2HWYA

Structure of pin domain of human smg5.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
158
structure length
116
Chain Sequence
PYLVPDTQALCHHLPVIRQLATSGRFIVIIPRTVIDGLDLLKEHPGARDGIRYLEAEFKKGNRYIRCQLYKILDSCKQLTLAQLPLDNPSVLSGALQAAAHASVDIKNVLDFYKQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein SMG5
publication title Structures of the PIN domains of SMG6 and SMG5 reveal a nuclease within the mRNA surveillance complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 32
structure length 116
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13638 PIN_4 PIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold 5'-nuclease 2hwyA00
3ZD8A 3QEBZ 3IX7A 3H7IA 5L6LB 3QEAZ 2IZOA 3DBOB 3H8JA 1BGXT 4MJ7A 1O4WA 1YE5A 1XO1A 1B43A 5ECWA 5H4GA 5HMLA 1V8PA 1TAQA 3H87A 1RXVA 3ZD9A 2IHNA 3ORYA 5L6MB 1UT8A 2QIPA 2LCQA 5SV2A 3QE9Y 3H8WA 2H1OA 1TAUA 3ZDCA 1A76A 3H8SA 5K8JB 3Q8MA 4XGRA 1V8OA 4XGQA 1MC8A 5HNKA 5ECYA 3I8OA 1EXNA 2MDTA 3ZDBA 1UT5A 1V96A 3TNDA 3Q8KA 2BSQA 4WA8A 5FV7A 1TFRA 1Y82A 2DOKA 1W8IA 5HMMA 2H1CA 3Q8LA 1A77A 2WP8J 1RXWA 3ZDAA 5H4HA 2HWWA 4CHGA 5HP4A 2HWYA 5ECDA 2HWXA 2FE1A 5ED0A 3ZDEA 3ZVKA 3ZDDA 1UL1X
chains in the Genus database with same CATH superfamily
2VNHA 2J33A 3PBKA 3DD5A 3O4FA 4HC4A 2EEPA 4MP6A 4V0MA 3UN1A 2GK7A 2Q9CA 3HDYA 3UKJA 1JEJA 3SMVA 1K8YB 1XWIA 2AG1A 2KWIA 4QQRA 3SLRA 4ZI2A 4Y9DA 3IAFA 4OLHA 5LMZA 2W42A 1E1QA 221PA 1GQYA 3KZOA 2XB8A 1HQCA 1BW9A 1E8NA 2Y3IA 4DCTA 1J8QA 3EAFA 1K7XB 1VJ1A 4FZ3A 5FTKA 3U5TA 1PEDA 3TEJA 1JB9A 2ZUBA 1E3QA 3WO1A 3KXIA 4OXKA 4XYLA 1TU3A 2B5VA 3H9JA 4J7CA 2YYSA 4D8TA 5IVKA 4GMHA 3EF3A 3ESXA 1YVPA 3PFHA 5ADVA 1C0IA 1U8XX 3Q72A 1RVDA 2XGSA 4DA0A 1O4WA 2QI9F 5H5JA 3B8EA 3VC7A 2CC2A 3KVOA 3D6TB 1NRIA 3Q3HA 3KE9A 3VQTA 1SCBA 1T36A 4AP9A 5G40A 2XDQB 1YZUA 2A84A 5B5SA 1QLHA 3HYSA 3BEDA 2BHRA 1QE3A 3IP7A 4GH5A 5SYAA 1MAVA 1S2OA 2OV2A 2C4HA 3DB1A 3DNFA 4QSMA 3ZE1B 2W6NA 3DLCA 3HDGA 3ACCA 2F7SA 4Q93A 4U02A 3RT1A 3IKVA 1JXQA 5DCWA 2GCGA 1ISGA 2OT3B 3H4VA 1G59A 3Q12A 1C0PA 4KVGA 4OAPA 1VI5A 5MGNA 4YFVA 4ZHQF 2PR7A 5C81A 3CVVA 2ZRCA 5CYFA 5BYAA 4MS1B 5IANA 1QE0A 3LHSA 2XKKA 1RXSA 4AN0A 2B8NA 4IV8A 3IQXA 1A76A 2AIRA 5EHIA 1NN5A 1M7HA 2JCVA 4YCBA 3G5TA 4ZRNA 1ORTA 4H1HA 4P0TA 3W9UA 3QU5A 1ORDA 3R3ZA 4BYGA 2BTEA 1EM6A 3BBPA 4IIJB 5CVEA 1U2SA 1LK0A 3R6WA 1ULHA 3L9XA 2XUPA 4WNCA 4DOMA 1V1RA 4LWPA 5JQGB 3LTNC 2AC2A 3S1AB 2IZ5A 3HYLA 4EFKA 1ZQ9A 2PUWA 3VUEA 3GCWA 2X3UA 4F7WA 2H9IA 3V8PA 1IY1A 3QYFA 4LRTB 4YDHB 4J9UE 1ZNWA 4MI6A 3IRVA 4PAWA 5KREA 1KOGA 1EFUA 3ZWPA 4OOFA 5ICGA 5IKPA 2XMZA 4AO7A 1DRJA 2HXSA 3K0KA 3FSRA 3GLUA 4Z54A 2CN1A 3GEGA 5G3YA 4DV6B 2HA3A 1RXIA 2XJ4A 3KAPA 5EJ4A 2C54A 3S29A 1JWAB 3B9RA 3KQWA 1NVXQ 2D0DA 2HD4A 3R8XA 1RR6A 5JBQA 3NIFB 3NVDA 2V8BA 1XD8A 3S1LA 1LZLA 4BX9A 3CW2A 3IP5A 3EXHC 2AN9A 4C5BA 4I08A 4PYNA 3HY3A 3PPXA 4Y98A 1IQRA 1VJRA 3DUFB 5KQLA 2XZDA 4C0QC 4EG6A 1G8GA 1GPUA 1X1CA 4A10A 3QPDA 3GMIA 3VX4A 3VMFA 1C3VA 4YACA 1LSSA 4BYMA 1FQKA 1MGPA 4I3FA 4NONA 2HWYA 1F4PA 4PXYA 4EJMA 4F4DA 3BEOA 2HDNB 3QHAA 2VSOA 4MPTA 3RW9A 3ZZ1A 5BSRA 3HI6A 1QNFA 3NRJA 5KO2A 5KVCA 1OX4A 2YWBA 5CB4F 4YMWA 1Z25A 1T6XA 4GOXA 5JCOA 1AZTA 3T1OA 2OV4A 3KOOA 1CETA 3T61A 5IUNC 1QVRA 3LV8A 4F9GA 2QRLA 4PZUA 3VR5A 1CYDA 2AXEA 3FI0A 1U3TA 5ICMA 3HL4A 4IH9A 3F6EX 5A5EA 4R9NA 2O48X 4DWOA 3DXYA 4S0XA 5KCMA 1M75A 3QMPA 3UFXB 2A58A 4KDCA 2RAFA 2I76A 1VJGA 5L40A 2OCYC 1CJUC 2CVPA 1BDHA 3GPCA 2V45A 3ABIA 2NU9A 3DR5A 2O0HA 2D74A 4F45A 5EQDA 1BMFD 3IOYA 3WLIA 1J56A 1GPH1 1PL6A 2O7NA 3GEPA 4MYSA 4XPIA 1KEZA 2NUAB 2FMUA 2ZT7A 1ORIA 3ED1A 4I19A 3R9XB 3P32A 4UTZA 1HYBA 4FOPA 4E03A 2QF7A 4EUFA 3ANTA 3U4MA 4OX9B 1N1DA 4O4LF 1U3DA 1UPAA 4J6FA 4YHBA 1UPTA 1IEVA 4LE2A 2FKAA 4IR7A 1GAXA 2OE2A 4A6DA 2IS6A 1EUCA 3ZE9A 2TS1A 4ZI5A 3ZCUA 1A0OA 1DB3A 5HKLA 4YJ2A 3KJGA 4ZT7A 4OQPA 3KC2A 2NTNA 1QVAA 5EXDA 4BTLA 2ZJZA 3N2GB 2RGWA 1DTSA 1PRYA 1EK1A 4WKNA 4YMLA 1BFDA 1ECFA 1TRHA 1YSCA 3FPAA 3AUAA 5BNZA 2WPNA 5EQFA 5KDOA 4MB0A 4PXAA 2OR3A 1XMSA 3JTMA 4ROTA 721PA 3EARA 5L4NA 5ICSA 3KJHA 1F7UA 1H8HA 1MDBA 1ZRSA 1DKQA 1N6KA 1N5RA 2OKCA 1DS6A 4LZAA 2NUTA 4DXAA 1E5QA 1REQA 1W87A 3WTBA 5CLQA 3GAAA 2YN4A 3OJOA 4MXDA 5K3CA 3RYHA 3B1ZA 4BQEA 3DAHA 2PYDA 3N53A 5FDFA 2W2PA 1AK2A 4RSGA 1TMYA 4RIEA 3MWYW 1YR2A 2ZCJA 1P1IA 2FFAA 3ETJA 4B5KA 1QUEA 1KEWA 2UZIR 2DUJA 4EYOA 7AT1A 3ZHYA 1C9MA 4B7UA 1TMGE 1MZVA 2X5NA 2H4ZA 2PNFA 3FYUA 4DUGA 2XKJE 3DTVB 2AI3A 1X7YB 1D2MA 3AKYA 4H6XA 3VKVA 5FUYA 2B3DA 4ZVUA 2B2NA 2ETXA 3IMCA 2JI8A 3MOIA 3R0VA 1TTHA 4S3MA 4YRPA 1N32B 4M0CA 3GWGA 2C7PA 3EW9A 4DR7B 4DPLA 1PQPA 1PWYE 3D3WA 4FEAA 2C4KA 5B1DA 2Q0SA 3ZIAA 3LVQE 3V00A 4U2GA 3ZDYB 3JY6A 2PBLA 4HBZA 3OCWA 4QPCA 3TO5A 3U3KA 3AEXA 4GO1A 5FQNA 2QSJA 3E48A 3L2OB 2LTAA 4LQ4A 4RVGA 4U2CA 3OTOB 1JQDA 1T9CA 2ZU0C 3PJEA 1OWPA 4IWYA 1V9SA 5E4JA 4AWBA 2BV3A 2J7PA 1MHPA 3PUJA 1N7IA 3EEOA 1CUZA 4RZUA 1YIDA 4Z8XA 1YDWA 5E0OA 1YBAA 1SB9A 1W1UA 2QRQA 5KUTA 1E2EA 4AG6A 5CFQA 3TRKA 4ND7A 3P20A 2E2WA 1EGMB 2ERYA 2Y8EA 3D5EA 5D00A 4POOA 3IBYA 4QVGA 3OPNA 1MP0A 1XL0A 4FGLA 3IQGX 5FTLA 3HJCA 4OQFA 4BNDB 