XZKA 3OOWA 4F2GA 3UK1A 3C7KA 3KC2A 1ZDMA 3INGA 4HLUC 5M2QA 3RCBA 3OQ6A 4JBLA 3FN4A 3U3DA 1VIMA 1DHRA 1TGYA 1WCXA 5ER9A 2ZYSA 1U4OA 3WLRA 1JDUA 4MGEA 4CE6A 5CBPA 1EX1A 4A0QA 3NBQA 1OGIA 1E6LA 1RE0A 2XWQA 1P1KA 2JF0A 2MSNA 2X8AA 5BN3A 1FK8A 3TD9A 2JGJA 3AO0B 4MKRA 2B4QA 1NXPA 1CR0A 4GXRA 1KI1A 4MVJH 4WXYB 3C2QA 2B34A 3MMPA 4MQBA 2VSFA 5T4FA 3WZLA 1N6IA 1EFKA 3AP3A 1EA5A 4PSCA 2VDMB 3WYGA 3FWZA 4K2AA 4LN1A 4E5DA 3PG5A 1QC5A 2CW5A 4ZA2A 2BSAA 1MOZA 2BEVA 3MCAA 4TM8A 1Y82A 1ZD4A 2L18A 3NT5A 4PGAA 4RC9A 4BWFB 3R3JA 3FDJA 2WUDA 3GC6A 2HMYB 1CIJA 2ZDHA 4M8LA 2AZ4A 3ESRA 5JW6A 1W1IA 3O8QB 4FMPA 3L3BA 4QE3A 2DOKA 1EGVB 3F9IA 3W7BA 4ED9A 2EWMA 2VJBA 1T8RA 1HDOA 4JUDX 4TWRA 3JAKB 1YQXA 1ODJA 2ZAGA 2GJ9A 3R7WB 4DRYA 3C5WP 1PRYA 2Q1XA 2H2FA 3BB1A 4Y6RA 2GN6A 2PR2A 3EA4A 3B70A 1RM5A 3EGDA 4H60A 1TECE 3NVAA 4LK2A 5AM0A 4DTIA 4EHAA 4R3WA 3QENA 4I2NA 1SUDA 3VR4A 1MABB 4GP9A 3RRZA 1NWHA 5KX5F 4DNOA 1ZGJA 1I3CA 2IP2A 4XUGB 1U7ZA 3D02A 1LVUA 3GEIA 4II2A 1XR3A 4ENQA 4UHKA 1X80A 1Z8DA 1JG4A 2YIJA 3AC0A 2I71A 3JQ6A 3WQBA 4W5WA 3T9CA 1C4OA 3VXKA 3RUHA 1G19A 4K9KA 1NBMA 3DAHA 1YR9A 3DBIA 3TBFA 1F2UB 4XYGA 1JQEA 1S3GA 3MWGA 3PC3A 2OK7A 1PQPA 3LBYA 3UG7A 2J45A 1PT5A 4KOEC 1LWNA 3TM4A 3V1KA 3MILA 2VRCA 1CWUA 2J67A 3AHCA 1MCZA 1IEXA 3CKKA 1L7AA 5DNAA 4Q00A 4D9JA 1PWXA 3K73O 4HDSA 4NK4A 1J2RA 1N6NA 3G17A 4FHCA 3DULA 3N8GA 1Y7PA 3GD5A 1ILEA 3VH3A 3UWSA 2D4HA 3CEPB 4CF6A 1D6NA 1WXEA 1KHHA 5J59A 4Q7EA 2FUKA 2QPOA 3TLJA 3VR0A 5AVRA 5AOAA 3KXIA 1QGYA 3B1YA 1XDUA 2QUBA 3EPJA 3IKJA 1HR0B 5G3YA 5BV8A 3GG9A 3WGOA 4YMTA 1M8PA 2R44A 4UEKA 3FZYA 4DLAA 5F4BA 4WY2A 2O2IA 2HHHB 1CF9A 4ALLA 4TZTA 3JSXA 1ZN2A 4RH1A 5IF3A 4RSMA 1CJMA 3SZRA 4UXJA 4ABTA 1GPNA 1YVRA 3AEUA 1JL3A 1NVTA 4IG9A 5FPPA 3LU1A 1AQIA 3JALA 3P0RA 3D7LA 4FI3C 1JF8A 3V4FA 3W06A 2JLSA 1RYZA 2GLTA 1ORDA 4KXMA 4YECA 4PLWA 3T3PB 4B82A 4GPAA 4LGMA 5K0GA 3PL1A 3HDQA 1F0PA 4WBXC 5EKXA 1WLYA 2NXNA 3FWHA 4E32A 2GBLC 4CM3A 2PUVA 2JJMA 1DQPA 4E09A 1E99A 4G2NA 4GF5A 1DJMA 4TRRA 5EMHA 4LPSA 3I9MA 4NXMB 1JXMA 4NFHA 4RVDA 3ZHYA 1OFUX 4BIIA 3EGEA 1G5RA 1B8VA 2XD4A 1DIBA 5H68A 4FFRA 2JIMA 3LRPA 4BV9A 1JKIA 2P90A 3M6MD 3VH1A 5KPDA 4C7OA 3U19A 1HBJA 2IHTA 3EGXB 4FYPA 2Y1DA 2X42A 1ECCA 3BPSA 1UL1X 2P2GA 1GEEA 2AN5A 1P2TA 3S1AB 1CY7A 2GN4A 3ZQ6A 4PE5B 3SS7X 3LXMA 2XW6A 4JLSA 3QXGA 1QRRA 4QBGB 2ZYWX 2KHZA 2RHBA 4JLVA 1RPJA 1XTUA 3PHIA 4N54A 5LP6B 3EVBA 1HT1E 4P7GA 4PRLA 3UOGA 4EBFA 1R6VA 3GLFA 5CM8B 4BQIA 1ZK2A 2V97A 1SCIA 2TYSB 5KKAA 3PIIA 2I1LA 2EBFX 3M34A 3QI7A 1MJGM 3Q72A 4J90A 1TQ8A 4N39A 3ESCA 4NZMA 4LDNA 4BDSA 1A2QA 3KZKA 4YRRA 1CNEA 3BXHA 2CCJA 3JYPA 3B6ZA 2R85A 1N2JA 1EDEA 1U2GC 1NAIA 1NNI1 3CW2A 3EZFA 4RD4A 4NI5A 1OH8A 2I22A 4HWTA 1E2BA 3PQCA 2BGKA 2YS6A 4BBAA 1V95A 5TNXA 2DQKA 5IH3A 3D6JA 5AO9A 2RH4A 3G2KA 4QJ5A 4B87A 3PHGA 3IV9A 5K9ZA 3N3BC 2ZFUA 1TUBB 3W5JA 2HN9A 4F9FA 4DR2B 2E5WA 4WNYA 1H4TA 4YIHA 3CF4A 1I30A 4WZBA 4B40A 2ZE7A 5CURA 1QFXA 2R00C 1QORA 1XMJA 3JU3A 3WVNA 4YAOA 4BIMA 4WUTA 3W5UA 4GI7A 4KC0A 1SBHA 5BNIA 2BFAA 1KPHA 2FKNA 4G1UC 2QE7A 1I0IA 3UJ9A 3QHPA 4UW9A 1W5FA 5LQSA 1N2EA 3L8GA 4BO2A 3EPLA 1L4FA 4O2AA 4RNCA 3O83A 4J1SA 4V24A 1B8NA 1YFZA 3H1GA 3VAZA 4QYMA 3WSWA 5KNBD 3JAMA 4PLHA 4IVRA 2O3UA 4AMGA 3E8XA 3WOHA 1HQDA 2HQ1A 3CZQA 3ZCTA 4EECA 2QOEA 2D62A 5F7ZA 3AOGA 4C08A 4JXJA 1UANA 1FJHA 1RS0A 2P5YA 1YHYA 3FZEA 