2HWYA

Structure of pin domain of human smg5.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
158
structure length
116
Chain Sequence
b'PYLVPDTQALCHHLPVIRQLATSGRFIVIIPRTVIDGLDLLKEHPGARDGIRYLEAEFKKGNRYIRCQLYKILDSCKQLTLAQLPLDNPSVLSGALQAAAHASVDIKNVLDFYKQW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein SMG5
publication title Structures of the PIN domains of SMG6 and SMG5 reveal a nuclease within the mRNA surveillance complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 32
structure length 116
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13638 PIN_4 PIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold 5'-nuclease 2hwyA00
1V8OA 3DBOB 4CHGA 3Q8KA 5ECDA 3H8SA 3ZD9A 1V8PA 1BGXT 3ZDCA 5L6LB 3IX7A 2IHNA 3H8JA 3ORYA 1B43A 3Q8MA 5HMMA 1RXVA 3QEBZ 3ZDDA 1XO1A 1TAUA 5L6MB 3ZDEA 1RXWA 1O4WA 1V96A 5ED0A 3ZDAA 2WP8J 3H87A 2FE1A 2QIPA 2LCQA 5FV7A 4WA8A 3QEAZ 2IZOA 5SV2A 2BSQA 4XGRA 1YE5A 3QE9Y 5H4HA 2HWWA 3I8OA 4XGQA 3ZVKA 1A77A 5HP4A 1UT5A 3TNDA 5K8JB 2MDTA 2H1CA 2HWYA 1TFRA 3H7IA 3ZDBA 2H1OA 1TAQA 1W8IA 5ECWA 3ZD8A 4MJ7A 5H4GA 1UT8A 2DOKA 5HMLA 1EXNA 1MC8A 5ECYA 2HWXA 3Q8LA 1UL1X 3H8WA 1A76A 1Y82A 5HNKA
chains in the Genus database with same CATH superfamily
1NMZA 4JP8A 4L78A 1C4XA 1NTOA 3HXKA 4C2AA 3RBXA 1NOJA 1VKOA 4XSHA 1KAMA 1DFGA 3DUWA 1NRXA 3B20A 2EDAA 2MOKA 1P3DA 5DLPA 3BRQA 1FNDA 3F7NA 3EGXB 4GYKA 1BW9A 2AJTA 5TPWA 4BC0A 4QDZA 5HCUA 4IHKA 4ND6A 2C2GA 5HM8A 3LCMA 4UNIA 3C3XA 5EWMA 4V03A 4ZEMA 4XD2A 4Y1EA 3TECE 1ZOOA 2OP1A 3G5MA 4YFVA 4ZN6A 5MGNA 4QYIB 2GN9A 1U3UA 2ZJYA 2YHIA 1P77A 3N70A 3GDFA 4W5OA 2ZR0A 5IN5A 5B3AA 1FZTA 1X7GA 3RHFA 2C7BA 1GPAA 3P2MA 5HYVA 3BORA 1S8OA 1NVMB 3HI6A 4OQLA 4I1YA 1K6IA 5B7QA 2QN1A 2JFPA 4MVXA 4JI8B 3OEED 4JUFA 4F9GA 2JFUA 4N5HX 1YBFA 2D0OB 1NJ1A 2HDNB 2NQ2C 2CDNA 3NUZA 3R6DA 5EP4A 4YGXB 4KDEA 1VA4A 5EERA 5TPZD 3RK0A 4C21A 1CYEA 1KK2A 1XN1A 1BH6A 2BGUA 1CX9B 2I4NA 3BG5A 3HU3A 2ECQA 3ITEA 3L1HA 1OFVA 3ME5A 4UE2A 4BVJA 1BHJA 3RFTA 4DBZA 3MWYW 1EG2A 1FFSA 4MVJF 4I6JA 4YQZA 3A58B 4YX9A 3M1IA 3TR6A 2ZR7A 2VHXA 3R2JA 1GPH1 1U0RA 3SOPA 1Q11A 4KTTE 1N2HA 2B4QA 5IJZA 2ZM5A 5FP0A 3TDNA 5ALJA 1R6DA 3F7TA 3FZYA 3WQBA 4BNJA 5KQLA 3IVAA 2OV4A 2CUKA 3NT4A 5KYWA 1KVQA 3EN0A 3WWEA 4EMSA 3GVHA 4BZZA 3JWPA 1USUA 3NH6A 3MMSA 4UMEA 2OHJA 2XBLA 4UBKA 4CETA 2NZYA 2CV2A 3T3IA 5KX5B 1QQTA 2FG7C 1VKHA 3R76A 4D9MA 4ZI7F 3H83A 5FNVA 2OBYA 1UC9A 3AFMA 4J6FA 3VU9A 3U16A 3IPAA 1I1QB 1XDZA 5AJYA 2ZIGA 1MDFA 5H4HA 1XLUA 1B0PA 2EWWA 4NXNB 2P3SA 1RR6A 3P32A 4FLMA 4EG4A 1K6XA 1I2BA 4IJWA 4LNUA 3HKBB 5D6OA 5FTNA 3UGTA 5JD4A 1YFZA 4JVNA 5IH3A 1IU9A 2WA1A 1TUBA 4H6XA 3T3OA 3IIMA 4PQGA 3BSFA 2PG3A 2WMNB 2DY1A 1FQOA 2LD4A 3DFUA 1U7TA 2QRJA 3JWJA 4NK5A 4UPVA 521PA 4DLXA 2AG5A 3EK2A 3AM4A 1KU0A 4L7QA 3OE7A 3HY6A 3G1UA 5AOVA 3WZ2A 3N2NA 5FV4A 3BCRA 4MQMA 1D8AA 5SYMA 1ZD4A 4TSKA 4G4SO 3DYIA 3FKQA 3E9EA 2CUZA 4P4SB 2IJGX 2GKGA 7REQA 2I3AA 4BO8A 1EJBA 3P26A 4XE5A 1T5DX 5FA8A 4IUDS 4TUYA 3O2QB 1XHLA 4KO8A 2CK3D 2CL0X 1O9BA 5DP1A 3TIFA 4IIEA 2VJLA 1LPMA 1T9AA 2ZPAA 3MG9A 4QUAA 2BZ0A 4DDHA 4WZBA 5LD2B 4J3FA 3OEWA 3ZV3A 5KHOC 5DGTA 3CWZA 1YQDA 2AN3A 3OEYA 2HNKA 1TOAA 1LFAA 1TO6A 1XVLA 2AJCA 2GLXA 2I76A 3WLMA 2XY4A 2WUWE 1E64A 3LJKA 3T5MA 1IXSB 2D2EA 3C5HA 2QEQA 4H7HA 1ADGA 4A0RA 3QVGA 2W0SA 4CKBA 3BMNA 4EGFA 3BWDD 4HGNA 2PAFA 1BOFA 1SKYE 3WAJA 1A69A 3CTPA 1XXLA 1DIBA 4UU1A 1BQ3A 1QFXA 3V6LA 1IE3A 4AF6A 3H9QA 1P0QA 4LF7B 3GVPA 3FRIA 4QJ3A 5IZCA 4DSNA 1JB9A 4QLAA 2OZEA 2PE5A 3F78A 2QT1A 4RV5A 3W5UA 3WGKA 5HGXA 3LSTA 3F1LA 2CLMB 3DCNA 3VAAA 1RBMA 4P7KA 1YASA 5LYJF 4FOTA 4E5DA 4LJYA 4UBOA 5K0CA 2P4UA 1SHUX 3C74A 1M76A 1URPA 2GEVA 1DARA 4Z0TA 4XWKA 1J07A 4RHCA 3MJEA 2FJPA 1G41A 3W9SA 5HA5A 1IUOA 1DKPA 2PSEA 4JLNA 5AW7A 4H7JA 1D3AA 5BSMA 1E2NA 1EFVA 1Z36A 2QU8A 3KJHA 4X3CA 2WY2D 5JS7A 3BE4A 5E6UB 2X0NA 3E0XA 1VG1A 1HNNA 1RWXA 5FO1A 1ORTA 2K87A 4XR9A 3T7DA 3TL6A 2I2CA 5LP6A 3QSYA 4L3WA 1PS8A 1UMKA 1TQ4A 3O7MA 4UTOA 1Y3IA 4C6SA 5B6PA 4RLSA 3BD9A 1ZXBA 1L5HB 3KOYA 2QLMA 3FR8A 3D3JA 2D2XA 2WI8A 3PNVA 2AI2A 4PYMA 1RPNA 4IEIA 2DHQA 4OXYA 1JT2A 3GH3A 3QKRB 1QFJA 2AK3A 1FOEB 1P0FA 5DO9A 4M76B 3A1FA 2XMZA 2OFPA 1C30B 1I4OA 1LDEA 2FSSA 3AESA 3H4TA 3LBFA 4RVSA 5G0TA 2P35A 4EVRA 5BVHA 1FMJA 1E2KA 1SWVA 1SUFA 2XOKA 3K1TA 3OJWA 3ZWVA 4H15A 2YN4A 4N3NA 4BX8A 5AVZA 1XPJA 3IA2A 5EQTA 1XVVA 2GFHA 4CL0A 3VISA 3KKOA 5E3HA 3WKEA 4BVHA 3FPHA 1GKKA 1LGYA 3HG7A 2HXSA 1P1IA 4UNNA 2BJWA 2ZPTX 4XPZA 3IEXA 3L4JA 2B2XA 5FTKA 3JXEA 3G88A 1JPJA 1XEAA 3DLAA 3QJYA 3CFYA 4IY1A 3HBLA 2Y1LA 1Q2XA 3DUFA 1KJ8A 2J3IA 2ZKIA 3T1NA 3JQGA 2HLPA 3BWEA 3VR6D 2J3MA 1KERA 3RFCA 1QMPA 5L7TA 1PFWA 3EVCA 5DZSA 1TYEB 2VSQA 2VNHA 3MWEB 4KIFA 1MA0A 3LE8A 1T1IA 1MGOA 2GK4A 4G1EB 5CFRA 1PGPA 4PO1A 2R5FA 3FRHA 1CEQA 3H05A 1G6HA 3FNFA 2EX4A 3IAHA 3ND5A 5BNTA 1GZDA 4PO9A 2AFRA 4D98A 1O4VA 2F6RA 2QPAA 1N2OA 2ZAYA 4P92A 1I4TD 1QNFA 2DECA 2A67A 2EP7A 3CNNA 3PYXA 1G3UA 3C8DA 2I1WA 4TMYA 5JANA 3GP3A 4L74A 5HIMA 1TIKA 4DM7A 4FDVA 4L4UA 2HMUA 3UMSA 3TVTA 1OMOA 2W6IA 1SKBA 2WJZB 3A27A 3L0YA 3C98A 3EIFA 2RHGB 3O2SB 5G1PA 