2J0VA

The crystal structure of arabidopsis thaliana rac7-rop9: the first ras superfamily gtpase from the plant kingdom
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
180
structure length
178
Chain Sequence
SHMSVSKFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVAVDGQIVNLGLWDTAGQEDYSRPLSYRGADIFVLAFSLISKASYENVLKKWMPELRRFAPNVPIVLVGTKLDLRDDKGYLADHTNVITSTQGEELRKQIGAAAYIECSSKTQQNVKAVFDTAIKVVLQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAC-LIKE GTP-BINDING PROTEIN ARAC7
publication title The Crystal Structure of Arabidopsis Thaliana Rac7/Rop9: The First Ras Superfamily Gtpase from the Plant Kingdom.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Nucleotide-binding protein
total genus 56
structure length 178
sequence length 180
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2j0vA00
1Q0UA 1LF5A 3OE7D 4GMXA 2VIIA 4QGGA 4NMMA 5FUYA 1MO4A 1KNXA 3WMGA 3BK7A 2QGNA 2IWHA 3PUXA 3BH0A 4S2EA 1FTNA 2OILA 5LPNA 4NYMQ 1RYFA 4QC2A 5AJZA 1IY2A 1Z6TA 2AXNA 1MABA 1G6HA 4M8NE 3LXRA 2ZRLA 1ZCAA 3BOSA 4MUBA 4N0DA 4MRNA 1ZUNB 2HJGA 5IHPA 2QP3A 3TE6A 1T6NA 3KL4A 1YZQA 4RVCA 4LY6A 1KAOA 4NHOA 5FUXA 4MGIR 2ZI6A 3FMOB 4HAZA 4EFMA 3PEYA 2PCJA 2WAXA 3AF3A 5KNBA 3BFXA 1U90A 421PA 3WP0A 3WNBA 2YWEA 4C0KA 3QBTA 4A15A 5BN5A 5LD2C 3SJAA 5AWFC 2GK7A 1CRPA 3O8RA 4PPFA 1M7BA 2ZE8A 3N2IA 3T35A 2R65A 5HZHA 3TUJC 3R7WA 4GOJA 3K0CC 1P4SA 1H8HD 3MAAC 5L8VA 4QM6A 1ZNXA 4N0EA 5FR1A 3MJRA 221PA 5FPYA 2H16A 3U3OA 2FPKA 2WJVA 5HCNA 4OK5A 5FTMA 2IHYA 4Q7KA 1BKDR 4NCJA 1F2UA 2IYUA 4I4LA 2FU5C 2DWQA 3EW9A 1UF9A 4KAXA 4TMXA 2DY1A 4KJZA 3VX4A 4DCTA 3TVDA 4FXPA 2XOKA 1YZTA 1RVDA 3CNNA 5BN4A 1ZD9A 4W5JA 1G19A 4OK3A 4OYHA 5EE3A 1H8EA 2Q9AA 4WVFA 621PA 4RD2A 1Z07A 3NDPA 4DC9A 1NSTA 2VP0A 3LA6A 2PCLA 1G9XA 4JS0A 3G82C 3OAAA 2GK6A 1HE8B 4E22A 1ZJ6A 2Y8EA 1ZYUA 1L4UA 2X8AA 3KJIA 4R2IA 3EPHA 3AKDA 4FMCF 1K6MA 1WXQA 3B1ZA 2FSHA 1T8UA 1T9HA 3K0EA 4LZZA 2AFHE 4EPXA 3VMFA 3T1OA 3I4LA 4ZIRA 1GILA 1G7CA 3Q9LA 4ZPXA 4Y0AA 4DSTA 4C4PA 2OE2A 2O8CB 1II0A 1U99A 1CBUA 2FGJA 6Q21A 2FF7A 2Q0HA 4CEIA 5CJPA 1AZSC 4BUJA 2P2LA 3W6NA 3MRSA 4BEBA 1E2EA 1X1RA 5C4GB 2B7BA 2RGCA 2J0UA 3NIBA 4OHXA 1CIPA 3DO6A 2F6RA 2QI9C 2J46A 4D4JA 4GI7A 1UBEA 4BWYA 3AUXA 2H8KA 3BXZA 1T8TA 4MUAA 4G5OA 4TQUS 3G0HA 3EARA 5B58C 1C1YA 3U6KA 3EZ9A 4AG6A 2ZU6A 2H1LA 4IFEA 1S1MA 2DWPA 4BGDA 3KQNA 4B75A 2WWYA 5J5CA 2EW1A 1Z28A 2B8WA 4L5BA 1J7KA 2BMFA 2OBLA 2ZYTX 4AD8A 1EG7A 3PIRA 3GJ3A 2NO9A 3M4YA 3F0TA 3DEFA 4UXIA 2O8FB 1NI3A 1DPFA 3ZYCA 4GOXA 1ZNWA 4UNQA 1DAHA 4JLMA 4US0R 4TLEA 2NMVA 2B7CA 5CITA 1QG2A 2IYTA 4Q1CA 1P60A 1CLUA 2VL7A 2W2VA 5KNDA 5F3WB 1XTJA 4NL4H 1U8ZA 4PXAA 1QHHB 4GRAA 5HTKA 4KYIB 1EFCA 4ZDIA 3K70B 1QVRA 2FGKA 2GRJA 2ZI3A 3OHMA 3GQBA 4MKIA 4TYNA 1VG1A 3EAQA 3THOA 4TMVA 1XTKA 4LHWA 2BM1A 4MYTA 3TUZC 2ZAMA 4IEIA 2V4ZA 1N5IA 2XZOA 1UKEA 2A7QA 4PZYA 3AKYA 1SZPA 1GRRA 4CEHA 1TQ6A 3W5JA 1TL7C 3K0FA 3HWSA 4UNRA 2VTKA 2W6IA 1KIMA 4OL0A 2O0JA 1W0KD 1W0JD 3QJYA 4HAVA 4ZO4A 1NNEA 2P6RA 2ORIA 4OI0A 3P27A 2QPAA 4HUQA 4LYJA 4CYMA 4Z1MD 1KZGB 1F2TA 2AN9A 1S1CA 3CH5A 4LJ8A 5GVRA 4LYFA 5CK4A 2C9OA 4X8MA 2ZYUX 1XB2A 1BOFA 4LI0A 2C5LA 3G5UA 2ZRNA 5IK2A 4NONA 2RCNA 2ONJA 4ZV4A 3KJHA 2FH5B 1JNYA 4IHQA 2WICA 1UFQA 1A5TA 5AUNB 2KBEA 1O3YA 4BFVA 3ETLA 2C95A 4QGHA 2IEZA 2QBYB 1E1RA 3QKSA 1HY3A 2VHJA 3W8RA 2VP2A 1T0JB 1SXJC 4OQXA 1VG8A 5KDDA 3REFA 2D2EA 5TVKA 1SQ5A 1NIPA 3RABA 3AGPA 1D6JA 3JVUA 3ZDQA 4GFDA 1COWD 5LB4A 3QEOA 5CIWA 1K5GA 3K1JA 2HUPA 1UPTA 2ZREA 4M9ZA 4POAA 1NBME 2G9NA 3BS4A 2OFXA 2UVQA 3IKJA 3LLUA 4Q4LA 1TTTA 1NN0A 1IJEA 3FFAA 3P4YA 2QY9A 4RCYA 3KB1A 3ZIAD 3W6PA 2CCGA 2WJIA 1XMVA 2O0KA 1JEDA 2ZS8A 2GXUA 1E1QA 5AJWA 1BYUA 3A8TA 2CNWA 3U44B 2OZEA 1E99A 3GLFB 1TQDA 2ZR7A 5DHFA 4TZ0A 2WMOB 3NWJA 2MSCB 1YR9A 5TB5A 3T1QA 3QKRB 4P4UA 2JDIA 3I62A 4QFMA 4Z8YA 4Q03A 4A2WA 3QVUA 4C2UA 4R98A 3K0CA 2GEUA 4OQMA 3SYKA 3KQUA 1FMLA 2OCAA 2CJWB 2K5UA 5TY0A 4LBZA 4LJAA 4JLDA 3MWKA 3KKOA 3PUWA 4XTCS 1HUQA 1JB1A 2A5JA 3EZFA 3UANA 2QU8A 1WBBA 1W49A 2W2TA 1DAMA 4G1UC 1H65A 3AP3A 2FPMA 1Z8FA 4QBFA 3ZVRA 4ZCIA 1QVAA 4PPNA 1OW3B 3ZJYA 1E2MA 4PPQA 3EWSA 2BBTA 5FPKA 5C2JB 3I5YA 1Z6AA 3QF7A 3UPUA 1JAIA 1Q44A 4JL5A 1IN8A 1Z0JA 3QG5A 1II8A 3WNDA 3K70D 3BFVA 1ZAKA 2YOGA 2DFKB 3ND9A 4PQYA 2EYUA 1GNPA 3R20A 2EWVA 3RDPA 2I3BA 2EU8A 2G6BA 3W34A 3R9WA 4M22A 1YHNA 1E32A 1MH1A 5JECA 2GJ8A 3QKUA 3CKLA 2ZE7A 1JALA 3GJ0A 4BFYA 4MRPA 1GWNA 2ZRAA 1GKIA 4AIIA 3U4QA 1Z2CA 2XNSA 3TSOA 4IDPA 4BZQA 4LK2A 4UNPA 1DVRA 2ZSBA 2AWOA 2FEMA 3DM5A 4ZDWA 4NBSA 4RZUA 3TLXA 1X1SA 3T15A 5TV2A 3WBJA 2LKDA 1KOFA 2MSEB 2WWIA 5FOWA 5UKDA 1XEWY 2AK3A 1N25A 1CRQA 1AJEA 3U6BA 1NN5A 2BMJA 2QPTA 3L43A 2R9VA 3EX7C 3K0SA 3SBEA 1FTSA 2REXB 2Z0MA 3WNCA 2PH1A 3E70C 4JBXA 1ZM3A 4PZZA 4C0JA 5J40A 1TADA 3V9PA 4U00A 2QM8A 1PUIA 1G16A 2XOKD 4NCNA 4TZ6A 3LQRA 5DIFA 1VPLA 3NHAA 3ADCA 5CLLA 2ZR9A 3CNLA 5AR1A 2J0VA 4MGYR 3RS5A 2ONKA 3OEEA 4O25A 3CLVA 3GEEA 2QMHA 5JBQA 4DCSA 3I8XA 1N6IA 2WWFA 3H86A 5CYOA 4A0RA 3OAAD 3C4JA 3LRPA 2O8DA 2R44A 4GNKA 2FDCA 5J4HA 1XTIA 1PV4A 2HJVA 4AK9A 1R5BA 3DHWC 5GJWC 1KI6B 3TW8B 2IS2A 