2J0VA

The crystal structure of arabidopsis thaliana rac7-rop9: the first ras superfamily gtpase from the plant kingdom
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
180
structure length
178
Chain Sequence
SHMSVSKFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVAVDGQIVNLGLWDTAGQEDYSRPLSYRGADIFVLAFSLISKASYENVLKKWMPELRRFAPNVPIVLVGTKLDLRDDKGYLADHTNVITSTQGEELRKQIGAAAYIECSSKTQQNVKAVFDTAIKVVLQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotide-binding protein
molecule keywords RAC-LIKE GTP-BINDING PROTEIN ARAC7
publication title The Crystal Structure of Arabidopsis Thaliana Rac7/Rop9: The First Ras Superfamily Gtpase from the Plant Kingdom.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 56
structure length 178
sequence length 180
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2j0vA00
1N6RA 2IXFA 2XTNA 2ODWA 1P61B 2YWHA 4XD7D 2I3BA 4P32A 3MWYW 2BJVA 2JJ2D 2QSYA 2WOJA 2ZRAA 3FMFA 1VYVA 2V3CC 1KKLA 3MRSA 3AF2A 5GJCA 4ARZB 2QROA 2B21A 1GL9B 1HUQA 1HT2E 1TQ2A 4FWTA 2R44A 3EZ6A 1MO4A 3MJRA 5C18A 5H1YA 1NY6A 2D74A 3B6EA 4LHZA 4PPQA 4Q9IA 3ADKA 4QJ5A 5A5GA 5BW8A 5L3SA 1W0KD 2GXAA 1E98A 1KZGB 2WWYA 1NVWQ 3NG1A 2XNDD 3DMDA 4PAOA 1N5LA 1XFAA 1G4UR 2IWHA 2MSDB 1F2UA 4BZXA 2YOHA 4Q7MB 2FF7A 4YQFA 1DAHA 1Q21A 2VQSA 5BYKA 3OIVA 3CW2A 3L0OA 5TV2A 2KB0A 3O8RA 3DHWC 4JLBA 1Q1ZA 3LD9A 2B6HA 4RD6A 4IDQA 3T06B 3FTQA 1RJ9A 4XVRA 3QXXA 2AWNA 621PA 3C15C 2ATXA 4TMWA 2ZREA 1JR3E 4LJ8A 1NBME 2FOLA 3OEED 1IY2A 4LX0A 2A78A 2QBYA 5L8VA 4TYWA 2A5FA 2RGNA 5CIQA 3R8FA 1N6IA 1XZQA 3BAFA 5FR2A 3T12A 2FFAA 1KSHA 2NPFA 5C1BA 4GBMA 2FSHA 2N42A 2PL3A 2OLJA 5DN6D 2FPLA 2AKYA 1OFUX 1Z28A 2SHKA 2IT1A 2OO7A 2JLQA 3H4MA 1UJ2A 3QKSA 5GJWC 3BFKA 3U3KA 4A2WA 4B48A 3SQWA 4MRVA 1EFUA 1IJEA 1G3RA 1P60A 2WSSA 2JLYA 4GP7A 1F2TA 2O8BA 5FFMA 1H8HA 3VR2A 2CJWA 3AVXA 1XJ0A 5EZ6B 1BMFA 2RMKA 1QF9A 2C78A 2ZJOA 1AM4D 2PJZA 1US8B 4PANA 1B23P 3QQ5A 4XSGA 1ZM3A 4KVGA 3KKOA 3HP1A 1X86B 4M22A 1OH6A 1II9A 3CX6A 3FHOA 3L2OB 3U44A 1N0VC 3RRZA 1RYFA 1SXJC 3K0EA 5FUVA 3MG9A 1D8TA 5DI3B 2W58A 3K0AB 3QY0A 5FL7A 1YR8A 5IK2D 2GJ9A 4IXMA 3LY5A 4HDQB 2P0EA 2Q6TA 4DEXA 2O8CA 3CX7A 4EJSB 2VPPA 1Q20A 3KL4A 1M7GA 2NO7A 2RGEA 1JECA 1Z8FA 2J87A 1UPTA 1NIJA 4IVQA 3BRWD 2PZGA 4ARZA 1P75A 1AQYA 4ITRC 3ICEA 2RHDA 1U8YA 1OB5A 3L0IB 3FFBA 1E9AA 5KO2A 1AJEA 4KITB 2AD5A 2QAGA 4C0LA 4BUJA 1ZCBA 1XXHE 1W47A 1G8YA 1GTVA 2R6GA 2JJ1A 3GQBA 4D0GA 721PA 1UKZA 3TAHA 4B3DA 4LK2A 1EX7A 1KYIA 2AFHE 4JVLA 1P3JA 3AKDA 3EC2A 5TXGA 1W36B 3GJ8A 2DHRA 4M1OA 4NDZA 4KBFA 1SVIA 1NY5A 2MMCA 3DOFA 2CL0X 2IYXA 4ON9A 1OFHA 1IHUA 1IN8A 3BXZA 1AKYA 4XVQA 2WAYA 4PPFA 2RAPA 1NL3A 4QNRA 4AKIA 1QVRA 2BM0A 2ZSDA 2HYDA 1WA5A 4MRSA 4E09A 3IKJA 4MDFA 4B35A 2F7SA 3QG5A 4IDHA 4KO8A 4Q1BA 5KPJA 5JECA 3U4QB 1RIFA 3M1IA 5AWFC 3IQWA 4HAWA 4PSVA 2Z83A 3ECCA 3EPLA 2ZYVX 2W0MA 1EG7A 1JJVA 4JIMA 3IEUA 1MR3F 3CB4A 3NEYA 1BOFA 1JPJA 1TMKA 2GBLC 2Q3FA 1YRBA 1G8HA 2DY1A 4GI7A 3BFVA 4B2IA 5F98A 3IHLA 1RZ3A 3D3QA 2BMDA 3CIOA 4PHFA 3FPAA 3QXSA 3GLIE 2WWWA 1VG1A 2XNSA 2QY9A 4G0NA 4JLKA 4M1WA 3EPJA 2WOOA 1DO0A 3SYKA 1DVRA 3DKVA 3EIHA 4KLNA 3THWB 1UKEA 2ORVA 5ELXA 1FW6A 1E9DA 1RPZA 3X1DA 4Q66C 2IBMA 2ZYWX 3B8HA 3F3YA 4C0QC 1US8A 3TK1A 3G0HA 4PC7A 2EYQA 3PIRA 4PAMA 3HU2A 3O47A 3ZDQA 4DEYA 4FI3C 5K8IA 1WF3A 1ZIOA 3A1WA 1KI2A 4EFLA 4C2TA 1U9IA 5FL7D 1DBSA 3NBZC 2B92A 1YE8A 1PLJA 5AJWA 1E2FA 2GKSA 2BBSA 3NHBA 4LJ4A 3TAUA 1R5OA 4EJSA 3B1XA 3KQUA 1LF5A 4RD2A 3DOEA 1VDZA 4A2PA 4O25A 4BASA 4CEIA 3H1TA 4C4PA 3T1QA 1TUEA 4NYMQ 2FA9A 3EXAA 4LBYA 4YXWA 3CPJB 4IEEA 1NMYA 2ZI5A 2ODNA 3P27A 1OXTA 2QAGC 2JJ1D 4PC2A 4YMWA 2V6JA 2J7PD 5L3QB 1DOAA 3X1YA 4D26A 1QVAA 2G83A 3A1UA 4Q1CA 1XMJA 2LKDA 3UMSA 4A82A 4MH0R 3W6NA 5B58C 2C5LA 3DVLA 3EARA 1VCMA 1RC8A 2WWXA 1Y63A 821PA 3JVVA 1GNRA 4PZYA 2QNRA 2H57A 1E2PA 1LS6A 4XSHA 3A4LA 1KKMA 4NHOA 1UBCA 3I92A 4CF7A 4G1UC 1OHHA 3U4QA 4P33A 4MGIR 2QN6A 1OH8A 4XJXA 1CXZA 3K9HA 5HCNA 2JLZA 4EAQA 4YMUA 4FN5A 5KSYA 3HJNA 1J8YF 1J7KA 1KI6B 1DARA 5DISB 3WMEA 2ZR0A 2HXYA 4LJ9A 4Z54A 2OSBA 1KNQA 2ZI6A 1KO7A 3AGPA 1A1VA 3VAAA 3U3RA 2IA5A 1FUKA 2HDNB 3GLHE 2CCKA 4LBZA 5F9FA 2YZ2A 2CHVA 2GJSA 4B74A 3THWA 2O8FB 2X19A 2ZTSA 1P2SA 4MRNA 5G53C 4JLNA 4X8OA 1D2EA 2H16A 1TL7C 4HLUA 5E7MA 1NVUQ 1I4DD 3L82B 3I32A 4GRAA 2PT5A 1TTTA 4L4UA 4LJAA 3SC3A 4EFNA 5JS8A 3FKQA 4RD4A 3VR1A 1GKIA 2AFIE 2AHOA 3GLGB 2R6CA 4B73A 4YDHB 1ZYUA 1G17A 1CR2A 5TB5A 5FTJA 2H92A 1V5WA 2VSXA 4LPSA 2O0HA 1TF5A 1WRBA 1X1SA 2F1IA 2ZETA 1ELOA 1ODFA 4PC6A 4LJ6A 2R6DA 2J0SA 4Q18A 1GRQA 3TSOA 4TMTA 4TYPA 3E70C 1U2RA 1QBKC 3NEJA 2V7QD 3W5JA 3LW7A 3P4XA 4LGMA 3EC1A 1PLLA 4FMCF 4Q5IA 1DPFA 4WA7A 4OJKA 1II8B 2X2FA 3EZ9A 2O8EB 1LY1A 1JR6A 2B7BA 3MCAA 4TWZA 5L3QA 4QC2A 1KHTA 3I5XA 5L3VA 4EIWA 4ZKDA 3AP1A 2JLSA 1G4AE 3A58B 4AYTA 1KJWA 3AKEA 3QIAA 3IO3A 4K8OA 4Z8XA 3V4RA 3ZIAA 2YWFA 4ZCIA 4AY2A 2IHBA 1NVVQ 1XD2B 5AUNB 3CNLA 4M9SA 4H1UA 5FPTA 2GTPA 1KZ7B 3QXCA 2WJVA 4DLSA 4MYHA 4EQ6B 5SZHB 3AKYA 3IHWA 4RY2A 1YZKA 2LWIA 2WJJA 3QVUA 4MKHA 4YMVA 4ZV4A 4JJZA 2AK2A 1I2MA 1N0WA 1W49A 2C03A 3MUFA 5TDHA 1NN3A 3QEJA 3SEAA 3IBYA 