2J0VA

The crystal structure of arabidopsis thaliana rac7-rop9: the first ras superfamily gtpase from the plant kingdom
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
180
structure length
178
Chain Sequence
b'SHMSVSKFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVAVDGQIVNLGLWDTAGQEDYSRPLSYRGADIFVLAFSLISKASYENVLKKWMPELRRFAPNVPIVLVGTKLDLRDDKGYLADHTNVITSTQGEELRKQIGAAAYIECSSKTQQNVKAVFDTAIKVVLQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAC-LIKE GTP-BINDING PROTEIN ARAC7
publication title The Crystal Structure of Arabidopsis Thaliana Rac7/Rop9: The First Ras Superfamily Gtpase from the Plant Kingdom.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Nucleotide-binding protein
total genus 56
structure length 178
sequence length 180
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2j0vA00
5B64A 3BOSA 2XNDD 1W7AA 2HV8A 4H1UA 4NYIQ 2OFOA 4ASUA 1SVOA 4LBYA 4Z51A 3CR8A 3QI2A 4A8JA 4LHYA 1U0JA 1MRNA 1TTTA 3CRVA 3UANA 2IXGA 1XTRA 4ILEA 4ARZB 3VU9A 4UQOA 1NIJA 5B57C 4FMBB 3PITA 4AKHA 1E9BA 3QENA 2OXCA 2YJTD 1Y3AA 2VSFA 2XZOA 1KI7A 3GLGA 2ZE6A 3CB4A 3MJRA 1JR3D 1US8B 4NHOA 4LPSA 3UATA 3Q7QA 2FH5B 4B35A 1PV4A 3ECCA 1W4CA 4TMXA 4B2PA 3SQXA 1TQDA 3DOEA 4E09A 1MV5A 1A5TA 4I99A 3PEWA 1VDZA 4MGIR 4FCVA 2OG2A 4D4JA 1YR7A 1KK1A 4Q9IA 3TW8B 3V4FA 2OAP1 4ZDWA 5JSZB 2QZ4A 4D6PA 3V9PA 2ZJBA 1VCIA 1DAIA 2LWIA 1Q0UA 1T3SA 1UKEA 4EFLA 1ZM2A 3ZVNA 1KTVA 3U6BA 4D82A 5KOYA 1KSFX 2QTHA 4B74A 3WBKA 2QGNA 5JECA 1EFUA 2OAQ1 1VHLA 1Z6XA 1OFTA 2O8FB 3SEAA 2QNRA 2OSBA 2QTFA 3F0TA 3TR0A 1N5IA 4OI4A 4MDFA 1NVVQ 4DCTA 5B30A 4C0JA 1WA5A 5CB8A 2QMHA 1OHHA 2ZM5A 4KI0A 1RC8A 2XXAA 2O8EA 4FMCF 1P60A 1YZLA 3QF4B 4HZUB 4QNRA 4WVFA 3Q85A 2PBRA 3MGCA 3OEHD 1LS1A 1GKYA 2C03A 2P2LA 2N1BA 5IK2A 3E2IA 1H8HA 2O52A 1KAOA 3R8FA 4CF7A 1JI0A 1GNPA 4WIAA 6Q21A 4QL3A 4BFVA 4HUTA 2UZIR 3O8RA 2EYQA 1K5DA 2BOVA 5K8UA 2KJQA 1FFHA 3NBXX 4C0BA 5J4HA 2V3CC 3OAAD 4L5BA 4MYUA 1XPRA 5HPYB 1FUKA 3T35A 2AKAB 4M9XA 3FE2A 3I5XA 3DVLA 1XPOA 1TEXA 4QGGA 4QM7A 3H84A 4O2RA 2VHJA 2VLIA 2X77A 2XZLA 1UBFA 1G20E 5G3ZA 1CR2A 1R5OA 4JMPA 5EXPA 5HE8A 2A5YB 4BPBA 1G6OA 4ESVA 4U7DA 2DWOA 5JI3E 2QMOA 5GVSA 2J3EA 1Z47A 5EQTA 5FBQB 1AJEA 1P6XA 1LY1A 1EFCA 2PJZA 2RCNA 5EUQB 2RGDA 2Z4SA 1B23P 2FU5C 1M7GA 3CH5A 1HY3A 1NY6A 1XZPA 2BHRA 4JLJA 4JLVA 1SHZA 4L8GA 4Q4JB 2PCJA 2BVNA 5FPTA 2FSIA 3U44A 5KTYA 2WOOA 2WKQA 1U9IC 3HPRA 3U60B 3O8DA 1EGAA 2C77A 1E2JA 1GM5A 2F1JA 4DLYA 2QPAA 3IIJA 1YR8A 2PEYA 4QM6A 1KI9A 3HDTA 3G5UA 5HCNA 4TLBA 1GL9B 2QROA 5CM9C 1E2FA 2NG1A 2ZJOA 2VPPA 3SFZA 2FOLA 2RHDA 2IK8A 2WKPA 5EXTA 2PLRA 3IBGA 5EJEA 4F4CA 2ONKA 1J70A 2Z6VA 3AF3A 3UPUA 2DPXA 3GJXC 4M2LA 4EJSA 1EWQA 3ICEA 3C14C 1I4TD 1LVGA 2FV8A 3C8UA 3EC1A 2OFWA 3M1IA 3OAAA 3I1FA 1IN8A 1NL3A 4M0LA 3KKMA 4V0ME 5FBLB 5FUXA 1NSTA 4UJ3A 5ELXA 1T5LA 3AKEA 1E0KA 3AP2A 4GMXA 4BLSA 1I4LD 1D5CA 2BV3A 2IUTA 4LX0A 5BW8A 2WWYA 2YKGA 4RKFA 4AK9A 5DGXA 3RHFA 5KUTA 2GJKA 4RY2A 3B85A 1KO1A 1ZINA 2A3RA 3LQQA 4LYJA 4Q9HA 3V00A 4BLRA 3P32A 2EW1A 3LV8A 3PEVA 2JLZA 3P4YA 2PZEA 2ZETA 3A1UA 5FOVA 4GDFA 2NQ2C 4GOXA 1G18A 3CX8A 4CEIB 2ODEA 4NMMA 2VHTA 1ANKA 2JJ2D 1NG1A 4Q4HB 3SJCA 1XZQA 3TQFA 5DN6D 5IF9A 2GJ9A 2V6IA 2ORWA 2OCPA 1W48A 2DFKB 4L16A 3RABA 1ZU4A 2QMEA 1NP6A 4PZYA 1QHHB 4ERNA 4ZI3A 1U94A 3LO5A 5KDLA 1XBTA 4FXPA 1R8QA 2IA5A 2FA9A 5DISB 4F4IA 1Q12A 2C2HA 3QEOA 3B5JA 3GLHE 4QBHA 4URZR 1XU4A 1R10A 4NBSA 1ZYUA 2ZS8A 2V7QD 5TARA 2GF9A 4JLNA 3ZZTA 4DCUA 5EP2A 1G5TA 1OXUA 5CIQA 1KSJA 3WYFA 1VG9B 5TY0A 4D4KA 1IM2A 2BMJA 3QBVA 2EFEB 3K9LA 3AF0A 4B3CA 1N5JA 1TNDA 5GJBA 1M7HA 3HJNA 2YZ2A 2ERXA 4QGAA 3QBTA 3P27A 1NN1A 3SHWA 4KYIB 2DBYA 4KITB 4PHFA 1KZGB 2XEXA 3LAWA 5KNCA 4M9SA 4P4TA 1T3LA 2RB4A 3PENA 2ATVA 2P5TB 3GLGE 4BEBA 3AB3A 4B3FX 3IHLA 2FFQA 1P72A 3HWSA 4JYCA 1JAHA 1GIAA 5J4VA 3QSYA 2PT5A 4WZAE 4KHZA 4F7WA 1UKYA 1YE8A 3HYTA 1FX0B 3E1SA 3PV0A 5FOSA 4H9GA 1HA3A 1KJYA 4K46A 4TYWA 3IBYA 4DLTA 4QHSA 1NN0A 1N6IA 4WOPA 1MH1A 4LPKA 5FPSA 3GEHA 4IFBA 3KJGA 1NKTA 3NBFA 3VFDA 3F8TA 4Q1BA 3AVTA 1JAIA 4W5HA 3EPHA 3K0CA 4P4SA 3FTQA 3LRPA 1HTWA 5AUNB 3AF2A 3GJ8A 4KYUA 3A8TA 3IPXA 1FQKA 1GDDA 2V7QA 1WBDA 2ZSBA 2PT7A 1XEWY 2MSEB 1SGWA 2J0QA 2ZJ5A 4PANA 4ZKEA 4MQBA 2I1QA 3A4NA 3QE0A 5DHAA 3UG6A 2GXQA 3N70A 2XOKA 1M7BA 4OBEA 4UJ5A 1T9HA 4NH0A 4YXWA 2V4ZA 2FJUA 3RS5A 3TKLA 2RMKA 1DE0A 1YU9A 4FMCB 4IHQA 1KO5A 5G40A 1NVWQ 3UK6A 2OLJA 4NONA 5HE9A 1DELA 1G3IA 1X8LA 3OEED 2ZAOA 3DHWC 3ZIAD 1W2GA 4U5XA 5CK4A 2FF7A 4LV5B 4R2IA 521PA 4A92A 3PIRA 2OBMA 2Q9CA 5E7JA 1TQ2A 1U2RA 1OKKD 4I1OA 4EDHA 3U6KA 1RPZA 5FTKA 1E1QA 5FUYA 3ADDA 3R20A 2J0VA 2ZR9A 4D0NA 2A5FA 2ORVA 3U3JA 1OFUX 4WA7A 3TLXA 4H1VA 4PQRA 1MT0A 4Q4AB 2RGAA 2ZPTX 3TJZA 1Q57A 4II7A 1E0JA 5G41A 2J0UA 2TMKA 3SR0A 1RE0A 1NLZA 2X1VA 5E3HA 1OH6A 4RZXA 1QG2A 4HAUA 3AVUA 1DO2A 4JKYA 3K8YA 4JLMA 4R71A 5KDDA 4IEIA 4X8MA 3PFIA 2J87A 3I32A 1SXJA 2YWHA 1NMYA 4FD2A 3OE7D 2ZUDA 1KI1A 2ZRNA 5AUPB 1Z6AA 1FW6A 4US2R 4BFUA 5KSPA 4UNRA 4LZZA 1RRFA 2WSSD 1U0HC 2FFHA 2FSGA 4CYMA 2R6GA 1QG4A 3M0EA 3FVQA 4P31A 1FMJA 1T0HB 3MWKA 2G1KA 1UDWA 3SZRA 1PLLA 1XMSA 2J46A 3VNUA 