1L1QA

Crystal structure of aprtase from giardia lamblia complexed with 9-deazaadenine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
181
structure length
181
Chain Sequence
TMSVADAHALIKTIPDFPTKGIAFKDLSDILSTPAALDAVRKEVTAHYKDVPITKVVGIESRGFILGGIVANSLGVGFVALRKAGKLPGDVCKCTFDMEYQKGVTIEVQKRQLGPHDVVLLHDDVLATGGTLLAAIELCETAGVKPENIYINVLYEIEALKGREKVGQKCTRLFSVIREHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenine phosphoribosyltransferase
publication title Closed Site Complexes of Adenine Phosphoribosyltransferase from Giardia lamblia Reveal a Mechanism of Ribosyl Migration.
pubmed doi rcsb
source organism Giardia intestinalis
molecule tags Transferase
total genus 51
structure length 181
sequence length 181
ec nomenclature ec 2.4.2.7: Adenine phosphoribosyltransferase.
pdb deposition date 2002-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1l1qA00
5JV5A 1XTTA 2H08A 1W30A 3DAHA 1XZNA 1QB7A 4M0UA 1DKUA 1UPUA 4P3KA 1ZN7A 1A3CA 3OHPA 1QK3A 1GPH1 1DBRA 1TC2A 4LYYA 2JI4A 2P1ZA 3N2LA 1PZMA 1UPFA 5ESWA 4P80A 1VSTA 3OZFA 4RABA 1O5OA 1HMPA 4X45A 1J7JA 4LYGA 1A96A 1I0IA 1XTVA 1YFZA 1QK5A 3GEPA 1ZN9A 2WNSA 4P84A 1P17A 5BRNA 1BZYA 4LZOA 3ACCA 1A97A 1XZ8A 4MB6A 2IGBA 2H07A 2JKYA 4RHXA 4F8EA 1AO0A 1CJBA 5HKLA 1DQPA 5ESXA 1NONA 4OHCA 1DKRA 4P86A 4RAOA 3H83A 2JKZA 1R3UA 1VDMA 1I14A 4RHTA 3MJDA 1OROA 3LPNA 1G2PA 2EHJA 4RHYA 5E38A 3GGJA 4Z1OA 1JLRA 4M0KA 2FXVA 1QK4A 1OPRA 3LRTA 1TC1A 3NAGA 4RHUA 1ECGA 3KB8A 3S5JA 1VCHA 1D6NA 4RQAA 2JBHA 4TWBA 1Z7GA 1NULA 3OZGA 4RACA 2E55A 5EUCA 1I13A 2H06A 4PAWA 4JLSA 2PRZA 1A98A 1I5EA 1P4AA 3ACBA 3M3HA 4RV4A 1ECCA 1ECJA 1QCCA 2AEEA 4IJQA 5BQPA 1JLSA 1OREA 4QYIA 5BQOA 3DEZA 5KAMA 1ECFA 1HGXA 4P81A 2XBUA 2PS1A 1I0LA 1GRVA 4ZFNA 4RAQA 5KAPA 1Y0BA 1V9SA 1IBSA 2C4KA 4JITA 4QYIB 5JSQA 1O57A 1QCDA 1U9YA 4FYMA 4M0PA 1MZVA 2DY0A 4QRIA 1XTUA 4PFQA 1UFRA 3O7MA 4WN3A 5HIAA 1A95A 1FSGA 4LZNA 4LZAA 3QW4B 3HVUA 1L1QA 2VFAA 1A4XA 1DQNA 3EFHA 4RANA 5BSKA 1G2QA 2PRYA 1BD4A 4P83A 4RQBA 1LH0A 5K51A 4WMLA 5IAOA 4RADA 3GGCA 1STOA 5IPFA 3ACDA 1WD5A 1G9TA 1ZN8A 2YZKA 2HCRA 4S2UA 1G9SA 1QB8A 4X44A 1BD3A 3G6WA 1U9ZA 4P82A 3DMPA 3MBIA 2GEBA 4KN6A 1L1RA 1ECBA 1P18A 1P19A
chains in the Genus database with same CATH superfamily
2CYCA 5DYYA 2YBEA 3SNHA 3STTA 3S1AA 2JLYA 3RFCA 2UUPA 1VE1A 1EUZA 3GW8A 1MAVA 4PSVA 4X66B 3EC7A 1SB8A 4J0EA 5CDFA 3O1JC 2GB4A 2UVDA 4BB0A 5FCDA 3QQ5A 4TXJA 5IJ0A 1WDWB 2Q1XA 4MQFB 2PLFA 3H5WA 1HDIA 2GK6A 2Y1KA 4G56A 1HQCA 1PDVA 1ISRA 4R2WA 4XR9A 2W00A 2CNOA 1UMBB 2NLOA 3WKCA 4WZAA 4PBRA 3ELBA 2ZSBA 3D3KA 2HUNA 3LT2A 3LC0A 1Y42X 5ESXA 1PR4A 2WHPB 3L0PA 1PBTA 3BICA 1KXJA 2ZRMA 3K73O 3NM5A 2YVUA 1DAFA 4FNOA 4NFYA 5DTIA 3TI7A 1FP4A 2A86A 4MHSA 5ERYA 3ZE0B 5A4MS 4YRMA 2YWGA 3DO8A 5CRIA 4PX5A 2B2XA 3AMVA 3WLOA 1DC7A 3H2YA 1OWNA 2A4MA 3OJOA 4LHYA 5T41A 4RK7A 3UHJA 3WLMA 4BNVA 3DXXA 1G8GA 2VQ6A 1X7ZB 2YDYA 4P9NA 3M4ZA 5FKJA 4TYQA 3GFOA 1OLUA 3D2LA 3C0KA 4Z9YA 1EDEA 1PR6A 5ALOA 3O1HB 3C6ZA 1D09A 1JLKA 2QRVA 2XWPA 2ZBDA 3GJXC 3JQ7A 3M0EA 3KKEA 1D8AA 2GEJA 3RJ5A 3TXAA 3JQ9A 3B3GA 1VJ1A 1WB5A 5BR4A 2VSNA 4D1YA 1IEWA 5GTDA 3CSUA 4M38A 1JKFA 1Z4OA 3C5CA 5KTTA 1YHZA 1J0CA 3LUHA 2PT6A 3VJRA 1U1GA 4QYIA 1Q6ZA 4WGFA 3X43A 1N57A 1RPTA 1X8KA 1KEZA 4QYTA 4UPDA 3UJPA 5A4AA 3WZ2A 3PE4A 5FL3A 1V3TA 2JAPA 1Z68A 2N47A 3C3KA 3EBLA 3EE6A 2P2SA 2MJLA 4J7AA 4RTPA 1W6RA 