1L1QA

Crystal structure of aprtase from giardia lamblia complexed with 9-deazaadenine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
181
structure length
181
Chain Sequence
b'TMSVADAHALIKTIPDFPTKGIAFKDLSDILSTPAALDAVRKEVTAHYKDVPITKVVGIESRGFILGGIVANSLGVGFVALRKAGKLPGDVCKCTFDMEYQKGVTIEVQKRQLGPHDVVLLHDDVLATGGTLLAAIELCETAGVKPENIYINVLYEIEALKGREKVGQKCTRLFSVIREHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenine phosphoribosyltransferase
publication title Closed Site Complexes of Adenine Phosphoribosyltransferase from Giardia lamblia Reveal a Mechanism of Ribosyl Migration.
pubmed doi rcsb
source organism Giardia intestinalis
molecule tags Transferase
total genus 51
structure length 181
sequence length 181
ec nomenclature ec 2.4.2.7: Adenine phosphoribosyltransferase.
pdb deposition date 2002-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1l1qA00
3KB8A 4RHUA 1I5EA 4RQBA 2PRZA 1VSTA 4JLSA 2GEBA 1LH0A 3DMPA 3H83A 3MJDA 5HKLA 1AO0A 1DQPA 1ZN8A 1A95A 2IGBA 4WN3A 5BRNA 2JKZA 3HVUA 1J7JA 3ACCA 3MBIA 3ACDA 4ZFNA 5IPFA 1VDMA 3OZFA 1BD3A 2PS1A 1FSGA 1P4AA 1OROA 4WMLA 1O57A 1QCDA 1A97A 2HCRA 3M3HA 4X44A 1R3UA 5KAMA 2C4KA 4KN6A 4QYIB 4M0PA 1ECCA 2VFAA 2XBUA 1ZN7A 4P82A 2AEEA 3OHPA 4RHTA 5BQPA 4TWBA 1BZYA 2DY0A 1QK5A 1V9SA 4S2UA 1STOA 2PRYA 4Z1OA 1L1QA 4MB6A 1UPFA 4RAOA 1DQNA 4P84A 1PZMA 1UFRA 4OHCA 5K51A 4LZNA 4RV4A 1G9TA 4QRIA 1TC1A 3ACBA 1O5OA 3O7MA 2WNSA 1XZ8A 1P18A 4P86A 5BQOA 4P81A 1P19A 4RQAA 4RADA 1TC2A 2E55A 1IBSA 1ECFA 1U9YA 1YFZA 1ECBA 1JLSA 2H06A 5EUCA 5KAPA 4RHYA 5IAOA 4PFQA 2YZKA 4LYYA 1DKUA 1A4XA 1U9ZA 3DEZA 3GEPA 3GGJA 1QB8A 4P83A 1QB7A 1GRVA 1DKRA 2P1ZA 3LRTA 1HGXA 1Z7GA 4IJQA 2JKYA 4RAQA 5HIAA 4FYMA 1NONA 1VCHA 2JBHA 4LYGA 3DAHA 4RACA 4X45A 4P80A 5JV5A 1BD4A 4LZAA 1ECJA 2JI4A 1A3CA 3EFHA 3OZGA 3QW4B 5ESWA 1XTVA 1MZVA 4LZOA 4PAWA 3N2LA 4M0UA 1CJBA 4F8EA 1OREA 1D6NA 4P3KA 4RANA 4JITA 1I0IA 1JLRA 1UPUA 1ZN9A 1QK4A 2FXVA 1L1RA 3NAGA 1G2PA 2H08A 1QK3A 1DBRA 1I0LA 1XTUA 3LPNA 2EHJA 1XTTA 1A96A 4RHXA 1I13A 1Y0BA 5BSKA 1I14A 4M0KA 1G9SA 3G6WA 1GPH1 5ESXA 4QYIA 5JSQA 1WD5A 2H07A 5E38A 1P17A 4RABA 1G2QA 1NULA 1A98A 1W30A 1XZNA 3S5JA 1HMPA 1OPRA 1QCCA 3GGCA 1ECGA
chains in the Genus database with same CATH superfamily
4EG6A 2QE7A 2QRPA 3O4RA 4U6QA 1PQUA 1SXJA 1YDEA 1K89A 1O96B 1QOZA 2VNSA 5K2OA 3RWOA 4CFSA 4I1YA 3ZDZB 3M6AA 3GJZA 1NJ1A 1HORA 4D97A 3L3BA 4BLTA 4QYTA 3PYLA 2PZBA 3OZVA 1XMPA 3KQWA 4ZARA 3ZQJA 1RQ2A 4JGIA 2VDVE 4W99A 5JY6A 3ACCA 2V98A 1INLA 1D9XA 1M2HA 3IA7A 4KCGA 5DM1A 1SD2A 5IM4A 4TWAA 4WK0B 4PC6A 1KU0A 1Z6AA 2XGSA 2YXPX 4B74A 1IN8A 4Z9FA 5BQ3A 3KT3A 4E70A 4CG1A 1M8PA 1RMTA 4P33A 5GADl 3P26A 1D09A 4U2FA 3CZRA 3R3ZA 4TM8A 1P9NA 2D3WA 2QTRA 4NU8X 2IH4A 1SKBA 2CY0A 3HP7A 3L1HA 4KN9S 4LYAA 2RGCA 1HC7A 1Q21A 4OIFA 4DA6A 1EUDA 1R4ZA 1W46A 1M2VB 3MINA 3GLIE 1U31A 4KDCA 4DCUA 3GUCA 3B48A 3ZH9B 1ISJA 3PK0A 3HU2A 1CF2O 4TTRA 1GAXA 3ER9A 1DU4A 3D3QA 4OJYA 4V0QA 2O2ZA 3UV3A 3IELA 5IF3A 5DTJA 1BGXT 1GG9A 5GVRA 3EC1A 4NLLA 2IEGA 5AI6A 3ZU4A 5LR6A 2X77A 4DLZA 4PXAA 4C7OA 1Z2NX 2PZKA 2VYND 3GCDA 1NQ5A 2I67A 1VYVA 4OMFG 2OLJA 4YJ3A 1MX5A 3DYBA 1K75A 2ORVA 4H7EA 4BX3A 4UE6A 4DR7B 3PHCA 1OFGA 3HV0A 3PIRA 2JFBA 5FV7A 5KTPA 4HX9A 3OM1A 1K6JA 3FHTA 2OVBA 2RBKA 3K1JA 5KQPA 3FBTA 3S28A 2WP8J 3B1WA 2FPGA 4CN9A 2GEJA 4P7BA 3TUZC 2VJBA 2ZI5A 3QVGB 1ISFA 2B8JA 5I48A 1TF5A 3BSWA 1JIKA 2JFXA 1EHYA 4IDAA 1IK4A 3BEOA 3TL3A 4A8JC 1N9ZA 4MQBA 1Z39A 2RJNA 1EJBA 2COUA 4I9FA 2OENG 4RAQA 4BKRA 3DM9B 2O1EA 5JXJA 4WK2B 5KSYA 3TEJA 8GPBA 2FEAA 3TCKA 1ZU4A 1E6KA 2XJ4A 4G0YA 1X92A 4EYKA 1RZRD 3N58A 3I2YX 2P2CA 2OGTA 3G7UA 3JQ8B 4DAOA 1C9NA 4PWZA 4FGJA 4XYBA 2R62A 3DAGA 1MB9A 1V5IA 2XCIA 4J16A 4F5WA 5K7SA 1NHWA 2IUFA 4KV9A 2OYRA 3TI9A 2JIZA 4EHJA 5EKSA 5IMSA 2F1IA 5EKXA 2JCGA 5EI5A 4D80A 1ITZA 4XWYA 3PX7A 1ORWA 4NATA 2JIDA 3EY9A 2P9GA 5IYZF 2ZKLA 2QYOA 2VDNB 4A6PA 1ISPA 2EFDB 1W4ZA 2Q6IA 1KNQA 3DTVB 3EN0A 3L77A 3O2NA 4Y1RA 5K8CA 1YBAA 2HGSA 1JR3D 3LCRA 5ESRA 1RS0A 4WQMA 4DQ0A 4W82A 2NZ2A 3KU1A 2W4QA 4DV0B 4KDRA 2TMDA 2XBLA 3BMXA 4TKUA 3BGVA 5JISA 1HG1A 1LLQA 3BKWA 2E1PA 1Z6QA 3L7CA 1HMPA 2H51A 4EGAA 3RFVA 1KU6A 2RB4A 2WUVA 2KB0A 3G9QA 4ZZ2A 3ZCVA 1ZIDA 3W9BA 4B7ZA 3BHIA 1P33A 3CZPA 1AQ6A 3KR9A 3OC0A 4FFOA 2GEBA 5BSRA 4CV2A 1AH2A 3PR2B 2GKOA 3M9LA 3WL8A 3L1VA 1GV1A 4DJJA 5CVVA 2CBGA 3NHUA 5FKJA 3OIVA 5JNUA 2IC5A 2F3QA 1ZINA 2OP1A 3HBAA 4MS1A 3W3AD 1JV2B 3MSXA 3Q3CA 3WDLA 1GPMA 1N2CE 1QVVA 3ZYZA 4CEJA 4TV8B 2VAWA 2YMQA 2ZCUA 1V26A 2D06A 2O3TA 4KMRA 2KX7A 2Z3ZA 1FSFA 1CY4A 2NTVA 3IEXA 2VBGA 3P0EA 5REQB 4PC7A 1Y3HA 1X2BA 2PS0A 2HIMA 4KW7A 5DP1A 5LBTA 3WG9A 4AZ3A 4DRZA 1X1BA 2NNWB 2R1UA 2NUAA 2WVJA 3M9XA 4LXUA 4MZXA 2DHCA 4PYNA 4WLNA 3V8RA 4ARVA 2C57A 4C6TB 2PUWA 5ECWA 4DWWA 4OX9Y 4E15A 1YS4A 1KEVA 3KUKA 3C1UA 4GI7A 4OQQA 3NKFA 3KV3O 4P4LA 4R6XA 3WFJA 3UC9A 1AKTA 3F3SA 2Z9BA 2G9ZA 4GPD1 5DHAA 4P8RA 3DONA 1TJNA 5ALQA 1SBHA 1MAVA 1MP0A 2PDAA 4IIHA 1JF8A 5TF4A 1L7NA 3ZY3A 4B5KA 1PK8A 1JJ7A 1Y1KE 1HYHA 1XWFA 1PDVA 1RP7A 4HY3A 3QE2A 1SXGA 5B58C 3SMQA 1NJ2A 4EY8A 2JGRA 4NP6A 3HJTA 4N8SA 2A58A 2QRLA 5JSZA 