2IYWA 1IOZA 1KY3A 1GL7A 1TF7A 1W4AA 2CCKA 2QRNA 1ZW6A 3TVTA 2BCJQ 2F1HA 4DEXA 2C04A 3LW7A 4TLDA 1S4QA 3H1TA 2QE7D 1D6JA 2IXEA 3P26A 1JEDA 1XX6A 1DAKA 3FHCB 2WM9B 5FL7D 3TRFA 2KBEA 5EE5B 4KBFA 2IC5A 3GEEA 1AGRA 2ZSAA 1JEEA 2REOA 3QPWA 4Q66C 4LJYA 2W6JA 5E95A 3GLFB 4A4DA 1Z29A 1HEIA 3FOZA 2KE5A 1AS3A 1VIAA 2KWIA 1AZSC 4TYPA 1S0UA 1E69A 3THXB 4QGHA 1OH7A 3LDAA 5GJWC 2CNWA 4QJ5A 5JWHA 1XD8A 4ABYA 3TSZA 4F93B 3QKRA 1FUUA 3QEJA 4HZIA 1WP9A 4CRWB 3RRMA 2GXSA 2YHSA 1PZNA 2OM2A 2RGNC 2DFTA 2ZROA 2FNAA 4A2PA 3NIBA 3T1TA 2ZE5A 1XD2B 2BM0A 1XEXA 4Q1CA 4CZ2A 3AVWA 4FWTA 2IX3A 1G16A 4AG5A 3AVXA 4IVPA 2ASEA 3NHBA 1X6VA 1LF5A 3FDIA 3MD0A 4AI6A 1F2UB 2WSSA 3CRMA 5KSOA 3U7GA 3Q7PA 2XITA 2UZ3A 1QHGA 4NYIR 5DLQC 4M9ZA 2GCOA 3Q3JB 2G0TA 3C5HA 3ADBA 3AKDA 2BBTA 1P75A 1KDOA 1Q44A 4MGKR 5DI3A 2CXXA 5B58C 4HAYA 2FFAA 3FB4A 1Z0FA 1ODFA 3HU3A 1Z2AA 3CKLA 4AKEA 4Q18A 4B3GA 1NF3A 2G77B 4B43A 3FFBA 1G7TA 3ZJYA 1NIPA 5K8LA 4JLDA 1KHTA 3B1YA 3VX4A 1M6NA 3EA0A 1FTSA 1AS2A 1F2TB 3B82A 1JJ7A 1G5RA 4EPYA 4XWOA 4AKGA 3CNNA 2YYZA 3QXHA 1GRNA 1E6CA 2D2FA 3DKVA 1D9XA 3ND8A 2DWQA 2GXUA 3BK7A 3PXGA 2QU8A 3RNLA 4EQ6B 4EPTA 3W90A 2X2EA 4PX9A 2VP0A 1UKVY 2ODNA 5SZJA 1BKDR 4RCYA 4Q9JA 4LBWA 3GJ6A 3JZAA 1ZMXA 4LV6A 2O0KA 2RGBA 4ZO4A 1E9DA 1G3QA 4RFSB 2G9NA 3QPVA 3W6PA 2O8DA 1KK3A 1XMVA 3JVVA 2IS1A 2ZR0A 1ZNYA 4OQXA 4XVUA 4TWZA 4TT3D 2IEYA 2CLCX 2VIIA 2VTKA 1Z06A 1VTKA 3MLEA 2RKOA 4GPTA 3ASZA 1W0KD 4OHZA 5DYIA 1GAJA 3GFOA 5HCIA 4Q9LA 4AC9A 1IN7A 1FZQA 3W8NA 1NMZA 2EFCB 2JASA 3P20A 1HUQA 2YWEA 2ZVQX 2BKUA 1A2BA 2JLYA 2CHVA 3R7WB 3Q5DA 4Z1MD 1BMFA 2W2XA 3O47A 1TADA 3I4LA 1QVRA 4OHWA 3IEVA 1V43A 3I5YA 4CVNA 1D2EA 1XTIA 2OEPA 4Q4LA 2ZTSA 1SZPA 1F5NA 5ANRB 3R9WA 2VQSA 5JEDA 4MGYR 1FNNA 4IOMA 4TTQA 1X8JA 2CJWA 4B75A 1NI3A 1YR9A 3IPYA 2CLDX 1QHYA 2ZE7A 3BS4A 3PR1A 5K8IA 5K8TA 2ORIA 4BFTA 4O3MA 3MSXA 3NG1A 2QQ0A 1DS6A 1TUEA 3X1WA 3A4LA 4P4UA 5L3QA 2I1VB 2CE2X 3C41J 3FFAA 4PHTA 5FFMA 3M4YA 1WF3A 3EIHA 3IIMA 4G01B 2ZI9A 1L7VC 2J41A 4MRPA 1YZGA 4DUGA 4NCJA 2JCSA 3G0HA 1OXTA 4PSKA 2D06A 3CWZA 2IW3A 3I8SA 3T1OA 1JBKA 1U99A 4N3NA 5JI2E 3TH5A 2HLDD 1AA9A 1Z8FA 5CITA 1YJ5A 1NVXQ 2ZYTX 4NKRA 2PZGA 4Q5IA 1BOFA 1G1MA 1P73A 3AVOA 1AM4D 1IBRA 4HAVA 4LRWA 1GP2A 1W49A 1RFLA 3AEZA 4ARZA 2GWHA 2R2AA 4CGZA 2KB0A 2XTNA 3A37A 2R44A 4OQLA 1QF9A 1P9NA 4OHVA 4KXFB 1SXJE 1F3OA 3ZQ6A 2G88A 4TYQA 3WBJA 4QRHA 1U81A 3EARA 5D3MB 3RAPR 2GJSA 3CRRA 1ZM4A 2CL7X 1KAGA 4FI3C 3BE4A 5AUOB 1CJKC 1CXZA 3AVYA 4NCHA 1A2KC 2C8VA 3TW4A 1WE2A 1OLOA 1T6NA 3RRYA 5C1BA 5F9FA 2YOFA 2GAAA 4TSFD 2J7KA 4ZIRB 1OPXA 3GLIB 1AZTA 1BIFA 1ZNWA 3T61A 3WHKA 4EUNA 2O8CB 3T1QA 1ZNZA 2IF0A 2IEZA 3ZD7A 4TQAA 3WYAA 4TTPA 2OXRA 5CIWA 3AVQA 2OESA 4XH9B 4OYHA 1RRPA 1QZXA 4OI0A 2O8FA 4I1UA 4K81B 2OE2A 1R0XA 4BLTA 3WY9A 1XP8A 1COWD 3RS0A 3OF5A 1SKQA 4US1R 3PCRB 5JJKA 2XSZA 4OI1A 1UF9A 1W44A 4DB4A 5CB6A 3REGA 2F3TA 3T12A 2XGJA 4YONB 3VR1A 1FQJA 2OCYC 1MO3A 1E32A 2P5SA 3EWAA 4LJ6A 3QF4A 4HZUA 4RD1A 3UMRA 1KO7A 1T3HA 3AUXA 5CDFA 1KIMA 3X1XA 1EG7A 2WMOB 1YRAA 1QHXA 4JSTA 1Z5ZA 4A15A 1HE1C 2NIPA 3QKSA 3WMGA 2OBLA 4QC2A 1E99A 1A4RA 2BJWA 3ZVLA 5IT5A 1JECA 4U00A 2VA8A 2NO1A 1AK2A 4DVGA 5BXQC 3SQWA 4DLZA 1FTNA 3FMIA 3B9QA 4IOLA 2VF8A 4JL6A 2I4IA 3AP3A 4JT2A 1R4AA 4M1WA 1F48A 4DCVA 3TGPA 4GT1A 4Q03A 4C2UA 2ZEJA 2W00A 5KHOC 4NYJQ 1VYVA 1E98A 5CLQA 1RW4A 2IXFA 4BGDA 4OHXA 2Q0HA 3KZ1E 2CL6X 2F9LA 1GZSA 2GZAA 2LKDA 2W2TA 2BEKA 2WWGA 4TL6A 1GVNB 3EXAA 1KK0A 3FMFA 4PPFA 1JPJA 2IBMA 2W6IA 1UADA 3IQXA 1X1RA 1LS6A 4MITA 1OW3B 1RYHA 4NYMQ 3AVVA 3BWDD 3NC1C 3AH8A 2Q3HA 1Z0DA 2XTZA 3DMDA 1ZCAA 4G5SA 1XDBA 3SYLA 4ACBA 1JALA 4G1UC 2BEJA 2RGXA 4HUQA 1T0JB 1TAGA 3CW2A 2XAUA 1W5TA 2ZS9A 2QUZA 4FWIB 1G64A 3L82B 1ESMA 1R5NA 4Q4JA 4B32A 4JLAA 4Q1FA 1H8EA 3KQHA 4N1AA 1KKLA 3VR2A 3NXSA 4TL8A 2ZITA 3LVRE 4RD0A 3OESA 4U02A 1EWRA 1EFRD 2XNDA 1R6BX 1XB2A 3SS8A 1VCNA 3C15C 4OKSA 1TPZA 3QXSA 3D31A 3K0FB 5FI1B 1ZUIA 4EIWA 1II0A 5FUVA 1II8B 4JBYA 2XJ4A 4R7ZA 4ZCMA 1HV8A 1VHTA 5AJYA 3P1JA 1PLJA 1Q1QA 1VG1A 4DC9A 1XD9A 2ZRFA 2CVHA 3REFA 1C1YA 2JLXA 5E4FA 4OJKA 3U3RA 1UDXA 2X19A 2JIZD 1JR3A 3NVAA 4IRUB 3CR7A 5L3SB 3E5HA 3TUZC 1HURA 4PR0A 2BM1A 2NZJA 3HP1A 3UWKA 1J2JA 221PA 4A9AA 3AF4A 4G5GA 4BE7B 5CLLA 4LBZA 1IXRC 4QKQA 2J5XA 2YOGA 4FMDF 4GRAA 4LCBA 4DT1B 2AL7A 4ZKDA 2JLUA 2W83A 4OI2A 3QY0A 3L0IB 4MDEA 2A2ZA 3SE0A 2VL7A 4PFSA 3GEIA 1E2EA 3LW8A 2ZRGA 2FWRA 1EX7A 3IDQA 3GJ5A 3QXXA 4M1TA 3VU9B 1DAGA 4EPWA 2PH1A 2OBNA 2QP4A 4O25A 2ZJAA 2ERYA 3RC3A 2ZANA 1WB9A 4CEIA 2C9YA 4Q4HA 3KJEA 1VYTA 1N6KA 4LJ7A 3QJYA 4WZBE 2ZI7A 4DSTA 4HAZA 1Z83A 4E03A 2A7QA 1S1CA 2NPIA 1IXZA 3KTAB 2ZYUX 3MRSA 1E94E 4RD2A 3ONWA 3ZH9B 5J4YA 2FPLA 4CW7A 3D6TB 1I2DA 1G8GA 4Q7KA 3CZPA 4JYBA 1CR4A 721PA 1EFRA 3BH7A 3VKGA 4M1MA 1NBMD 2ZI5A 5EE1A 3IHWA 3BFKA 3PG5A 3W5IA 4WW0A 4C30A 3NH6A 4QBGB 4Q47A 4IJMA 2GESA 5L3RA 1T91A 4MKIA 3PUVA 2HEIA 4RVCA 4ACAA 2NMVA 2AXNA 1CJUC 3EIEA 3OEHA 4A0RA 4PSAA 2FN4A 3TQCA 2P3SA 4PPNA 1N5LA 2VP5A 3K9GA 1Q22A 3LLUA 5HZKA 1WMSA 2DCUA 2QL6A 2D4HA 4RZUA 4JLPA 2CK3D 4UXHA 1OSNA 1HT2E 4B2LA 4DXAA 3LBHA 3MUFA 1DADA 4OL0A 1JR6A 4W9MC 2JDID 