3SE7A 1H2WA 1U9YA 2YS6A 3GJ5A 3QOXA 2XUQA 1VL2A 4LRQA 5GOZA 3UK1A 4UFPA 3ZWKA 4BX9A 1E2EA 1PR9A 2PQ2A 3DMRA 3D8TA 3LM8A 3AFIA 4TLDA 3H65A 4FHFA 4ZIRA 1B0AA 1SIOA 2J9ZB 2X7XA 1Y1SA 1KMHB 5KYWB 2CJYA 3D81A 5DISB 2LNDA 2G08A 4CTMA 2RHTA 2Y68A 1SMKA 2FZVA 4IM7A 3INRA 5LDDC 2IF2A 2RGWA 4QPNA 5A04A 2AKAB 4RANA 2CVZA 2YDXA 3DZGA 4OJTA 1XVVA 4QUJA 1RLMA 5KYKA 4P7KA 1U65A 1O4VA 1ULUA 1GP2A 3WNCA 2W2KA 3CJTA 2AE2A 1ACMA 4H0CA 2VT6A 4RY9A 4PQEA 5CFNA 5B57C 2Y1GA 4LGYA 1Q2UA 2A4KA 2C9BA 2REBA 1FLVA 2YRXA 3Q7EA 4XR4A 2YJZA 4DMCA 3DGEC 2EL9A 3PUZA 2UYQA 1EUYA 1Z18A 1ONNA 2KBFA 3KM0A 5A9TA 2MDTA 3OQIB 2EX1A 5A03A 2ZB4A 1Q11A 2E4WA 4J0FA 4RQUA 5CT6A 3U61B 1SCUB 3GFTA 1ECBA 2VJBA 5BW6B 4B8ZA 3CW2A 1L5ZA 1YGYA 1XMVA 1JAZA 4OXQA 1CLUA 3ZWOA 4BAGA 3DUWA 3DAHA 3FNRA 2YOHA 1NYQA 4F85A 2YYZA 4TM7A 4PCVA 2PSSA 1M2GA 1JBQA 5JAMA 3CVJA 2AB0A 4GRDA 1AXRA 4N76A 1DWPA 2Q3LA 4LYFA 1EU1A 1Q3KA 3OUZA 3HY3A 1XROA 3BKWA 5CGQB 2OB2A 4M7WA 1HDXA 2HHCA 1SCUA 1TJ4A 4NS1A 2VQ3A 3ZLTA 1XQXA 4LDRA 4CQLB 4X1IB 1ZD4A 4WOCA 5D7BA 4GU5A 3GMTA 3MGGA 5BR8B 4MWSA 4RHXA 5DX1A 4E5KA 2ADMA 4JJ4A 1I4WA 4R1OA 3O8DA 3ZCUA 2PZAA 2EBHX 3DOCA 5CIWA 2IHNA 3E81A 2YFQA 1A1SA 4OHYA 1XELA 1TVCA 3MMPA 1BG6A 1KDVA 2PG3A 3G0DA 1YONA 4Q3OA 3EXG2 3PYLA 2PRSA 1KEEA 3PXAA 3LC1O 4LK3A 4X1IA 4EA9A 1DBWA 2V7PA 3DWEX 5D84A 1RHJA 1FFSA 4AMGA 4IMIB 1GG9A 4K46A 1RKQA 4G9EA 3GT0A 2AHRA 1OX4B 3AP1A 3P2EA 3B6MA 1CERA 1EX6A 4NNOA 2X2OA 4A0SA 3GMDA 5KZMB 4I55B 5H81A 3W6PA 3LQ1A 2W6OA 4L9SA 1JHMA 2JBHA 5CFZA 2AW5A 4ID3A 3TW8A 3C5WP 4HADA 1AKUA 1WVIA 2R6JA 2XY4A 3EA0A 3FPCA 5GM1A 2XRFA 3U62A 3EZYA 3ZJTA 2IYOA 3T0GA 1KDPA 5G0WA 4EPWA 4CUZA 1V8ZA 3GYGA 3OMXA 1EZ1A 2VWGA 2KW5A 5JECA 5FLXA 3O4VA 1ZM9A 4YLGA 4LOIA 4AW9A 4HUTA 3ZDQA 3HKEA 4EPTA 3KQSA 1Z4JA 4MCIA 2OBBA 3G17A 4S3MA 2ZM5A 2O9JA 1YJQA 3HUUA 4TLLB 3QVVA 2R1TB 5IEJA 5JNUA 1Y37A 3BERA 3R5HA 4IDBA 5KB3A 4Y2GA 1NRJB 3VZSA 1OIWA 4UTVA 3DMTC 2AN5A 4DLSA 5HM8A 5IUNC 5IU6A 3AOEC 3WRYA 1A95A 4DLTA 2VRBA 3V7NA 4OF4A 3QH4A 4DSZA 4I8IA 1V39A 2GNOA 1K6MA 4YTEA 1QPGA 2YNMD 5K3BA 4YAKA 3MWDB 4BIIA 1G18A 4ZQEA 4Z9FA 2PXXA 2R96A 1XXLA 2VJLA 3N39C 3ZLBA 4GXTA 3RVDA 2I9KA 1UJ6A 2AQ8A 3B36A 1U2DA 4MCJA 2ZREA 4B5LA 4NCKA 5G4LA 1U02A 3GFSA 1XZCA 4R8MA 4RKFA 4W9NA 5EJIA 3TRFA 1FRZA 2BGKA 4GGPA 2F9FA 1WDLA 3G9TA 3GY0A 3MTGA 3OQHA 3WL8A 2BLLA 4GM0A 2B34A 2QM0A 2H8GA 2OSVA 3GLVA 3K6JA 4DA9A 6NULA 3ZEIA 4FSDA 3MWDA 4QQRA 5FBHA 3WJ7A 3GRPA 1Y8RA 2TMYA 4PS1A 4YUXA 1OWPA 3GBSA 3GIDA 4INOA 4EH1A 5CDHA 5CFPA 4D97A 4LBZA 1LK7A 3NHAA 1P73A 4FCTA 1TI7A 1ACJA 3IP9A 2F1HA 5SICE 3WO0A 4A6DA 5LYJF 3E84A 1TA0A 5ECYA 3R24A 1R27A 2YASA 3DKKA 1N1DA 3UCXA 1DKUA 1XRRA 2CGEA 2WYVA 3EQ7A 4FUTA 2PH3A 3TGPA 1ST3A 3FMVA 1TK9A 3MXTA 4E46A 4R9UC 2G70A 2ZU6A 4W5TA 2PKQP 3A9WA 3IA7A 1JFLA 2P0YA 2PVPA 3IAUA 1P5ZB 4XPIB 2ZBRA 1J7JA 4KGVA 4GVXA 4K8RB 1TXGA 4BNIA 1ILEA 1AKQA 3PPIA 3W1VA 3RBAA 4F0JA 2EKDA 2WHXA 4LWPA 4OHUA 1LDYA 3TB4A 1N2IA 3HLYA 5E2AA 1LXCA 5AKHA 2NUPA 3ZWQA 2J31A 4CLRB 2OXRA 2QD1A 3HJHA 1JZTA 3I0ZA 1GZDA 1QOQB 3A27A 3P32A 1AKNA 2AI3A 3QKSB 1LS1A 4LYHA 3KB1A 4LCJA 1FDVA 4PO8A 4M49A 1A8SA 1IDOA 2D7JA 1IM5A 1I24A 2FEXA 2Q3DA 3K7EA 4G1MB 1QH0A 3D4IA 2ZS9A 3KQYA 3QTLA 4XLZA 3DCJA 4M7PA 4NFHA 1C30B 2BV3A 2PHZA 5EYPA 1JG2A 2GDZA 3F1KA 4UDYX 5E38A 4HXGA 1Z5OA 4KUEA 4GMDA 2YWFA 2QPOA 3EPRA 5G4KA 1ENYA 3RC3A 1IE3A 4R2XA 3PNQA 3T94A 