2CWDA 1U1IA 1EQ2A 2Q6VA 5F23A 3W2GA 4EI7A 4QYSA 1JUDA 1U5BA 3E48A 1RKUA 1TW3A 2D2XA 1BAPA 1YULA 4H7IA 4HEA6 4AZWA 5LNK6 2HHAA 2BLLA 4J4HA 4JU8A 5BYAA 5ENVA 2BONA 2C8LA 5DHQA 3L06A 2PUEA 2G5GX 2HZBA 2YZ2A 4JU9A 4F3YA 1FFEA 3NPMA 4RY2A 5JSYA 3DOIA 4ES6A 3U16A 1T8WA 3TD9A 7MDHA 1HNWB 5DLPA 2N42A 2VPXA 4A5OA 4ZCPA 5B30A 4M8SA 1UJCA 2O0LA 1DINA 1J8YF 1G7TA 1NONA 4HYYA 1OA1A 1QQAA 1MT0A 3D8UA 1B3RA 2WG2A 1JLHA 4GX1A 5LUBA 5E6UA 5A71A 3M5CA 1ESCA 1F8FA 4KH1A 3NAMA 4Q4JA 2CLLB 2WE7A 3OKCA 5IFLA 3EFOB 3PQ2A 3FCUB 4BP3A 4EPXA 1I30A 1W36D 2PH1A 1XYGA 2QVGA 1KO7A 4B3GA 3HFGA 4L8LA 4YREA 2B2NA 1M8FA 3ILXA 5KC9A 5KUTA 1Z2CA 2F90A 3AXSA 3OZDA 4O33A 4PG5A 2WFLA 1ACMA 1L7OA 2ZIXA 4Z2AA 2KLHA 3HPQA 1U7HA 3QLTA 4H1UA 1Y8RA 4XX1A 2IX3A 2QD5A 3BX1A 4XDYA 5F4ZA 1YJQA 4OMDA 3R7BA 3G6WA 2AQKA 1KSFX 3V8NA 1Z06A 2DRIA 2YVKA 4QVKA 3TO5A 4C0KA 3USCS 3QBVA 3ON5A 3M89A 5BQXA 2X3YA 2XECA 5CM2Z 5IC5A 3FWYA 3M1LA 3KSAC 1Z5NA 4YIKA 2VN8A 3LFUA 1QE3A 2O2IA 4D8TA 3KAPA 2Q5IA 3WK7A 1Q50A 1FYDA 2CDAA 1VBMA 1VC2A 4W1SA 4XOUA 5ARCA 4GNRA 1XN1A 2P79A 3O8LA 2F3UA 1PP4A 1Q15A 2WSLA 1GNRA 3BMCA 1U3VA 4MTLA 4MQUA 1SFRA 5ITZB 4C0JA 1S9DA 3WJAA 1YB1A 4S3MA 5C8YA 2I4RA 3HYSA 1OA0A 3CUEF 3P4UA 2V03A 3R7WA 2IIPA 1HSZA 4KH0A 4K88A 4K6CA 1PR0A 5D2CA 1PTJA 4JLNA 4ML3A 4PSCA 1L8AA 4V2UA 1F48A 3T4UA 1X1CA 1C0PA 1YJBA 1G8FA 3DP9A 2FFQA 4Q7QA 2HA3A 1E6CA 2RG7A 4UHDA 3O8RA 4ZYVA 5LB4A 4JWTA 3DCNA 5FPKA 1AZWA 5LMNB 3B12A 3G2NA 2YYAA 3L6BA 2R86A 1M1NA 1POWA 1WQ4A 4QGGA 4BVLA 5BPHA 2HT6A 1ORDA 1YK0A 2N0SA 3T3PB 5I47A 4DMCA 1HI9A 1NNUA 3V97A 1FFAA 4PR0A 1DQRA 1ZG3A 1OXKB 4LOIA 3SSNA 3KAKA 4WA8A 2C9CA 2NP7A 2WICA 4LFCB 1DP4A 5G41A 4AO7A 4BEBA 1FJHA 4NZ9A 1G4HA 1NURA 5GWXA 3KXLA 4MS4A 3CRMA 3ZQ4A 2EL7A 2A30A 4Y6GB 5DN9A 2XDQB 3HYLA 4V03A 5DNDA 3RYCA 4DNQA 2QG6A 1PWEA 4YAUA 1BCRB 1P1CA 1PSWA 1G4AE 2YBDA 2PKQO 4M98A 4MV7A 2P91A 3SLGA 5BNWA 3N3AC 5CDYA 3H5LA 1M2EA 1I51A 1NF2A 3WQQA 2O7SA 5I5EA 5FA8A 1J09A 5DNWA 1MRSA 2IPMA 2DQYA 4ZT3A 2ZTLA 2MT9A 2NXEA 5JD6A 4KXYA 4I08A 3QIVA 3MUNA 4TVBA 3FFBA 5L7WA 3LPAA 1G64A 4ZOLB 3CRZA 5HDBB 4B9AA 4BMVA 5DFAA 3R0IA 3IQGX 2QLNA 4MVJG 4YP5A 1QP7A 3AM4A 3VNBA 2BFBA 2HRBA 3LUGA 3K8ZA 4ON9A 1E7SA 2P2LA 4BMOB 4FJ2A 3EFHA 4ARCA 4IG4A 2PRKA 1EFAA 3O7WA 4PAWA 3N2LA 1GDDA 2OGUA 1FU4A 4BUZA 3LL4A 1UXJA 1ONSA 4JBXA 3JRXA 1JEQB 2CB9A 4P3KA 4S04A 1M72A 1TTTA 3KOMA 3P71T 2CJWA 1NVKA 1KS2A 1I2AA 4NJOA 5GOZA 1G3UA 5BVGB 2R2AA 1UANA 4GR5A 4AKTA 2R79A 1U7WA 2DBZA 2AFVA 4YASA 1T2NA 1N2CA 4YAWA 2XIJA 3N59A 4EY4A 2O50A 3I32A 3KIPA 3OM0A 4G5YA 3SHOA 2O06A 1EFVB 1RDFA 3I83A 4D99A 3V2IA 3RYFA 4DQVA 4BJ6A 5C46F 1RKBA 5EESA 3IUJA 1FNBA 2B69A 4K6GA 3VKUA 3ZZTA 1GTG1 4CCWA 1IHXA 2FR1A 5D3MB 2FJPA 5TGZA 5IM5A 2UYHA 1MEOA 1GHTA 1JQBA 2BGWA 3J7AC 2NT3A 1P1HA 2AN5A 2O8BA 3N8NA 2CL6X 2G1UA 2WW8A 4PHHA 2XBMA 3R3UA 4GI3A 4RK7A 2CE7A 2YHUA 3GMIA 1MAAA 4L5YA 4AJJA 4D3FA 4ZIRA 3TQTA 1YA6A 2VO1A 2IHUA 1MB4A 2B82A 4RIGA 5H02A 2GKGA 4L50A 2BE9A 2IRWA 4R16A 3T12A 4EG4A 1L8OA 3AQ4A 1MX9A 1GDHA 4BNNA 1KK0A 5HHTA 1E0SA 3EHDA 2WKRA 2JGMA 4MW9A 4D4KA 1ZFNA 3ZQ6A 4HH1A 1TZ2A 3K32A 3MN1A 2ORYA 1BOFA 4IIGA 5KQLA 4XQCA 3WQHA 2WJPA 4WZBA 2Q4OA 3T9DA 2ZBUA 4G5XA 3HDVA 3M0EA 3TWOA 1J90A 1RWWA 3OLZA 2QLTA 4ZA2A 2VDMB 5IJ0A 4G0OA 4NJEB 1NI3A 5DGIA 3T06B 1P73A 2Q46A 4J2HA 3LQ2A 4Q4LA 1NBWB 2GLXA 2IL1A 4Y2XA 4ZO9A 5HFNA 4QXQA 3IVAA 1B0PA 1W4RA 4X92A 1DOAA 2PA0A 4XRGA 2Y0PA 1YZHA 1KI3A 2H3EA 3L4BC 4IVPA 4Y6OA 2NIPA 3KLMX 2PUAA 2NZ8A 3PVSA 1XCGB 2VP9A 3HCDA 4FYPA 3ISTA 4EG3A 5KJEA 3DZHA 2ZQZA 3OQ1A 3TR0A 3K0BA 1PBNA 1SPXA 3IBSA 3KSZO 2AE1A 1ZGAA 5FYQA 1XLWA 1F8GA 3AWDA 1KYXA 5LDGA 1JPJA 1XMOB 1FS6A 2AXEA 4RK6A 4B44A 2WPDD 3HEAA 1LBEA 3G5AA 1L1QA 2FETA 4P4UA 4RPJA 3ZHSA 4I2NA 4ERXA 4TXHA 5KDOA 1YUNA 2FRVA 1XZDA 4LNHA 1RXWA 3SHTA 1JG6A 3H84A 4E3ZA 3AR4A 3WAJA 1WULS 4HR7A 3LX6A 3HYNA 4LC9A 3O84A 5T3UA 5G1PA 2IWRA 3TYXA 3U4DA 4UASA 2OAGA 2C9OA 1Y3DE 2GDJA 3FYTA 4JLWA 3KQOA 4ZVNA 3UAZA 1XNRB 1BMFD 5IBCA 4P36A 3VX3A 4Q4AB 4IGFA 4P3YA 3C1OA 3MGKA 1IBSA 5JU6A 3WWCA 4WN9B 1PR4A 2G4LA 3PP8A 3L4SO 2WE8A 1Q0HA 1VE3A 16PKA 1Z73A 3FKJA 3BIFA 4EFLA 5L3SB 2DMRA 1CZOA 2DBVO 5LZ7A 3CT4A 5AHXA 1M10A 3F8TA 4KZPA 1ORTA 1RPTA 3GRVA 2FWMX 5B4TA 4MYRA 4EUNA 3TLGB 2VF4X 3NKVA 2V8BA 3D9QX 1V6CA 1CUAA 3EQ6A 1GTZA 3AI1A 3SEZA 4IO1A 4MKFA 4CQLB 1RCTE 2WT4A 3PXDA 3D7NA 4FGWA 2G6TA 5IABA 1XXHA 3HO8A 1U9JA 4TTJA 4RTSA 1CBUA 1E9DA 3QY0A 5C81A 5I45A 5FTMA 3BL5A 5E3JA 1FXSA 1SUEA 1ZX1A 3IO5A 8MHTA 1L5WA 3O4HA 2CXTA 1ZXLA 3EVFA 1V43A 2WKPA 5HIJA 3UWSA 4C4SA 4XKJA 2KE5A 3L6OO 3EF1A 1FUUA 1HDEA 1XQWA 4L5IA 4XFDA 7REQB 3WRYA 3EGXB 3U1VA 3OPYB 4NABA 3CE6A 3JW8A 4XQ0A 5FADA 1TQDA 1CSEE 2VQ3A 2ZTVA 3OQPA 4NZNA 4WZ6A 5HKOA 5L9AA 4LXYA 2I91A 1N25A 2CJPA 3AW9A 2IE8A 2X2OA 3KU4A 2OBFA 4NJMB 4WAUA 3UJBA 1CUWA 1KO4A 2OM2A 1NUSA 4G5QA 1L4EA 4N49A 4F8YA 1NLZA 4MYSA 1RJGA 5DDIP 3PC8C 1DB3A 1JMVA 3OE4A 3GFGA 1ABEA 2CD9A 3BRQA 1E59A 3FSRA 3KT6A 4QODA 4WD3A 2Q07A 4AMYA 1DAIA 1X86B 3E3MA 3L0ZA 3SZOA 4EYQA 1E2MA 2ODAA 2VP2A 3EXAA 4IHJB 1XF1A 2AOTB 2WHQA 2YVUA 3HKEB 4HMQA 4S1NA 4Y6QA 3CA8A 2CNLA 5EC8A 1UR5A 