1CJVC 4CEJB 1IHUA 1YZKA 1OIXA 1W0JD 4CEHB 1JPNA 3W8RA 3KKNA 2XXAB 1AKYA 2H1LA 1Q1BA 2FZLA 2YINC 3U7EB 5SZKB 5FBVB 1E4VA 3KL4A 2QM8A 3EA5A 1JJVA 3H2YA 1UFQA 1G4UR 3QPUA 4PZZA 2DHRA 2DWPA 4Q02A 2VHUA 2VP4A 2WJHA 2JATA 1E0AA 2ZREA 5AJXA 1FX0A 2O8BB 3AKCA 4LHVA 4WZ6A 1CBUA 4A0HA 1AQUA 2JJ1D 3EZ9A 1P2TA 2WWIA 3HU1A 1KYIA 1GL6A 2ANBA 2EFGA 2QGZA 3EC2A 4Z8XA 5A0FA 1DOAA 4MUAA 2N42A 2F6RA 4G5QA 2ANCA 4UNSA 1R0WA 4NE2A 3MWJA 2KI5A 3RSLA 2A5GA 1UBEA 2QTVB 3MFYA 3SJBA 3KXIA 3X1DA 4AIIA 4M1OA 1WDTA 5G53C 2J7PD 5JS7A 1YQTA 3CBQA 2GKSA 2WPDD 2JJ8A 3E70C 3WMFA 5KSZA 2OO7A 1M34E 2VO1A 3WNDA 2CDNA 1PLKA 4GNKA 2QAGB 4LYFA 3KB2A 4PPGA 3F3YA 5FUWA 3ZQJA 2ZR7A 2OT3B 4LSGA 2W2VA 2AD5A 1N6PA 1GTVA 2CE7A 4MA4A 2CLSA 5EE3A 4HEJA 3CLVA 4DLRA 3EWSA 4NCKA 2GEVA 3FGNA 4A2WA 1D9ZA 4YMVA 4JLOA 1KKMA 5CDFE 2ECKA 4BLQA 1SVWA 3S1AB 3RS7A 4TYNA 1XEFA 2VEDA 4GOKA 1Q21A 3GFTA 121PA 2REXB 3ZS8A 5DH9A 3CPHA 3CX6A 2PJRA 1PVOA 1NVUQ 2IYZA 2Z5FA 2ZRAA 3VR6A 3C16C 2BMFA 5F9HA 4Q4AA 3GJ7A 4JL8A 4C4PA 2C98A 5KU1A 3THYB 4G3XA 3GPLA 4LOAA 4QFMA 2ZJ8A 5KYKA 2O0JA 1C9KA 2GAOA 2ZRLA 5SZHB 1HT1E 3R8CA 3VMFA 4DIEA 4KSBA 3CPEA 4LHXA 1UEIA 2JJ2A 1Z2CA 1TF5A 2GBLA 5DN6A 5EZ6B 3PVSA 1GITA 1CJMA 1YKSA 4LJ4A 1U8ZA 3PUWA 1XPUA 1P61B 2FPKA 2QI9C 4DHEA 4JLBA 1CRPA 3U3MA 2RGNA 1G6HA 1IQPA 1PUJA 2QAGC 1ETUA 1NY5A 3PQCA 1LNZA 4O0MA 4PAQA 1T4GA 4XOIA 1YZTA 2WJJA 3L2OB 4X8LA 1OJLA 3SNHA 421PA 3I92A 4YC7A 4BWYA 3SI7A 1WBBA 2Q6TA 3QQ5A 3AUYA 4PHGA 3B9PA 4Z54A 1TQ4A 3K1JA 3NHAA 3A1TA 4MUBA 5DSZA 5JRZA 5TMPA 4HB4A 1LB1B 3EZFA 3OFND 1SQ5A 2EFHB 5A4JA 2HT1A 1NLYA 2H7VA 3B8HA 4YQFA 1NJGA 1E9EA 5LDDC 3L0PA 1H65A 2FMXA 3TSOA 621PA 1U0LA 1OB5A 3K9NA 4Q01A 4NPHA 5CYOA 1Z28A 4PC3A 1RVDA 5H68A 3GLFA 1NKSA 1BYUA 3PUXA 1JR3E 2BMEA 5HR5A 2ZE8A 4IW3B 4CDGA 1KI3A 5AJWA 4EJSC 4RZ3A 1WRBA 1P7CA 2VSOA 3THXA 2RGGA 1XJCA 3DM9B 4JIMA 1DBSA 2WMNB 3NKVA 5JRJA 4MRVA 3WNCA 5EP1A 4FMDB 1AQYA 3RWOA 4WBSA 3UXMA 4EFNA 3LQRA 1E79D 1N5KA 2QORA 2C96A 2BMDA 1RKBA 2JGNA 2ZI6A 5FBRB 4DDTA 1KZ7B 1XD2A 1S3SA 3IILA 2WJYA 2QSYA 4DSUA 4HLCA 3AQ4A 4LHZA 3T1VA 4BZPA 4EKDA 1KJWA 1MOZA 3KQKA 4TN1A 1F2UA 3W6NA 5JBQA 4LI0A 3D3QA 2WBLC 3VNVA 3L0SA 2F43B 2QT1A 2F3RA 2XTMA 4IXNA 4RCZA 2OLKA 1XCMA 5BYJA 2E9SA 1ZIPA 5JHHB 2GHIA 3IQWA 3BH0A 4GBMA 3SYKA 1G19A 4N0DA 1G17A 1KMHB 3BAFA 4X8OA 3G82C 3FHOA 2P6RA 2H18A 3LXRA 4FIDA 3NDBB 4AWXA 3R9XA 4DCSA 3OFNA 1Q3HA 1OIWA 3ZIAA 3OEEA 3B78A 2IHBA 1OE0A 2G3YA 2ZRKA 3QXCA 1F2TA 4KFRA 2JLVA 1HQCA 2F1RA 5BWMA 2QQEA 3ZDQA 1OKKA 1UBGA 1UJ2A 2AX4A 1J90A 2VHQA 1ZC3A 1JXOA 1QVAA 1TQ6A 1W4BA 4OK6A 4URWR 1EFTA 3AKYA 1N6HA 4HLQB 1J99A 1MABB 2NZ8A 3DZ8A 4KAXA 4Q9KA 5F3WB 2DB3A 2GEUA 2OV2A 4C9BA 4RFVA 2WHXA 4BECA 1RJ9B 4RFSA 2E87A 2B92A 4G0NA 2W58A 2AWNA 3GQBA 1W46A 2AXPA 2BBOA 3KUCA 2NO9A 1OIVA 2LKCA 4MYTA 2HUPA 3VKHA 4V0NA 2GCNA 3ZS9A 1WXQA 1VPLA 1NG9A 1N3BA 1ZIOA 4B71A 3I61A 1BS1A 3OE7A 1BO6A 1P62B 3A1SA 4LHWA 2H57A 4V0LA 3BC1A 3WNBA 3UMFA 4ON9A 4OK5A 5LD2B 3B1XA 3FKSD 2G6BA 5FTJA 3TIFA 4ZV4A 1T8TA 1XF9A 3R7WA 4RZ2A 1FNMA 2N46A 4RKEA 3HU2A 3X2SA 1GWNA 3KFVA 4PZLA 3GJ0A 1KK2A 4JVLA 4MRRA 1S2MA 4BUJA 3CONA 1IY1A 3QVUA 1FL9A 5DO9A 4A6XA 4DCNA 2IYSA 2RHMA 2YC2C 3N5CA 5H1YA 2XB2A 2RAPA 3B2EA 1IN6A 4DDWA 1M74A 3CO5A 4OJQA 3SJZA 2QE7A 4DRZA 3I73A 5CYPA 4KCGA 3UKDA 3EPLA 5FL7A 3CM0A 3TK1A 1SKYB 1XXHB 4TL9A 3SBDA 2ODBA 2QA5A 1ZD8A 3AM1A 4AYTA 4S35A 3H0KA 3U4QB 1GILA 1DG1G 2VYFA 4TMKA 3BJIC 2WIBA 4EPRA 4I4LA 2AWOA 2ZU0C 4PC6A 1IJEA 1IN5A 5J4LA 2J1LA 4GP6A 4BFXA 1E2HA 2WVJA 1OXSC 3AF1A 1DAEA 1DAHA 3B1ZA 4WXRA 1RRCA 5F98A 2MSDB 2QG6A 3CNLA 3TNFA 3X1YA 1CULC 4ESHA 5L3VA 1XFAA 2C99A 2VHCA 2QT0A 2WICA 2WWWA 1N0WA 3PEUA 4NDZA 4A0FA 5LD2C 1KI6B 3NBZC 1G3RA 5JMTA 1OYWA 3EPKA 2V9PA 4EAQA 2GK6A 1U98A 1CS4C 3A36A 3F5FA 1NVVR 2PMKA 1KNXA 3ZGXA 3LFUA 4TLAA 3U3OA 4FCTA 3IO3A 4TMZA 1OFHA 3B60A 2Q3MA 2C78A 5JJIA 2QAJA 4Q1DA 1D2MA 4LGMA 5C46F 2NPFA 2OCBA 2FGKA 4BRWA 2A30A 1TF2A 3K0EA 4UNQA 2GJ8A 1K5GA 2FFBA 2H5EA 1P2SA 2K5UA 1XJ0A 4I81A 2XB4A 1VKJA 2Y8EA 4Q00A 4KFTA 2C5LA 2CEAA 2Z83A 4ZIRA 1CIPA 1E2GA 1EFHA 4G5RA 3GLIA 1A1VA 4JLKA 1EX6A 1P2VA 4M9QA 5KPDA 2H92A 2WIAA 2ZYVX 3MMPA 2O8CA 2QPTA 4PXAA 2R6CA 5C4GB 3DEFA 2IYXA 3UWOA 2AFHE 5C4MA 1XTKA 2QRZA 3GP8A 5J40A 3Q8XB 3LBNA 3N2EA 4KO8A 4LJ5A 1GG2A 5FOWA 3BXZA 1Q3TA 1IY2A 2D74A 1J8MF 3T34A 4W7SA 4HLUC 4UNNA 5LPNA 1K6MA 2WAXA 4TMWA 3BH6A 4LWZA 2Z4RA 1Y63A 2OZEA 3B13B 5AWFC 3GLFE 1CKEA 3OZXA 2R9VA 4US0R 5AUQA 3AVPA 1FOEB 2GEDA 3EPJA 2P67A 3BB1A 4IVQA 3BFVA 3ETLA 1OYYA 4TT3A 1W4RA 2D7DA 2W0SA 2ZRBA 3LBIA 2PX0A 1E9AA 2ZSDA 5E7IA 5JWRA 1VYUA 1KI4A 5JJLA 3EX7C 1W0KA 4L9SA 1DTSA 1SVSA 3ZLJA 1ELOA 4K8OA 1CLUA 1RRGA 3THWB 5KNDA 4MGZR 1OF1A 4QBIA 4XVQA 5FR1A 3FMOB 4M1KA 4POAA 1JQJC 1KGDA 4R2HA 4NZYA 1KNQA 1DEKA 4Z1MA 1US8A 1KMQA 2NO7A 3NC0C 4MH0R 4NCIA 2QBYB 4D80A 1N6LA 1E2DA 3K0AB 4OQNA 4XTRA 2PX3A 4A6PA 4LC1A 2GVDC 4QXAA 4D26A 3ZVMA 2ZJ2A 3LNCA 4ASUD 2Z43A 1IXSB 2ZRHA 4TQ9A 2BJVA 4OQFA 3SN6A 5JSZA 1SVKA 4KLNA 4B34A 4DLWA 2J0SA 4OK3A 4E22A 2BIFA 1E9CA 1R0ZA 3AV0B 3W5JA 3CZQA 3K9HA 5J4KA 2ODWA 1LTQA 2AR7A 2EYUA 4BLOA 1ZD9A 2B21A 1I2MA 