4QNRA 3SU8A 3KKQA 1UEIA 4F4CA 1NG9A 5FUWA 1IN4A 1J8MF 5JI3E 4C0AC 4PAQA 3W90A 2QN6A 3HYRA 1Z83A 1CS4C 2XJ4A 4M4SA 3GLIA 1K8RA 1Q1QA 1BYIA 4JBWA 3B82A 5JJKA 3P26A 2HXYA 4OQLA 1V5WA 2GCOA 3UXMA 1Q57A 4FMBB 3FOZA 5JCZA 2I4IA 4HEJA 4V02A 4PFSA 2WIAA 5BQ5A 4OJQA 1OIXA 3U3MA 4HAUA 5CB6A 3VU9A 2OCPA 4RFVA 4F38A 1Z08A 1N5KA 1P2TA 2Q9CA 1TU4A 4L15A 4XVQA 721PA 1IONA 1EWRA 3CX8A 2ZE6A 2I1QA 3VR3A 3C7KA 4CT5A 1XXHB 3TJZA 1AM4D 1DAEA 1ZU4A 2HDNB 4YDHB 5EP2A 1ZIOA 1E2LA 1S3SA 1A1VA 1LV7A 3N5CA 2NO6A 3QPWA 2GETA 2MMCA 3KJEA 3GJ5A 1DARA 3FFBA 1O87A 1VMAA 2QMUA 2ZRHA 4Q4JB 3A1VA 2WJHA 1JECA 3BD9A 1G17A 3MCAA 4I1VA 2Q6TA 3QXCA 4IOKA 4NE2A 1ZMXA 4NTZA 3TH5A 4IVQA 4G01B 4UQOA 5KOYA 1G3MA 2RHDA 5KU1A 2IXEA 2CK3D 1UBCA 3BC1A 4XOIA 2HCBA 1L2TA 1GP2A 4LC0A 5JZVA 4EIWA 2O8EB 1GG2A 2KE5A 4FMCB 2XB4A 4WW0A 1EFRD 4EDHA 4RCZA 2C03A 3AQ4A 1DO0A 1OKKA 4DLVA 1TQ2A 4TLAA 5JWOA 5L3QA 2ZS7A 1IQPA 2W6ID 4ARZB 4EPTA 4ITRC 4YMTA 2WAYA 3RS3A 4DRZA 2PEYA 4CEJB 3NG1A 1TQ4A 1E2QA 1XZPA 1TF2A 4KSBA 4PC6A 2VP4A 2ZJOA 4LHVA 3PR1A 3O47A 3AVOA 4B44A 2NZ8A 1F3OA 1XTSA 5KSOA 1FNMA 2OFWA 4OI2A 5IK2D 3CZQA 2W00A 4IXMA 1SVMA 1JBKA 2OEPA 3GLHB 4TYYA 1J90A 4TMTA 2IUTA 3L0PA 3PQCA 2X77A 1FUUA 3FKQA 1OXVA 4URZR 5DO9A 4P4SA 1YRBA 1ZNYA 4UNNA 2BV3A 2A5DA 3CONA 1YE8A 1T3SA 1E1RD 2EFCB 2ERYA 1ZU5A 4OI1A 4EPRA 4AKEA 3K09A 3V4RA 821PA 4TMZA 4A8JA 4IDQA 3RC8A 3CPHA 5A5GA 2WJYA 2YWGA 4Q1BA 1KI2A 3TBKA 3HYTA 4DT1B 1NMXA 1ZM4A 1JI0A 1EGAA 1E9CA 1WB9A 1E1QD 2D4HA 3IDQA 1RRFA 1LS1A 1X8LA 3AVPA 4QJ4A 3EWAA 5HPYB 5G53C 3Q7PA 2QQEA 2IBMA 1KSFX 2F1IA 3OESA 1GIAA 5FH9A 4KLNA 3AKEA 3ZD6A 5JLJA 2JDID 3PVSA 4D0LB 2CBZA 2A9KA 5FPSA 5D3QA 4HAWA 5AUOB 1KSJA 2IYVA 3VX3A 4DUGD 5DYIA 3QE0A 2P65A 3H0KA 1X8JA 2JIZA 3L2OB 4KU4A 1AGRA 3LBNA 5KPDA 1XPRA 2C78A 1KI8A 2PZEA 4L9SA 1FX0A 1CF4A 4PC3A 2B8TA 4Q4AA 4CVNA 4ZCMA 4LOAA 4U7DA 4NYIQ 3L8YA 1W4BA 4WXPA 1TPZA 1OE0A 2V3CC 4TLDA 4UJ5A 3I5XA 4A82A 4I1OA 3AF2A 2ZM5A 3M6AA 2ZVQX 1IM2A 2AKAB 4JLBA 1UDWA 2J0QA 1M34E 2RHMA 3QF4B 1XPOA 4NH0A 2ODWA 2E9SA 2R6GA 2I1VB 4XVRA 1SHKA 3C14C 1FL9A 1RJ9A 1UKVY 2ZRFA 1SXJB 4RFSA 4V0MA 1WBDA 3IEVA 3H4MA 2CHVA 2ZRKA 3LDAA 5BXQC 4EJSA 2XAUA 5KO2A 5B64A 4PC7A 4DBLC 1ZM7A 4OHYA 1LFDB 5DHAA 4HAYA 1E9AA 5H70A 2GF0A 2R6FA 5EE5B 1R0WA 2FFQA 2JA1A 1CULC 1MT0A 1XTQA 1U0JA 1XD2B 4KCGA 5JJLA 1LS6A 3RC3A 1XEXA 4JVMA 4YMUA 4KBFA 4HB0A 3THXA 4M1TA 5EXPA 4P4TA 3RRNA 2AD1A 3PG5A 1X6VA 1QRAA 2H7VA 3I73A 2R6AA 3BH7A 4BFTA 3I8SA 1VG0B 4AWXA 1AS2A 2GKSA 3Q85A 4DIDA 5JRZA 2HV8A 1IXZA 1YZGA 4B48A 1M6NA 1L4YA 1PLKA 1CR0A 1ETUA 3TUIC 4XWAA 1WMSA 2O5VA 4LCBA 4AI6A 5D3MA 4Q1AA 1B23P 1CEEA 3NBXX 3FWYA 3PXGA 1YU9A 5HE9A 2OHFA 3TAUA 3IEUA 3D3QA 4WBSA 3AP2A 3O8DA 4ZKDA 1OB2A 2ANCA 2BC9A 3UWOA 4ZKEA 4FN5A 4V0ME 4TN1A 2D74A 4PPGA 3SNHA 4CW7A 4RSGA 3P32A 3DMNA 2C96A 4DJTA 2KJQA 3K9LA 3MD0A 5CLQA 2ZJ5A 3B1VA 3U60B 1SVKA 1E2DA 3HR8A 2ODNA 4TWZA 3LW8A 3FMFA 1CJTC 3RRYA 3N70A 1RRPA 1YJ5A 2OG2A 5F2EA 3GLGB 4F92B 1KMHB 5CDFE 2RGEA 4AKHA 1AA9A 1KDPA 2VHTA 3BRWD 3LW7A 2WJGA 5E7IA 3LX8A 3NC0C 3P4XA 4DEYA 3K8YA 3S1AA 1NLZA 3W5IA 1E9RA 4DEXA 4D6PA 1R5NA 1OJLA 3KQHA 2J59A 1E9DA 3RVBA 2IWRA 2WPDD 5L3SB 4A36A 1KDOA 3A37A 5IDVA 2VRWA 4TL9A 3TR5A 3FPAA 3QENA 3B2EA 4TQ9A 2OCYC 1YZLA 2OAQ1 2ZITA 3CZPA 1MRNA 3LH5A 1U2RA 4Q9KA 4R2HA 3DZ8A 3RS2A 1QBKC 4DWJA 2RAPA 3P20A 1XP8A 1AZTA 2H92A 4ON9A 1UEJA 2WTUA 1IN5A 2Q3FA 3HPRA 2QMEA 2JJ8A 3FDIA 5DLQC 1KJYA 2GXSA 4PQRA 3IHWA 4JT2A 4A6XA 1SXJD 3A1SA 2VLIA 3KB2A 1D2MA 3W9YA 3BB4A 2ZI4A 2HLDA 2ZRBA 2H17A 2ZSEA 4MRRA 1G20E 3IIJA 3SJZA 4F4IA 2QROA 5FOUA 2DBYA 1AK2A 1SKYB 2X2FA 1GRQA 2QG6A 4DDTA 1CTQA 3QXHA 2G88A 1RRCA 4A4DA 1KI9A 2CL6X 2IUSA 2QORA 2WWGA 5C46F 1OKKD 5JJIA 1KKLA 3VFDA 4JT4A 2GZAA 1NVWQ 2WOOA 2IYWA 5EXTA 4FCVA 4AURA 4ZI2A 1U94A 2W58A 3T06B 3MGCA 3TIFA 1T4GA 2J0SA 4Q9LA 2DWOA 1EX7A 1F48A 5H1YA 4YMWA 3D7MA 3ZGXA 5CYPA 3RYTC 4DCUA 2O8BA 4K81B 3WYGA 4TT3A 3NBFA 3MMPA 4B3BA 2ASEA 3DVLA 3NH9A 4UNSA 4B6EA 4K46A 4D82A 3QG1A 4NYMR 2IL1A 4OI4A 2V1XA 4YQFA 3I61A 1CKEA 1TUEA 2O0HA 5JHHB 1ZINA 3F5FA 2XGJA 1XCGB 2ZSDA 4LHZA 1ZCBA 2FOLA 2XZPA 3A1WA 4FCWA 3TQCA 4GDFA 3VKWA 1PZNA 2YC2C 4QL3A 3IIKA 2DCUA 4H9GA 2ORVA 3EZ6A 5TMPA 1E2GA 5B57C 2WWHA 3R8CA 1PUJA 1OFHA 2F7SA 1JXOA 2FWRA 2PLFA 3CRW1 1N5LA 1XTRA 1AS3A 1CR4A 1HYQA 2ANBA 1SKQA 4D25A 2GF9A 2V6JA 3DKPA 3TNFA 2F1JA 1MO6A 2IC5A 1RE0A 2GDJA 4LYHA 4LWZA 4RD3A 3LAWA 3KUCA 5DI9A 2PX0A 3SDZA 3SN6A 5H8WA 3F8TA 4LJ7A 4C7OB 1OIVA 2PLRA 5C18A 2PT5A 3DL0A 3T61A 1C9KA 1HT2E 1GL7A 2B92A 3X1DA 4CRWB 3ICEA 3B13B 2QM7A 4B74A 1ZD1A 1DG3A 4HDOB 1UKYA 4G5RA 4Q9JA 1VHTA 3A58B 3NEJA 3CH4B 5LBIA 4IDOA 3J81k 2AR7A 1ELOA 3WY9A 2R2AA 1YZNA 2X1VA 2JIZD 1OFUX 1DOAA 3CRVA 1IAQA 4AY2A 4E03A 4CZ2A 1I4DD 2N42A 1IJFA 1HURA 1T5IA 1MABB 4RKFA 4O2RA 3U3JA 4DLZA 1NBMA 4QBIA 2JATA 4BRUA 2ERXA 4MKFA 2YOHA 2ZVPX 1JAHA 1R6BX 1ZBDA 4HSEA 4Q01A 4UJ3A 4YMSA 1PLLA 1DBSA 1OXUA 3SHWA 2JLWA 4I99A 3R9IA 2CCJA 1JXMA 4GBMA 4B32A 3KKPA 4Q7MB 3WP1B 3GLFE 4FD2A 1N2CE 1NVVR 3BIFA 4HZUA 4C0SA 1ANKA 5FL7A 2OESA 1NP6A 4QG7A 1W47A 4BFUA 2A30A 2G1KA 3VHXA 4ESVA 3U61B 2FA9A 4KV9A 4Q48A 4F93B 