3HXTA 5BWBA 2FZCA 1ZO8A 3DXXA 4HNHA 3W9SA 2PRSA 4JC8A 5TVKA 4QOJA 3H4TA 4H3KB 2CK3D 4NS4A 4C88A 2FW9A 1NUPA 4IINA 4MWSA 3UFBA 2EKPA 3W6UA 4AYWA 1GDHA 1DP4A 4WI1A 3PIDA 4MVCA 1G60A 1XOIA 3F1LA 1PFGA 1EVEA 3GGDA 1MO3A 4FHDA 3O84A 3LX8A 5ESXA 3NOQA 4IVNA 3N86A 4TMXA 2GEBA 1SK9A 1P1CA 4TVSA 3K1ZA 5KX5A 4C3ZA 1YONA 5EMHA 4QGAA 3NM6B 2AR7A 4FN5A 3FIUA 4YRMA 3FUTA 4QTTB 5AKEA 5EG5A 1P1HA 1JJ7A 5HZKA 3TMYA 1AQ6A 2QMZA 3PI6A 4Q3NA 5DW0A 1UXJA 1MX5A 3KT0A 5KDDA 2HRZA 4Q9NA 1H6BA 3NYRA 4WKPA 1E3DA 5IJ9B 4W5TA 1KAOA 2CXTA 2PWAA 2I99A 1CDDA 3SC2A 2ZM6B 1ZPDA 1W1IA 2HQOA 2I2FA 4HXFB 4PYOA 2Y0PA 5TLSA 2O2CA 4DF3A 1G3UA 2OL4A 2QTGA 1EEXB 3JD1A 3VBCA 3H2KA 1KPGA 1HBJA 1XBTA 3H2GA 4G8CA 1A7UA 1NE7A 2IC5A 3LAWA 5H16A 5JZMA 1QAMA 2VK2A 2XQJA 4UBJA 1XI2A 4F5EA 1PWHA 1T6BY 3B6IA 1ZVJA 2ZWAA 1G63A 2D59A 3FTFA 4TWRA 2J4CA 1O94C 3V9AA 5HBRA 3P71T 1GEGA 1W5AA 4LCBA 4XYBA 4F60A 3VOTA 2IHTA 3REGA 4MB2A 2HM7A 4KMMA 3K6SB 5BW5A 2V7EA 5I7UA 1G20E 1Q20A 3ANNA 1OTHA 3EXHA 3AYXB 5HQTA 1Z07A 2VZ0A 1F3OA 2J9FA 3CE9A 4QD3A 4ISCA 2J67A 3U7FB 2WWGA 4JODA 1G3IA 2G5TA 3LCJA 3UXYA 5K8TA 1E99A 3GJXC 1PFWA 2C96A 4H4EA 2ESRA 1SN7A 2A9QA 1KI4A 2QM7A 3CQ9A 4UZFA 1OSNA 1MC8A 1U11A 4NBKA 2AQHA 4TLAA 1N77A 1RI5A 2PA0A 2VHUA 3B6ZA 3AHHA 3ELBA 4KSBA 3WA7A 4Y9TA 1NPDA 1S9HA 5F5LA 2MOKA 3PGA1 2RAPA 1ODSA 4O2BA 1PP4A 4L9RA 5DI9A 3TYXA 1PJZA 1NWCA 4P0QB 1C29B 5EXTA 2J5XA 2EJWA 4R05A 3AJDA 1DC6A 2C3YA 1II0A 5BV2P 4DV0B 1TDJA 2ZRLA 3A14A 3RJ9A 4XDZA 3JWPA 4YQYA 1XKQA 4DYVA 1PV4A 2OHGA 1KVQA 3T3DA 4G23A 3OFSA 1KMIY 2PSHA 4YUVA 4LHEA 5K8UA 1VIDA 3ZZ0A 2YXLA 3ZDAA 3AC0A 3OWHA 2OAEA 3NDIA 1M2KA 2BBTA 3UPTA 3L7OA 4OHVA 1L1EA 1VG0B 1HX7A 1UFOA 1WZCA 3D7KA 4I6GA 5C7OO 2J4DA 3TTXA 2P65A 4EJSC 5FOQA 2ZAYA 1JYFA 1GSHA 1VYTA 4BO3A 4WUTA 2P7IA 1T6NA 2YXBA 2RGUA 3DBHA 2C0QA 1Y3AA 2CFSA 3HQ4O 3IP1A 1N6OA 2PL3A 4QPNA 1K8ZB 5E4FA 3UMSA 3UT5B 5FWDA 2J5RA 4H3VA 4NOMA 2VR1A 4F12A 3VR6H 2FWRA 3B1JA 4OFZA 1USKA 4B3CA 3O8OA 3HJFA 2BM9A 1STOA 4PVDA 1FP6A 1WXIA 4ZOLA 5EJAA 2CCKA 4AG5A 4TT3A 1XZDA 1RQRA 4CN9A 3C45A 3KD2A 3QWAA 5TPZA 4X91A 3KZCA 5LYJF 1RABA 4JROA 3ITNA 3OCZA 4EB8A 1N1EA 4D96A 2QAGB 1UBUS 3FUVA 1JBKA 1I30A 2BBWA 4JEIA 2HJSA 2YBDA 1UP4A 3EDCA 3M5DA 4KQJA 4PU0A 2QX7A 4INAA 4WXMA 3PNKA 5FBHA 3BAFA 4EG0A 5A4AA 3FHJA 4BVGA 1N3BA 2IX9A 4BN0A 4RS3A 4JGBA 4U1RA 1E0AA 3E1GA 4EGJA 3CRMA 3GH3A 3GLGE 1LVGA 1XTPA 4MLDA 1SWWA 5BSKA 1P75A 1W4ZA 1XQXA 2EOAA 2X8AA 3O1JC 5M7EA 3CCFA 1TM3E 3U7HB 1RC8A 5A3RA 3GPDG 2VLIA 3LL4A 4FEEA 4FGJA 5DHUA 3JPYA 2F62A 3E7PA 4EHNA 4E30A 2NZVG 3L8FA 4CMKA 2DBZA 4PC7A 3KSAC 2UYYA 2I22A 2COEA 4K7JA 4G4SO 3ZPXA 1AKEA 3F90A 3MUNA 4UARA 3WNQA 3AR6A 3W8RA 2CXQA 3UT6A 3OPXA 1JG7A 3GZNA 2GA8A 3FSGD 3L1KA 1G6KA 1VKHA 3ZV3A 3VH1A 3KHKA 2AN3A 4PLGA 1Z2EA 3GL9A 5TGZA 5C1IA 1SEPA 3IP6A 2JHGA 5D7BA 1ABFA 4CR7A 2GB4A 4OSPA 5I7FA 2H7YA 5GV7A 3CXUA 2IYRA 2IYSA 1C41A 5CBPA 5IASA 1LV8A 4NBVA 1I9GA 3RABA 3F0TA 3JSXA 4MX8A 1R8SA 5J9FA 2ZYDA 1Y1PA 4MVWA 1BSVA 2C95A 2K7ZA 1BG6A 1C8BA 1VHTA 2H5JA 3T9DA 4DA7A 3JQAB 4OFBA 2LBPA 3H65A 1KETA 3LPLA 1SXJE 3WZLA 4MUGA 2QOEA 2HIGA 4X7RA 3SHTA 5FPTA 4YLYA 1PSZA 1M8FA 3P8ZA 4LXXA 4EB0A 4LY0A 4HAVA 1G18A 1GDDA 4G0UA 4ZT6A 5J2TA 4D26A 4I81A 4PAGA 1N2CA 2XODA 4UCFA 4TV8F 4TWJA 3EC1A 5FYDA 2OQRA 5IWAB 4W9NC 4QLAA 3QVSA 3HN2A 1UWKA 4ZO7A 2I55A 1J0AA 1RSZA 1W0JD 1A71A 3IMKA 2PKXA 3KUXA 3NR2A 3GLHE 1BA2A 4EG3A 1FP7A 3CC8A 1D0IA 5K51A 1DIGA 1P60A 4HNAA 4JUBA 3HVJA 1D9ZA 1DOHA 2A86A 3IT2A 3CF4G 4FR0A 5A4IS 4QGGA 2IU6A 4PF1A 5AUPB 2AYXA 1NA5A 2IXGA 3EULA 4J07A 3RVLA 5JALA 3D4IA 3AVUA 3IVRA 3D59A 4CEIB 3E3MA 5KJEA 4RD4A 2H52A 5G41A 3TINA 3UG6A 4UE6A 4L4XA 3A3KA 1OFUA 5FPSA 4ED9A 1P0PA 3CJTA 3I9V6 1QP7A 3KWFA 1JILA 1K98A 5G1PA 4EELA 4ESHA 3EDQA 4M0DA 1U2EA 3BCHA 4KH1A 3HKBB 3RU3A 4RHUA 1P2BA 2JLCA 2M1XA 1NNUA 2CVHA 1B0PA 1XEWX 2XDYA 3R75A 4YMHA 1RKXA 3T35A 5CTAA 2K2WA 4CE6A 5TMBA 5JI3E 4D3FA 3G0OA 3DYIA 2YVAA 2QTFA 4I4TF 3OPQA 1E1MA 1UDXA 2QZSA 3TCKA 4AJ2A 4GI1A 5JD5A 1KDOA 2FFBA 5ALJA 3W5JA 3E2MA 4JI3B 2OKGA 1K9SA 2Y1EA 3PCRB 4FDTA 3HKDA 5AKKA 1JSCA 3QVMA 5IRCD 1TLFA 2G8NA 2WAXA 1WU7A 1UCFA 1ZK3A 1L8QA 3GJQA 3I76A 3PG5A 4CM9A 4CPDA 1O94A 1K6IA 3LUKA 3RUEA 1TE2A 4BO7A 1C7ZA 4D41A 4MUKA 3TG2A 1GGKA 1C1DB 2OECA 1MN6A 3GOQA 3HYTA 1IY8A 1SELA 1Q1AA 2GN0A 1H1LB 1Z8HA 4NE2A 4M0PA 3BXHA 4XSVA 2P4SA 5H4GA 3E5HA 4HEJA 2HZ7A 5DNDA 5D85A 2C2MA 3THWB 2OP0A 1UJBA 2NP7A 3EQ2A 2GVNA 1VRWA 2FNAA 3B9BA 4W1RA 1BEZA 3NC1C 3Q6NA 2AE2A 4ZA2A 1FFSA 2HDWA 4Z9BA 1RWMA 3VPFA 5EHZA 3HABA 3GPBA 1XHEA 2BFDB 2ZUWA 2RGBA 3O6VA 4L5IA 4JB0A 4FM9A 4HDNA 1K6JA 2PGDA 3W3ZB 5JVDA 2NO0A 1R0XA 4JP5A 1X2BA 1C3LA 4RTQA 1VCNA 1IXZA 2PL9A 3DLAA 1WXWA 2R79A 4B76A 2ZZMA 1WSAA 3UJ8A 1GPMA 2V7UA 5LYJB 3SPXA 3MINB 2O8NA 2YV5A 2ZYGA 4B45A 1KOLA 2BUAA 4IMIB 3OOJA 5HIMA 3WJAA 3K0FB 3P27A 5LJLA 4LPKA 4RM3A 5EKDA 1Y89A 3UV6A 2V7QA 1P2SA 3IEPA 4MV8A 1ACJA 1QBKC 2HFJA 2R44A 5IJAA 3WNCA 5JLJA 5KC8A 1Y1RA 1DKUA 3W2HA 2PL5A 4B43A 4EJSA 2FGKA 2ZANA 3GDHA 3QE3A 5TS3A 4HPJB 2J3EA 2W9XA 2OGZA 2R25B 1NYRA 3AVTA 5ALPA 4LZZA 4E3ZA 4HQ0A 4H1UA 2O1EA 1HZZC 2C31A 