1T8TA 4JVMA 4A4DA 1HH4A 3NBFA 1KI8A 3U3MA 3U61B 1ETUA 3NH9A 1E9FA 1XMVA 4M1TA 4LV5B 1XEXB 5CYOA 1W4CA 5F2EA 2J7KA 3AB3A 5DO9A 5GJVC 1KI6A 1KGDA 4BGDA 3FMPB 3KB1A 4NU0A 4P4SA 4ZCLA 2QORA 2WJYA 1G7SA 5FTNA 2WVJA 1SVOA 4IRUB 3KX2A 3AVVA 4IVPA 4TLAA 1XZPA 3WYGA 4RZXA 5EE9A 3K53A 4NBSA 3GMTA 1DTSA 2BCJQ 3GLFE 2O8FA 5A0FA 4FMDF 3RS7A 1NIPA 5KSZA 3U7GA 1M74A 1Z6XA 1OSNA 2WJGA 4ZDWA 1ZNYA 4GMXA 4B34A 4TLEA 4D4LA 2IEYA 3GJ0A 1KAOA 1RVDA 4DBLC 3BK7A 4MRRA 4TLDA 3GLGA 4YMSA 4RFVA 2OM2A 1Z6TA 1FOEB 1E2EA 4BLQA 3IPYA 4CYMA 1U8ZA 2BM1A 4TL6A 4AKEA 1TX4B 1KY3A 5LBIA 1DS6A 2ZSFA 3LLMA 4WXRA 1YZTA 3B1WA 4EPRA 3CR7A 1KSJA 4URZR 3Q5DA 2YVUA 3O8DA 4GPTA 1DO2A 4NCKA 3TUJC 3FDIA 1U98A 3A4NA 1FZQA 2RKOA 4RCZA 3N5CA 2XJ4A 4BWYA 3TUZC 4NYJQ 5JI2E 3Q5EA 3RRMA 5E95A 2O8EA 1Z08A 3PUZA 1KAGA 2ZE7A 1CKEA 2QMEA 1GL6A 1G9XA 5HKKD 3ZIAD 5JHGB 1YR7A 4PSAA 3TJZA 3LFUA 1CBUA 1GL7A 4R2HA 3BE4A 2ZYTX 2GK6A 4TSFD 3WBKA 5G40A 1UKYA 4D82A 4AWXA 4DCVA 3AP3A 4WIAA 1G21E 3P32A 1ZD8A 4JSTA 1GUAA 3THYA 1G291 2W2XA 3GJ5A 4LV8B 2GETA 4OQFA 2OT3B 5GVRA 5KYKA 4DLXA 3F5FA 1EWQA 2FPKA 3WYFA 3CNNA 1UEIA 4AIIA 5JEDA 1E9EA 4PXAA 3A1SA 2C77A 1KDPA 3IO5A 1Z83A 2IYSA 1CRPA 1XEXA 5DH9A 4HAUA 5CLQA 3LWNA 4V0MA 3A1TA 4D25A 1FP7A 1N5IA 4A9AA 3LQRA 5JSZB 2IL1A 3ONWA 4GNKA 4L5BA 4ASUA 3ZLJA 1FMLA 2ZJBA 4BEBA 2G1KA 2BBWA 3H84A 2Z43A 5FTLA 4DSTA 2Z6VA 1RKBA 1S0UA 1R2QA 2RGCA 3SFVA 5G3ZA 2F6RA 4MDEA 1ZM4A 3B2EA 4PO8A 4QFMA 1R8QA 2IWRA 3WP0A 4UQOA 3W6OA 221PA 4HLCA 2VP6A 1E1QA 2QSZA 4DSNA 2B7CA 4N3NA 3AQ4A 1T91A 2ASEA 3H86A 3SJZA 1TF2A 2V9PA 3PVSA 3OAAD 2PBRA 4KFRA 5AR1A 3W5IA 3VTKA 2IS2A 1T4GA 4II7A 3MFYA 1Q1BA 3TR0A 2WIBA 1DG3A 1P6XA 3NHAA 3I8SA 2WICA 1BKDR 3FFAA 1XD9A 2QQ0A 4QXAA 3LQQA 5DHAA 2ZE6A 1T5LA 3ZZUA 5CYPA 4FW9A 3NDBB 4IOMA 2Z4SA 1G3UA 1OF1A 4LYJA 4HAZA 5CDFA 1ZUNB 5IT5A 1XBTA 4MKFA 2ERYA 4EDHA 3QBVA 4TMKA 2WAXA 1NJGA 1ZM2A 1AS2A 2EYUA 5JJKA 4EFMA 3EZ2A 2IS4A 1HQCA 3RRNA 1NG9A 4TMVA 2GCNA 1UKVY 4DLVA 1H65A 4JMPA 1QG4A 3BH6A 4V0KA 4QRHA 1JBKA 2FN4A 4X8MA 2I4IA 1XDBA 1WBDA 3EWSA 4OHYA 2C9YA 5DSZA 2B8WA 2HT1A 5J4YA 3FKSA 3UPUA 2FEOA 1YU9A 1Z0AA 4W5JA 1TU3A 3QE0A 3QNUA 3RS5A 2XZOA 5AK0A 3KKPA 1U99A 3OE7D 2OXRA 3V4FA 2GJKA 1M7BA 4NCNA 2V55B 2GVDC 2QRNA 2G1JA 2HF9A 4LC0A 5AJZA 2CCJA 3V00A 4TLBA 2FSIA 3WMFA 5HCIA 4U5XA 1RJ9B 3K0SA 3SJCA 5AJVB 5JSZA 2PCLA 4ASUD 2W00A 4S35A 4DCUA 2WHXA 4F4JA 1FQJA 2EWWA 2OCAA 1A4RA 4JKYA 2OCPA 2QTHA 1E4YA 4DT1B 2ZI9A 5FBVB 1E2GA 3UIEA 1GFIA 4QHSA 1E2KA 1OV4A 5CK4A 5JLJA 4NYIR 1HQYE 1PUIA 1YHNA 2FGJA 1D6JA 2QE7A 2FV8A 1ESMA 3B78A 1E1QD 2AR7A 2DWOA 4E22A 1W5TA 1Q22A 2Q0HA 3TGPA 2A5JA 1DAFA 4QHTA 2Q9AA 3EIEA 3X1WA 2KWIA 2O8BB 2HJGA 3KQNA 2JIZD 2PT7A 2PX3A 4FCVA 1SVKA 4MUAA 2VHCA 2W2VA 2HLDD 1GG2A 2Q3HA 1OIVA 2F9LA 4YC7A 4XVUA 2JDID 4FMBB 4LCBA 1VKJA 3PUYA 2XJ9A 2ZAOA 4HAVA 4MGZR 1TEVA 4I1UA 4M21A 4Z1MD 4HAYA 5J5CA 4UKDA 2ZRFA 4OK5A 3NWJA 3ND9A 1UADA 4WZAE 2BOVA 4F4CA 1LV7A 1SQ5A 4CVNA 1MKYA 1XEFA 1YVDA 2GF0A 3HR8A 2XB2A 1EESA 4B47A 1KO5A 2P65A 1OB2A 3S1AB 2O8CB 3LXRA 4ZDJA 2ZRNA 4O3MA 4DXAA 2OLKA 4JLOA 4EPXA 5C2JB 2OFWA 1GDDA 1CJMA 4G01B 5E7IA 5CJPA 2AX4A 2VF8A 4M9ZA 1SZPA 4Q19A 5ANRB 5KSOA 5JJIA 1MABB 1NMZA 4ACBA 1W0JA 2QAGB 3ZVMA 1J90A 1P62B 2Z4RA 4IFBA 1UDXA 1ZC3A 3GFTA 2RB4A 1W4BA 1T3LA 2XOKA 4LYFA 1JQJC 2QA5A 3LVRE 1VYUA 3BB1A 3MMPA 5EP4A 5M04A 2JJ8A 1IN5A 1T9HA 2IYLD 5DGXA 4L15A 4GOKA 2QAJA 4Z8YA 1XF9A 1QRAA 1XX6A 4RVCA 1RE0A 3ZJYA 4B76A 2V6IA 3RLFA 4ZI2A 1E9SA 1KSFX 3FWYA 5JMTA 3L43A 3QXHA 2NTYC 3GJ7A 4NONA 5J40A 4CW7A 2W6IA 4LY6A 3SS8A 1WCV1 4FMCB 1KI4A 3MJHA 4BLSA 4C0JA 2N46A 2ONKA 4PAQA 3IIMA 1G19A 1WP9A 3PR1A 5TVKA 4DT1A 2C2HA 2D7DA 3E2IA 3IUYA 3I5YA 4HZIA 2NZ8A 2P6UA 2GBLA 4US1R 4ZIRA 4CGZA 1M6NA 1OLOA 2FWRA 2I1VB 1Z63A 2JLVA 1L8QA 3FB4A 1NN5A 1N6KA 1JQLB 2G3YA 3PQCA 1A2KC 2G9NA 2A7QA 4NCJA 4TQUS 4M1YA 3B82A 4EPYA 2LCFA 4XH9B 3RVBA 1OW3B 1W2GA 4AK9A 1UDWA 4C2UA 4QG7A 5JJLA 1N6LA 5KNDA 2BKUA 1D9XA 4OQXA 4G5QA 2ZS8A 1UBGA 4JZKA 2REXB 1KI3A 3BBPA 4JL8A 4PTLA 2J1LA 2JATA 5AJXA 3E5HA 5CB6A 1QHNA 3OEHD 3CX8A 2ONJA 4DLTA 2IYZA 1WDTA 3VR5A 4I1SA 4Q9JA 4QM7A 1GKUB 3SYNA 3X2SA 1SXJD 4Q1FA 3KUCA 4GFDA 4W5HA 1KJZA 4C0BA 4LHXA 3Q7QA 2DBYA 4TYQA 1PJRA 1R10A 2UKDA 4LHWA 4PZZA 3NBXX 3I73A 1KSGA 2EFDB 3FGNA 4JLPA 1E2LA 4CT5A 3K0CA 1GRRA 3S1AA 4HUTA 4I4LA 4WZ6A 3U60B 1LNZA 2RGXA 2YC4C 4M2LA 3KDSE 5G3YA 1DAKA 1XB2A 2WJIA 2ZSEA 4UXIA 4CEIB 1MT0A 3W3AA 1OKKA 4JT4A 4A6XA 2ZU6A 4FMDB 1U0JA 1BO6A 4UXHA 1D9ZA 3VHLB 3EPKA 1MABA 5HTKA 1W0JD 1X3SA 2ECKA 4BEJA 4N0EA 1XCMA 3UANA 2BIFA 3QSYA 4LRWA 5FPHA 3TW4A 1YZGA 1GNPA 3J81k 2QP4A 2C9CA 2GWHA 1SKYB 4UXJA 2VYFA 3K70B 5KTYA 4V02A 3U3JA 5JCPA 3CKLA 1AIPA 1KY2A 2J46A 3GFOA 2C96A 3TR5A 4JBYA 4GZLA 3CF2A 4MRPA 2C04A 4KCGA 5FR1A 1S96A 2QGNA 4HEJA 4ZO4A 5JWOA 3K09A 1G8PA 1CLUA 2FU5C 1O87A 1R5BA 2W6ID 4PQRA 2ZIAA 2BEKA 3REFA 1Q57A 5EQTA 5SZKB 3OF5A 5CM9C 3TSZA 2H18A 4RD0A 1MO3A 3SHFA 2ZANA 5JRZA 2AD1A 4IVRA 1GILA 3KQHA 1XWIA 3ZVNA 5KUTA 5FI0B 2QPTA 3VNVA 1Z2AA 2OXCA 5EXPA 3EASA 1COWA 5HPYB 1I4TD 1E6CA 2WSSD 5FPYA 3DM9B 1R7RA 1B0UA 4M53A 1H8HD 2H17A 1N6OA 2OFOA 5JS7A 