2UUPA 3T3OA 3NH9A 3EXG2 1XLVA 1D3AA 1T9DA 2O2XA 1R6BX 2XZPA 5JZOA 1QX4A 4L8VA 1NRIA 3L1UA 1Z4PX 5BSEA 5JT1A 2VNHA 3AU8A 2DF8A 3TTYA 4CM5A 2VF2A 3RQSA 4QTZA 2FQ1A 1JXOA 1FJGB 1UINA 4DV3B 4GSLA 5DLQC 4G2NA 1V1JA 1NZJA 5ENZA 1ZK4A 4CV3A 3C87A 3VOTA 1OAAA 2O2SA 4A73A 1OZHA 4IKPA 4C7JA 4AP9A 1KZ9A 4DNXA 3FUVA 4UQOA 1ID1A 5G1NA 4JQYA 1Y34E 1HRDA 4PX9A 3OCJA 4BKUA 4N0MA 2IVZA 4IWYA 3DFKA 4A7PA 2K2WA 1K7SN 1YT5A 1ZWKA 2XBUA 3QU4A 4BJ3A 1SVUA 4BNWA 3K1TA 1ZHHA 2D0OB 5AXBA 4QUBA 4QPCA 3ZUPA 3H65A 1C41A 5EQJB 2R1VA 5J5VA 5JECA 3DGEC 4BNYA 4V1CI 3C74A 1NG1A 3UBMA 1LPAB 1LW6E 2ZYSA 2GMWA 1JTVA 2AB0A 3HP4A 4DQKA 3A6LA 4N7BA 4J7CA 1HEYA 1NTRA 3LD9A 3KS9A 5E6SB 1GUFA 2D3TA 1I3NA 3OQ6A 4F5DA 2GN1A 3EVBA 3ZVRA 3SC4A 1THMA 1Z4JA 2C84A 2I33A 2VWHA 4A6DA 4OL0A 3FA2A 1LB1B 2FMKA 1UMBB 5CW1A 2R2GA 4YAFA 4I5GA 5AOVA 4C4XA 4GPEA 3GVPA 4L5BA 1NJ8A 1J39A 2A2ZA 2FZEA 1JHAA 2IUSA 1T9ZA 2EJBA 2PPVA 2VKQA 1B6GA 3Q7RA 4NCAA 5A4JA 5KKCA 1J20A 4TZ6A 4MGYR 3ASUA 1Q1ZA 2D13A 3LO8A 5FPPA 5AOCA 2BGLA 4W6QA 1VM6A 2P35A 4PTZA 2CL0X 2LRHA 3G0BA 1O6FA 4AYWA 3GNTA 1XD8A 3PDJA 4EELA 4YCLA 1XVLA 2YC2C 1N2IA 1W94A 3H2IA 1B76A 1RZUA 1Q2UA 4YALA 4ARZB 2D62A 2XWBF 5IARA 5TMDA 1BD4A 2VHQA 1BHSA 2BDEA 2WD7A 2WJYA 1TD1A 3HDGA 1NOIA 3J7TA 3KJIA 4CLHA 5MDHA 5LQKA 4ZOAA 3D81A 5A3JA 3AK4A 3ESZA 3RVNA 4QDZA 1DC4A 1BHQ1 5DU2A 4JI6B 4QO8A 2P2GA 3DCIA 4MHTA 3VJKA 5KKNB 3PWKA 1CP2A 3KLNA 2ZUSA 2J9YB 2IEBA 3GG9A 3I5MA 4LJAA 5EXPA 2GD2A 3ETJA 3GLHE 2GSDA 1TNDA 2CEKA 2GJ8A 3NG1A 1KDPA 4JVMA 3GUYA 9ATCA 1AZLA 3LH5A 2FVXA 3OCXA 1WUKS 1RI2A 4ZAWA 1CQJA 4INOA 3WRXA 4ALJA 3QYFA 4LJLA 2BR4A 3ELYA 3R41A 5TRTA 4U2BA 4TRMA 3HL0A 3IPLA 3IP5A 2JGDA 3S44A 3RAGA 2XYGA 4TXNA 4AWXA 2Q3FA 2HO5A 3L84A 4EZEA 1W0KA 4GM4A 1SGWA 2UZ1A 4F1JA 4WTOA 2Y2VA 4N82A 4J8PA 4KQEA 1QDEA 2WWWA 3KKNA 4JP8A 2HBZA 1N6NA 4KXNA 6ABPA 1B0UA 1QYDA 2CD7A 2QRQA 4HGRA 2Z0MA 3F3KA 5SZJA 2NQ2C 2Z43A 5E0OA 4CMKA 1C2TA 4DILA 3FCAA 5BNIA 2J3LA 5HOEA 3L1IA 5DULA 2OBMA 3HK2A 3FM9A 4DIMA 4B7CA 3WXBA 4X1YA 3KVVA 4JK3A 1SRRA 1X9GA 1IY8A 1GL7A 1OZGA 2YWFA 3C14C 3M3HA 2OZKA 2FUG6 2RHRA 3OH8A 1MIOA 4LZPA 1T1GA 5KOYA 2CXXA 3EAFA 1QAQA 1MO6A 4KMMA 3HB1A 1IM2A 1EXWA 2QLMA 4XQ9A 4JIMA 4NV0A 2IYWA 1OAOC 4FMDF 4U7DA 3FUWA 5K3CA 3RABA 4YXWD 2ZVJA 5HMMA 1R8JA 3I53A 4Z7JA 5DN6D 3NBKA 2IDMA 4XXHA 2HL6A 2RC5A 2YVAA 3E35A 2B3DA 2GFIA 1EBBA 3NBFA 4ZMSA 2CMHA 4ZT4A 1YA4A 4B3SB 1O96A 5FR2A 3RVQA 3I2GA 4M0EA 1Y7HA 2XVYA 2NXWA 2AL7A 1DRVA 1C9JA 5BMVF 2WI8A 1YSCA 5IVIA 4U63A 4PRZA 5F2NA 1T8RA 1VE1A 4JA2A 4RKQA 1C1YA 2V4ZA 2Y6VA 3C43A 3PCXA 4OB6A 3RYHB 4EYEA 1UBGA 1DGQA 1KDOA 2JZOA 1FTWA 2VNAA 3PQ6A 1NX9A 5EMNA 1IEVA 1PQ4A 3R5JA 2O3SA 2X2EA 2YHBA 3NGMA 1MAHA 4W5HA 3D6HA 3TINA 4DB4A 2PY6A 4ZO6A 1IATA 5G4KB 4QVIA 3GJ4A 2C92A 1TRHA 3AZPA 3NNNA 4YLEA 4ZO7A 4YB8A 4EKEA 1D2CA 1B7GO 1ZHOA 1HNXB 2WHEA 3TSYA 3AYZB 5HF6A 4RVCA 4I4CA 4NG5A 2XNDA 1JSRA 5ALWA 1PFYA 5CITA 1JFTA 4HDCA 4GMXA 1AA6A 2QL9A 4RACA 4D96A 1M2VA 1E1MA 3CGWA 1FC0A 3CZ4A 3IP6A 3DNPA 4BN0A 4LZAA 2GTIA 3PSHA 3LGSA 2CLSA 4AMUA 2A5FA 5FIUA 4JC8A 1I3MA 1QYRA 3RIHA 3RNOA 1M2JA 3WL3A 3ZV4A 5HUHA 1F2VA 2X0KA 4AJIA 2CV0A 2WY2D 1LPBB 2ZUWA 1I0IA 4Q82A 1ZD4A 2DZDA 1W1UA 4RD1A 4RQUA 4B3RB 2XCRB 4LF9B 1RI4A 3ZQKA 1PT5A 3R0VA 4YMLA 2FHPA 2NZWA 2XCTB 2DECA 3GGDA 1NVVR 3KQYA 3LE8A 4N7JA 2ZIGA 5G4LA 1LLUA 4B7AA 4QGHA 2RARA 1V1RB 2HH9A 1XV5A 3PNVA 1JHDA 5KSPA 3VSEA 1XEAA 4HDNB 1ZJ5A 1P2BA 1KIFA 4HV4A 1MXFA 4M38A 5ESXA 4C4ZA 4BQFA 3COWA 2WD9A 2NVUB 1ZJYA 1X2EA 4H7DA 4CR8A 1YJCA 1GUZA 5CXUA 1MC5A 4HB4A 2G88A 3C1AA 4Z9BA 3NOQA 1O94C 4FT2A 3P96A 4PNHA 2CJXA 2W9XA 1Y9AA 2AJCA 3M6IA 2JLWA 3EQ2A 1Z8DA 1MOSA 3C48A 3ZHVA 4UTOA 5I8PA 5LB2A 2C5FA 3LG2A 3VHXB 1LTQA 3WGGA 4QM6A 2YC4C 4ALNA 4XEUA 5CCEA 3G7SA 1L7QA 2VPWA 2WHPB 3Q9SA 2UUOA 4ZPXA 4M88A 2RK3A 3ZDFA 1IVSA 4O2LA 1QV9A 3KEQA 3TX2A 1DTWB 2PVSA 2UZIR 2GKSA 3GRAA 5M5BA 1AS0A 5C5EA 1OFUA 4TS3A 3VR6H 1UEJA 2HTEA 3MRXA 4Y1EA 2V5VA 5COAA 4KGZA 4AP6A 4RFVA 4RK5A 5T4HA 2TECE 4NOMA 5ALNA 2JLUA 4JYAB 5AJHA 3IP3A 3LYUA 2PQMA 3UUFA 2JGEA 1BRMA 4BC1A 4YQFA 1KRHA 2EL9A 3JR3A 4EF5A 4TLMB 4MYUA 4FE4A 2WF9A 2XI4A 5IEBA 3DTVA 2ERCA 2W98A 3H5TA 1K9VF 3SY8A 2GCNA 4NBKA 3GLSA 4CDRA 1IOWA 1MDFA 3EZ7A 1UIRA 2FWNA 4LBYA 3UK0A 4D82A 1U98A 2PD6A 3TLZA 4TTVA 4YDRA 3F1KA 4AY4A 4ZZ3A 1WHTB 2W2KB 4KXXA 5K4AA 3U3OA 1U65A 3IXQA 4NZPA 4G0WA 2P6PA 4I9GA 3DMTC 3TW8A 3LUJA 3AP2A 3EPLA 4GL4A 4JXZA 5A7FA 1X8LA 4GI1A 4TWZA 5DYTA 2IP1A 5BW5A 3M82A 1K5DA 3TIFA 2H00A 2CEAA 4R54A 1FRFS 1PQYA 5K3FB 4ZI7F 5C5IA 4DG9A 3ACBA 1IBCA 4IHAA 5JFTA 4CR6A 4XGRA 4GHWA 1AXEA 3DLBA 2YJ5A 4MCJA 1DWQA 4XFKA 4Z4GA 1NOKA 1MIHA 4DR5B 3HVHA 2PMFA 4LJ9A 4TV8A 2ZYAA 3S2ZA 2JZCA 3HCEA 2VAPA 1D5WA 3NKLA 4YRJA 5REQA 4ZT2A 3BS4A 4LXXA 4A9AA 1QOQB 4DV5B 5A4MS 2ZJ3A 1G7RA 1L6RA 3AINA 4IFIA 4IHQA 2ZQ5A 3MCVA 3PHHA 4OHKA 2Y27A 4E51A 2GO7A 4WPGA 2X42A 4Q7MB 4C6TA 2GCPA 3IOYA 1KQNA 1ND5A 3GBSA 2HCTA 3MCZA 4BRUA 1XNGA 1GRQA 1W2GA 5FL7D 3KHSA 2FI1A 1V48A 5DRTA 2ZB3A 3MB5A 4RCZA 3H2JA 1ID8A 1J56A 4K2AA 5FWYB 5K3DA 3BXEA 1CJMA 5KYTA 3K72B 1DAEA 2FKAA 1OJ7A 2R8ZA 2V7BA 3IE2A 1YJ8A 4PPYA 1C80A 2JLQA 