1Z22A 2ONJA 1Z0AA 3OIVA 3UMSA 1D2NA 3GCGA 4URUR 3QKUA 2ZAMA 2WSMA 3KQNA 4DLUA 2HCJB 3H4MA 1UAAA 4DWJA 3VKWA 1FP7A 1F60A 2H8KA 2DY1A 4DDUA 2A78A 1W36B 3CX7A 2VH5R 4LJ8A 2DFNA 2IS2A 4ZDIA 3NTUA 4KJZA 1UBCA 4KBGA 3WXMA 3VQTA 4KVAA 4F92B 3RLFA 2HLDA 3DL0A 4B44A 3FMPB 4LYAA 1G8YA 2GXAA 2AKYA 3PJRA 1TU3A 2WTUA 3K0FA 4V0KA 4JJZA 2ZRDA 4B3XA 4XIGS 3WRXC 1EK0A 4YDSA 2GNOA 2HF9A 2RGEA 4PTLA 4QHYA 1W2HA 1CP2A 1KJZA 3VR5A 1U9IA 4BFYA 4DLXA 3LWNA 2IYQA 3K53A 2F9MA 3HR7A 1V5WA 2C95A 1KDPA 5BN3A 3M6AA 2ZI4A 4I1VA 1DAFA 1S96A 3WMEA 2C9CA 2W0MA 2XZPA 4XWAA 5L3SA 1X3SA 1YZUA 1GNQA 4MYCA 4PPQA 1LW7A 2ZXUA 2AHOA 4ZDKA 4IXMA 4WXPA 4KU4A 1YZNA 1OHHD 4HAWA 1D8TA 4DT1A 2PZFA 3MG9A 2JEOA 2VP2A 1EXMA 3EZ7A 2YNMA 4IOKA 4TSFA 2VRWA 2ZJYA 3DMNA 2QN6A 3QXJA 5DE3A 2WJGA 3ASYA 4FW9A 2CL0X 2P0EA 5HTKA 3THOA 1Q1ZA 1UPTA 2WWHA 5H70A 5IK2D 3A58B 4PO1A 4LBVA 1H8HD 2GDJA 2FEMA 2B6HA 4B76A 1W36C 1NSFA 2B7CA 3K09C 5JHGB 1L2TA 4D4LA 1E96A 1ZU5A 3CF6R 2V54A 4B3DA 3RS2A 2PMDA 4YMTA 4C7OB 3KTAA 4UXJA 2BWJA 1Z07A 1EESA 2VP9A 1COWA 1ZP6A 2ZSFA 5KO2A 3ADCA 4TLEA 3VHLB 1JNYA 4RD3A 5TXGA 2ZIAA 4QHTA 1IN4A 1YRBA 5JS8A 1Z6GA 3L43A 2WWXA 3HR8A 1E1RD 3B1WA 1CRQA 3KJHA 4ITRC 4TMTA 1GKIA 3CIOA 1L8QA 5FL3A 3J81k 1VMAA 4JL5A 4Q19A 4UNPA 3FHTA 5FTLA 2IUUA 3V4RA 2REBA 2ATXA 5M04A 3U2QA 3P4XA 2IYLD 4D4MA 5J47A 4GMDA 4Q21A 4BFWA 3GLHB 3PUYA 3LVQE 3SBEA 3KKOA 2HF8A 3KX2A 3ND9A 5DHFA 4KFUA 4GFDA 4CEJA 1SULA 1DG3A 3RVBA 5JWOA 4HDOB 4CEHA 1UM8A 2EVWX 2ZUCA 4MRNA 4YLGA 1ONBA 1ZUHA 4C0KA 3IKJA 1N6OA 2V1XA 1HQYE 4XSGA 2IS6A 3NBYC 2EQBA 4C0AC 1Z6YA 4Q7LA 2HDNB 4P3YA 3SC3A 4A8JB 3X1ZA 5C18A 3LX5A 3QKSB 3U7HB 2O8BA 4D2IA 3CH4B 1GUAA 3BRWD 4HDCA 2FSFA 2IUSA 3ADKA 3GLGB 3GLIE 5FH9A 5E7MA 3TAHA 2JA1A 4B47A 1GSIA 3QG1A 2ZRPA 1KOFA 2WV9A 2R6DA 4BRUA 4C0QC 4TL7A 2HYIC 5DI9A 2PCLA 4HSEA 4F4JA 1AS0A 4EPXA 2GF0A 5F2EA 1IJFA 4LK2A 3OIWA 5B2ZA 1QHHA 2BDTA 2V6JA 1UEJA 2CHGA 4JT4A 4MKFA 4UKDA 4RSGA 2RGCA 1E1RA 4CT5A 2FG5A 2JLSA 1KO8A 3DDCA 1MR3F 1SVMA 4C2TA 3DZDA 4A2QA 4TQUS 3NH9A 2YVUA 4DKXA 3IEUA 1E2QA 5JCPA 4IDOA 2QAGA 2V1UA 4IFEA 3A6PC 2B8WA 5AJZA 2D7CA 3VTKA 3ZZUA 3B6EA 3D8BA 4HUQB 4DZZA 1ZBDA 5FI0B 2GZHA 2DR3A 2HJGA 1G9XA 4M1SA 3VAAA 4W5WA 1L4YA 2Q9AA 4QNMA 3MAAC 1QHIA 1P3JA 2JIZA 2NGRA 5IDVA 3SYNA 3S1AA 4AD8A 3RANA 3GD7A 3BB3A 3WRYC 4A8JC 1J8YF 3C4JA 2B7BA 1A82A 2O0HA 2QM7A 4Q7MB 5BN5A 4HI0E 2IT1A 2O8EB 1W1WA 3LX8A 3I3SR 3THYA 2FGJA 4C0SA 3DOFA 2YOHA 3BGWA 3TUJC 1G8HA 1JB1A 1XJQA 3CWQA 2V55B 4M1YA 3DO6A 2HCBA 2FX3A 2BCGY 1GRQA 1OXXK 1G8PA 5KSYA 4A1FA 2P6UA 1TL7C 4TLCA 3KQUA 2QENA 3JZMA 1AKEA 3W3ZB 1KSHA 1ZNXA 2WZQA 4F38A 4ZCLA 4JVNA 3TSWA 1G7RA 1S9DA 3I62A 1P5ZB 1NBMA 1XTSA 3TMKA 3U3KA 1NJFA 1Z3IX 3CRQA 4XTCS 1R0YA 2V8OA 5EE0A 5H8WA 2HYDA 1Q1EA 1E0SA 2GK7A 4M22A 1KDTA 2AN9A 4GZLA 5FPHA 4LJ9A 5DNYB 2O5VA 2DFLA 3HYRA 3LD9A 5FR2A 1O3YA 5LB4A 4QG7A 5EUMA 3WP1B 4MKHA 1BYIA 4AYWA 3KQLA 1LV7A 2P6NA 1Z0JA 4JS0A 4PO9A 2PLFA 2CK3A 3IO5A 5FPYA 1CTQA 4XJXA 5SZIA 1Z0KA 1DVRA 1VCOA 1Q20A 4QJ3A 2JDIA 1OV4A 4DSOA 3U44B 4QBFA 3T06B 3CPJB 3BERA 1OB2A 1SHKA 1W0JA 2WKRA 3K70D 3AGQA 4D0LB 1G3UA 1G7SA 2J9RA 2G1JA 3WHLA 2GVZC 1P9RA 1CR0A 4KODA 5GVRA 2IYTA 3R9IA 2QMUA 1OT3A 3BBPA 1YVDA 4Q48A 2J59A 3SU8A 4EPVA 1N0UA 3L8YA 3KKPA 3EAQA 3AP1A 1DO0A 2MMCA 1GFIA 3AGPA 3VR4A 3TUIC 4BFSA 2XOKD 5IHPA 1ZM3A 2VSXA 3W3AA 4YXWD 3NDPA 4JKIA 4HDQB 2JJ1A 3GFPA 4IOJA 4B48A 2IWHA 2H17A 3NEJA 3RC8A 4A0GA 4YMSA 2JLWA 4EJSB 4DB2A 1O87A 1TMKA 1ZD1A 2KSQA 2GTPA 2HT6A 5FOTA 3FKQA 2G83A 3FYHA 2ZYWX 4XSHA 4DEYA 4GSYA 4NP6A 1NRJB 1E9RA 2ZRJA 1N25A 3ZD6A 1ZAKA 4KLZA 3KKQA 1XTJA 2HJVA 4FN5A 4URVR 4GP7A 2GILA 3EIQA 4AYXA 1E1QD 3KUDA 4JBXA 2J7PA 1F6BA 3UG7A 3Q72A 4JSYA 2F43A 2WPDA 3H86A 4MYHA 3WYGA 4BEJA 2XX3A 5JLJA 2IL1A 1E2IA 2BBWA 2WJVA 4P33A 4P32A 4IVRA 4GL2A 3ZYCA 3RS4A 4EFMA 1KMHA 1S1MA 1FMLA 1S9HA 3KB1A 3WP0A 1RYFA 4MRSA 2BC9A 4HAXA 1DARA 3KDSE 2ZVPX 3TVDA 1SVLA 4R98A 2OHFA 4PC7A 1NNEA 5BYKA 1SXJD 3VX3A 3GJ3A 2ZRMA 4LY6A 1RZ3A 3CRW1 2B8TA 2Q3FA 2A9KA 4YMWA 2PEZA 3UIEA 1ZC4A 4HLDA 4BFZA 5EXXA 2EWWA 4TTRA 1P2UA 1MABA 2AFIE 2GCPA 1XTQA 3DPUA 4HYYA 1VECA 4YMUA 1N0VC 4F91B 1ZM9A 4RD4A 1OH5A 1RJ9A 1MRSA 1II9A 2EU8A 2JLRA 1NLFA 4AURA 2NOAA 4E5UA 3EZ6A 3RRZA 2VP6A 2LCFA 1M8PA 4XVRA 4JZKA 5FTMA 2OFXA 5TB5A 4B6EA 2R6FA 1Z6TA 5FTNA 2R62A 5CJPA 3W9YA 4B6FA 3SOPA 3T5DA 3CNOA 3LH5A 4GI7A 3LA6A 4LJAA 2W6JD 3RYTC 3VHXA 2IYVA 1G7CA 2GZDA 4GZMA 1P9WA 2ZSEA 4KV9A 1NN5A 4DDVA 4V0OA 1VIYA 4AY2A 2FEOA 5FOXA 4B3BA 1GNRA 4PSVA 2CNWD 4I1SA 4WAUA 1KI2A 4DIDA 1QDEA 4KSCA 1M2OB 4D81A 2DYKA 3A4MA 3IUYA 1AN0A 1Z63A 2WOJA 1JXMA 3TR5A 3VR3A 3U7FB 1KO4A 5AR1A 3QIAA 4TZ6A 4JJKA 2J45A 1XCGB 3C7KA 1MO6A 1XXHA 4O2LA 1X86B 4P4SB 3JVUA 4IKEA 5EZ5A 3ICQB 4TMVA 2Q9BA 1HH4A 1T5IA 1KY2A 3K70B 3U4QA 4L15A 3KJIA 1CU1A 1QHNA 5IRCD 1IAQA 4EQ6A 1TU4A 2AK2A 2CCGA 3MWLA 2VBCA 2IYYA 2XNSA 3FWYA 3U5ZB 2QSZA 1TUIA 1TX4B 3ZVRA 1KDRA 5UKDA 1I4DD 1E9SA 2F55A 5DYGA 4BZQA 4J0QA 4HLUA 4M4SA 1E79A 2OUKA 2G0NA 2F7SA 1QBKC 2CHQA 2UKDA 3O8BA 4JVMA 4B73A 1ZUNB 2D3WA 3B7GA 4LC0A 1KI6A 2A5DA 4PAOA 2IF2A 5LBIA 3W34A 2CMKA 2WAYA 5JFGA 5D3QA 1NN3A 1E2MA 