1RC8A 4PHTA 3IBGA 2FSFA 3R7WB 4JYCA 4ACAA 4DB2A 4TL6A 1KY3A 4PX9A 4URUR 1TF7A 1OB5A 4JLAA 2QUZA 2ZS9A 1E9FA 1NLFA 2YJTD 3CWZA 1E79D 2QE7A 4Q66C 1WA5A 3NBZC 5J4VA 2IT1A 4M9XA 1DAKA 1F2UB 2R6CA 2G83A 2NZJA 3IQXA 1UJ2A 1FP6A 2IXGA 2ZJ2A 3KDSE 3EPJA 2D7DA 1W4AA 2FFAA 2ZRMA 1QHIA 1TEVA 1ZUHA 2MSDB 3VR4A 4NKRA 1EXMA 2QA5A 2WWWA 3GJ4A 1OXSC 1Q1ZA 1JJ7A 2D3WA 4F4JA 3EC1A 1ZVQA 3I3SR 3IILA 3ZQJA 4M2LA 2DHRA 1SVLA 1U98A 3U7EB 5IF9A 1G4AE 5IRCD 3W3ZB 5K8IA 2PBRA 2FE4A 1FPMA 4ZIRB 3KXIA 2EQBA 3ECCA 4KODA 1S4QA 1SVIA 1A82A 1X8KA 3BE4A 4LJ6A 2P6NA 5K8LA 3GMTA 2AD5A 1JPNA 1W7AA 4CEIB 2BCJQ 4TL7A 5HCIA 1I2MA 2XTNA 1W36D 1Z0KA 2BDTA 2J0UB 1NLYA 2J1LA 3C16C 2NG1A 4XIGS 2VSFA 3CPJB 3IHLA 4Z51A 4PZLA 4YONB 1AQYA 1KY2A 2V1UA 5FOVA 3ZH9B 3FE2A 4GT1A 4B3XA 5DI3A 3HR7A 1YVDA 1P75A 1SVOA 3PUYA 1OF1A 2XTZA 4DXAA 1YZUA 1LVGA 1FZQA 2ZYWX 4FWIB 1XD9A 3AF1A 3EASA 2GNOA 2BEKA 4EFLA 4ZDKA 5EP4A 1KDTA 3K53A 3CIOA 4FCTA 4LJ5A 4A1FA 1Y63A 2QQ0A 3ICQB 3T34A 1WF3A 4URXR 3K09C 3FMIA 1NJGA 3GEHA 2CXXA 1KO8A 4W5WA 4XH9B 4L8GA 4A8JC 1VYTA 5AK0A 3IIMA 1N0WA 1U81A 3QPVA 2C9CA 1GAJA 4F7WA 4PAMA 3VHLB 2HEIA 1P6XA 4ASUA 1OLOA 1VCIA 1KNQA 4WXRA 1A2BA 4Q9IA 5CM9C 3U3RA 3GFOA 4Z8XA 1T3HA 2VHUA 2Z83A 1XJQA 5FL3A 1ZIPA 1YZKA 3VNVA 2KI5A 2NO0A 2HCJB 1M7GA 5BYJA 3BGWA 4HATA 4BRWA 3EA5A 4D81A 3PFIA 4JBYA 5EE1A 1IXSB 2P0EA 2CDNA 2VHQA 1R0YA 5CM8B 1P2SA 2QSYA 1X86B 1XBTA 3K0AA 4JKIA 4Q4HA 4V0OA 1Z06A 1TNDA 4CEHB 3HP1A 1II9A 1IY0A 3AKCA 4QBGB 5FTNA 3RS4A 3B1YA 5HKKA 1X3SA 2KB0A 1AN0A 2GJSA 4V0KA 4X8LA 5C4MA 4B47A 5GJVC 4GZMA 4TTPA 2QTHA 5G41A 1F2TB 2SHKA 3FHOA 1XXHE 3C15C 1Z47A 1US8A 1XEWX 4AYTA 3IO3A 3T12A 2WKQA 1HA3A 2R6DA 4NDZA 1H8ED 1ONBA 4D4LA 1EESA 1KO4A 2BMEA 3D6TB 4Q7LA 4EQ6A 1JR3A 4F91B 4JIMA 4PO9A 5JSZA 5KDOA 5HE8A 5F9HA 4Q1FA 4IDNA 3LLMA 3UG7A 3JVVA 1AIPA 3EIQA 2ZRJA 4O3MA 1D2EA 4HAXA 2IXFA 1KO7A 1KDRA 3ZVLA 3Q5EA 1W2GA 1G5RA 1L8QA 4EJSC 3LVRE 4NCHA 2ZRDA 2ZXUA 4TT3D 4NP6A 3HDTA 4P3YA 4W7SA 4EPWA 4OBEA 2IYYA 4DLXA 1VYUA 1W44A 3LX5A 5KSYA 3ND8A 1Q3TA 4DDVA 3LFUA 2ZUBA 2IX3A 2BM0A 2MMGA 4A0GA 1T0HB 1FNNA 5G3ZA 4ZDJA 2X2EA 3AM1A 4P0TA 2X19A 2H5EA 4BQSA 4JVLA 4XSGA 4CT4B 4B73A 1KYIA 1TF5A 1UKZA 3RLFA 5LD2B 2YV5A 1UADA 5J4YA 1G8GA 1NVXQ 5AJXA 2QT1A 3QNUA 4JL6A 2YZ2A 4C0BA 1P61B 2OLJA 1SGWA 4NYJR 5FTLA 5K8UA 1ZP6A 3SI7A 2JCSA 3ZQ6A 3VAAA 4FINA 2B6HA 2XNDA 3GLHE 1E2PA 2ODBA 4MGKR 2NPIA 1JR3E 3U7HB 1QHNA 4KXFB 5GJCA 3R8FA 3AVQA 1Z0DA 4B3DA 2L0XA 2GVZC 4BFXA 3L8ZA 1W36C 3CUEF 4DLSA 1AS0A 2P5SA 4MQBA 3KQKA 1G4UR 3CF0A 4PTLA 2HF9A 1E9BA 5EUMA 2OCBA 1A2KC 4Q1EA 3B8HA 1II8B 4XVUA 5EZ6B 4L4UA 4LPKA 4LV5B 1KMQA 2LKCA 3BB3A 1XX6A 3T5GA 2BMDA 1SVWA 2IYSA 3IPYA 3NVAA 1GM5A 3WMEA 1NBMD 1XMIA 4ILEA 2VP9A 2IEYA 3BBPA 4LYAA 3UKDA 1P9RA 3I32A 1G7SA 3IUYA 1GSIA 4H1UA 4JMPA 4D4KA 1KK3A 3MG9A 4X8HA 1RW4A 4PHHA 2NGRA 1TAGA 1QHYA 4YMVA 3U4QB 5L3VA 3KTAA 1YRAA 4GP6A 4BLPA 3A4MA 1XZQA 5FL7D 1NF3A 2F43A 1DO2A 4FW9A 3AV0B 2E1RA 1G5PA 1M2OB 2HYDA 4V03A 4DSNA 3AVWA 2ZAOA 2GILA 2XSZA 2QAGA 3I72A 1N6NA 2CL7X 5FPHA 1CR1A 4DSUA 1G41A 3O8BA 2XXAA 5E7MA 1PJRA 1WP9A 3SQWA 3ZLJA 2V54A 1ESMA 4R7ZA 4DLRA 3CPEA 1P2VA 1Z22A 3B1WA 1N6OA 2QE7D 3JZMA 4ESHA 4LJYA 4QHYA 4TQAA 4Q9HA 5M04A 2WHXA 3T1TA 3EPKA 1DEKA 2AWNA 1NL3A 3QEJA 3VR5A 3TGPA 4BFSA 4LBVA 3RANA 4HB4A 4A0FA 3THYA 1KJWA 5FUVA 4KVGA 4URVR 4HLQB 4C2TA 1G21E 1KI4A 4JL8A 5CIQA 1Q1EA 4WA7A 3OIYA 3CRQA 2V6IA 3PEVA 2N46A 4QXAA 4B71A 2RGNA 3HU1A 2G0TA 3E1SA 3LY5A 2ATVA 4N3NA 1JQLB 1KGDA 5EE9A 4ERNA 2VSOA 5JI2E 2O8DB 1VCMA 2IYZA 3B5JA 3WRXC 4CIDA 4PO1A 1KTVA 2QP4A 5AUPB 2RMKA 2CNWD 1CXZA 3RWOA 1TEXA 1HH4A 3B1XA 3PEUA 2EFEB 4C3ZA 1G1MA 1R10A 1E0JA 1GRNA 4L9WA 2W0MA 4R9UC 4IXNA 3GLIB 1RYHA 2J41A 3C41J 4PHGA 4IOJA 1G64A 3THWA 2GESA 1E4VA 2OV2A 2GCOB 2FV8A 4MYHA 5J47A 1E3MA 5G3YA 4GOKA 3WHLA 4RD1A 5FOXA 4M21A 2VH5R 5JWRA 1GZSA 1QHXA 1R5OA 1VYVA 2BEJA 4A2PA 5JCPA 4PHFA 1S9DA 3W6OA 3VU9B 1CJUC 4PC2A 1FMJA 5LB2A 4I1SA 1P9WA 3A36A 2WMNB 1M74A 1C4OA 2QRZA 3ZZUA 3A6PC 5DNYB 1S8FA 4M0LA 1YKSA 3SJBA 3FHTA 5JS7A 4WIAA 3PEWA 4M9SA 1S2MA 2OBMA 2H57A 1OFIA 5DGXA 4W9MC 2PL3A 1EFUA 3WHKA 3X1YA 4LRWA 3V4FA 1W5TA 2YKGA 4QHSA 2GXAA 1E96A 4BEJA 1DAIA 4BLRA 1KI3A 1XWIA 3T1VA 3OF5A 4B2IA 4HZIA 4TTRA 2EVWX 3TVTA 4ASUD 1Z0AA 4U02A 2JLZA 2DFLA 1W2HA 4OKSA 1ZNZA 2WM9B 3VKGA 2IUUA 2FFBA 1NKTA 2IF0A 2QL6A 3CBQA 4NZYA 4HB3A 3SZRA 1AKEA 3FKSA 4PSKA 2WOJA 4OQFA 2YYZA 3PV0A 1KSGA 1GUAA 4GSYA 2ZE5A 1Q1BA 2AK2A 2ZI5A 5KUTA 1OH6A 2W2XA 4BFWA 1JJVA 3GLGE 1KO1A 1R0XA 4FIDA 2A5YB 5CDFA 1KO5A 2PJRA 3FB4A 4Z1MA 4PO8A 1D9ZA 1QG4A 1G7RA 1NSFA 2YINC 2ZROA 4R71A 5L3QB 2REBA 2F3TA 1EFTA 4G5QA 1XJCA 1R8SA 4JSYA 1XF9A 3KJGA 5HKKD 3GJ6A 4MYUA 1F60A 2O52A 3FGNA 2P5TB 4QJ5A 1NVUQ 1OYWA 2GEDA 3CW2A 3VQTA 2V8OA 1Q20A 2RB4A 4YC7A 3KQLA 1CJMA 4FMDF 3EZ7A 4DVGA 4A0HA 1ZM2A 2FEOA 3CR7A 4AG5A 5J4KA 1GNRA 4BLSA 3A1TA 4BLQA 2OO7A 1TMKA 1Z3IX 2B21A 2IYRA 3OEED 4HLDA 4KFTA 1MO5A 2GXQA 2FNAA 4P4SB 2CEAA 3QQ5A 2O8CA 1OPXA 2LWIA 1JR3D 5DE3A 3WBKA 4IVPA 1G8PA 2JAQA 3LD9A 3X2SA 3QVVA 1TX4B 2D7CA 2PX3A 2ZPTX 4RD0A 2FG5A 2C2HA 3OFNA 3KXLA 3PCRB 3QXSA 2BOVA 4I81A 4DSOA 2ZI9A 