3FAZA 3PUHA 4K9KA 2Q1YA 4ZVVA 3RJ9A 1GARA 2GPSA 4W7HA 2YN4A 4EO9A 1K2VN 4XGIA 2QI9F 1OUMA 4DG8A 4ZKDA 4L76A 5BWBA 5AKKA 2VF8A 3F5QA 3KQLA 2XUFA 2J6CA 2GQ0A 1LXCA 3F6YA 3JRNA 2FX2A 2P0EA 2M1ZA 4JJKA 4L9AA 3E53A 3Q40A 3IT2A 2M32A 3BZWA 4LXQA 4HXGA 1WBDA 3BOSA 3E5HA 2EV9A 3R44A 1FPQA 4RORA 1NVGA 3AUSA 4PIPA 5FULA 5LD2C 5GZ3A 2QVZX 3Q2KA 4I1PA 2VK4A 3KJHA 1RXCA 3PJFA 4AS3A 3F2IA 4U00A 3PA6A 4UM9D 2WA1A 5FEMA 1G8AA 2VDOB 3UGKA 5AW4A 2PUVA 3FOCA 5G0UA 2ZAOA 2H0AA 4G41A 4Q18A 4II3A 5L3QB 3ICVA 4U2KA 1PD0A 1SUSA 3EFOA 1BVUA 3OT1B 2VPZA 3VYWA 3W2TA 4Z7OB 4OKNA 2X4IA 2W0MA 4JFRA 4O2AB 1E3JA 5AVJA 3PXGA 3O4GA 4ZRDA 3OTIA 1N6OA 2PJUA 2W2TA 3Q7SA 4HI0E 4RDIA 1L7XA 2FEMA 3RTEA 3I1FA 3GRPA 4BDTA 3E9EA 4BQRA 2EEPA 4NS1A 2QN1A 4NH4A 4O02B 4BNTA 3BGWA 3JTEA 4LJ7A 2JGFA 4NTZA 3UCEA 4TSKA 1Y4ZA 2WAMA 2Y0CA 1G20E 4F9EA 3K71B 3NTRA 5IVHA 3QMWA 5T6BA 4Q1VA 3NBYC 3OEEA 5I7FA 3RTGA 2ZGVA 4TTQA 5BSUA 1ZPDA 5ICMA 4IRXA 3NVMB 3UMJA 3LS2A 1XR3A 4YI3A 1IOLA 1CUZA 1NLYA 2AN4A 2MSCB 2PWZA 3B52X 3GH1A 3GUZA 4GOMD 5KTRA 2ODWA 1GNVA 1VPTA 1ZCAA 4L5JA 3WRWA 1ETUA 1PJAA 1XT6A 2Z5VA 4FLEA 4QJBA 3I73A 4ALIA 3EVNA 2H9AA 3L6EA 2FDXA 1H6DA 4R9NA 4CIXA 2DOKA 2QN3A 3LXUX 1DLJA 5K51A 3W6UA 2C4NA 4AN4A 2VJYA 4UCFA 3ND9A 4KSBA 2IHJA 1J2JA 4K87A 4R7TA 1IXYA 4W5RA 1DJNA 1N6RA 1TU4A 3UG6A 3QPCA 3S68A 4QWWA 3EQ7A 1E6LA 2D6FA 3QU9A 5FOVA 1SAYA 1Y8CA 3T7RA 3UMFA 1ZRMA 3WB0A 4UTRA 4G1MB 4X6XA 2A5GA 1XQ1A 4RVGA 2J85A 3HVKA 8AT1A 1QO9A 4LXTA 4FTWA 4CMCA 4RGQA 2HU7A 3M4JA 1U8CB 3K73O 3VPXA 3HADA 2VVTA 1R4AA 2R4UA 4V0SA 1DQSA 3L8EA 4UMFA 1ECLA 3NOVA 3LUKA 1U8AA 1YL6A 3N8KA 5A0FA 3I5XA 2VEDA 4BFCA 4DR3B 1V7PC 2JI9A 4RD3A 1GCIA 2C31A 2ID7A 2YW9A 2GN6A 3FXAA 5ARDA 5I4CA 1TAUA 2H48A 2XDQA 1AG9A 5JXHA 1DUSA 2BM1A 4F38A 5CTJA 3HJNA 2YY5A 1BCRA 5EYPB 3T5MA 4AJLA 4BLSA 3GDOA 2IP4A 2BHSA 1MOQA 1EQAA 1VG8A 3ROXA 3TW6A 5A5FA 4Z4FA 3CF4A 3C3YA 3PNYA 5D5HA 2MYUA 5EMJA 5TXGA 2IE0A 5KDLA 1G8PA 4RFSB 1OT3A 1TL7C 1NQAO 3CPJB 3PUXA 2IIQA 3KETA 1FPMA 3AT1A 1F8XA 2B30A 2FZGA 3AUJB 3JYHA 4ZOLA 1DQYA 5TVKA 5A2GA 2G1JA 1FUYB 1YUMA 1R0WA 3L7AA 3CUSA 4K46A 3WL6A 3A4LA 3M5DA 4XM2A 3QUCA 2C42A 2WSSA 1P1FA 3MERA 1EGMB 3M6UA 1EAYA 1RHRA 1AO0A 1BROA 3EC7A 4M1WA 2ZE6A 1UDCA 3T4EA 1YQ9A 1KY2A 4AQYB 2UYGA 5D5QA 2QNBA 4UMVA 3DDWA 1Q20A 3DAYA 4YCBA 4DYHA 1ZSNA 1JEQA 1JJIA 4GOKA 1AUVA 4LGMA 2H2IA 4D98A 2Q3JA 5KEIA 2XXAB 2BV3A 2ZRBA 2RGUA 4MV5A 1YVPA 2W6JD 4Q48A 1UOPA 3NANA 1EVEA 1DKPA 1GQRA 2QI9C 3RIEA 3HNRA 3N2NA 2D5IA 1ZD9A 3ELUA 5ISMA 5D7BA 3PUKA 2IYXA 1Z5UA 1G60A 4PPQA 4C2TA 3P0JA 2V96A 4ZODA 4EGQA 4RF2A 3OE7D 3RU9A 1EFVA 1JDBC 4D9JA 1SVLA 3NPAA 3RWBA 4RKFA 1XTRA 1QTRA 3LT4A 1XZBA 3ED1A 3A9UA 4UUOA 1MORA 2PT5A 3VSDA 4A0HA 5EHZA 1KC1A 2VOJA 5D3MA 3ROFA 1L4BA 4I9HA 4F71A 3I1JA 4MJ3A 1YCGA 2PZGA 1KORA 2QQFA 1ZC3A 1ODTC 3KQPA 3HA3A 4Z4EA 2P6OA 3ELWA 3N75A 2P62A 3E82A 4Z99A 2O0KA 2Q21A 2XTAA 1KP3A 4U7HA 2G63A 2DKFA 5EZ6B 1TKCA 1VRWA 5LKRA 3H0CA 4HGPA 5ANRB 2C98A 4FIZA 4IRMA 4J7XA 5D1NA 4G85A 1B1CA 4AS1A 2ZQYA 4TVOA 1S0UA 2P69A 4UU7A 3P9QA 3FCCA 5A9RA 3GEDA 4RXTA 4KBGA 1J99A 5GGYA 4NJEA 4WLOA 3PFWO 4AAYA 3NM4A 4MQ5A 1G59A 1GTMA 4FNMA 1Q57A 4HNGA 3IMKA 5IULC 3OKFA 2Y92A 3QNUA 4IV0A 1M83A 1I4OA 2RHBA 2QIPA 3NHBA 4J0HA 2VRWA 2ODPA 4AY5A 1KOFA 3M6MD 3O8DA 1VHTA 1NAIA 4X3CA 2WRZA 3JQAB 3KJNA 4Y98A 2EGGA 2ETXA 3HN6A 1L4UA 3IQDB 3QJ5A 4MQ4A 4IQFA 4XD7D 1E7WA 4G26A 3LBFA 2XDAA 1EWRA 2TMKA 2VHTA 3E81A 2QP4A 4QQ8A 3SSMA 2QAJA 5L7TA 1DT3A 1Z0DA 5CDUA 5AW0A 2IU4A 4CIDA 2WKWA 5TGDA 1JILA 4DADA 2PSSA 3V4PB 1THZA 2ZI4A 1II8B 1UZMA 3G5UA 2AV6A 3QKRB 1NXPA 3QX9A 2ILVA 5EUBA 1JIQA 1WV1A 1S1CA 2E3JA 3V42A 1US8B 1F3LA 3HJCA 4DNPA 4KL8S 4Q4AA 4DPMA 1JDZA 4NK4A 2GXUA 4WN9A 3SHVA 5JD5A 3PQEA 2RGXA 3HLTA 1T13A 5H68A 4HPWA 3L6DA 4FZ5A 5AJWA 4GLOA 4RVOA 4AKEA 1XN4A 3DMFA 3HU5A 2DTDA 5FD8A 4E5UA 1P5RA 1NF9A 5L3SA 4YEDA 4MI6A 3IPCA 1B26A 4WK6A 3VU9B 4OP3A 4KMOA 1K3FA 2Z2ZA 4KYVA 4YJHB 3E2MA 4JKYA 1XRMA 1H8ED 5DW3A 3TLGA 2OBXA 2GRUA 4PSUA 1TJYA 1VSTA 2PFKA 1B00A 3SC2B 3LQKA 3MLAA 5DBOA 2FEOA 4CQLA 2R00A 4C0WA 3PD0A 3GLTA 2BZ1A 1E3QA 5EJGA 3AFHA 4GMKA 3RC2A 1OKKA 4PTYA 2XKAA 1DC6A 1XAGA 2KQUA 1ORHA 1NRJB 1OJLA 5DTMA 5EXEA 2DFPA 5K8IA 2Q41A 4CV1A 4OSPA 4V0KA 5IC4A 7REQA 1DCMA 1Z15A 3HWRA 5H3LA 1QXSA 3R9KA 3EGXA 4Z8XA 3OPYA 4EDFA 4PRYA 3NM5A 4TMVA 1RBYA 3AIOA 2OC4A 3PUWA 3L8CA 1K97A 2HF9A 3FLBA 1CB7A 5COBA 1QE5A 3PKIA 4E5PA 3PEFA 5FTKA 4RMIA 3WYCA 4NJMA 3HJFA 3QEBZ 1KAEA 2AFIE 4WUVA 2ZBQA 3ZD6A 4ND2A 3PYMA 3U39A 4YJGB 1Z07A 2RGAA 2VAXA 4IBOA 1FMFA 3AC0A 3GC6A 1QQ7A 3P9SA 1FQJA 1LSOA 4V3BA 4D42A 5AXAA 4NVRA 3WGNA 2CYCA 5AW9A 1LU9A 4IHJA 2AOTA 3HKEA 3P0HA 4FQ5A 4WZAE 1W4AA 3OUUA 4EW1A 2HA2A 1SG6A 2JJMA 4URHA 1DTSA 3LY9A 2IP2A 621PA 4JJZA 5TV2A 1JAZA 1EUQA 3EEQA 4PICA 3L4EA 4M0CA 3TLEA 2C4VA 4D44A 1D4AA 1QQ5A 1FVOA 1SU7A 2RAUA 3B60A 4CM3A 2EKZA 4JX9A 4CF3A 1WD7A 4H0NA 1PJ2A 1MV5A 2E55A 4EUFA 1YRWA 2W2OA 5IH3A 2P78A 5D1HA 1Y7PA 2VWGA 2YRWA 1O6CA 3HHPA 4ZQIA 1KDVA 1CQXA 2HDHA 3IIMA 2FPRA 3PI7A 1Z3IX 2C59A 2EX4A 2OHJA 1PQPA 3KLPX 3L7DA 3HGQA 1HDGO 5KX5A 1YL5A 3CKKA 4MGZR 2FFRA 2WB2A 4IZ6A 1H93A 1Z83A 