The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
42
|
sequence length |
200
|
structure length |
197
|
Chain Sequence |
FETVPVWRRQPVRVLSLFEDIKKELTSLGFLESGSDPGQLKHVVDVTDTVRKDVEEWGPFDLVYGATPPLGHTCDRPPSWYLFQFHRLLQYARPKPGSPRPFFWMFVDNLVLNKEDLDVASRFLEMEPVTIPDVHGGSLQNAVRVWSNIPAIRSRHWALVSEEELSLLAQNKQSSAKWPTKLVKNCFLPLREYFKYF
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural insight into autoinhibition and histone H3-induced activation of DNMT3A
pubmed doi rcsb |
molecule tags |
Transferase/transferase regulator
|
source organism |
Homo sapiens
|
molecule keywords |
DNA (cytosine-5)-methyltransferase 3A
|
total genus |
42
|
structure length |
197
|
sequence length |
200
|
ec nomenclature | |
pdb deposition date | 2014-07-31 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Vaccinia Virus protein VP39 |