2WA2A 4F91B 3OEHA 1NW3A 4I8DA 3HUTA 4MQ5A 1HTTA 1I6MA 1FLAA 3C5WP 4O4IA 4ZOAA 1IN8A 1PR9A 3QOYA 3R74A 1CZOA 4A8PA 2F3PA 2JIZD 2P1DA 2FW1A 2PRJA 1Z3CA 1R7RA 1T15A 2ZI7A 5EFOA 2EJTA 3KLNA 3D7RA 3OP1A 1Y6RA 3OU7A 2NQTA 4DR1B 1KVRA 4J0HA 5L4LA 3QKWA 1HK7A 3A4NA 1THZA 3HZOA 4LGVA 1HLFA 2VRCA 4OHOA 3AETB 2O7VA 1BU5A 1R9MA 4KACA 2W71A 2LV8A 2VYVD 3GAMA 5T4HA 2PZLA 1OLXA 3LQ4A 1UM9B 1RD4A 5EZYA 4OQNA 3L84A 3NAGA 1NN0A 4IRMA 2ALJA 4TSFA 3V4ZA 1XYGA 4ARUA 1NATA 3QWBA 4C4OA 4PX3A 3AB8A 4AKIA 3TAUA 1J8VA 1Q16A 3C5HA 1T4DA 1YD7A 2GHRA 3GLSA 4O2AF 4ZXFA 1XKXA 3CZPA 3UUWA 5BYKA 2C84A 5JC8A 4MUYA 4RE6A 1VCHA 2Q8NA 4J6EA 2GGSA 4WV3A 1DZIA 2GD0A 3ETGA 3H6KA 1MO5A 1P4SA 3C2QA 2IP2A 1MVNA 3WIBA 4L95C 5KHOC 2WIJA 2X3YA 3PFGA 3PDIB 1L4GA 3T12A 5I45A 3FHTA 3HK2A 3QKSA 2LPMA 4KR0A 3KAKA 1YVUA 3KFXA 4PICA 3LGXA 4U63A 1ZNYA 2UZ1B 1OVMA 1UOQA 3CNNA 5DM60 1OFUX 1OJ7A 2C9DA 2EFHB 2OP1A 3INRA 3WGYA 4YRNA 4QOHA 3TGPA 1NXQA 4WJLA 1R8XA 3AK4A 4OVKA 3X3HA 2HT1A 1G3QA 1IXSB 1RYHA 1XC7A 3AZOA 3MJHA 4PZ9A 4BL5A 2FRXA 3MQ2A 1CUAA 1C4KA 1JU4A 4GM1A 5K3BA 4GVLA 1IRXA 2JH8A 1EUQA 1VBKA 1C9KA 3PPVA 3MJSA 3OPMA 2G1UA 4A0RA 2JFNA 1G4HA 1T6YA 4HDCA 4OB6A 2DLCX 3AR4A 4FKMA 4L7QA 3Q3VA 4QYIB 3X0DA 3TM5A 3UXHA 4ENPA 2BF4A 2SKDA 4G0XA 1G7RA 3G2HA 1QWSA 1HKUA 1DRUA 1LI5A 1WG8A 2CUZA 3NFYA 4CIXA 2FSHA 2GHTA 3NGXA 1NF9A 3CINA 1SVKA 5FOTA 1FUKA 4F5DA 3ILVA 3I1FA 4PLVA 1DV2A 5HQ3B 4W9NA 4FZ5A 4ALIA 2P68A 4PR3A 1LI4A 3VYTB 1LPBB 1C9YA 4O1MA 2DZDA 3HDQA 4LTMA 1WETA 4L78A 1KH2A 1E3WA 1V11A 2OVBA 3T94A 2OORC 2R65A 1RRFA 2BFPA 2GCEA 3K9HA 3NC4A 4DJFC 1VE5A 4NCJA 3BHIA 3JR7A 4RMHA 2YV4A 4OHWA 3Q4GA 1ECCA 5ES3A 4BMOB 4W8OA 4EMBA 1WB6A 5DN6D 2PQ0A 4KL8S 4QGBA 4RJIA 2G3YA 1HNWB 2I2AA 4BKOA 2AJDA 5HNKA 2D5IA 1O96A 1HYQA 1LRLA 2MSNA 3REQA 4AJOA 1U5CA 4UOQA 1H66A 2XNSA 4YUXA 2ZB4A 3EQ6A 2LWIA 4GLJA 3KR1A 2EATA 3GLIA 2RAUA 4J9VA 1MPXA 3T5CA 1NKSA 4B3SB 3OURA 3DR3A 1PT7A 5A3SA 2YVLA 4ND3A 2NXEA 2P9YA 4PLZA 1T3ZA 3DULA 4S12A 1K8QA 5ALFA 1D2RA 3GAFA 4ZVRA 5GJBA 1WPGA 2JI7A 3ILHA 1J2RA 4G8JA 3TL6A 2BT4A 1Y7IA 1COWD 3ZWDA 2FUG6 4UHCA 5T6MA 2WIGA 5JH7B 2IYWA 1RXYA 4QUAA 4EEZA 3SBXA 4X90A 5CLIA 4NYMR 2W2VA 1QTIA 3H1BA 2Y6UA 3WWCA 4A27A 5LQMA 1XPRA 4KLCA 1CUIA 3EUAA 3MRSA 3RSGA 1ICIA 2ORIA 3HJRA 4X3OA 1EE2A 3UAGA 4ZEMA 4EHIA 1MV8A 3UAZA 1K0UA 1SXIA 3IV9A 3LZDA 4JJIA 2WNSA 3NORA 4WECA 5DJ5A 1VDMA 2RJNA 2WZDA 1QQAA 4QEDA 1NVDA 1ZOIA 2I33A 3HUEA 4F8EA 2YWGA 4QTUB 3MCWA 5IVDA 4EMSA 2W6QA 1Y3DE 2WSIA 3WADA 3T7JA 2YIDA 3NWOA 2Q8PA 3F7TA 1F20A 4N76A 3G7SA 3PNVA 1AGYA 4U0KA 2IZOA 2RHGB 2W22A 1F2VA 4G0WA 4LYJA 5AKHA 4KRXA 4C14A 3HSSA 2ZJAA 1WZNA 4MVJE 2APJA 1PWEA 4OG2A 2C57A 4YEDA 4HB0A 4N0MA 3FB1A 3G5LA 2P2NA 1ZSNA 3OZVA 4G9BA 5LQNA 4QNRA 3RH0A 2C2ZA 5C53B 2AK3A 1P7ZA 1ZM3A 4Q6BA 2WFLB 2UUPA 2WUVA 3OUZA 3VPGA 2ONYA 4QO7A 1TAQA 2DPXA 1TQ8A 1DXHA 3ESRA 1RLIA 2NXCA 2YNMD 1DJQA 4Y0VA 4DA4A 1T3GA 4F9FA 2FN9A 1R6AA 1N3YA 1IONA 2F1KA 3A36A 3O3MB 4U7HA 2P4EA 3G79A 5B6PA 5G0TA 3ZHTA 2ATIA 3PQ8A 1DG3A 3ZGYA 4CQMB 5TQ0A 3DE3X 5EIHA 5G1NA 4GL4A 3IAS1 2WJVA 4LDQA 4ZVOA 2QBYB 3PFBA 1BC5A 2X7JA 4G1MB 3TJRA 1YIOA 3BORA 1IG0A 1ST3A 2AMVA 4QARA 1U2TA 5KEIA 3H9QA 4KMRA 3RK1A 1MC5A 3ISJA 1WD5A 4G1EB 4JMPA 4KQ6A 1HZZA 2P6OA 1OD6A 2NZ2A 4HS4A 1ONBA 3DZJA 2HMWA 4E31A 3ADOA 4LV6A 3EGVA 3VH2A 1LRKA 5KYVA 1OAOC 4AROA 4HX2A 3E8SA 4ZO6A 5HM6A 4CF7A 3OJFA 3W5DA 3IMEA 3BREA 4EKEA 4RY2A 5DX8A 5LQSA 2XUIA 4OXYA 2F43B 3TXAA 1M2JA 2FPPA 3IOBA 1LRJA 3CB4A 3CZMA 4PRYA 1COZA 2VJDA 3JASA 2UKDA 5JLAA 3WOVA 1XDSA 4A0FA 1H0HA 1SXGA 2FZGA 4I1UA 1YB6A 1QONA 1JE1A 3ICOA 2QRMA 4AZVA 2GPAA 3O8BA 1F6DA 1ISRA 5K0SA 4WCFC 1RYDA 3BSFA 3IUSA 5DOVA 1L5FA 4Y0NA 4NI5A 1BHJA 2G80A 2VG8A 3MWJA 4HNGA 5FUQA 1LTHR 2WP0A 2W4IA 2C8VA 1SVWA 4O5OA 4CLRA 1ECPA 2IEZA 2C29D 1N75A 3PT5A 2XB4A 4YBZA 4QE3A 4MUBA 4REQB 1M9NA 5DXJA 3CVYA 2G1PA 1F48A 5EXXA 3ADDA 3IOCA 1CYEA 3HCEA 1LLFA 2CLCX 4FHGA 3UM9A 1WF3A 3Q8XB 3W77A 3A2KA 4CDGA 1I2MA 1Y7HA 3KXKA 4TTPA 3U62A 4WXYB 3AF6A 3GDGA 5CH5A 3MTDA 3LBHA 3ADPA 1OYWA 4IMPA 4JLDA 1PJCA 4KPFC 3IERA 3GT4A 5FH9A 4Q1AA 5C7IO 1B2RA 2PNJA 5DYWA 3ZCVA 4G5GA 3PR2B 3WKBA 2OZLB 4JOQA 4DYDA 3DXFA 3NIDB 5GZ1A 1B3RA 1UBRS 4DMFA 3VGPA 4CQLA 2GLXA 3VC1A 4J49A 3IAEA 5L3SB 4Y7DA 5T57A 1Y8RA 2I6FA 1NOKA 5B2EA 1HL7A 1EBBA 3H11A 3R0ZA 5HZGA 5E7JA 5JHGB 3OCYA 5ALKA 3VOBA 1QYIA 2RGGA 2VDWA 1XDWA 4M46A 4Q3BA 1NDUA 2G9NA 4F4CA 3HV2A 3R7FA 3AKZA 3FHOA 2EC5A 1H2HA 4UNNA 1D9XA 1B0ZA 4ZRMA 5C8YA 3WMWA 1SCJA 4OHUA 4BQSA 4EHBA 3AFHA 5KTMA 1P2DA 3NB0A 1BXRB 2RBEA 1M1NB 1OBVA 1U94A 1KKLA 2KM1A 3BDAA 3FDZA 4JLNA 1NYTA 1E6CA 4KUGA 5A04A 2VTBA 2WVHA 4GKJB 2GLTA 3RGGA 1HT1E 1ZK2A 2DAPA 3GY0A 2P9BA 4B4UA 1SIBE 2WU8A 2WWYA 2AK2A 1YDMA 2OORA 3IA7A 4TMYA 3QW2A 5KYYA 3EOZA 4PYRA 1YT5A 3PGMA 1I4TD 2VCYA 3CVOA 4E51A 3TLGB 3KR2A 5K8LA 2DT8A 2RJOA 1SKAA 1AQNA 4JVMA 2YV2A 4NNOA 5LBIA 2XUQA 3WB1A 4KSCA 3WVNA 2ONJA 1UJNA 1CS4C 1QIFA 4PG4A 3INNA 5IN5A 3RLIA 2BM1A 2B1QA 2OCKA 3VKUA 2BGLA 4DHEA 5LKAA 1EXDA 4X00A 3DO6A 3S6JA 3DKKA 3BXXA 1U3CA 3PQ3A 3OQJA 3Q9LA 3KKQA 3TDMA 3FNFA 1CPYA 2GEUA 1QK4A 3E5NA 3PTAA 4PPFA 