4AJOA 1Y6FA 2QJTA 2WG1A 2XUPA 1P6XA 5SZIA 821PA 3ZLJA 4P80A 2JBAB 5A1JA 1K68A 1P61B 3EXHB 3ETEA 4KUGA 1BEUB 1Y6ZA 4UXIA 4KQCA 3IDZA 2J32A 4ZT7A 1V41E 3WBJA 1W2WB 2A59A 4KG7A 2CZQA 2WIFA 4L4SA 3OETA 2XH8A 1QHFA 4XJXA 2IUEA 3ONNA 5U4QA 4A2PA 1FJ2A 5IK2A 1EFDN 2ZR0A 2NP6A 4QDOA 2DYKA 4KB5A 5E6SA 1WCYA 1XK6A 2WC1A 4ZWNA 3WAKA 3N2KB 2FW9A 4JVLA 4PFSA 1Z75A 3V00A 1TCUA 3RS4A 3GL9A 3JS5A 2MU1A 1UMBA 4EPTA 1I7SB 3HBFA 5T8KA 3IGFA 4HO1X 4DUYB 1MG5A 4OGFA 3G17A 1ORRA 1Z29A 1Z6XA 1GXSB 3O1LA 4QA9A 3VYVA 4YV7A 3W5DA 2GDZA 1R4NB 1L5RA 4PG6A 1EK0A 1NMXA 2VQDA 3H87A 3K9LA 3QMPA 1CR1A 1BH6A 2E4UA 3QJGA 3ZGLA 5JS6A 3NHYA 2FWJA 4RUKA 1RLJA 2I6QA 4WLVA 4L7QA 3IUYA 1X7ZB 3N2GB 2BUCA 4HT3B 1U2PA 1VJDA 2H18A 4WECA 4ARZA 5E8JA 4JIGA 4F12A 3HBNA 2NO9A 4FFBB 2B7LA 3RW9A 5LM3A 3E4DA 4U7TB 4RHEA 1HZZC 3FNRA 3VPAA 3VR1A 1JB9A 1FMJA 5DOZA 5A6SB 3S29A 3U3RA 1USIA 5JXGA 3KYDB 3N2ZB 2Q6LA 2Z58A 2HMWA 1UWCA 2NZYA 4G84A 4NYMQ 4C08A 3GV0A 5FUVA 3R3XA 4JJAA 3LPCA 1N2HA 3MD0A 4CKWA 4HK4A 2V65A 4ABYA 2M1XA 4C04A 4F3NA 5A4IS 3CE9A 3IA2A 3VC1A 2O7QA 2AFHB 4NZOA 1AO3A 4RCVA 3T7KA 2GNOA 1XPUA 2JHGA 3MJVA 2L42A 4U3JB 1CY2A 3EPPA 1NOJA 5A06A 2PV0A 3T3DA 1XPOA 1K4YA 4X24A 2XNCA 5CYGA 1U1CA 3FBWA 3NVKI 4NIMA 2QLFA 2Y4NA 3E5RA 2XF8A 2WK1A 1EVYA 2JJ2D 5FI1B 1K0UA 1A9PA 5CB6A 5AI5A 3WHIA 2VRBA 4X3PA 3RC9A 2HNBA 3MWFA 1J5XA 3N2EA 1AUOA 1KFCB 4UNPA 3V7YA 4Z1OA 5B6PA 5HUQA 3GLFE 1QFSA 5A3QA 3WNZA 1M2KA 4RF3A 3WQRA 5ALVA 2A78A 1YASA 4PZDA 2FJ0A 1MEJA 1CDOA 2EQBA 5H70A 2RHDA 3IHWA 3C7KA 3LZCA 5B7NA 2Q3DA 4M9CA 5GMOA 1E0DA 1FUEA 3EE6A 4LXGA 5EJ7A 4X1IB 3GAFA 4ZDWA 3VPSA 4CM8B 3U0VA 1ECBA 2PL1A 5CGZA 1E7MA 1RR6A 3GP8A 4JC5A 3JZFA 2OCYC 4EEKA 2DPHA 2F67A 4JI4B 1UK9A 3TEMA 1S3GA 4TLAA 1RWPA 5IHXA 1QVZA 4A36A 1C0KA 1OV6A 3LPDA 5HIAA 3KJFA 3SLRA 5AXCA 1QIIA 2OILA 4CI0B 3K5HA 3VJMA 4MA4A 1OXMA 4YHHB 3CZAA 4GECA 3E22A 1KH3A 4KXQA 3VV2A 2H4HA 3TAXA 2OK7A 3FYUC 2INGX 3QSGA 3ONFA 5EG5A 3GAMA 2DX7A 2V7WA 4MV8A 4BFWA 4M1QA 3D1LA 3LT1A 2QP3A 2GF9A 1ZVJA 3ZWQA 4BFYA 3Q8LA 4JH0A 1UFKA 2V7XA 4FNOA 2QD4A 4D0LB 1H2YA 1LC3A 2CNNA 1AA9A 3UJ8A 1N9GB 1SCAA 3OJLA 2NO5A 2FOIA 1QO0D 5A5GA 3A28A 1IE3A 1PVOA 3RYHA 4KLZA 1IJBA 3QHAA 3QA9A 2FA9A 3NHJA 4B09A 3R7AA 1XD2B 3T9FA 4EVSA 2LCFA 4JSRA 3QEMB 5DZSA 5JHHB 3DSRA 4ZO8A 5G4KA 2GT1A 2NVOA 4NE9A 1RHMA 5AESA 2R7MA 2F4NA 1AU9A 1MTOA 4DA9A 1Y4SA 3C7AA 5F73A 5JI2E 4E2ZA 3K0AB 5K45A 4CF5A 5TQ2B 1QMPA 3ZW7A 4ZU3A 4B17A 2B1JA 2ZRFA 4Q9DA 2QUAA 2ECKA 1XP5A 5HKLA 5CH3A 1YZLA 1JJAA 3C8MA 3OE1A 1T1SA 3HB5X 3F5DA 2W2MA 3GVCA 4OBWA 4BATA 1CPYA 1CQWA 1TKAA 2CNWD 3AFNA 2W2LA 2OMEA 2WF5A 1N2ZA 4KXMA 4YRPA 1HTTA 4UJ3A 4BQQA 4KLNA 2W2XA 4EB8A 4LHVA 3B1JA 2A67A 4ME6A 2FSUA 1ONOA 2QQ0A 5KB3A 2O23A 1RI5A 5ALXA 5L7YA 1Z2OX 1MTZA 4C89A 1I2DA 4C9BA 1WUTA 4WACA 2ZUDA 3L43A 3WNBA 1V1RA 4UU1A 3ZUGA 1TD9A 1I10A 1QKKA 4HDNA 2OR3A 1SUPA 4GR4A 2FEWB 1K66A 4UM5A 2F4VB 2NVUA 1DKQA 3OFND 4UMEA 3S5UA 4E14A 4XSGA 1ESDA 2PMKA 2KS6A 1N5OX 2SKCA 1Z33A 4QZVA 5CDSA 2H4WA 1HLGA 2HRRA 3JSAA 1MAWA 1WPQA 1YD7A 5KNBH 4LN1A 1JYFA 3SXPA 4JP2A 3UMVA 3V7FA 3GLQA 1NDUA 5HM6A 2J8ZA 4R1PA 5F7OA 4CZ2A 5EXTA 3VHXA 1UL1X 2BMAA 3HB7A 1C3LA 1Q0PA 4HXFB 3UT0A 1CK4A 4X6UA 5EJMA 1PW7A 2V7QA 1QHEA 2WHPA 2QM7A 4M89A 4CFYA 4OLBA 4FSXA 3J81k 1E99A 4FWTA 1DTWA 1KVRA 3PNMA 6YASA 4AWBA 2R85A 1WSWA 1MJFA 4BX9A 2B1QA 4HQNA 1VI2A 1KI4A 4MS3B 4X1KB 5JEEA 2ZBVA 1FDIA 1Z0SA 1T4BA 2OP0A 1AXRA 2ZXUA 3DMDA 1JSLA 1W6UA 3LXMA 2XQIA 1QZUA 4NNOA 4NYIQ 4WCDA 3UKDA 4RU1A 2BGMA 5PGMA 3NASA 4DCCA 3WK8A 4E03A 1J0DA 1R0RE 3B6JA 5KCMA 3RBZA 3EPKA 1UEXC 1NI4B 1VIYA 3JATB 3P1JA 3THOA 4DIFA 3DR5A 2HHCA 3EVEA 2LKDA 4N76A 1HKHA 1JZTA 1YTLA 3VR5H 3LT5A 4OJQA 4ZVLA 3GFOA 3P0IA 5DGDA 1H8HA 2QRVB 4DSNA 2OHGA 3B3AA 1L3BA 4XUGB 2JI4A 3WWEA 4DB2A 1XLUA 1QH0A 1QPBA 2ZJ1A 2YWRA 4OV6B 3EA5A 2OFFA 5JS2A 3OZRA 1NVDA 1GPYA 5BMOA 1WHTA 2W2KA 4F3CA 1Y1TA 1ICEA 4UAUA 1U0GA 4ARUA 2JIPA 4GYYA 3TFWA 1BHO1 3UXHA 1JVBA 3ZZ0A 2FU5C 1O4WA 1LLCA 3NS7A 4EKDA 5E9AA 2RE8A 3CLTD 2PX2A 5K3FA 1DO2A 4XB6B 2H1LA 2JFQA 3F73A 1QO7A 1TYDE 2ZZNA 5GM1A 1DIGA 1HEUA 1V47A 5IZCA 3MA0A 4IIDA 4FN5A 2LIPA 3BH0A 5L6MB 1OLOA 3INTA 5DHSA 3L8ZA 1MF7A 1YWGO 1P1RA 4LYDA 2C2ZA 2GTHA 5BY2A 3JY6A 1P5FA 2YJZA 2HHJA 5CBPB 1H3EA 4BV3A 3AF3A 1JP7A 5AFSA 1T8YA 4Z0TA 1YRBA 3EYWA 3FZNA 3SF8B 5A02A 1G3MA 1KXJA 1VTKA 3HZHA 4O8ZA 4W5WA 2HW8A 1COWA 4MI3A 5ALOA 4ZRNA 3COVA 1WU7A 1X3LA 1ZBQA 2IGTA 2NYAA 5D00A 3AESB 2MSWA 5FQOA 3VKWA 2BPOA 1OX4A 1ESMA 1W25A 1VRVA 5JBQA 3ABSB 2J7KA 4EUEA 2LP4Y 4RF4A 4HTFB 4MKIA 2W00A 1K7FB 1PYGA 2I7TA 5FWYA 3MXOA 3N7TA 2B0JA 3MWKA 1S4MA 3A06A 5DNAA 2VZ0A 4IDQA 3DL7A 1JHVA 1FP2A 3R5XA 3GA7A 4DR2B 2HPZA 3S7ZA 4BE9A 2BJWA 1JQKA 2AQHA 2VP0A 1TK9A 5LDHA 1E3LA 1E8NA 4BLPA 4EI9A 3PXBA 5KO2A 4XDGA 3ETGA 4NBRA 4KEAA 1FYVA 1QCYA 1F51E 2I3GA 3OTQA 1CLEA 1BDHA 3ZHBA 1CJSA 4TV9B 1SXQA 3T38A 4C0SA 4MRVA 2HWUA 5KMGB 4N5MA 2C4KA 3QOFA 5EGNA 2Q4EA 3DOOA 3G79A 4U2GA 2NU6B 2Z5LA 4NECA 3KZCA 3HN7A 3AEZA 3H8VA 3G8AA 4L08A 1ZM9A 4UTZA 1X87A 1ZCZA 3QKUA 1RLOA 3FY4A 3AILA 3H5NA 2E4ZA 1G2OA 3VTAA 3A0UA 4TM7A 1N0UA 4X91A 5BN4B 4ZHQF 1X1SA 2UVDA 4OJMX 