3TRDA 1YA6A 3FKQA 1PJ8A 1X1AA 3ENVA 2P41A 4HZIA 3ZOZA 4DWJA 5IWCA 2D6FA 5DSXA 3P9SA 1LNQA 2H9AA 4IDNA 1KU0A 4U39A 4XFKA 2AFIB 2FE1A 4ACBA 1UODA 3OZGA 3I39X 2B1QA 4ZYYA 3WGUA 2WEKA 2ODAA 2HRCA 4AWXA 3LUFA 5I7EA 2NPOA 3PHHA 4JLSA 3S44A 1C9MA 1ZM7A 1FW6A 3UZUA 2IHKA 5L7TA 4Q3BA 4E5PA 4N5NA 4DB4A 3TBKA 1Q3TA 2UUOA 2DUWA 4G1UC 2BLNA 2G77B 5CYOA 1NUQA 1YE8A 3OTHA 1ESNA 1XJCA 1GGKA 4NJEA 4BMCA 4DNQA 5IUJC 2VSXA 1XN1A 1A8IA 3U5ZB 1Q1ZA 2LKCA 1D4AA 1MFPA 3EQ6A 4OQXA 5CLFA 4K3VA 3PNMA 4F3RA 1NMYA 3E9NA 4UD6A 2OENG 4HDNA 2BR4A 3ZXIA 1OJ7A 4CQNA 1QCDA 1V3UA 1HEYA 1VYHA 2OBYA 4D8UA 1CUGA 3FVWA 2X4IA 1PX2A 3P2JA 1Z0KA 3AJ8A 3PDIB 4HHEA 4CMKA 4DCVA 5FL7D 2EEZA 1C4XA 1MQ9A 3D8BA 1UDXA 3GQBB 2FP3A 2NSLA 4HQFA 2OCGA 3DWFA 2UXBB 3GLFB 2W22A 3AEZA 1T4MA 5T7BA 4MJLA 3CIOA 3PA6A 3WYFA 1XQ6A 3A6KA 1N2CE 2NYUA 3Q3HA 1PLLA 5FBQB 3WMWA 3K70C 1EG7A 4M8LA 2JFQA 4WXPA 4XIGS 4O2AF 3M1YA 1AB6A 2NVUB 3QEKA 4Q03A 1IHDA 3VUFA 2Y1EA 1J8QA 1ZO8A 2Q1WA 4OQPA 3WGNA 1ZJWA 1Z6TA 3CR3C 2CBZA 2NXJA 4FC7A 3ZCTA 4ENTA 1XVUA 3NCTA 1ZM4A 5C8YF 3F67A 3FOWA 4CXMA 2LGJA 5HK9A 1TM5E 1PZGA 5EXPA 1NDHA 4HN9A 1OTXA 3A6JA 4ILKA 2JGLA 1KI1A 2UYOA 4G3XA 4FS8A 4O4JF 4XVRA 3FTDA 3ISTA 4IHJA 4ZAYA 3KXIA 4N3BA 4TMFA 3GA7A 1P8JA 4BNDA 2FZGA 1FYXA 3AEUB 4MPPA 4ASUD 1M2VB 2P9CA 5ER9A 4HLDA 3VYTB 4BWVA 3OTOB 1GPKA 5J1SB 4HQKA 1SVIA 2M2IA 5E2IA 3S2FA 3LQQA 3TVTA 3VSAA 3RYHA 5TJHA 3DF7A 4KXUA 4UTOA 1EH5A 4JP2A 1CQPA 5ICMA 5AT1A 4Q3LA 4S1PA 1SXQA 2VJOA 4FINA 1QVVA 1XEFA 2ZYSA 4G09A 4KYVA 2PKXA 4EM6A 1SU4A 2VP4A 4LZOA 1M66A 3DAGA 3A1WA 1H8HD 4I9NA 1X1QA 4JAVC 1JEOA 4Z4GA 2L69A 1T8SA 4RPLA 2QKYA 4YROA 5JDIC 3BX1A 4XPZA 2FJUA 5CLIA 5HS4A 3H5RA 2ZZMA 1J07A 1Y4UA 4K9RA 3ANXA 2AG0A 2IPOA 2PYZA 3TX6A 1PT9A 2BTEA 1A9XB 4BB6A 4D8WA 2Z1NA 3KEFA 2XPCA 1DLIA 4AF7A 5HJ2A 2RGRA 1YR8A 3PR3A 2B8TA 5B7GA 3EEBA 2ORWA 2DQZA 4O4HB 4HYTA 1VZ3A 2V0GA 2SKCA 3CEJA 5AVUA 4NBNA 2QAGC 4W5NA 1NKTA 3RS7A 3QKRB 2IXFA 2D0IA 3AXTA 1HTWA 2FP4B 1Y1PA 3Q98A 4GPBA 4UUQA 4Z4EA 4BPRA 4G0UA 3M5WA 4O63O 3L6BA 1X7WB 3HM2A 4JFAA 4X20B 5CNMA 1RM4A 1K92A 4XDHA 4GUAA 4DLPA 3ROZA 3Q88A 2X41A 2HIGA 4Q66C 5TARA 2ANBA 5AKYA 1YJCA 1RIIA 2BM1A 4N49A 4H1TA 1FUEA 1X87A 3PP8A 3IUNA 3G9ZA 1LTHR 1U5BB 2V6FA 5CVVA 1NFQA 1NMQA 5ELLA 4DIBA 5JH7A 4U9HS 3AVOA 2NO4A 4U9UA 2ODTX 4BLWA 4AS3A 4E88A 5CFRA 3CUYA 1TA4A 3KALA 1O9HA 4URXR 5C1OA 3JPYA 4RD2A 5ICSA 1DC8A 5BXYA 2JLZA 1E64A 1W4ZA 3VH3A 3Q3EA 4JI4B 1VSVA 3EC1A 1L7AA 1EUCA 1AZLA 2C20A 1KAOA 2W6JD 3KVNA 3HCCA 2XKAA 3H16A 4AJKA 3K2BA 4ZVVA 5KSWB 3R8FA 4EYQA 4IDHA 1KFJB 2AXNA 5TSDA 1U90A 4KDFA 5DI3B 3G2QA 4E94A 4E09A 4AKTA 3N53A 2I03A 5CJPA 1JQJC 3S2YA 4WLNA 2B0JA 4KE7A 2W6NA 1WJGA 3Q3CA 4FHDA 3OAAA 3DB2A 1EFLA 1U11A 4Y9SA 5D5PA 4G0XA 1D4ZA 5ALRA 5DN6D 3ZJYA 5C4MA 4B82A 3FOBA 1RPAA 3DMTA 3LY8A 1WMBA 4DDVA 2YXBA 2W6ZA 5J2TB 1EINA 3NX4A 3R40A 3WIEA 3AOEA 4RDHA 5B4TA 3VPHA 4I50A 3E2IA 5JPDA 1AQNA 2PFKA 3UGTA 3ZWVA 5GOTA 3WHIA 4AMZA 3A58B 4JWTA 3LUCA 2O23A 1J0DA 1C0EA 2QRKA 3FNGA 4IQ4A 4BGDA 2V7WA 4WOBA 1VG9B 1RNLA 1S1CA 3G8DA 4HL6A 5DGHA 3L04A 1UMDB 2ZQYA 2IEZA 1IY1A 2HCFA 4BDTA 1W36C 4C0JA 4B6SA 4B80A 3KZCA 3QV1A 4KLNA 4XJVA 4B8WA 2C7PA 1FUUA 1YHYA 2HA0A 3D3WB 4YUYA 3I34X 4OHPA 5JMTA 2ERYA 4FYVA 5M29A 5G3ZA 5ENZA 4B3RB 1MOPA 1X7YA 5K9ZA 4YHHB 1TRHA 2Y3IA 3FHOA 2VT2A 4WOJA 4G1EB 3SNKA 1U98A 2N9UA 4XKJA 1YZ3A 4AVYA 1S8AA 4WZZA 2B8NA 2DAPA 