4RD6A 1MKYA 1G291 2ZRIA 3SHFA 1K8RA 1X8KA 2GBLC 5FOUA 3LY5A 1VG0B 2NO6A 2QPOA 3TE6A 2ZQ5A 1MO4A 5KDOA 3CF0A 2CBZA 2J0UB 1NBME 5TDHA 4PC2A 2P65A 1ZM7A 2GA8A 1E2KA 2NTYC 2HXYA 4Q1AA 4OHYA 4PO8A 1NMXA 1AIPA 3K0CC 4B33A 4TZ0A 5EP4A 2WJIA 5CM8B 2GETA 3QUSA 2MMGA 3O8CA 5TVKA 3NWJA 5GADl 1CR1A 4HB0A 4Z8YA 3CUEF 1E2NA 3K70C 2QP3A 5JCZA 2MSCB 1SXJB 4ZPXA 2C9OA 3Q5EA 1R5BA 3LXXA 1E9FA 4M53A 5AK0A 5KNBA 4V03A 1PUIA 2XJ9A 3B1VA 1G4AE 4P0TA 5FPKA 2CVFA 5KPJA 5C2JB 1U8AA 5HKKD 1W5SA 2ZUBA 4XD7D 1E2LA 1BMFD 1XRJA 4NYJR 4AG6A 3EZ2A 1WCV1 1VG8A 1WQ1R 2QY9A 2YWFA 5J5CA 1MO5A 1W36D 2WWFA 5GJCA 4D0GA 4S2EA 4URXR 2IYUA 1G3MA 4NYMR 1RIFA 4LYHA 2FZ4A 5G3YA 2OILA 2D2EA 3IGFA 3I8XA 3LLMA 3MWYW 4BQSA 4PQFA 2PL3A 2H16A 5BQ5A 1OH8A 1IONA 4L9WA 4LUCA 5JZVA 2YC4C 4G5OA 3K0SA 1G5PA 4M21A 4QOSA 2X2FA 1C4OA 1GKUB 2EWVA 1Z0IA 3THWA 1CF4A 3SDZA 5DIFA 1XMJA 2FSHA 3SJAA 3SFVA 1R8SA 1IY0A 2ZS7A 1B0UA 2AK3A 3BIFA 3FKSA 1ZCBA 2BBSA 3OIYA 4PHHA 3PUZA 4BLPA 4DUGD 1XMIA 3QKRB 2ZU6A 4C0LA 2GJAA 8OHMA 2QBYA 3T5GA 3K0AA 4DBLC 4A36A 1ZRHA 1SXJC 1PJRA 1X1SA 4R9UC 5D3MA 1FP6A 3EG5A 1KI8A 1XEWX 1UKZA 1ZVQA 3QVVA 2IHYA 3L0OA 4E07A 1XEXB 2JAQA 3I72A 1DPFA 4PQYA 1VCMA 1YR6A 2FE4A 4Q7JB 4JVSB 5GJVC 5EXSA 4L4UA 1U8YA 1KSGA 3BB4A 4Y0VA 3RWMB 1N2CE 4C3ZA 5L8VA 4NTZA 4CIDA 2YWGA 4IDNA 4IDHA 4PC1A 5HKKA 1G8FA 4XD7A 4XWKA 5P21A 2GCOB 1XCPA 2IS4A 1S8FA 5DI3B 4B2IA 3K09A 3A1VA 3N2IA 1E3MA 2X8AA 2R6AA 2JLQA 1U90A 2NO0A 1JQLB 4Q1EA 4AKIA 3BORA 1G21E 3RS3A 1L4UA 4FCWA 3QNUA 3CF2A 3W6OA 4BASA 1LF0A 4LV8B 4UXIA 3PEYA 4QGFA 4MKGA 2QEQA 4CT4B 1AGPA 2A5JA 1YZQA 3MJHA 1N6NA 2QP9X 3OIUA 4FINA 1E2PA 3QG5A 3DKPA 2SHKA 4X8HA 3EASA 1LFDB 2Z0MA 4DSNA 4NU0A 1G41A 1OFIA 4LDJA 3FPAA 4HATA 2CCJA 1J7KA 4IDQA 3C5CA 2GRJA 4W5JA 3HPQA 4KVGA 4M8NE 2AD1A 821PA 4QJ4A 3EW9A 3DM5A 5AJVB 5LB2A 2XSZD 4IDPA 2VF7A 1T8UA 1XWIA 3A1WA 1DAMA 3IIKA 1ESNA 3Q9LA 4YDHB 2ZRCA 2O8DB 1W47A 2Q21A 3OHMA 2HXSA 3RSOA 1ZJ6A 2F1IA 4V02A 3GJ4A 4GOJA 5A5GA 4HB2A 1A7JA 1SVIA 2R65A 4DLVA 3TBKA 1E4YA 1Z08A 1QRAA 1HYQA 3MCAA 4D25A 1GRRA 4ZDJA 1HE8B 5BN4A 4V0MA 4A82A 4TYYA 5FBWB 1S3GA 1CEEA 5TV2A 2IWRA 2ZI3A 3RRNA 1R2QA 3KFXA 2L0XA 3KXKA 5CK5A 5EE9A 2UVQA 2R8RA 5CJ2A 1QHSA 1SKYE 1XXHE 4C7OA 3QOFA 5JEEA 1GOTA 4RJLA 1CJTC 2BKEA 1TEVA 1R7RA 1XNJA 3TAUA 4N0EA 4NCNA 4JBWA 4ZI2A 2ZJZA 4NL4H 2CJWB 3NEYA 2IYRA 2I3BA 4KFSA 2FPMA 4DJTA 2YV5A 5EP3A 2RH5A 2W6ID 1N6RA 1II8A 3QKTA 5HZHA 3ZZ0A 4URYR 3BD9A 5L3QB 4BZXA 2E1RA 3L8ZA 4HB3A 4OQMA 3GMTA 3QF7A 4Y0AA 3RDPA 4C0HA 3U61B 4DLSA 3GLHA 4ZCIA 1M1YE 4IEEA 2KBFA 1H8ED 1YHNA 3KXLA 1OXVA 4PAMA 2OCAA 2FDCA 3D7MA 1P4SA 3T15A 3BFXA 2EFDB 2D62A 1BH2A 1FPMA
chains in the Genus database with same CATH superfamily
5B64A 2BFBB 1QQAA 1X1BA 1R37A 2GHRA 4I9NA 1W7AA 4OCZA 2HV8A 1YFKA 2B1QA 1GSHA 2H0QA 1IEQA 3TBHA 1GZDA 1YKGA 4J16C 3GRZA 2PSFA 2ZR8A 3AUUA 1PDOA 3AHEA 4QAQA 3QI2A 3WRYA 1CQXA 4A8JA 4MS3B 1QXSA 3Q98A 3I2HA 1V5GA 5IXJA 1A9ZA 3CRVA 3OVMA 1XTRA 1O96B 3ND7A 4ILEA 3ZV6A 3H13A 4FMBB 4WLFA 1F0YA 2OC9A 1E9BA 2OK7A 4K88A 4KPFC 1E5XA 2VSFA 4UUMA 5GV8A 1L5HA 3TLBA 3O03A 2JH8A 3WAKA 3O31A 3PBKA 4IQ0A 4ZCPA 3ZI0A 1US8B 3UATA 1PV4A 3AXTA 1DAPA 3D4BA 1W4CA 4XDHA 2P2ZA 4B2PA 5EHQA 2QXYA 4CIWA 1MPTA 1DC7A 1RVV1 4K3UA 3SQXA 3W4IA 5EIBC 3THSA 1A5TA 1XKTA 4I99A 4MGIR 3G0IA 3ZHUA 4LTMA 4K0KB 1WCIA 1OWPA 1Y33E 5FLEX 3FPJA 3AQIA 1KK1A 3LP8A 5I45A 1VPDA 2J48A 1ZLXA 3OQMA 2XZDA 4XGQA 3IAS1 3V9PA 2NT4A 3PX2A 2XF2A 1Q0UA 1Z39A 2HK7A 1JEYB 5EMKA 2VPQA 1ZM2A 3LDGA 3ZVNA 1C1DB 3U6BA 3QLVA 3WSVA 3KLNA 3PGXA 2GZSA 4OB6A 1DX4A 1F51E 1KSFX 2CXQA 3AHJA 3BSFA 4X9XA 2JGRA 5KNBH 1EI9A 1T2FA 3WBKA 5JECA 3EEIA 2W2MA 4FYKA 3O38A 1FSPA 2WDPA 5ARBA 2WLSA 4HFJA 4CIVA 3K35A 3WGOA 5AM1A 3DYIA 2FPPB 4YEDA 1LK5A 1H2RS 1T9DA 4AZTA 3SDBA 3GT4A 1NUQA 1FTWA 2YJZA 1M34B 3KHKA 2AV6A 5BSVA 4YXFA 2IHVA 2I71A 2X41A 4NZMA 5KS2A 3IVRA 3VMMA 5I4KA 3V33A 1RBQA 2XWQA 3ADOA 4RZIA 2I7CA 4CKWA 3NHLA 2F3PA 3Q12A 2OZLA 2JVJA 4EG0A 3UJHA 3QF4B 2B61A 4YY3B 3T4EA 4I7EA 3CE6A 2Q8QA 3TCXB 4BNHA 1AQJA 1RC0A 4GKJB 1GKYA 2C03A 5IK2A 4ND3A 4AWBA 3E2IA 4LNAA 2AZXA 3BCHA 3ELYA 1KJJA 3V6MA 1QIGA 4LJSA 1KAOA 4I36A 2I29A 3C24A 4CF7A 5KYXB 1ULHA 5DWQA 1JI0A 6Q21A 1USVA 1DJOA 1RYBA 4XIFA 4EO7A 3O8RA 1LPOA 2BOVA 3OPYA 1TA4A 4RLQA 2KJQA 3NCTA 2H11A 3NBXX 3ND5A 4Q05A 1LKZA 3FCCA 3FR7A 3CH6A 1LH0A 1JXQA 3OAAD 5C8XA 1XPRA 1FUKA 4FHEA 3T35A 2AKAB 3FE2A 4MW4A 1XPOA 1MENA 1L1RA 4QM7A 4DJDC 2VHJA 4PYNA 2VLIA 2FFJA 5G3ZA 3HHEA 6ABPA 1LCIA 4MQMA 1UMDB 2AC7A 1EP2B 3AFMA 1RAIA 2DTDA 3CS3A 1G6OA 3LCCA 2B3TA 4U7DA 4DIKA 1X9GA 3FWPA 4J0IA 3T3HA 5LXTB 5GVSA 3J7TA 4BXOA 4HH0A 2YV4A 2DPGA 3ZWVA 1Z47A 3GAFA 5EQTA 1I4WA 1WMDA 1Z17A 1FCJA 2C8JA 3WQHA 2PJZA 2Q4OA 2RCNA 4LFCB 2RGDA 3MBOA 4BPRA 2I1LA 2Z4SA 4D4HA 4DLNA 2B37A 1CQIA 3D54D 1B23P 5I8ZA 4KR3A 2FYTA 1VIMA 1NY6A 3WGQA 3RYHB 4JLVA 3VDMA 1CZNA 1R4ZA 2ALJA 4IZIA 4MTLA 5JUWA 1PSZA 2GD2A 3W8DA 4QYSA 3U44A 2X76A 4J94A 1OVGA 4HDAA 2H7XA 4BV8A 3WZMA 1GTSA 1FJGB 2H00A 2VLBA 4GPIB 2WOOA 1DUIA 5G0SA 1U9IC 3O8DA 5CLJA 1VKZA 3W2HA 1AGXA 5JNRA 2RJNA 3R74A 2QPAA 1QYXA 1NR5A 3LPNA 1YR8A 4UEQA 4UUQA 2M6SA 1KI9A 