5I9NA 2I1VB 1BE1A 1UKEA 1G64A 3DAGA 1AVTA 4UFNA 2C5LA 2O59A 1Q0QA 2OWDA 2R5NA 2ZE5A 4PG5A 2PJRA 4LF6B 3A1TA 1D2RA 3ACCA 3D6HA 5HZGA 3F3SA 1FYDA 3N2ZB 4G85A 2OHIA 4JGIA 4AI6A 4RH3A 5FWYB 1AO0A 4XWGA 3DT8A 2BFFB 4NCIA 4WN9B 2VYFA 1Z73A 3BMXA 3CSUA 1VBKA 3KT8A 2A0WA 1YACA 4KI0A 4BB6A 4B81A 4WGGA 2B5WA 2P27A 4WEQA 4XRRA 5A4KA 1XTRA 4IHQA 1S5PA 3PWZA 2BDTA 2IGTA 3GJRA 3UA3A 1WKBA 4K0KB 4MVXA 4BTVA 2DXIA 4ZEOA 1JG1A 1Q0UA 1QZZA 4CTJA 4D5EA 5AXDA 2EKQA 2P78A 4RK4A 3E9RA 3ZWNA 2PCLA 1OFVA 1S96A 1LH0A 1Y8RB 3U9SA 4DEYA 1EMDA 3SM9A 7YASA 4OXRA 4OPMA 4DLSA 1KMQA 3A11A 4OFXA 3TVTA 4TSRA 4RBNA 1JX6A 3TOCA 3LY7A 4ND4A 2I4MA 3PTAA 2R97A 3AM4A 4K9SA 2EVWX 2IYZA 2W6ZA 3BIFA 1V4NA 1TLTA 1UOPA 3LRXA 3DAOA 1MTOA 3SXUB 4DCUA 3G0DA 4UUQA 3JQBC 3JRNA 3OEWA 4JN6B 2C4WA 4JYMA 3LT4A 3VO2A 1V5WA 4TMYA 4R1NA 3OPNA 3TTVA 5LOVB 3UMYA 5CXXA 2FPIA 1GA4A 5DI9A 1NUUA 3FPHA 3GCDA 3A6HA 2HF8A 4R31A 1EJ0A 2C0QA 3SX2A 4GYKA 2H9AA 1P2UA 2DWUA 2BM8A 2K2QB 1PJQA 3DUFA 5IC6A 3NV7A 1B6RA 2Q4OA 4X6YA 3E1KA 2WQZA 4NCAA 4RFSA 4HQKA 3PXGA 3O8RA 4QVGA 3HN6A 4ZI7A 3F8TA 4PAGA 1J24A 4R16A 4FGUA 4AO8A 5HM6A 3LYUA 3UK0A 1O03A 3UMCA 5HKBA 3ZU3A 4DUGD 4O4JF 4XWAA 5A71A 1M7HA 2EZ8A 2AG6A 5HW0A 2Z58A 4PLZA 1XD9A 2W6IA 3WNCA 2FJUA 421PA 2XT6A 3WGYA 2CKDA 1B2LA 1PI3A 2ZUBA 2P5SA 1NG9A 3AHGA 4WESB 1OYOA 3LW7A 1NQXA 4G6ZA 3V4VB 2PRJA 1VKRA 1SCUB 1A5SB 4G8JA 3T5CA 3CNBA 3TZBA 1YHNA 3V7FA 1Z4JA 3T9DA 3KZMA 5IXJA 1SWVA 2P6PA 5FFNA 4F4DA 5KVVA 2A1TS 4X1IA 3HNRA 3A1EA 5DASA 2DUWA 5EY5B 1WZCA 4CR7A 5CT9A 2C2ZA 4NNOA 5DN9A 3QTLA 4CCSA 1N0UA 2JLYA 3K0SA 2AA3A 2DBZA 1IK4A 3ZV3A 1NA5A 2VA8A 2KPOA 2V6JA 3D43A 2QL9A 1SGWA 1AQ6A 3GH3A 3CR7A 3M6XA 1E3MA 1QPGA 3I9V1 3MT9A 4CQMD 1R0CA 4K0RA 1T5OA 1V8OA 1YZKA 1SB9A 3CGWA 4MUKA 5REQA 3X1WA 1MA0A 1WVMA 4QA9A 4TV9A 2WR8A 3IT0A 3LM8A 1FX0B 1G8YA 1DC5A 3I0NA 4AKHA 1EAMA 4LRXA 3TG2A 1YKFA 1IOVA 1E32A 2HYDA 2KQUA 1GPKA 2Q3FA 3GQBB 4J7UA 1RPTA 3PJDA 3KS9A 4X91A 5KC8A 4KE7A 5BMVB 4EI2A 5B6PA 1WPXA 1JQAA 1QRDA 4DC9A 3BFPA 1W0JA 2QYSA 1JMYA 3L6EA 4U02A 3V42A 3U3MA 1ZRSA 3UNXA 3ETEA 4KSCA 3TF5A 1ZXBA 2WRZA 3HZRA 3AUUA 1J0AA 1CYDA 2DSTA 2PD6A 1XEXA 3ZQKA 1U0RA 3AVOA 3FOEC 1SUWA 4Y18A 1PT8A 2RGBA 3HKBA 2E21A 4BLUA 3QM1A 3FPAA 2NXCA 3GJ3A 3AJ8A 3LTEA 4GPZA 3DDOA 3C7CB 3O93A 3WGTA 1J09A 1MHTA 2GN0A 4FOTA 5AVQA 1RMTA 1KXJA 1OBVA 1JHOA 3KM0A 3DYVA 4QBHA 4LMPA 3GLHE 2VYQA 1AKVA 1E1DA 1QHIA 4IZ6A 1FYWA 3ZY4A 3QVSA 1XVIA 1F3OA 1ZIXA 3NPAA 3SSOA 3WGNA 2JFNA 2AN1A 3EVFA 4IMJB 4J1QA 4XOUA 1ZMOA 4KQEA 1SD2A 1UC4B 2QG9A 2WLTA 2PMEA 5JXGA 3VO8A 2FXVA 3RADC 1G5TA 4L2IA 5JJIA 1BTOA 1S8NA 4K6CA 8AT1A 3LPDA 2N1MA 2C57A 3J81k 1A1VA 1ZNXA 1PN3A 4X1YB 3PRKE 2NZ2A 3K0AB 1LPSA 4PGMA 2QN2A 2HA6A 1L4NA 3R6LA 4Q05A 4ENPA 4QFMA 2RGAA 4NYMQ 3UJHA 5LQDA 2DFPA 4L28A 3WO1A 3D0QA 3OZGA 3EIXA 1UC5B 4AJEA 5AK0A 4CN8A 4D8TA 4X7MA 1VE1A 3GL9A 1H69A 5H7XA 4ZTZB 3PICA 1OZHA 4K7JA 1NVDA 3BFJA 1XROA 4LYYA 1F8YA 3IELA 1FSSA 1R3DA 4DG5A 4NOJA 2DUUA 1N5OX 1CE8B 1PD1A 1VMKA 2WSLA 1EVQA 1MO6A 4MK4A 1UC8A 2FLVA 2OLEA 1E0AA 1GR1A 3CV3A 3Q6MA 4R1MA 3SJCA 2IL1A 3NVMB 3OEHA 4I4TB 4M7OA 2M98A 4JCCA 3EG9B 3CLSC 5AYVA 5JAHA 5IT0A 3BB4A 1EUDB 3NXKA 5HTOA 2DJIA 2PLNA 2YHUA 4MR9A 4P2GA 3I64A 5JCOA 1GKYA 1X7HA 3JRXA 4LK3A 3GLUA 4M1QA 2HJGA 1HYHA 3LCJA 5BSHA 1IL0A 4X6LA 2B8EA 4HH1A 3S44A 1KOFA 1P5RA 4MUEA 4P83A 4NCXA 1J5EB 1SIBE 