1BMFD 4KI0A 4A0HA 2NQ2C 5LDDC 1H8EA 3U2QA 3WRXC 2P67A 1NKTA 2ZJYA 2Q9CA 4B3CA 2OUKA 4R71A 2VIIA 2GCOB 1DAMA 4EPWA 4DIEA 4BZQA 3G82C 4FXPA 3QF4B 3AVQA 1NG1A 1XD8A 2A9KA 2REOA 3AF1A 2F9MA 4E07A 1P5ZB 3I3SR 2IXGA 4OHZA 5J4VA 3NH6A 4QJ4A 2N1BA 1UFQA 2GAOA 3K0CC 5J47A 4MYCA 5SZIA 4TMXA 1JEDA 2R2AA 1E4VA 3SHWA 1OKKD 1G5RA 5EZ5A 2OG2A 4PQFA 4GL2A 2YNMA 2XSZA 3LBHA 4PC3A 4PQYA 3TMKA 5H8WA 1MOZA 1EX6A 3R8CA 4JJKA 3GPLA 2JEOA 3CRW1 3T1VA 1R0WA 1G8FA 2WWHA 2QM7A 3KQLA 4H1VA 2ZYUX 5KHOC 2IW3A 3GD7A 5BQ5A 3LW8A 2ZI3A 1ZMXA 1U94A 4M0LA 4Q1DA 3AUXA 4IW3B 4CZ2A 2J45A 1FTNA 2QPAA 4H9GA 2CNWA 3RNLA 4G5RA 2AL7A 3KKQA 1Z0IA 4BLOA 2J9RA 1R0ZA 4UNSA 1OYWA 6Q21A 2F3TA 5JWRA 5D3QA 4GDFA 1UM8A 3BC1A 1XCGB 3KXIA 3K09C 4BFSA 4BLRA 1S9HA 3CRRA 1N6NA 1Z6GA 2V1XA 4P0TA 1P9NA 1YR9A 2YWEA 3SI7A 4LHVA 3WYAA 1Q3HA 3KTAB 2HCBA 5KU1A 1E0KA 5LD2C 2HV8A 1UEJA 3THXA 1XPRA 2RCNA 4HSEA 3RDPA 4HUQA 4ESVA 2CK3A 1U90A 4P4SB 2A2ZA 1NN0A 5LB4A 2Q21A 2K5UA 1UAAA 1E9RA 3B1VA 4UJ5A 2ZRIA 3RC8A 1LVGA 3TVTA 1E0SA 3VKGA 5EUMA 4BRUA 4DVGA 121PA 1SGWA 1XPUA 4US0R 1ZW6A 4WOPA 2YOGA 1Z0DA 4HB3A 3QBTA 2DCUA 2XB4A 3DMNA 1CU1A 2XAUA 3U6BA 3GJ3A 1SXJE 1W7AA 3ADDA 1OIWA 5CLLA 3ZGXA 2GCOA 4LBVA 4PPNA 4CEJB 1OJLA 1UBFA 4URYR 1TAGA 2ZRKA 4R7ZA 1G1MA 1ZUIA 2QMUA 4IXNA 4K81B 3QF4A 3TIFA 3TUIC 2BJWA 4Q7JB 4Q02A 2HYIC 5FOVA 4HB4A 4DKXA 3CWQA 2MSCB 4GZMA 4GT1A 2OEPA 2GJAA 2KBEA 1X8KA 3L8YA 5BYJA 1IN7A 4JT2A 4Q21A 1JAHA 5DIFA 4R9UC 1OXXK 4YXWD 4OI0A 4O2LA 4KAXA 1RW4A 2QI9C 2ZQ5A 3GEEA 4TT3A 3QPVA 5G41A 2FEMA 1VCIA 2J0VA 5B2ZA 2RGDA 4Q4HB 3NVAA 3K9LA 3SN6A 3CRQA 1R4AA 2KJQA 5FPKA 4DUGA 1W36D 3K70C 4MKGA 2QTVB 1FP6A 4BFXA 2IHYA 2EQBA 3ZQJA 4TMZA 4Q7KA 2Z0MA 1JEEA 1KJYA 2ZS9A 2ZVPX 3C5CA 4TL8A 3B1YA 3ZQ6A 1YJ5A 3OIUA 2UZ3A 1ZINA 2ZS7A 4B44A 4P3YA 5KDOA 3THYB 3WNCA 2WSMA 1S3SA 1M7HA 3NDPA 3KXLA 1XMSA 1T6NA 2OCYC 1OHHD 1QDEA 1TQ4A 1IQPA 2VEDA 1G7TA 5CJ2A 2BKEA 2A3RA 2B8TA 1VCNA 2PMKA 2EU8A 2RGAA 4C9BA 3T34A 3KTAA 2P6RA 1TEXA 3QXJA 2GXUA 1NMXA 1X8JA 4IHQA 1CR1A 1E9CA 2WWFA 2ZRMA 4WXPA 4QM6A 1E3MA 4UNPA 2HF8A 3A1VA 4JBWA 3SBDA 2QM8A 1VHLA 3SZRA 5DNYB 2UVQA 1G20E 5HZKA 2D2EA 3GCGA 1XXHB 3KQKA 1HEIA 2GHIA 2J5XA 1L4UA 1RRFA 4IOLA 2AXNA 2J59A 1V43A 1YZQA 3F8TA 2JLWA 3AGQA 3UWKA 3A8TA 1KK3A 2IS1A 4LBWA 2DPXA 2VF7A 1TQ6A 2PLRA 1JAIA 4MKIA 3RANA 1XTRA 4V0LA 2NOAA 4B43A 2WZQA 2GNOA 2HXSA 1Y3AA 4LSGA 2HT6A 3C4JA 1AS3A 2EW1A 2VHTA 1G6HA 4IFEA 4Q48A 3T1OA 3BWDD 4LJ7A 4TQAA 4CEJA 3ZS9A 4XOIA 2WKPA 3MGCA 1J99A 4D80A 3LV8A 2GXQA 1KDOA 3OFNA 1CJUC 4A92A 1N5KA 1KDRA 2IF0A 4KJZA 4DDWA 8OHMA 2OV2A 2IK8A 1ZNWA 1JR3A 1NBMA 2VP2A 1TPZA 1G3IA 1PUJA 3PG5A 2NO0A 4R98A 2EVWX 4GMDA 3N2IA 1F48A 1Q44A 1TADA 3L8ZA 1K5DA 4QGFA 3GJ4A 1E2IA 3P1JA 2UZIR 4D6PA 3U6KA 4A36A 2JASA 4HB0A 4Y0VA 4ESHA 4V0OA 4B75A 4TT3D 4NTZA 5IDVA 1C1YA 1W48A 1GKYA 3GLIB 4PZLA 1U81A 1SVWA 2QQEA 2W6JA 3OIWA 4OK3A 1FX0B 4LWZA 1WXQA 4Q4HA 1DAEA 3B1ZA 1U8AA 2BCGY 3CZQA 3ZS8A 4F91B 1Q0UA 2A5DA 3HU3A 3RHFA 1OXVA 3X1XA 3CRVA 1OXUA 3OZXA 1VHTA 2JCSA 3RYTC 4QBFA 2H7VA 1GSIA 4URVR 4B6FA 3B60A 5EE5B 3T5GA 4BPBA 1HE1C 1G6OA 1E2NA 3R9XA 1IXSB 4S2EA 2WBLC 2BC9A 1E2HA 1I2DA 5D3MA 1Z22A 2H1LA 1EFRA 4D0LB 1E2QA 3LBIA 1PLKA 2QT0A 2VH5R 4WBSA 1L2TA 2XEXA 1G7CA 4TL9A 3VKHA 1OH7A 2WWGA 1LW7A 2DWPA 2D3WA 3AUYA 3KB2A 1FNMA 4ZDIA 3VR3A 4A8JC 1OPXA 4A2QA 3H0KA 4UNQA 4OBEA 2OBMA 3R20A 2BDTA 2NG1A 4FINA 3A37A 4W9MC 4GSYA 4LPKA 2XTMA 4JS0A 5DLQC 2G0TA 1JXOA 1TF7A 5H70A 2NO9A 4RZ2A 1XXHA 5EE1A 4DHEA 1EFTA 4O0MA 1DADA 5TARA 4F7WA 4KHZA 1N0UA 2G88A 3NBYC 4U00A 5HZHA 3THOA 4PSKA 4JBXA 1VIAA 5J4HA 5L3RA 1CRQA 3AF3A 2GRJA 4DDUA 3TQCA 4V03A 3RAPR 3ASZA 3EG5A 3VQTA 1CTQA 2NMVA 3R9IA 2QTFA 5FTMA 1T0JB 1AS0A 1SVLA 5FBRB 2GVZC 2PEYA 4HYYA 4KBGA 3LNCA 2GZHA 1IJFA 4Q47A 1FMJA 3AVUA 2FZ4A 1BYUA 2KE5A 3AVTA 5FUWA 1Q1EA 5GVSA 3W8RA 1DELA 1JXMA 1CJVC 4BQSA 1AN0A 2P3SA 4EPTA 4ZKEA 2VP4A 4TTQA 4ZI3A 1A82A 1X8LA 2W0SA 4I1VA 5JI3E 3PEYA 4OI2A 2D06A 2IC5A 3K1JA 4KFSA 3FYHA 3CWZA 3JZMA 1XEWX 1QG2A 2P6NA 1SKYE 4F38A 3KFXA 1ANKA 2ZPTX 2ZUCA 3GLIA 4MGYR 4DIDA 1RRGA 1N5JA 3RS2A 2ORWA 3P20A 3BB3A 4KFUA 4KLZA 3GLHB 1FX0A 3GFPA 3M6AA 4HI0E 3BB4A 4U7DA 3EPHA 1ZU4A 2OHFA 1M34E 1ZD1A 4ERNA 1JPNA 3PEWA 3MWLA 4B2PA 1G64A 2VHJA 3AF0A 4DLUA 5E3HA 5JZVA 4RSGA 1FQKA 2WKRA 3AVOA 3QKUA 2GF9A 1GP2A 3C41J 1OT3A 2YKGA 3JZAA 4N0DA 1KO4A 4FD2A 3M4YA 4DWJA 4D0NA 1LFDB 1Z0JA 2GILA 3I8XA 1NN1A 1QHGA 2DYKA 3Q3JB 4XD7A 1IY1A 3BIFA 4CRWB 3QF7A 5EE3A 2JJ2A 2OE2A 3W34A 4A0GA 4D2IA 4WW0A 4IDPA 2QGZA 4TZ6A 1QHIA 3IDQA 2BBOA 3SU8A 5TY0A 1R0XA 1G16A 5FTKA 1HV8A 2ZITA 4YONB 1E2MA 3WHLA 4O2RA 5K8TA 1FPMA 3AF4A 3RS0A 3QPWA 3B9QA 4XWKA 3D6TB 4FWIB 3UWOA 3V9PA 3ZD6A 3HU1A 2OAP1 4LV6A 1W0KA 2RGBA 1SVMA 3B13B 4OJQA 2IEZA 1ZD9A 1KIMA 4DDTA 4TLCA 4DDVA 1JB1A 2NIPA 2ZRJA 3WNBA 1KI7A 3IPXA 3G5UA 4FCWA 4WVFA 1CEEA 4G5GA 4YDSA 2V1UA 2L0XA 4ZIRB 5LPNA 2GEDA 4E5UA 5BN4A 4X8HA 2KI5A 1NLZA 4JYCA 3KUDA 2R9VA 5B57C 2OBNA 2X77A 3DKPA 3CNOA 4JVSB 2CXXA 4A0FA 4RKEA 4DSOA 5K8UA 4P4UA 2FPMA 2OFXA 2ZRHA 3OHMA 4JKIA 1MO6A 3MSXA 5JBQA 1VTKA 2ZJ8A 3QENA 3TBKA 2J0QA 3QUSA 3F0TA 1XMIA 2GEUA 1MH1A 4HB2A 4KYUA 