1K8XB 4QLOA 4LY3A 1BWSA 3HU1A 4OGWA 5BURA 1BW9B 1O3YA 1SURA 2X77A 3H1TA 3KSDO 3W6OA 5JCZA 3NYIA 4O3MA 4MGYR 4AI6A 2R8YA 1O1YA 3KZXA 4WEOA 4WTOA 5AW4A 2VP9A 3X1DA 4PWZA 3RFCA 1Z33A 4GM0A 4D4MA 4F1KA 2XKBA 3CH4B 5CYGA 1LS6A 1OI4A 4QUKA 4X1YA 1SQ6A 1JDVA 5J23A 3SQMA 4GIBA 3WJ1A 1MW8X 1SPBS 4E33A 1U1IA 4PG7A 2GDJA 1UJCA 1P3Y1 2ZDGA 5BRJA 2FOLA 5B3AA 3ZCPA 3R44A 5G4KB 4LY9A 2O9JA 1T36B 4QZVA 2JJ2A 5E9WA 5HE9A 5CT9A 2QRNA 2PT9A 2V4MA 2BJWA 2PGJA 2DCUA 1I2AA 3BD8A 4FHCA 5ALLA 2Q5EA 1ISIA 3TL2A 4UOZA 2ODAA 4BP3A 4A92A 2XQKA 3E7DA 3I05A 4RK0A 4U6NA 2ID9A 1RU3A 3HJTA 1W76A 3FPEA 1CXZA 1YHZA 2OGUA 3NRCA 4JIMA 5C8ZA 1SH7A 1MA0A 3IQFA 5KYGA 1TUBA 1J7KA 2CFOA 5FFMA 1NVVR 4QJBA 3WLHA 1J1UA 2E89A 1M0EA 1DFGA 2I4IA 4LKRA 2ZLBA 1Y4SA 4W4TA 2QUBA 1H4VB 2MSCB 3F6RA 4JXXA 4NULA 3USCS 1AZSC 2IEBA 3O2JA 2H00A 4RGYA 5REQB 4CI9A 4BQFA 1GV1A 4AT1A 3EZLA 3LWDA 5U1PA 3NBQA 1GP2A 4KYTA 5B7GA 2E5WA 5H3LA 1V1RB 1CUBA 1KIMA 1TEVA 1XTUA 2EKZA 2FW8A 2OHVA 3NTLA 5I4IA 5KNCH 1KKMA 3VA7A 5I51A 1WUIS 3JAKB 4ECAA 4EQ6A 4WK0B 3M1AA 4MVJH 1K2VN 1YI0A 3D8RA 5DHFA 3VNRA 2NZXA 1LX7A 1CUJA 1JHQA 2BHLA 4V0NA 5EPUA 1ZUD1 3DBLA 3PPWA 3KKOA 3Q3GE 5F4BA 1JYSA 3EZFA 5BSEA 1NVEA 3QPUA 1N5MA 3VC2A 3U60B 2Z5FA 3U81A 1J70A 1Z29A 3FF4A 4F6RA 4H7DA 3MSCA 3GUCA 1ENZA 2Z30A 4I5GA 3OKFA 1T1GA 3R7NA 1VIVA 2ZSAA 1NQUA 2P4UA 2R7NA 2Z9BA 5LKRA 3TD6A 4MUJA 1JDZA 1RACA 2FJPA 4IEIA 4OUDA 4NPAA 4PYIA 3RV3A 1JIKA 3EBPA 3WYBA 1V8PA 4UVDA 3S7ZA 2ZWPA 4D9GA 2QY9A 2E9SA 1OAOA 2HCBA 3DVLA 1V2HE 2HMSA 4KQGA 4NKRA 1YHNA 4NSNA 3VUFA 3AIMA 3FYDA 4L02A 2OV1A 1W36B 5B3KA 4JKYA 1MO4A 1OHHA 3VTKA 1OX4B 5U9CA 3A7EA 1DC7A 2OPHA 1SVIA 2G4LA 4P58A 5HSGA 2FRDC 2NOAA 1P19A 3HKCA 2VHTA 4L4ZA 4B3RB 2FPOA 2BPOA 1OFGA 1ZOOA 4WCFA 1WX1A 3SIXA 4CMBA 5IT4A 4HCJA 2YHUA 3LP8A 2OZKA 3K9CA 1RWOA 3LOPA 1M72A 2ODEA 4DB4A 2Q1WA 1FSSA 3KQYA 3PEFA 4QUJA 4JXZA 1YZHA 2ZIXA 1BE1A 1CULC 1P8JA 1ZN7A 3R5JA 2VAXA 3KPVA 4J16C 3G9UA 4MHSA 1Z2OX 1QDLB 1E8MA 4JD5A 1R6BX 5FA8A 4GPIB 1G5QA 5IEJA 4NDZA 2NU9B 3QKTA 3RANA 1EXWA 4MK4A 3VPHA 2XT6A 4CWAA 1IBRA 1RZUA 1E1RA 1SVOA 4XPIB 1YA8A 2V0GA 4XGQA 3BULA 3RKRA 5EAIA 3AQIA 4LDJA 2I71A 1MABB 1YS2X 4K6CA 3L7YA 1Q0PA 3G8AA 4ND2A 3UB3A 3O91A 1KY3A 1KTIA 2HO4A 3I9KA 5AM3A 1H0SA 4X20B 4DCGA 3N0RA 1OWOA 3ABOB 4WBNF 2X41A 3EMVA 5FXMA 1QGYA 2ZPUA 4BZQA 3GJ3A 5CRIA 3HY4A 1UIRA 3MCUA 4TSRA 2Q9BA 4G84A 3HN6A 1QSGA 5EYPA 2IF2A 1PBTA 3HWWA 3HEAA 3NTVA 3NBAA 4H6WA 4YJ2B 3PUHA 4RM2A 2Q3MA 3SYMA 1JQ3A 2RI0A 3PWTA 5C1OA 5KVVA 3A0UA 5AJYA 5EJ8A 3VDQA 4CLHA 1I6WA 5HRUA 2YJNA 1D1SA 3RTGA 2AOVA 4EKYA 2XGMA 5IF9A 3DMDA 3DTNA 2WY2D 4NMXB 5C8VA 4TUYA 3AWIA 2WTBA 3I42A 4FWBA 4XTRA 3ZLJA 3G2LA 2NUTB 4DJEC 5FO0A 5A05A 1Z2CA 1MTZA 1REQB 1T1JA 2RMKA 3KQMA 1R0SA 3HA3A 3DOEA 4PHTA 2O07A 3RYHB 3T5TA 2TYSB 2V3CC 2AOWA 3EJWA 4GYJA 1PFQA 1OB5A 1CUGA 1U8CB 1VM6A 4LV8B 2OD9A 5BMVA 5HEKA 1TECE 4GKAA 3T5GA 1U7HA 3WLPA 4DCCA 1KOFA 2G1AA 2ZSDA 5AFSA 3FYUB 4TL9A 2XXBA 1DX6A 5HF8A 4JCCA 4WIAA 4JYBA 2YJZA 5ALSA 4HVTA 3D0QA 1X8XA 5HE8A 4Z1MD 3DL4A 1QF9A 4BLUA 1Z36A 4KE7A 4M9QA 4MWZA 1S0UA 1R4ZA 1J9EA 4W5HA 3TDNA 5BUZA 1XMPA 2JBHA 2ZSFA 2OBLA 3GCXA 3BWXA 4QHSA 3EWIA 4D0GA 3D3WB 4QUGA 1EFTA 2EG9A 3FPGA 3M1YA 3UJBA 2NV6A 3O95A 2W8ZA 5A5FA 2AR0A 2MT9A 3IBCA 1EDOA 4JT2A 4NY1A 3T9EA 1KVUA 3Q85A 3H2BA 1HDCA 5TDHA 2JJ1A 3A4YA 4X1IA 3VO2A 3WLKX 1QQTA 5KB3A 3N58A 2Q5HA 2BRUC 4RKWA 2FTKE 5DNWA 4EHDA 5B58C 1DIBA 2YMQA 3DOIA 4KOAA 5FV4A 3TUZC 3EVNA 4X8LA 1RQ7A 1RQXA 2W6JA 5D51S 3LW7A 1VJTA 4QBTA 3KXDA 1GQFA 4NAHA 3H17A 1E0JA 3L41A 3CKLA 1K97A 4BNVA 3IPRA 1C9EA 5KKNB 4OB8A 4DQLA 5TEVA 4V0ME 4II3A 1MC4A 2FPLA 2BR3A 1VHLA 4FOSA 1QGUA 2CLFB 1GL7A 2PH5A 3EGIA 4NU6A 1G20A 2GESA 4UPEA 3UBTA 4LMBA 2XB2A 3QBJA 3Q1KA 3OH8A 3LK7A 3DMGA 1NC3A 1UKEA 2R751 4QG3A 5EJ9A 2ZIZA 4WZZA 4ZAFA 4Q7EA 4BX0A 4LHVA 2GEKA 4TMZA 4CDNA 4EDHA 2X13A 3IIKA 1MEOA 4ZVMA 2C5BA 4DNFA 4YC7A 4ZZ2A 1KAGA 1J8MF 3GIDA 2TECE 5KX5B 3EZ2A 3CKMA 4UEJA 3WIEA 4YJKA 4C0HA 1KH1A 5EWLA 5C4MA 4BB5A 1EJ2A 5P21A 1SVUA 1KK2A 4KVAA 1JZQA 3DTTA 4EBBA 4R2LA 2AJTA 1L5MA 2I6TA 4W5RA 3URKA 2FH5B 1P9WA 3RSOA 2AVNA 3OIWA 3RRYA 2Y05A 4JLBA 1W30A 5ITZA 4L1KA 4QJ3A 3UGJA 1YQUA 4ARCA 1PGQA 5BQPA 3PFIA 3MJ4A 4MICA 1A1SA 1JNXX 4EPXA 3SC2B 5ED4A 4K6KA 2H54A 3RUIA 1XU7A 1PYDA 2WSSD 3A9CA 2RB4A 4KWEA 4KQWA 4LJKA 4Q9DA 5C4GB 4PPNA 2BSQA 2YY7A 2GF2A 4QYWA 3UJPA 4EATA 1DEHA 1X94A 3H19A 3IP3A 3L92A 2J59A 2GYVA 1H2XA 4JVNA 2FSPA 4LVNA 4LVUA 3L7JA 4L73A 4R7TA 2JLRA 1P31A 2XOKD 4HWOA 1AIPA 1D2HA 1O6FA 1X2EA 2EJVA 5FFNA 1HL3A 3C7KA 3SJUA 3ZNPA 4CUKA 4GP6A 5K1ZA 3F71A 4LWOA 1OV6A 3GRFA 2PBRA 4H17A 1YJQA 4UHFA 3KZ1E 3SQLA 2P2SA 4CT0A 1ZUNA 4H9GA 1UADA 2EBWA 3EXHB 3ENNA 3JX9A 2XMSA 1IOZA 1NR5A 1KEKA 3G2OA 5DCLA 3CZQA 2J9FB 5AOCA 3IUYA 1PKEA 3SF0A 4V1CI 3CM0A 4N49A 1A50B 1H94A 3CX7A 4LZNA 5AI4A 4JENA 4C01A 4PHHA 3EAGA 4MUNA 3ZH2A 4Y6OA 5DLDA 3G5UA 3DJYA 4CG1A 3QA9A 3AUFA 5EP1A 1WMSA 3GQVA 1UM8A 2G7ZA 4LYHA 4A1OA 4Q24A 5L95A 3V7YA 1YH3A 2HJRA 5CUQA 1SUSA 4O2BB 4BFCA 3ABSB 1W96A 3GLGA 1E3JA 2FRDA 3UCEA 4RO0A 1EFAA 4LWZA 1O5TA 3BGSA 3PVCA 3AJ8A 3DMFA 2YCLA 3BHJA 