2JFBA 3AEQA 3IDFA 3P9SA 4N8SA 4DA0A 1WBBA 2BSQA 5G0VA 4NMWA 5TEVA 4TYQA 3C3EA 1SBQA 4YRCA 3RIXA 1FL9A 3ZCQA 4W9RA 2YWRA 2YIMA 3GVHA 5DCWA 2R3SA 4EH1A 1SUPA 2EKDA 1P81A 4FLMA 1LBIA 2OBFA 2XUZA 3PS9A 4HCJA 1GPWB 1Z39A 5E4TA 5AXCA 4R0MA 4MRAA 3MYYA 4IKOA 1U6KA 2W2XA 2Q2QA 2WLSA 2Z5VA 2JLBA 1VYUA 4YDQA 3C5EA 1R0XA 1GGEA 4GR4A 2ATCA 4ZZ3A 2B8WA 1OWNA 3GV0A 5TVGA 3KQHA 2PWZA 2C2YA 2ZIWB 4NE2A 2MIIA 5BRNA 3DPUA 5ECDA 1PJ4A 3A1VA 1ISHA 4F3RA 2A84A 3DL4A 2ZIXB 1P0IA 1CZHA 3NTRA 3U7EB 4Z4HA 1CZOA 1AC5A 5C7IO 1R6UA 5IM4A 1DPGA 1T3GA 3WMWA 4CIVA 2WOOA 2Q4DA 2WIKA 4QUHA 3GLTA 2HGZA 2IQIA 3L4EA 3NBYC 4HB0A 5T8KA 5LR6A 4KYTA 2X1VA 3SCZA 3M4ZA 5JSYA 1E62A 2ASVA 2DFNA 1GGNA 2JCXA 3A3NA 2PUJA 1FB5A 1KSFX 4JDPA 1A9PA 4O1IA 1SU6A 2Z2YA 5BSUA 1JSRA 2V6GA 4IIJF 4KQHA 3PWSA 5HMMA 3OPQA 3MXOA 5TPWB 1DBSA 3A36A 4MR8B 1LZLA 2FY8A 4WGFA 4A91A 3AL0C 5FDFA 1R8JA 1Z0FA 1N6LA 3Q85A 2C9BA 1GU1A 1L9XA 3B6KA 3O8QA 5K7SA 1N33B 1LVGA 3ZWQA 3DSRA 2QRLA 4B3FX 4BV8A 1RXVA 4D3DA 1LX7A 4RJIA 5FNVA 2QXUA 3LE8A 3JAKA 3EEIA 1P5JA 4NBVA 1XA0A 1Z0IA 3R7WA 4RPCA 4LGVA 1HDRA 4W5NA 2F3TA 3LF1A 4BKQA 2XD9A 3B1VA 4G89A 2R87A 1I9CA 4NEQA 3GRFA 4Y6LA 4YRDA 5EZ5A 1MABA 1ZG3A 3AEKB 1TIBA 3GRZA 1KR5A 1UEIA 4N3CA 3FUUA 3VU9B 2F4NA 4LFAB 2GVZC 1D5WA 3L0PA 3QEJA 2FWMX 1W5EA 1DCFA 1LC0A 2FFBA 2FUCA 3O94A 1BRTA 1W4ZA 2EARA 2QZ9A 3VYUB 2WU0A 1F2UA 3UJ3X 2OZLB 1H05A 2UV8A 3ICEA 3RG8A 5LUAA 3HVRA 1C7IA 2H1IA 2QX6A 1KFBB 3CXRA 1EXMA 3E9MA 5BN5A 3A9SA 1LPAB 1MNQA 2ZETA 4GYYA 3GGPA 2HIHA 2PXHA 3ICOA 4MKZA 3H0KA 4Q21A 5B1HA 3KQNA 1YDGA 2ZTSA 4MV5A 5IVHA 1XAGA 1Q3HA 4KRFA 4EW6A 3D3WB 3OKAA 4CNQA 4L76A 2C07A 4TTIA 5AHRA 4OXQA 4PO8A 1M1YE 3Q2IA 2P4SA 1GFWA 3N2NA 4WXHA 5JANA 4BFVA 1N1MA 4Q9KA 4CFYA 4C87A 1DINA 2OO7A 2Z2XA 4CKCB 2ZJYA 3I73A 3JWHA 4DF3A 1DT3A 2R8BA 5JAOA 3D1VA 3R9IA 2J9XB 4QU8A 4WJKB 3IT1A 3VR6A 5JZOA 1U7TA 4WA7A 4ZAYA 4RPGA 4A9AA 4BO9A 3RIGA 3EF0A 3OWHA 3L93A 4QJBA 4KOAA 1Z0KA 5EKDA 1UXGA 1RYHA 5BV0A 3E15A 1ZCAA 3SDZA 2VHVA 3OCUA 2XZTA 2ORED 3IQXA 1LBTA 3KJHA 2JLRA 3W78A 2Q3DA 3L6CA 4BGDA 2BE7A 2K2WA 5IKPA 1AHIA 4XOIA 2GBIA 4BO4A 2Q41A 2DHCA 5AK5A 5GJVC 2DQSA 1L7NA 1JJAA 3VMMA 3CWCA 3H87A 4YHBA 2WU1A 1J70A 3DDNA 2EG5A 3F47A 3NCTA 3Q7EA 3T34A 4H7IA 4AQDA 5JTTA 1UZAA 2UYQA 4JWTA 2C0CA 4RGQA 5GV8A 4ZHQF 2ZR8A 1I6WA 2RDMA 5CCEA 5I9LA 2X5JO 1XLTA 3C70A 3EGXA 4OD0A 1VCMA 1B43A 2J30A 2IU0A 4ON9A 5HF6A 4RK5A 2DR2A 4LV5B 3BCSA 1WCYA 3NM5A 3V8VA 1ZR2A 1FQOA 1QWOA 4JC0A 3S1AA 1G3MA 4LZNA 4JLBA 4ISCA 5IJZA 3ZE8A 2FEWB 2CXTA 4ZV9A 4BVGA 2AFHE 3EPHA 1R18A 2BUAA 3QY0A 3G88A 3V00A 4RL6A 4O25A 3GUVA 2ECOA 4LWZA 2R1TB 4INOA 5FWNA 3R7DA 2PL1A 3IODA 1DE0A 1R0RE 3QF7A 3TXYA 4Q3LA 2YRXA 2ZJ3A 4MJ7A 5TQ0B 4DLTA 1UXHA 3TH5A 4OQFA 3WGMA 3AFIA 4EHKA 1KR2A 1NMYA 1ICIA 4QYIB 2X86A 1IYZA 3F98A 2IX3A 3GJ0A 1IOWA 2O0HA 2ZIAA 3N7AA 3GF4A 4MOWA 3V34A 3QW2A 4AUKA 5BNWA 2B5VA 4CIDA 3FD8A 5EJ2A 3D4PA 1VSUA 2AQHA 4CEIB 4B3MB 4HTFB 1EP3B 4QOIA 4HYYA 3DBLA 2V4ZA 5CU7A 1JJ7A 3RODA 4BRZA 1M6VA 2NYVA 5EVJA 5JQWA 1GNQA 4YALA 2X0FA 4D6PA 1AMUA 4PYNA 1TUBA 4ZQFA 3THYA 4IOMA 3WWPA 4Z7OB 2ZTLA 3HP7A 4CKBA 1A2KC 1RLIA 3G85A 3KVRA 3KHUA 3N0VA 2QF7A 3VHRA 3ZGLA 5L40A 4UAUA 5GONB 2BMWA 1IQUA 1RHQA 4CMAA 2V7BA 5BOVA 3V46A 5LZ4A 3CJQA 2AWOA 3ROKA 2C9OA 1DC4A 1I4LD 3U44B 5JSQA 3NDPA 1BSVA 2PX5A 1RJDA 1EFTA 5CJJA 3HPRA 3OQJA 3FFTA 3IP5A 2OQ2A 