3SYLA 1I2DA 4W5HA 1CP2A 3NHBA 1U9IA 4N1AA 1K5DA 2C99A 3RRMA 4A8JB 4B6FA 1Z63A 1OXTA 4XWOA 2OSBA 2YWHA 4URYR 4OHWA 1XU4A 1Y3AA 4H1VA 2YNMA 2PT7A 4KFRA 4U5XA 2G3YA 4PC1A 5DYGA 3GD7A 4DDWA 2EFDB 1R2QA 1GNQA 4M53A 4Z54A 5FBLB 4FI3C 3KZ1E 2QSZA 2VEDA 3EPLA 2FX3A 5JRJA 2KWIA 3PUVA 5EP1A 3UMRA 2O8FA 5DN6A 1XPUA 1N0VC 2J87A 2YOFA 3E5HA 2V7QA 2HYIC 2W0SA 3CWQA 5BYKA 4FWTA 1KK1A 5L3RA 2CE2X 1N0UA 4M1KA 5TDHA 1QHHA 3ONWA 3OZXA 4QNMA 2XNDD 3ZZ0A 3VKHA 4Q47A 1Z0FA 4M1SA 1FFHA 2GCNA 3DMDA 1FX0B 4QOSA 1U8YA 2QAJA 4Q4AB 1CR2A 2FPLA 2IF2A 5FOTA 4AYXA 4DLUA 1JQJC 3FHCB 4MKHA 3QPUA 1XD8A 4RZ2A 4LSGA 3NC1C 2TMKA 4JLVA 5BW8A 2ZRCA 3B78A 4MDEA 5DISB 5EUQB 3FVQA 3WRYC 4LV8B 1RJ9B 121PA 1F6BA 2EWWA 4RFSB 2F9MA 1KJZA 3IGFA 3ADBA 1S3GA 4EJSB 2NQ2C 2QTFA 5K8TA 1QHSA 2R8RA 1BO6A 3C5HA 1VCNA 2ZJYA 4RD6A 3FYHA 2DPXA 1DELA 3SOPA 3NDBB 2G1JA 1XEXB 2N1BA 1UBFA 2BJWA 4IRUB 4KVAA 3E2IA 4JZKA 2E87A 3SBDA 2OFOA 5KSPA 2ZJBA 1E2JA 2RGAA 1Z6GA 2XSZD 3B9QA 3THXB 1PVOA 2QBYA 2GZHA 3AVTA 3VR2A 3LV8A 2FZLA 4JLKA 1FOEB 1YQTA 2WSMA 1GITA 4US1R 5GADl 4Q00A 2ZU0C 2P67A 4TSFA 2WBLC 3TSWA 1T5LA 1XMSA 2C8VA 3MFYA 4GPTA 4NPHA 1HQCA 4ABYA 2OXRA 5SZJA 2JJ1A 3SHFA 1NKSA 2WKRA 2FSIA 4M1YA 3CB4A 2D2FA 1E9SA 2VF7A 1DE0A 2A3RA 2PZGA 3GJ8A 4QGFA 5FTJA 5D3MB 4LV6A 3B60A 5KDLA 2JJ2A 2GBLA 1KSHA 2C9YA 4PSVA 3U44A 3GLFA 3AB3A 1NVVQ 3UMSA 2AX4A 3AUYA 2DYKA 1E0KA 2ZUCA 3IQWA 3QI2A 4BZXA 5KPJA 3ZVMA 1W36B 4E09A 3LVQE 2NO1A 3QKRA 3HU2A 2F1HA 2ZR0A 2EYQA 4QGAA 2Z43A 1A4RA 1AKYA 1CJVC 1KAGA 3PENA 4D26A 3WMFA 4C30A 4I1UA 1EWQA 2CJWA 4HLCA 3NTUA 2REOA 5G40A 2IS4A 1NY6A 1J70A 3H84A 1JPJA 2GZDA 4AKGA 3N2EA 1LY1A 2A5FA 1RRGA 1GVNB 1VDZA 2QTVB 3VR6A 3WYAA 4LBYA 1OT3A 1R8QA 3CRMA 3FTQA 5HR5A 2IYXA 1Z0IA 3GP8A 3W8NA 3PITA 4A92A 4HLUA 3S1AB 5F9FA 4RKEA 4HYYA 3RWMB 1R0ZA 4DCNA 2IHBA 3LXXA 1W4RA 3QXJA 3LNCA 3DZDA 3BH6A 2F9LA 4YXWA 4QKQA 1P62B 2IA5A 3TQFA 1OSNA 2JLSA 1TUIA 2VPPA 4TL8A 5JWHA 2A5GA 3OEHA 4V0NA 3FMPB 2RGXA 4LBWA 2RKOA 2VQSA 3I92A 2CHGA 3CX6A 4G5GA 4BLOA 1GFIA 4RY2A 4A9AA 1NN3A 4JSTA 1W4CA 1BMFA 1GTVA 3W3AA 5FI0B 2CK3A 1KI1A 1LNZA 5TARA 4MKGA 4TTQA 4D80A 3TMKA 3BFKA 1KK2A 1KHTA 2Z6VA 3QY0A 2GEVA 3SFZA 4C0QC 1UDXA 3UATA 4TYQA 1EFRA 3AF4A 1VKJA 2HT6A 3AVXA 2F55A 2XB2A 2W6JA 4M9QA 1N6PA 4HDQB 3WYFA 2QRNA 4LX0A 3U5ZB 1OH8A 3FKSD 3HJNA 4B35A 2BJVA 1D2NA 2DFTA 3NH6A 5JMTA 3D8BA 3AVVA 1SVSA 4B3FX 2Q9BA 4L16A 2QT0A 2UZIR 1HV8A 3UIEA 3LWNA 2A78A 3TK1A 4KI0A 4URWR 4Y0VA 4LHXA 2AXPA 2BBOA 2ZUDA 4ACBA 3EG5A 5ANRB 1QHGA 1OXXK 5B2ZA 2RGGA 5FFMA 1P9NA 4B43A 4OJKA 1QF9A 4PQFA 2NOAA 1ZC3A 3AVUA 1V43A 1RFLA 3NBYC 5KHOC 1D8TA 4AYWA 4J0QA 4KHZA 2IK8A 3KKNA 3ZVNA 1NRJB 2YWFA 1IOZA 3U7GA 3ASZA 4M1WA 1OHHA 4PANA 4TMKA 4D4MA 3K9NA 4C0HA 3EA0A 1WRBA 4DKXA 1S96A 2FSGA 1YR6A 2QP9X 3U3KA 1LW7A 2J3EA 2RGDA 4IOMA 3TKLA 2O8BB 4HB2A 1KI6A 1W1WA 4AKIA 3TR0A 1E2KA 1E2NA 5EQTA 3SJCA 5BN3A 1ODFA 5FR2A 2PJZA 1AQUA 1RIFA 3VNUA 1R7RA 1LF0A 3SEAA 2NIPA 2J5XA 1E6CA 1J8YF 1DS6A 2IW3A 2ZSAA 2QAGC 3OFND 3C8UA 5EJEA 3BAFA 4G5SA 3RSOA 1N6RA 4IW3B 1VIYA 1DAGA 2GAAA 1G18A 3RNLA 3QIAA 3QUSA 2ZJ8A 2CLCX 4EFNA 3ZS8A 1G7TA 3B9PA 2XITA 5E7JA 1QZXA 1GKUB 2D06A 2C77A 4UKDA 2CVHA 2VP5A 2OBNA 3SR0A 2G77B 2HF8A 1XXHA 1P72A 3DOFA 3IO5A 3MLEA 4YLGA 4XD7A 8OHMA 1E0AA 2ATXA 4HI0E 4LJ9A 4X8OA 1VIAA 4DUGA 1NJFA 2XZLA 2BBWA 3OIVA 3AP1A 1S9HA 2DB3A 1IHUA 3H1TA 2AHOA 4IKEA 5DN6D 4Q4JA 2V7QD 2RGNC 3KKMA 3UMFA 5CB8A 1U0LA 1WDTA 4LPSA 4WZAE 1ZUIA 1M1YE 2LCFA 2HXSA 2ZQ5A 1E69A 2RH5A 4Q19A 1BS1A 1MV5A 3BB1A 1B0UA 3QSYA 4KFUA 3CX7A 1CJKC 4TLCA 1G8HA 2CVFA 2ZETA 2PEZA 2ZIAA 4PR0A 1XFAA 1D5CA 3OIUA 1P5ZB 2NO7A 1CU1A 1I4LD 3Q72A 3RHFA 1E2IA 3BORA 1XDBA 1E2HA 2PMKA 4QM7A 4FMDB 2ORWA 4TYWA 5SZKB 3TW4A 2O8EA 2RGBA 1DAFA 3K9GA 2WKPA 1E94E 2UKDA 1GDDA 2J7KA 1IN7A 3I1FA 2WSSA 3SC3A 4C9BA 4A2QA 3B85A 3K0FB 5AUQA 2ZI7A 4KLZA 4MGZR 2HLDD 1VHLA 2WWXA 1A7JA 3KFVA 3TSZA 5JS8A 3Q7QA 4KYUA 1RPZA 4HZUB 4Q18A 4ARZA 4B3CA 1Z29A 3KFXA 4B2LA 2GA8A 1NMYA 3M0EA 4HUQB 4CEJA 2GTPA 1HEIA 4BASA 4JLPA 3GCGA 2OM2A 1G3QA 4GP7A 2AKYA 5H68A 4NYJQ 3T5DA 1P73A 2V55B 1G3UA 1VTKA 4EUNA 521PA 4JVNA 2QMOA 2VYFA 2FN4A 2JLQA 2KBFA 1W48A 4EAQA 2VBCA 1UM8A 5JEDA 3AF0A 3GLHA 3BJIC 5FPTA 3RRZA 2WVJA 3EIHA 1KI7A 2XJ9A 5EP3A 4IOLA 3QKSB 1FUKA 3TAHA 4BFZA 1WCV1 3RS0A 2QNRA 4V0LA 2D62A 4B33A 2JLUA 3AH8A 4XSHA 2Z4SA 2J7PA 2VA8A 2WJJA 4IVRA 4TSFD 1YR7A 5BWMA 1OIWA 1RZ3A 3X1ZA 2ZRIA 3PJRA 4D0GA 3IPXA 2OUKA 3DPUA 3B7GA 4QRHA 2G0NA 4M1OA 1XMJA 2CHQA 4CF7A 3SFVA 2VO1A 2JJ1D 1OH5A 3O8CA 4JLOA 1N6HA 2PZFA 3HPQA 2Q3MA 3QOFA 3CRRA 2UZ3A 2WV9A 2JASA 3L0SA 1Z2AA 1DTSA 2PMDA 2IS1A 1J99A 4DT1A 1TU3A 3JZAA 5FBQB 4DHEA 4DCVA 1MOZA 2JJ2D 4K8OA 3WXMA 1E98A 1ZD8A 1NY5A 2OXCA 2CE7A 1LTQA 2BKUA 2FMXA 4JLJA 4CDGA 5FBVB 4JKYA 5FBWB 4C0LA 4US2R 1WQ1R 3OE7A 1P7CA 4MITA 2Q3HA 4LUCA 4TMWA 4OHVA 1JEEA 1GOTA 1L7VC 2EFHB 2BKEA 5KYKA 4MA4A 4Q1DA 5DI3B 5CK5A 5JEEA 4IJMA 4Q21A 1E9EA 4KO8A 1VECA 1Z6XA 4ZCLA 4IEEA 3KX2A 3GPLA 2VHCA 5F98A 2WPDA 1XJ0A 3SE0A 3U7FB 4CGZA 5TXGA 2OAP1 3BWDD 3U2QA 3DKVA 1P3JA 2C98A 5EZ5A 4D2IA 1ESNA 1KK0A 3MWLA 4QBHA 3C5CA 2P6UA 4KITB 2CLDX 3BERA 2JLRA 