4AG5A 2OZEA 4XWOA 4Q9LA 3GP8A 2IF2A 3DO6A 3ZD7A 3AP2A 4PO1A 5HR5A 1YR6A 3R7WB 4RJLA 2XTZA 4LI0A 2IYYA 5DN6A 4IKEA 1GOTA 2FMXA 1WE2A 2CL7X 1TUIA 3NTUA 4AC9A 1NKSA 3RWOA 4TL7A 1Z6AA 4FCTA 1UBEA 1P2VA 3GLHA 3EW9A 4IDOA 2JLRA 3IQXA 1VECA 3HWSA 4Q4JA 3CPEA 3ICQB 1XEWY 1ZUHA 1XTKA 1XNJA 3TE6A 2XXAB 2QRZA 5F9HA 3FHCB 3OIYA 1QHSA 2CHQA 4EKDA 4CDGA 4KXFB 1VCOA 1W46A 3K9NA 4OYHA 5KDLA 3W3ZB 2RH5A 3NC1C 3W90A 1P2UA 3PENA 4ZPXA 3FKSD 4NMMA 5IK2A 3EZFA 3TNFA 2O8DB 2DFNA 1E69A 4M9XA 4RD3A 4B3FX 1G5TA 3ADCA 2WIAA 3BORA 3KFVA 5EXTA 5EE0A 3WHKA 3FE2A 3QPUA 3CPHA 2VHUA 2J3EA 3HYTA 3K0FB 1J70A 3M0EA 4QBHA 2EFHB 4X8LA 4OQNA 1IONA 1MV5A 5GJBA 2WPDA 1Q3TA 4GOJA 2AWOA 4XTRA 3RS3A 2FH5B 4NYMR 1JALA 4IDNA 2ORIA 4MQBA 4ZCMA 5BN3A 3DEFA 4KODA 1KI9A 3TQFA 2ZSAA 4LOAA 3PUWA 2CDNA 2VSFA 1IY0A 5FI1B 5LD2B 3QKRB 2DFLA 4G3XA 2DWQA 4AURA 4N1AA 2R62A 1F3OA 1RFLA 2GXSA 2QE7D 4ABYA 4DRZA 3IGFA 2BBTA 3LX8A 5UKDA 3GLGE 3UMFA 1XU4A 4PC1A 2C99A 1XJCA 2VTKA 3NKVA 3T5DA 3Q72A 5SZJA 1E79A 1P9RA 2EFEB 2ZE5A 3DL0A 4KVAA 5AUQA 4A6PA 1E32A 3PV0A 1E2JA 3MWJA 4OHVA 1IOZA 1Z6YA 4B33A 5FOUA 2O0JA 2ZI4A 2BMFA 3B7GA 3R7WA 3QG1A 1ONBA 1EK0A 1ZNXA 1K8RA 1OXSC 3AH8A 1AQUA 1P72A 1G41A 2C9OA 1Q12A 2ZEJA 4OQLA 1N6PA 3TLXA 1IM2A 1XP8A 1HTWA 2QPOA 3SOPA 1XCPA 2C95A 3Q7PA 4TYNA 2ZRLA 5DI9A 4BLTA 1M2OB 3FVQA 3EX7C 5EXSA 3CM0A 4F92B 2ZE8A 1P2TA 1VG0B 4L9SA 4MITA 4NL4H 4DB2A 4JL6A 5P21A 4C0HA 3U7EB 3RS4A 5KPDA 3TVDA 5JRJA 4PFSA 3B9PA 1T3SA 3LX5A 4OL0A 5EXXA 3RRYA 3GLFA 4QOSA 1A7JA 2XXAA 4DLZA 3MWKA 3W6PA 3B85A 3C5HA 2XOKD 4W5WA 3VR6A 4M9QA 2ZJ5A 5DYIA 4KSCA 3VX4A 1ZAKA 3PEVA 2O8DA 1XTIA 3KKNA 1N3BA 4HDCA 5EP2A 1MO5A 4JSYA 4XWAA 1AK2A 4V0ME 5BN5A 4ACAA 1IAQA 2V4ZA 3PFIA 3VU9B 3K0FA 1J2JA 1R5NA 1XJQA 3ZVLA 2X2EA 2ODEA 2WPDD 2AK3A 5FOXA 2EWVA 3T15A 1T8UA 3I4LA 1TNDA 4FIDA 3I72A 2XZLA 1QHXA 4ZDKA 3O8CA 1MRSA 1RRPA 3BH7A 3C7KA 3MAAC 2J7PA 4Q9HA 3LXXA 3KXKA 4I1OA 1IBRA 4NYIQ 2ZXUA 4JLJA 1ZRHA 1SULA 4EUNA 2AXPA 3QKRA 5FBLB 3THXB 4HUQB 4HLQB 4HAXA 3UKDA 1W44A 2ZJZA 4DCSA 3REGA 4B32A 2F43B 1NVVR 2ZRCA 5DYGA 4AI6A 2WMNB 5AJYA 1SHKA 3NC0C 2PX0A 3P26A 3VKWA 1EFCA 2QL6A 2X1VA 2Q3MA 2YC2C 1G8GA 3BERA 3RSLA 1E79D 1HY3A 4LUCA 2R8RA 4US2R 3IIKA 5GADl 1JNYA 3U7FB 2GA8A 3SFZA 2E1RA 1SKQA 1S2MA 2FGKA 2RGNC 4DCNA 2CLSA 3DPUA 3LRPA 3T61A 5FOTA 2IYRA 3SR0A 2KSQA 3I61A 4MUBA 3VNUA 1ZP6A 1X1RA 3IILA 4KYIB 2R6AA 1YQTA 4HZUB 5CDFE 2Y8EA 2IYWA 2TMKA 2ZAMA 2ZRBA 3L0PA 1DEKA 3CF6R 4JLAA 4I81A 5CB8A 1QHHB 4D81A 2IYVA 4Q1EA 4L9WA 1G18A 1AKEA 1GZSA 1EWRA 2FSFA 4QL3A 3SJAA 4DLRA 2ZRDA 1KOFA 4RFSB 4K46A 4R2IA 3CR8A 3KKMA 2GCPA 1I4LD 2LKCA 4C3ZA 2DR3A 5EP3A 1BH2A 3LDAA 1E99A 2RGGA 3LBNA 1ZIPA 3AM1A 4WAUA 1LB1B 3NXSA 1Z47A 3TW8B 3VFDA 3BH0A 3DZDA 2GAAA 1ZU5A 2PLFA 3DZ8A 3EAQA 1WQ1R 3QI2A 2JLXA 4LJYA 4C7OB 2ZRGA 1AA9A 3BFXA 3W8NA 1M1YE 3ND8A 3FHTA 5DI3A 3K0AA 1KMHB 5JHHB 1CULC 2MMGA 2F3RA 2GESA 4LC1A 2NZJA 1KK2A 1VPLA 2D62A 4TTPA 5C4GB 3N2EA 3WNDA 2FFBA 2Z5FA 1VIYA 3SNHA 2CEAA 4OK6A 2QEQA 3EA0A 3VU9A 5IF9A 4Y0AA 2BMEA 3CO5A 5FBWB 4AKGA 2V7QA 1VG9B 4LZZA 3D7MA 3UATA 2FE4A 3CBQA 3E1SA 3T1TA 3VX3A 3P4YA 4POAA 4YMTA 4HATA 1AGRA 1J8MF 3KZ1E 3SYLA 1P4SA 2QUZA 1OIXA 3VMFA 2XGJA 2VA8A 1NJFA 4BFZA 4NYJR 2CHGA 1E94E 3EIQA 4P31A 4PHHA 5KNBA 3LA6A 4IEIA 4IJMA 2FFQA 2FSGA 2VP9A 1YZNA 4A8JB 4GP6A 4XTCS 1W4RA 2P5SA 1XTQA 4Q00A 3L0SA 2PZEA 5KOYA 1N2CE 4B3GA 2ERXA 4BRWA 5IHPA 2F43A 1EFHA 1ZNZA 2QU8A 1COWD 4QBGB 4BE7B 2FDCA 4JLMA 1RYHA 5EJEA 1G3QA 1SHZA 4LHYA 5CITA 1HYQA 5J4LA 3I1FA 4JLDA 1Z06A 4AYWA 1H8ED 1IN4A 2R6FA 4BFWA 3QOFA 5CIWA 3AV0B 3HPQA 521PA 1C9KA 1F5NA 5E4FA 4LYAA 4URWR 4D4JA 2GDJA 1C4OA 4HZUA 4RZUA 1E0AA 1WBBA 4Q4AB 2C98A 3CONA 1QHHA 5EUQB 1F60A 3UK6A 4C0SA 1S9DA 2V8OA 1GM5A 1NF3A 4V0NA 3UG6A 2ZVQX 3NIBA 4PO9A 3GEHA 4RFSA 3PITA 2AN9A 2FX3A 3ASYA 4U02A 2ZR9A 1EXMA 1KO8A 4NZYA 4QGGA 3WXMA 1P7CA 3R9WA 2J0UB 4DLYA 2VP0A 1CJKC 1XPOA 2YINC 1OFIA 2BEJA 3CRMA 4Q7LA 1K5GA 2ANBA 2YOFA 5KNCA 3BD9A 4IOJA 2XSZD 1W4AA 1PZNA 1Z5ZA 2XITA 2VRWA 3CLVA 3WY9A 1ZJ6A 3PUVA 1O3YA 4C7OA 1W2HA 4MA4A 2NO6A 4TZ0A 1U9IC 3OESA 1KMHA 3LH5A 3X1ZA 2JAQA 3K70D 2PZFA 4OI4A 2VHQA 4EJSC 2KBFA 4URXR 2E87A 1X6VA 4UNNA 1T0HB 4A0RA 1KNXA 2CNWD 5FL3A 2X8AA 4P4TA 3MLEA 3ZH9B 2D2FA 3BS4A 3JVUA 3TSWA 4HLDA 1Z2CA 1IN6A 1D2MA 3CUEF 3CZPA 2DB3A 2IS6A 5D3MB 4JYBA 3HYRA 5JWHA 3B5JA 3LO5A 1S4QA 1CIPA 1GIAA 4OKSA 4A1FA 4M8NE 421PA 2QZ4A 5HKKA 1W36C 3EA5A 2O52A 3RABA 2FJUA 3D8BA 4A8JA 5KDDA 2IX3A 2WWIA 4TSFA 2CK3D 4CT4B 2CE2X 4NPHA 4Q03A 3CF0A 1FFHA 5H68A 4PHTA 2IUUA 4RZ3A 1YZUA 2REBA 3A36A 4B2LA 5FUXA 1GVNB 3AVPA 2PJRA 1IXZA 2WM9B 1NSTA 1OE0A 1S1CA 4J0QA 4E03A 2FFHA 1D2NA 3I62A 3FMIA 2NO1A 2ANCA 5FOWA 3TKLA 1PV4A 4Q4LA 1G7RA 2ZROA 2QP3A 4Z51A 4BFVA 1K6MA 2VSOA 4UJ3A 3PXGA 4DLWA 2EFCB 4TTRA 2C8VA 4QKQA 4XIGS 1BS1A 2PEZA 2QMOA 4PPGA 3GEIA 1QHYA 3MD0A 5LB2A 3IBGA 2PH1A 3LAWA 3TRFA 4Q4AA 5F3WB 1UF9A 3FMOB 3KJGA 2IYUA 1PVOA 4D4KA 5AUOB 2ZR7A 5DHFA 4MGKR 5C4MA 2YV5A 3W9YA 1P73A 2CE7A 2D4HA 4L8GA 4M1SA 2DFTA 4URUR 5TMPA 4A15A 2FG5A 3SJBA 2BWJA 2VO1A 2QENA 1CS4C 3ZYCA 1M8PA 1NP6A 2J0UA 5FH9A 4HLUC 4M1MA 3HDTA 4RKFA 1WB9A 3BJIC 