1EVYA 5EIBD 2WD9A 5K3SA 2YYZA 2W42A 3CR3C 4E94A 4EHHA 2NM0A 4FHFA 3BXGA 3KXPA 1LRKA 3MYRA 1BO6A 1AHHA 1ZESA 2I62A 3LOPA 3CUTA 4RDCA 1I3OA 3ELDA 5IABA 1QOZA 4UNSA 4MRMB 2OYSA 2ZDGA 2VHTA 4RW0A 4ZO7A 4QM7A 4X92A 1FU4A 3JQRA 4ZCQA 1M2KA 1PJLA 2EFDB 1TJ4A 2HMWA 2CLFB 2HRRA 1FUYB 1M6WA 1YZGA 2WF7A 3PQ7A 1BDIA 4AF8A 3UJ7A 3W2FA 2VHCA 3OKCA 5DI3A 1L7XA 1NG1A 2V1XA 3WDKA 4E7OA 5A0TA 1UAGA 1C7JA 4IWYA 4I99A 3U4HA 4S05A 1U8ZA 2I7VA 2G70A 1D7OA 1NJ1A 2FSIA 4UMFA 4Q01A 4KZKA 3RLIA 3U2QA 4QLOA 1VFPA 3TFWA 2ECFA 1TYCA 2D7JA 2IXTA 3NOOA 3EAGA 2BFFA 4WN9A 1MFPA 2FE4A 1GILA 4EGSA 1HQYE 2WJ4A 2CCGA 2YW9A 4GPIB 3V4ZA 3EEOA 3O9MA 4DC1A 5ICMA 2JFPA 1Q83A 5AJVB 1U6JA 3S2IA 3HLYA 3SIRA 1CQPA 3SR4A 1V3QE 4MO2A 4EZBA 3ESAA 3YASA 5LZ2A 4AX8A 4LTNA 1U0EA 4G5FA 1U2EA 2WF9A 3GUYA 1RQXA 1X7WB 2X9LA 3QK7A 1IY2A 5IMBA 1Y8RA 2Q8PA 3HXTA 4YH1A 1A71A 3O90A 1KYZA 5FTMA 4ZWNA 4EG5A 3IHKA 1USUA 3JZDA 4RPKA 5KZMB 2II6A 1BXZA 3O4HA 3DF9A 1J9EA 3BIJA 4G56A 1I24A 4OB8A 2QQEA 1NYRA 4FMDB 5A6SB 4CKYA 4KPYA 1FRFS 5EXPA 4U2KA 1R9MA 3LP5A 4NMHA 4DM3A 3CZPA 3SXUA 2ZVJA 2O0KA 3LC2O 3I58A 4P7KA 1AB6A 4BNDB 5CITA 3L4JA 2QVZX 4I7EA 5DM70 1U81A 3NHYA 4XGQA 4ZHSA 2O8DA 4LWQA 4LV8B 4H1TA 4KGDA 3MS7A 4UHFA 4A8TA 4XAQA 5LOVA 3UFBA 1RVDA 2A8YA 2HY7A 2PBRA 2I3ZA 2YVKA 3BD9A 3NH9A 4KLZA 5J5CA 3K0EA 3LJKA 1EA7A 2DR3A 3O8OB 2FPMA 5LLSA 3WTBA 5I4BA 2FJ0A 4NZYA 4MWTA 4XSHA 2DLNA 4HMPA 1JLLB 3KUKA 1NQ5A 4C0QC 4DQ0A 2VBCA 4AIIA 1LRLA 4GW3A 4WCVA 2R751 5BN4A 5EVCA 2NO1A 3GG2A 3ONNA 5B6JA 1SVUA 2ISSD 5TF0A 4FSXA 2HLDA 3AW8A 3PGJA 1H65A 2HFKA 1RKUA 3H8SA 4QUBA 3QIVA 3U17A 1KJZA 1NU8A 1AT1A 2XIQA 1JDZA 1EI9A 3WGJA 1MN6A 2JJ1D 2NO5A 4CXMA 4LCEA 4URZR 2W2MA 3MEQA 1E6KA 2B82A 3ZVKA 4WESA 1NJFA 4GBMA 1KFEB 3F7TA 4H7KA 1SCUA 4BX3A 3S27A 3THYB 2VXYA 2PUEA 3J80A 5ITWA 1KS2A 1EXDA 1EFVB 3A14A 4PZDA 4WKCA 3RKSA 4LJSA 3UH1A 4BY9E 1VJRA 2JGIA 1XU4A 2YV5A 5BNTA 2VDUE 5A5EA 3CLRC 3O73A 4TYMA 1D1TA 5A3SA 3BF8A 2NU7A 3KTAB 5U4XA 3RH0A 5A5GA 1L0BA 2ZQZA 1G2PA 4RLFA 3OQBA 3A1SA 1CY8A 4O4IB 5AKXA 3WJ7A 4D4MA 1G8AA 2YHIB 2QAJA 5ANRB 1ZSNA 2MCFA 3G5UA 4NH0A 1SURA 1T5HX 4UULA 4CLXA 2M6KA 4CM5A 4D96A 3RS5A 4E5VA 1UT6A 3U1BA 3OWOA 5EWLB 3IILA 1FX0A 1ZEMA 4LHXA 4CDRA 2B98A 2AI1A 2OVFA 3DA8A 3GQBA 4FC6A 1SG9A 4HAIA 2R4TA 3FFXA 2PUCA 2I4RA 3ET4A 3OOYA 3K6JA 4DZRA 5BMVA 3PA6A 5ABPA 4R4JA 5CDFA 3FNEA 1LD3A 3HJUA 4KI7A 1HX7A 1J2TA 5KOIA 4ZODA 2VJOA 1PGPA 2YJ3A 4EG6A 4RKWA 5CFLA 5KNBH 4G24A 4URUR 1ZRNA 2I29A 3T9EA 4Y9UA 1Z5GA 2ZKLA 4JQOA 2LE0A 2C9CA 4D4IA 3L8EA 4RVOA 2PBZA 3CUEF 4CYMA 3C7DB 3FI0A 4AYWA 1X1SA 2X76A 4FYMA 3VSEA 2MYTA 1WV0A 3BQNB 4I46A 1LGYA 3QW4B 5JNWA 3UXMA 3JYNA 2KBEA 4DBZA 4CMBA 1FTWA 4UTOA 2VTVA 4TKLA 1Q16A 2X14A 4R3NA 2GKSA 2WSBA 1QIDA 4ESHA 2X4DA 2E6KA 3DV0B 4KLNA 1BH6A 1EXNA 2Y99A 1X7DA 1T1EA 2VEOA 1PX2A 3CJTA 2EFYA 3QE0A 5FP0A 5EJEA 3UVEA 5KYXB 2JHAA 2QYOA 2WD8A 1U9CA 2JEZA 3BWMA 1PJSA 2J3LA 1C7RA 3R09A 5EHNA 4TWJA 5AXBA 3VDNB 3HN7A 1Z6QA 4QHSA 5BW8A 3FHTA 1JIQA 4GBJA 4X1YA 3WBKA 1ADFA 1LLQA 1OFTA 3G82C 2Q4RA 2ZT6A 3K0AA 1ACJA 2XCUA 3CIOA 3GPCA 1QRTA 3I61A 5AKYA 1UBMS 1DDOA 4OOFA 4BO1A 2C8KA 4BNVA 4QGAA 1G8HA 1R8SA 4I1UA 2YHBA 3D1JA 5HQTA 3OICA 4WOJA 4INZA 1NUTA 1CK4A 3AONB 3D3KA 5C3UA 2OCDA 4E15A 5KHLB 1CE8A 5ALXA 2YVLA 4G1FA 4IUCS 1U7WA 7ABPA 1VGVA 1L5NA 3STWA 3H6GA 5JV5A 4HXFB 3JQ8B 2XMZA 4YJGB 4C7XA 