5CDTA 3NU1A 4HBGA 4L75A 1KPIA 2BEUB 2ZQYA 5HCNA 2H4WA 5KC8A 1GL9B 1O1YA 2QROA 5CM9C 3ER6A 1XVVA 3NBQA 4ANFA 4UTRA 4LDAA 4XB2A 4MVJA 3AOEC 5FT9A 2WKPA 2IK8A 1LLUA 4BO2A 1YFJA 2WQ6A 1UM9B 1M2WA 1CUCA 1SK8A 1D1QA 3D7SA 2JH9A 2GN1A 1Z45A 2XW6A 4TV8B 1SXGA 2HGSA 3LLVA 1MFZA 1RLUA 3S8YA 1D0SA 1C9JA 4FCCA 3R2JA 5JROA 3ZE7A 5FUXA 1NSTA 4RAQA 1IUPA 5JJCA 4BLSA 2WWYA 5BW8A 1AZWA 1K63A 1XA3A 3C43A 4RKFA 1S7GA 1K88A 5HEKA 5LBUA 4KR6A 1OX5A 1LBSA 2Q4RA 5KUTA 2IEDA 4G4IA 1EGMB 3ROGA 4PIPA 3SPXA 1ZINA 2A3RA 3LQQA 3BWMA 3Q3IA 3OMXA 4LYJA 1JRLA 1PL8A 1PZHA 4RX1A 1XKXA 1KJNA 3MCTA 2D13A 4FR0A 3KD3A 2R48A 4D3FA 2ZETA 4HFMA 2Z1DA 3QUCA 2UYCA 2JIRA 5IAKA 2F4NA 5LA6B 2NQ2C 3K16A 3F1LA 3WOHA 1G18A 2WABA 4CEIB 4NMMA 1ZPDA 2JJ2D 1NG1A 4MR7B 3WVNA 3M1YA 3RIGA 1TZKA 2V6IA 1G8MA 1P7PA 5JCOC 1BEEA 2JAUA 1V0JA 2PU5A 2DR0A 3K1YA 4L16A 4PZYA 3RABA 5IJ9B 4JROA 4ALNA 3LUBA 5GWXA 4RVHA 1JJAA 4KXMA 5KDLA 2P9QA 3N53A 4OJNA 3TJRA 5NLLA 3HJHA 1EXVA 3DZCA 1T2VA 4MMXB 3OT5A 3TXAA 4AWAA 4QBHA 1AVTA 1C3JA 5IXYA 2KMLA 1A4IA 1KL7A 4N6OA 4QXMA 1TZBA 5TARA 1CNFA 1SUAA 3FDZB 2FOIA 4OFZA 2R5NA 1OXUA 4MUMA 3INRA 4QPCA 1VG9B 5TY0A 5K0SA 1IM2A 3TF5A 4NV3A 4W63A 4FEGA 5AKJA 1CQPA 2IYNA 3WSWA 1N5JA 1Y0BA 1UJNA 4O4IF 4R0NA 3R23A 4J1TA 1YDEA 1LPNA 4QGAA 4AY3A 1EFVA 3N2YA 4TKZA 3KK0A 1SQFA 5T4HA 5FFNA 5ALDA 1HG0A 3QTBA 1ZNQO 4UHEA 4S0ZA 3EJWA 3SKVA 4K0RA 4KITB 1SNYA 2PZBA 2XKBA 3D3JA 2XEXA 4OU4A 1EDDA 2EHDA 3IMKA 2OCKA 3DW3X 4QO8A 4EZBA 2FQ1A 4HGYA 4LNUA 5F3RA 1L3IA 1YB1A 2RB4A 4EFKA 2XQIA 2OD2A 1TECE 3CGGA 4Y9DA 2ATVA 3FFXA 2LIVA 3AI1A 4B3FX 3ID6C 3NJRA 3TFWA 2FFQA 5LLDA 4JBGA 1NXOA 4WKPA 2X5OA 1DCTA 4NJMB 4W9RA 1E3LA 3KYDA 4E21A 3FWKA 1QUEA 4KR9A 3QSYA 3ED1A 3HVIA 3HYTA 3C7DB 4CG1A 3NUZA 1AXRA 2P9GA 1JHYA 1M2OA 2VUUA 3ZWOA 1E3DA 1Z4LA 3E8XA 3RRJA 5ITVA 2Z4TA 5LP6F 1XUOA 1XRRA 1CB7A 3BF8A 3UC9A 5JBIA 3ZKWB 3EDQA 1N6IA 1HNNA 3M4XA 4WOPA 4LPKA 1GDHA 1BXRB 5FPSA 2XT9A 3WNZA 4F12A 5C1PA 5LQDA 1KFKB 1TKRA 2I4MA 3KJGA 3VFDA 2M32A 2UXDB 2D8AA 5JTUA 1QB8A 2ZB7A 1JAIA 4CBVA 3H9GA 2H7CA 3K0CA 1Y9EA 1ACJA 5COAA 3K0KA 3BWVA 4JCOA 5ECYA 4JXXA 1HTWA 3PIIA 4BGVA 4UBKA 4WPGA 3ZUPA 4O2AA 1TM4E 1W85A 1C0EA 3A8TA 2WA2A 5EXDA 2IDKA 4I5EA 5EZSA 1GU7A 4RA6B 1XEWY 5A9SA 1SGWA 1YRHA 3ONFA 4N3CA 5LYJF 2JGMA 4MQBA 1KIAA 2OOSA 1XRNA 4KXYA 4PYOA 5GGXA 5I3ZA 3UCEA 3OE4A 4K28A 2PGAA 5ALIA 4MYRA 1RRVA 1T9HA 4YXWA 4HS4A 2DUJA 1YASA 4OAOA 3RS5A 2X7JA 2YCLA 1NVWQ 2V4MA 4NONA 3FB1A 4XVHA 1PFUA 3UJBA 1DELA 1G3IA 3UXEA 3ZIAD 1ZJWA 3LBYA 4U5XA 5SYNA 4A92A 3HL0A 1CB0A 3LL4A 4FBMA 3PIRA 5C3MA 1KZ9A 1SOMA 1PTJC 2OBMA 1NPYA 4TKLA 1AKWA 3PQ2A 1TQ2A 3T9BA 3VZSA 4HGOA 3W2FA 4EDHA 1L7RA 4FFPA 5FTKA 3R20A 3H2IA 3U4CA 2XQFA 4BVAA 3LSYA 2ZR9A 4D0NA 1KFCB 2A5FA 2JJYA 2ORVA 1GZ6A 1LNSA 1OFUX 1YHYA 2VEOA 2ZIUB 1KJIA 5DTRA 3U3JA 4U3JB 4Q4AB 1MT0A 4R8MA 2ZZMA 1RQNA 3OFVA 1K27A 3OPNA 3TR6A 3V2HA 3P9XA 3ZJUA 1E0JA 1KJ9A 3K6SB 2TMKA 5COQA 5FP0A 1EDBA 1H5QA 3D64A 1NTOA 2QLBA 2VUIB 2X1VA 4MB6A 5E3HA 2G06A 4RZXA 1OI7A 3EGWA 4DKJA 1A98A 1OT5A 1UT5A 4MCJA 5H4HA 2G5GX 1DO2A 4JKYA 3NTRA 5FWYB 4BQIA 3ZU6A 3MTBA 4G9EA 1RT9A 2JARA 5LZ7A 1EK1A 1M76A 2XR1A 4G1EB 4KNVA 2J87A 1K3FA 1SXJA 2Q6VA 2YWHA 3EXHA 5M5BA 4FD2A 4JUIA 4RJKA 2O7SA 2ZLBA 2ZRNA 3KVOA 5E2IA 3SXUB 4US2R 5DBOA 1M8KA 1AZLA 1E77A 2YHIA 3TQRA 5K03A 1TM7E 2IZOA 4KIGA 4WNCA 5J2UA 2PKQP 2R6GA 4Y30A 2KW5A 2RGUA 4AP6A 1RFGE 5M29A 2A84A 2E2WA 3KOZA 1MTZA 2WUFA 1YRWA 2Y92A 3QMPA 2BLNA 3IHTA 4MPDA 1I0LA 2G1KA 1M2VB 2QN9A 3RYIB 5LMZA 4AQYB 1QOZA 4Y1GA 3VNUA 1CC1S 2W7TA 4PRYA 4WDRA 5E38A 2HQSA 3L1VA 4BDTA 2OD9A 3RUHA 4JX8A 1NM5C 1GL7A 4B7XA 2P3QA 5B58T 1Y8CA 4MNTA 4BKOA 4CDMA 1ZW6A 1WXGA 3LC1O 1PDVA 4HWPA 2ODAA 3H1FA 2F1HA 4R1OA 3RSHA 5LQCA 4TLDA 4FLMA 5MFZA 2OA0A 3NHFA 3QPAA 4FGUA 3VNQA 3G89A 1JEDA 4YUVA 4HN9A 1DAKA 3QYPA 2O19A 2Z5GA 2V7UA 5FL7D 3RC9A 5EE5B 2IY8A 4BNGA 4PGGA 5KCMA 2IC5A 4OSPA 4ZQIA 4HFRA 2AZDA 2ZSAA 4IGKA 2QVXX 5HVNA 5CLIA 1T5SA 3TDKA 4ZQFA 4G86A 2AE2A 4KPEC 3PTAA 3D8RA 1Z29A 3ZJ5A 4C1BA 4IV0A 2IBTA 3RRBA 2B25A 2VNSA 4Z9BA 2ZYAA 1KF0A 3THXB 2XQVA 4ZU3A 4N5DA 3R7DA 1OH7A 2CNWA 3WWOA 2R1VA 1UKBA 4UFOA 3TSZA 4WXMA 3WA7A 4PGMA 3BE5A 2P9TA 2Q5LA 4CRWB 1GQ2A 2E6KA 4RXUA 2YHSA 3NHYA 3DAHA 1KJQA 3LKDA 2I76A 3GT0A 1XAIA 2BP7A 1DT5A 1KR2A 1FLVA 1Z4JA 3OZCA 2ZE5A 1XD2B 3DE0X 1SK9A 5B3JC 3F6YA 4I50B 5AVWA 3ZU2A 1XEXA 1WABA 4Z4FA 1G16A 4AG5A 3VO9A 3AVXA 2ASEA 5JAIA 1X6VA 3FDIA 1UBUS 3MD0A 1DC8A 1Q95A 4A5SA 4AI6A 2QYTA 3U7GA 3Q7PA 5CAEA 3B89A 2YUTA 4BCCA 1QHGA 4RTNA 3HFRA 2AOXA 3TG8A 1HE5A 2GCOA 4H7FA 4AMGA 1OROA 5I7WA 3DONA 4RZQA 4XM1A 2QN3A 4YCAA 1KDOA 2GNPA 4BQQA 4B45A 1AHHA 4MGKR 4WCFB 1JLLB 1NQTA 4LRQA 5DI3A 2CXXA 3FUCA 5KTOA 7AT1A 3OFSA 1ND6A 1GARA 4C2BA 3FB4A 3RT9A 3DBLA 2EG9A 3EGCA 4G9GA 3WWEA 4AJ2A 4YPOA 5A9RA 3WGYA 1IMJA 1R74A 3NWPA 1NF3A 3IH5A 3R0IA 2G77B 3AEXA 4HDMB 3FFBA 1EXNA 5KKNB 3CJTA 4LQCA 4ES6A 3UT0A 2K7FA 1KHTA 3VX4A 3RK0A 2A86A 1AS2A 3FRHA 4TV9F 5IBPA 1G5RA 3MQ2A 1IZYA 5AVVA 2J8ZA 2D2FA 2G1UA 5K8VA 2IIQA 2DWQA 2GXUA 3BK7A 1PT8A 7YASA 4WH0A 3PP8A 4EPTA 1B1CA 1VE6A 2VP0A 3H1EA 5AK6A 5B7NA 4NXMB 1RIIA 5LQKA 