2Y0BA 3C3EA 2PEYA 4Q48A 1A8QA 2KS6A 1OBFO 1P62B 2HL6A 4LV8B 4AZ3A 5K0EA 1FX0A 2DKOA 4MB6A 5CVCA 4FEGA 2ZIEA 3D3WA 5AKJA 1JI0A 5HKLA 4LZZA 4DQKA 2CXQA 2EEPA 2FGKA 1Z5PA 2OTCA 1USWA 3QJGA 5HG0A 3EXIA 3CEHA 5JS7A 2XGGA 4QGHA 4XWAA 3DVQX 1VJ0A 3L7IA 2OFXA 3OFND 2PWYA 3D6NB 4N5IX 3ZCRA 1MHTA 3FWZA 1B16A 1T5BA 2IEGA 1THGA 3CEAA 3LUKA 3OESA 1X74A 3W5JA 4BO3A 2JI9A 3D5EA 2GKOA 4RZIA 3DQQA 1NPTO 3G0OA 2PX4A 2Q8NA 4ZV9A 5JLAA 2I71A 2Q5OA 4KQHA 2FZKA 2DOKA 5EMKA 1GQFA 2HA4A 2X40A 4NJMA 3T3EA 4IJWA 4A8JB 1D7OA 4MARA 4J1TC 4MR8B 4JOQA 3M6AA 3U6KA 4M1WA 2CXSA 2XWJI 3QJYA 1A1VA 1MOZA 3LDHA 3NC0C 3QU9A 1XZHA 1GN9A 5EPUA 4EELA 3P94A 4ENUA 4L8YA 1ZWKA 1QCCA 1CQIB 4DZTA 1M0EA 3QXXA 3IMKA 3H2IA 2F3SA 5FNZA 3WJ1A 1XRSB 4GPZA 2OAP1 4L85A 4ZDKA 3CPHA 1RJDA 2C31A 3DFKA 1X2EA 1OLSB 1TU0A 1QCYA 4BX2A 4C5BA 5IJZA 2VJMB 3PCRB 1DQYA 5IP5A 4YBZA 1PZNA 3DFZA 4M1ZA 4MR8A 2VHVA 3IBYA 2OSBA 4F5ZA 2GN0A 2R8XA 4K87A 1N6OA 3G02A 2J41A 3QXCA 3VQTA 4NQZA 2YMQA 4PYNA 1W2WB 2HXGA 1YVUA 1ZFNA 1DX9A 1KSJA 4BIMA 2CL7X 4BZZA 4D96A 2CUNA 2G25A 1EJBA 3UJCA 2XOKD 3QE4A 4PHCA 1QHGA 1WLYA 1QGAA 4JSRA 5IK2D 1XTZA 4H1HA 3NWJA 3OJLA 1SUEA 1PV2A 1P0PA 3F7TA 4JQSA 4RW0A 1VPTA 4W5RA 2ZSFA 1XNRB 3IOBA 5FTWA 4J3NA 2PD6A 1W47A 3DXYA 2D1FA 2OFOA 3KT0A 2X1LA 2BFDA 4EABA 1M2FA 4IOKA 1YVRA 1YTLA 2D06A 2IYAA 1EVZA 1FL9A 1S3IA 1W94A 2CYAA 1QOPB 1T1RA 1T3GA 3C3BA 2R2GA 3DT6A 1XVLA 2C8KA 4UQOA 4DCUA 2JJ2D 2IZZA 2RAPA 2ST1A 3HU3A 4RCVA 2EDCA 1PS8A 3C6BA 4QLOA 1AUVA 4I5GA 4Y2PA 5JS6A 3OZBA 3GEGA 1VP9A 3H0CA 5GV8A 4R1MA 2IZ5A 1LQ2A 2WM9B 2JW5A 1PBNA 3D8HA 3NFRA 1BW9A 1DG9A 1ZIOA 2XE4A 4B40A 2Y6UA 4BO8A 4ESHA 1ZESA 2M1XA 3D5TA 4QU9A 1GFZA 2XMQA 2OEPA 4C7JA 2CE7A 3NV7A 4ZPJA 2YICA 3CRZA 1OFIA 3OF3A 3DULA 1JIVA 4C3VA 4Q1DA 1EP1B 1IDN1 2QS9A 3U0VA 1LX6A 3DFFA 3WGMA 1GKLA 2Q2OA 5IKXA 2W4MA 2R4TA 4NU6A 1I6MA 4JI6B 4AROA 3HB0A 2A92A 1W2GA 3QSGA 2F62A 3WGJA 4ZYXA 3OICA 2HYDA 1VSTA 2EZTA 5F1YA 1JMYA 3TL2A 3WB9A 4QTYA 4ZMSA 5LLDA 2VNKA 1T5OA 1THZA 3KXKA 1J2JA 1R0WA 4AUEA 4Q39A 1PT7A 1XDZA 2D8AA 3QVGB 4RF2A 3KVVA 3TSWA 3BGVA 4P84A 1B4DA 1GKUB 1PN3A 4G1FA 1QDEA 4PY2A 2AIRA 1PG0A 1UJ5A 2FZCA 4W7IA 4E6EA 4NPHA 2XECA 5AK4A 3UCFA 2RMKA 3W1EA 13PKA 3AF0A 3KPVA 3R0JA 4WNIA 3SZRA 4W6ZA 4XJSA 5L51A 2GRJA 5K0LA 5JQGA 1UKCA 2ETVA 1R0YA 2AF3C 1KO8A 3G2KA 5K0NA 2IOFK 4RY0A 3STHA 1GZ5A 3AUFA 1P1FA 4HUJA 1D2AA 3I04A 5L3VA 3OIVA 1G8MA 4L0MA 1NVAA 3W90A 1Z8DA 4F4IA 2DBVO 4R8KA 1MG0A 1MAAA 2Y27A 2IVZA 4B32A 3WQSB 2V7QA 2WU0A 1PYOA 2ZQ5A 1P60A 1R5NA 3KJIA 3DKIA 1YZFA 4PZPA 3ASVA 2OZVA 3A3OA 3EEYA 5JDIA 2BZ1A 4XQCA 4NP6A 4F5WA 3BPSA 4KNWA 2XNHA 1Q84A 1IB0A 4MVJP 1C1HA 1KHTA 3C3MA 5FJIA 4JVLA 4GSLA 3V8PA 1TX4B 5EA2A 2B1JA 3O4GA 2HB6A 2BSXA 1Y5LA 3TR0A 2Y67A 5E9JA 4IJQA 3A6DA 5G53C 1RKVA 1EFPB 3TBHA 3SHTA 3IS3A 3EVNA 3C16C 1GVHA 4DUZB 3WSVA 2QAGA 1GTJ1 1N8SA 1XQWA 1OJLA 3IE0A 5CYGA 2CHEA 4P92A 1HYHA 4DAEA 4JIGA 1HE4A 3WLLA 1CNFA 3FSGD 3D6VA 1DTWA 3P0EA 2HF7A 3GA0A 3TX2A 4BJHB 5DPMA 1NZFA 5CBPA 4KCGA 1CQJA 2QMUA 4GMFA 4V0NA 4XYMA 4F4HA 4IG9A 1C7RA 4N5MA 3I1FA 2TMKA 1AUPA 2WRZA 3I12A 4MUBA 2HWKA 5LIPA 3BIFA 1IOWA 1FBNA 1JSXA 1U3FA 1PS0A 3PL5A 1XWIA 4JCOA 1KMMA 4LRTB 2RGNA 4A8TA 3VPAA 4G0OA 5BV7A 2VPWA 1O0BA 2IHBA 5JAQA 3OX3A 4X90A 2KQUA 5ABPA 4CFZA 5CXUA 2VSQA 1W46A 3P19A 3NWOA 2QUAA 3AU9A 4G0YA 3WGKA 3TQCA 4YASA 2Q29A 3VPBA 4EDFA 5JAPA 1ZISA 1CEYA 4O2LA 2X22A 