4KEAA 4IHJF 4KYIB 2ACEA 4MWBA 4R3WA 6REQA 2A5YB 5JI2E 5AW7A 3P9KA 3MRTA 2A1UA 2FDCA 4HGQA 2XSZA 1VHJA 3BMNA 4X24A 5AM5A 4C2UA 3NEPX 1ZGBA 1YNSA 3CUTA 3OO0A 4RHEA 3PQ5A 4J16A 4CI0B 5KWVA 1C8KA 3CLUC 5L8VA 1WA5A 2ZJ2A 3CZRA 4G2NA 3QOXA 4ZPXA 1ESDA 2JIBA 3M5WA 3RJTA 3GP8A 4LXGA 2ISCA 3NYQA 3RIHA 2PIAA 2FPXA 2C2XA 1IUPA 1HOTA 2A6PA 3E2PA 3II6X 4R8VA 1ESEA 3AVQA 3DBHB 2WKWA 1QP8A 4GC9A 5G0UA 1N3LA 3VGJA 2PLNA 4CLXA 3WGJA 1I2CA 1S5PA 4XRRA 1ESNA 1TO1E 1WBBA 1T5SA 2R6CA 1O77A 3TSCA 5J47A 1NXWA 4LYAA 3RG8A 1SKMA 2ES4A 2G6BA 3BKXA 3O8OB 4NZOA 3JATA 1DLJA 4ZOLB 3F96A 1HNZB 3ZEAA 2J48A 1EKXA 1UF9A 3CW9A 3K2BA 3NPMA 2XWQA 4CUJA 1DAOA 2LDBA 4W1SA 2ZTVA 3KZVA 1Y9DA 4MKXA 1O0BA 3BK7A 5F3RA 1GO2A 1Y1LA 4LDPA 4LJAA 1UMBA 3ZG6A 2VNIA 4YFYA 3LA8A 4PWYA 2FEWB 4II7A 3UG7A 3BIFA 1G21B 4KN6A 3QVJA 1NG1A 1P61B 2VZEA 4RMJA 2HQRA 5D87A 4HVLA 1EEHA 5EESA 1AA9A 3CLRD 4KQ1A 5ECYA 3BWVA 3GLHA 2DHRA 1FYFA 5I7HA 5DIFA 2RHDA 2AC7A 3UMCA 1E6UA 3MRXA 1ONPA 3ZJUA 2OAP1 3HDJA 3QU7A 1G291 4FVTA 2Q1YA 2QTTA 3PC4A 1QIEA 2VQEB 3JQ8A 1CRLA 1HE1C 1U8ZA 4P2BA 5G02A 4M88A 4BLOA 4MV3A 4L76A 1OH8A 1LDYA 1UAGA 1J39A 1OCEA 4RYDA 4DXHA 2CDBA 5HKKA 3WA6A 4YJGA 1UJ2A 1HFJA 3GFSA 3TXYA 1QCDA 3HACA 1BE6A 4JI5B 4ZI3A 4QIHA 2B4KA 1DAGA 2FPUA 2AKAB 3N2IA 3GDWA 5DT9A 1LLQA 2JANA 5IAAA 1AO3A 3FCEA 4WRRA 4CRWB 1IEXA 4CV0A 3DZGA 2VAMA 2B0JA 2H4JA 2HSGA 2IP4A 3IAUA 3SS7X 2ZUEA 2JFWA 3AERA 4LHWA 5HFAA 1E7WA 4OYRA 3IDZA 3MGBA 2CB0A 4IIEA 2BRUA 2WYIA 4PYQA 4Z9YA 2IH5A 1NTRA 1Q21A 1EP9A 3E4CA 3NETA 4RQTA 4RKEA 5JAQA 3MHTA 3DMTC 3QX7A 4ZD6A 1DX9A 2XHEA 1QFMA 3S2SA 4F8YA 4JX8A 5J2TB 4F9TA 2HPHA 3H5TA 5IP5A 2OHHA 3GNQA 2D8AA 4GPAA 1N2CB 4BNNA 2H1RA 4HH1A 1HT2E 5AI5A 2I4RA 1OYVA 2GK6A 2I29A 1GNLA 2KJQA 2GA9A 3G85A 2IPXA 1NJ5A 2NSDA 2ZIUB 2QUZA 3ESCA 2X9VA 2CJFA 1VKNA 5EXSA 5BSGA 1JHDA 4LF8B 1TQ2A 3N2EA 1HWYA 3RC8A 3SFTA 1JT9A 4QDJA 1XZKA 3ZGNA 1S2LA 4HNAB 4DMKA 1AT1A 1OREA 4P4SA 1KYVA 1L5VA 3PQ4A 1ESCA 1QO0A 3HYRA 4K2AA 1FTWA 3E8XA 3QFFA 2VTDA 2AKEA 2ZU6A 4OXIA 3B7WA 1N7HA 2PBZA 3K20A 3R6GA 4MZXA 4O2RA 3O93A 2IUFA 5IDVA 1C30A 3TZCA 4DVJA 2QUHA 1FJGB 1SUCA 3C3WA 4TKUA 1Y1KE 3T38A 3RVBA 1OVGA 3AP2A 1P4AA 1U99A 1DU4A 3M81A 2NXWA 1DMRA 3BIWA 1X7ZA 3VR0A 2PJZA 1JAIA 2ONCA 1PNRA 1WVMA 4B7XA 1CQXA 2Q5CA 2CNKA 4RU1A 5A0TA 3BILA 2QRVA 2PZAA 1GGJA 2WIFA 5F21A 1C8VB 3WI7A 3IBSA 4AY6A 4PTYA 4F97A 1DTWA 1II9A 1SRRA 2J9RA 3EIEA 4AUNA 4H7JA 3H0EA 4YCLA 2A9VA 1DJPA 4MW0A 4IKPA 421PA 3RROA 3HKDB 1G66A 5A5VA 2B6NA 2CY0A 1OFVA 5JMOA 2BKEA 1R00A 1VSVA 2DFNA 1RM3A 2Z57A 1KJZA 1HRDA 1TYEB 3AOGA 4PONA 3T4XA 3GUYA 3GGCA 2IXDA 5CIWA 5C31A 3NHYA 1CERA 2IELA 3P9XA 5CW1A 1PDVA 1PX0A 2P8SA 3H6HA 1QIDA 4U7WA 1DIRA 2QK4A 1UEJA 1AJEA 1JX6A 1UODA 2CFRA 1X1DA 3DZIA 3TLYA 2QLFA 2QZ9A 1JFVA 4GG1A 2XBUA 4W8HA 2Q2QA 5IK2A 2MJLA 2IU0A 2JAHA 3MMXA 4DVGA 1TM1E 2FFRA 2VDOB 3DF7A 1L6RA 4KFUA 1BDJA 1KO4A 2JAUA 4JL6A 5FV7A 4DILA 4M38A 1V5WA 2OBFA 1DQYA 1PJ2A 3IVMA 1TA4A 1Z4LA 3IO5A 5CPFA 1GG9A 4HDNB 4XLLA 4F3CA 1FU8A 1I3LA 2GF9A 3OTIA 5JVDB 5BNTA 1N34B 4YMVA 1EESA 2XZLA 3LJKA 3P9SA 1ZSYA 4FFBA 5JAUA 2YMMA 1PZFA 1Z73A 2MYTA 4P6VF 3QHPA 4RLFA 4UNIA 4WY2A 3ROGA 1C3EA 4N0PA 4FS3A 2Y1DA 3GEIA 4WNYA 3MS7A 4L28A 3AZQA 2X2PA 1RE0A 3LECA 1UBKS 4WOCA 5UKDA 4MMXB 3L3BA 3DT8A 5BV8A 1HG1A 3ZDDA 2WFMA 2HFKA 2ZAIA 4ZCTA 2ZDQA 3W7BA 3BK2A 4CEHA 1N2GA 3GRKA 2G07A 3M9XA 4EMTA 3FNGA 1CUWA 3R6DA 4MROA 4DSUA 3FNIA 4EJSB 5FFFA 1YS4A 1MVOA 4H35A 3SHWA 1H2RS 3U6BA 4PS0A 5ABPA 5JFTA 1YKFA 3BHMA 5DMXA 5HZHA 3QEJA 1CIPA 2VYQA 1JTEA 3F67A 4BXOA 4HT3B 4TL7A 2J1LA 4BMYA 3QVKA 2BJHA 1HDGO 2B4YA 2AUNA 3QVTA 1THGA 3E35A 4EW2A 2YBEA 3SR4A 1OPRA 5A6SA 3DTVD 3EXAA 1HY3A 1QUFA 5HJ2A 2MIIA 3QBEA 3DBVO 2W2XA 4MJ7A 1LPAB 4O4IB 2RGYA 5DGCA 3W8NA 4FMDF 4RTLA 3DV9A 1L0BA 4J1NA 4B0OA 3BXZA 5EZ5A 3WL3A 3LX6A 3HFRA 1VTKA 1JG1A 3VI4B 2XRZA 4MIEA 3ST7A 5JECA 1RXVA 1UK8A 3RTBA 1D2CA 3BSSA 3BBLA 5TGDA 3HJUA 2CMGA 1S01A 2B4QA 3PV0A 3DOCA 1Z5WA 4IGAA 5C5IA 3SQXA 4J3FA 1VMIA 2GN8A 3LBYA 2GK3A 4N3GA 1O57A 3TB6A 2QXUA 4L8VA 4OQXA 5AKGA 6PFKA 3NMUF 3ZY3A 1OLXB 2VHVA 3IJ5A 1JSRA 2EHJA 3LCRA 2YIMA 5LWQA 1CB7A 1W2WB 1BVRA 2YASA 3KPYA 3H9CA 1DOAA 1V3TA 1VMDA 2H1FA 2Y1XA 3IMGA 3C6KA 2Q41A 2RB5A 5ESWA 4Q3DA 3NBMA 3TS1A 4V38A 2FMXA 4V0KA 5KKAA 3EOAI 1YJBA 3LCVB 4OHCA 2FEKA 5FWXA 3MT7A 1GXSA 2XX3A 1XCOA 4FC7A 3RNOA 4CGYA 2BTOA 1OKKA 5DLEA 1IAQA 1KI8A 1PJAA 2IDZA 2OSVA 3AFOA 5DULA 3ZCQA 2KPOA 3RRJA 4YRAA 5F1YA 3PDCA 1XTBA 6AT1A 4UDNA 2FMTA 3QKSB 2NXJA 1S89A 2Q3EA 3S99A 4L5BA 1MT3A 2Q5JA 2NV0A 3AY6A 4ZYUA 5LIPA 4HEQA 4DXDA 1JKIA 1V71A 4JR1A 2PE5A 3U7QA 5I4KA 2PHZA 1FU4A 4RC9A 4JUAA 5E1BA 5EL0A 2YVKA 3A32A 3QLUC 4N7JA 2AFHE 3CG4A 3TQSA 3TOZA 3BFPA 1KP2A 1EWTA 2E6KA 2PMFA 1XALA 3E2IA 5A2QA 4TGLA 1V8DA 1GY8A 4NAVA 1K0FA 4B74A 3Q8KA 3FYCA 3OX1A 1HOXA 4OD0A 2HAEA 1T13A 2PMDA 3A6PC 3DMTA 3O82A 3T4PA 3DGFC 1DO8A 5KQMA 2IHYA 4YIKA 4KNWA 1YRQA 4L07A 2F55A 3CCCA 4S2EA 1L7EA 2B7CA 1ZWKA 1A5SB 3FWNA 4XR9A 3ICCA 3LRPA 3LYLA 5SY9A 1ZD8A 3SKVA 1E3WB 1V11B 1DNPA 1DQRA 1X38A 2G0TA 2ZB2A 4JP1A 2QMHA 4O4JA 4R9VA 2P6RA 2KE5A 4XSHA 3CF6R 1SD2A 4RPLA 