2HT1A 4JYBA 4PSAA 1U9IC 4DLWA 3NEYA 2JGNA 3CF6R 4YXWD 2ZRPA 3KUDA 4BECA 3QF4A 4WAUA 1PLJA 2ZYVX 3OEHD 1G8YA 4NCIA 3ADDA 3REGA 2W83A 1SXJA 2CCKA 4HDCA 3UK6A 4Q5IA 2CL0X 1BMFD 2CMKA 5GJBA 1H8HA 1T3LA 2ZSFA 3LBHA 3CF2A 2Q21A 1W46A 1XD2A 2KSQA 2JLYA 4P33A 3F3YA 3GLIE 4JJKA 1G3IA 3CNOA 2AFIE 4LJ4A 4II7A 3IBYA 2CLSA 4P32A 4E07A 4RJLA 3K0AB 2ZEJA 4JVSB 4Q4HB 4MYCA 2W6JD 4B34A 4G3XA 4WZBE 4Q02A 2QGZA 1N6KA 1VG9B 2ZANA 3V00A 3AVYA 3ASYA 1G3RA 1U8AA 1F5NA 2YC4C 1ZW6A 2FZ4A 4BLTA 3SQXA 4KFSA 3NKVA 1G291 5KNCA 1EK0A 4NU0A 2NPFA 4B3GA 3K70C 4LGMA 3L0IB 4PAOA 4EKDA 4MH0R 1FP7A 1US8B 2GHIA 4MRSA 3GJXC 2XX3A 3M1IA 1T91A 3LO5A 4GL2A 1HE1C 1HT1E 2IYQA 2WZQA 5LDDC 4ZI3A 1Q3HA 2EFGA 1OFTA 4M1MA 2GJKA 1Q12A 5P21A 2AL7A 5E4FA 5GVSA 5E3HA 3A4NA 3ZD7A 4AC9A 4EQ6B 5JSZB 1DG1G 1Z6YA 1W5SA 1VCOA 3ZZTA 1XNJA 3QKTA 4QJ3A 3NXSA 1DADA 1SXJE 3CM0A 1HQYE 1OHHD 2VP6A 3EC2A 2BHRA 4DIEA 4D0NA 3SYNA 1G5TA 3D31A 2YHSA 2IYLD 2OT3B 3DDCA 2BIFA 3EIEA 2XTMA 1SULA 4BPBA 1IBRA 3B6EA 4TYPA 2OLKA 2JLVA 3AGQA 4UXJA 4JJZA 4Q7JB 1XCPA 3KXKA 1OV4A 4UXHA 2ODEA 4E5UA 3GLGA 1HTWA 4O2LA 4IFBA 1KMHA 3K9HA 5AJYA 1NG1A 4O0MA 3X1XA 4EPVA 4A6PA 1Q22A 1LB1B 4BE7B 1MRSA 1MO3A 4OK6A 2BCGY 4MRVA 4KSCA 4JLNA 4LDJA 4WOPA 2IS6A 4WZ6A 3UWKA 4RZXA 3GEIA 5KTYA 5L3SA 5EXXA 1E2FA 1G8FA 5DH9A 1BH2A 5JHGB 3LQQA 1G6OA 4MDFA 2WIBA 3PUZA 4XD7D 2ECKA 2F3RA 2A2ZA 3AEZA 3X1WA 2V9PA 3CO5A 4B76A 5A4JA 1N5JA 5E95A 2JLXA 5FOSA 5DSZA 1YR8A 4GZLA 2GBLC 4DLYA 2Z4RA 3GFPA 4XTRA 4IDHA 4EPYA 5IT5A 2BWJA 3OIWA 3RS7A 1NMZA 2FJUA 2H18A 1GKYA 1N6LA 3MWJA 2FFHA 1EX6A 1FQKA 1UBGA 3MUFA 4TLBA 1SHZA 2DR3A 1XEFA 2ZRGA 4HUTA 4GMDA 1W0KA 1W0JA 3MJHA 4XJXA 2GJAA 3SS8A 4DDUA 1BIFA 4P31A 2F1RA 3VTKA 5HZKA 1XCMA 3Q3JB 5FTKA 4S35A 1D9XA 2WSSD 3Q8XB 3CR8A 2VSXA 3QXXA 4HLUC 3H2YA 4YDSA 4B2PA 4XWKA 1ZM9A 5SZHB 1IXRC 3KTAB 4LC1A 5KSZA 3HU3A 1IY1A 2YVUA 2BBSA 2R62A 1I4TD 2F43B 2P3SA 1E79A 1NN1A 2QENA 1KKMA 2QAGB 2Z5FA 3RSLA 1M8PA 5A0FA 2XEXA 2QEQA 4RZ3A 2GWHA 3LBIA 2ZJZA 1RKBA 5AJVB 5EXSA 1E4YA 4DLTA 1J2JA 1IN6A 1FQJA 4RD4A 5ELXA 1GL9B 2XXAB 3DM9B 3ZS9A 4DB4A 2ZTSA 2VF8A 1M7HA 3L82B 4DZZA 1COWA 2NTYC 1U0HC 1JR6A 1Z5ZA 2GAOA 3MSXA 2DFNA 4OHZA 3UG6A 1AGPA 3TRFA 3A1UA 1Q21A 2J9RA 4NYIR 2J45A 4KBGA 3ZIAA 1QDEA 2J7PD 3GJ7A 1NIJA 3VR1A 1P2UA 3THYB 3A4LA 5JFGA 3EXAA 4LHYA 1N3BA 2BVNA 4OQNA 5B30A 4QHTA 3R9XA 2GCPA 2GVDC 3MWYW 1OYYA 1SKYE 3QBVA 2C04A 3DOEA 5C1BA 1UAAA 1MR3F 1FW6A 1EFHA 3GFTA 2GJ9A 1GL6A 1XRJA 2JEOA 3L0OA 1ZRHA 4BZPA 3P1JA 4G0NA 2QZ4A 3ADKA 1ZC4A 5SZIA 3EZ2A 1S0UA 5J4LA 5CJ2A 4C7OA 1WE2A 2ZJAA 5EE0A 1OH7A 1MKYA 3Q5DA 5FBRB 1R4AA 2QPOA 5FI1B 3RAPR 1KZ7B 3THWB 1E0SA 4NCKA
chains in the Genus database with same CATH superfamily
2OXTA 1LF5A 2VIIA 4PFKA 4QGGA 2PLWA 2Z5VA 4NMMA 2XCSB 1XU9A 3A7DA 1QGYA 3JD3A 1KNXA 1PK8A 4BMPB 4EUFA 2PZMA 1Z8HA 3KOWA 2IWHA 3TPZA 3UA4A 5B12A 2KW5A 3BH0A 1FTNA 4FC7A 5F78A 4D9KA 4F3TA 5LPNA 4D99A 4NYMQ 5CA0F 1N2HA 2JI6A 3FZQA 3GW8A 3EISA 4M8NE 3KZCA 1BA3A 2ZRLA 2UZ0A 3BOSA 3KYIB 3V4ZA 2B8EA 4TZTA 3Q9NA 1ZUNB 2WVAA 2ZXEA 3IRVA 5I48A 3HTXA 2EBHX 1YUMA 2JGIA 3A14A 2P2YA 1Z7EA 5THQA 3TE6A 1EVLA 1T6NA 1XRPA 2L17A 4LY6A 4RVCA 3FSGD 1L1QA 1XU7A 1ZONA 1V4BA 4J29A 3TIVA 3ZWPA 2JAOA 3UENA 2PCJA 2WAXA 3EDRA 1GCUA 3DQZA 3AF3A 3R0VA 1NP7A 2H7XA 2PGIA 4DLPA 2QZJA 1FE8A 2ZAIA 2DUNA 2W6CX 3BMXA 5AW5A 1T9BA 1XCLA 4QULA 1USKA 2FCAA 5FX2A 5IJ9B 1ISPA 4P1ZA 5DYNA 3T35A 1U7UA 5LFAA 4GM0A 1XAGA 2KQUA 5I9TA 3TUJC 5EJ6A 4QASA 5CXUA 3KG2A 1H8HD 3MAAC 1KEWA 2D2VA 5L8VA 2XCIA 4N0EA 4PAWA 5FR1A 4NRDA 3MJRA 3F5SA 221PA 3ELWA 1UQTA 4ZZ2A 1JSCA 3WOHA 2XRZA 1Q0QA 2IHYA 4EMTA 2XT6A 3K2BA 4ZVNA 4FE4A 3R7AA 1EA7A 4KJZA 3VDRA 4EUHA 4C1NA 3PNSA 2UUBB 4OX9Y 2XKBA 3TVDA 4JIGA 2CYCA 4DHWA 1WULS 2P41A 3S6JA 2NTVA 3HKEB 1ESEA 1RYDA 1NMQA 1ZD9A 4I4TF 1G19A 1LPOA 1P77A 1H8EA 3TVYA 4K2HA 3GJSA 3I8OA 4WVFA 1Z07A 2Q8QA 3EULA 1NSTA 2O1EA 3HVHA 1NONA 1G9XA 1SC3A 4U9HS 4NH4A 4BGUA 1HE8B 2VNIA 4FCCA 3OPQA 1LLUA 1L4UA 4FUTA 2ZYAA 3EPHA 2HPZA 4KX3A 1VFNA 1WXQA 4QOJA 5JAOA 3I9NA 1MG5A 2FSHA 4MWEA 3EGEA 3E5RA 4FFRA 1DIBA 1M2GA 4EPXA 1JIJA 1YIDA 3ZU4A 3Q9LA 4ZPXA 3U62A 2VTBA 2NU7B 1UP7A 2NAPA 4OBWA 4OJNA 5F2OA 2OE2A 4C4PA 4KN5A 4R68A 1ZN7A 1USWA 4ABTA 1CBUA 4ZCQA 3LQFA 4EK9A 4CEIA 1AZSC 1LVHA 4O4IF 3LDGA 1N2IA 2UDPA 2YJ6A 3DEHA 5H3LA 2F4VB 1NVFA 4J2OA 5EJGA 4HO1X 2B7BA 1JDUA 3WGJA 2J0UA 1VP9A 4CUZA 2XUGA 2XNCA 4EKEA 1PX0A 1DV2A 3VPXA 3JQAB 4KACA 1G8MA 5EKTA 2CXUA 2F6RA 3OQOA 4IQ4A 5ALYA 2BE7A 1MT3A 2GPSA 2I8CA 3F46A 4GI7A 4K5QA 3AUXA 3EE6A 5FNVA 4WCVA 5CEEA 1EXWA 2RC6A 1BNCA 3G0HA 3EARA 4M76B 4QTYA 3AEYA 2CGEA 3U6KA 3RK0A 5FA8A 4HBGA 4JU8A 4MQ4A 4NAVA 3LKDA 4YJ3B 3ZDEA 3KQNA 4B75A 2IU3A 5J5CA 1RPTA 3AFOA 3C8MA 2EW1A 1LPAB 3IUSA 3IVMA 3ORQA 4FNAA 3LBFA 4L5BA 1J7KA 4P38A 3HRKA 2OBLA 3VPAA 4AD8A 5JNSA 5F51A 5LWQA 3PIRA 3GJ3A 2PD4A 4MVJG 3C7DB 4NMWA 3HYSA 1DI0A 2W2LA 4WCFB 1ONOA 3ZYCA 2OMKA 2VT6A 3KXPA 3MGKA 4UNQA 3GG2A 1VKZA 3RFFA 4JLMA 3T95A 1DRUA 1M9NA 1QZZA 1ISSA 3AZQA 5CUQA 1FYVA 1RWVA 1DQNA 4MTLA 2WJZB 2G9ZA 3PUHA 1X77A 3BL5A 1P60A 2VL7A 1NVMB 5KNDA 1XTJA 3UGTA 2OHOA 4PXAA 4TTVA 3DR3A 3CH7A 1IQ0A 