3EG9A 3PHLA 1EUDA 3RFXA 3KL2A 1ESCA 1JPVA 3PD7A 1N2HA 5BQ5A 2SICE 2GWHA 4BVEA 1PS9A 1RXUA 1ONNA 3U0BA 4IDDA 4MV3A 3V1MA 4D1YA 4EY3A 4W6ZA 3EZ6A 1JKXA 1IUPA 1MORA 1NFFA 1QVZA 1MT3A 3C3XA 3FYSA 3E9ZA 3LX8A 2JJ2A 4NDAA 2O3SA 1VE9A 3FWKA 3GRVA 1HFKA 4BE7B 2I34A 3L0ZA 3EYAA 2LPMA 2BDUA 1LPPA 2Q46A 2W9XA 4R1TA 5LFAA 3WKAA 3I04M 2Z56A 1LI7A 5L53A 1Z6PA 4L15A 4E5SA 1DOHA 4ZOQI 4O59O 1KBQA 1I7NA 4U2CA 1ONSA 4D0LB 3ROEA 5EKTA 3UZUA 4IFTA 2O8VA 4IMRA 3T0FA 1FP2A 4DJTA 1NMEA 1TVEA 1UKBA 4TQ9A 1O95C 5CXSA 2CWDA 1CP3A 1WZNA 2V6MA 3H05A 3KZ1E 2QLNA 5HWSA 5IAKA 2AQ8A 4OOEA 2WAYA 1A9XA 3HV2A 3KP1A 1OC2A 5EJGA 3TOVA 3NVKI 3PNVA 5EE5B 1VLLA 1SOMA 1VLMA 1R4NA 2QLFA 4OP3A 1CUEA 3EBPA 4C7BA 1TEZA 5GADl 3RE1A 2H2DA 1HO3A 1U1CA 2GXUA 1MA3A 1Y4SA 3KTFA 2M2IA 4MLDA 2ZIXA 3VMFA 5K0FA 1FYFA 3E2PA 4PCVA 1VI2A 5EP4A 1FXWA 4QTYA 2POCA 3GI1A 1JECA 4RLSA 5HUQA 2J09A 1M8KA 3DBHB 5LSAA 1QG2A 5FPYA 4ZXFA 4C3ZA 5C8ZA 4WK6A 2W2LD 3L1KA 2D0PB 2KMLA 1R50A 3VV3A 5L3RA 3RFFA 1U8FO 3KQOA 3LL7A 1UZMA 2D00A 4OHOA 3RUDA 2OG2A 2WU3A 1GUFA 1KXZA 1XN1A 3L9WA 4R84A 5TB5A 1D3AA 1L8LA 5TPWA 4MR8A 2PKWA 1K7FB 4C3UA 2DPLA 1GO2A 4A0GA 4F5DA 1XOIA 1V0JA 3M2TA 4PNZA 3BGWA 4GL2A 4O29A 1XZPA 1ZR4A 2NU8B 3VSCA 1H2AS 4HDAA 1L3BA 4KBGA 4RM3A 5C2JB 3P26A 4C22A 4FUQA 2RHHA 1EWQA 4R69A 2GF9A 4N3AA 3S1SA 2ZDQA 4OX9B 2WFZA 1NMXA 4QAQA 4RKEA 1E2FA 1VJ1A 5I9IA 3QKIA 5HQJA 4HT3B 1GPBA 2CDAA 3SF0A 1AURA 1DJQA 3K0CA 3LPMA 4KREA 3AEKA 3IJ5A 4FEEA 1YL7A 1SKBA 5IFLA 5FBKA 4B3BA 1C9YA 2D1YA 1NZDA 4M9XA 3NDBB 2B4KA 3E4CA 4M89A 5JD4A 1GYRA 5CHEA 1E3LA 2F4VB 4PY2A 4XJVA 4X1OA 2HDWA 1SG6A 4HGRA 1BEUB 3R7LA 2V55B 1T0UA 2H4HA 3DEKA 3FUCA 3TJRA 5AM1A 2OZLA 5ICFA 1CUAA 3V1YA 2BFBB 5DULA 3WNDA 1UMDB 2C4MA 4F06A 2QJTA 5BY2A 3G8YA 5C8VA 3E70C 3T9FA 5I5EA 2W2KA 3WL3A 5D5HA 1XYVA 1XD2B 3GHHA 2WE8A 1T5LA 4V0QA 5KTOA 1EHYA 1YGPA 3DKPA 3LLSA 2IDZA 2ZI4A 3D3WA 3H8VA 3ZDAA 4DR3B 2YTZA 1E98A 1GY8A 3UV3A 1T1SA 2C3UA 4Y1GA 1UZLA 4DLRA 1ZM3A 3FFWA 3EB9A 3LQRA 4LXQA 2A9QA 3CISA 3NTOA 1MVNA 3LQKA 4CKCA 1B74A 1G8KA 5DT9A 4RZXA 2FG6C 3CO5A 4L02A 4M3NA 2X23A 4OHWA 2HNBA 3TLAA 4NULA 2CNKA 2UZ0A 2FPGB 2LIVA 2BMEA 3P96A 3WNVA 4E4YA 4N0EA 4X8MA 2WWVD 3UATA 4F04A 1G3RA 2A58A 4DLLA 5A4JA 5JU6A 4YI5A 2H92A 1CUIA 1Z63A 4X20B 5F5XA 4E03A 5IT9A 4J91A 1NXXA 3ANYB 1O4WA 5DGDA 1TAUA 2H5IA 3I5XA 4X95A 1T0HB 5JI3E 5JMOA 2J3JA 3SZOA 4RZ3A 2X0DA 1Y6JA 1MDFA 4XWKA 3SIPA 3SSMA 3UJPA 4C3VA 4YXWA 2AVDA 1ULTA 2OV8A 5KQRA 4RQBA 3UPDA 4QOSA 1I7LA 2FSFA 1JIIA 2X8BA 3D54D 3JPYA 3V6LA 4M37A 3ZY2A 4MW1A 1R0LA 5EUQB 3AEZA 3EXAA 2ZRCA 2G67A 3EYWA 3PF9A 2HK9A 5F98A 3DMHA 4JHXA 1F4PA 3MMXA 4E2ZA 2GNOA 2RH8A 3BRSA 5FBHA 4LFCB 1XNHA 4EG4A 2AH5A 3IRVA 1OR8A 3W4IA 5KDDA 2JVKA 4MS3B 5BWOA 3HM2A 2Q1TA 3EDMA 3PT5A 3Q11A 4QQNA 4ZTUB 2ODNA 2QAIA 2QL6A 1VL8A 1Y8QA 3GT0A 3GFFA 2ODPA 1I1NA 1MOSA 2R1TA 3R77A 5A9TA 2E18A 2HDHA 3I2FA 5T4BA 1MC8A 5TGTA 5TQ0A 4FFBA 3SLRA 1KFJB 3TZ6A 1M72A 5AUPB 1YTLA 5EA2A 3TMKA 5DYWA 2NO4A 4DS3A 1NLMA 4AQ7A 1QIEA 2O14A 4PYOA 1EHIA 1J2YA 3PUYA 1QIGA 4H7PA 3V97A 1GA1A 4CF4A 5IMSA 3KSBC 3HJAA 1E2JA 4CEIA 1M7BA 3C6KA 1JFTA 4HTFA 3V8NA 1G63A 3MGBA 2WYVA 3KV1A 4HSEA 4QDZA 4D4GA 1QQ6A 1GPAA 4JBWA 3CZ4A 1R9GA 1J6UA 1IH8A 2DTDA 3DZDA 1O89A 1G3UA 3UENA 3NHLA 1KH1A 3FB1A 3OZEA 1Q77A 1L4MA 1JQLB 2JD1A 3QKSA 4G0OA 1MAVA 2BGIA 3MELA 1QYCA 3ENQA 4J0IA 1IZ8A 3OFKA 