2VOEA 3D8BA 1NXPA 3SDBA 2O1WA 1JH8A 2P5TB 3BQ9A 5KNCA 2DWCA 4QQKA 1N8TA 1Z2DA 5JZBA 1Y9ZA 3VI3B 3QEBZ 3IX7A 5H1YA 2JLBA 1MB0A 1GNSA 1Z4IA 1KQPA 2VFAA 3GT7A 1K3FA 2OY0A 4MVJA 4R1SA 2X0EA 2I8AA 3U4AA 3ZGVA 5HPYB 1QHYA 1O96B 3LT2A 2P77A 3NNNA 3REQB 3FTCA 4IICA 3WQSB 3RU2A 3AXTA 3V48A 2J0SA 4OIMA 2D0PB 1DKOA 1DPFA 4G1UC 3GLIB 5ECGC 4DMCA 2ZPAA 4IDGA 1PJQA 4PZEA 2RHMA 4MGIR 4WUVA 1VLVA 4DIBA 4ZVTA 1TT7A 4C0BA 1YK0A 1W0KD 2AYZA 3D4LA 3A3YA 1KZ1A 1M54A 3O8QA 1CRZA 1G19A 3WMFA 5JADA 3M0EA 4EYEA 1PT6A 5DBHX 2O2GA 3O2SB 2CMFA 3T34A 1E4OA 5BT9A 5D3ZA 1F9AA 3LVRE 1RPNA 3CRRA 3FRHA 3IDQA 4HGNA 4F0JA 4RTNA 3K1TA 1EVZA 3K6RA 1E2QA 5F1KA 2I3GA 5CCDA 3PYMA 3VR2D 5JS6A 4G25A 2JI4A 1I5OA 3DZDA 2I6GA 2GZAA 1XTVA 2K6GA 3O03A 3WLTA 3QE9Y 5J63A 3VZPA 5EVJA 3X1MA 3GH1A 1NL3A 2J30A 4HADA 3KG2A 1RFLA 1V8ZA 1T9HA 4C43A 2I66A 3QUCA 1XF9A 4CFYA 3K70C 2GO1A 3JYNA 3A2LA 3FPFA 4YMSA 4DQXA 1ZGJA 1EFPA 1TRKA 1Z9BA 3L5KA 3IEIA 4PRKA 3I2JA 1MJFA 4G1FA 4U7FA 4OAOA 4FPXA 2R6HA 1UFVA 3W06A 3VYRB 4RVFA 1NR1A 1JH9A 3EODA 5JS2A 3SU8A 5KQPA 4EZIA 1AB5A 3WB9A 4F3NA 3AT1A 4MV5A 4M9CA 3Q1LA 2VS1A 3TDKA 3EY4A 1IDN1 1X86B 4D99A 2XA9A 3Q3EA 4N41A 3NXSA 3TKLA 4MVJM 2GM4A 3OEEA 2VHEA 1CE8A 2WU0A 2OQVA 1AS3A 3QYAA 3AW9A 1S2DA 1DE0A 1RMYA 4BEWA 1TT5A 4AN4A 1FQOA 3OIYA 3L05A 2XCLA 3ZOZA 5AHOA 2XYHA 2VYVA 1OR8A 4DLRA 3DWEX 2C2WA 5LM3A 1FSZA 1HE5A 3H99A 2J31A 2YQ4A 1QG4A 1E2HA 2PCJA 2ZBQA 1F8FA 3T5MA 2E21A 4W7SA 3CO5A 1KYQA 4ISBA 3QPWA 3WL4A 3OU2A 2W93A 3TMKA 5TQ0B 1A5BB 4D8VA 3LCUA 4BC0A 1A77A 2ZAOA 2D8MA 3A9WA 2CXUA 1Q6YA 2QT9A 4UZSA 3ZU6A 4B3MB 1R3DA 1WPXA 2BGGA 4GT1A 2VJMB 1N9GA 5F12A 2DJ5A 2Y1LA 3K9WA 4ARIA 4BV3A 1G5IA 2A8YA 2DJIA 4LF4B 4QELA 1SKBA 1XAIA 1JT2A 1RPTA 3ICPA 3OZFA 4OLFA 1KFJB 2GTHA 1WQ1R 4YMGA 2W2QA 2MMCA 4NV1A 5HKOA 1K5GA 1KMHA 3CYFA 3ORRA 1N5JA 2JBWA 4XGIA 1Y33E 4M6WA 3QF7A 1UL1X 1ESMA 4Q6WA 5ALDA 5IT9A 2C94A 2O6LA 2EXXA 3FLEA 1O97C 3D8UA 5I8PA 1TIPA 1CUDA 2C8LA 2V9CA 2FPPB 3BWBA 4UMVA 3VTAA 3SR0A 2RHLA 3JASB 2MHCA 3BMOA 2NU7A 2Y0BA 4BFLA 2G0NA 4S05A 3KQQA 2QG6A 1ZR4A 3UZUA 3X43A 1G8FA 5DVZA 3JQAD 1G4AE 1MNAA 1RKUA 2Y1KA 2VNKA 4AS3A 4G0QA 5EJ7A 3OZSA 1RJDA 2X22A 1PJ4A 2BI4A 1FVXA 1KIAA 5D2CA 3VISA 3C1AA 4WHMA 5IKOA 1EGVB 1K6XA 2CLLB 4MV7A 5EIXA 1CVRA 2ZJ8A 1ZVVA 4ZDJA 5I9LA 4DIOA 2JFOA 1Z5ZA 4ZVPA 2PS3A 5HFNA 5IM4A 1PJSA 1YBHA 2GX6A 3P45A 2BDTA 4LSZA 3X2EA 1QFYA 3T1HB 3VNQA 1H5NA 4D57A 2B5OA 2XTNA 4JI1B 2O59A 5A3JA 2WMDA 2GKOA 2FN7A 3IKMB 3CT4A 3L5OA 3Q5EA 4BNTA 1LX6A 1USUA 1Y1TA 3PQ7A 4FBMA 3TXXA 1FS6A 4I5DA 2IEDA 1FC0A 5KBYA 1EWQA 2C42A 3FYHA 1IZZA 4QXAA 2C3OA 4KO3S 3PP8A 3SHQA 1E32A 2ILTA 4ZO8A 1XJ5A 2O50A 3PD1A 5FULA 3U3RA 4CQLB 4Y7CA 1NQ5A 1LPNA 2J08A 3QLUA 4BZWA 5MDHA 1HDYA 4MIYA 4ZC8A 3QYJA 1Y8RB 4FWIB 4WFJA 2NU8A 3H11B 2JK1A 2A33A 1ZAKA 2JEOA 1HDEA 4QODA 2VDWB 2V0CA 1UBJS 2O3TA 3GEEA 3S3TA 1ABEA 3N5KA 3SSOA 1PK8A 4OH7A 3DE0X 1KYXA 2X86A 3C3CA 2QRJA 2GM3A 1UBOS 5C8YB 3EH1A 3IO3A 4E1BA 1UAAA 4TZKA 2JCBA 3M82A 3WJ2A 4CIDA 4P84A 5F33A 2V7PA 2WILA 2C78A 3FR8A 4QBGB 3TOXA 3S2ZA 3FDZB 3O4RA 3RPEA 5I9TA 4UNSA 4GLLA 4KK3A 3TVYA 3F7NA 2VTBB 4QFCA 3ZX5A 1XZHA 4ENWA 4UBLA 2PGOA 1U6KA 3IPYA 3LPCA 1PU2A 3WGMA 4OJNA 4DCNA 4E94A 2QW8A 2N75A 4PANA 2HYDA 1OXVA 4Y18A 1YAHA 3MFQA 3EMBA 4AQYB 4HVAA 4J4HA 3TTWA 1QYVA 3OT5A 3V5NA 5KYYB 1JDNA 1P9RA 3ZV7A 4CM1A 1WMEA 2VF2A 1OWLA 1IWBB 1ECBA 1GPAA 1JR2A 1Y6QA 2P62A 1TFRA 2R7MA 2X0KA 5TNXA 4F9EA 3WWDA 4B7CA 3SHFA 2QVGA 3RREA 1E1YA 4LCEA 3GCZA 2ZRJA 4YXWA 5B30A 4BNYA 3SJAA 2V7XA 5CBKA 2HLDA 3NYWA 3LUGA 1B8NA 4ZYLA 4FOTA 2W2OA 2VHCA 1ZU5A 3BGWA 1TKAA 3DNMA 1LSJA 4Q3KA 2QRPA 2Q6KA 1VIMA 5DSXA 3IJPA 4ILEA 4Z86A 3OC6A 1Z4OA 3HJAA 1RPZA 3S5UA 2W6ID 4FR2A 1M74A 3R9IA 1WXXA 4JEHA 1PFYA 4QHTA 1T0HB 3IIEA 5EWJA 3QITA 4KREA 2P2YA 2PKWA 1JMVA 1WWKA 3CHYA 3NU1A 4NS1A 1L5SA 3BM5A 3QU9A 1ADBA 3DE1X 3T6KA 3MJVA 3ZJ4A 5LD2C 2CLHB 4IDQA 3OKCA 2QUKA 3ZBUA 5KNBH 4QU5A 1PLKA 3W2TA 2QG4A 4X1YB 5KC9A 1E2MA 1D1TA 1A4XA 1XCBA 3GRYA 2AB0A 3RODA 5DM70 1WB9A 2PJDA 1VIYA 3ES9A 4R01A 2WM8A 4W63A 4ACAA 2WMOB 2VUTA 2ZTLA 4M9XA 4UUMA 2PRIA 4XM0A 4NHEA 2B25A 4IKEA 5DTQA 3IT0A 4ROSA 1GZDA 1WSWA 3OD5A 2C88A 3GRVA 2V4UA 5HQJA 3U1VA 1EA7A 1ZIOA 4S04A 3WNBA 2ZIEA 4P4GA 1OX5A 4MYRA 3D6NB 4OUKX 1XR3A 4FX2A 4Q1CA 5FNVA 4A03A 4ZFNA 2B8WA 4MW6A 4BRSA 1Z0DA 3GVIA 3J7TA 4UJ5A 4BVAA 1TOAA 2WPDA 1A9ZA 3S2GA 4CTMA 1B3BA 2GPYA 2B34A 3KDAA 4UTXA 1XVLA 1O08A 4HR7A 1YBMA 1TIKA 1TUBB 2PR2A 3PUZA 4OBBA 3Q9NA 1NP6A 3ZYZA 4BV2A 1JPJA 3WXMA 3V7FA 2HEIA 1VBNA 4P1ZA 1Q95A 1ZFNA 1QH8A 5BOSA 3B89A 4F3KA 3QPBA 4RV4A 2JLWA 1U2QA 3BJZA 1FTQA 1EFKA 4LFAB 4DNXA 3IPXA 1J6UA 2D0OB 5EN4A 1XU9A 2I7CA 2VJNA 4LJRA 3FFAA 1YC5A 3WK5A 1KBOA 2ID8A 3LTEA 1DDGA 5AKZA 1MKYA 1T8PA 4NYIR 1M8KA 2QMUA 1KR2A 4S1TA 4I3GA 4EQ6B 1H4QA 3OQNA 2QXTA 1OC2A 3LF1A 1EA5A 1GILA 1ZOLA 3OP4A 1AKVA 4YQZA 2PLRA 1PO7A 3FOFC 3DBLB 4ILKA 1RQLA 1XTQA 4RF2A 2FMKA 2H17A 4XRGA 4WZ6A 3G23A 3UWOA 4F6RB 3U31A 1LVUA 2YY5A 5BW6B 3KWMA 2Q7OE 2JFZA 3H9GA 2DKFA 5CA1A 4Q9IA 5FX2A 4BLQA 2Z9CA 3ABRB 3Q7QA 1T9AA 5DHAA 1IBLB 4R1MA 1NF8A 2C97A 2D0IA 3AGPA 3ENWA 4U7GA 5CXXA 