2NPOA 3Q40A 4ZVMA 2DC1A 4GRAA 5BYBA 4BBAA 4D41A 1BU8A 4DMRA 4YQZA 3EPPA 1P5RA 3K70B 4O2BB 2FGKA 1P7ZA 3AUJB 4WLFA 5JAPA 4TYNA 5T7BA 4BQFA 3CNQS 3THOA 2FUEA 3AFMA 3VVMA 4COOA 3E35A 4LHWA 2BM1A 5JCOA 4DCMA 1RMQA 4MYTA 4PY2A 2ZAMA 3D6HA 2B98A 4IF6A 4LZJA 5DBOA 2QVYX 2PL5A 4JDUA 3HV0A 5EKDA 3VZBA 2Y05A 2XZOA 3B52X 4Z5XA 1MA3A 1GRRA 3W5JA 1QKIA 1TL7C 5TPZA 2W6IA 4QDUA 2P78A 4BIMA 1EP2B 5I9SA 1KJQA 1XRMA 1W0KD 2O0JA 1HFEL 3GU3A 3BA6A 4ZO4A 3IAM6 1EFVB 3EVFA 4QU0A 2OA0A 5TF4A 5A5DA 4V1CI 1H9CA 4CMGA 5M2QA 3R3SA 2AR0A 4ZVSA 1YB1A 3ICPA 4ML3A 4Z1MD 3AG5A 1C9MA 2AN9A 3CH5A 3JRXA 2HRRA 3QMWA 2EWMA 1XV5A 3QLUA 1GHTA 5CK4A 3RGWS 1LA2A 1WNFA 1YL5A 2ZYGA 2Z9CA 4CKCA 3BWMA 3GR6A 4IHJA 2C5LA 3FA2A 3G5UA 5SYAA 2AOUA 4LVUA 2RCNA 1B6SA 1TI7A 1WB4A 5GONA 1H6DA 2FH5B 4P98A 1UFQA 3IIIA 1NXXA 3FPSA 4JUIA 1DBWA 1RHJA 1QORA 3PD0A 4LOHA 4PU0A 1FMCA 1O3YA 4B8WA 4EW3A 4H35A 3GOQA 5CVJA 2YDYA 4QGHA 3L1UA 5A0VA 4UTVA 1Y8ZA 3BZWA 3I42A 4UCQA 4ER3A 1HY3A 1M1YA 2A9RA 3KVNA 3WTCA 3PX2A 1KY4A 2D5LA 4BWFB 2I4MA 1UIMA 1RRMA 5LP6C 2D2EA 2M9MA 3I09A 5LP6F 1R6VA 3RABA 3JVUA 1D6JA 4L27A 3UYLA 2IEDA 1IPFA 1COWD 1Y81A 2F64A 2RAVA 2XA2A 3QEOA 4OEHA 2QUKA 5AJUA 4ESOA 1EGHA 1VPVA 1K5GA 4FYXA 1BX1A 1T3ZA 3FSRA 4M3NA 1B3BA 1UPTA 1KZ6A 2VXBA 4M9ZA 4POAA 3PBKA 4XASA 3IESA 3CT6A 4NWIA 2QY9A 3ZIAD 3D8NA 3IDZA 1XMVA 1Y80A 4E3WA 4LK3A 4LYYA 4WRRA 2VFAA 4HDNA 2H54A 4QFCA 3V4OA 3U44B 2QQGA 4YRAA 1JKJA 2ZR7A 1N2CB 3LXMA 4QPJC 4TZ0A 2V7GA 3NWJA 1U2ZA 2NVUB 3ACDA 3OQJA 3WGHA 3O1IC 1XZNA 4G1CA 5AK4A 2VJQA 1POXA 5TB5A 3T1QA 4HVAA 1JP7A 4MPTA 4GI5A 4P4UA 1IJKA 3C3EA 3E22B 4Q03A 2VZ9A 1Z2NX 3QVUA 2CF6A 4QFMA 2IUEA 4R98A 5H9VA 1U8FO 3TWOA 1GAEO 1EUZA 3K0CA 1AKQA 5D1HA 5EC8A 3KQUA 3K8ZA 2CJWB 2K5UA 1HYGA 3AU8A 4GZ6A 2PR2A 1ZK3A 3KU1A 3FSEA 3KKOA 5YASA 5AOAA 1JB1A 2VI5A 4E4TA 2BFFA 4LZLA 1YQUA 4YMIA 5EESA 3LO8A 1ODLA 2Q3CA 4W8GA 3FPEA 2BHSA 1GGEA 1W49A 1CPYA 3L4SO 2W2TA 1DAMA 3S70A 4ZCIA 2NVBA 3PUJA 4C7JA 4N6OA 4TTIA 4PPQA 3EWSA 4MXDA 1PJQA 1IN8A 4MP3A 1VJ5A 2JRCA 1II8A 3ANSA 4RQTA 4QYSA 3RUEA 3FRJA 5CLJA 3NPAA 4YNBA 2XBLA 3TCXB 3BWVA 1QRSA 1GNPA 4P83A 2EWVA 3G2MA 2PKQO 2H85A 4RV9A 3HG7A 3R9WA 4RADA 2P90A 5HJ7A 1H66A 2GKOA 4FW8A 3O8OA 1EZ4A 1Q91A 3K9WA 5TJHA 1GWNA 1KS9A 3I9OA 4AIIA 5KJ6A 1YWGO 2EARA 2XNSA 3CB2A 4FYKA 5KNBD 2H65A 4RTPA 1NDUA 4EJFA 5ABPA 4N01A 2ZSBA 3E7DA 3Q2OA 2AWOA 4UNPA 5H82A 5KYUA 3N2NA 3U3DA 4BX0A 5JTUA 1M2OA 3T9DA 2HRZA 1YZVA 5TF0A 5I3ZA 1TZBA 4HMQA 5CX4A 3MQFA 4YCLA 3R8XA 3E8SA 4IWXA 1IEWA 4CIVA 4GSKA 1YQQA 1KOFA 1MGOA 2ZPAA 5AI6A 1N25A 2QYSA 4KE9A 1EZ1A 4WVLA 4DUYB 3WC4A 4CTJA 1LVUA 2OZVA 4YAKA 1L8LA 1DPGA 2QPTA 3L43A 1LH0A 2R9VA 1DBIA 3AY3A 5I7EA 2REXB 2WINI 2Z0MA 2FPIB 4HGPA 1RACA 4JBXA 4PZZA 4QDZA 1PUIA 5AM1A 2Z56A 3K4HA 4NCNA 4PLFA 3LQRA 4XUDA 1VPLA 4U39A 2WE7A 2I2XB 2ZR9A 2B61A 4FYPA 3NS7A 1OTXA 4Q4CA 5JDIC 3L7KA 2CXRA 4O25A 1LCIA 4Y6LA 2C9BA 2XUAA 3KXDA 3H86A 2WWFA 3TLAA 1RXVA 3QHQA 3HZRA 3I6MA 4BNLA 3S2FA 3OP4A 1NR7A 4X62B 5IAJA 2O8DA 4WY8A 2R44A 3PGA1 1W35A 2WU4A 4PGHA 4ZCTA 3VYTB 5J4HA 1XTIA 4YN3A 5BR1A 2FXIA 2L69A 3FOEC 5EJAA 3ZIDA 1OI4A 1TW3A 7REQB 2ZQYA 4EY5A 3ICWA 4F2DA 1TM3E 4F4CA 5FUWA 4KO4S 1Q19A 4CQMA 4Z4FA 5JI3E 3W90A 4P80A 2QN6A 3LNTA 4DA8A 1HEUA 1TVCA 1A77A 1X7ZB 4DXDA 1U7XA 2NACA 1Z5OA 1XZJA 3Q3VA 2HXYA 1V5WA 1Y5NA 3UXMA 3ESDA 4FMBB 4LGYA 4QDJA 2HT1A 5JCZA 2I4IA 3HDYA 3D1LA 8ABPA 5H0IA 2WIAA 5JDCA 5K05A 1CRLA 4BFLA 2HPHA 5CB6A 3VYVA 4LVCA 4DY6A 5AI0A 2CFRA 3ZD9A 4TOIA 4ZGBA 1P2TA 2C58A 3M5CA 3VKFA 4OTZA 3M9WA 1IONA 5HKBA 1MNQA 1EWRA 1X7GA 1GZUA 4KQCA 3GFBA 4I8IA 5GOTA 4ISCA 4CT5A 1DAEA 4XYEA 3HH8A 3DZBA 3JD1A 3BXEA 1LV7A 3RH0A 1LBEA 4H3KB 1GU1A 3QPWA 4DTIA 5EMHA 4AJHA 3AR3A 1AGXA 2MMCA 3VPCA 3QU2A 1RLMA 3TOSA 3P71T 2X6TA 8MHTA 2I2BA 4KQJA 5CVVA 1O87A 3EIXA 1YS1X 4Q4JB 5CYFA 1OT5A 1OVMA 4BAZA 1O94A 1JHOA 1WKBA 3AIOA 1E3EA 4L2IB 2VDPB 4DUZB 1PNOA 2TMYA 1JLKA 1EGMB 4CIWA 1V26A 4ITVA 2J3QA 4AAYA 1ZGZA 1THMA 4UQOA 3C3AA 5A4IS 2ATIA 2IE0A 1G3MA 3URKA 2NVOA 5KYYA 3OZGA 2II6A 3MCZA 3IAS6 5HFNA 2YZNA 1L9KA 4RY0A 3V7YA 4JI8B 4HNUA 1ID1A 2AHRA 4RVHA 3IULA 1DCTA 5IUKC 1AHIA 3D4PA 3T7RA 3DZCA 1RLJA 4EO4A 4U2CA 3VU1A 1SCKA 2C54A 1NPDA 1CJSA 1DO0A 1Y1QA 3AR6A 3CZRA 3E3MA 3G9UA 1O7JA 5JWOA 1L5WA 5IZ4A 2CLEB 2IPMA 3L6BA 2ZS7A 3TTUA 2HWWA 3E1KA 1KVRA 2UYHA 3CURA 4ZI5A 1M6VA 2IPAB 4H17A 1LSUA 3FNHA 4ITRC 4JBLA 4K6CA 2FP4B 4N0QA 3OZUA 5T6MA 3RS3A 1SUEA 1PJLA 3GAZA 4OP2A 4KDFA 4X0EA 4C4YA 4XARA 1E3WB 1TF2A 2HIMA 3AIIA 1I1QB 3O47A 1EQ2A 3WAKA 3NDRA 4OMDA 3IP8A 4IY1A 5D00A 2LTAA 4HN4B 5DN9A 5DWDA 4H7HA 3TRHA 3BSSA 4CMJA 5A3JA 5IABA 4W9NC 1HE2A 3L8HA 2O8NA 4B9EA 4ZYXA 3ROZA 3SICE 2NZWA 4HYTA 3E3NA 3PTLA 1QIIA 3F9CA 1HNXB 5HZMA 1SBZA 1YRBA 4DIUA 2A5DA 3CONA 3F8WA 1YE8A 2HWYA 3OCJA 2DM6A 2M98A 4FGWA 4PRYA 5ERYA 3W6ZA 2JHGA 4BUCA 1GZ7A 2AC7A 1E1RD 1O97C 1Y9JA 2E1PA 2XMRA 3C6YA 3ELUA 2ERYA 1IHDA 2PBFA 3DTNA 1EDBA 1ZLYA 4OI1A 4E4YA 3N2GA 4AKEA 1ISIA 4ZO6A 3K6SB 2GYUA 4JJ6A 5JBIA 4B09A 4PLYA 5JMWA 5FI5A 4NZMA 5CCEA 1NOJA 821PA 4RETA 2BSXA 4MB0A 1WXGA 1IVYA 2HQOA 3LP5A 4GKVA 5E6SB 3PICA 4BE9A 4B2YA 4OAOA 2DT8A 