3RVJA 4DPMA 4PPGA 5AKIA 3KOMA 2VK1A 3TG8A 1UDCA 1DXOA 2HTFA 2AV6A 3GLVA 4FZJA 1O3YA 3L82B 3LL4A 4MJ7A 4RSHA 1XAHA 3EAGA 5EKXA 1E3IA 1RC0A 3RS2A 5CT4A 2QY9A 3HNOA 3PRHA 4FYWA 4F4UA 1WSWA 1DZIA 1DV1A 2YX1A 4P35A 3NYQA 4QRIA 3L07A 4DFDA 5BYKA 4KIJA 3TQOA 2DPHA 1YJQA 3WKAA 4EVSA 5GIPE 2D5BA 2YZKA 4PSDA 1OQAA 1Z68A 1C1XA 3DXXA 2HK8A 2KBFA 3PX2A 2DZDA 4V38A 3NX4A 3CPJB 2X8JA 5CIWA 4NEHB 3L77A 3QYFA 5FWYB 1A7UA 3TB4A 3VYRB 1E9BA 4XTCS 3KP1A 3CNOA 5AK5A 3TL3A 5CG1A 5KC9A 2VXYA 4ZALA 1O96A 5DI9A 2IK8A 2JLAA 3MBIA 4AUKA 2A9OA 5I4IA 3BAFA 2O8EB 4BFCA 1HFEL 4JLSA 2HC9A 1KETA 4OKSA 5CCXA 3BIOA 3N28A 1BCSB 3OY7A 1E3SA 4JU9A 2PMEA 3FDFA 3HWSA 1MH1A 3I30X 4RZ2A 2JFNA 2PZ8A 3UH1A 1V0JA 1KYTA 3IURA 4IGFA 3D1VA 4ND2A 2HQSA 4IV5A 5D84A 1WZIA 5DTEA 1B43A 4NEQA 1R8QA 1E1CB 1NBIA 3GRFA 2W93A 4F5DA 1N0HA 4QYSA 5TEVA 2ERYA 4O2BB 1U31A 2RI1A 4KV9A 2HA6A 4CF5A 1RXVA 3DULA 1CE8A 4COOA 2XCRB 3KZCA 4W1SA 1H9AA 3TXAA 4P3YA 4M1EA 4KFRA 4U5QA 2IE0A 1V43A 2NO6A 3MT0A 1IULA 4O3MA 1Q7GA 2IDKA 4JODA 4DV4B 1PBTA 4O25A 4HGPA 1UJBA 5ALLA 1II0A 5EN4A 1OLSB 3EGEA 3ZZMA 2LGJA 5JCOA 3HUDA 4F11A 1G6Q1 3NASA 3O8NA 3U7RA 1SU8A 2KW5A 1PI3A 2W90A 4EP1A 1MC4A 5DNCA 4HNHA 1NFQA 3W6NA 1RTTA 1V26A 2P8JA 1NDQA 4YDHB 2IL1A 1Z4PX 3KR2A 5FWXA 1N5OX 1MT3A 3QELA 3O8LA 1OHHA 2V8OA 1OXXK 4TZKA 5FOXA 1I2AA 2LE0A 2O3SA 3AVXA 3IP9A 3ESXA 4DWOA 3RU7A 3UW1A 3G2QA 4G26A 121PA 1KVSA 2BTQA 2Z8YM 3CF0A 3NXSA 4NP6A 4E4RA 1UXGA 1O6ZA 5FLYA 3VM6A 2YVAA 2QI9C 4M7PA 2J31A 2PA3A 3SC2B 4MVJH 5I47A 1JG4A 4NV3A 4AJ9A 1IBMB 4M1YA 5BV2P 1P29A 2EGUA 4JUDX 3BHMA 1S9HA 2C0PA 1ECGA 5BNFA 2BGTA 4Z7NB 5E2BA 5GWXA 2CY0A 2NX2A 1NW9B 4X1YA 4WWHA 4DQXA 3RGGA 3SXPA 2PD4A 2GOYA 3D81A 4RSRA 1V3TA 2Q4TA 1Z0DA 3N6XA 4OX9Y 2FX5A 1SXPA 3EXAA 1CVLA 2RKWA 2I6XA 1YVUA 3DEYX 5REQB 5JJKA 4AKHA 1IJBA 1M0EA 2FY8A 2QX8A 3ST7A 1ISRA 2DHCA 4BP3A 4HKTA 3CKMA 4MYSA 3H1AA 1PQ4A 4KUEA 2ZFUA 4YB8A 1Y5RA 5A71A 4AJEA 2GHQA 4MI6A 3PVCA 1VKJA 1ZM7A 2E2WA 2SICE 2YNMA 4XLZA 5HMLA 1JLLA 1GSIA 1LCIA 3ORRA 4QVIA 1REQB 3R0ZA 1YRWA 2GF9A 4Q3AA 5I7RA 2OMEA 4K9SA 2GJ8A 2C8JA 3GG9A 3Q2OA 3U1TA 1DINA 4K8OA 3VO2A 4U9HS 4W5JA 2VG8A 2VP5A 1J24A 3OZFA 4LRUA 3TZEA 1UM9B 1K06A 2KHZA 1R7RA 1QVWA 1ZRNA 3I76A 3KTFA 2XGOA 3AHHA 4G9BA 1NF3A 4PTLA 4OQYA 1V3UA 2GCPA 1NNEA 1T2AA 3PSHA 1P80A 4G5SA 3P97A 1JVSA 1XMSA 3RU9A 5AOBA 4C0HA 2IU0A 3BULA 3NWOA 1W5AA 1NVAA 3N2KA 3GJTA 3G5LA 3RM3A 1WF3A 1C7IA 3C7CB 1Z47A 3RSHA 5LQNA 1P2UA 1WY7A 2X9LA 3LPAA 4EA7A 1WNTA 2AN5A 1RDFA 1G8YA 4YUVA 2IS1A 1NF9A 3RIGA 4UNQA 1OU4A 3FCCA 1OZGA 1BEUB 4GMGA 4FBLA 4REQA 4MIOA 4CQLA 1UJ4A 3IA7A 4EVIA 4CKCA 2GM3A 2M9MA 2ORIA 2W7TA 3D2BA 4RDXA 4X3OA 3KL2A 4ZQCB 3WKDA 2HRZA 2DFTA 1SD1A 3CRZA 1GN9A 5K2MA 3VR5D 1ONBA 4EG6A 5IF3A 5K99A 3V97A 5E7MA 3AF0A 3LQFA 3C87A 3EIQA 2ZEJA 4HEA1 1NIPA 2ZTMA 1CJVC 2BEKA 3BICA 4FCCA 2PT7A 3HKEA 2L82A 2L19A 4TQAA 1G9XA 5L3QB 4DV2B 4NZPA 3QEBZ 3UA3A 4J16A 3FGNA 2G07A 2IY7A 4C29A 5A03A 1TGYA 4M1QA 4KR9A 2V9ZA 2BGMA 3LHIA 2VQEB 1R88A 2OBNA 4BNDA 3VZBA 5E4FA 2HK9A 3TB6A 1YIOA 1EQUA 4MW2A 1I3KA 2W37A 4PYRA 1B3BA 4CEHB 2E9SA 1NU6A 1ORIA 3BMQB 2GO1A 2FPUA 3WTCA 3ZK9A 3ZZ0A 4BFVA 5BWNA 4AK9A 3H1EA 1JECA 4P5EA 4E1VA 3P1JA 1F4VA 3EGWA 3OTGA 2RGDA 3RAPR 2WJVA 1SXHA 3M4NA 4LDQA 2QYTA 5AOAA 2B21A 3W5HA 3D6UA 2IHVA 1DCFA 2P6PA 3IUYA 3NBAA 1Z0SA 4I4TF 2QLBA 1FNNA 5GMOA 5EIWA 1TCBA 3VPGA 1TM5E 2PKRA 5HHTA 4UNSA 2G80A 3OPNA 1CF2O 2KI5A 2CXNA 2GHIA 1NVXQ 2Y0EA 1ZI6A 2HJHA 2ZI6A 3KSBC 1NXXA 1Y8AA 1Z18A 2HI0A 2OLEA 1EM8A 2HXGA 3EJ6A 2BP7B 4IRMA 3URMA 1NNSA 4LJ6A 2YASA 1H0SA 1JLKA 2XYQA 4PLGA 3HZRA 3E9QA 1NMSA 1GZ7A 3QVTA 3C1TA 4ID3A 1M2EA 4NBRA 4ZYZA 4LJ8A 1YQ9A 4IEEA 4EW2A 1YCGA 3F4LA 4HADA 3L6OO 1Z9BA 4OA8A 3VFDA 2B4YA 1K4YA 1GLNA 3N59A 4DSAA 3PC8A 2QG9A 1IUKA 1L5OA 2YYSA 3EZLA 2V5VA 1KJZA 3E7FA 5DRTA 2HMAA 3LV8A 5MGBA 1P17A 3H0CA 3ASVA 3KKKA 1GGNA 1UMBB 3RT9A 2IUTA 3I53A 4JLPA 1DKMA 4RJIA 2ACWA 4DA4A 2BHNA 3AI2A 2VDRB 2INGX 4TXJA 4UC0A 5FLEX 1E3WA 2O6HA 4GR5A 4M8KA 5DOZA 3SZLA 5L4SA 4IWYA 1HTTA 2V97A 4AUEA 3CNQS 5AJTA 4WKBA 2VT7A 5HR5A 1GPNA 4R8VA 3JYHA 1BRMA 3GF4A 2X5JO 4PRYA 4NCAA 4LA4A 4IVPA 1N2JA 2B78A 2C9MA 3EAFA 1ZD1A 4L8VA 3SPXA 1RKBA 1ISGA 3DHNA 2YXLA 1RMTA 4MKFA 1XTTA 2IX9A 3EGCA 3KDPA 3RWBA 5DBIA 1R9NA 5KSYA 5LQAA 4B83A 4QYXA 4YT5A 1B1CA 1JFVA 2BC9A 2O0HA 4K40A 2P62A 4WFKA 1FDUA 1LBQA 1VE5A 3NTOA 4ZDWA 2ZXUA 4F2WA 4Q24A 1ZQ9A 3DDCA 2A1UB 1WTAA 2WFZA 1NBEA 4G37A 2D5CA 2FUG1 2NU9A 4YP5A 3I5MA 2AMJA 5CVUA 4ZAYA 4TMTA 2QP4A 1KFJB 1T1JA 1CZUA 2IS2A 1SC3A 5FFMA 3GLGA 2GZMA 1BE0A 4OKNA 4YMVA 3L7MA 3ZUGA 2C9ZA 3EGIA 1PL6A 3NRBA 5BRAA 3WDKA 1GWNA 1F38A 1H2BA 2WV9A 2XMGA 1WOYA 1E6KA 1U1IA 1UAYA 2WOJA 3KR9A 3Q85A 4PONA 1U3GA 3GBSA 2IEAA 3BA6A 2RC6A 4K6KA 3D43A 4KB5A 4YLEA 1XLVA 1PSDA 2BR3A 3QUSA 1CY0A 4JLMA 3N0VA 4KX3A 4BJHB 1MB4A 3T54A 4KQ2A 1P72A 1SXIA 3OQVA 3PD7A 2I9KA 2W48A 2QWXA 5EXXA 5HZHA 1QCYA 3SWWA 1KSFX 1L8OA 1QF7A 4CT0A 2P41A 4JLUA 2QN6A 5FWAA 3ZY5A 4DMKA 4MQ4A 2VWPA 1RIFA 4B3TB 4OM8A 4B46A 1U7WA 4ASUD 1LBHA 2AFVA 2QI9F 4M89A 1KZ1A 1MHPA 1PO7A 2V0CA 4RV9A 2ZJ4A 3ROEA 5A06A 1NRWA 2QVGA 1W0JA 3EY4A 