2C1XA 2FP4A 4LDNA 4OUDB 1DVRA 4PBRA 1YZVA 1P9LA 1TI7A 1XD2A 4QM7A 3ZHQA 2VEOA 4LHZA 1T6ZA 2Q6TA 2BBOA 4ITRC 5JO0A 1E1LA 1CUUA 1JKMA 2B98A 1BO6A 3UHAA 3R8FA 2BFBA 4J2OA 2GRUA 5CXQA 3NUZA 3H5RA 1F7VA 2Q6VA 3BZWA 5KJ1A 2ZKLA 1JLLA 3KXPA 3ZW8A 2H7CA 4ER3A 4BVHA 3T3PB 6GPBA 3AINA 2O3UA 4D5EA 3HKCB 3ROQA 2R8PA 4UE3S 4JITA 4GYYA 3L6CA 4FI3F 4G0PA 1GKYA 3GMSA 4IM7A 1Z6AA 4HKTA 1B0AA 1BROA 2POQX 5FA5A 4WMLA 3U3OA 1F51E 4TKZA 4ID9A 3ZE7A 4TS4A 2C4UA 3BIOA 4XWOA 4A2QA 1TKCA 4QYXA 4R40A 2ZIXB 4Z0NA 2W11A 2XRMA 3U4QA 4RHYA 3UB2A 2HN9A 2DPMA 5ALHA 4B8ZA 4B9AA 1MRSA 1O58A 2GPWA 3BDIA 2H5IA 2QV7A 4JOSA 4OV6B 3E84A 2GVZC 4YH1A 2OZVA 2WF9A 4EA7A 1KZ4A 4Y9UA 3TRDA 5JNVA 3ROTA 5AVKA 1WVGA 3U3MA 3I32A 2JAQA 2DY0A 2HJHA 3C6ZA 1U7XA 2GI4A 2Z6AA 1LDEA 3VV3A 1XZFA 4JVLA 1GCOA 3HR8A 4MYUA 3F4LA 1A98A 1WE2A 3AKCA 3WXBA 5AK3A 1FRFS 2QM3A 5CURA 4B48A 4W5OA 1WNFA 1KYWA 1QHFA 4KITB 1CR0A 2VJAA 2WQZA 3K5HA 4P3YA 3DLTA 3KKEA 5CVVA 4TV9B 5EYPB 1IHOA 4QFMA 1EK5A 1K7YA 1O6BA 2E4XA 2XIJA 3C87A 4MHOA 1W59A 1JVNA 1J5EB 1AUVA 2XWJI 2W98A 3KV1A 1EWRA 2P1ZA 3CLHA 4MPRA 5A1TA 2Q9AA 3EX7C 2V9ZA 3AESA 1T0PA 4E0BA 3ZE2B 1R15A 1Z82A 2QR5A 3CIOA 3C6QA 5MHTA 4TUYB 1UKVY 2G9VA 4C7BA 4WADA 3E3NA 3FNRA 3USZA 1QCCA 2Q1UA 4AWAA 1QVWA 1YDEA 3LHKA 4Q82A 1SXQA 1RWKA 4HDOB 4BC1A 3C15C 4CU2A 1QS0A 2ZIWB 1AXGA 2HCTA 3LC0A 3MPUA 5EQJB 1V45E 5LA6F 2H1OA 2G5CA 2WJ4A 3LQQA 5BMVB 3L4SO 4IEFB 3TAXA 1IMOA 3LUHA 3FCAA 4K6MA 4HATA 3IDAA 3CX3A 5TB5A 4EA6A 5DYIA 1ZIDA 2P27A 3QF4A 5CFLA 3RR2A 1OH5A 1X80B 4QX6A 3W8EA 4N5IX 5BSFA 4V02A 4BFUA 5L7YA 2H48A 3HH8A 4BJ6A 2REBA 4PYLA 2WQ7A 2JHAA 4MEJA 2IQIA 4GKVA 5T4EA 1J23A 3TW8A 4DTIA 3EEQA 3C8ZA 1FTYA 3FSJX 4ZEOA 4FGWA 3ZVRA 4H4CA 5B1YA 3ROFA 2WJZB 2EKBA 1NE2A 1WEHA 1BXKA 1JHYA 1XROA 4JA2A 4KO4S 1N5OX 1KSGA 2H31A 3DEYX 3BL8A 1OTYA 3R5TA 4H7HA 4R1OA 1OGYA 3HJNA 1RCUA 2H1IA 5ALYA 1UQRA 5EUQB 3WYNA 4Q1BA 3PPIA 1WD7A 2X8LA 2M6SA 2QNRA 5JD3A 3T95A 3BJRA 3BJIC 5FOUA 4HNSA 5DIZA 5AVYA 2IEGA 4B8WA 3FOAA 2XITA 3PICA 4U0JA 1KPHA 1P91A 4AJEA 3SF8A 1CJTC 3I4LA 2COKA 1T8WA 3B6JA 3FZNA 3H2ZA 1XCPA 3SDSA 2C2GA 4F21A 1QGUB 1NLZA 1EX1A 3A4TA 1KEPA 2BMAA 1IN6A 3Q7EA 1JL3A 5EGNA 4IL5A 2PPLA 3A6GA 3A4MA 1A9RA 1GUZA 1KZYC 1XLTC 4FYPA 2F3TA 3I39X 3B7GA 3UICA 3MUOA 2BFCA 2AVDA 3IB3A 2DERA 5B37A 5TS2A 1FSFA 2IZ0A 5E6SB 2ATEA 2QENA 4CQMD 2HYIC 4XUEA 5FO1A 3UJDA 4G67A 3B13B 3E15A 1L7NA 3V3TA 3VHQA 4HI0E 2D5AA 2I6QA 4XB2A 2ODBA 3ZS9A 4DBLC 4DIUA 5EWLB 1SVMA 2A7QA 3FETA 5CNIA 3OE4A 4CKEA 2X8JA 1N5KA 1ODFA 2VNSA 4DPKA 4BIIA 1E7RA 4LTNA 2XNCA 1V7ZA 2C1EA 4ZEVA 3GJTA 1Z5PA 4OGLA 1L5OA 3D02A 3LKZA 4DARA 5ITZB 1CVIA 3KRTA 4HQNA 4OGKA 5A2GA 1QH9A 5JCPA 3K09A 3MRVA 1XE3A 3FLMA 3HR7A 5HF6A 4X6LA 5KYWA 3CH6A 4CODB 1XZIA 3ZDQA 3LLSA 1RQGA 2Y92A 3FW1A 1RJEA 4MS4A 5DTJA 3VSDA 1LDMA 1NKVA 1YZKA 2BEKA 2WF8A 3C6XA 2GETA 3AY3A 2E48A 5A9TA 3TE6A 3K9FC 3U19A 3ZZUA 1U80A 2ID4A 3DEFA 3LT0A 1V43A 2CNOA 3EVCA 3G59A 5IAJA 5CITA 3IODA 3FPSA 5H82A 2D1QA 4YP7A 4J8PA 5ELLA 2B8TA 4IYRA 3Q98A 1SU8A 3PPYA 1KYIA 3G6WA 3SXJA 5IMBA 3OT1A 2VQ3A 4LYGA 4KQHA 1HTBA 1KYTA 2DT5A 3KB6A 4CVNA 2A1TS 3FTPA 4ATNA 5IHPA 4I1PA 3P4YA 3CEMA 1ZUNB 1P7PA 4WXPA 1IY2A 1NIPA 4YJ3A 3STYA 4AYTA 5HZMA 4RA6A 1ZOSA 5JY1A 4HMQA 5AJUA 3V55A 2PT7A 5HTKA 2LVBA 4BZZA 3QFHA 5KYNA 1Y8ZA 1E5TA 1SUBA 3G82C 2Q3FA 1D7AA 3NBZC 3TD9A 1NF3A 1NP7A 3L18A 4RZ3A 3ZN2A 3IE1A 1E2PA 1UQUA 1FDRA 1XF1A 1RTTA 2EL7A 2VRBA 4D9EA 5BQXA 4XZ3A 3ILSA 2ZITA 4JDPA 3BB3A 1Z0UA 4UPVA 3DL7A 4YROA 3CJRA 1HPLA 5DWQA 5AUQA 3WLSA 4L0MA 1W4RA 2NSYA 5IJZA 4A2CA 1PYOA 5KOHA 2FI1A 3U40A 3BGIA 1A04A 4MP3A 3GLGB 5TE9A 2WG1A 1Z5GA 2GFQA 4UBOA 4ACBA 3QG5A 5F5XA 5JYEA 2F9MA 1HE8B 4FT4A 1F0PA 2Q21A 4UHHA 1W19A 1CRQA 2R4TA 4GX5A 3TIGA 4A6XA 4IX1A 8AT1A 4WINA 4NLLA 5EE0A 6REQB 4TLDA 5IXJA 1IJFA 2A1UB 3TR5A 1FUEA 3BMNB 1GAJA 3HCDA 4ZQCB 1E0SA 2R4UA 4Q3LA 4C4TA 1OA0A 1URPA 4CIYA 2IS4A 1NZFA 4KV9A 3V7NA 5CFNA 2H2HA 4IIXA 2V4ZA 4P3PA 2ZRHA 3VR4D 1UUFA 4IEEA 4B47A 1GPNA 4R8MA 5AXBA 4HNUA 2FQYA 2PD3A 2XQFA 2N1BA 2XE6A 5GJWC 3AJ9A 1HDZA 4KE9A 1XCGB 1L8AA 4WE3A 2D5LA 2VJYA 4N6OA 3ZWYA 1PL0A 1V16A 1XA0A 3V4OA 4PSCA 1ZCBA 3P0HA 1RT9A 1GG8A 2OLEA 3EDYA 4UTVA 4IJVA 4K0RA 4RPIA 4XJSA 2XGGA 3JATB 4U2BA 5IH7A 2ENWA 4EI7A 3KVYA 4HLQB 4B6EA 4L8LA 3QUAA 2D1TA 2N3ZA 4J1TC 1AC5A 2A88A 3H5VA 4TS3A 3V34A 1XKLA 3E9YA 1SG6A 3VSBA 4BIMA 3L8MA 1TJ4A 1I7DA 4FW9A 4UUOA 2FW7A 1DIAA 1L9KA 4RF5A 4NENB 5DBGA 3EEYA 1XYYA 2NTYC 2XNHA 1UMBB 3DG9A 1EM8A 1VCIA 4IVRA 4KP7A 4Z8YA 5KVQA 4DMMA 2TRSB 3RSHA 1GGNA 3NT2A 3PVZA 1JSZA 1C7QA 4U5QA 2JJMA 3MZ0A 5TEWA 3AY7A 2ZJBA 1E1QD 5TJHA 2GYUA 1N2OA 3DV0A 4IDEA 3GLHB 1SWVA 2Y2VA 3FCSB 1K68A 4OL0A 1DKRA 4O0MA 3UMJA 2VQDA 2HRBA 1TMOA 2V3WA 3I3OA 3NW9A 4RFVA 5EUMA 4A8HA 2IZ1A 3AR2A 4H15A 3HLYA 5EKXA 2GDZA 2W43A 3DOFA 3L8GA 3G2PA 5DHQA 1XFAA 3FX2A 2ZUTA 8ABPA 3JQ8B 1YV9A 2ODPA 4AUEA 3VDRA 2ZYSA 4OF4A 2NSJA 1T2CA 4UUNA 4YJGB 5EGSA 2JHCA 1C4WA 1GGMA 4WLVA 3ZK8A 4X65B 4BZXA 2X23A 2YMPA 3PXDA 2BGTA 4I9UA 2D5CA 4OY3A 4WESA 4CV2A 3T5BA 5JYCA 5F5NA 4HRXA 3OPYA 2W4QA 4FNOA 2WLTA 2ZYUX 2XF2A 3HEBA 2REXB 3UIEA 3RTEA 1BJRE 