1ONOA 1W93A 4YCBA 4Z3KA 1KKUA 3FF4A 1BD3A 1OVGA 4I2NA 2WJWA 4OAQA 2B3TA 1Y3AA 2GCPA 1RLUA 2IYRA 2PDAA 4NCIA 4EFKA 5BMOA 2J4DA 2IEDA 3MOIA 4RK6A 5HCIA 2BKLA 3UK6A 5KDOA 1FXSA 2ROQA 4LYEA 2IQ5A 1CTQA 4OHBA 3RS4A 3SS9X 1LVGA 1WZCA 2JFBA 1OT3A 1QKIA 4X0EA 2P9ZA 2NZJA 3RSGA 1F0PA 1TZBA 3DTVD 5JC1A 2IS1A 1FF9A 2C9DA 4GI3A 4YJ2F 2XGOA 5LIRA 4J4TA 2OBMA 1GFWA 4XWTA 1ZHHA 3JRXA 5FWNA 2WKRA 2BGIA 1B00A 2PWBA 4FLFA 4RUKA 1WDMA 1YRQA 4H7JA 4LJRA 3AR4A 3OY7A 3FIUA 5L3ZA 1PTJA 3QWIA 1GZSA 1J70A 2B4AA 2ZU0C 2P9GA 3AK4A 3K1AB 3X2EA 4ZYZA 4M9XA 3UWOA 1W1IA 2VKQA 3VC2A 3F8WA 4H08A 1AS2A 2HF8A 1D2HA 4Y30A 3S55A 3U7EB 3WL6A 3ZY5A 5HUQA 1JLLB 2PIDA 3N2ZB 3RYFB 2D0PB 4Y1FA 1RS0A 1ZCBA 3OSZA 2XWQA 2CLSA 3PJGA 1LDNA 4PLFA 1Y9ZA 2PSHA 4Y0AA 3L7NA 2MSNA 1R8QA 3CC8A 2FR8C 1CF2O 2W71A 2WOJA 3BM5A 3E7XA 3OZAA 4I1YA 4E70A 2AZDA 1V1JA 3KJZA 4MPTA 4WGGA 5PNTA 4G5YA 3W2EA 1TD1A 4MXDA 4KWEA 5CK5A 3SYNA 4EB0A 1JLLA 4PO1A 1C7ZA 3AF3A 1AN9A 2O7NA 3GEHA 4YEDA 3RFFA 1B42A 5D1HA 2JFYA 1VLZA 2YWDA 2P30A 1TUBB 2JHPA 2PS9A 3FGZA 1SG6A 1IQ0A 2JL1A 2FPLA 1DC6A 2A9PA 1W1UA 3EB9A 4L9AA 3R7NA 5LYYA 1YR7A 2HF2A 3O95A 4OQZA 5KJ6A 3ANMA 2NU9A 3C1TA 3TAUA 4INAA 4WESB 3JWJA 1XWFA 3KJHA 4GWLA 2WWVD 4A1FA 1C9NA 2XIQA 4E2FA 4Q7QA 1BMFA 4J1TA 4BZPA 2JH9A 1BVUA 1AQUA 2ODPA 4CTOA 2IYXA 4OL9A 3KJXA 2R7KA 3KWJA 4CVNA 2Z1MA 2GJ4A 1U6KA 4H6PA 3TQOA 5AQ1A 3IRVA 1RTKA 2EFHB 2RC6A 4Y1RB 1SC4A 4BX0A 1QGDA 3VR4H 3LHIA 2H5JA 3OLWA 1FCJA 1CR2A 1HT3A 1UK7A 4YJFB 1Y4AE 1R18A 5B58T 3VSEA 2FQWA 3C7DB 4WADA 1U9JA 2WD9A 4B76A 2PZ8A 4IGIA 4EL5A 1IU9A 1NR5A 1U8XX 2RONA 1M2JA 1TYBE 3K6KA 4L75A 3ZE7A 5M04A 3TW0A 4ZYUA 2JHCA 4CW7A 1JFTA 2A5GA 5DTJA 4HD8A 4AO6A 3RT7A 3HABA 1YS7A 4BTVA 1VHQA 2JGMA 1M3SA 4Q9HA 1WUTA 2PKYX 3FFBA 3H9GA 1C41A 1RDFA 4NZOA 4QBFA 4BBZA 1RT9A 2C2OA 1JVSA 2VDVE 2YBDA 3ZWBA 1XUOA 4GW3A 4C7OB 4GKVA 1ZUHA 1I80A 4KACA 4C3ZA 5FO1A 4URHA 2AK3A 3VBCA 2YY6A 3DS8A 3TJRA 4AMUA 4XX1A 4EJ0A 3U60B 4D44A 1CJCA 1C3XA 3LUPA 4QGAA 1CUXA 1ENOA 1W85B 3AYXB 3GVXA 1IEXA 2EFEB 4BMZA 1QTRA 3H9EO 3WRXC 2VYVA 4D9KA 1QYIA 2AWOA 2IPXA 3HTXA 4UTNA 5TQVA 5KYYA 2GN8A 2GSWA 3KSUA 5JSYA 2C99A 4D5GA 1F7VA 1WY7A 2VT3A 1Q22A 3HUFA 1TIPA 1TLLA 3CRRA 1Y6GA 3TH5A 3KR0A 4IIEA 2G0TA 1GNVA 1RP7A 5LDGA 3PENA 1PP4A 1EHCA 3OLZA 1ZGHA 4MYRA 4QBHA 2WTUA 3OKAA 2BBOA 3IERA 3ZHYA 2I4NA 4YCMA 1W85A 2JCGA 2HRBA 2ZLBA 1ZYUA 3PUHA 4TRMA 5D8DA 2IYUA 4FFBB 3SDBA 1R4ZA 4TXMA 5ESRA 3AHJA 2P68A 2Q0QA 3MUOA 3RSHA 3B1WA 4KIWA 3O8NA 2C2GA 5IULC 1WP9A 1T2EA 1E5QA 1M7HA 3FWPA 3WYDA 5AW8A 3A25A 3GRVA 4FFOA 1JPNA 4DLKA 4AJLA 3HJAA 4JJZA 2VBCA 3RS5A 3FCEA 4BBAA 4D98A 4UXIA 3GGJA 5B1SA 4YIHA 2FX5A 2DPMA 4DXHA 4IZHA 4FFBA 5GZ1A 1BDHA 1EDZA 3CGWA 1XPJA 3NFYA 3NT5A 3EXFA 3R7WA 3ZQKA 4I1OA 1BAPA 3UA4A 4PPNA 1NW8A 1UKBA 2FMIA 3NBAA 2QN3A 4GOLD 3R9KA 2QT1A 3P9CA 1DKNA 4BDSA 3V6MA 3GVIA 1OXTA 1T3TA 1PV1A 3FMFA 1KDYA 6AT1A 4AS1A 1IN6A 4MDFA 1XKLA 2FUG6 5FEMA 4N0QA 3IXLA 3NATA 1BWRA 1RCTE 2XKKA 3LD9A 3DM9B 4OHRA 4AFNA 4JLDA 3ANSA 4M0EA 3HJFA 2GZ3A 3DONA 3N8GA 1G8KA 4BNYA 5EJ6A 1EUDB 4XA8A 4DSTA 4KC0A 1XP5A 3ICWA 1QIMA 4FX5A 4R69A 4XUGB 5I7VA 1A2KC 1T2DA 3GGSA 2IX3A 2RGBA 3RC1A 2I2CA 5KREA 1WXHA 4QNNA 4R71A 5BYJA 1C3OB 3LWDA 1Z2EA 1VGQA 4KE6A 2XT6A 3O6VA 2GAOA 3SZLA 1SQ6A 1QZ3A 3ZYZA 1Z4QA 1OW3B 2BGLA 2ZBPA 3ES9A 2AC7A 1EUDA 2I87A 1K9VF 4EG3A 1XCJA 3QWBA 4L02A 621PA 2ODQA 3LZ6A 2ISCA 1Z15A 1NQUA 