4DM4A 5CLFA 2CNLA 4X91A 3R0JA 3BL8A 4DJJA 2RBKA 3I8OA 3NHZA 1WIWA 1YU6A 3GDWA 1UXIA 3L3BA 3LBIA 3OMXA 4JNCA 3KWFA 4IIBA 3Q7IA 4OCZA 3PEVA 4NCJA 4WZBE 1BEZA 1Z5WA 1XMIA 1HUQA 2HHCA 3PFIA 4IQ8A 1HE5A 4IGKA 4BCCA 1X7YA 3OPYA 1CWUA 4ITRC 4K5QA 1C8LA 4EHNA 2OP0A 1VE3A 2PH5A 3F8TA 2GILA 2IEYA 5C7IO 3RVOA 5AR1A 5LA6F 1M8JA 2RHLA 5ITWA 5CMLA 2J0QA 1WHTB 2RK4A 3WR5A 3DHWC 2ERXA 4YDSA 5JZBA 3FD8A 4I1RA 1AC5A 4RQUA 1CB0A 3PUKA 3X1XA 4QKQA 2Z4RA 3REFA 2VHVA 2B4RO 4LDPA 2FWJA 1VCOA 3DP7A 1Z06A 2AL7A 1L4YA 4GUDA 4HDAA 1P7PA 2A14A 4L76A 4DMFA 1NMEA 2BKAA 3ELWA 1N1GA 5CM9C 4RK5A 5C4IA 4A1OA 5J2UF 1BDMA 1K1EA 3HP4A 4WXEA 1VP9A 3QHPA 2O5EA 1N6PA 1UDBA 1ZH0A 4M99A 4ITVA 2I4LA 3ROZA 3F9RA 3MGCA 4FN4A 4XLLA 5A6SB 2VF2A 4FW8A 4JHXA 4DARA 5G2OA 3DFZA 2HZ7A 1XNGA 4M0UA 4TS3A 4FW9A 3E27A 1E18A 2VZ8A 2NNLD 3T6KA 2VDMB 1EZZA 1YKSA 2Q6TA 4ZMRA 4L95C 4XX1A 3D3WA 2OXRA 3LX4A 1B8PA 4KOAA 1XQVA 1U2SA 4PHFA 4A6XA 5BSEA 4B76A 1GGHA 1SPBS 1WMEA 3FOBA 4D5GA 4C0SA 1I80A 3SICE 2B2CA 5IHXA 1K08A 2GS9A 1Z75A 3LRXA 1NUQA 1EK1A 1T3SA 3DZFA 4RSMA 2P3LA 2XMDA 1AHIA 1RJ9A 2AC4A 3WGQA 5IDWA 2D62A 1ZN7A 2RK6A 2VF4X 1YR3A 2OKCA 2ZATA 4EYSA 3CNHA 2LPMA 4ZREA 3VC7A 1JHOA 1Z8DA 1NBAA 3Q1LA 4N41A 3DFFA 4MV0A 2WJ6A 2ZRIA 2PV0A 4YPOA 3CNBA 3GEBA 5FPYA 5K5EA 2VPZA 3PTZA 4JR1A 1N6HA 4RMGA 3I42A 5F35A 5IBPA 3WWOA 2K7FA 1V37A 3X1YA 2EYUA 1U9JA 1UOPA 2JB9A 1VECA 3ANXA 3HN2A 3P9PA 1YONA 4DSTA 5HGJA 5G1OA 6ABPA 1EYZA 1FSGA 4OKIA 2FE1A 3BXHA 4ARAA 1DUIA 1DOZA 2AS0A 3UMBA 5ADVA 1U98A 4UHBA 2GJKA 3PFGA 4CZ2A 2VUUA 4H27A 1QVVA 5FV7A 1HSZA 5JAQA 5TQ0B 4B7CA 1R6XA 4I5EA 3ECCA 3JQRA 1ZGHA 5SZKB 4B5KA 4MP3A 4H1WA 3R6WA 1EE9A 1W87A 4V0LA 1AF4A 2C9CA 5KOJA 1XZAA 3EHEA 2Q21A 5JY1A 1K9SA 2JH8A 2DKNA 3ETDA 4TRNA 4MQ6A 2J41A 1FTWA 5LOVB 4PAOA 4EY3A 3GIDA 5E6RA 1P5FA 10MHA 4MW6A 4CLDA 3JASA 1W46A 3OT1B 4WBSA 2V1XA 2ABWA 2Q99A 1K8ZB 3WMRA 2WJYA 1Q77A 3IKMB 4DL9A 2C29D 2WF8A 4BEWA 4YY3B 4YRAA 1H8ED 2H1FA 3OIVA 3TAUA 3W6UA 1I3NA 4D9CA 4IWXA 3WNQA 2C96A 4ES6A 2E4VA 4DZRA 5FOUA 2CCJA 2Q1TA 4GI1A 4P32A 4E5SA 1SRRA 3BTVA 5DDIP 1OH8A 4FT2A 4QIHA 3S4YA 2GAFA 1JMKC 5EMKA 4DM3A 3E2IA 1Y34E 4HDSB 1CC1S 5KTMA 5DBFA 1NF2A 2OHXA 2PR2A 3HSYA 3M83A 3KKLA 1T24A 2Q4EA 1NJGA 3EFBA 1U0TA 4GM1A 4QDUA 5L7YA 5B1YA 3R7SA 4UE6A 4EQZA 1QWSA 2P75A 5HIIA 2QD4A 2Q5FA 2NUBA 3NTLA 5BR1A 5IU6A 3ODGA 2DQ4A 1YOVB 1PAUA 2XD4A 3KE8A 5CYFA 2G1JA 4DC9A 1JQLB 1KI2A 1WAMA 2QZJA 2ZKLA 4JEHA 1H65A 2HBZA 4LMPA 2VDKB 4B4VA 3MTGA 2OFXA 2OZLA 3D5TA 3LM8A 3PQDA 4BQFA 1EVQA 3H17A 4E1AA 2MSNA 5COBA 1R6BX 2Y05A 3OPMA 4MUBA 3PJDA 4OI4A 4MVWA 3CRMA 1UK6A 5CITA 3N6VA 4KRYA 1XZEA 3QOXA 1EVIA 4BO3A 2W4MA 3VOAA 1LK5A 3U61B 2FEPA 2VA8A 3R5SA 4RPHA 2IPXA 2P77A 1UZMA 1EHIA 4YJ2F 4YJ3A 2BFPA 3NNDA 4QBGB 4ZZ2A 4O4HB 3SHQA 5LVAA 2C0CA 2WPDA 1B23P 4Q9NA 3U39A 3CMMA 3PV0A 4FT4A 5FUQA 3ROXA 4DCPA 2G8LA 3P0IA 2ZIWB 3NWEA 1NMQA 1P2TA 4LZOA 3S5JA 4WZAB 2V7TA 5EE0A 5B4UA 1DADA 1KPGA 3MWDA 1H93A 4L5AA 3TZBA 2B35A 1F8UA 1M0SA 1ADCA 1QIEA 3DE4X 3NXKA 4Q3CA 1BKSB 1ZL2A 2ODEA 3GGSA 3QOYA 4FCTA 4HQNA 4ODIA 3H18A 4MUYA 3VA7A 3IT2A 1ZAYA 2ARKA 4IPTA 2VZEA 2IPOA 3ILHA 4K28A 2F4NA 3GLIA 3CF4G 3HR7A 1OA0A 2J9FB 3A4NA 3C43A 1V5FA 3P2IA 4L27A 1EDOA 4FNAA 2FR0A 3KWLA 4D4LA 2VJMA 3NJRA 2WTNA 3QTBA 5IC4A 1YZFA 3KOUA 4UOQA 2BFBB 4C0XA 4DR4B 4DQVA 3TH5A 4YAWA 4CF3A 2JAOA 4TMKA 8OHMA 4IF4A 3B89A 4Y9UA 1WHSA 4NH4A 1E89A 1HQYE 2E4XA 4YBZA 3IMKA 3CCFA 4CM9D 1IJEA 1IVYA 3EHDA 1G5TA 1KXJA 1WMSA 3PFWO 5EKTA 4EG5A 5CB4B 3NOOA 2WTMA 1Q3TA 3CCBA 2IZOA 2OD9A 2R25B 3F6YA 3NBKA 3FWKA 4S1NA 1BCRB 1ECBA 2QTVB 4DXDA 3BMOA 3ABIA 3EXEB 3WJ2A 1OX4B 4C88A 1U0SY 3NHSA 4S1PA 2OV2A 1RWOA 2QTRA 1NUHA 1KJNA 1QDUA 4GR4A 1HYEA 4JBLA 4H08A 4KH1A 4FGLA 4MWSA 1N3YA 4ZV9A 1IONA 1E94E 2JI6A 4G84A 2XH8A 3OPQA 5FFNA 4U9UA 1VIDA 3F6PA 4NE9A 3KPYA 1KY3A 2XLCA 3N3BC 1YACA 4DXAA 2Q3JA 1GCAA 2ZDGA 1HOXA 4PQRA 5TLSA 2GH1A 4IZIA 4MQUA 5TQJA 1A3CA 1E2DA 4GDMA 3K1ZA 4B6OA 1CUFA 2DBQA 2QZZA 2X2EA 4YAGA 1ZJJA 4GVXA 4B6SA 1ZG3A 3CBQA 3ZE0B 3GXBA 2QTAA 1LVHA 4MUEA 2A3NA 3CUTA 3LPNA 3B3AA 3ONEA 4KE8A 1JYFA 3WQSB 4Z9XA 3BRWA 4CV0A 1QGUB 3D0QA 4BWYA 3PWKA 4JUAA 3W5IA 4HNTA 4Q9KA 1ID8A 2JFFA 3MQ4A 1TQ8A 2WDZA 4ZAGA 3LWDA 5CCDA 5K0JA 4XDYA 2PVCA 1UR5A 2OAP1 3QOFA 3WKCA 1POWA 1E0KA 3Q3GE 1NKTA 2Q7XA 3KT6A 3LLCA 5G4LA 1WV0A 2DUMA 3A2MA 3O8DA 1YHYA 5ALXA 1MAUA 1TCCA 2DHEA 4PG6A 2Z2ZA 4RFVA 3UMCA 4EHDA 3LXUX 2V7UA 4NOMA 4IHJF 3COSA 1G0NA 1ZRSA 3LCRA 4I3FA 4PSAA 4Z51A 4ZIRB 4JYPA 9ABPA 3GJQA 3SJAA 4GPAA 2O50A 1GQOA 3LA6A 3WQHA 1RE0A 3N8KA 1X70A 2HSWA 4PSVA 1E1LA 1EFTA 1YRQA 2YCLA 3GU3A 5DHPA 2RGNA 4FR2A 1TQDA 4OJYA 1UODA 2Q9UA 1P0CA 2HH9A 2X0IA 1ZUNA 5GM2A 1L7PA 4KJZA 4ZZ3A 4K88A 3EZ2A 5AHOA 4HB3A 1KJQA 3PA6A 4ALNA 3I6BA 5JNTA 3GGJA 1Q7RA 3AIOA 2XNJA 2W6JD 1SCDA 2G6BA 2HIMA 4RK0A 4M4SA 1K4MA 5CX1B 1KQGA 4B0OA 1SVNA 2C1ZA 2GBGA 4AMUA 1C1DA 1WXIA 3D3EA 1GUFA 4O8ZA 4AZSA 3T1YB 2B9EA 3RC7A 1N34B 4G9GA 1N2CB 3UN1A 4E5YA 5FBLB 3HVKA 4CMGA 1G38A 5HF5A 1BMQA 2WEKA 4HDNB 1E9AA 4DRZA 2EIHA 1VBMA 1VHTA 4KNVA 4NENB 5DSZA 5JECA 4G56A 4HQOA 4KGVA 2F8MA 4ZJUA 3IPYA 3P4UA 5HJ5A 2Y1XA 