2JI8A 3CPHA 4I3GA 5A5GA 2MR5A 3Q3EA 1N5OX 1XGKA 3DF7A 4FEYA 3T7TA 1Y6QA 3ZE1B 5IJZA 1M34A 2IP2A 3AO0B 1XLTA 3JQQA 2IV2X 3TBKA 3UHPA 4DT1B 1AG9A 1M1XB 1NMXA 3R5TA 2PQ0A 2COKA 2OORC 2IDMA 1YVEI 1X8LA 2ZBGA 2BM8A 4MCJA 3EWAA 5ESDA 2QU7A 3KE9A 4AP5A 1KSFX 3DWFA 1P2FA 1B93A 2OZKA 2ZZKA 4D9IA 3NIGB 4ZHSA 4L50A 3FY4A 3FNIA 4YBZA 5JLJA 3PVSA 4PXYA 3GUVA 2NSDA 3DF9A 1XHEA 4BNIA 1CYDA 3V4VB 4CM4B 1KSJA 2IYVA 4HVTA 1IUKA 2A9FA 4EHNA 4N8EA 2VPTA 3E61A 3C74A 4ARIA 4Z99A 1VLVA 2QN9A 1LBSA 2ASVA 3L7IA 3KKLA 1AGRA 4JJ4A 5DCUA 3SDSA 3ZBTA 4DMFA 2WP8J 2JRLA 4B3CA 1KI8A 2I1WA 3AI1A 5I01A 2C7BA 1Q84A 4Q37A 4IKOA 5E2AA 3T9BA 1EI9A 4Q4AA 1ACJA 2AG1A 4HFRA 1UAGA 4ZP1A 3IJ5A 4CVNA 5A1TA 4AO8A 2IH4A 4ZHQF 4R31A 3IPCA 2R87A 2I2FA 1M1UA 1W4BA 2WKWA 4TLDA 3T3GA 1C8LA 1JR2A 4QZVA 4GUDA 2V7UA 4E15A 1JHXA 3ZDYB 2PQ2A 4UE2A 3S2ZA 1GVHA 3W9BA 3M6AA 2AKAB 1NVEA 2GERA 3EVCA 4JLBA 4PS0A 3T0FA 3QF4B 4YALA 4BTLA 1XPOA 4MWTA 4RY9A 2DBRA 2HU8A 2A14A 4O4JF 3RVDA 2Q3BA 4W6QA 5A7HA 2UYGA 1UKVY 2ZRFA 4RFSA 3MM4A 2XQGA 5K99A 4YAIA 1P8AA 1UPXA 3FPBA 4PR3A 4UASA 1WBDA 2J6BA 4Y6QA 3DLTA 2XAUA 1QC5A 1T8RA 3G1WA 5CFZA 5K7SA 5MFZA 4OHYA 1SUFA 2DVMA 2AI3A 2AJTA 2PH5A 3PHCA 4QOIA 4WDRA 1E9AA 3ZWXA 2R6FA 1RKUA 4BKMA 2FFQA 3A3YA 4G0WA 4GL4A 1U0JA 3NX4A 3AOGA 3IUEA 4AJ4A 1ULBA 1XEXA 4JVMA 1SURA 3G2QA 4S3MA 4C89A 3CN7A 4OHBA 4HB0A 2NSHA 2WDZA 1JGTA 4I14A 3M5DA 5TQ2B 3SS9X 4XQCA 4I3HA 3RRNA 4ZMRA 2IHUA 1GXSA 1D0VA 2H7VA 3H4IA 5EHGA 4CTMA 1UANA 4E5YA 5K0GA 1VG0B 4UC0A 5AQEA 5L4NA 1JQKA 3SYRA 1L5FA 2QNBA 3Q85A 4R9RA 4MVJF 1HQKA 2PFSA 5BWCA 1EM8B 1T3GA 4BVBA 1IXZA 1AX9A 3KWJA 1ZDMA 4MMXB 3U4HA 1CR0A 3HUUA 4QYIB 4BCCA 4OQYA 5CD1A 3OT1B 4DOMA 4AI6A 2NYVA 2V9ZA 3BKWA 2ZTMA 3MQ4A 4Q1AA 3LPAA 1CEEA 1F3LA 4IIJA 1RIIA 2BR3A 3RVOA 4GI2A 3TAUA 1V11B 4D4IA 3N39C 3O8DA 4G1FA 2Q7DA 5HUQA 3N5KA 4LX8A 4CJXA 4PINA 1MJFA 4I4IA 1Y4ZA 2OB2A 4QOHA 1RTTA 1OB2A 3NMUF 4XQ0A 2P9ZA 2BAGA 3KOUA 3PL5A 3RC2A 2KPOA 2D74A 4CW7A 1FP2A 1GZHB 3P32A 3DMNA 4FT4A 2OWEA 5K0JA 4P53A 1WTCA 3K9LA 4DJTA 1U7WA 5EGSA 5J2UA 3G8DA 1IZZA 1ZGHA 2ZJ5A 3B1VA 3O9MA 4HQOA 4MA0A 5C31A 2F8LA 3QOYA 3UWPA 2ODNA 4P4GA 2NUPA 2D5AA 1CJTC 3L4BA 2LW7A 4BVLA 1Z56C 2IZ6A 2JFGA 4UMDA 3MAJA 5F2EA 3ZY4A 1PGOA 2QTVA 2RGEA 3PI6A 1AA9A 1L1RA 1KDPA 3MWEA 4HWGA 1C7QA 5TNXA 1ZJWA 2HK8A 3NC0C 1V5FA 1KEVA 5JRDS 4DG5A 2AFVA 2QR3A 3P4XA 1FRZA 3EIWA 2I4LA 3K8YA 5ALMA 3F9RA 4TXMA 2CSUA 2OP0A 3WADA 1KYTA 1C3XA 3S2SA 3V8VA 2JW5A 4BNYA 3KQHA 1M54A 1CUVA 3E18A 5GV7A 4O33A 3MINB 1IIRA 3OLCX 3A37A 3FOBA 2GCEA 3FPAA 5B1DA 2I6TA 2QZSA 3QENA 3NQ41 4QVGA 2PTHA 2CFTA 1J0EA 4HEQA 4OM8A 3WB2A 3NWPA 1YZLA 1SXGA 3U4CA 5I4CA 1YOVB 1BCRA 5IUJC 4ZC1A 2IHJA 3NAMA 2YWXA 1UP4A 1A9SA 3RS2A 3DZ8A 1DX9A 1W1IA 2PLAA 2YWDA 1P7VA 2W2KB 5EKSA 2WTUA 1GV0A 1YS9A 1PBTA 1ZLXA 2Y2VA 4CLHA 2LPMA 4YXFA 2HGSA 1KYZA 2JJ8A 3DA8A 3FDIA 5DLQC 3BXHA 3DD5A 4BVAA 2PKRA 3NGLA 1J22A 2F3QA 2XMZA 1CDEA 2OB1A 3LQKA 4JT2A 3OJFA 5G0TA 3NAZA 6YASA 2VLIA 1IU9A 2W37A 4NBUA 1D2MA 1ZJYA 4Y1EA 4YT5A 5FADA 5JROA 5DVZA 2BFCA 5E0KB 4CLOB 5B4TA 5AO9A 2INGX 3ISVA 4N3AA 2O23A 2O5CA 4G63A 3BL8A 3IIJA 1MXFA 1JNXX 2QD5A 1QAMA 2C4NA 2DBYA 3A6GA 3BK2A 3C3KA 3LCRA 1SKYB 4FFPA 4TM7A 4ZALA 3WKAA 4AZ0A 4LXHA 4TWBA 3PD1A 4DDTA 3H3XA 4UUBA 1CTQA 1UBHS 1GTL1 2PO7A 4IIHA 4J0EA 4A4DA 2XQFA 3TS1A 5KSYA 2CL6X 1KDYA 4E3ZA 1WPRA 1VSBA 4EY4A 4RMIA 5JJIA 2AE2A 4B4DA 5DF1A 2PGNA 4N40A 3VFDA 5JD6A 4BBPA 2PL1A 2I9KA 2PR7A 2PMCA 3CLRC 4RVSA 1JIUA 1FEZA 1R0CA 4GPEA 1BQ3A 3JWPA 3T06B 1DTEA 1WJGA 4INPA 1Z4PX 1VL5A 1T4GA 2PV7A 4IICA 4J03A 3RD5A 1NJ1A 2V58A 1E6KA 3P52A 2DWOA 2JKVA 2WWVD 1EX7A 5A4MS 2PS0A 4YJFB 2YZGA 3WLFA 5KJFA 5EIXA 1ESDA 2Z1DA 5A3QA 2X14A 3ZY6A 2IZ0A 1UOEA 2R5NA 3RYIA 5BWOA 3BRSA 4LMAA 4QT0A 2G70A 2G67A 3PDWA 3WDSA 3BSWA 4K81B 2JH9A 1A8IA 4UDOA 2ASEA 1L3CA 3NH9A 5G0UA 4K46A 3LF1A 4PM4A 3V2HA 4NX2A 9LDTA 3THRA 4J0KA 2FI1A 2V1XA 4YQFA 3I61A 3VU0A 3O5AA 2HFJA 4KGVA 1GN8A 2I67A 2O0HA 3F5FA 1WABA 2PZKA 1G2OA 5JHHB 3UUFA 1L5NA 5DBHX 2VK1A 2Z9BA 1ZCBA 4HQKA 2FOLA 4XM2A 3HRHA 4FCWA 2JGLA 3TQCA 2VF2A 4FHFA 3DE2X 3F6EX 3KIPA 3QRWA 5EWMA 3VR6H 3R9XB 1U7OA 1XG5A 2ORVA 5BOSB 5DT9A 2LCIA 3DFUA 3QX9A 4UPVA 1EFAA 1E2GA 1OLUB 5B57C 2ZIWB 2MINB 1JE0A 1Y34E 1DC5A 2GLTA 2WQZA 4GR4A 3R8CA 4MW1A 5ICMA 3WB1A 1JXOA 2FWRA 2PLFA 3CZMA 1TZJA 4KPUA 1N5LA 1XTRA 4IJQA 1CLEA 2CW5A 2ANBA 3CSSA 3H2JA 4XQ9A 1IXKA 2V6JA 1U3CA 4YO8A 4EY3A 1RKQA 4OGLA 4ZXPA 3SJ7A 2F1JA 4B4KA 2PFGA 2OO5C 4J7UA 2PX6A 3NB0A 5CT9A 1O96B 2OCGA 3SF8B 3F8TA 1Z0UA 1OIVA 2N9UA 3KOOA 4ZYLA 1N1MA 4XJTA 4Z9YA 2PT5A 2I66A 3UICA 3T61A 1C9KA 3ZDFA 1GL7A 3KEGA 5KNDH 3K73O 1A5ZA 3B13B 4NMHA 1SQ6A 1NPTO 3CVXA 5F76A 1QAOA 3VYSB 4G5RA 4Q9JA 1QQ5A 1DTWB 5AHRA 1UXIA 5JARA 3NEJA 1X9GA 4R81A 2XAAA 3CH4B 3DR5A 5LBIA 3ZE2B 1EB8A 2WT8A 3H4VA 3J81k 2GS9A 3V48A 1J07A 2OD7A 2OZLA 4NZ9A 1ELOA 3IQIX 2J33A 4C43A 4YJHA 5J5AA 5LSAA 2TS1A 4AZ3A 2Z8ZA 1A8UA 1Y6ZA 5F2KA 1VJGA 5TGZA 4ZV9A 5EAIA 3O3MB 4KR6A 3S7ZA 1GSOA 3TX2A 3ABZA 1CNFA 1C1DB 1HO3A 4X94A 4O2RA 1P81A 1EHIA 4QBIA 4IXWA 3ONEA 1R6BX 1ZBDA 4UJ3A 3VH3A 5C8YF 2J8ZA 3NHRA 1OXUA 3C7CB 4UMVA 5KJEA 3PGVA 