3PGVA 1Q7RA 5H0IA 4B71A 3ZEAA 2PSDA 4R9NA 3V97A 1A72A 3AETA 2GLTA 3JQQA 1F06A 2QBYB 1VLLA 2OAGA 5U4XA 3AY0A 3PJEA 5DCUA 2AN3A 4W5WA 2ZDGA 1Q17A 1W88B 4R51A 5EKDA 5HIMA 3L5OA 5IKOA 3TKLA 2V7GA 3VHXA 2O2IA 3O3NB 2BZGA 3UPUA 1XCBA 1GLNA 2QVYX 3U3JA 1X19A 1SPXA 2AQKA 4ENQA 1D1SA 1CVIA 3HWRA 4LJSA 3X2SA 3SQOA 1GHTA 3EWNA 5CNJA 1G3UA 4OY3A 2AOWA 1B41A 1XAIA 1U7HA 4RQTA 1RAIA 3ZLVA 4QDZA 3NQ41 2QBYA 3OE5A 4HK4A 4DE5A 4ZWNA 1UBRS 1QHNA 4KWCA 1EFDN 1FY2A 3DTVB 3PQ6A 2O6HA 4GLOA 5IHPA 1JUDA 1KJQA 1RP1A 3QUBA 4UHEA 4C4RA 1TF7A 3ROQA 3ZKWA 3MCZA 1AH2A 4P3KA 1SXHA 1GPNA 3ESZA 3C98A 4G4GA 3AHHA 4GOXA 1E7YA 5LQJA 3KRTA 2PNJA 1DAPA 4MLZA 2G9QA 2ATCA 2C7VA 4JLBA 1Y1QA 3BFJA 3IQFA 3RC2A 5C34B 2FR1A 3RKUA 5KU7A 2PUFA 1Z75A 2Y1XA 4JT9A 1KYIA 1EIWA 2VTDA 4UBOA 3QG1A 3B5EA 4FBGA 1QHXA 1Y9DA 2HNBA 4KW7A 1MLDA 3SZUA 5KQRA 4OLBA 3SJUA 2Q6LA 4DMGA 3HXMA 1DKPA 1FFGA 3ZE1B 2C96A 1ZHFA 4H4EA 1N7GA 3E9DA 3NPAA 4LE2A 2GF2A 3H6KA 4JGIA 2OO3A 2DLDA 4OHCA 3JQPA 5IBQA 3VJLA 2MSDB 5HMMA 3FCYA 3WC4A 5E6UA 3AB3A 3R9XA 2AUTA 3HK2A 1ZUNB 5BQFA 1SUPA 3FDZA 3C6MA 1CUIA 5CM2Z 1CS0A 1DAEA 1L8XA 2XMRA 3KQOA 2VUTA 2DWPA 3HN2A 4C05A 4C0XA 1ZONA 2GAAA 1KEUA 3AF4A 3QITA 2B4YA 4RS4A 1Z2NX 3H42B 2EW1A 4U7DA 3TMKA 2DY1A 3IPAA 3LVFO 4UHDA 1PSZA 1LJUA 2XB8A 3L6OO 5F9MA 2C0PA 4G1VA 4BJ3A 2Q5FA 1RVV1 5FPHA 5DX8A 5EIOA 4JYAB 1DUSA 4KO1S 1U2QA 1A8UA 2GRUA 3DM5A 4ZQHA 3X1MA 3OM8A 3E1KA 2PJRA 4L15A 3UK2A 1NW4A 1NQAO 4BJ1A 3RPEA 2IELA 1U0RA 3SBEA 1EJ0A 4OQLA 3BULA 4E4RA 1DQRA 4P33A 2AJDA 2ZE6A 1USKA 5FFFA 2CMKA 2FR8A 1HGXA 5TGDA 3ZY4A 4B6FA 4B85A 1BHSA 1NKSA 1ODKA 4ND6A 3JQ8B 1CUHA 4KQ6A 4BXOB 3F4LA 1B7GO 3EFEA 3I64A 3PJDA 3TNDA 1IFXA 5AK5A 5J47A 1NVKA 1Z4PX 2WUGA 4PLVA 1E69A 5EERA 1A5SB 3V1TC 2PZLA 1U9CA 3HCEA 2UVQA 3NDRA 2VF4X 3O7WA 5DTRA 2QM7A 4OBXA 3SEZA 3K2IA 3OE7D 5EZYA 4J16A 4NIMA 3B1JA 5DGCA 2Q7DA 2J5QA 4O4HF 2E85A 5TGZA 3TOZA 1O03A 4RESA 2H5EA 1XN4A 3ITNA 5SY4A 3M33A 3SC2A 2I8LA 4B4VA 1YFLA 1LFAA 2F1RA 5CB4A 1XXHE 5I48A 3NC1C 1D0IA 2VAVA 4EI7A 4O6VA 4CG2A 4WFIA 2LBPA 2YJ4A 1PE0A 3SAJA 5LWQA 4Y7CA 1AUQA 3TAHA 3LUBA 1QFSA 2F9MA 1S5PA 1ZMTA 1PCXA 3AL0C 4HPXB 4DLVA 1TTTA 3EISA 4HMQA 1EB8A 4BJ6A 2KHZA 2YV4A 1Z2CA 1SURA 1PDWA 2AMJA 1VBMA 3H11A 1CUDA 2E37A 3R9IA 2QTZA 2GERA 3NGMA 5B1HA 4R0MA 2I3ZA 2R68A 1VL8A 1L1RA 1A27A 1X8XA 3R5FA 3T4PA 3V8EA 4IDAA 3BMNB 2P69A 3SZGA 1JTEA 4K0RA 4N0PA 2RKBA 1O89A 2ZT8A 3QI7A 1CW2B 1V5GA 3C3WA 5I7WA 1YR2A 2IZOA 1UPUA 3JVDA 1N9GA 1TCBA 2RG1A 3R0XA 5FPYA 2GEUA 3QIAA 3IA2A 3K6SA 1U1DA 2AG8A 2XBLA 4TWIA 5H68A 5JEDA 3PR1A 1SXPA 2XB2A 1ZL0A 3O4HA 1YZTA 1F5SA 1QCZA 4KXLA 5A4DA 3SHFA 1DT5A 3GU3A 2CN1A 3AM3A 4EQ6B 5I51A 1OU4A 3QEMA 4TS9A 3WBKA 3CH7A 3W5AA 2X0NA 1D5WA 3N8KA 2FXIA 1I4OA 5ALJA 3M89A 1MPTA 4I4IA 4QM7A 3IP5A 3WRXA 4NDNE 1Z7YA 4ETMA 4AXBA 1M8GA 3GEDA 5J2TF 3AQ4A 1E2NA 5EI5A 4HFJA 1ZH4A 2GHIA 2W6ID 2G5TA 4C08A 4IIGA 4F04A 5LPNA 2I22A 4LF9B 4YMLA 4OYRA 3BXEA 2JLBA 4RNDB 2UU9B 1C0IA 1J25A 4MCAA 1IVNA 2AD5A 2YIMA 1WY5A 1F8UA 4FWIB 1Y3BE 1DO2A 1UBKS 2K87A 3HCPA 3WKBA 1D1PA 4ZYLA 4R1PA 1UF9A 3OIYA 3K0AA 3UJHA 1X92A 1C9YA 2CZGA 4GP7A 5EIAA 1UPTA 1YS4A 2QN1A 4HFRA 4YVFA 3JYNA 3P9YA 1Z8FA 1Z17A 2ZRPA 3BMXA 1B8VA 1JJFA 1KZGB 1Q1NA 4LOAA 4LXIA 2QTNA 2VL7A 3KSMA 1RJFA 1Z7GA 3RHZA 3RRZA 5FWYA 5KBYA 3CVVA 1ACLA 1ETUA 4PAOA 1WZEA 1M1NA 3PUWA 2O3QA 2WAXA 4FW8A 1E4EB 1JG1A 1SJ9A 3QVJA 4KV9A 4YRPA 