3H2SA 4QL3A 4F12A 4JOQA 4B3BA 3HNPA 3BOSA 4JR2A 5HUJA 4TVSA 3EARA 2FN4A 3FOCA 2V54A 5DNWA 2JFVA 3RVSA 1J7JA 1GVHA 4C2BA 3QNWA 1N6RA 3OA0A 3B3QA 4BBZA 5JG7A 2WD9A 5CEFA 1JNYA 1RMYA 2PSSA 2XKJE 3QKSB 3C5EA 2Q45A 2AR9A 1MC5A 5FPSA 3NM6B 5JBQA 3QEAZ 3PNQA 1RAHA 4KPFC 1T26A 2BUBA 5CXSA 5EWJA 5ALEA 2JRLA 3IP8A 1U90A 3GEEA 1N2BA 2D59A 2XUOA 1TW3A 2VLBA 1UEXC 3X43A 4E07A 5K8TA 1KGDA 1Q16A 2EKDA 2RAVA 2ACVA 1HNWB 4X24A 1LRLA 3S5UA 1I33A 4HH3C 5JAPA 5J2TA 1SK9A 4PAMA 4X8OA 1Y8QA 3V4RA 2JGDA 2JHCA 4Q4JB 2BHSA 2N1MA 4CEIB 2J67A 4NY1A 3WGOA 2MDTA 3L40A 3MHPA 1HORA 2DFNA 3KZMA 3GRRA 3C15C 5FIUA 3RVRA 4X95A 3SE7A 4Q48A 4A8TA 1FQWA 3QJGA 1D6NA 5H3HA 3RC2A 2CFTA 1K9VF 2C3OA 1M6HA 1HTWA 4OGLA 2PBFA 1JEEA 1FP4B 1YF3A 2NPIA 1GCGA 2BFDA 3HUEA 4ZWNA 2V9PA 4CFZA 1XLWA 1S8FA 1PGOA 1FQJA 3P9SA 2IV7A 3VJLA 4MKXA 3ENKA 4G4JA 3CEJA 3KC2A 2PL1A 4I9UA 3GXOA 3CH6A 1T9GS 2VN8A 2WB4A 1QH1B 4RX1A 4M7RA 3V32A 4Y2TA 3ZD8A 3RC8A 3UQZA 1ZGGA 5T3YA 4N3BA 3SKYA 4RHYA 1EWVA 1P6UA 2RH5A 2OV8A 4P3NA 2YUIA 5BOVA 3SBDA 4E31A 5TMDA 3DBVO 4V39A 2ZBEA 3NBZC 4NOLA 3GEPA 3QPCA 4I4IA 4JMPA 1LDMA 3MSXA 3QX3A 2J8ZA 2HXYA 3SVTA 4TKUB 1R2QA 5A9RA 1ZU5A 3P0JA 4GP7A 1YRYE 3KDAA 2AE2A 4ZYWA 2D2VA 2BEVA 1YFLA 1HT3A 2E89A 3E9DA 4Z4EA 2MR6A 5FTMA 3DGEC 2AIRA 3RSLA 2YRWA 2K7ZA 3BJRA 3NUGA 3SC3A 3TLMA 5IHPA 5KEIA 4GC5A 1RIIA 3I52A 4KLAA 3R4VA 4MUXA 1PQUA 1R50A 2FMUA 2OBMA 4O4IF 3E70C 5EXDA 3B9BA 2Z2IA 2GO7A 2WT4A 5F2KA 1WEKA 4GI5A 3RKUA 5I7EA 2YKGA 1W88A 3ORFA 2WJJA 5EHQA 5U4QA 1VLVA 3CZ4A 1VHQA 3R6GA 4I99A 4YVFA 4ZQIA 4I55A 2NUPB 2ZSHA 5H83A 4WE3A 3TUJC 3THXB 4HAYA 3AUXA 4LV6A 4QT4A 1JQBA 3FBGA 4CWAA 4OSEA 2BZ1A 2N47A 2QROA 2H17A 1S3FA 2ODTX 1EUDA 4GXNA 4B79A 5C3MA 1EAMA 4J03A 4TROA 4ED9A 2QF7A 4FONA 1XB2A 1XWIA 5DIFA 4N1AA 3U4QB 4EY4A 4YMLA 1G1AA 1RXUA 4P38A 5COQA 3BL6A 2EEPA 2FUCA 2HTEA 4HZIA 2H1WA 2Q5HA 3N1UA 3AV0B 5G0UA 4LHYA 2HPVA 3DE7X 4MVYA 1R9GA 4NEGA 5CNIA 4YRMA 5BW5A 3HBAA 5IYZF 1QRSA 3FOWA 3NEYA 3R0IA 4XI9A 3HQ4O 4HGYA 1TECE 4QPCA 3KETA 3KELA 1IZYA 1M8GA 3DDZX 2ROQA 5PNTA 1ZNQO 4OYLA 4Q7JB 1XTSA 1TGVA 4EARA 2UYOA 2OCPA 4EHBA 1C5KA 1EUCA 1GFIA 2Z5GA 4TRMA 2VBCA 4GL4A 5JZVA 3MA0A 4CQNA 4KRGA 2IHUA 1S8AA 1XZBA 3ICWA 4FKZA 4W9NC 4KPEC 3I0MA 2EP8A 4LYHA 5DX8A 3VU8A 4BV3A 4RMHA 4N0PA 4CUZA 3RSZA 4AZ3A 4UOZA 3WICA 2O0KA 1JAZA 4YQFA 1Y6FA 3HR4A 1TLLA 4FHZA 5JZMA 3Q3CA 2BFFA 3I92A 3SX2A 3I4LA 4EL5A 4WEOA 1WTCA 4P31A 1NVGA 3LHSA 3R8CA 3LKZA 3MCVA 3ZVMA 4U7PB 3F47A 5J4HA 1EP2B 1QZZA 3MGAA 4KLRA 1A04A 4H4CA 3ORQA 3OKCA 5E0KB 3TMAA 1ZXLA 1KE2A 3TZLA 2DM6A 2BFEB 2QRPA 1M72A 3IIJA 2WP0A 4CTOA 4EBFA 3GOHA 3DVAB 3FVQA 4RSGA 4H3HB 4HS9A 1GKLA 5E9JA 2VJYA 1NVDA 4HLNA 2WUVA 3WA6A 4RMJA 4O59O 4GEGA 2R6CA 4LHSA 3HJRA 4CUJA 5B1EA 1TAQA 3FJOA 1EAYA 4IG4A 2FLWA 4LBVA 3EGDA 1KO5A 2NZ2A 1WCYA 1Y4AE 1XP5A 1VMEA 2JIRA 1QZXA 3CLTC 4J49A 4QOSA 4AF8A 3EMVA 5C7YA 4I8XA 3CLTD 1ZA1A 1OXSC 1K8RA 3ETCA 1D1TA 4W6QA 2RD2A 3BHJA 2PFGA 1P33A 1E1RD 1H2EA 1PD1A 2DFLA 3EXHB 2ZIXA 4R7GA 2E55A 3ZU4A 2Z1DA 3V4LA 4EY5A 3MS4A 3HYCA 3MC1A 3QU7A 1CEEA 4TLAA 4DYDA 1XDBA 4PW0A 1ZD3A 4AL4A 4EB6B 4EJSC 1HBJA 4BXOA 2HQOA 4QGGA 4R1PA 5E9QA 1MB3A 4M53A 1C9YA 4ZOAA 4NBNA 4ZVOA 4A0HA 3EFHA 1ISJA 1ZGCA 2C83A 1HZJA 1HPLA 2YMPA 2FSPA 3TWOA 2EFJA 3W5CA 2CL6X 3MFQA 4CLRB 4F2GA 4JYAB 4NKRA 5H8WA 3WMXA 2Y0BA 3LDAA 2DULA 1FNCA 1I6MA 4J3NA 5KZMB 3LUFA 1JHVA 2OCYC 2VF5X 4TXMA 2WB2A 4MMXB 3IALA 4U2BA 4R8SA 1U3CA 5KKCA 3T5BA 5JQGA 1Q91A 4K3VA 1BFUA 1T13A 1SZJG 1C3OA 1SQ6A 2NVOA 3FHLA 3STVA 1RJGA 3BSWA 3NIFB 2WTUA 2RE8A 1Y7PA 2DFDA 1W35A 1YNSA 1Q3KA 1I4WA 2JGRA 3QENA 1E8DA 3QVWA 4NDNE 4CDMA 3L0BA 3FDJA 4D2IA 4DSZA 4EW6A 4JROA 1R0YA 1ZM9A 2FFJA 2QE7D 4ARZB 4CDRA 1AVTA 5CJJA 3EW7A 3IT1A 4BNIA 3AWIA 2BYTA 4UMDA 1EUQA 2P8SA 3K9CA 2AFHB 2QTCA 3VR6A 1EHYA 3I04A 3PTLA 3H65A 1XR3A 4PLZA 3CPHA 3HADA 1BX1A 2EAUA 4A03A 4NCHA 2I03A 3LTEA 1PS9A 3UT5A 1KTVA 4EBBA 4UCQA 1ZJYA 3TKLA 4KE9A 1RXWA 1ODIA 3BIFA 1MOZA 2PH1A 3EZFA 5T41A 2YZ7A 4HEJA 3DMYA 3W8NA 3L0DA 1KOFA 1NUAA 3EJWA 5CBKA 1FTGA 2OPBA 5EI5A 5I7OA 1FCJA 3RLFA 3T7IA 5IKMA 3S1AB 1GTRA 3OF5A 4FOOA 4MR8B 2P5TB 3HEAA 1XTKA 4EFKA 1M1YE 4IVNA 2JA2A 2YN2A 4LEIA 4EQ6A 3BRSA 4LXQA 4LYFA 4NPCA 4G81A 4XGNA 5LZ7A 2WHPA 2NW6A 4M1TA 1M66A 4NHEA 1I3MA 4OAPA 3M3DA 3LYUA 4NSNA 1QO0D 1RFGE 1N33B 3NTQA 1DC7A 2V6IA 1QGOA 4XWOA 5THXA 1N0VC 1CRZA 1AD2A 1TJNA 3DONA 2ZJ7A 1DEAA 3QX9A 2NT4A 4MA5A 1TYAE 4OYRA 4P22A 3TMKA 1M33A 4CCSA 2HR1A 3E5HA 1Z83A 1UT5A 3GDHA 2AEJA 4XYMA 2XNDD 4F3YA 2IS6A 1C8BA 3MTDA 2JIDA 4WCFB 2GCOA 4FR0A 4R7TA 2R87A 1GG8A 2VTKA 4LGMA 1LWOA 2H85A 3KU1A 1EDBA 3K9BA 1BS9A 4EI7A 5KWIA 1C9JA 1FU7A 2PUFA 3PC4A 4WVFA 1MXHA 2WIGA 3DYBA 5DEOA 5ULLA 1GT91 2X3YA 2Z3VA 3L5KA 3SDZA 2B8JA 4KXVA 2QIOA 4PIVA 4X3PA 3DV0B 1MEEA 2AQHA 4R2WA 5KTRA 1DLIA 2QZSA 1U6KA 3DWGA 4UHDA 4DE5A 5AD1A 5K01A 2QN8A 3W5DA 1G20B 1TU4A 3GIWA 1QXSA 1U0LA 4RFSB 4UVDA 4DDWA 1V1MA 4HUQA 4B81A 4L0CA 4CL3A 4FFDA 5JAZA 3NNNA 3BXOA 3LQ4A 4I50B 5EY5B 4C5AA 1XMPA 4PIMA 5EQDA 3TEFA 2WIBA 2OBLA 7ADHA 3JQCA 4C30A 5D01A 1RC1A 1T9HA 1E96A 1PL0A 3FTQA 5DM70 3QLUC 1TX4B 2IZ0A 5EP3A 3EVNA 