2RBEA 4AWAA 5BPFA 4CMKA 2C9ZA 2HTEA 4II7A 1Y3FE 3PQDA 3U44A 3FOBA 2PMBA 4L78A 3ROFA 3O91A 1JIVA 3WHIA 1MAAA 4C89A 3O84A 5CFMA 1DKUA 4PC7A 4V0ME 2E87A 1HYGA 2AJCA 4MGIR 4M54A 3G9TA 3OX1A 4D5GA 1CZUA 3JQ9A 4OHBA 3FOFC 2M32A 3KZVA 2I2FA 2GN8A 1VCIA 1P19A 1L5WA 2XE6A 5F5LA 1Q21A 1UWKA 1VA4A 2ZPAA 4ZAWA 1VHQA 4MRMA 2R6R1 2GD1O 5KVCA 1K4KA 1H9AA 1CIPA 3ZYZA 1ULSA 4YXFA 3W8DA 3WJAA 3WGGA 4AXBA 4DC0A 3MUNA 1I2MA 3A3OA 1NDHA 4FQ8A 1L7DA 1ZBQA 1LCIA 2HQSA 4K6KA 4P58A 3ZGNA 3D6TB 3U4QA 3FLMA 3U7IA 5KYVA 1ECJA 1RC1A 4WZAA 5T67A 4YX9A 3JD1A 2DUNA 4MGKR 2XNJA 4MVJM 4BKMA 4C0HA 3P4XA 1AUVA 2Q5EA 1WKCA 4MR7B 1BWRA 2BHRA 1GJRA 2Q8NA 2WWHA 3HRIA 3QLEA 5DDIP 2VDOB 4G84A 2JHPA 5EFZA 2J6IA 3O31A 2JBHA 5KU7A 1JYFA 2A9VA 5T6BA 2RK4A 1BIFA 3USZA 1NN3A 1NKTA 2E4YA 4N3NA 2Y0PA 3SNKA 3AF2A 5DLQC 5LVAA 2H29A 3IUJA 4JJKA 5C5EA 2XF2A 3ER6A 3HDVA 4OAQA 1XYYA 2FMKA 2O7VA 1U3GA 4B0OA 3ZHQA 4YT5A 5BW5A 3QYAA 3V55A 1X7WA 2IOFA 2DF8A 2ZJZA 2PQ2A 4R2IA 1X7XB 2RFLA 1E2HA 1UFOA 4XYLA 4F1JA 3RVPA 1DAHA 2I4IA 2P9CA 1QF7A 2SNIE 4M38A 1ABEA 1NE7A 4BQFA 5A6SA 1OAKA 4OKNA 4DV0B 3RTBA 5KYWB 1M1NB 4KUHA 4ND8B 1NONA 2I3GA 2R2AA 2QLJA 2VHJA 3CB4A 1KU0A 2IGBA 3OMWA 4UUBA 3WFIA 2XXAB 2IU3A 1VI6A 1JDPA 2WM8A 3UGQA 2YC4C 2V03A 4BNDA 1S2MA 3N8IA 1ZNQO 3G2IA 2IPOA 3FCAA 3HB0A 1JEYA 4LFBB 1HC7A 2RGYA 4IVQA 2LKDA 4MI3A 3C1UA 2ZM5A 3THXB 1VA5A 5AMXA 1U4SA 1ZW6A 1QYWA 1ULBA 2R7KA 5C3MA 4J2TA 1Y63A 2XR1A 3MINA 4XM0A 4ZO9A 1I7QB 2QUKA 1A4RA 4H4DA 2HR1A 1U0HC 2P69A 1O5OA 3G8CA 1JLLA 5LZ7A 5TXGA 4EA9A 5IHXA 4YMVA 3CLVA 3F6PA 4GP6A 1SVIA 1II8B 2IZZA 4ZGWA 5U9CA 3FVQA 3WB1A 1N5JA 1RVV1 2AIRA 2WAXA 4PO9A 4DR5B 1VP9A 2R8YA 3KBOA 1Z62A 1UOOA 1ABFA 4V0SA 3DW3X 4QGSA 3IULA 4DUZB 5LDDC 4O2BF 4CCAA 4Y7CA 3OZSA 1TO2E 1P8AA 5M5BA 2HSWA 4O2LA 4GMGA 3DOUA 4FDTA 1QTNA 1CT9A 1YH3A 1F2DA 1YRYE 1GQRA 3EODA 2HF7A 4IEEA 4J43A 4G9EA 1ISRA 1NHWA 3Q9UA 4LW8A 4MQEB 1FUEA 2R8ZA 4R7ZA 1GZ4A 3KB8A 3DE6X 3DR3A 3MRTA 2RHTA 5L8VA 4BKRA 1EFVA 4PBSA 1XDWA 3WMRA 4OQLA 1KYIA 3DKIA 4INPA 3X3HA 3HR8A 4DVJA 2HV9A 4GRDA 5FXMA 2OXFA 2PFGA 3FJYA 3KJNA 3ZX5A 4L9RA 2RHCA 2J07A 3EVTA 3KTAA 1H9CA 4DMLA 1YT5A 1VL5A 3O2NA 3V8MA 3OCYA 4LYAA 5AWFC 3EMVA 4C2TA 1V1MB 3ABIA 4MCJA 4O4IA 3REGA 3INNA 2YHIA 3GFPA 4B6EA 2XHEA 4E5NA 5HG0A 2Q07A 2H1HA 5TJ9A 1N78A 2A7QA 4A3SA 4UPDA 4CF7A 5K3OA 2EKBA 5ALFA 1A9TA 4LDPA 2ZREA 2JFGA 1MRSA 3TEMA 4JOBA 5EWLA 1YR1A 1UDBA 1RWKA 3ITEA 3HEBA 3LT5A 4DCCA 4U2DA 1ZD5A 1KL7A 1T10A 4AF6A 4MI6A 5FI3A 4OXXA 2OV4A 2GZDA 1M0SA 3RUEA 3K4HA 2OYCA 1E1RA 1QS0B 2P6UA 4URVR 1E66A 3F3KA 1NQAO 5BOSB 3I4LA 1TK2A 4BVHA 1M2HA 3I9LA 3NYQA 3N6XA 2AOTA 5G41A 4JVLA 2JVIA 1IN4A 1C81A 2AEJA 2IV7A 3T1OA 2YN0A 5TDHA 1V8PA 3MWKA 5HILA 2G83A 4B3HA 4BNXA 1J0CA 2F3UA 5DYTA 3RWMB 1WSAA 4WWHA 1MJGA 4KR0A 3IQIX 2DTXA 4P31A 1GGKA 3VSAA 3QFHA 2KJQA 3D5QA 3MWYW 4WE3A 2NTEA 4RSRA 5E2IA 1YUNA 4AMYA 4FE3A 1GM5A 1LLCA 4BMYA 4J0GA 1GRCA 2A9KA 2I67A 1KA9H 5GTDA 3ZLUA 3RSQA 4WNIA 5JRJA 3DV0A 3QXSA 3DDSA 2J33A 2QVCA 4M1MA 4AZWA 4DSZA 3VA7A 3L8FA 3AGQA 2PMDA 4D9GA 1UBKS 4DGSA 1DEAA 2JGKA 2V65A 3G7UA 2GM5A 1Q1EA 2QD5A 5KYXA 3F4BA 1CYEA 4D6YA 2C2WA 2QD1A 1EYZA 4IIVA 2SCUA 5AOCA 1ABBA 4YLYA 3HV0A 4JFRA 1KERA 1Q1AA 4MWSA 4K81B 4DG9A 4F97A 1ODFA 1U0TA 2PUAA 2J0UB 1R0KA 4D98A 2A4KA 5ADWA 1A4XA 1K6JA 4BMOB 5K3DA 4MKFA 3USES 4ALNA 3RTAA 4GOMD 3EVZA 2VHZA 4BLVA 5KSZA 