1NRJB 4KV9A 1HT1E 1Z0KA 4WZBE 5IRCD 5JEEA 1R0YA 1TU4A 4AYXA 1MRNA 2O5VA 2OAQ1 1YZLA 2HCJB 2QMHA 3OAAA 1R6BX 3SBEA 4DUGD 1ZM9A 2YWGA 4JVNA 5C46F 1FL9A 2ODBA 4OQMA 2OESA 4B6EA 2JGNA 1FUUA 1DG1G 1VG8A 1CP2A 4BFUA 1NVXQ 1E1RA 1YKSA 3HPRA 3RC3A 1CF4A 3C8UA 1FTSA 1LF0A 3TH5A 3U3OA 2GZAA 3SQXA 2NGRA 4QGHA 3SDZA 4AKHA 1JJ7A 2ZUDA 1QZXA 1OFTA 1CJTC 2RHMA 1U0LA 2EFGA 2VBCA 2W83A 1II8A 1F6BA 3U5ZB 2G6BA 4TYYA 1W5SA 4QHYA 4NCHA 3PEUA 2A30A 1W1WA 2JA1A 2OCBA 5HE9A 2CMKA 4NCIA 1E0JA 2ZSBA 4PHGA 2J41A 2I1QA 2OILA 1N6HA 1JI0A 2CVFA 3K8YA 1XD2A 4TQ9A 3PJRA 1BYIA 3C14C 4BLPA 2CLCX 1SVSA 4C0AC 4TN1A 3VHXA 3FOZA 1ZM7A 4EQ6A 4LDJA 1KK1A 3H2YA 1E2DA 2BV3A 2G77B 1EGAA 2CVHA 2VP5A 1DAIA 5FPSA 1HURA 3WRYC 2BMJA 1GITA 4PX9A 4I99A 2QP9X 2YYZA 2P2LA 3UXMA 3LVQE 3OE7A 3QVVA 3ZZTA 3AVWA 4G5OA 4HDOB 1Z29A 1GRNA 4W7SA 5FUYA 2Q9BA 1G5PA 2QG6A 4CIDA 1GNQA 2IYTA 3U7HB 4NH0A 4D4MA 2JLUA 4CEHB 1E96A 4QJ3A 1XTJA 3OFND 4B3XA 2W2TA 1L7VC 1ZCAA 4NKRA 1WMSA 1T3HA 3PCRB 4DCTA 1JR3D 1NI3A 4LYHA 1NBMD 1Z3IX 1YRAA 2G0NA 3BGWA 4RD1A 2PMDA 1Z07A 3QKTA 4JLVA 3RSOA 3C16C 3AKCA 4DZZA 3KJIA 3WMGA 2H5EA 3ZZ0A 5JCZA 2H8KA 4KU4A 3VR4A 3N70A 2F1RA 1ESNA 2ZI7A 2IUSA 1TQDA 1NLYA 1T5IA 2W6JD 3A4MA 2JIZA 1KDTA 1Z0FA 4DB4A 2CL6X 2HLDA 4BECA 2GEVA 1E9BA 4Q4JB 5JFGA 3AVYA 4OI1A 2JDIA 2ZRPA 4AD8A 1E1RD 3K9GA 3HR7A 4Z1MA 2VL7A 3Q9LA 1SXJB 2HEIA 2D7CA 2WMOB 4Q1AA 5AUPB 5B30A 2WTUA 1XRJA 3UMRA 2FNAA 2YJTD 1AZSC 2BHRA 3GJ6A 4Q01A 4NP6A 2HUPA 4C30A 3ETLA 4DC9A 5HE8A 2GZDA 1S3GA 1KO1A 1L4YA 4ILEA 4C0KA 2F55A 2ZU0C 1EFRD 1S8FA 4G5SA 1KTVA 1LS1A 5J4KA 4IOKA 2YHSA 3KJHA 3QEOA 4M4SA 5FBQB 3ADBA 2P5TB 3QJYA 4BFTA 3CH5A 1LTQA 1G3MA 1VMAA 2IYQA 2ZJ2A 1KK0A 1A2BA 2V54A 4YLGA 5BXQC 3CH4B 1ZC4A 2CCGA 5E7JA 2F1JA 2ZUBA 1IXRC 2OBLA 5L3SB 5KSPA 1OYYA 3O8BA 1BIFA 1A5TA 3EZ7A 2XNDA 4L16A 1F2UB 1VYTA 1KMQA 1II0A 2ZM5A 5K8LA 1U0HC 4DSUA 1CR4A 2XZPA 2GK7A 4LJ5A 4MYTA 4F93B 2DFKB 3T35A 2GJ8A 2PCJA 5A4JA 4AG6A 3LLUA 2IXEA 2AKAB 2WV9A 4NE2A 5FOSA 1ZBDA 1GAJA 2F1HA 3UG7A 2IUTA 4QNMA 5B64A 3IIJA 1CR0A 3ZVRA 4CEHA 4B3BA 4OHXA 4BFYA 1NSFA 4RCYA 3AEZA 3Q85A 2QBYB 1P9WA 3OEEA 2E9SA 3PUXA 4JL5A 2ZJAA 1Q1QA 4PR0A 2NPIA 5CK5A 1OH5A 2WKQA 1R8SA 2CBZA 3KJEA 3DDCA 4OHWA 1KI1A 2BVNA 4BZPA 4DJTA 5BWMA 4KSBA 4QBIA 4UNRA 2O0KA 2WJHA 1DE0A 3A6PC 1DAGA 5CM8B 2A5YB 3QKSB 3BOSA 3GJXC 1N25A 4M1KA 2CLDX 3WBJA 1F2TB 2ATVA 1NNEA 1AGPA 2FZLA 4EPVA 2CJWB 3IEVA 3D31A 4MYUA 2VLIA 3SE0A 4B71A 4Q9KA 4GOXA 4QGAA 2HJVA 1FNNA 1HA3A 5EP1A 2XX3A 3RWMB 1RRCA 1NLFA 1XTSA 3EWAA 3OEHA 2QT1A 1D5CA 1ZVQA 2A5GA 3WP1B 3GLFB 1GWNA 5DE3A 3U44B 1S1MA 1SXJA 3Q8XB 4KFTA 3DM5A 2R65A 1HE8B 4F4IA 2MSEB 1AZTA
chains in the Genus database with same CATH superfamily
1XZJA 3KV3O 3UZUA 3DBLA 1OBCA 5ALTA 5AVUA 5K5EA 4XD7D 1YJ8A 1J0AA 2I3BA 4P32A 2R6JA 2JJ2D 2ENUA 2GJ4A 5C0OE 1SKMA 3W9BA 3VR4H 3MTEA 4R8MA 1UBUS 4D6XA 5BN5B 4D8YA 4HNRA 1ODIA 3AF2A 1YXMA 4DDHA 2HA0A 3LDUA 4HSGA 5EOVA 3RUDA 2E89A 4L6CA 1QVZA 5COAA 3JVIA 3C7TA 3MJTA 1W88A 1E1NA 4YQEA 3RWBA 1YK1A 3IBTA 3EZ6A 4BNDA 1NVGA 2FSVC 1QGUB 1AQ6A 2VOEA 1VIDA 2HCTA 3DEKA 5EGNA 3O0TA 4Q9IA 1VZ3A 3ZH2A 4C7VA 1H9AA 1HORA 2QPLA 3NBKA 1UZUA 3IHKA 4LWOA 1UJ5A 4QJ5A 4WXEA 1E0DA 1Y3DE 1X80A 2XNDD 3DMDA 2OXIA 1Z26A 2HNKA 2WHEA 4C1NA 4QUKA 1YDHA 4NMXB 1C9NA 4Q7MB 1LEHA 2FF7A 5AI0A 4CXMA 5BYKA 1LSSA 3PS9A 1T5DX 3L0OA 1Q7TA 5TV2A 3CUTA 1CZHA 1CZNA 1C9EA 5BO5A 4Z4HA 3R5JA 3ODPA 2BGKA 2O54A 4HEHA 2B6HA 1UFVA 3RS8A 3JW8A 3T06B 5DCYA 1RJ9A 1RYEA 2Q5HA 1C0EA 3ZOKA 3C15C 5BV0A 1VE5A 2PJDA 2ATXA 2HRBA 2RCYA 2WR8A 4ENUA 5CFLA 3V7YA 4NZPA 4C4OA 2LBPA 1RPNA 2EZUA 3P4UA 3TKAA 3V2HA 2HWXA 2NACA 4X65B 4CF5A 3R0IA 3MXOA 1SBIA 3SIXA 1Y7PA 5C1BA 2G8NA 2FSHA 4ZOLA 3CX4A 1DV1A 3I58A 2PL3A 1QQBA 5TC4A 1BN7A 5E8JA 1G66A 4A6EA 5DN6D 3U5TA 1YIOA 2SHKA 3FUVA 1KC1A 1ZOSA 4L50A 2JLQA 1Y37A 2VHEA 2Z08A 3H4MA 4MUGA 3ZKAA 5EZYA 5CBKA 2WF7A 2ZJ3A 2O1XA 2WSSA 3PGKA 3T9AA 1K86A 2CFSA 2PXXA 3ECSA 5H7XA 4TV8B 5TGDA 4ZT3A 3WIUA 2O8BA 4KGVA 4ZWNA 2A0KA 4UE3S 3QOWA 3X43A 4F5DA 5LN1A 1XJ0A 5EZ6B 1BMFA 5TGZA 3C3AA 2C78A 2ZJOA 2MU1A 2YMPA 1US8B 4PANA 1GCOA 1LA2A 4KVGA 4D9HA 3QPCA 2HIGA 3KKOA 4M0KA 2WU3A 1OH6A 1JX6A 2I4NA 4YRPA 2R6R1 2OHJA 3A0UA 1NZDA 3KHSA 3RYFA 3TDNA 4KXWA 1ECBA 1D8TA 1N4DA 4E13A 3DKIA 2WVHA 4RH0A 3PF9A 5DLPA 4OFWA 5EVJA 1XIVA 2P0EA 3KALA 3JX9A 2O1SA 4EJSB 2GS9A 1S2DA 3ENWA 4LDAA 4RS4A 1RWBA 2V0NA 3LX6A 1A97A 5EXEA 5F1OA 4EA7A 4ZVOA 1D4ZA 1PFWA 1USGA 2IBSA 3O95A 1P75A 1AQYA 3G0CA 3TQRA 4OG2A 1PWHA 3ZXSA 1OB5A 3FNHA 5DNDA 4OJYA 3FFBA 4RETA 5JH7A 5KO2A 5BSRA 1UAYA 4IIYA 4C0LA 4BUJA 1XXHE 1SCKA 1G8YA 2GHTA 4KE7A 2KPOA 2HHAA 3GQBA 4ZD6A 4JUFA 3T7IA 3ZR4B 3QMPA 4D0GA 3RFUA 4R1UA 5B1EA 3TAHA 3UUGA 5JPDA 3GF4A 2HQRA 4FGWA 4LK2A 1MJFA 2CY0A 4QYTA 5KVVA 4MDEA 4JVLA 3EC2A 3AKDA 4BNIA 1H0KA 3GJ8A 4M1OA 5TF4A 1QZ3A 3CUYA 5BR8B 1SVIA 1PJBA 3DOFA 4BQRA 4G4JA 2I78A 7YASA 1OFHA 5ALPA 1PJQA 2VDQB 3NGXA 2IZ5A 1RPJA 1AKYA 1UC9A 4H3KB 4XVQA 3WK8A 4CMAA 3EDYA 3COJA 4PPFA 2RAPA 1NL3A 3JRXA 3PE4A 3KOOA 5FT9A 5KREA 1QVRA 2BM0A 4D9MA 2ZSDA 2HYDA 1ND6A 3Q3VA 3LYAA 3COVA 2OBFA 1WKBA 2PZAA 3F2VA 2X13A 4MDFA 4ZC8A 