4QGBA 1QGED 5BW6B 4B4WA 3L0BA 1IY0A 4Z4CA 2XVMA 4MARA 3LDHA 1DPGA 2I6GA 3H9JA 2P4SA 4Z2YA 3I62A 3P9XA 1XDWA 1PJ4A 2IH5A 5C4MA 5L3QA 1DOHA 3D6UA 1I7PA 5IT5A 1BYUA 1VIAA 4MUHA 4P1ZA 4F4HA 1QJ4A 2ZAGA 1JQ5A 3OT1A 2H8KA 3F5FA 3LLMA 1GGMA 4MQMA 5FCDA 2ZCJA 3CZ9A 1L7PA 4C30A 2W6MA 3ZNOA 3ZW8A 4D9EA 4O2AA 4E4YA 2AEJA 2ATVA 4LK2A 2H06A 4S1TA 1E9SA 2ZT5A 5IKEA 2JCBA 4BE7B 4LWQA 2CLMB 4DMMA 1W36C 4FW9A 4S1PA 3DDHA 4RJJA 5B36A 2IU3A 4ZVKA 4XASA 3GFPA 4TWJA 1P4RA 1P3JA 5EKDA 1R8XA 3OIGA 3UJAA 4E94A 2XAUA 3D2BA 3SVLA 3KP1A 3QA3E 4G3XA 4RWEA 4FYJA 5ALFA 3ZOZA 4HNVA 1VLZA 1RWVA 1PGJA 2ZTSA 5AI8A 1XYYA 1KK3A 1ZA1A 2DQSA 4UTNA 3QTLA 4D9KA 2I6UA 2I2DA 1KIMA 5MN5A 1JBKA 1Q0UA 2PXAA 1M3SA 1W96A 4TQAA 2W6ZA 3AIIA 1E0AA 4KDEA 2QZZA 3UHJA 4M9QA 2GK6A 1DXQA 4BNJA 2R60A 5DJ5A 1Q44A 4C29A 2XUJA 4KTVE 4FKZA 2XEXA 2JVKA 1I0LA 3HJRA 4YRLA 4DCMA 3GAAA 3K70B 2QYTA 2ESRA 2QL5A 1RRMA 4R9UC 3OPQA 4FDVA 1K3UB 4Z1MD 1VLMA 2FWIA 2XXJA 3EODA 4EB0A 3RS0A 4FJ1A 1FNSA 2A33A 3ONDA 3TSOA 1NKVA 1NW3A 2NACA 1VGRA 4PCVA 2W22A 5HCUA 3ZXUB 3ZC3A 3RM3A 4E5KA 3TECE 4QOFA 3TVDA 1T6XA 3ONEA 5FT9A 3DLTA 5AQ1A 3WE7A 3WADA 1GG2A 1IVNA 2F7SA 1QHYA 2MMGA 2ZJ6A 2XMRA 2EIHA 2ZSKA 1N5LA 2HV9A 1PR6A 3RVLA 3SKVA 5CDHA 3HY6A 5A5EA 4JDPA 1X8XA 4G0QA 4F5YA 2QT0A 1SXJD 4ZU6X 2JKZA 4IXDA 2O1SA 4H35A 1CFJA 1LNQA 1VKNA 2XDYA 2YWCA 3AEXA 3R5HA 1NATA 4JT8A 4PZ0A 4X94A 5JJIA 5AIBA 2RIRA 4GPBA 3AERB 1RLIA 4MO2A 3PUYA 1K27A 2F8MA 3REQB 2DGDA 1BC5A 3V3TA 2DB3A 4ILKA 1KF0A 4EJMA 2RI6A 2FG5A 3NRBA 4Q0MA 4K86A 1VMEA 4A0SA 3VKVA 5EYPA 2ZRDA 5HKKA 4TSRA 4NMXB 1FDSA 1R3UA 2V97A 3OUZA 3MJ4A 1NW8A 1UF9A 4L9RA 5TT0A 1V71A 2VIIA 3KWFA 1QNLA 3PQ8A 1YQTA 5F3DA 5K0LA 2R5FA 1U2TA 3BK1A 5CLIA 4EITA 3A10A 1N7HA 4RFSA 3N0VA 1PV2A 4KYIB 3EB9A 4DLBA 5ITSA 2B5WA 1HL3A 3GBVA 1BWRA 2JI6A 4TMWA 3P0RA 4UAGA 5ED4A 2I2AA 4FDUA 5DYNA 3U44B 1NBMA 3SICE 1B1AA 2QTCA 5A3VA 5DMHA 2YVQA 4WBNF 5JAUA 3ESXA 2HYDA 2IX9A 1OVMA 1GNQA 3JYQA 3PX3A 3ZWNA 2O6LA 2YFQA 2B34A 1GYRA 1PGQA 1SBIA 1Z18A 2JGNA 2P2DA 1IAVA 1DAMA 1DBVO 2OBYA 3BHMA 2A9FA 3K6RA 4LYFA 1ZUD1 4UAJA 2RBEA 4P86A 3OQMA 4XQEA 4E08A 1P19A 1WVMA 2W70A 3MTJA 2O59A 1M2WA 1D8TA 3TLYA 2XXAA 1ARZA 1U2DC 2AMYA 1NLMA 3CF6R 2DHRA 2WYIA 2WP0A 3K9GA 3IJRA 3SQXA 1GY8A 2B83A 3B1XA 4ZOEA 3BYZA 1JIJA 3B85A 1VBFA 5AYVA 4GBMA 1U0SY 3CLRD 4PLFA 3ZK9A 4CI9A 2PG3A 4CN8A 2JLBA 2R7AA 4M7OA 4I14A 3PRHA 1VLLA 3KALA 1CNEA 4ZO4A 5FA6A 5DBIA 5AI4A 3TG2A 2AHOA 3DEAA 3LVRE 3COPA 4RZHA 2H1CA 4LDZA 2M9MA 5ALSA 3ZDXB 2ZPUA 1W34A 2P5TB 4MUAA 3WGMA 1OWPA 2C8VA 5TJHA 4MP3A 1SCNE 3AF5A 1J07A 4HGNA 1GR1A 3CF2A 4G1FA 3ZKWB 2H08A 1ZVVA 2OD7A 1M8GA 1UH5A 5K1ZA 3ZY2A 2Y67A 2C8JA 1RYZA 2VHZA 4Q5IA 2PZMA 4MK4A 4QD3A 3SQOA 1ZMBA 3U40A 1NC1A 3R5FA 5AJYA 1GYPA 3EPHA 3DBVO 4YUZA 3QV2A 1YB6A 1JHRA 4PHTA 3WZ2A 1B4DA 2WYHA 5HKBA 3HZOA 5CPBA 1Q12A 2WDPA 5AKHA 5ICEA 3BH7A 1NY6A 3GFTA 3H1FA 1K5GA 4RH1A 4P5PA 3D0KA 3RHFA 1T3TA 2HRQA 2AQ8A 2VP4A 1NUTA 1DO8A 1G2QA 3HP1A 3CEMA 4URZR 2CCGA 2GYVA 3EC2A 5JVDB 5IEJA 5JASA 5T7BA 1UUFA 1N5MA 2H2WA 1RWOA 5FB3A 3ZGXA 5KVAA 4INZA 5EZQA 3ZJ4A 5HNKA 2PUFA 3AM1A 1FRVA 1I5EA 3SM3A 3BTVA 2B4TO 1V8DA 3GLUA 4MHOA 1ZUHA 2P77A 4JYBA 4C01A 3JQAA 4MGIR 1NFFA 2VJAA 4K3VA 5IDVA 4MAFA 2CFOA 2AJBA 2HIAA 1FQKA 3FPBA 3U4QB 1QP4A 2BFEB 3MAAC 1V37A 1Q7RA 1IPEA 3WL7A 2QZ4A 1O6BA 1NXSA 2FR8C 5KS2A 3VZPA 3MJSA 1MCZA 1MRZA 3OZFA 1BD3A 5F9MA 1BVRA 4CCSA 3A4VA 3MUOA 1J0XO 4DJ5X 4HDSB 5GY7A 5G02A 4D4IA 2GHIA 2NTYC 3H2ZA 4WOKA 2AMLA 4D26A 3NC0C 1II8A 2PKXA 4LCBA 3QKRA 2X4GA 3U3JA 1H2WA 2UYOA 1YKSA 3QPBA 4QGSA 1US8A 2O05A 1UXOA 4PR3A 5EQTA 4Z3KA 5IHPA 3OWXA 3G8CA 1WE2A 1IEXA 2IPAB 4LC1A 4CMHA 3P45A 4GGPA 5IFKA 1KY5A 3KOWA 1YCFA 3GRFA 3L82B 2CXPA 2ZSBA 3GLVA 1ZN7A 2XJ9A 4RA6B 4L4ZA 4TYNA 3A6JA 1XA4A 2X9QA 3VU9A 1ODLA 4CLXA 1UPTA 4HQLA 4YJHA 2XTMA 4DEVA 2HO4A 2YNMD 3TVTA 2AW3A 1LDEA 2DPMA 2R1TB 2XHEA 3IVRA 5JJ5A 1O87A 3SC2A 3HI4A 3LMKA 5H0IA 2J5XA 1KZ4A 3ZHXA 5JATA 4DV1B 3D54D 3IUSA 1PNOA 1DJOA 4WXMA 1CJKC 3DA8A 5JCOC 1FVFA 5CU7A 1MHPA 2QROA 4HJRA 2EHDA 3TLJA 3UA4A 3K9WA 5LZ9A 3OE5A 1DHRA 1BU8A 2VXOA 3ANYB 5DTQA 2G9VA 2WM3A 3J81A 3AF6A 4Z3OA 1GNTA 4XDZA 1ZMRA 5CTAA 2ZROA 3BXGA 4QYWA 3JCZA 2GN4A 4IGKA 1YZNA 4JJ4A 5DLDA 3EYAA 3EVZA 5DX0A 3WSTA 1I7NA 2MHCA 5J58A 2F64A 1WOYA 3AVPA 1G16A 5HFAA 1AOXA 4BMXA 1N8TA 3FLEA 5CX1B 2OV1A 3VC3A 1NG9A 3QFHA 1FS5A 1Z4IA 2O8NA 2VPTA 4YJGA 1IHPA 5JXWA 3CPHA 2ZULA 3WGHA 2FOLA 4LHYA 4AQDA 721PA 4K9QA 3EWSA 1T36B 4OVKA 1XC7A 4RKEA 1WUYA 3KZOA 1O5IA 4BLVA 4QVGA 2NO0A 4FMDB 4IH9A 4Q4CA 1SURA 4F2GA 2Z6QA 3CZMA 5KDDA 4L6AA 3BJZA 2QZ9A 5DYIA 1Y1RA 1JAXA 3HL4A 4ND5A 5CT9A 5F98A 2X7HA 4C6RA 3SHQA 4DCPA 3W1VA 1SO8A 4KE7A 3L7YA 2V0GA 4DREA 3HLYA 2HIGA 1YONA 2CFCA 1LQTA 4F91B 3QE3A 1MW8X 5FUQA 5BMVB 1ZW6A 3R8CA 4GPAA 1GGNA 4OY3A 2X40A 1EX7A 2K2QB 4G9EA 5ER6A 4DNFA 1WJGA 2C4UA 3TIXB 4UUBA 1DARA 3K31A 1VCIA 4M86A 1P31A 1DBQA 2ZUBA 3WS7A 1CUEA 1WIWA 4U7PB 1OLUB 4OHRA 5EUMA 1Z3CA 5CUQA 2CF5A 4E2XA 5G1OA 2HQOA 2R6R1 5TJ9A 3BRWA 5LD2B 3SOZA 2OBNA 2WTEA 2ZUUA 2YZMA 2XUGA 1GKLA 5K3BA 1YIAA 2YOGA 3TIGA 3SF0A 4RQBA 1Y37A 1OE0A 2O2DA 3KKOA 1YACA 2JBAA 2OQRA 