4K9RA 4JBLA 4DV2B 5SV2A 3R0QA 1D4AA 2ODNA 3EG9A 5GONA 1Z83A 5M2QA 3NGMA 4ID3A 2Y1FA 4GPBA 2CVZA 5G2OA 5EZQA 4RDHA 1AQUA 5B4TA 5D86A 4BKRA 2WDZA 3BTUA 1BWRA 2RH8A 4JP2A 4W5QA 4I66A 1NHGA 1NLYA 2AHOA 2VKTA 3FMIA 4KMSA 5EHNA 4AJ4A 4Q12A 2R6GA 3I0NA 5K8JB 2OLKA 4HTFA 3LUFA 2IDKA 1AO0A 1FW8A 3N05A 1VSBA 1UKZA 1KSFX 2WYUA 2BGKA 2XWPA 3DAPA 3ZWKA 2XOKA 5EI5A 1QH1A 1XLTA 2YCBA 4HZIA 4M0MA 4FK8A 4ZWNA 3Q7RA 4HDAA 1YQQA 4DLZA 1GZ5A 1UZUA 2WICA 1UANA 4EAQA 2PZ8A 1PSDA 2DC1A 3OCVA 3DEAA 1GKIA 4X3CA 4P3KA 4OGFA 4P93A 1KDYA 1JALA 5LU9A 1XK6A 4MQFA 4LN1A 3GV0A 2QLLA 2RE8A 2RH9B 4O8ZA 3FMVA 4Z4QA 2FW0A 5K0TA 2WZCA 4C20A 1C30B 1P44A 3W5UA 1CVLA 1E2DA 4WOBA 4MSUA 3WYEA 4E13A 4IF4A 4TKUB 1GR1A 3HBAA 1ZNZA 2V59A 2XCIA 4LG1A 1WW3A 1XYVA 4YV2A 3QLJA 2P5SA 2B4AA 1X7ZB 4YUAA 2CMKA 2DG2A 2ZTSA 3CGWA 3V1LA 1ZM4A 2O5RA 1EAMA 1L7VC 3L77A 4HYTA 1W36D 5I8WA 1DTWB 4MAAA 4WL0A 4HUJA 1W75A 2P8JA 3RJ5A 5IBRA 5MN4A 3EXIA 3PYXA 4NMMA 1MTOA 1IRIA 3ZY5A 1H4TA 3I6QA 5CYPA 1QYXA 2OXIA 1T1IA 2GILA 1XMIA 4NU8X 3VR5D 2R1UA 3QMMA 5EHGA 2QAIA 2W7TA 4ZI7A 2AMFA 2PS0A 3ZQJA 3FFTA 1Q84A 2VTKA 1DBSA 1GKUB 1J5XA 1Q0QA 2X9LA 1T0UA 2Y0CA 4KZPA 5EJIA 1GZUA 1HA3A 4EBFA 1YXMA 4YT5A 2CWDA 3DNPA 5HCNA 3ETLA 5LOVF 3V8NA 5K3FA 3MTIA 4AU1A 4TTIA 1KI2A 2JDIA 5LDHA 1HLPA 4CCSA 1KHTA 3F2IA 1JR3D 2VDPB 1TPYA 5AQEA 5FPPA 5LZ8A 3HGQA 2QTZA 3W5SA 4DLBA 3PSAA 3V8RA 1PNTA 1PLLA 4E88A 1Q7RA 1I4DD 4QRHA 3IEVA 3U48A 1ETUA 3LT5A 1AGXA 4DV1B 2GWHA 2ZI9A 2VSNA 3I2YX 4LMAA 4DLAA 4B3TB 4FX5A 3I9MA 5FUVA 1QFZA 2Z1NA 1QK5A 3HP4A 1TIBA 1FBTA 4IQGA 1A2KC 2NZ8A 1YL5A 3VNVA 4KBGA 4PYJA 2JG3A 4FFBB 3RS5A 3WGVA 2YS6A 3Q9SA 3WE7A 1INLA 1IVNA 1RWWA 1VE6A 2AEMA 2RDMA 2ZSJA 3KIPA 4G63A 2SNIE 4P3OA 4PLWA 1P5FA 3GGPA 5JS7A 1DEAA 3LP6A 1H69A 5J4KA 4X85A 5LQKA 1QYRA 9ABPA 4EG7A 3RYCB 3A58B 2BMJA 1HH4A 3GJ5A 3SVTA 2FGJA 3JRNA 4CEHB 2IS1A 4YJHA 5AKLA 4RD1A 1H5UA 3LFHA 1VE7A 4IFIA 4ZOBA 3T9BA 4IUDS 3HTXA 5ALOA 1VL8A 2ZSUA 2PS9A 1U2GC 4OQEA 4G5OA 3ZDRA 4ZZ1A 3CF4A 1QO7A 4HH3C 2QW1A 1FLVA 2BMWA 3EMKA 2JC3A 3SSNA 3W9BA 2ZAMA 1ZKDA 3DMHA 4PFQA 2PMEA 3RWMB 3SN6A 4KLNA 4BXOB 4P4NA 2X4GA 2IV3A 4KDEA 5DTRA 1QCZA 2X0JA 3JD4A 3D4PA 4TYPA 4DNQA 2AFHA 2J6BA 1M1YE 3LQFA 3GMTA 2FPWA 4DUGD 1EG2A 4PZLA 3LHIA 1RWVA 1MCZA 3K7EA 3FD8A 4J1TA 2Q2OA 2I3AA 1EYZA 3G0IA 5AMXA 5BV0A 1MG0A 4ETIA 1FJHA 3WNVA 3KQHA 4PQRA 4BKPA 4EPWA 1E8DA 1S4QA 3RFUA 4HQFA 4HO1X 1MQ9A 3FDJA 2V54A 4D8YA 1JVBA 3ZIAD 1ZVMA 5JCXA 1NMEA 2BISA 1SUEA 2GQ0A 2ZUDA 4MJLA 1EBFA 1X1TA 2ZJ3A 4WOKA 2CMHA 3NBYC 4B5LA 2O2EA 1CY1A 1GL6A 5HIIA 3STWA 4FDLA 3TZLA 5KU7A 4DIMA 2EJBA 3A1DA 3IIIA 2W8BA 5LLDA 2J7PD 2AZ4A 3I8XA 1E7YA 5T6BA 5BOVA 3ND7A 1YOVA 2HMVA 2X6RA 3SZ3A 3OQ6A 4KYUA 4XD7A 3HV0A 1D2NA 2ZQ5A 4FFSA 2ZBEA 4JXKA 3UEOA 4XTCS 4IHKA 4JL8A 1U7UA 4FE4A 4XARA 1QIIA 1WDMA 2NPOA 3DZCA 3TQCA 4B6GA 2F1IA 4Y6LA 1NP3A 2AOXA 3TLAA 5FWXB 1X8KA 3U09A 1GXSB 4WCVA 4JNCA 4X5OA 3VNAA 5DM4A 4WY8A 2AMYA 1BX0A 1A27A 3A6JA 4YNBA 3F3MA 1XQVA 4KQXA 5JG7A 2TSYB 1ZS9A 4PN7A 1RZ3A 4GNRA 1TEXA 3C8UA 4OJMX 4MI3A 2B6HA 4BB6A 3ZDXB 1PQYA 1UBFA 5F35A 5KNBA 1MX3A 2GTIA 2O52A 3UB4A 4P33A 4RPGA 5B55A 2DQKA 5AW3A 6YASA 3BRWA 3NALA 5A7GA 2R0QC 4EKGA 4HYQA 5CGQB 1PVVA 3U7QB 3ZXXA 2XT9A 2F48A 1JQJC 3EW7A 3KTOA 4BO0A 2HIHA 3C85A 3VMMA 1OU0A 4WLUA 3PKIA 1D09A 4B40A 3VPAA 1IB6A 5AXCA 5CLFA 5I6DA 4U8GA 1WPRA 1K2WA 1M8GA 1YHYA 4Z5XA 1VFPA 3AVVA 1IEWA 5EA2A 4GUDA 1BDBA 2XBMA 5CMLA 1NXTA 4RE5A 3ENKA 2PEZA 4G3XA 1IULA 1ATIA 2BELA 4PRZA 3SX0A 1JEYA 5COAA 1U2PA 1G8PA 1T9GS 3AL2A 4JKOA 4E21A 2GM5A 1A5ZA 1LGYA 3T1QA 5ECWA 4KRFA 2TMKA 4TMFA 4QXOA 3SOPA 4C2TA 5TR9A 1VJ5A 1YJAA 1N8SA 1E9AA 4RLSA 2Y77A 4ZAWA 2PKQP 3QKUA 3UJHA 1L1QA 3CUWA 5SZKB 1XNQB 2ANBA 1U5BA 2UYQA 3H7AA 4O4JB 2OBXA 3GARA 5DBEX 4B2YA 1QU2A 1BQ3A 4A26A 1OIWA 3ZWCA 2L19A 3VJRA 1CF4A 5C32A 2I7TA 1L4EA 3NG1A 3LPMA 2DUWA 5K0JA 4UQLA 4DIDA 3IKJA 2ZUFA 1LC0A 4RTKA 5DSZA 5DNVA 3UWPA 3GD7A 1J8DA 4D9FA 2JK0A 1MGOA 4FLMA 1A7AA 1UBSB 4CKWA 1LLDA 1KE2A 10MHA 4HEHA 4C4SA 4UNPA 2PUDA 4DV3B 1DWUA 1KA9H 4RH0A 4OI1A 2VTVA 3PR1A 3TN7A 4ZJUA 3PUIA 2ZR7A 1NBME 1TYCA 4KR9A 5EUBA 2HW8A 4ZYYA 3PS9A 1RWQA 4OU5A 4Y9SA 3UMVA 1SC4A 2D1FA 4PY2A 4XXHA 3TRIA 5FNZA 1FLNA 4L15A 4BNZA 4FMPA 1BEUB 1I4WA 3CPSA 1NDHA 3JALB 2Q62A 3L01A 3HM2A 2EFEB 1JHXA 4O1IA 4EY8A 3T3OA 4C0WA 3ZWWA 1BKDR 3GWZA 4FIZA 4OLJA 1B0UA 1FPQA 3O8QB 5KYXA 4ERNA 4UHJA 2ABWA 2GH1A 2D62A 2ZUUA 1Z7EA 3COSA 3PK0A 5SICE 4JZKA 3EFEA 3GT3A 4JLKA 1G1AA 4JUFA 3Q5GA 1SM4A 2VCHA 1L7QA 3JQ6A 1Q0LA 1OGIA 4G65A 2HA0A 2IYPA 3R09A 2CXOA 1G9TA 3L4EA 4AQDA 3NTOA 5JNLA 1QRUA 1VECA 3G5MA 2DBVO 5AI6A 7MDHA 4M86A 4JBIA 3O4IA 2VJLA 3ZNOA 3C8MA 3KT6A 2QTNA 4OREX 4B4WA 4G8BA 4ODIA 2ZTUA 3RSSA 2ZXUA 1EFPB 2O19A 3AVYA 1FRZA 3T7TA 3BF7A 1OILA 2HWXA 2YWDA 4UEKA 5JJKA 4NFSA 2PUFA 4P7BA 3L7LA 2OHJA 3KP1A 4KQEA 1Q44A 4GWLA 1KDPA 1QWOA 2AF3C 3A1TA 1JEEA 2OO3A 4PZYA 4Z51A 1QMGA 1UOEA 1KJ9A 4U6QA 2P4HX 3ZVKA 1JLHA 4KPUB 5K0BA 3B6KA 4Y2QA 4TT3D 1WMBA 3LIIA 3N6XA 3WHIA 1CE8B 2Y2UA 1GZ3A 3RD5A 5TPZD 2FYTA 5JZVA 1HEUA 3DAOA 3TNLA 4G56A 4ZQEA 5C1PA 3BTOA 3R3VA 1G5RA 4FMCF 4TMKA 4WVLA 3PENA <