3WMXA 1QCCA 3ZWWA 1ODLA 2GTIA 3GEPA 3TRKA 1MRZA 3LM8A 4HAWA 4GBED 5JANA 4O4JA 3ZTTA 1FIUA 4XASA 1ZONA 3G1WA 4UNIA 3N2GA 2W0MA 4IIJA 2ZVJA 1LI5A 2ETXA 3KS9A 1YI1A 3EFHA 4YJ3A 2CDCA 4ZVMA 1KPHA 1FSSA 4KDFA 1A7KA 1Y7TA 2BFFB 2H00A 2Q3FA 4B2IA 4GI7A 2DY1A 2MINA 3PLNA 2WT9A 2B8NA 3BFVA 4WK4B 5AM0A 3IHLA 5SYNA 4AS2A 2JBAA 3CIOA 3VSDA 3WFJA 4L76A 3GLIE 1WP4A 4ZK2A 5CNJA 1P1BA 2XNSA 1N7HA 1OWOA 3B53X 2IIVA 3EPJA 5EJ7A 1Q83A 1DVRA 1WCYA 3EDQA 4IXTA 3EIHA 1UKEA 1OILA 4A26A 1C3OA 2Q62A 3GFVA 1FW6A 5A7GA 1DC4A 2MR5A 2Z2YA 4LF5B 2NQTA 1WLSA 3C1OA 2GSWA 3DOCA 2IBMA 4KE9A 3X1DA 4DR5B 3B8HA 4ZYVA 3JSAA 4EI2A 1PJSA 2V3VA 2BE9A 5ECGC 1DX9A 4PAMA 5CMLA 5F1KA 4ZZIA 2XCQA 5CPBA 1KQPA 3K6SB 3F6RA 3IIEA 1KI2A 4R83A 3OPMA 4H60A 1U9IA 3QVXA 5D51S 5DGHA 5FL7D 4HO1X 1PG0A 4UHFA 2AZMA 5D85A 2QD2A 2BRUC 4I5GA 1FYFA 2BBSA 3NHBA 4NE7A 5AVZA 5GWXA 4PO3X 1VDZA 3JARA 3WISA 1QLWA 2DBVO 4H59A 4IHAA 4G81A 4NYMQ 1BEEA 4PBRA 3BWVA 3KT0A 1KFEB 1A9RA 1P2GA 3CPJB 4F4UA 1NRXA 3PD1A 4HXFB 4EYQA 4NJMB 3INYA 3P27A 4OYYA 3GJSA 2JJ1D 4XQGA 5KQRA 2R1VB 4YMWA 4YAEA 1C3JA 2EQAA 3OUTA 4ND4A 5IJ9B 2EIHA 3LPDA 1DOAA 4WNAA 1ZDMA 2VXYA 3T9EA 3BWMA 4OIMA 3K1TA 4MW1A 4HT3B 3TSYA 2H8GA 2ATIA 3QLVA 2G83A 1WOYA 1ZGHA 4PRLA 3PTAA 2P3OA 3TOSA 4S1NA 4A82A 3B8EA 2QX7A 3RC1A 4BDTA 1EE1A 5ICGA 1H0HA 1HYEA 2RIPA 3F98A 1AZWA 1LSJA 1QOPB 4N0PA 4P92A 4DW8A 3WK9A 3EARA 3LX4A 1VCMA 4CMBA 1XWFA 3R5TA 2ZB3A 5T6MA 1JWAB 2NXWA 821PA 3NHZA 4UCFA 3HM9A 3RARA 1O58A 1NXXA 4MV0A 5LLDA 4JYMA 1XTPA 3LKZA 1Z2OX 4XSHA 3Q8KA 3IUBA 3F97A 4IRMA 4M60A 1UBCA 4R6WA 3ZI7A 5LCXA 4CF7A 4AXXA 2I6XA 4G63A 5ISMA 4EELA 3DOIA 3EDCA 3K9HA 2CF5A 5HCNA 2D59A 3VO1A 1K98A 4YMUA 5REQA 2II6A 3T5PA 1WBJB 2JVJA 1KI6B 4EH1A 1OX4A 1FVHA 3RJZA 2VFAA 1CB0A 4LJ9A 4Z54A 1EVIA 1ESZA 3EFOB 3RLIA 2ZI6A 4ZOAA 3RUFA 4EARA 3AGPA 4JB8A 1WNTA 4AW9A 1QLHA 1QQAA 4CG3A 4GM0A 3SHQA 3UWSA 3GLHE 4BE9A 5FWXA 4I55A 4LBZA 1E59A 5LU8A 4I08A 3F90A 1UEXC 4U6NA 3W9SA 4B74A 5A2QA 4CKCB 2O8FB 5K7SA 3OUUA 1T9BA 3FOWA 1O8BA 4G1EB 4JLNA 2H16A 4ZQHA 3IAM6 1U11A 4BAZA 3I04M 2V7UA 4MK4A 1TTTA 2ODAA 1FS4A 4I4CA 3SC3A 1RBZA 2PA3A 4F6CA 1SHTX 5CHYA 1ITZA 3GJTA 3ZJ4A 3HCBA 5JS8A 1ZIXA 5CPFA 3RKRA 2GPWA 1OGYA 1B0PA 2AFIE 3NATA 3I05A 1TVKB 1YJXA 1G17A 3FTCA 1CR2A 1E1CB 3VV2A 2P4UA 1G8KA 2XMPA 1SU4A 3E18A 3STHA 5AKHA 5E3JA 1JKJB 1NW5A 2H92A 3QU2A 2QRHA 3R0JA 4J3FA 4ENVA 1NC1A 1GUDA 4KRYA 2F1IA 2GPSA 5ALYA 3R9KA 4OUDA 1KAQA 2C5AA 3KZNA 2P40A 3QMMA 1DUVG 2W2PA 3E70C 1U2RA 1Q7RA 3WX0A 3T1HB 3NEJA 1XRSB 2V7QD 3AFHA 2YNMC 3LW7A 3O4IA 3P4XA 4A8PA 2R8ZA 3TN7A 1Q0SA 3L7KA 4LGMA 4EY3A 5ICEA 2QZ9A 2VH2A 4ND8A 4FMCF 4UQLA 4HGRA 1DPFA 2EL7A 1R18A 4GS5A 5G1PA 1JR6A 4UEWA 5KNBD 4Y7DA 4EIWA 4ZKDA 1QRDA 2FPIB 1BAPA 1G4AE 3A58B 3AP1A 4E2XA 3QIAA 5KAMA 3KYDB 1N2OA 1LDGA 2XB9A 4OJMX 4AY2A 2XKKA 4AZ3A 4C20A 5ADVA 1XD2B 2YVAA 1K92A 1QS0A 1D0IA 4FC6A 4NBLA 3R0XA 4D98A 5DMHA 3NIDB 5CB4F 1SB8A 3S1SA 3K92A 1WDMA 4HWPA 4XM2A 5SZHB 3D3EA 3AKYA 4RY2A 1YZKA 3B2QA 3O6VA 3QVUA 4J43A 1NX6A 1Q84A 4LY3A 3ZV5A 4ZT2A 3LHFA 3ADPA 3KZKA 3KPWA 1M2VA 1W49A 3WGJA 3SEAA 1Q95A 2R87A 5TDHA 4HY3A 3IBYA 3L7DA 3O1LA 5AVRA 3L7CA 3V33A 4A4DA 3SNKA 1JPVA 3LUPA 4JZYA 2R86A 4LN1A 4LTMA 3JYHA 4HNTA 3EVDA 2XWQA 4DPLA 2JGRA 4W1RA 3QFSA 1RZVA 1X1DA 3NR2A 3ZJTA 2VJAA 4IHJB 1W4CA 4OUKX 2QT9A 1H1DA 1CQWA 2OCLA 5GJVC 1YK0A 3OFJA 3FMPB 4D8XA 1UT8A 5C51B 3U9TA 4ZCLA 4TUYA 2P3QA 2WJYA 4NEQA 5FTNA 3RT7A 2AMYA 3FF1A 2OC9A 1I3OA 2I66A 4ZOQI 1YCFA 4HNAB 5E9JA 3RV3A 3D4PA 4IVPA 4TLAA 1XZPA 4RZXA 4WI1A 2HSGA 4G8BA 2C2BA 2X23A 1PZXA 4L27A 4RBNA 4XQEA 5EYPA 4MZDA 2CYBA 4N7MA 4NBSA 4ZZ1A 4XD2A 3JPYA 3ZEIA 4AJLA 2Y2UA 4S1WA 4LA4A 5G0VA 4O4IB 5D8DA 3RS7A 3AY3A 2QWXA 3UWDA 4X44A 1M74A 2X0KA 3D3NA 4XRGA 1OSNA 2WJGA 4AZVA 4ONEA 4OV6B 4D9JA 2OO3A 4WY8A 4W5RA 4RXUA 1TYBE 2IEYA 2OZLB 1B42A 3RB8A 4LZAA 3N0XA 4A27A 4XYLA 3QZUA 1C1XA 1W75A 3BK7A 1IK6A 1YDMA 3I3OA 4TLDA 5E4FA 4ZQIA 3DTVD 3IAS6 3UC5A 4M0FA 4N5MA 1SB9A 1Z6TA 1FOEB 4MX8A 3IPYA 5JZOA 1ACJA 4ZO7A 1U8ZA 1J0DA 2D1RA 3NVKI 3GFFA 4TL6A 1Z36A 3TEJA 5DRYA 4JKOA 4H08A 2ZSFA 3LLMA 2PRKA 1O57A 4EPRA 2JKYA 3EXHA 3O8DA 4GPTA 3O1HB 2RHJA 1MOSA 4HGQA 1U1IA 1Z68A 3ME5A 1YS1X 3A4NA 4BKRA 1A8PA 3CUSA 1D4FA 5FORA 1BRMA 4V2IA 4BWYA 3TUZC 5JI2E 1DKMA 1UIMA 5AJUA 5TJHA 2QGFA 3RRMA 2D1QA 1O94C 1NHGA 3WGKA 3B9RA 3LOPA 3KVRA 4FUTA 5JYCA 3ITNA 1UMDB 3KBBA 2IX9A 1FNBA 2NZUG 2QMEA 1GL6A 3KVNA 3EK2A 3ZIAD 1GLVA 4CLOA 1YR7A 1HG0A 3FOEC 1I6LA 2UVPA 2YR0A 4KUHA 3LFUA 3WLAA 5HZGA 4JI8B 1CBUA 3SFTA 4CWAA 1NC3A 1TYZA 4TSFD 3A6ZA 2DLNA 5G40A 2VG8A 3RVPA 4DCVA 1NNLA 1VKOA 3L7MA 4WESB 5CT8A 4ZARA 3RVRA 3I5MA 2R68A 1WU8A 4LV8B 1VQ1A 3H18A 5G4KB 4BJ5A 2BKXA 4EMBA 3W5BA 4YLEA 1U0OC 3DE4X 4M76B 3SD7A 5AVJA 3F5FA 4HFJA 3AHFA 4L3VA 2TMDA 2BDUA 1Z0SA 2X0JA 4INPA 4MW5A 1DEAA 2BR4A 5FQNA 4U9HS 3M9WA 1E9EA 3KZVA 4PXAA 1MA0A 4MS1B 2C77A 3IO5A 4B4OA 3N8HA 2N3ZA 4ESOA 3DULA 1F7VA 1RRMA 3QFTA 3PHCA 2HMTA 4PNZA 1XEXA 2V96A 4R1PA 4HAUA 5DH9A 5DYTA 2UV8A 3TO5A 3MTAA 2V58A 5CCDA 4HG2A 1GQSA 3OOEA 4D9FA 1LK7A 1VSQA 1I3KA 2JFNA 4J94A 3ONWA 4Y2RA 4UHJA 3NFRA 4L5BA 5TX7A 2OYCA 4N3BA 4ASUA 