5MN4A 3R0XA 1CEXA 3QEOA 4KXLA 2GQ0A 2VSYA 1E1QD 1P1JA 3IR6A 3N2GB 1BWPA 5DRYA 4BFCA 4F38A 4ZXPA 3RC9A 1EBUA 3VZRA 1UBOS 2GN9A 3AW9A 2EJWA 2D74A 4FVTA 5AI4A 2CLCX 3OCXA 5ALKA 1WWKA 3GJ6A 4QARA 2ZJOA 3JQ8A 4HRAA 1ID1A 4YJGA 4KPEC 4OHRA 1K8YB 2ONYA 4P5EA 3IX7A 3RT7A 4FSDA 1Z45A 1AA9A 1IM2A 3C7TA 5C35A 2OCYC 3IEPA 1Z74A 4J1TA 4MPPA 1K4YA 3BTSA 4PSDA 3EPKA 4TL7A 4YJ3F 3WWZA 1F7VA 3GFGA 5AM4A 2P77A 4DN6A 1LTQA 2GXSA 3VPFA 2VTBA 4J8PA 2VJYA 4QDJA 1GCOA 4WW0A 1QV7A 3SQMA 2GO1A 3LRTA 4GXQA 2QTLA 3HCCA 1U5BB 4AMBA 5JZ9A 1NNSA 2BGWA 1E69A 1UT8A 2OZEA 2ZZKA 4EB6B 2NVBA 5A06A 3D2BA 6PFKA 3R3ZA 5FYDA 4MVJG 4E07A 2OD7A 2I2WA 2BWJA 2HUPA 1E0JA 2W6CX 3LP6A 4U8HA 4WTOA 3SY8A 5A9RA 1SBNE 3WHLA 3RS9A 4EY6A 2CV2A 5IWCA 4IQ0A 1CDZA 3VSDA 4BJ3A 3QX7A 4K9NA 2UZIR 2ZBRA 2H7YA 2BEKA 2QTVB 3CRZA 1KEEB 1V8DA 2EDAA 3H19A 1N0VC 3IAM1 3IUQA 3M49A 1JQKA 1LZKA 4LHWA 2BBOA 1NFQA 5DN6A 3C5HA 4GOOD 3WICA 1E1YA 2JC3A 4NAVA 1IQPA 1HNNA 2P2SA 4H3KB 3DLIA 3DHVA 4F45A 2FAXA 1JJVA 2WWGA 4KODA 4OMCA 4UDOA 3IQWA 1R0YA 5CH3A 4WVFA 3LOUA 2YWHA 1YVUA 4J4BA 4YWJA 1BJRE 2A5GA 4WOBA 2ZUEA 2WYIA 5BUQA 3GUZA 3SXJA 1ZVJA 3BMCB 3K5WA 3O9VA 4WLEA 2XNDD 4KFUA 4BVAA 3HK2A 3DBHA 4TYWA 4MQMA 1E1KA 2CDCA 2G8NA 2PXAA 3AB3A 3L0YA 3P19A 3L40A 2H5JA 4ZARA 2ONJA 2P7IA 1GGMA 1SCAA 3AI1A 3MAAC 5L4LA 2EF1A 2WYOA 2PYDA 1YB5A 8OHMA 5ES3A 4XVHA 1QO0D 3UT5B 2JEOA 1FPMA 4JR2A 1F60A 1GN9A 2BOVA 4BNUA 2BHSA 2C4VA 1MEJA 2ZW9A 1XGKA 3FIUA 3DJYA 4RACA 1CZRA 4IFEA 3C85A 4U9IS 1L5ZA 1DAFA 2YXPX 2CEAA 1QE3A 3CNNA 4HXYA 5ALRA 4EKIA 4HRVA 2IRWA 1SKYB 2C03A 1FSGA 2QTZA 1PG2A 4UEQA 4B47A 4EHBA 2F8SA 4UBLA 4Y2QA 1PGNA 2CMFA 4HQ6A 1LF0A 3BORA 5FOUA 4DNXA 3A06A 4L0QA 5DX0A 3BJIC 4YUXA 2VT7A 2IHBA 2BAGA 4ZZ0A 1RLUA 2MR6A 1L3IA 2AN9A 2AJTA 2Q5FA 1MPXA 1NBME 3B6JA 4IDPA 5ALUA 5LKRA 4BRWA 5AESA 1MHPA 4RVFA 2J32A 2QM3A 2RAPA 2H8GA 5K5EA 4GGMX 3WV5A 3Q12A 5C5CA 3IP1A 1Q1NA 1STOA 2REQB 2BFBA 2AK3A 3B5JA 3A3YA 1V1JA 1UMDA 4N82A 4RVCA 3HB7A 9LDBA 3UMRA 1VLQA 1LDGA 3HCEA 1LDEA 4BNKA 2JJ8A 1XD2A 4TL6A 3BWVA 4BNMA 5B3LA 4U2FA 4B71A 1NQVA 2IIVA 3CT4A 3PC7A 4JP2A 2B7LA 3F67A 5ADHA 5TE9A 1W85B 4ZI5A 5L6LB 2MSLA 3JCZA 1SMKA 3MIZA 4AULA 4G36A 1MW8X 2P9YA 1K68A 2COKA 3QKWA 4IR7A 5SYNA 1PJAA 1W75A 1R0BA 5ELXA 1Y37A 4MYSA 1YDHA 4CR6A 4PANA 2X2EA 4G01B 5KB3A 4EHDA 1YS4A 3AWIA 3PLNA 4Q82A 2OE2A 4I5DA 2O52A 4PG4A 4V0RA 3I9V6 2C1EA 2R6AA 1P29A 1LFDB 1Z4KA 2HMUA 3NBAA 3WG9A 2FPGA 4RZSA 2GFQA 3E48A 3GZJA 4YI3A 3RS8A 2PV7A 3IAS1 3SHQA 3PRHA 1U2PA 2BL4A 1UOQA 1WXDA 3HI6A 2HO5A 4JR1A 4QPZA 3SX4A 4BQPA 4X20A 4MITA 3K1YA 4UEWA 4JYAB 3DVQX 3M1YA 5CW2A 4QJIA 4DIMA 2XYQA 3HWWA 1ECBA 4X60A 3NHSA 3FLAA 3KB2A 2YMMA 5FUMA 4C7JA 1XA3A 3MB5A 1PG0A 4NFSA 4NEHB 5IFKA 4TKMA 3KLBA 3FJOA 1PFVA 5EQDA 4REOA 4UKDA 1CVIA 1R6XA 4LVNA 4UQOA 2ZJ4A 4LYHA 1B2RA 5AQEA 3Q0IA 1PR2A 2DC1A 2L42A 4U7HA 4OBWA 3THWB 4TV8B 3KPWA 3L7OA 4O6VA 3KAQA 1N1DA 4RVUA 1H8EA 1XT6A 1U2ZA 2WVJA 5L51A 2F9MA 3QVUA 3OJOA 1TVKB 5I7AA 3WK9A 4H3VA 4MS3A 3GLFE 5IH7A 2P4HX 3GVPA 2Y4NA 3L7BA 4YGYA 4OGFA 4YP1A 4F1WA 4LEIA 5T4HA 8ABPA 1T0IA 4PYIA 1DDGA 4RDIA 2ST1A 1T9KA 2JHFA 2TMYA 2DULA 2DHQA 4D9CA 2WJ3A 4KV7A 3CIFA 2WG0A 4NYJR 1YUBA 3DC2A 5FWDA 2GNPA 2PUBA 2HDNB 4EYGA 3RVMA 3W6UA 4R1LA 5DFAA 3N05A 1SU7A 3OZBA 1LV8A 2NP7A 2C9MA 3OEYA 3S28A 4QUAA 3A6JA 1O97D 4QHYA 3COZA 5CA0B 4QU5A 2VQFB 2VNSA 4F71A 3TZKA 