4IYRA 3EXHA 4BIMA 1YDFA 3VMFA 3RE1A 3K0FB 2Z56A 5EIXA 3D0OA 3GQBB 3MM4A 4X8MA 1GVNB 2GD1O 1KYYA 4CRWB 3BSFA 4QQFA 1RE0A 1KETA 1XEWY 2WTAA 1E9VA 1F60A 1PW5A 3DDSA 3SJ7A 3RUPA 2K4MA 2DXIA 2PKEA 5GONF 2ATCA 4YMSA 1JEYB 2OXIA 2AF3C 4GVPA 3TX6A 3C6ZA 1L5KA 1TB4A 4R40A 2WJVA 3FR7A 2VBCA 3RUHA 1X13A 3TLKA 4JN6B 3FTEA 1JXQA 1UJ5A 3CB4A 3N2KA 4J0KA 4JSYA 5E1BA 5IG2A 1QCDA 5T64A 2HCRA 1VIMA 2NMVA 4WEOA 2AZXA 3P19A 2H31A 4UC0A 2XWSA 2HK9A 5ADUS 4EI8A 4JBHA 1P2TA 2C0PA 1PYDA 2QVLA 4ZAYA 4BL5A 3T1YB 4MKZA 4OQNA 4F6CA 5BV7A 1GXSA 3IQXA 5BV1A 4DLPA 4EHAA 4QUDA 3T35A 1OC4A 2OOKA 2HSGA 1V6AA 1R4NA 2N1MA 2WTBA 4BVKA 4FPXA 4ABTA 3A1DA 4LJ5A 4ASUA 3EULA 4AUEA 1MQ9A 1BN7A 4UPDA 2ZG6A 2ICAA 3G2JA 1UJNA 1LBIA 5J4VA 1I4DD 3FFWA 3P9RA 1X7ZA 2FSPA 2SNIE 3N2GA 3BH6A 3SAJA 1JG4A 3A25A 2EBFX 3GOHA 1UBLS 1R74A 2FNAA 4BO4A 1B23P 3BK2A 3FHLA 3IAHA 1NUPA 1QGYA 4G67A 1WPGA 3U9TA 5HOQA 1A2BA 5A6SA 5C1DA 4IWNA 3ICOA 3KYDA 4PZ9A 4IDCA 2IFTA 4BFZA 4RADA 5GJBA 3PPYA 4N39A 1EDEA 4WXPA 5CNKA 5F33A 4BAUA 4LYYA 3IPRA 4MUXA 5J47A 4IMJB 1ZN2A 2SHKA 1F17A 2D7JA 1TDJA 4D3XA 3LRPA 3AXTA 2AFHA 3BEDA 3PR3A 3DF9A 3ANSA 3VV3A 2ONKA 3ZR4B 1SCUB 5IW8A 1QHNA 5K03A 1BFUA 2BI4A 3BE6A 1JAIA 1SXIA 2G4VA 3I9NA 2ERXA 5ESDA 1UKCA 2NYUA 4G89A 4S35A 4PCLA 3OMXA 1MVNA 4HWTA 2C4MA 4LZOA 1HUQA 4R9SA 3OAAA 2OORC 3L0OA 1Q91A 4O2RA 1TF2A 4H1TA 4RENA 1E6WA 2FWBA 4CMIB 5BYJA 1YBMA 4OXRA 3V5NA 1KWKA 2FFBA 2ZTHA 4V3CA 3KVNA 2ZIWB 4C0AC 3IUBA 4EHBA 1B3BA 1LQUA 3MRTA 1E5VA 4DA4A 2Y1LA 4MMXB 3ZHQA 4MDHA 3TG8A 1YRQA 3D5TA 3E3OA 4IOLA 4FEGA 1OXVA 4ZI7B 4R81A 4X1IA 4AB1A 4CM8A 5JZSA 1FA9A 2ZYDA 4WKBA 4B47A 4LFAB 1CV2A 4EX6A 3SIPA 4HC4A 5FBHA 2HAEA 5B3AA 5SICE 1IVYA 4GX0A 5AD1A 4BP8A 1CFZA 3FH0A 5FPHA 5YASA 3V9AA 4G07A 3D7RA 4DJEC 3CLVA 1NQUA 1N36B 1P7YA 1JH8A 3IAEA 1CDDA 5ALUA 1CZRA 1QHHB 2MYTA 5EE9A 1E94E 1NSFA 4Z0NA 1UBFA 3L0DA 4L8FA 3UH0A 4B7XA 3SR3A 3TB6A 4ILEA 2B25A 5IC6A 1KQPA 4EW3A 3WBBA 2FZVA 4KR0A 1FRQA 1GYQA 3FTDA 2ADOA 3SYLA 2V54A 3PHIA 5KOJB 3VQTA 5IX8A 2ZZMA 3TNLA 4GBJA 2D1RA 1ZSVA 2VDKB 2A5JA 2Y0DA 1JYEA 4PY2A 2QV0A 1LDMA 1MABB 4GP6A 3W05A 1N9GA 4NYJR 2R8YA 1FRZA 4X84A 5JNSA 4NMMA 1Q5PA 3JZDA 4AXBA 1J8VA 5JQGF 4KQHA 3CVUA 1WXIA 221PA 2KSQA 1XD2A 3B38A 4RKWA 3CCBA 3TZCA 3G0OA 3QEMA 3HCOA 2I7VA 1U7UA 3F71A 3MOSA 2IW1A 2MSNA 5FPYA 4M2LA 3NUQA 4II7A 3AHHA 3STVA 3DWGA 4DT1B 2OXFA 1DV2A 1JWBB 1QBGA 3C8DA 3EDYA 4BLWA 4CMGA 2PWPA 4CU5A 4M7RA 4DPKA 4GKBA 3Q3JB 4PE5B 3JRWA 2PK3A 2NZXA 3HGTA 1Q17A 3K0AA 3NHZA 4HYQA 3IB3A 2CVQA 4UUPA 3K16A 1H6AA 1D0VA 3O8NA 4HWGA 4K8RB 5DM2A 1DQNA 2VHEA 3Q87B 3X3HA 1ZUWA 1UFRA 1X1EA 3R0QA 2V1UA 2C7QA 1C9YA 2XMZA 1K8ZB 4RY0A 2PFGA 5ILOA 3P32A 1A8PA 2IHKA 3PUIA 4DSTA 4BXOB 1YQUA 2XMGA 4INPA 2RHOA 2QRMA 3BFJA 2Q9UA 1UBMS 1XDSA 3I42A 2C0CA 3L41A 2DQ4A 3ETHA 1RW4A 3HBMA 3UOGA 5DNYB 2O07A 3LK6A 4KFTA 4P3PA 3NBZC 4AULA 2ADFA 3OEHD 3QY9A 5ICCA 4YT5A 3IS3A 2XUKA 1SD1A 4BV8A 1LQ2A 5AKJA 1DEHA 4A27A 1E9EA 1A77A 3RSCA 3W6OA 4QQKA 4HWKA 3L4BA 4KJXA 4QU9A 1D4OA 5AOAA 2C9YA 3FPCA 4FFMA 4PEVA 1A9XB 1EP1B 1LNZA 4TTTS 5JNTA 4TUYF 3AKDA 5FI3A 2RH5A 1YXMA 3TTVA 1UWKA 5HJ5A 2Q99A 1OYOA 1DAKA 4M9ZA 3ZTTA 4EO4A 1QVWA 3TTSA 1AK9A 1EDOA 3TRHA 1JA0A 1JLKA 5LJIA 3IP9A 3IH5A 1HA3A 5CCDA 5BQFA 3M70A 2VHVA 3K0EA 4TN5A 4Z51A 3ZIAA 1E98A 4AZ0B 3SZMA 1JU4A 3O94A 1U80A 2X0FA 2IKQA 1A69A 4RDXA 3X1DA 2QX7A 4X1KA 4MS3A 2OYSA 4C22A 4XGNA 2X1VA 5ULLA 3QW2A 2WPNA 4US0R 3VAYA 1USGA 3VVLA 4YV2A 5ADHA 1I24A 4L85A 1JIVA 4FVTA 3WMXA 4KUEA 4P5EA 1U8ZA 1NI4A 1ES9A 1KARA 2PGAA 3JATA 3MLEA 3TQRA 1RWQA 4BBPA 4BNZA 4ZZ1A 2VUIB 3M1IA 2BUBA 3TN7A 1ZISA 4X54A 2QOEA 3SVZA 1C3OB 2EP5A 4DLXA 3OMLA 4LSGA 5F12A 3IBTA 3W79A 4E1BA 4F93B 3GZNB 1OHHA 1GL6A 1H9AA 1TGVA 2QRVA 2QTWB 2XWPA 2ZRAA 3GDWA 4F3RA 2C9DA 2PR2A 4NULA 3VC7A 3INNA 2OB1A 3BXOA 4B35A 3D7LA 4FFVA 4ND3A 3UMYA 1EFPB 4F8JA 5IZ4A 3DO8A 1VL8A 2P9TA 4H31A 1SN7A 1PZEA 2C7VA 2XODA 4PAGA 3V32A 1T8SA 5CT5A 4ZCSA 1VB3A 3OCCA 3DEKA 4ISBA 3HSYA 3U6BA 1WXEA 1JQLB 3CINA 3CB2A 5J59A 1Y7LA 4YRKA 4UBOA 4RESA 5I7UA 2ONJA 2WUEA 1X7WB 4QTTB 5CA0F 4GZ3A 2EZUA 1IU9A 2ZAYA 4TSFD 2P4EA 2IV2X 2P9HA 5ALYA 1E89A 5LQNA 2OHOA 3IAS1 1O9GA 2FFHA 4J0FA 1PZFA 2QT1A 3LKDA 4B8WA 2Q49A 1VFPA 1RBQA 5CBPA 2X86A 4IIUA 5DCUA 2WWFA 2J30A 4A8PA 1KI6B 1O95D 3FJOA 3OCZA 3SF8A 4O0MA 4TOIA 5TEWA 5BYKA 1L2TA 1PDOA 2ZB8A 3DT8A 2Z9DA 5AM5A 3RF7A 3OZSA 3QPVA 1UAAA 1V5WA 4N3AA 3WIOA 3AESA 1RWKA 4GRAA 4OF4A 5C5CA 3EZGA 3N0TA 4D74A 3PTAA 2QVCA 2PKCA 1EESA 3H9EO 1VL6A 4HUQB 1Q1NA 3DOFA 4LTNA 3X1KA 2C7OA 4HHEA 2VLBA 3EH1A 2GGSA 4HTFA 3WNCA 1NF3A 4M49A 1IY9A 4JJ7A 4K9RA 3KXKA 3OZWA 3T5TA 1P2VA 1T1EA 2C04A 5HQTA 3LW7A 3WYAA 1TM1E 2UYYA 2VDRB 4YJ2F 3BWCA 3K9NA 1QWOA 1U5CA 3SWWA 1AF7A 1XDZA 2YHIB 2IQIA 3UHOA 3Q0EA 1W8DA 1L7AA 3LNCA 3SYRA 4KR7A 5T3YA 5CP8A 2CXRA 4XD2A 4NL4H 2XXBA 1X1AA 4TV9A 3W5SA 3FR8A 1JFVA 4YRDA 5KMGA 4GL2A 2ZITA 3EK2A 2C97A 1RXVA 2X0IA 2O8DB 2NU6A 2OUKA 3HCWA 3ZJYA 1W1WA 5TQJA 3UXEA 4C4AA 3ZX5A 3OZUA 2M6RA 4EFDA 1Q0LA 3II6X 4E07A 1F7VA 4R1MA 2AC7A 3ENWA 2F8LA 2JI7A 5FA5A 4PG4A 3ZCXA 3ZE7A 5BN4A 1GQOA 1Q3HA 1CETA 3HYRA 1V6SA 3I52A 1KMIY 2E4XA 2G71A 