4BEBA 3HCAA 1UBRS 2BBWA 1QGAA 4U7FA 1DWOA 4UASA 4DSTA 3UXYA 5K2OA 4EY5A 4K9DA 5DM1A 4IXWA 1HDCA 1YL5A 1NA5A 2J30A 1B2LA 1PZGA 1PBNA 1JKMA 3PVCA 4H7PA 4QLBA 1NW9B 4C6HA 2CB0A 2NUAA 4RTQA 5JVDB 3LUGA 1YZFA 1YR3A 4QFMA 1KVRA 3JQBA 4JGBA 1V5IA 1K8XB 1R8QA 3Q7RA 3ZWYA 4BC0A 2AS0A 2XNJA 1QIGA 2VAXA 2RHCA 4J75A 2VP6A 1QJCA 3EXEB 3E8SA 4P4LA 3JTEA 3MPUA 1AO0A 5F5NA 1C3LA 2GEBA 3AQ4A 4J76A 2CVOA 2YV3A 5KQMA 3I04A 4KVZA 1QFJA 2RGRA 5CFQA 3OTOB 4J3NA 5K01A 1AUVA 1FSFA 3G1TA 4JT8A 2ZJ0A 2QU7A 5ITSA 4BTEA 1XVVA 1I24A 1OZHA 3A9RA 1Q1BA 1V4BA 4MQFB 4TT8A 3TR0A 1L7QA 1THMA 3I8SA 1V95A 2WICA 4ALNA 5K3OA 2IDMA 3N3AC 4XZ3A 1QYDA 1QQ6A 2XDAA 3K1ZA 4UUMA 2MT9A 2QQ0A 3B9BA 2QIOA 3I6YA 3ZZUA 4MPRA 2I22A 5JO0A 1RKQA 3WYNA 4OGLA 5DWQA 1LSUA 3MMSA 2XUDA 1OF1A 3OI7A 3UXEA 4LYJA 1VLMA 4NATA 3WB0A 5ER9A 5IT5A 4BNXA 4TWIA 3VDQA 2XVZA 2ERYA 4EDHA 2WAXA 1ZM2A 5BNWA 3ILHA 3ZHXA 2G4VA 3NOXA 1ESCA 3OTGA 2BGJA 2J5BA 5CYFA 5EA2A 5JJKA 2D2VA 1A8HA 4MI3A 3EZ2A 4Q3EA 2IS4A 1U6KA 1GVHA 1HQCA 2FUNB 2XGSA 5I7EA 4AUKA 4CKYA 2D1SA 1RAEA 2JFYA 1UKVY 3QVTA 1GGKA 4DBVO 4RADA 1NZJA 4XDZA 2REQA 2FN9A 4V0KA 3C2QA 4QRHA 3ZDZB 5JYEA 2OPBA 3B5EA 1SQFA 2ZBVA 4C3UA 8AT1A 1J1UA 1E5DA 4I2NA 1ABFA 2AMVA 4IDFA 4LX8A 4WFJA 3F6SA 1H0RA 5HTOA 1WBDA 3EULA 3JQPA 5DSZA 3N05A 2I1WA 3QV1A 3FKSA 4ZHQB 2FEOA 5AM2A 3ENZA 1XPJA 1C8KA 1F4VA 1M1YA 1TU3A 1T5SA 1Z0AA 2CL5A 2EBWA 2J3JA 3E1GA 3LIPA 4LZLA 4NMWA 1L4EA 5IU6A 3HKEB 2XZOA 3B89A 3KKPA 2DSNA 1ZZEA 4LK3A 5CNKA 3UFBA 3S1LA 2O05A 5AM3A 5IAAA 1SD2A 1WMEA 2GVDC 5B37A 1I8TA 3VC3A 3G9XA 4ZYUA 5EQJB 2CCJA 2QVGA 4TLBA 1NQXA 1Q91A 2A0UA 4BO9A 4BJHB 1CQZA 4CODB 3K0SA 1EJ2A 4ZMRA 3MWEA 2QTTA 4G1BA 5EWMB 2I0FA 2PCLA 3HBLA 4WK2B 1RZRD 3T7JA 3PX3A 4P2GA 4S35A 1E5XA 5FA5A 3CJRA 2ASVA 1YGYA 2EWWA 2OCAA 3A25A 1TFUA 2AA3A 2P7IA 5IJXA 3WKAA 3LVFO 4DR1B 2B9VA 4DT1B 1GQOA 1PJAA 4TKUA 3V1KA 2YUIA 3V4SA 4BX3A 4FHDA 4CQMB 4PICA 2HI0A 4HQLA 3E9RA 2FSPA 3TLCA 1YBFA 4CL3A 1TJYA 1D6JA 4AJKA 3NPMA 3VYRB 4BNNA 3MS2A 5HXAA 3ETNA 1ESMA 3B78A 4LC9A 1QF6A 4BNVA 4F4HA 4R51A 2C9BA 1OLUA 1PR5A 3ZU3A 1A95A 2XT0A 3O21A 5BRNA 2Y0CA 2KWIA 3U7RA 3KQNA 2KW5A 2PSJA 4DGQA 1GKKA 2PX3A 2NT4A 4OLFA 5AKZA 2HLDD 4Z99A 1GG2A 4JELA 3ANYB 2F9LA 1H6BA 3HDJA 4AZ0B 4MVJP 2JDID 3E15A 1AO3A 3L92A 1VKJA 1CZKA 2QRUA 2XJ9A 3PUYA 1NVKA 1EM6A 3TBHA 1R00A 1Z73A 4I1UA 4M21A 1ES9A 4LRXA 3ANLA 4PXSA 1YKGA 4YMIA 3M34A 1CY2A 1K6IA 4F4CA 4EF6A 4JP3A 4GBJA 4QU9A 1S2GA 5JSHA 2B82A 3BFJA 5CH3A 4CVNA 1MKYA 1TUBA 3LUFA 1YVDA 3HR8A 1L8LA 2PSDA 1S2OA 3U37A 1EFKA 1HLPA 2BFBB 3OIGA 1AKMA 4LWPA 3RTDA 5A7FA 3S1AB 1PL6A 5LP6A 1SVNA 4OP1A 4M0EA 4PG8A 1U0FA 2ZRNA 4UFPA 6REQA 2OLKA 1D2RA 3PE3A 3HWX1 4AB1A 4EPXA 5C2JB 1GDDA 5HYVA 3QW4B 2AX4A 4RIHA 1P5HA 3CCFA 4IMPA 4GZ3A 3WGYA 3TNJA 3TQTA 3TI9A 3ANMA 1LK0A 4G4SP 1EDZA 2EJVA 2QAGB 1J90A 1X2BA 3CUUA 5FD8A 3GFTA 3A1CA 1N36B 3VYUB 4P6VF 3QMWA 3RUPA 4KPGA 1D0VA 2UZAA 3FB1A 5DM2A 1WXIA 5JPIA 1JQJC 3NO4A 2AYZA 5CUQA 5LBUA 4P0QB 2QS9A 4QELA 1CFJA 1F5SA 1VYUA 4MYSA 1YQWA 4MUIA 1XAJA 2YJGA 3X1XA 4L0CA 4F1JA 1WHTA 5DGXA 4F6RB 2QAJA 2YJNA 1QRAA 1XX6A 4GX0A 1RE0A 4ZI7F 2R6ZA 5D6OA 3OJXA 3RLFA 4W99A 1M1XB 1QXSA 1E9SA 1KSFX 4U2KA 5JMTA 2JFZA 3L43A 2P2ZA 1VXOA 4QAQA 1V8DA 1TK3A 2QN9A 1JDSA 2Q2VA 2QXTA 2RAFA 2W6IA 3SS8A 3EEOA 1WCV1 4I9FA 1C81A 1TKCA 4ZT5A 1Z56C 1KI4A 3OQMA 1AQLA 3OLQA 3UMVA 2N46A 2ONKA 3EPPA 4PAQA 4B80A 5FLEX 2Z6QA 1MPXA 1CNFA 1WP9A 1LXCA 5TVKA 3I5YA 3BRSA 3VYTB 2GBLA 1QAQA 5EWLB 1OA0A 4IQ4A 1E3IA 2JJQA 2IVFA 1OAOC 2XIQA 3C8DA 1NN5A 1N6KA 1JQLB 2BEVA 2Z5LA 2ZIVB 3PQCA 2WWVD 3S2SA 4NCJA 5C31A 1A9PA 4TVKA 4CLRB 3TFOA 1Y3IA 3B82A 1X7DA 5DNWA 4S0XA 4XH9B 4XWTA 1MZPA 1OW3B 4BZZA 2RIRA 3LCRA 1UDWA 4YP6A 3KQYA 2FPXA 2YWDA 3GNSA 4C2UA 4AICA 4IYRA 2BKUA 3HBJA 4FDUA 4OGKA 4OQXA 4G5QA 4EO7A 4GQAA 5G0WA 2BZ0A 4JZKA 1A5BB 2REXB 2F1KA 4JL8A 5CB6A 1PS8A 1V4NA 3OEHD 3PXCX 5KTSA 4F96A 4C22A 3QUAA 1EWTA 3HHEA 4QM7A 2WF5A 1JFVA 2HCRA 3HNOA 2BR3A 3SYNA 3BKXA 2G0AA 3ZHCA 4Q1FA 3TPZA 1KXJA 2QNBA 1EDEA 1RYBA 4C0BA 4LHXA 2DBYA 1PJRA 2UKDA 3ZTYA 5NULA 1MX5A 1I4EB 1FY2A 3NBXX 3OPXA 4JV5B 3IMCA 1DBPA 4JLPA 1ULTA 1UXJA 5E6SA 1TGVA 3KHKA 1L4KA 3OF2A 3KDSE 3QYJA 4O5OA 2G28A 5G3YA 3U17A 1L5QA 3O8OB 4LDNA 1YRYE 5I7WA 1F20A 3W8DA 1LBIA 3IMKA 1X7WA 3JAKB 3KUKA 2UYYA 1U0JA 2ACVA 4M46A 2ZYIA 3PRJA 4TS4A 1YB6A 2GRAA 3RIMA 3EPKA 1IHDA 2HRDA 2QRKA 2HNAA 1F12A 5J9FA 4D9GA 3QIVA 4LRWA 3D1VA 5FPHA 4OYRA 5C7YA 1EA5A 5IW8A 1N2IA 2C7BA 3O9ZA 2J32A 5ILQA 2A92A 3ABRB 4UXJA 1J2YA 1OT5A 1KBQA 1KMNA 2VBIA 5J2UF 3K70B 4V02A 5AVYA 4I4TB 5I8ZA 4C7KA 2NUTB 3JYOA 1AIPA 1VL1A 3TTYA 4CIBA 3EODA 1V6CA 4M36A 1RR6A 4M8KA 1PE0A 5ICCA 3HLTA 1M34B 4GZLA 1PNTA 4JBYA 5B6JA 4YCLA 5JJBA 5B1IA 1NJSA 3CF2A 2C04A 5JU6A 2X1MA 4ES6A 1FVOA 3VSEA 1VXRA 1TEHA 1LDMA 4HEJA 3UAOA 4MMZB 5TQ2A 3BDVA 4IGAA 1LKZA 2A5LA 1R74A 2QRLA 3RIEA 1O87A 2IP4A 2Y99A 3A27A 2I2FA 3WTBA 5H82A 1J21A 1W85A 3N3BC 4RY0A 3OF5A 4WOCA 1N3LA 4ZVVA 4MICA 1U0GA 4IMIB 2X8JA 4W5QA 2AD1A 1GILA 2BZ1A 4I0WB 4M54A 3ZVNA 3AIMA 3KLOA 5FI0B 3QV2A 1OLXA 1PJ4A 1XDGA 4QYIB 2OXCA 3DE5X 3VNVA 1COWA 4J1TA 3RODA 2WSSD 3RVMA 1ECLA 3ZW9A 