2VTBA 1ISIA 2PT5A 5FOTA 1H6DA 1KYZA 1VMIA 5L3SA 1SD5A 3LQKA 4KVZA 3VPAA 4BLWA 3VKGA 3H5TA 2CFRA 4JJFA 5CFPA 3FUXA 3NO4A 2AE1A 4C6RA 1P1FA 4BNUA 1N2GA 4NCNA 3HXMA 3DXZA 9MHTA 2YOGA 2YBDA 3DPUA 3ILSA 4D25A 5E4YA 5ILQA 1EINA 4YV7A 2H2HA 1C7EA 5SY9A 3DBIA 4LAFA 4UTPA 3RUEA 3RYHA 5FBZA 5LL6P 2O8NA 2XUDA 1A9OA 2C97A 3L01A 3AR4A 3G0OA 2R6HA 3FPJA 4M9CA 4R05A 1M8PA 3AQIA 3RFXA 2FFQA 2NV6A 2A86A 1J5XA 2HBYA 5SYAA 3RPEA 4A5OA 1IOWA 1HLFA 2ES4A 3FYCA 1X0VA 1VYVA 4J29A 5F98A 1UP7A 4KP7A 1JAHA 5JXHA 4KR7A 1OZAA 2PKXA 4MPRA 4BJ1A 2Q9BA 3H1FA 4YN3A 2H08A 4JGBA 3L8YA 1RLOA 1TE2A 1JHAA 1KI8A 2PKYX 5CFQA 1HG1A 4QATA 4GQIA 5JAIA 1A8IA 2O8CA 1OIWA 5ARBA 4GP6A 5M2QA 3U3OA 3PU6A 4Q9IA 1RHRA 3B52X 2PRIA 4NYMR 3UUGA 4M98A 4LDZA 2NVBA 3BB3A 1RHUA 2G8NA 2ZE5A 1IK4A 2I2WA 3C3PA 2FZWA 5DBOA 3B8EA 3E0QA 1AUVA 2EGGA 2CNDA 3K31A 3O94A 4I1SA 5DLQC 4Q0MA 3E53A 3UY4A 3CW2A 1ABFA 1AKEA 1V6SA 4L28A 4RD6A 5CK5A 4FHDA 3EQ9A 1Z5PA 3FLAA 5HXAA 4YRLA 3WO0A 6REQA 2DH6A 1IZ9A 3B1YA 3THWB 2VHCA 3AFHA 3DE1X 1LF0A 2V7PA 3BXFA 4JP5A 2P7HA 4MQFB 5AKEA 3DBRA 5HKLA 3T1HB 4C20A 4DCGA 1T6ZA 1BXRA 2WF7A 1WXXA 2BGJA 1EP1B 4F2DA 4DR1B 4MW0A 3WGZA 4PYLA 2XWJI 3CKYA 1DAGA 5EJIA 5CTJA 5J4YA 1EH5A 4R9UC 3CN7A 2ID9A 1JKJA 2GKSA 4RZXA 1ZK1A 5DLDA 4PCVA 1RRCA 3TRKA 3HXQA 4DZTA 1BMFD 2G72A 4IVRA 1M7HA 1TKBA 4H2DA 4QYWA 2X5OA 4FZRA 4H7KA 2ORVA 4POAA 3NDIA 3UYKA 5CPBA 2IVFA 1TXGA 2OHOA 4TMFA 1GA6A 2D1RA 2VHTA 1AE1A 1DAOA 4UBIA 2RGWA 3E5NA 2AJLI 4I5GA 4MRAA 4LQ4A 2C61A 3VSBA 3T7KA 4BGUA 3HYLA 3I6MA 3B5IA 1E9CA 4PX9A 2QVYX 2FFBA 2I2BA 1PVDA 1T2EA 3MCAA 2JLRA 4IXTA 4MWEA 3TW8A 4X62B 2ZE8A 3N8HA 3CRVA 5AJUA 4V1CB 5AESA 4PY2A 4CMBA 4JP3A 3ZHVA 1DKUA 1L7BA 2A0FA 3MJ4A 3OZGA 4A36A 2ZRPA 5K0GA 2WK1A 3H11B 1Q7EA 2X5NA 2XUHA 3O91A 1B4DA 2H48A 2XHEA 3QPBA 4RE6A 1WR8A 4ND7A 4BMXA 4C4PA 2H2IA 1T2FA 4WK0B 4PU0A 2QMYA 3VR5A 3G23A 1Y82A 1JHYA 1CNEA 1RD4A 4AO8A 3LO5A 4ER0A 2JANA 3LBNA 1CDZA 1WPGA 5KBYA 1L4LA 1RE1A 2NXCA 1HMYA 1NONA 2FPIB 3ZXYA 1GUDA 2RHMA 5DI3B 1XMXA 5ADHA 3FYUB 3AEUB 3ZWKA 5FX2A 1SVUA 1W30A 4PO8A 4WN9A 3WLAA 2KS6A 2JCGA 3DMGA 1NXVA 3U7FB 4RDHA 1BMDA 2M6RA 3CWQA 2M1ZA 4HB4A 4HMOA 4O0MA 5EPEA 3KVOA 3VDMA 4PVDA 3PC2A 1ZGJA 1M73E 3BWVA 4DWWA 2OSBA 1H1TA 3NKLA 4GH5A 5TXGA 3Q5DA 3K9FC 2FVYA 3BFXA 4G2NA 3P9XA 4JOBA 4QGBA 4QOEA 2WSMA 1GPWB 3P9KA 4F0JA 3C4QA 1PR5A 3K0FB 4OXKA 4BJ3A 5A7FA 3JQ8B 5KNDD 4N40A 1QH8B 4BUJA 5TDHA 1GEGA 2CZQA 1LNSA 3Q6MA 1QV9A 3STXA 3EY9A 1Z2PX 1F8GA 2QRGA 3HP7A 3KV1A 3T4UA 1M2VA 3FY4A 2JJ1D 1CJTC 2QGFA 3EXIA 3PS9A 3GB9A 3GD5A 3T3PB 4NHOA 5ELMA 2A0YA 2ORED 3F3SA 3M5DA 3UVEA 3UOWA 2Y0CA 3GOQA 1FSZA 2J5BA 2YS7A 3DMHA 9LDBA 1W44A 2WSIA 4RTJA 3BK7A 3KD3A 3ZI7A 1UOQA 1NQOA 1V96A 1EFRD 2Q8QA 3LWNA 2ONCA 4DA9A 1KEZA 5D2CA 5AVSA 4KDFA 2KPOA 1SKYB 4P80A 2JIMA 2Z2YA 3IJEB 2WDPA 2ZP1A 1Y3FE 1NMXA 3IVRA 4FUQA 5HUQA 4A9AA 1U1DA 2A7QA 2CKDA 1CP2A 3GJ0A 2FETA 4D9GA 4BEJA 1NVKA 1Z3IX 1G7SA 1HR0B 1JDPA 4F8EA 5JV5A 4D26A 1OYYA 2H8GA 2O7QA 4NFSA 4X44A 2Q7DA 3JQ7B 1YQUA 5FEUA 2IZ7A 1VLZA 3D8UA 3VJMA 4IOLA 5JW6A 3ZY6A 2DKOA 4OGKA 4RULA 1DBSA 3FVWA 1UWCA 2IEBA 1TRKA 5AKXA 5EJ6A 2Z9CA 1RKXA 1RWBA 4UASA 1JIUA 3MRVA 1J8YF 4ALMA 3IJPA 2BLLA 4BNYA 3HDHA 3DAYA 4Y6RA 2CFOA 3EX7C 3JVEA 1IK6A 1OJLA 1E7MA 2GUWA 2BT4A 2X19A 2CMKA 4IQGA 5EHNA 1WXEA 1QVZA 4EG8A 1WSBA 2J5XA 1C9NA 5CB6A 5GJCA 1IZ0A 1BWRA 1VL5A 1GCIA 1VXRA 1ZMRA 4RY8A 1XWWA 4TKZA 5CUQA 4K46A 4TZ6A 4Y0AA 3VMFA 3A7EA 3EG9A 4R1OA 5FWDA 1TFUA 4AJPA 1C7RA 2D0IA 4PYJA 5CD9A 1LC3A 1E5TA 4MUAA 3CUWA 1IVSA 3ED5A 3OIGA 5E1OA 4MJLA 4BLPA 5IVHA 1NNUA 2I78A 4NS4A 1NRIA 2YJ5A 4UEQA 1VBKA 2Z2JA 3A6ZA 3WIUA 3ZK7A 5HPYB 4Q9AA 4MTCA 2E5FA 2WVHA 5ESXA 4DC1A 4LV8B 1USGA 3O8QA 4L4SA 1ORRA 1T34A 3COPA 1XCLA 4JXXA 3C4VA 4NPAA 1NR1A 4QG3A 1I4DD 1YBVA 4YR9A 4OEHA 3ZS9A 3I1JA 3PNPA 2WSSD 4Z86A 4IRUB 1UUFA 4OQ4A 1VYTA 3A6KA 1B14A 3MBKA 3R4CA 2XXJA 5FKJA 4JI5B 4BCBA 4EDHA 4YCLA 1JEYB 5C53B 5A4KA 3AHGA 3IQWA 3CX6A 1OIVA 1NJ8A 4JK3A 4JY7A 1NOIA 5KVSA 2D2FA 2PO7A 2XNKA 4MV6A 1J39A 1OGYA 4BLSA 5GY7A 4Z1OA 1RT9A 3LQ1A 1YDHA 1UBUS 1RHKA 1R74A 1UWVA 2HF9A 2LXNA 2PGJA 2WV7A 2GVZC 3QHAA 2HWUA 3EPPA 1QBKC 4IJVA 5J40A 3RVBA 1ZKDA 3W5VA 3UT0A 5AW2A 3D7RA 1C0KA 3K0AB 4MVJM 1ADYA 4IDPA 2G36A 1JI0A 3OLZA 4JUIA 3UA4A 2YJGA 1IMJA 2YICA 4PTYA 1IBCA 2PFKA 1WVGA 2QL9A 4DIBA 1SQFA 3RUPA 1C9DB 1WB4A 1SQ0A 3KZXA 3ER8A 3SMQA 2H4HA 4BMPB 4LGCA 3DO6A 3HVUA 3S8EA 1IL0A 2XGSA 2QRZA 2GTPA 5K3BA 3U7EB 1X39A 3LXXA 4PM4A 3LQ2A 5KNCD 3F6BX 5TSDA 4J3JA 1Z6AA 3UFBA 4AJIA 2QVCA 4NYIR 1ISSA 1WCIB 4Z1MA 4LC1A 3S2YA 3JYNA 4FGKA 5CA0B 5JO9A 3I2KA 4MV8A 4F21A 4DANA 4P93A 4EPTA 1OPXA 4XUCA 5KNBA 1F4PA 3HCOA 3A6PC 1LDGA 1YL5A 2WYUA 4ZT7A 5IKPA 3GK3A 3PUVA 4FE3A 2CXPA 3FNBA 4JFRA 4IGIA 2YWRA 1GTVA 4FNMA 4PQYA 4DIFA 2XADA 1AQLA 5FOVA 2X0FA 2QZPA 3UJDA 2W71A 1QK5A 3WGGA 2VEOA 3KSAC 2HJWA 4Q37A 4MDYA 2F64A 5IUNC 2JAWA 3Q15C 2CCKA 3DWEX 1Q1EA 4QM7A 1M0WA 1Y3CE 4Q4AA 1L7OA 1WMBA 2JGJA 4HPJB 3WE7A 4IL5A 5I7UA 5IN4A 2VC2B 3ENWA 5AKGA 4K6GA 1H5NA 5FUXA 1FFAA 1Y1LA 4WLEA 2Z3ZA 2CHVA 3Q88A 1VFPA 2AG0A 5T6BA 5HM6A 4OGGA 4K9QA 1F60A 3DV9A 4NECA 4B7UA 5CJPA 