2P62A 1XJCA 2QW8A 1E58A 4P32A 1VGQA 4AS3A 4G5HA 4JT8A 4Q19A 4NTZA 4YJFB 3U5TA 5CB4F 1G7TA 3K9QO 4WZBE 1UBJS 3LA8A 1PJRA 2FSGA 4KX5A 3ILYA 3R7BA 3CZCA 4KEAA 2XUKA 3C0KA 4NJMB 1NXVA 1JZTA 1BKDR 2VDVE 4YP9A 4ZVUA 4EFLA 2E0IA 3BGSA 1JQDA 3TINA 5H9VA 1OE0A 1XJWA 2DFTA 3G2LA 1I8TA 3PUKA 4RF2A 3JZIA 2XGMA 3SM3A 3GMIA 2F2TA 3KEFA 5LYYA 4DLWA 3K1TA 2CLKB 2XBLA 3T3EA 1CR1A 1XTSA 3I2KA 1SXGA 1YB6A 3VZCA 2MSCB 5ILQA 1TCVA 2XHZA 5EJ9A 4ND2A 1GL9B 1CRZA 3PLAE 4YCSA 4ZVKA 1X0VA 3Q7IA 1E9AA 2EL9A 2P9JA 1S8AA 2QT9A 5B2ZA 3TAHA 4BO7A 4D99A 1TF2A 3IKLA 2ZUSA 5GM1A 4QRDA 3NB0A 4RENA 5KOYA 2BJWA 3PITA 5TY0A 3Q7SA 4YMLA 4EHFA 4IHAA 4UQPA 2ZRNA 4EPTA 1UQRA 3CBGA 1VG1A 2J0VA 1RZUA 5LWHA 3LDGA 3G6WA 1B1CA 1O6CA 3P9RA 5DISB 4Z7JA 2VT2A 5JZVA 2IZ7A 2ZPTX 4DCOA 3OE7D 2I7TA 3VC7A 5EXXA 4RIGA 2QX9A 1GPDG 4RSHA 3ZE0B 4Z7QB 3U3JA 5HGJA 4DIUA 2ZAOA 2JLZA 2CNWD 3R3UA 4MR7A 3A1WA 4HNVA 3N2LA 3L4BA 2B2XA 1PWEA 3A37A 5EMKA 3O0TA 1O4VA 1EUCB 1BROA 2JFWA 3DB1A 1MPTA 1A97A 4FYKA 4QICA 4L7VA 2AOWA 3HCWA 5JROA 1VSVA 5HZKA 3R6WA 4RKFA 5GVSA 3LCVB 1R10A 2X3YA 4YLGA 4L16A 4FEGA 4OXNA 3OBBA 4UVGA 1LF5A 2HXSA 4Q4DA 1X7XA 2FWBA 3JZAA 4ZT4A 4JVSB 5K0NA 5B58C 3I5YA 2G71A 2ZRAA 5T64A 1PZNA 3TQHA 1LK7A 2ZIFA 2O2HA 3D3JA 1CJTC 4WINA 3AUKA 3DEJA 4X8HA 2OGZA 4P0PB 3J7TA 4YFVA 3WFZA 3LKZA 4BFZA 1M1NA 4P4GA 4ND8A 3A1CA 5KYWA 2XXAA 4D8XA 4D4JA 3UJ6A 3I9FA 1F2TB 5IBRA 2RI0A 1Z82A 3D3NA 4KN8A 2Z83A 2X8WA 1Q3KA 5I9SA 3UC9A 4HPXB 5A5DA 4KBYA 2P5TB 2W6JA 4F7WA 1DEKA 4ZPJA 4DV5B 2OORA 3RYFA 2E82A 3ZGXA 1HGXA 4J49A 1I0LA 2CV0A 1GTRA 5H16A 2ECQA 4MS4B 1AXEA 1L5QA 3E8SA 4ZVLA 1J0DA 3THXA 2HQOA 3O9ZA 4J1TC 3CX3A 5DVZA 5DMHA 2HA3A 3L0CA 3OZIA 2QLLA 3UTCA 3AL3A 1VLVA 3ND5A 4PWZA 1XHFA 2XMBA 4JY7A 4DA4A 1UDWA 3I2HA 1EH5A 1II8A 3VZSA 1X77A 3ESDA 3OJXA 4IILA 1Z8HA 2CUTA 3M33A 3R4CA 4L73A 4XUCA 3RTDA 3NAQA 2ODAA 4ER3A 4F3KA 3F6BX 3LG2A 3QU4A 4Q1DA 4UU8A 5AM3A 5CVVA 2WSYB 3L6OO 2IYUA 3E0QA 3C43A 3FSGA 4KTTE 5C8YB 2HKIA 1UM8A 5G0UA 1QR2A 2H7CA 2YOHA 4F6CA 1USKA 3EOAI 2PD3A 2AF3C 1M2NA 3DPSA 1H4SA 4MQEA 3EVGA 5A7GA 2P9TA 3P2MA 4QOFA 1Z5UA 2QM0A 2D4AA 2AX3A 3B1KA 4M9RA 3UM9A 2CNNA 4QM6A 1N32B 5K3FB 4CLOB 1R0ZA 2FZCA 1TC1A 4GXTA 2G9VA 5CLJA 5J4YA 3N2IA 2JNWA 5F3RA 5F73A 4A1FA 3OQIB 1UT5A 1V1MA 1JXOA 3OQHA 3OTIA 2P1RA 2FN9A 1N5KA 2O2EA 3UUFA 1KNXA 1G4HA 1J8FA 1RRKA 2GPBA 1CHDA 5DM0A 2PZ8A 3CH6A 1BXGB 1ISFA 4WADA 4UE6A 1GDHA 3OPMA 4MGZR 4X24A 5DBGA 3CUYA 4DM4A 5C53B 1RJEA 1ISGA 1AJEA 1TQ6A 1AK9A 5JUWA 5LUBA 3PHJA 4BQSA 1SWWA 1GT6A 2J9RA 3IO3A 5AJWA 2BTEA 5DLDA 1AHNA 1HDXA 1WXHA 3SEQA 4QG3A 1QS0A 5JXHA 5BOSA 5KS2A 3NOVA 4UU0A 4RIIA 1TYBE 5K1ZA 2YKGA 4BEBA 5M34A 1ZGZA 1QJ4A 2H1WA 2YJ4A 3GZ4A 1CZLA 4TMKA 4UXIA 2A9PA 4QFCA 1ZW1A 1BQEA 4HH0A 4EKYA 3A32A 4ECEA 2V9CA 1D04A 4IUDS 3LY5A 3HBMA 1BMFD 3WQQA 4HDOB 4PSVA 1YR8A 3RVOA 4W6QA 3D7SA 2C97A 3VNSA 1VHTA 2HCRA 4NS4A 2PUTA 4GRIA 4HV4A 1N9KA 3ORSA 1JEDA 4R0NA 3TRJA 2A0FA 4V3BA 1PQ4A 1EU1A 3FNRA 1S3SA 2EFCB 4HXEB 2FW6A 2VNKA 5DHSA 2YWJA 3SS9X 2QW0X 4BN5A 5IVPA 1GV1A 1ONOA 5KI6A 4NPAA 4PLCA 5KDLA 3QZUA 2WTUA 1ITZA 4ESEA 2O8CB 4I5GA 1Q92A 2NO6A 4QTUB 3PCTA 5JWRA 1R4MB 2CFOA 2FMTA 3EEQA 1SC4A 1XRLA 1YE5A 4MIEA 4BNTA 1TZJA 2PH1A 1ADBA 1CETA 4YCNA 4YRSA 4C07A 1G2OA 1PYOA 4XXHA 3EZNA 2OM2A 1K7SN 4HP8A 3RU7A 3M3HA 3T94A 3STYA 1VYTA 1HSOA 1IATA 2R6JA 2I65A 2NO7A 4FR5A 4R8RA 1H8HA