2V55B 3DVRX 1E3TA 4J7AA 3L1KA 3LQRA 5AT1A 4I9NA 2VRCA 4PLWA 2QRZA 4QTYA 1LA2A 1NR1A 5F2EA 3HRKA 1A1SA 3QTTA 4EMUA 1XK7A 5JSKA 4MINA 3G85A 4CQMB 3VHLB 4U4AA 4BVGA 1NA5A 1HFEL 3NJ8A 1UOOA 3USES 4LKOA 5AICA 1BWPA 2I4TA 5E1DA 1R3DA 2VQEB 1P7WA 3EUAA 3SC6A 3HE3A 4V38A 1KH2A 4RTKA 3HJHA 4XFJA 4ZYYA 4FFDA 1QONA 3GJ0A 3QEOA 1Q77A 1W29A 3ZEIA 1RJWA 3OA0A 1UADA 4IZOA 4PZYA 3QIAA 4YT4A 3BAZA 2PRZA 1NYQA 3EF0A 3DL0A 3KJGA 3LVQE 1IEWA 2ZYRA 2I9PA 4UBMA 5MGBA 3AVWA 1GAWA 2HWKA 1A76A 1DT5A 3SZGA 4WH0A 3P9NA 4RFLA 2YTZA 5IJXA 1QV7A 2VT6A 2CNDA 4LQCA 4PU0A 4RC9A 1OXTA 4Q3LA 4RE6A 4RS4A 2ZSAA 5EIOA 4EPVA 3G49A 2B36A 2JAXA 2BTOA 1NQVA 4EEXA 4Q3CA 1D1SA 4K6FA 2P67A 1I7QB 1QHXA 1C1XB 1CF9A 2DPYA 4NFSA 4L6CA 3ZBUA 2QGZA 3ANLA 4C3ZA 2E6UX 2H7CA 3BGSA 1AK2A 4FHEA 4C2AA 3GAZA 4H59A 4JR0A 5D8DA 1VB5A 3MFYA 4R8KA 3TCXB 4M7PA 4BQPA 4M0FA 3DCYA 4IDGA 1KK1A 4DCOA 2GB4A 3LV8A 4ALMA 3HJBA 3KB6A 1XQ6A 3AYXB 5I7OA 5T4BA 4Y2JA 4UEKA 1T43A 3T3GA 2AW5A 4ID9A 3I9KA 1PD1A 3O26A 5JDCC 3WLEA 1H2RS 4BNFA 4CEIB 2CKDA 1MB3A 3IMFA 2MR5A 1QUFA 4CMJA 3R0ZA 1IH8A 1TYEB 1R5BA 2FPMA 3DM5A 3JWIA 4PSAA 2OVFA 4CL3A 3BWMA 4JT4A 1PSDA 3D4OA 5AW1A 1SA0B 2ZYUX 1E9AA 4H9GA 4RJKA 4MB2A 2GUWA 2MSEB 2QHXA 4YQZA 3R74A 3EDRA 2WIDA 2WAOA 4PRLA 3AERA 3HCAA 1QJCA 5DTRA 4F2HA 2D54A 1E8DA 2IH2A 4YH1A 3REQA 5EAIA 1MJHA 2HBQA 3GPBA 3LJKA 4I3HA 3R6GA 3GARA 4RDCA 4DDWA 1ZIXA 3I1YA 5KTSA 4C0HA 2ZWIA 3FLAA 2AA3A 3U7IA 1P3Y1 2YFHA 1IB0A 1YRLA 3GNSA 4H7FA 4AS2A 1Z6GA 4J0EA 3S2IA 1UC4B 1WQ3A 2HSEA 2OESA 2AWNA 2ZJBA 3ZHTA 2CLKB 1WHSB 4RPGA 3F67A 3NJ4A 4PO8A 4XUCA 3QMMA 4ZJZA 1OH7A 4CFZA 4ER7A 4JV5B 3QLJA 2XNDD 5FNVF 2BFPA 1E3SA 1MQSA 1WY5A 4KPUB 2P90A 1SIUA 4PN3A 2UUBB 3PUVA 3EA4A 4Y2SA 1ZW1A 1C3EA 1ZD2P 2FVYA 3DZCA 3FYUB 4U9IS 1FMCA 3U44A 1TK2A 4M1EA 2FW1A 2J9RA 3FROA 3QXGA 3FKSD 3EOBI 3ZY6A 1C9KA 2V7VA 4HEJA 1MV8A 1GRCA 3UK6A 1KVTA 3DE1X 3G9ZA 2V45A 4O4HF 3OM9A 2P2YA 3AL3A 4S12A 1MQ8B 4B82A 5LU9A 1LS1A 1KEUA 4BP9A 3QVJA 4JUCA 4YECA 3TPCA 1GPH1 3QGMA 4O4JF 3ZNNA 1U28C 4R68A 4YTEA 3NC4A 2JLRA 5JZ9A 2VJKA 1YDMA 1QFXA 3IL2A 1U5AA 1AKUA 1UK7A 4E12A 1OI4A 2GEVA 1BEZA 4TMFA 1YGYA 3E7XA 3NQ41 3ZDBA 1CUVA 4AY2A 3TXAA 3TPFA 4HB2A 5JC1A 4BCBA 1JMYA 3VR6D 2GR9A 3PHGA 1V11B 4PGMA 1Y9DA 5HDQA 3ITEA 5D3QA 1KZ7B 3RK1A 5AM3A 3DGFC 1JHXA 3IESA 4CMBA 2FQXA 3T9BA 5LPNA 2V0CA 2CXHA 2Q3CA 1Z4NA 3BJRA 1PQWA 3CNEA 1W0CA 4BQOA 2GZMA 1WZIA 2WTXA 3ORHA 3AO0B 4JKIA 2P30A 3JQGB 4AI6A 1ODKA 4Q9HA 3ZKWA 1ZJJA 2EX0A 3L79A 4O4IF 4WMLA 2J48A 4TYMA 4XLLA 4Q37A 1RAHA 5A9TA 2B0CA 2E82A 1G98A 4WBSA 1MNAA 1MVLA 3GB9A 3LCVB 4PM4A 2H0QA 4L5AA 5CVTA 3B53X 3FPHA 4J1TA 4TQGA 5HP4A 2X5JO 1CJVC 1F6DA 5IKMA 1F2UB 2WYVA 3OURA 4EEZA 3U62A 3H7IA 1CDZA 4H0FA 1ECCA 5B55A 1JU3A 1SM4A 2AG6A 4MUGA 1NNEA 2YMLA 5JVDA 1TO2E 1RM0A 4H6PA 1UFOA 1Y1LA 2H1IA 4YBRA 1O94A 4YIHA 4GUDA 4LYEA 3TOXA 5K99A 1J21A 3P97A 1IJFA 4GLJA 3ED5A 1PGOA 2A9QA 4MRAA 5B6IA 1VHQA 4QBFA 4R1SA 1GUBA 1KMQA 2QSYA 3U4QA 2BFEA 2BEWB 3CLSD 2VG8A 2XQKA 3ANTA 1RSZA 4PW0A 3T99A 1SZCA 3O1HB 1XDDA 5CLLA 4HDSA 1JG3A 1P74A 1PT8A 1UDWA 3D6VA 5D01A 3O83A 1YNSA 2XQVA 3KX2A 2DTEA 2GBLC 2XUAA 4C4OA 1JLMA 4KAJA 4O08A 4ER0A 1R0YA 1KBQA 3NYIA 2XKKA 4EA9A 3TTWA 2AE2A 1TJ4A 4E4RA 3UJ3X 4CYMA 2C7PA 3GHYA 1U0BB 2H7YA 3ENNA 5AM1A 1G9XA 1YS9A 2AN1A 3ILHA 3P2JA 2YJGA 5JAHA 5SY9A 1G17A 2IBMA 5AVTA 4G5RA 4RA6A 4TQUS 3ZV6A 4FM9A 1BWQA 3ZN2A 1D1QA 3LO5A 2YXEA 4Z0HO 4E5YA 4Z4IA 4DCVA 4BFSA 4MUBA 1WEKA 1XCMA 1GM5A 5CA1F 4ITRC 4R0MA 4ZVOA 5JMWA 2R1TA 3DDNA 1SU4A 5JAPA 1RZ3A 1PGNA 1NTOA 4C7MA 3QX8A 2R8PA 4JJ8A 4JLBA 3AKZA 1YQQA 4XJTA 4NEQA 4YAGA 2VQFB 3WGLA 3WLTA 2B7CA 1R6DA 3K15A 1E2UA 3PT5A 3HSKA 3ZJTA 2O57A 5CW2A 4EJ6A 4KRYA 2VUSA 3WTBA 1J0BA 2W6QA 4MZDA 1NMYA 2WOOA 4ZJYA 1A7AA 3GJQA 5IRCD 1DXOA 2Q3HA 2YV5A 3LKVA 4QYIA 2ISCA 4XEHA 1SBNE 1A5SB 1EHIA 1DE0A 1I4LD 1J1ZA 1JQDA 4FJ0A 1CCWA 2XCUA 3E9QA 3WL5A 1LWNA 3PQDA 4BZPA 5ILGA 3BQ9A 4B33A 5A1TA 1S7CA 2KYRA 5CVDA 2Y8EA 2PLWA 4GU5A 4HAIA 4R2MA 3KPWA 5FBZA 1A8QA 2DWCA 1RABA 1P1KA 2BN4A 3WL4A 2OMKA 5JNLA 5KHLB 1N34B 2QRGA 2O5CA 5B7PA 3DMGA 2I71A 5KC8A 3P2IA 1T36A 2BSXA 3WYGA 4LUCA 1SIOA 4JVSB 1M76A 4P0TA 3DMNA 3KR0A 1FE8A 4GEKA 1XB2A 3Q4GA 3LP6A 1A2QA 5FO1A 2UUCB 2WWIA 1V8FA 1XZPA 2BFCB 1OROA 2H5JA 3GZ4A 4LZZA 2BMWA 3DV9A 2HI0A 5P8WA 4D9GA 2YW2A 1D2EA 1E3EA 3DEHA 5EHGA 2LDBA 1Y3FE 4FCVA 3TBKA 4HUJA 5EIBD 1WZUA 4BMNA 2OHFA 1RBMA 5BMVA 2FF7A 1AZSC 3MJHA 4PCAA 4X66B 1XMSA 2IS4A 4ZEXA 1II9A 1QFJA 4PYOA 1EJ2A 3FWHA 5CVCA 3WGKA 1RJFA 4NWIA 4P9NA 3NIWA 1UT8A 4FGKA 3JZIA 4FXPA 2IZ0A 3WV4A 1WX1A 1EJ6A 1OLUA 3H04A 1WDKA 4CKZA 4MIYA 4QPJC 3ZEAA 1N6HA 3BWDD 4RQTA 3JPWA 3TUIC 3RLFA 4B85A 2KLBA 2PT7A 4QG3A 5TMBA 4UOEA 1OAKA 3QVTA 2WWTA 1RM4A 3K0HA 3K1ZA 4MB6A 4QT0A 1K4MA 2IPOA 4IILA 3X1JA 1TMKA 4LEIA 3AF0A 3UVEA 3K0FA 5FUXA 1V35A 4D8UA 4IUDS 2VP5A 4D5GA 3GQBA 4F4DA 1SOUA 3MTAA 4GM0A 2DKNA 3HH8A 3WMWA 1Z22A 4NNPA 3ZCUA 1TC2A 4BAGA 5IJAA 4AL4A 5BNFA 1JEYA 5CLJA 3MD9A 1KNXA 2A57A 2H59A 5EA2A 5BUQA 3SEFA 1YKGA 4EIWA 3Q8MA 1NJ5A 4TMKA 4WHMA 5T6MA 4CODB 1W8IA 1S01A 4OYYA 4WA7A 3KBBA 3VKFA 1J06A 3L0IB 3STUA 1TYCA 1VGQA 2FXIA 3TJRA 1MOPA