3ZGOA 1S96A 2PS3A 2W6QA 2OC9A 1Y8RA 3TX6A 3OZUA 1KSHA 1NLUA 1BMTA 1ZD8A 3PX7A 3SZMA 1H23A 2W6NA 5AK4A 2G3YA 2JFOA 3TRIA 3M6WA 3K09C 4GUAA 4Y2UA 4YV0A 3RS0A 4HY3A 3EF0A 3M4JA 1CTQA 1UDWA 2CXQA 1WXHA 2E49A 3MM4A 4BQRA 1FVXA 3BH7A 3LK6A 2CVHA 4RJLA 2QRKA 1E6LA 3FIJA 3NFYA 2ZBRA 3E23A 4G5HA 4M36A 4CDNA 1DXHA 1OF1A 5JNUA 5BQOA 1NJ2A 3J7TA 3LC1O 3OBIA 2ZTLA 1E7WA 4KCGA 7YASA 1YL7A 3NALA 1E2QA 3J81k 1HXHA 2BLNA 3BBPA 2AOWA 5GAJA 1QHIA 4DGSA 4KOEC 5BMVB 5I48A 3I0NA 4KE6A 1UL1X 1CZOA 1UWLA 4PX2A 1P61B 2BCJQ 3G2OA 1YTUA 4IFIA 3FAZA 1ND6A 4JKIA 4XCQA 4DNPA 3PTAA 4HRVA 4DCJA 5JNWA 8GPBA 1T36B 3P0RA 1VG8A 2DX7A 4HT3B 4B3RB 3UWMA 4IP0A 1QV7A 1XDSA 2BDUA 3MPOA 3QKTA 1HFKA 2K2WA 1L4NA 1XTZA 4R0MA 5CW1A 4E33A 5K0ZA 1A1SA 2FJ0A 3BMXA 4QU8A 2V3WA 5KVCA 4EO7A 1XA0A 2O52A 5DNEA 5EIBC 5JASA 1H4SA 2JGLA 2BIFA 2YIJA 2POQX 2F3UA 3PHBE 1YIAA 4OUDA 5EIBD 3KKNA 4C0LA 1LA2A 5EJ8A 1GPYA 3CG0A 2HV8A 4IX9A 1Z4MA 2P1RA 5DMXA 1CEXA 1CY4A 1O54A 4AXXA 4L02A 1U3FA 2IYUA 1D0VA 1L5SA 3OU6A 1DWQA 2JBAA 3R3YA 1X92A 3K0CC 2KM1A 4DQ0A 1EVYA 2CNWD 2R00C 1MZPA 2DP4E 1DIOB 3E3AA 3QBDA 4GBJA 4D41A 4QICA 4QOFA 2XODA 5IT9A 1YBMA 2X4LA 3O1HB 4MGEA 1ATIA 3BMCA 3AERB 5D1HA 2VRCA 2A59A 4RVUA 3GCZA 3FZNA 2J46A 1UAAA 4IX1A 4XIGS 2EFHB 3QXXA 4YJKA 5KMGA 4EHJA 2A5DA 4S0ZA 2QD5A 5H1YA 4NJEA 5LNK6 1XRJA 2C92A 1E79D 1BG6A 4H35A 1Y5LA 1FEZA 1FRFS 2ZAMA 4G01B 2ZJZA 1CK4A 1CB7A 3BWMA 3UCFA 1KIMA 3TKAA 1TJPB 4MS1B 3F73A 1SXJB 1H8EA 3GA5A 1TF7A 2ZK7A 4IEFB 4J9VA 4ZJPA 3M2TA 1PNTA 3C7DB 5CU7A 3JARA 3ZDAA 3A6JA 3UAXA 2DE0X 3QYPA 2FHPA 2ORYA 3FTDA 3OTWA 3RAGA 4PC7A 4JYZA 5AKLA 1UKYA 2YV4A 4KBYA 2IHJA 3L6RA 3ZLJA 2RB5A 3WLPA 5TE9A 2QQ0A 5P21A 2WAXA 3KJNA 1MJGM 2I2FA 4L51A 2JPDA 1CG6A 4M0KA 4MJXA 1YVRA 4PZPA 4X41A 3S2FA 3TZHA 2XVMA 2V03A 4XQ0A 2QQFA 1MIOA 4WOJA 3ZN2A 4N47A 4W4TA 1V5WA 3H5IA 2F90A 2VUTA 3GL9A 4F9EA 4DKXA 1GR0A 4MWTA 2ZUSA 2FW8A 4WNAB 5KYXA 4ZEXA 1QYDA 4KN6A 5DYGA 3RV4A 3WBBA 1ZM3A 2QN2A 2Y1CA 3EYAA 3AUKA 1O6FA 5B7GA 4QECA 4YUWA 3KIPA 1T9KA 1Y9JA 5CVEA 1OX5A 1ZGAA 2CMDA 4D82A 2FN7A 4CLHA 5KS2A 1U8ZA 4YK7A 3ZI0A 4U8GA 4C87A 1K5HA 3OHPA 3GFRA 1O03A 2NU8A 1Q5PA 1YUMA 2B2NA 3V8RA 1ZWKA 2AFIB 3RRMA 1DMRA 1K75A 3VI4B 4C07A 2O5CA 5ALIA 1HA3A 4E5VA 1CERA 3PICA 2Y77A 1F6BA 2G28A 2VUHB 2HNBA 3J7AC 2EKZA 5C8YA 1QIHA 4TXNA 5KTPA 4PZ0A 4U7GA 1BS1A 1R5JA 3AF1A 3U62A 2A5JA 3CH4B 3RYCB 3O90A 1M1UA 2GEJA 2ZZKA 4AG6A 3ABSB 1RQRA 1RXIA 4RHFA 4LF6B 3NCTA 1S2MA 2XYRA 4K9OA 1I6KA 2ZRFA 1LX6A 1PZGA 1P7YA 3TQFA 1SHTX 1DBRA 3X2SA 3ZCTA 3C5CA 3H6KA 2J6BA 4ZRMA 5EAIA 4TV9F 4TVOA 2QX6A 5KTYA 5F1KA 4HH4A 1T6YA 5KOHB 2HF7A 4TYPA 3OX4A 3TL2A 1W4AA 4RAQA 1YUNA 1KI7A 1Y4UA 1QRAA 4HAVA 4NNPA 2B0JA 2CEAA 3H5VA 1O8CA 3H9CA 4AVYA 1KPIA 4UM5A 4K6FA 3ZVNA 4C3UA 2ILTA 4KO2S 4MS4B 1ZEJA 2CBXA 4BHTA 2YVKA 4E5PA 3ZW9A 1I36A 5JVDB 3WIVA 2Z30A 3F8SA 1M1ZA 4LSWA 2TYSB 5ENZA 2OGUA 1MTOA 4B3HA 7GPBA 5IM4F 5CLQA 4FTWA 1IEXA 4KGDA 4Q19A 1YB4A 5BSRA 2P2NA 2NPOA 3KKZA 5GONA 3RTDA 1NBMD 4C76A 5TQVA 2O05A 2QD3A 1JVNA 1M7BA 1H1LA 1ZEMA 2VDNB 2WJPA 4HMPA 4NBWA 3S68A 4BAZA 1Y1PA 3DTTA 5AUOB 1YQXA 5LKAA 4X93A 1BW9B 2C7VA 2R96A 2YJ3A 5TPWB 1MU0A 1CJBA 3X1MA 2ZYHA 1U2DC 4QSHA 5EWMB 5IG2A 4O2AF 3T1VA 4C78A 3DZHA 3GEHA 2JS7A 1C4OA 3CKLA 1DPFA 4PZLA 1M2HA 1K2VN 3MVEA 1C1YA 4EATA 1PKXA 2I4RA 4A92A 1D7OA 5LP1A 3FNRA 4NBLA 1BDIA 2QVLA 1R4MA 3N39C 4H7EA 2IYLD 2GBLC 2F67A 2V4MA 1T8RA 1INLA 2AJBA 3A1EA 3KKEA 4FSDA 2AZTA 3VC2A 5JJCA 1W47A 3F1KA 4PWYA 4F38A 2OWEA 2ZSEA 5LFAA 3EPRA 4AJ2A 1JL3A 3SJBA 4FCWA 4EY7A 4RGVA 4BBPA 2I9PA 3JZMA 3DOIA 2COKA 3OT5A 3LPCA 1SUSA 1UH5A 2Q2VA 3AXSA 4XCVA 3E5MA 4GKJB 1D2CA 3TQRA 3I4CA 4QUJA 2J4CA 4PZDA 4DWVA 3NETA 5IVPA 4OHYA 2JHGA 3DNPA 4TX1A 3VU1A 3TRHA 4BP8A 3NPMA 1SU4A 4WOPA 5A3RA 1FYXA 2H5JA 1KFEB 4B43A 4LF8B 3AV3A 4LFCB 5CRIA 5IVDA 1A5BB 2LVBA 2G1UA 2QAJA 1SQ5A 1Z6TA 2SKDA 3I01M 2YYAA 4GOLD 4I3HA 3UXHA 2J3JA 3WL3A 1BVHA 2G09A 2JHAA 1RCTE 4ZVLA 4R2KA 5KYWB 4OXRA 1NVVQ 2MIIA 4RDIA 3HL4A 1RQ7A 3U3RA 3FE2A 4RYLA 2Q46A 2R47A 1NY5A 1M6NA 2ZT8A 4DN6A 4E5UA 1QTQA 1IB6A 2P2LA 3TDMA 4MHTA 1V35A 3KTDA 4ZHQF 1N5MA 4WESA 1TZBA 2PZKA 2EQ5A 4JA2A 1GRVA 1MO2A 5FNVB 3GLTA 3VU9B 4U0JA 3NRCA 2IIQA 3OF3A 3U0BA 3WLLA 1NI3A 3AHJA 4O4JF 2R4TA 3JZAA 3L18A 4RJ2A 4W7IA 3VR3D 4PINA 1Z08A 2VPWA 1B8UA 2OYCA 3IQIX 4NU8X 3UMFA 5H4GA 4LNUB 5K8VA 1W29A 2MINA 3INRA 3K9QO 5F33A 3W3AA 1ZISA 5DYNA 1E1YA 3BTOA 1TUBB 3LY7A 3GUUA 4BC1A 3ICEA 2B4AA 4WOBA 6NULA 3N8DA 4KXYA 1OBFO 1OXBB 4MRMA 3S3TA 3VZCA 2JG3A 4BB5A 1R4AA 4LUCA 3FBWA 4K1XA 2OCAA 2F55A 1Z4QA 1GGMA 1U04A 2FH5B 3HJAA 3KQOA 2TMDA 2LBPA 3HVJA 4ML3A 4TYMA 2FKAA 5IP5A 2CE2X 2PKQO 1E4VA 2XA2A 4BPBA 1QYIA 7REQB 5GVSA 1GTZA 5HZMA 1E0JA 2JFBA 2JFGA 2P65A 1MDBA 3H8SA 4EH1A 4MPPA 5LQJA 1YOBA 2YXEA 2UVPA 3OZCA 3PGMA 4TUYB 5AUNB 1EWRA 5F21A 5HQ3A 3CX7A 1EJ2A 3WLRA 1FFWA 5L3RA 2BDEA 2G5CA 3L4BC 5L7WA 4WZBB 1MENA 1XSEA 3L49A 1MVLA 4WDQA 4Y9SA 3CIFA 1U9CA 2CFSA 4MV4A 4D3SA 3FCYA 3PA8A 4RC9A 5EL0A 4XVRA 2DUWA 3W6PA 2NO0A 2R6DA 3JD1A 4KRFA 2EATA 2RH8A 3QVGB 3NEPX 3BMNB 4CKBB 3T5PA 1XNRB 1US8A 5BMOA 1ZIPA 3MJHA 1W9MA 1UIRA 1IG3A 2A35A 