2RHBA 5CURA 4HQLA 2ODNA 2RI1A 1FFEA 2ZZKA 5CPFA 4Q9JA 2Q5HA 1P0FA 4D8TA 1B3RA 3LPLA 3ER8A 2QR5A 2RGBA 3R6TA 1E9DA 5JAQA 1X1AA 4XPZA 4NHEA 3W6PA 3IE0A 3RB8A 4MV0A 4E5DA 1DHRA 2P41A 1JKIA 3JVVA 4U5QA 5D3KA 3URMA 3VBCA 2NUBA 2WM3A 4RH3A 4OQXA 4DAEA 1UXOA 4XVUA 3H5WA 4TT3D 5AI9A 2IEYA 1DJMA 1ZJYA 4JBHA 3HBMA 1K4KA 2L17A 2PSJA 3H2JA 3FPFA 1E6KA 1YBHA 3H8SA 3Q8MA 1KOJA 3HDVA 3OM0A 4MS1A 1W0KD 2E7ZA 4R3WA 4OHZA 1AK1A 3UMGA 3CURA 1DT3A 4B5LA 3DH0A 1QF6A 3T9AA 4L5JA 2C84A 3W8NA 3VR6H 3MNFA 3ABQB 3L0ZA 3D8HA 3BKWA 4WCFC 3P20A 1WXDA 3GRKA 3A1FA 2Z5LA 2ZVQX 1UUFA 4BVBA 3LK6A 1JHDA 2D8MA 2XCIA 3KPJA 2W5UA 2IPMA 2W2XA 1V95A 3O47A 4HG2A 2MWMA 3ZR4B 1FVXA 1XNRB 1V43A 1O6FA 1XTIA 4Q4LA 1QH0A 4N48A 1B8NA 1F5NA 3U0VA 3VZDA 3JCZA 2V9ZA 1FNNA 3VU9B 4J8PA 3AEQA 3PS9A 1VBNA 1DB3A 1X8JA 4O1HA 3M83A 4BGUA 2UZ4A 2CJFA 3ILVA 1I9CA 2JBHA 4RDHA 4BE4A 4A0SA 5K8IA 2F8SA 4RHYA 1CUHA 3WG9A 4BFTA 5K8TA 3IMCA 4IO0A 1QIDA 3HYSA 3IAM1 4IINA 3MSXA 4ZO8A 4EHAA 4O3MA 3NG1A 3WLAA 2IYFA 5AKYA 4JJFA 1N2OA 3X1WA 1MDFA 1MC8A 2BGNA 3AY6A 3EIHA 4MAAA 4G01B 3TNJA 4BNNA 3HZHA 3HV2A 4GVPA 3C85A 1EK5A 4ENRA 2IH5A 1F17A 1N2JA 3E3MA 1X7YB 4XW2A 1RM0A 3IUSA 4QSMA 4DUGA 5H5JA 1O08A 3VYTB 3A4IA 1PQYA 4G4SO 4AG3A 1PJQA 3WI7A 4C5AA 2NXEA 1BS2A 3C3XA 1UODA 2QLFA 3M3HA 4PG6A 3TH5A 2HLDD 2DH6A 3SQNA 3AESB 1EAMA 4JGIA 4X84A 3GBPA 1QFYA 2WYVA 3JQFC 1KZ4A 1YKFA 2CWDA 4G97A 4NKRA 3MWEB 1A1SA 4HVTA 5FQOA 3ZIDA 1YVPA 1AM4D 3PNQA 1NPTO 1ULSA 1MVNA 4OQZA 4RVNA 1UFRA 5HYVA 4JJAA 5JY1A 1W49A 5F1OA 3T5CA 2C7GA 3GFQA 3SR3A 5BVGB 1B14A 3AEZA 8GPBA 4CR7A 2GWHA 2R2AA 2P1DA 1VI6A 4UVGA 4Z0HO 4CGZA 3OZVA 2WUVA 5A9TA 1JFFB 4OQLA 5AI5A 1HE4A 2NN3C 2JHFA 1JIXA 1AO3A 4U7FA 4DNFA 3NHSA 2Q8PA 1SXJE 5D86A 2QRQA 5TRTA 3UWPA 4G1MB 2PH3A 5C7IO 5MN4A 1XJWA 2G88A 2YFKA 3E82A 3DT8A 4FDAA 4TYQA 4H6WA 4QRHA 3EGOA 5EPUA 4C14A 5IM4A 4F72A 1M2NA 1T0UA 1TVMA 2CL7X 2NV0A 3CRRA 4OHOA 5ES3A 2PQ0A 5TNXA 4CMIA 3CMCO 3PU6A 4GQIA 2C8VA 1W5EA 5EJ5A 4JOCA 3P8ZA 1TUBB 1WE2A 1SUCA 1VL1A 2J7KA 4ZIRB 1TYCA 2BKXA 1LLCA 3GFVA 3PHBE 1AZTA 2PUFA 4H3HB 4D02A 2XYGA 4NBVA 3DLCA 3DV0A 2O8CB 1R4MA 4J2HA 4UU8A 1ECCA 2IEZA 5T6MA 3S99A 1JG1A 4NATA 1ZIXA 4TTPA 2OXRA 1XNGA 4L1KA 5CIWA 1XZHA 3CLTD 3T3GA 4AJ4A 4XH9B 4IGEA 4OYHA 1EBUA 3ZCTA 5HF6A 1QZXA 2VYQA 4JUDX 4EBFA 4B3HA 2YY6A 4KN8A 4I1UA 2OE2A 4M60A 2B30A 3OD5A 5DX8A 2YV1A 4EKNB 1J5XA 1FSFA 1ACLA 3BD7A 1GU0A 2GWRA 3PIDA 5IUNC 5CVTA 1QO9A 5J58A 4MHTA 2YFYA 1ZGCA 3NB0A 2EJUA 3REGA 1EUCB 1UDCA 1WF6A 4UE6A 5K3CA 2XHZA 2VF4X 4BNIA 2D1QA 3LPMA 3FZYA 1FQJA 3CLUD 1UMCB 5D00A 5BV0A 1JDZA 2AA3A 4L57A 1M66A 4HZUA 1KO7A 4E1BA 4BNZA 3GPCA 5CDFA 1KIMA 2WYUA 2OVBA 1CK4A 1UOQA 3KG2A 3IJPA 1Z5ZA 2JKYA 3RFCA 1HE1C 1NW3A 2NIPA 2PTGA 3PC8C 1FTYA 1QYVA 4QC2A 3PQ5A 3T5BA 4H6XA 3WMGA 3RHSA 4RTRA 1Z5WA 2FFRA 4RYLA 1A4RA 2FJPA 2ZBPA 3QK7A 4D9IA 5FNVA 3QV1A 4OTZA 3G2MA 4W8OA 3QEBZ 1TO2E 1SBHA 3D0RA 1DIAA 2BMVA 4DLZA 4ENSA 1Y1TA 3I37X 4ISCA 5JVDB 4CETA 2GJ4A 4JL6A 2ZDGA 2I4IA 4ZVRA 1R4AA 1DINA 1F12A 1F48A 9ABPA 4CLDA 2WHPB 4G5YA 4P4LA 4Q03A 5AJTA 3E9CA 4NQRA 4C2UA 2ASVA 1JHXA 3NAZA 5BMOA 4NU8X 4RV4A 3DQQA 1VYVA 1JDSA 1GZ4A 3JATB 5CLQA 5IX8A 4BMDA 3STUA 4BGDA 2ZTMA 4OHXA 2VXYA 1RI1A 5CB0A 2CL6X 2F9LA 5I4IA 3ETCA 3BULA 2Y76A 4PPFA 3SVTA 3ZOKA 1JPJA 4AJPA 3NALA 4LZLA 1X1RA 1LS6A 4MITA 3QU7A 3FOCA 4AY5A 3NC1C 3LHDA 4MI1A 2FW1A 4HWOA 4QUDA 2MDTA 1V5IA 1PFVA 2I99A 3IEKA 4MVJP 4HUQA 8ADHA 5ITZA 2R6ZA 3IBFA 1SXQA 2XAUA 4FWIB 4M6WA 3RJ5A 4YJ2A 4LG1A 1QU3A 5FWXA 1G64A 2I2CA 1L4MA 4Q4JA 1W6RA 4B32A 4JLAA 3O3MB 4Q1FA 1IB0A 1JT9A 1N9GA 3JQQA 3KQHA 3AB7A 2ERCA 2PGIA 4JP1A 1BWPA 4TL8A 2M1ZA 2BJHA 2FEXA 2ZITA 3FPHA 3GVIA 3L4BA 4JC5A 4PRLA 3UK7A 4F85A 3OESA 2A35A 2WHQA 5JISA 3SG0A 1M33A 4J76A 4NIMA 1R64A 1L7EA 1S2LA 5BSMA 2QRVA 2NAPA 3WICA 2FZKA 3J80A 3ZLBA 3RAEC 1NAIA 2W2KB 3KO8A 3KYCA 3K0FB 1H6DA 5I7FA 1II0A 4E2FA 1TTPB 1II8B 1XTPA 4EI7A 4C3UA 5C37A 2C57A 1MO2A 3H1PA 3EMVA 3NHPA 2XJ4A 5CVEA 4ZCMA 4MJ7A 1EX1A 2CT8A 1PLJA 1VG1A 4PM4A 4TMYA 4BO3A 5M3BA 4Q7EA 3RUIA 2ZRFA 5FA8A 3UGQA 1AH2A 1KXJA 4YPFA 1NV9A 4DCOA 2JLXA 2VDWA 1QIKA 4LISA 2AX3A 1UDXA 2JIZD 5L4SA 3L0BA 3ZU4A 3JPWA 1PEAA 3BICA 5JSUA 1SG0A 4G65A 2HO5A 4C6TA 2GO7A 5L3SB 2QX9A 1RBMA 3E5HA 3OQJA 1SOWA 1TI7A 4ZVUA 4YO7A 3PFBA 2RH9B 4RTMA 4LYYA 4ZVQA 1PVVA 1ZH2A 3JRWA 3PVCA 4PR0A 4A9AA 1L5YA 1XQWA 1RWOA 1TJ3A 2I2AA 3AR5A 1OXMA 3BL5A 3OC6A 4I66A 1IXRC 3I6QA 1K68A 1JIVA 2J5XA 2YOGA 3ESDA 1D4FA 4GRAA 4RDCA 5CA0A 4F4UA 1TMOA 2AXEA 1LZKA 1NJ6A 5LFAA 3OJXA 1Z4NA 3GEIA 4DR1B 1P8JA 3ODPA 1ZSYA 4BO0A 5AESA 2ZRGA 4EPWA 5ADWA 1DAGA 1IC6A 2PH1A 3IP1A 4KWEA 3ZBUA 3PFWO 3JQ9A 2ZJAA 2VP3A 3ONDA 4HH3C 4PBRA 3RC3A 2ZANA 2BSXA 4HXEB 4WGGA 2JAOA 3Q0TA 5JD3A 4HNUA 3KJEA 3D9QX 3VO1A 1N6KA 4NS4A 1ZESA 2ZI7A 2Y0CA 2A7QA 1KPGA 1S1CA 1QVVA 2NPIA 4IUDS 1IXZA 1SKUA 2YXPX 3C1TA 3OZ7A 5CB4B 1VJDA 3G49A 4GZ6A 4ZHQB 2OGUA 4Y2UA 3F5SA 4AF8A 1S4MA 2HDWA 4Q7KA 3RJZA 4DQDA 1X70A 1Z75A 3AUKA 1DWPA 5EE1A 1EQ2A 2I62A 1FC0A 1INLA 1E8DA 2JGDB 3JR7A 5DNVA 2ZAIA 4MWCA 3WK6A 1DCFA 1MNQA 2GESA 5L3RA 1T91A 3PUVA 4RVCA 2A0KA 2BT4A 5FOQA 2XCSB 3OEHA 4UAVA 3IUQA 1DG9A 