2R8YA 4NSNA 4PYIA 2JGRA 3BWVA 4KR7A 2G06A 2OGTA 4WXHA 3LQYA 4G0QA 1CVRA 4XGQA 1UKAA 4KMOA 3AEKA 4YCNA 1I7PA 3B8HA 4YV0A 2GZSA 2FPSA 5A0VA 3EAGA 2CNDA 1YS2X 4OSPA 5CA1B 1U2GA 4GMGA 4KHZA 3U4QB 1O94A 2BMEA 4MRMA 4FD2A 1QAMA 3RSQA 1T9HA 3TLMA 1NVTA 2ZCUA 1H5QA 2F8TA 1VSQA 2ALJA 3CYFA 5CT4A 4D26A 1C9EA 3N0WA 3UC5A 1VE5A 2HLNA 2WTBA 4FHCA 4H7DA 1EWQA 2GUWA 3AVWA 4I4NA 4B31A 2Q8PA 2V5AA 4K6FA 1RHUA 3HUDA 3TLXA 1HDEA 2JGDA 1Q19A 2Z83A 3OPVA 3VTFA 2W83A 3BZUA 1YR1A 1Z7BA 2G9ZA 2WABA 3KPYA 4YS6A 3WVNA 3ILXA 2B1IA 1HDCA 1KOFA 3TRJA 3NVKI 3NTQA 1E89A 1BH2A 3FJ1A 4KE8A 1F4LA 4C9BA 4D7AA 4E5SA 1GNLA 2CXHA 2V7XA 4R2KA 1S8FA 4WZBE 5BR7A 4QDTA 3N87A 2ZIUB 2Z8XA 2VRNA 1V6AA 5F64A 1YOVB 3PV0A 4YUAA 1N5JA 3B6EA 1LPOA 5ITWA 3AI3A 1GGFA 1NURA 4FFMA 4INPA 5K20A 3RJZA 4UEKA 4E2XA 3IILA 4RZUA 3E27A 4BNKA 4P35A 1OI4A 3JASA 2EARA 4G0MA 2E5FA 4HVAA 1FQWA 4JBHA 5K4AA 4EB8A 2AZTA 4RS3A 1G7SA 1ZVMA 1JL3A 4NBUA 5FHRA 2GK4A 5BNZA 1JEYB 2OCLA 3DZDA 1BA3A 4ZEOA 1W0KA 2ZTUA 4P5PA 1ORHA 1CUAA 4NBSA 2HF9A 4BC1A 5AI9A 1QU2A 2JJ8A 3HY4A 3NBYC 1ZKDA 4LRUA 5JTUA 2QTGA 2WTAA 5BV0A 2VK8A 1O9GA 1I36A 1JT2A 1H4VB 1DIBA 1L7RA 1LUAA 1S96A 2N1MA 4B3XA 1YUBA 3R7DA 3O38A 3IJPA 2RJNA 4OQ4A 2K2WA 1I4LD 1H5NA 4WCFB 2OESA 4RAOA 4RH3A 4OHXA 1E4VA 3I6YA 1R3UA 4EKDA 4KO8A 1EK2A 1Y3HA 3FCAA 4IAOA 1PFUA 4RGQA 1DAMA 1XTIA 3I4LA 3KQKA 3M49A 5BNTA 3ORRA 3RYIA 3FMIA 5DNCA 2XDAA 2G17A 4WLVA 4K9MA 1W49A 5I8ZA 3E3OA 3Q6MA 5DM2A 1ICEA 3BJRA 4MGKR 3RFTA 2W37A 4BMVA 1A71A 3MBKA 3QPAA 4B3HA 5K4HA 3GGPA 2IEYA 1KFBB 1RYZA 2IT1A 5E0OA 2PH1A 5ALGA 2I7DA 2QTHA 3BFPA 5TS2A 3BMCA 4OKNA 4KVFA 1W48A 1AD2A 1HQYE 3IEXA 3R3ZA 4EB6B 5FRDA 3ZQ4A 1LBSA 2GN2A 5J40A 5KSYA 4KOAA 1XRJA 2ZRHA 1MU0A 4PSAA 1N3YA 4MGEA 4TTPA 2J67A 4IQ0A 1ZC4A 3DDCA 3BCUA 5BQOA 2HIHA 3LW7A 1BCRB 5EY5B 1ODCA 1MVNA 2DSNA 4EENA 3FLEA 3VOSA 1COWD 1V9SA 2C2BA 3L05A 3RUCA 2VP0A 4ALIA 4CCAA 1LRLA 1XTSA 3UAGA 5JZMA 3HP7A 1KYQA 2Y71A 5IF3A 2CC2A 2IU3A 3TQSA 1QG2A 1UWVA 1MEEA 2A14A 1QTNA 4PRYA 3CN7A 2ZVDA 4OQMA 1E32A 2JIZD 3PPVA 4M86A 1OHHD 4CEHB 5DIFA 3IOMA 1QVWA 1CX9B 2LWIA 3GLIB 4WVFA 4Y98A 2R79A 3AR3A 4KQMA 3FSEA 3NVDA 3C8ZA 3GP5A 4PQRA 4DG5A 4EMBA 1QORA 3RC9A 1QYXA 3HVUA 5C51B 3JZMA 4KRYA 3ELWA 4BVFA 1ZJ6A 1MXHA 1I3NA 1DJMA 1RRPA 1B1CA 4GLBA 4JYCA 4TUYB 4CMEA 4JP1A 3L4EA 1AT1A 4UAGA 3WB1A 2XE8A 4ZI2A 2JF0A 3BIWA 4BO1A 2XITA 3WE7A 4OM7A 2AOTB 4L5CA 1UZUA 1OA1A 2ZI3A 4B44A 2OUIA 1X3LA 1OGIA 3ND6A 4OGFA 2VA9A 4R98A 1XRMA 4WWHA 4D74A 1S2GA 1L3IA 4IEEA 4A0QA 4CTNA 4J7CA 2E87A 4NMWA 2ZROA 1C7JA 1X9HA 2FAXA 3Q7TA 4TUYA 5EPOA 3FGOA 1N8KA 2VF2A 1O0SA 2AXEA 5CVJA 1N2EA 5AICA 1ZSVA 1I4DD 2VDNB 1EKXA 2JBAB 2WFLA 2J9XB 1KERA 1Z22A 1Z5ZA 3QXHA 3AM1A 3JR7A 1VJ5A 4H31A 1A7AA 3LF2A 2E2WA 5TMPA 2G5CA 3TLKA 2FMFA 1Z13A 5JBQA 2C95A 1KPGA 5LVAA 4NV3A 1ZH6A 3SY8A 3IR7A 2GOYA 4HAIA 1Q1QA 4UHJA 5FXMA 4IMJB 4WKNA 3QPCA 3UENA 2OK8A 4HRVA 5CT5A 2Q6TA 1BX1A 3EF1A 4V0ME 3CJQA 1IBKB 4Z99A 4BN4A 3E4DA 2I1WA 4Y2XA 1J8DA 4EHBA 3D6UA 2OGSA 1PT8A 1T6NA 2JZCA 3BE5A 4J9VA 3L2OB 5FA5A 1NBME 4R01A 1RJGA 2YXEA 3SE0A 1DBQA 1TQ8A 4FCCA 1VCOA 4ICIA 1GFSA 1XZAA 3BDIA 4MHOA 4ZAXA 3UAYA 3VPSA 5KTSA 1D2EA 4TQUS 5HKKA 5L7WA 3O8OB 3THOA 1JU4A 1K2VN 3HKDB 4RYLA 1GSOA 3RVOA 3PUKA 1WSWA 3RSSA 4F56A 1NUPA 1KIAA 1KS2A 2X5NA 1AE1A 2QQ5A 3R23A 2W2NA 1XK7A 4Q3NA 5I3ZA 4HN4B 2QQGA 2PKEA 4QD3A 5IZ4A 2HDOA 2IE0A 1O97C 3T1NA 3PPYA 