4WKPA 5FNVA 4QREA 1B0UA 1TLFA 3L4BC 4W7IA 1ZEMA 3USZA 1WNFA 3CNHA 4R81A 5IAGA 2OFOA 4BVJA 1CX9B 3G2QA 1QRTA 4RKRA 5JS7A 1BMFD 4KI0A 1UZAA 4IQGA 5LDDC 2NVUB 3U2QA 5CNMA 2QB5A 1C0IA 4HWRA 1DBQA 3RD5A 5JXGA 1NKTA 1MV8A 3F7MA 4NFSA 3VC1A 5F1PA 2VIIA 3GLKA 2FMHA 1FRVA 1XYYA 2QRMA 3PQFA 1YUMA 3JQFC 4OQYA 3H9CA 4QODA 4ZOEA 4EM6A 5JD5A 2XECA 4LXIA 1AKTA 1PJCA 1CLEA 2GAFA 4FXPA 4G1FA 4UU8A 3QF4B 4B09A 4O1MA 3AF1A 2H59A 1IM8A 5JAQA 3B6MA 1VBMA 5A6SA 3I3SR 4OHZA 3ZDDA 1R37A 4IKOA 4QJ4A 1OFUA 3CBGA 2DHDA 4HEA6 4NV3A 2B3TA 3CUWA 3A6KA 2PWYA 3R44A 4MYCA 2PTGA 3FYCA 2OZVA 3M2TA 3OVMA 5SZIA 2UUBB 4RH3A 5HFJA 2PAAA 1XI2A 1UXOA 2R2AA 1FXSA 2X0NA 4O63O 3W3AD 1KZ9A 5KNDH 5CW1A 4KE8A 4ZODA 2VQFB 3I6ZA 3WLKX 1XDZA 2JBWA 1Z25A 2HMVA 3GBSA 3L02A 3LBHA 3LK6A 3ML1A 4IDEA 1SOAA 4Y2UA 5H8WA 2JAHA 2UVDA 3LF1A 2FSUA 1NXOA 4YRJA 4GI5A 1JKIA 5LDGA 4AULA 2QM7A 2WEKA 1DT5A 2EKBA 1RXYA 4II3A 2HMYB 3WB9A 2YFYA 2O2EA 5FWNA 1EGVB 1OC4A 5M29A 3FUXA 2OQRA 1EFDN 1NLUA 3BGOS 2ZI3A 2ZUEA 4JUBA 5ETJA 3NRJA 2YRFA 3CRZA 2OC4A 3FH0A 2V7PA 4IM7A 3ENNA 5L7WA 3AUXA 1ZGAA 4IW3B 2JI8A 1V3QE 1KBZA 4GKVA 2QPAA 1JAZA 3K0HA 3JRWA 3UKOA 3VVCA 4G5RA 1J0BA 4HRYA 3UO8B 1HR0B 4BLOA 2NU9A 3A9SA 2GPBA 2F3TA 1P81A 3DFZA 1EVZA 5D3QA 4GDFA 3KXIA 3OWHA 4NBWA 3L9XA 2PWAA 2Y1DA 2Z2JA 4Z4QA 1MIOB 1RTKA 1YONA 4AMBA 2OQIA 4Q6WA 1Z6GA 3IDSA 4QPDA 1P9NA 1WV0A 4E31A 1XKTA 3DXZA 2RJNA 5A02A 5DT9A 3BXPA 3R0ZA 4BB6A 3KTAB 4BO1A 4JROA 2CJXA 1K7XB 1E0KA 2O3SA 4K86A 2HV8A 5KU1A 3UMJA 2Q3BA 4X41A 3O4RA 4DIBA 3WKDA 4ESVA 2ZXFA 1U90A 3NTRA 5F3RA 3P9SA 2QOEA 1NW6A 1NN0A 2FVXA 4LYYA 2Q21A 5LB4A 4OSPA 4YQYA 1REQB 5DLYA 5IZ4A 3WOVA 3VDRA 1S8OA 4ZJYA 3VKGA 5K20A 1H6DA 1KYWA 2SICE 4BRUA 4DVGA 1YRLA 3OCJA 2OWDA 3B3FA 1B0AA 1SGWA 1XPUA 4J9VA 4BATA 1M6HA 4C14A 1KKUA 3SLGA 2XB4A 4LRSB 2VZ9A 2H07A 3N9IA 5BSVA 1LBEA 4X1IB 2NSDA 2HA2A 3PFBA 1PQWA 2PL5A 3TDMA 1W7AA 1HX7A 1NVTA 2FOIA 4OLBA 2ALJA 3TIVA 2GCOA 4LBVA 4CEJB 2W71A 1D0SA 2Q8QA 1RVV1 1PDWA 2BLLA 1V16A 1EFPA 2FLVA 1ZUIA 2QMUA 1H9BA 1QAOA 2X7JA 3RSSA 1UOOA 1ZMBA 3DQQA 2B5VA 4KRGA 2DY0A 1PNRA 4LCEA 3TUIC 3D7RA 3K6SA 2GAIA 3NHRA 4GOMD 2HYIC 3LL4A 4ARUA 2ADOA 5AM4A 4BNKA 4EVSA 1W30A 1E3LA 4GZMA 5GZ1A 2G5GX 5IT4A 3L8YA 4MI1A 4JT2A 2YNMD 3TLEA 4DMFA 4R9UC 4F3RA 3R09A 2ETVA 3QM1A 3DMTC 1V7CA 4L4RA 1HL7A 2ZQ5A 4ZQEA 4KOEC 1LV8A 4HN2A 5JT1A 1XMPA 1WUJS 4PGFA 5DHQA 3ER8A 4AZTA 3KTOA 3H1EA 3SN6A 3UM9A 3MT9A 4IIFA 2KJQA 5FPKA 1EG2A 4CBVA 4MKGA 4LF4B 3LLVA 1Z4PX 3BREA 4DNOA 2WZCA 1E4EA 3W06A 4YRCA 3SX4A 3DGFC 3IRVA 4IUDS 4Q7KA 3TTUA 3ZY2A 3ZQJA 1P74A 3C4QA 4CMCA 5ED0A 2ZVPX 1M0TA 4YAJA 3C5CA 4CKWA 4FDTA 3FSJX 2WQZA 4YV2A 4N03A 4B44A 1YUNA 2E4WA 4G09A 3E2PA 4LYDA 4ZAZA 1L7MA 2XTJA 3R9XB 3E3NA 3FNQA 2OENG 1HEUA 4AY5A 4CR8A 3E6AA 2OCYC 1AB6A 4PZCA 2G5CA 2GF2A 3ZLTA 4J7AA 3H9UA 2CLOB 1VB5A 3IAAA 4Q39A 1P1FA 1HLFA 1RDFA 1VYHA 2A3RA 1BW9A 3BZWA 4BNZA 1VJ1A 5K0FA 2P6RA 1M76A 2YV1A 3PDIB 1A9XA 4HYEA 1E9CA 4ND1A 4RHUA 1HPLA 3MTJA 4QU0A 4WXPA 4QBKA 3U0VA 3UUFA 4Z7NB 1XNQB 3SBDA 3Q8MA 4F3KA 2DH6A 4JH0A 1VHLA 2BLNA 3CKMA 2UVQA 4NI5A 5LQJA 2D2EA 3DMGA 1H4QA 5ERXA 1RXCA 1AKWA 1SIBE 3TIXB 4YMGA 1L4UA 2PU7A 1ADFA 1TPYA 2J59A 3EFBA 1V43A 5HRCA 5BYBA 3DBIA 2R8OA 2JLWA 1PFVA 3HXMA 1IZZA 2R8XA 3H42B 1KK3A 4BMZA 4FDLA 2AR0A 1GHTA 5TR9A 2IELA 2QI9F 3QYPA 3FDFA 4OO3A 1TM5E 1IBCA 2GNOA 4LSGA 3GMSA 1RLJA 4B82A 1AS3A 1X1EA 3R3WA 1K08A 1G6HA 1GZHB 4Q48A 4DA6A 2FMFA 1LX6A 4TQAA 4DNPA 4KQMA 4XOIA 1XN1A 2NVWA 5FHQA 3OU2A 3LV8A 1K2VN 3DF7A 3OSUA 5JFTA 3EZGA 1KDOA 1CJUC 2IEAA 1YJCA 2CNNA 4A92A 2IF0A 4DDWA 2WW8A 5KKNB 4O2BA 1PEYA 4DBZA 5E1OA 3FSEA 2IK8A 4MS3A 4CCSA 4FYYA 4Y8VA 2M1ZA 4KQ1A 1PTJA 1G3IA 1DRUA 3KB8A 4GHWA 3AXTA 5G02A 2F8MA 2I3AA 3K0KA 1Y6QA 2HZBA 4WKGA 3WKBA 1Q44A 1RI4A 4IS3A 3GJ4A 3P1JA 3HCEA 5AP9A 1TAHA 1MU0A 4IFTA 4Y0VA 5IAKA 4RH1A 2FPPB 2NZXA 3ZHZA 1EK5A 2BR5A 4TT3D 2W2OA 1O94D 1C1YA 1U8CB 4NTZA 5IDVA 3V2GA 1W48A 1C7RA 4FDMA 4X5OA 3QBEA 4FLMA 4PZLA 1X14A 1SVWA 1VDMA 2QQEA 3IP5A 3OIWA 1ORTA 5FP0A 3HCCA 1RPTA 1Z8HA 3CE6A 2AEFA 3WDLA 2ZUUA 4XLLA 2BCGY 3IX7A 3MTQA 3ZS8A 1UK6A 4XDGA 5AW4A 2CBXA 5GGXA 3RHFA 2QTVA 4WV3A 4IZIA 3IQHX 5C1OA 5KC8A 2DB3A 5CH8A 3GJRA 4GLBA 1T9GR 3TLYA 4UD6A 3IE1A 2C7RA 1GSIA 1STOA 3G2OA 4E5KA 3OKFA 2CNBA 4PZ9A 3T5GA 2HDWA 3ZXXA 5KWVA 1KFBB 1VGVA 1CQIA 2OKCA 3UMYA 3NTQA 2DR2A 2V7WA 3FG9A 2GZSA 3F74A 1DDIA 3L0YA 4Y7CA 4A03A 1JNXX 4D8VA 5HK8A 2W93A 2H1LA 2QUBA 1EFRA 4NOLA 3E82A 1HNNA 2JCYA 3HP7A 3LBIA 2QT0A 2VH5R 1L2TA 2XEXA 3RPEA 1G7CA 4TL9A 4WE3A 4KQCA 4UU0A 2WWGA 1LW7A 1Q17A 1ZGZA 2DWPA 3BIJA 2L17A 5AQEA 5FEUA 4JXJA 3P71T 1OPXA 1E7WA 3NVDA 1KBOA 3R20A 3IT1A 4OBEA 2VK1A 3HVJA 5FB3A 4CIVA 1L5OA 1UDAA 3QOYA 4J4TA 4J03A 3DFUA 1K5HA 2WDPA 3GCWA 5BT9A 1DQZA 2Y66A 3BTVA 3WSWA 2G0TA 2JFFA 4PCLA 1JXOA 1KS9A 2JANA 1KYTA 3RKUA 3TR6A 5IDQA 1BEZA 2WHPA 5DM4A 3HVUA 1XXHA 1TUGA 2BE7A 4B4VA 1BX3A 4O0MA 1Z4NA 3DBRB 3VM6A 4D8UA 1N0UA 1SC9A 3AUFA 4B85A 3OA2A 2DTXA 4PSKA 4QVKA 3HCOA 1ZK2A 4JBXA 3OWXA 4RVOA 5H4HA 5IVIA 4C7XA 4FDAA 1CRQA 5EMHA 3AF3A 4Z7JA 3FVWA 1WW2A 3TQCA 4V03A 4BZWA 1O9BA 3EG5A 1ZOPA 3OJCA 4MDYA 3BWCA 2I4RA 4QE3