5D84A 2FN4A 3O90A 4RF4A 2PWPA 2IDZA 4HYQA 1O8CA 2DKNA 1O03A 4PFKA 3ANTA 4G24A 2A0FA 1WMSA 3I76A 3F8WA 5EIEA 1YFLA 3B36A 2CK3D 2I6QA 1OSNA 1VMIA 2WU3A 3AHCA 4UXHA 4XX0B 5H3LA 2QIPA 1B6SA 4W9MC 2AFIB 1CJVC 4K6HA 3HXQA 3TX6A 4FB5A 1OWOA 3BXOA 2QZZA 1M2JA 2QJWA 2IP2A 4FWBA 4M1QA 3W8RA 1NWCA 4KQXA 5IF3A 4WKBA 4CTNA 4FHDA 1MVOA 4ER6A 1R6AA 5BN1A 3PHIA 5FBVB 1E4VA 1I3NA 4X20B 4UHDA 1PCXA 3TOSA 1IQ0A 1Y5RA 1YK1A 3QPUA 4R8RA 3GPDG 1WXFA 1BDIA 3EQ6A 3PNSA 2WJHA 4R69A 4FZ5A 4TTSA 1FQOA 2JK0A 5FLYA 3UV3A 1VL8A 2GYWA 3V1NA 4A0HA 1TCVA 3EZ9A 3DE5X 1P2TA 1XTBA 4E1AA 1GL6A 4Z8XA 1VB3A 4LGVA 2D0OB 4WN9A 1S5PA 1NXQA 4G5QA 2F6RA 2FWBA 1ENOA 1EDZA 4UNSA 4EF4A 1DIGA 2IZ6A 4NI5A 4EVSA 5D3ZA 1MEJA 3RFUA 3MWJA 4CV1A 3L01A 9GPBA 4D8WA 1I32A 3R3UA 5AW8A 1YONA 1Z18A 1DCMA 1UBEA 1ONNA 2DECA 2KI5A 4KLRA 3SJBA 1PT9A 1QZ3A 2QZPA 3W7BA 4YV0A 3QFCA 4J0JA 3CT6A 4H1WA 1A69A 1SIBE 3LUHA 4G63A 3EULA 3IE2A 3CBQA 5DNCA 6LDHA 2X9VA 3PQDA 5CCXA 1T2EA 2QVYX 4P93A 3DNFA 4B85A 1DZIA 5KHAA 3MA0A 1U0EA 3BG5A 5I51A 3OZWA 4PZPA 2MSWA 3DZBA 2BCEA 3LLCA 3HBAA 1PLKA 4GNKA 5HQ3A 1EH5A 3KB2A 5JYBA 1H1TA 3FYSA 3ZQJA 1X9HA 2AMVA 2W2VA 3IBTA 3QVKA 1MH9A 1J9ZA 3QVGA 1UKAA 3H0CA 4UHCA 4DLRA 4BWFB 1BX1A 1U2PA 4DMRA 3Q40A 5A2QA 5ARDA 5CDFE 2XUQA 4BLQA 3L8FA 5LMCA 1QGUB 2VDUE 4X7BA 5JQGF 3EVDA 5KMGA 1XEFA 2C5HA 4WI1A 3ZDDA 3JARB 4Q3DA 3ENZA 4GOKA 1BRTA 1AQ6A 2FZVA 3GFTA 1UK8A 2ECOA 2P8JA 2VDPB 5ALHA 4YP6A 4DJJA 3CWCA 3ZS8A 2QW1A 4IIJA 3WL7A 2PJRA 1PVOA 2C2KA 1GV1A 3UMYA 1NVUQ 1QQ5A 2Z5FA 3G02A 4PYIA 3VR6A 1NYLA 3NDRA 1ID8A 1SZCA 4YRGA 1X7HA 4JL8A 3GGOA 1J9GA 4MXDA 3LUDA 4YNBA 1EYZA 2P9BA 4H31A 5KU1A 3ERCA 3DDNA 5ENDA 1E7RA 3JQ8A 3WL3A 1RWVA 3VH3A 2O0JA 4A7PA 3SS7X 4JDPA 4C7BA 4E51A 1P1BA 4DIEA 4CMKA 4LHXA 5L3ZA 3ZPXA 2GBLA 4YV2A 1TF5A 5EZ6B 5FEUA 1KZYC 1GTMA 2FZEA 4YCCA 1CJMA 1YKSA 2E4WA 2M9MA 2O7RA 2FDXA 2V4UA 2Z9DA 3PUWA 4LJ4A 2I5PO 5JR3A 1GL3A 1VJ1A 3LOPA 4MINA 4DHEA 4DUYB 1CRPA 2DOKA 4LQ4A 4FFOA 6ADHA 3BHNA 4DIMA 1PUJA 1ETUA 4XI9A 3NDIA 4O0MA 4LDPA 4XOIA 4DQ0A 1I6LA 3L2OB 1E3JA 3A4TA 1BQ4A 5TQVA 1OJLA 4RQUA 3ZHVA 1TC1A 4ECEA 5JD5A 4HDKA 1GCGA 5JS1A 4JBNA 3WSTA 4BWYA 1SU6A 2X58A 5FBHA 2RG7A 2G04A 2HF7A 4KUGA 2EEPA 5CXSA 2ODTX 3AXSA 1PJAA 4S12A 4XUCA 3AUYA 1KDZA 2VJMB 4EUSA 4YJHA 4DNXA 2B69A 3LUKA 3PE6A 4Z54A 3FR8A 1MC4A 2E82A 2WC1A 3Q11A 3ZWPA 4BHTA 1DTEA 3WC4A 3SZOA 3CKYA 5JRZA 4CQLB 4F5WA 2HMVA 3HR4A 1LB1B 3EZFA 3OFND 5EZYB 1V1JA 3EG9B 4G2TA 4UATA 3NHJA 3I30X 5K1ZA 3VXKA 1R9NA 1E9EA 4YQFA 3ILXA 4FYPA 3L0PA 2AE1A 3O9VA 3M9WA 621PA 2YASA 2WF9A 4O3FA 4ZV7A 4NPHA 1CETA 3EVGA 1RVDA 2WHYA 4Z9YA 2AMFA 3JRXA 1XCOA 1NYTA 3GFSA 1P80A 4EHIA 3PUXA 1WB6A 2ZE8A 2J32A 1OLUB 4IW3B 4TM7A 2GF2A 3KE9A 2E6UX 2O2JA 4ND4A 1LX6A 4EJSC 1AOXA 1LJ8A 2IEGA 2UUPA 4K5QA 4KZPA 1P7CA 4IJ5A 2OPBA 4RZ3A 2RGGA 2K7ZA 1XJCA 3DM9B 1E7MA 2XUIA 4RHFA 1WLYA 4G4GA 4Z99A 4TKUB 1MF7A 3F9IA 1P0PA 1NHGA 1J42A 2WZCA 1CZKA 2JZOA 2OTCA 2ZJ7A 3QY9A 2XF8A 4G85A 4HO1X 3DQZA 4I9FA 1Z2DA 4R2LA 1GADO 4WBSA 4B6GA 4W9NA 1E79D 3QNWA 3GLVA 1KZ7B 1KZ6A 1S3SA 1YRYE 3IILA 3OWXA 2PFSA 2QSYA 3O7WA 4TUYF 4EKDA 1KJWA 5INTA 3L41A 5E6RB 1MOZA 3UCFA 3E22A 4TN1A 2HI0A 3ZHOA 1F2UA 5F3DA 3KQKA 3W6NA 1DC5A 1B3BA 2NZUG 4LI0A 1J09A 3ZJVA 1ST2A 1LBHA 3HVRA 3A2MA 3GFBA 3VNVA 1ZI8A 2F43B 3AJ8A 4FYJA 2F3RA 4UE3S 4RCZA 5AW2A 1USWA 3LK7A 4RTSA 1Q5PA 4JZYA 1JH8A 1KRHA 3SYKA 3P9ZA 4N0DA 3D2LA 5A3QA 1N78A 3FYCA 2CKDA 3WK7A 3WLEA 1Z5OA 3BAFA 3C8HA 3OUUA 4HXGA 4X8OA 1WV0A 2P6RA 1SCJA 1P1KA 2H18A 1RXVA 1AUVA 1OIWA 1U0FA 5EIWA 5KC9A 4MEBA 1QB7A 1OE0A 4JA0A 2XADA 3O3CA 1NC1A 3JQRA 5JZBA 3CUVA 1VSVA 5BWMA 2HSGA 3AETA 4R2WA 1A9XA 2G1AA 2H3HA 3ZDQA 2F8TA 1EA7A 5REQA 3OOSA 1J90A 2C54A 2CXOA 2ESRA 3EIFA 4I14A 1JXOA 1W4BA 1ZVKA 2ZIXA 1E5LA 1IEWA 4MUIA 1NA5A 1EFTA 3AKYA 2IVZA 3BSWA 4CFSA 4G0MA 5A4MS 4CT0A 2A1IA 3AKZA 2NZ8A 3A3OA 2DB3A 3M2TA 2GD1O 2GX6A 2OVFA 3PEFA 5DCYA 1GPJA 1YAJA 3DXXA 3KSRA 4R84A 2WHXA 2CFTA 2GM4A 3TTXA 2Q28A 3ML1A 3GMDA 3OO1A 1XTTA 2G4VA 2JBAB 2FPXA 2B92A 4G0NA 4B6PA 4YWHA 4BB6A 1HK7A 4BVKA 1T1GA 2PS9A 1OBVA 3CLSC 2GOYA 3GQBA 3NX4A 3FBWA 1PJ8A 1X2EA 2PDAA 1LA2A 3CG0A 2NO9A 3NTQA 4YALA 4KMRA 3VKHA 4MYTA 4BNKA 5BMVA 4HDRA 1SJ9A 4WASA 2AI1A 3DE3X 3ZWQA 4BS9A 2E37A 1UINA 1ZIOA 3TE7A 2R1TA 1BS1A 1NP7A 2BKAA 3M6MD 1TAUA 3A1SA 4PZCA 2QJFA 3B3JA 1SO8A 1T1SA 4MP3A 1QZTA 4NBRA 1PR1A 4GEKA 4V0LA 3V80A 1Z8HA 3KQQA 3WRWA 3EH2A 2H5IA 2IHZA 3DE2X 1A8HA 1NXXA 1DRVA 3FKSD 1VE3A 4L73A 2EERA 5FTJA 5ADVA 3HYCA 4LECA 4D8YA 5DV9A 3R7WA 3NBKA 2N46A 1QFSA 3ELUA 3DAOA 4F2HA 3A32A 1JAZA 5B4UA 3OKPA 2QTRA 4CUKA 1Z3CA 4OUDA 3UCXA 1G2PA 1Z8NA 3GJ0A 1KK2A 4JVLA 1KHHA 4B7AA 4BUJA 4LFAB 4P0QB 1FL9A 1KFJB 2X5NA 2VUHB 3UAZA 4OHMA 4A6XA 4DCNA 4X41A 1QRRA 2M1XA 3DBVO 2IYSA 5EFZA 1QUFA 3F2IA 2CVPA 1ZQ9A 2DTXA 3B2EA 1IN6A 1U3FA 4PNZA 4KIWA 3RU7A 2ZWOA 3CO5A 4OJQA 2X0NA 4F5YA 5ITWA 2BGGA 1DI0A 4KXLA 4DRZA 2I7VA 5CYPA 1ZD3A 4DM3A 3CM0A 3EYWA 2SKDA 4DDMA 2CXPA 4P5EA 3SXPA 4PCAA 3ENKA 3K31A 2I3DA 3F98A 5ALRA 1DGQA 3CE9A 5AT1A 2PYDA 3ITDA 3ZW8A 3CUSA 2VWPA 3K4QA 2WIBA 3IAS6 4PNEA 4EPRA 2NP6A 4I4LA 3L8EA 2AWOA 5J4LA 1IN5A 2RARA 5EIXA<