4RPIA 5TT1A 1QKKA 3VHQA 1SB9A 3PPWA 1XNQB 5HILA 2EP5A 3G0CA 3K1JA 3ZX4A 4RW0A 3DKVA 5BUSA 2QMZA 3WLOA 4RTNA 4CG2A 3UJ7A 2CF6A 1ODFA 3DBHA 3AILA 3GLHA 4KDRA 3PD0A 1JIXA 3DFIA 4ARCA 1AU9A 2MMGA 5B55A 7ABPA 3HXOA 3PJFA 1GDTA 2A9KA 3PE3A 5TVGA 4EWLA 1D6JA 2EJTA 2QORA 3VO8A 1L7AA 3K5WA 5CT5A 1V7ZA 1GTMA 5KJEA 4ZO8A 3P19A 3UMVA 2I66A 1Y1RA 1J9EA 1BGVA 3HDVA 1EFVB 5JAOA 5CGZA 3DOCA 2ZS9A 1FP6A 3H99A 3HU2A 1J5PA 4O4LF 4NK4A 1KWKA 3LZDA 1BN7A 3F98A 3B53X 4X71A 2NXNA 4WA8A 4DBVO 5LP6B 1OREA 4RL6A 2JEYA 4FS3A 2BM1A 4LNHA 1BDBA 1KH1A 3OWXA 5FPQA 4UU8A 1O9GA 3U81A 4EGCB 2XMPA 4LHEA 5L51A 4RCVA 3IOBA 5FBWB 4PC1A 3ZQ4A 3GGDA 1RHJA 1ZS9A 4ZVTA 2CNBA 1JZQA 1PWYE 1Y9ZA 3AFNA 3T99A 4Y1GA 1A9XA 1YMUA 1YVEI 4QUEA 3WL6A 3O75A 5CH3A 3FOEC 3AESB 5AIBA 1MTZA 3KQMA 5BVHB 1UT6A 1FJ2A 1IJKA 3T5AA 1HDOA 1VSTA 4B34A 3C3DA 3LDHA 3H3FA 4JA0A 3D59A 1L1RA 4L07A 4FYPA 1M2WA 5K03A 3LZ6A 1GV1A 3UHFA 1ZOLA 2XD9A 1C1HA 3CRQA 4E7PA 2YW9A 3ZPXA 4Z0HO 3AEXA 2HQBA 3T7AA 3HB4X 3U7QA 5F7OA 2VBFA 1JMVA 2FVXA 3BJMA 2EBWA 4P6VF 2UZ3A 4KJXA 2WHXA 2P67A 1MABA 1WMAA 1PR4A 3PUIA 1VE1A 5DYYA 1Q7CA 2VTEA 3DUFB 1E62A 1LK0A 5JRJA 3A1DA 3FYUC 3JQGB 8AT1A 4AKIA 1QHNA 1AV7A 5ILOA 5DNYB 1E98A 1OYWA 2DT8A 3T9FA 2ZSAA 1SBHA 1AHHA 1CY8A 2NO1A 2NXWA 2BGKA 3CE9A 1AGYA 2H16A 2IPAB 3IC5A 3OQPA 1JEQA 1NUUA 2JGKA 2O9JA 5ANRB 2IZZA 2QR2A 3W9BA 1OI4A 1HURA 1CDEA 3IGFA 4MEBA 2JH9A 4BVFA 3R5FA 1SC9A 1EDZA 3X2FA 5ECGC 3Q11A 2VYVD 5JU6A 4GGPA 3DDSA 4TPKA 4Z4IA 5B58T 4YA6A 3T0FA 3T5CA 3T95A 1CVRA 2CXOA 5L4NA 1GCOA 3P2JA 1ZJ5A 3OQ1A 1WP9A 2V7XA 1T3TA 3BK2A 1TNDA 3LS2A 4ZICA 3T3NA 2IXDA 2O7RA 3CRNA 1OROA 4MV9A 4IAOA 4GOKA 5TNXA 3K30A 2Z5FA 1YA6A 1YJXA 3TIIA 3REQA 4X97A 1FP7A 3C1UA 4UDYX 3D8NA 3C41J 3WOVA 2B9VA 4HH1A 4B3JA 3R09A 3QPAA 2IT1A 4V0RA 3PGA1 1C1XB 1Z8FA 1TM4E 1R1DA 4MWZA 4AYXA 2W00A 2X8JB 2XQFA 3L6DA 4NARA 2RGXA 4W9NA 2BMJA 5F78A 2WG2A 3LVRE 2ZQYA 5TJ9A 3PCRB 3K7EA 1IHYA 4HZUA 3TNFA 1JAXA 3JAKB 4INJA 2Q3HA 3AGPA 4EZIA 1A27A 3UK2A 3OFKA 1O96B 2D74A 3GUCA 3QSGA 2ZBQA 4BIMA 4YIHA 3JD4A 1UMBA 2EWMA 5U1PA 1N4AA 1EB9A 3CV3A 1U65A 4M54A 1LJLA 1N8TA 2I2DA 3EMDA 3S2ZA 5C46F 4ENSA 4MGHA 2ZRAA 3OE4A 3JWGA 3ZWQA 4BNKA 2HIGA 2JCXA 2PQ0A 3HA5A 2BH2A 1Y3DE 1JR2A 4GWLA 5ED0A 1L4HA 5FL3A 3UC9A 3ILYA 2CZGA 2VAMA 2G9ZA 3KCNA 5AIAA 4QLBA 5IXYA 2BEUA 2OZKA 5EGSA 4BRSA 2DTDA 4HTFA 4Z9BA 3V3KA 1JH8A 1ZK4A 4N65A 1OGJA 2PZBA 3N2EA 4WI1A 4N7JA 2EFDB 5IUKC 1CE8B 1DCMA 1JKFA 2FAXA 3CXUA 3L46A 3M3PA 1W5EA 2ZIZA 4H59A 1TK9A 1FA9A 1K7SN 2Q0XA 1NW5A 4URYR 4ZT3A 3GR6A 3RJZA 3AHFA 1A82A 3C45A 3ESZA 3IUEA 4JT9A 1X2BA 5IAEA 3STWA 2JA1A 4QT0A 1P2BA 1CD5A 3GJRA 1PNVA 5FCDA 3PPXA 4L4XA 2UXCB 3TJRA 3DR5A 3PQFA 3RRZA 2DQSA 5HRUA 3R5TA 4DB4A 2IOFK 3BWXA 3F5MA 3W5JA 1ZUHA 1NP7A 1YWGO 2AEFA 3UKJA 2WM3A 2PGNA 4W5QA 1Z5GA 2I0FA 5FWXB 4J2OA 2AR0A 2X9NA 4EJSA 1HYHA 3QELB 1HI9A 5EQFA 5IAGA 3ZCRA 1A9PA 2P9CA 4UMFA 1A1VA 4KITB 4J43A 3QE4A 2ZYGA 1JIQA 4NF2A 1A2KC 3OZSA 3DVRX 3CLUD 2IPMA 4X6LA 2Y9MB 1E1MA 2FDRA 4P3OA 5EXEA 3X1KA 4HLUC 2C7GA 4YJGA 2DOKA 2ZCUA 1E3MA 3DD1A 2GHRA 2HSEA 3KX2A 4GX2A 3U37A 4GBED 1WUKS 2GZDA 3EDMA 3MLAA 5ALUA 1M7GA 4HPWA 4X1YB 2AKAB 3U26A 4G0WA 5ERYA 1OXMA 1SCQA 3I3OA 3I9OA 2WAAA 3UO8B 4LXYA 3TD9A 1D2NA 3KVNA 3VYUB 4OMFG 5L4LA 2C4KA 2ZS8A 2QE7A 2L0XA 4XQGA 2QRLA 1DO0A 4YIKA 3USZA 2VTDA 1N92A 1TM7E 1UANA 3CEHA 4CBVA 1J2TA 4YT2A 2VXBA 2DQYA 5B6IA 4X54A 1VMAA 4ZI3A 1H42A 2EKPA 2X7XA 1XQ1A 4JJKA 5CBPA 3EC7A 4BDSA 3ZCVA 4ESHA 2W2LD 2C8LA 1EEHA 1GQ2A 1Q22A 4GPD1 3E9RA 1W6UA 2R85A 3AC0A 4H7PA 1IY0A 4LBWA 5FF9A 1RCFA 2ZBUA 3U4HA 3ZGLA 2D54A 2Q29A 2E1RA 4P84A 1JLLB 1HDRA 1I14A 2G63A 2AOUA 5DGCA 1NF8A 5DHQA 1DG1G 16PKA 1UK8A 1XC7A 4AP6A 1JHUA 4H7IA 2FPMA 1GHTA 2J0EA 1WDWB 3K70B 1X0XA 4LZWA 3KVVA 1CW2B 4ZVVA 5C52B 3ER6A 2FQQA 221PA 2OCIA 1IMOA 1YZ3A 2V45A 3TI7A 4YP7A 1AUPA 4DJDC 1X2EA 4QXPA 1Q6YA 3D7MA 5L9AA 3AFOA 1TZMA 1VRCA 2FRVA 2C00A 1L7XA 4MKGA 5J63A 1VYHA 1NBHA 3V8NA 7MHTA 2PT9A 1QO0A 4RTMA 5B1SA 2GN1A 3OF2A 2AXEA 5HE9A 3DCJA 3HSKA 4JBNA 1CR1A 1HWYA 1G21A 5ENVA 1AX9A 5A5GA 3N2KB 3ZYZA 2GT1A 3AL0C 1XBTA 1Q0QA 2OG1A 3UAWA 5CFNA 4F91B 1Y8ZA 2BFNA 1DJLA 2BI7A 2BI4A 3PXXA 4I1VA 1XL1A 5IBRA 4BTLA 2XRMA 3KUDA 3GV0A 4MV7A 1P7VA 4TSRA 3ROTA 1CEYA 4REQB 4CQLB 4LXHA 4UVGA 3T4EA 2P2ZA 3WNVA 1GU1A 4CKCB 4ROSA 4KVFA 3QU2A 3VAZA 1SD2A 1XZKA 3KQLA 1SBTA 4R81A 3TTWA 4D8WA 1T3HA 2HD4A 3AUJB 2YIMA 4URUR 3FYTA 4MO9A 1Z2OX 2X4DA 3ORSA 4Y6OA 4OJTA 3Q4GA 4MB0A 1B74A 3PRKE 4N0QA 3HKEB 5ALTA 4PZ9A 2H8KA 3MAAC 1F8XA 1OH7A 1G5QA 3L92A 4ZI5A 4GYJA 1V9LA 1WD7A 3OIDA 3PFFA 1E3TA 3NKVA 4ZI2A 3LFHA 1SOAA 1SU6A 3EH1A 1T3ZA 2PRZA 3MMNA 4GR9A 1D0IA 1OLUA 2B6HA 2CXSA 5TGZA 4GP9A 2GZSA 1MF7A 2R2AA 4BNDB 1PSWA 2GK7A 3NTRA 2L18A 4BMDA 5KQMA 5CYOA 1CPYA 3ANSA 1R00A 2PGAA 2AI1A 2WLTA 3DOUA 3QLUA 3FI0A 4ZQEA 4LJ9A 4Q12A 5BN5B 4B7ZA 3OQMA 3AEKA 1A2QA 5KX5F 3GNSA 1RYMA 1V2HE 4FKBA 5KJCA 1U7DA 5I9IA 1TU0A 1UKVY 5A4JA 1JEAA 1MO4A 2VSYA 3IHTA 4XM2A 1DFIA 4TLLB 3LLMA 2NXJA 1FNMA 1G17A 2O2SA 4IXWA 3OFND 1NW7A 2IXTA 3TIVA 4K6OA 1GYRA 3PEYA 4P3XA 5FQOA 4G0QA 4BKOA 1EM8B 3C3KA 4OYHA 2X77A 3T7EA 1L4GA 