2VT7A 2ZBEA 4R01A 4B32A 4Q7MB 3LY9A 4YRZA 2CDAA 3AR4A 1NVVR 2ONZA 3WE7A 4DR6B 4C0SA 3L18A 5FL7A 4X6XA 4DR7B 4F4IA 1W47A 2QRMA 1GZDA 2QDKA 1ENPA 4NARA 1DQSA 2PU7A 5BN5B 2I71A 3REQA 1Y7PA 2QZZA 1SQSA 2Y1DA 4J76A 3PC8C 4Q48A 1SG0A 1RC8A 4PHTA 1GU0A 3IBGA 2FSFA 4QDTA 4PZ9A 3T1YB 4TL6A 3SY8A 1J0DA 5I9IA 5CG2A 4G0ZA 4QXMA 2ISQA 4URUR 4IYRA 3UH0A 1OB5A 4JLAA 4OXKA 1XF1A 4S1WA 2GSWA 1PL7A 2VK8A 4KMOA 1NLFA 3IJRA 2Q1YA 2ZOSA 3P0FA 3SSNA 4LF7B 4UTZA 1DAKA 1TC2A 2R6CA 3IQXA 1N3LA 1GFWA 3GZNB 4ITUA 5C1OA 3H9CA 5LKRA 4K9MA 2PUJA 2ZJ2A 4KGDA 3CCFA 3EPJA 2FFAA 4W6ZA 4R83A 4XYMA 2QLNA 1TEVA 5EYPA 3RSHA 3I52A 4V1CA 5I7VA 3CNHA 4B34A 4X97A 1FU8A 4UFPA 1NYTA 4TV9F 1EXMA 2WWWA 1A9YA 3FX2A 3HXMA 3NTOA 2BFDA 4I5EA 3ZW7A 5LMCA 2HJ9A 2UVPA 5EOVA 5HHTA 4C08A 2NU6B 4EUSA 4M2LA 1XMPA 2DHRA 3COPA 3AF6A 1U04A 1U0RA 1G4AE 2Q28A 3NHYA 1UQRA 4ZQFA 3W3ZB 4EI9A 5I8WA 3VTFA 2F62A 5TQVA 1YRLA 1L4HA 4AWAA 4LCJA 2VJBA 4GR9A 1A82A 1BE6A 1X8KA 5DNEA 1CX9B 4M9UA 3VVLA 3TI7A 2FLVA 1MGPA 1JBEA 2BFPA 2FMKA 2HNAA 2JIBA 2WM8A 3M1LA 3T5MA 4TL7A 3W78A 4BN4A 3BHMA 2XCRB 1IWOA 1I51A 3P9PA 2AF3C 5CFMA 2J1LA 4DCOA 1JJBA 2Q62A 3H75A 4GUAA 5SY6A 1EH5A 1I32A 3IHLA 3VU8A 2H5JA 3FNGA 1T0BA 2RKWA 3QBEA 1QIJA 1Y42X 2V0NA 2YJ4A 3R09A 4MVXA 5DASA 5CFPA 4RSMA 1JHUA 1XZEA 3CMMA 2VUUA 1HDZA 2ZCVA 3DMYA 3E0XA 4GT1A 4HS9A 5DI3A 3ZH9B 1NNEA 3HR7A 4FOPA 4ZGGA 3LHIA 5HKOA 1KE1A 4EL5A 4EA7A 3PUYA 3OCVA 2XTZA 1XMOB 2IP1A 1JMVA 1X1AA 3I6ZA 2CXSA 3I9MA 3MGGA 3OT4A 2G8NA 3PFBA 4ND7A 1LVGA 4ILKA 4NMLA 2ZVJA 4UBKA 4QBTA 4FWIB 1VPTA 1GNVA 2HIGA 1W4LA 2GNOA 2ZUVA 4EM6A 3W2IA 4EFLA 1HLGA 2XNJA 5CEFA 1KDTA 4A1FA 4LJ5A 2VYCA 1Y63A 1B00A 2Y93A 2EL7A 3GCZA 4U3JA 3I9JA 4URXR 2HBYA 1FYDA 3DBHB 5DYYA 1NJGA 5KOHA 2DP4E 1CUYA 3DPIA 4QBKA 3H11A 3CFYA 2OY0A 4DR4B 2QD4A 1SHTX 3DB1A 3QPVA 2C9CA 5JSYA 4Z7NB 1F20A 3GVIA 2L2QA 3VGPA 4B80A 1BW9A 1C2TA 5CAEA 1ZK4A 2PA3A 5EPUA 3HA2A 4GWGA 1KNQA 2Q6OA 2HV9A 3H2KA 3GCWA 3M6WA 4Q9IA 4FNMA 4BX9A 2FCRA 1D2CA 2LRHA 3RAFC 1KZ9A 1Z2DA 2NO0A 3JQFA 4M9CA 1T2AA 2EKQA 1FYWA 5BYJA 3ZEAA 3BGWA 2CDRA 3CEAA 4JDPA 4BRWA 4D81A 3L93A 3JS5A 3NNNA 1S5PA 3P2EA 1A7AA 1O97D 1UC5B 2FPPB 4LQLA 1D09A 1NM5A 1V16A 1OASA 3IUMA 1R0YA 4GQAA 1XMQB 1KMMA 4HEHA 2O2DA 3CG4A 2BGUA 2D3TA 3BCRA 3DMHA 4OUDB 4DQLA 4JP1A 2QSYA 4FE7A 3W77A 4JKIA 4RLSA 1Z06A 3EQ8A 1N7IA 1TNDA 5AXDA 4CEHB 2MSNA 2JAUA 4CLEA 4FFSA 2J3HA 1ZR4A 3EXEA 3PWSA 3AKCA 1N5RA 2VRCA 3FLEA 3N8KA 3G17A 1AN0A 1E1CA 2BW0A 4X8LA 4Z7QB 1RWPA 2VBGA 4D46A 5GJVC 2QTHA 4U2GA 1JF8A 1F2TB 3SC2B 5AOBA 1L4FA 1XXHE 4KB5A 4KK4A 1Z47A 3TSCA 1ZW1A 1XEWX 4M83A 3UWSA 3O4GA 2WKQA 4W82A 5EWLA 1TIBA 2R6DA 2QL5A 4NDZA 1T0UA 4NC9A 5BWBA 3HS3A 3KQPA 2BGTA 4HG2A 5DBIA 3TLGB 2QVGA 5BVHB 1NE2A 1KH2A 4EQ6A 5KDOA 3A4IA 1PR3A 2AYXA 4Q1FA 4XX0A 4YJ2A 1P80A 5FLYA 3M6IA 3IALA 4O3MA 4MWGA 1D2EA 4U6QA 4Q3KA 5IN5A 3ZVLA 1QFYA 3CZ5A 3K6KA 3PQ6A 1ZH0A 3Q5EA 4ND4A 5CCBA 1SELA 1M8JA 3VZSA 4TT3D 4P3YA 3IMFA 5BSRA 2J5BA 5G4KB 4JR1A 5CX1B 2IYYA 3DPSA 2JGDA 1IOVA 3DE0X 4G0PA 1XTZA 1FTYA 3ND8A 2DFVA 4HDKA 4YYZA 2RSLA 2ZUBA 2MMGA 3E23A 5AVJA 5I5GA 3MXOA 1NSYA 1XR3A 1T0HB 1FNNA 2EQ5A 4W8HA 2X2EA 3WGQA 1W9HA 2GRUA 2V74B 3GBVA 4LVNA 1PYGA 3WGZA 3BL6A 4GECA 3WRWA 2HQBA 2X19A 2IIPA 3D64A 2H5EA 4IIUA 4OFBA 4P0TA 4Q05A 5L9AA 1Y7HA 4JVLA 4RA9A 5SICE 1DX4A 4BNJA 2QLLA 5BN1A 1PUXA 1KYVA 4WI1A 2E5WA 3IMCA 4I5IA 1JXQA 4CLXA 5LD2B 5JG7A 2IV7A 5LWHA 3H9JA 2EV9A 4YH1A 3UT5A 3P9YA 3GLRA 5AJXA 5AP9A 1FFEA 3OFKA 1L1EA 2YZ2A 1P61B 3QNUA 5AI9A 1U5BB 2P27A 1SGWA 4UEJA 2PN1A 3IP7A 4N49A 4RMJA 5BXYA 4PG7A 2VDLB 4Q16A 4N41A 3P9SA 5TVGA 3UHJA 2JIQA 1RZRA 3FHLA 3VAAA 2N3ZA 1L9XA 2B1GA 2B6HA 3LKBA 5DNCA 1ZJZA 5U1PA 5CMLA 1E2PA 1UMCB 2Q2VA 3QVGA 3K92A 4FYVA 4JEUA 3EWIA 1GPJA 3PDIA 1VBKA 4Q0MA 5EWJA 3U7HB 4U6NA 1LFAA 3V2GA 3R3UA 2GASA 2WIFA 2ZM6B 4PYNA 1JJAA 3SM9A 3PKZA 3LUCA 1FDTA 2W6PA 1NQVA 3CUEF 1GO2A 3QWIA 4GLOA 2H63A 4HDRB 4FDUA 2YUIA 3EXIB 3AHHA 3DGEC 4YROA 1XZFA 5TC4A 4NQRA 4Q1EA 1T9CA 1YFZA 1YMVA 2KM1A 3B8HA 1K7CA 4O4LF 4KWCA 1W87A 1UK6A 2VCHA 1INLA 1RS0A 3BB3A 3T5GA 1PFWA 2BMDA 1UT8A 2BUAA 1NTRA 2H6EA 3PJGA 5FT9A 4EI7A 1GM5A 5JPIA 1Q2XA 3FCUB 3W2GA 2Z6QA 1UXOA 4LTDA 4JQZA 3N2KA 2DZDA 1CUFA 3OZIA 1NBAA 2CVOA 2I03A 1GSIA 3KEMA 1C7EA 3MG9A 1JYSA 1LRKA 4X8HA 2V4UA 4DDHA 4DFDA 5JXWA 5KNCH 1QKKA 2NGRA 4PHHA 4EBFA 4GX0A 4JA2A 3H6GA 1T6ZA 3ZWYA 5I4KA 3ESYA 1DFIA 2EDAA 1YRAA 2SCUB 3GRZA 3A4MA 4GP6A 2Q07A 4LWOA 1XZQA 2MSLA 4ALMA 3TECE 3JD2A 2F43A 1M72A 4OX9B 4QVKA 3AV0B 2HU2A 2LV8A 3UO8B 4DLAA 1LLFA 4DSNA 2GILA 1I4WA 3O92A 3P0JA 1T34A 3GEGA 3GROA 3IKLA 1C0PA 1QIEA 3SC6A 1HT0A 4Z3OA 2CL7X 1NW4A 3ZVKA 3H05A 1WKVA 3ICOA 1PR1A 4L5CA 1G41A 1BJKA 1Q15A 4B6OA 3O8BA 4CKEA 1G4HA 5E7MA 2QQ5A 5SV2A 3WB9A 3U1VA 1XZHA 2V54A 1ESMA 1I6LA 4R7ZA 4L3OA 2WR8A 1YQ9A 4BX3A 1P2VA 1YJQA 1Z22A 3B1WA 4QPPA 3VZDA 2JFVA 4Z4HA 4K6FA 2C9MA 1GNSA 4PWYA 5M04A 2IEBA 4L0DA 3VXKA 1DEKA 2AWNA 1PNQA 4P3XA 3QEJA 3TZHA 3QFRA 5FA5A 4BFSA 2GX6A 1SO8A 1TMYA 1IE3A 2MSWA 4J0GA 1KDZA 2RHJA 5BSUA 3U39A 3HWRA 4XAQA 4YJKA 3AI7A 2IXAA 3G5MA 4H4EA 1TU0A 4KN6A 1TK3A 2O1WA 4HLQB 4HNRA 6REQA 3UJ7A 2H4FA 4WA7A