3VR2A 4I1OA 3H9EO 4TV8F 4CN8A 1F2VA 4DJ5X 4GT1A 2G1PA 4KSYA 2ZRCA 4ZU6X 3JPYA 1VJGA 4KSBA 2GAIA 3B7PA 3LVQE 3R74A 1XMOB 4MWDA 2DFVA 3QFTA 1VIVA 5KTOA 4JI0B 3WSWA 5EJEA 3VKWA 1QKJA 5JCJA 1I9GA 2HAEA 1G8MA 2GMWA 3PWTA 2NTNA 5BXYA 1E3WB 2CDCA 4K2AA 3KPWA 4N7BA 4LWPA 1W4RA 2P6OA 5HRCA 2VJNA 2FQYA 5LOVA 2H57A 1FTYA 1M5UA 4HQ0A 3AMVA 4LZPA 1E3DA 4PS0A 1TYZA 3D54D 1KP9A 2OO7A 2PX3A 4IZHA 3JR7A 5H59A 4P7BA 1RPAA 3B6EA 3ML1A 3QZUA 3SQXA 1DOAA 1SXJD 1Q0ZA 2QX4A 4FK8A 1T0UA 4LN1A 1AA9A 3AH8A 4UVIA 4EITA 5K3EA 4A0QA 4DGQA 2IUSA 3VSEA 1E4OA 1CS0A 5J5CA 3U9TA 3BE8A 1FBTA 3WY9A 5LMZA 3I6IA 3WYCA 2JJMA 4DLRA 1NP3A 1JMYA 2VPPA 4TT3D 4ZARA 1P9WA 4EG1A 2WTAA 1G2QA 3RU3A 3TD2A 1E77A 4UXIA 2ETXA 2AT1A 3OTIA 4B3SB 1JJIA 1D04A 3COWA 2JASA 4HF7A 4MEJA 4OBBA 4RIIA 3RJMA 5AW1A 4JNKA 1BMFA 1LQUA 1E3QA 2OV1A 2NU9B 1P7CA 1PR0A 3R0VA 2XDQA 3HYNA 1ZLYA 5CFZA 5AFSA 3FZEA 5JRDS 4FFRA 1N7GA 4O5OA 3GLGB 1MW8X 2NPFA 3LUJA 4KKXB 2Z4TA 3RADC 2BKVA 4WN3A 2H51A 4MGYR 1AQYA 3VUFA 2IRWA 3IO5A 3U2QA 3LBYA 2C98A 2PL3A 4GI7A 3ZGZA 3L6BA 4E2XA 2G5PA 2B1JA 3RT7A 4Q82A 2CNNA 2P4QA 3ADPA 1J4AA 1JAYA 2W43A 4CJXA 2CV1A 5ALFA 2B1GA 4HJRA 2JFHA 1YDEA 3DEIA 1BKYA 4FYMA 3A26A 1JIIA 1POXA 2GJ4A 3O1JC 3LY5A 3RH0A 3VSCA 2IVZA 2ZT6A 3QWFA 2HA4A 1Z5UA 1L5ZA 2VSXA 1U5AA 4F45A 5T8KC 3A10A 5C8VA 2PU5A 3C6YA 2IXAA 3KSDO 4FB4A 1NLZA 2V74B 4CTMA 5I9NA 4UZFA 1MVOA 3G17A 4B47A 5FAXA 4JKOA 4BO1A 2E4YA 1QYVA 1CZHA 3H2IA 2YWFA 1UFVA 4KAFA 1H3EA 2FKNA 3CTMA 3OJLA 4EELA 4L16A 3VPHA 4JJ7A 3ETJA 1TM3E 3HE3A 3LHDA 4ZVRA 3I73A 1USIA 3RROA 2IELA 4XUEA 4AUMA 1ONSA 3DF9A 1JU9A 4P2BA 4CQJA 1HMPA 2GXAA 4XFDA 3LUCA 2RARA 3GGCA 3I58A 3CA8A 2Q0QA 1EVEA 4OFBA 4P2GA 2AKEA 1Z38A 4ZGGA 3MUFA 1H9BA 2VF7A 4NXMB 1YV9A 1ZH6A 5ECWA 5AP9A 1YB2A 3P52A 1FB5A 2JW5A 4XR4A 2ZJOA 2EZTA 1ZN8A 1IHPA 3L1JA 4G8JA 3IE0A 3MXOA 3NVMB 3S1LA 3IAM1 4MDEA 3A04A 2B7LA 1VSVA 2G9QA 3TTSA 4C3OB 2GPNA 3GGOA 4U2DA 4EO4A 3N86A 2OORC 2X1VA 4WT7A 4DTIA 1GUBA 2DUNA 1ZD5A 2EZ9A 1X7YB 2VNSA 1XDDA 4LSZA 2E37A 3OPYB 1AXEA 3BVPA 5FBKA 3CZ5A 1RMQA 3RNOA 1MRNA 5KSOA 2IYPA 1ULBA 4AMGA 4TL8A 5BY2A 2Q2OA 1YR2A 2QTMA 4J1TC 3MNFA 3GGPA 4BO5A 2N0SA 4EFMA 1N32B 4MVCA 1GGJA 3PI7A 2GEUA 4MRPA 5C34B 1FS6A 1MQ9A 2I99A 5D7BA 4U5XA 2V0GA 3E35A 3IDSA 3DS8A 1KEWA 2OUKA 3CPEA 1ULZA 2G77B 3L7IA 3LDGA 3NJ4A 5DTMA 4DLPA 3H75A 1EBUA 4LTMA 3F6RA 1HO3A 2IXBA 3GLHE 4RKWA 2GZRA 4EHKA 1GFWA 2Z8XA 3OH8A 4IFTA 2F9FA 2XT9A 1QHHA 5TVKA 3FWZA 3B3FA 4O8CA 1NXPA 4MS3A 1ILEA 2Z5VA 4JIMA 3V8BA 2F62A 3CR8A 2GLTA 4HH0A 4CIBA 1AG9A 1TVEA 1V39A 2CWDA 3AUTA 4Z7OB 2OCBA 2VDJA 4LFAB 3NBUA 4JI1B 5INTA 4G8DA 2IPLA 1XEFA 1L4EA 3I5UA 1QP7A 4QEKA 1N0UA 3C6QA 3KQQA 2R1VA 4KYIB 5JFOA 2GR9A 2NAPA 3D3WB 3BJIC 4FFWA 1XTRA 4GPIB 1FFHA 3F71A 1XO1A 1LDNA 5EIHA 2VPIA 4EF6A 2BSAA 1TVKA 5MN6A 3FNQA 3VNUA 3FPAA 2WHQA 1L3BA 1QHYA 2XUIA 4GZLA 1QLJA 5DW0A 4G4IA 1PJ4A 3WRYA 4AJHA 4YMHA 2EJVA 2WAMA 3SSAA 3KK0A 2FWIA 2GK6A 2H9YA 3GJXC 2DPLA 1EZ1A 3AIKA 3FCSB 4OLJA 4U8HA 4EB3A 2IIBA 3QNUA 4I5FA 1UBGA 2HMSA 2VP3A 4P83A 4DOMA 1QLWA 1JHRA 2UYYA 3PYLA 2ZI5A 2QAGC 2VI5A 4KPGA 4R54A 4AKTA 1RJ9B 5K2OA 2VRBA 3KUCA 3NC0C 1SHJA 4O2BF 4WLOA 4KQGA 3ZHCA 4URWR 1QB7A 1P9OA 2JZOA 1NJFA 2BMAA 3OSZA 5BSGA 3C1OA 3EVGA 5B6JA 3HXPA 5KYTA 1UFQA 2QLNA 4NYMQ 1EK5A 1YI1A 2FMHA 2GZ3A 2YJZA 1TU3A 2H63A 4K26A 1HDEA 4JBGA 5EZYA 4O1IA 5A4MS 1I2ZA 2PIDA 4HX2A 1GTJ1 4NE7A 1NDUA 2EX1A 2JIOA 2JJ2A 1Y1QA 2ZJ5A 5KIAA 4MINA 1CUCA 1WKVA 4IQ4A 1HEYA 2P1DA 2V65A 2QTZA 5A0VA 1LSSA 1ZI9A 1IY1A 1O8BA 2WSSA 3G7NA 1MT0A 5ER6A 1SCUA 3FBTA 1A71A 3A28A 2OD7A 2QVBA 2GF0A 3MT7A 4DLKA 4CYMA 1Y4DE 3BE5A 3OE7D 3NYRA 4PGMA 4WL0A 1KZYC 2CC2A 2OOKA 5EMJA 5KOJB 2XYVA 1DAHA 1UZUA 1E5QA 2VT6A 4PLCA 3FDIA 2H4JA 1WPQA 1YK0A 1ZCZA 3Q7RA 1K0UA 4JT8A 3UWDA 3WISA 2JVIA 5F12A 1P31A 3CCCA 4NENA 5DTQA 2VDWA 4J0EA 3U4GA 4R9RA 3V4VB 2OXTA 5E6RB 1PZNA 1UC8A 1UXHA 3PYMA 4ZCLA 2HDOA 3JASB 3I0ZA 4BWVA 2I7DA 3BGOS 4LY0A 4EJ6A 3BJZA 4H16A 1RADA 1RQ2A 4B48A 3EVBA 4F8JA 4FSXA 3USES 2UZAA 4FGZA 3UTCA 5JJ5A 2B25A 2ZVDA 4MAAA 3TYXA 2RK3A 1C0EA 1FLAA 4FB5A 3LKDA 3H6GA 3AIIA 2XZDA 1U0BB 1UJNA 2XTMA 3TVYA 1V8ZA 2IYFA 1XKXA 2FFHA 2J9RA 5IM4A 2FP3A 2P9JA 2O7VA 4LF9B 1T0HB 4RKRA 1XMQB 1WP4A 4GX0A 3GEGA 4XJVA 4LRQA 4NATA 1TW2A 4Q9JA 1CIPA 2HRBA 4FUTA 4DYHA 3VJRA 4RE5A 5HTKA 3WOHA 4XEHA 4B44A 4CM7A 4OQDA 1JGTA 2XKBA 3OQJA 1B0UA 1SY7A 2HRQA 4P0TA 2NZVG 2PYIA 4YLGA 3GVCA 3ZY3A 3VSAA 1XK6A 4Y98A 2Q5CA 3LT0A 4CLXA 1JFRA 3CZQA 4ZA2A 2M6SA 4Y2RA 5L45A 1W85A 2WMDA 1XCOA 2OY0A 3IEUA 1L3CA 1D4AA 4M9RA 1SA0A 4WUVA 4E12A 2OZLB 4NMLA 3CPSA 3OM1A 1SEVA 2ZRBA 5B4TA 2RB4A 2IODA 4QGFA 3F4BA 5KC8A 3II6X 3QI2A 2QN9A 2WKQA 4RVDA 4TYQA 3FLEA 5IPFA 3PE6A 3W1VA 1Z12A 4DPKA 4AG5A 2AUTA 2HQRA 5AHKA 2BMWA 3NONA 2C2HA 1UZLA 1EGVB 1SBCA 2P9TA 3GJ5A 4O3FA 1W8DA 4P86A 3I23A 4YJ3B 5I7AA 4D74A 2HV9A 1YIDA 2W5UA 1DT3A 2IEIA 1XEXA 4QHTA 5JQWA 4Z7JA 1HE8B 1O4WA 3BAZA 4B6PA 2I34A 3PCXA 2LCFA 2YVUA 4ZCMA 4B8ZA 1T0BA 3K09A 3MWDB 1NC3A 5BVGA 2XOKD 3HDGA 2QG4A 4G36A 1XT6A 2VWGA 1I7PA 2Y0PA 3IR6A 3PVSA 3SIWA 5PGMA 4TTSA 4CPDA 3AQ4A 5AKKA 1RSZA 4MIKA 3TM4A 4AN4A 1P44A