4G4SP 4AJJA 4ETNA 5AESA 3W0LB 3BH7A 3H7AA 2AVDA 3C85A 3NG1A 1FU8A 5ALDA 3EW9A 2DETA 4OGLA 4HO1X 2QZJA 3P9NA 4TRNA 3OFKA 2BJHA 3QM1A 3GEEA 1XEWY 4LF4B 4KR6A 1E61A 3RSOA 3HVRA 3VXKA 1FRFS 5CMLA 5K8TA 3NKFA 1S6YA 4GEGA 3E3LA 3Q8KA 1MPXA 1UMCA 2H0AA 4X95A 4GE0A 4BQQA 1Y5RA 3GPBA 3KDSE 4JT4A 2FPXA 1CUZA 3B82A 3PC8A 3I5AA 5IS2A 4LJ9A 2JJ1A 3L0YA 4MP6A 4XB6B 3RSCA 3X1XA 4JITA 3RC7A 2J08A 5AI8A 1FOEB 1IJFA 2QRZA 4KVGA 5EIEA 1N6LA 1PR5A 4PSDA 5AO9A 2QVBA 3UJAA 4G9BA 2WLSA 2DBZA 1W52X 3REQA 1L7QA 3DBVO 1IZ0A 3UFXA 1BTOA 4R3NA 4XTCS 2J5XA 3QFCA 3O1LA 4D6XA 3ZDZB 4LZAA 1GUYA 1KH1A 4E22A 1OIXA 4AIRA 1GGMA 4G24A 5KOYA 1L5FA 2BSAA 1G2QA 3I5YA 2XGJA 3EC2A 3ZV3A 3S7TA 5IWAB 5GPBA 4HNGA 3DG9A 3JZAA 3M1IA 4TKVB 3RRJA 3ONVA 1PK9A 7MDHA 3U1BA 3IAS1 4BO2A 1MA3A 1V37A 4FOOA 1GZ7A 4FWTA 2WBLC 3TDKA 2CJPA 4ZTUB 4ROSA 5KI6A 3ZVMA 2OUKA 3I9JA 1FMTA 4JEIA 1BMDA 1Y34E 4F3KA 4YYZA 1EWKA 4HWTA 3LVBA 5DIZA 1Z82A 2HRRA 1ZWLA 5FWAA 4DC0A 4JL5A 3HLTA 2ZAIA 1UBOS 3QELB 2ZS8A 1PGPA 4W8OA 1RWVA 3ON5A 2EW2A 4NE2A 5U1PA 5KYTA 1C4WA 2L82A 3SU8A 3TM4A 5AR1A 1TMOA 1MX1A 3EUAA 3RIEA 2JB9A 2NVOA 1UP6A 3NI2A 4D42A 2GESA 1C50A 3AG5A 3I58A 1B93A 4PAMA 1TAGA 3NMUF 3KQQA 2I7CA 2JK0A 2XVZA 2P4QA 3L5KA 4XB1A 3ADCA 1Z3CA 4MQEB 3ER8A 4F97A 2YIVX 3T1TA 3T1QA 5CJJA 4URWR 2GF0A 1G55A 2HDNB 3WLNA 4GVLA 2GZMA 2PGDA 5DXJA 4KR9A 1RKBA 3ZGOA 1PV4A 3G0CA 5EP3A 3TCXB 3WLSA 2R6R1 4MYCA 3ZXSA 1GL6A 4L8WB 1SC3A 3IQEA 2JRLA 3QE9Y 2PEZA 2JC3A 3MUNA 2C88A 1MT0A 4DV4B 1JSRA 4YT8A 1GKKA 3PKIA 5FT9A 1GAEO 2SCUA 3A4MA 4OUDA 1NDUA 4U0KA 4ZJZA 1MH1A 2GJSA 1KR5A 2PX6A 4MZDA 4RSGA 2UZAA 5JVDA 4L7VA 3SMVA 1XAHA 3WQBA 3GP8A 4OU5A 3T61A 1UJCA 1RZVA 2PZKA 2PRJA 2WFMA 3C70A 4S2EA 3AHEA 2Q7OE 3WYNA 4CMIB 5C1DA 1E0KA 1IZ9A 3DKRA 4IGKA 2WZQA 5JSUA 1I5EA 2GJ9A 3QBDA 2MYNA 2QVCA 3SF0A 2YJ5A 5K6AC 2BBTA 3EZNA 2V9PA 5HF6A 3I9FA 5G2OA 3S8YA 2W2OA 1GLVA 2KSQA 2P67A 3PGXA 1OFUA 4PZDA 4ZDWA 3RWBA 3ZIUA 4R9RA 5TY0A 4BZWA 1VPEA 5DLYA 4FMCF 3F46A 4GG1A 1M6NA 4DQUA 1JXMA 3H1GA 3RREA 4Q4HB 3ZZ0A 2R3SA 4KQXA 4R1UA 5TQ0A 3CF0A 1NIJA 4TMZA 3ZQUA 4EL0A 4JI2B 1FU4A 3GVPA 3K0SA 5CH8A 3HJUA 3OU7A 4LWQA 3WO1A 4C0KA 2GKGA 2WF9A 3RNLA 4BMOB 4CV0A 3EZ7A 3FKJA 1R10A 4JOCA 1AK1A 4KYIB 1EFRD 1MABA 1W581 4OFWA 1V1MA 5B3JC 1SB9A 3GRCA 1B6SA 1SCBA 2JGEA 2IBMA 4L0DA 3B7PA 1TLFA 1QRAA 3HCRA 1U4OA 2I5PO 1N6KA 4YMIA 3VA7A 5LMNB 1FNCA 1SCJA 4OIMA 3VVBA 3GG2A 3G0BA 3NVMB 1L3CA 3K4HA 4CMJA 2E49A 2WAAA 4UVDA 4W8HA 4F96A 1IY8A 4XSGA 3Q40A 2UZ1A 1RXIA 3BE8A 4FQ5A 3KUUA 1K75A 1Z08A 2HDWA 2X42A 4MUXA 4FGWA 3AYZB 1PX0A 2P1RA 9LDTA 2XTJA 1FVHA 1P3Y1 3PLNA 2C4NA 1L4YA 1QFZA 1XQVA 4HNTA 4P0QB 1Q50A 1F2TB 1ZRSA 3VR4D 5GONA 1I1OA 2D2EA 1XXHA 3LTEA 4RVFA 3VYRB 1RJ9B 1E0SA 3HCAA 4LX8A 3P9KA 1Z33A 3CISA 3RUHA 3PXXA 1PR1A 3UB3A 3ECCA 3UXYA 3WLTA 2JFPA 4FEEA 1JFSA 1JU9A 2ZJ7A 1LBEA 3GK3A 3ISVA 3IKTA 5DCWA 1G98A 1NYRA 2GN4A 4BB9A 5DLQC 2C7OA 2ZT6A 5BOVA 2H1VA 4M88A 2ZSAA 3GFGA 3QKWA 2EGGA 3HP4A 5FUQA 3HPQA 4YREA 5BRNA 4HDQB 1DBPA 2PYIA 4F6RB 4FLEA 3D0KA 1ILWA 4M3NA 2AFRA 4M0FA 3WR5A 1VG0B 1DAIA 4JR1A 2RARA 1OWMA 2J3QA 5FOTA 3TNLA 1EFCA 4EUHA 3JTEA 4FYWA 4JI5B 3RUFA 5AIBA 1D6SA 3Q87B 1EWVA 2HNAA 4II7A 4ONEA 4TYYA 4KUGA 1GNRA 2JI6A 3KOWA 2ZANA 1PGJA 2V5VA 2ZRFA 3RQSA 3ANNA 5HUHA 2C54A 1NZJA 3FTNA 5ERXA 3VJMA 3TR6A 1RFGE 3KSAC 4DFDA 2PUEA 2AJBA 1PLJA 2MYTA 4TMVA 3AFOA 4LXUA 1QBGA 4R2IA 2B5VA 4ZI7F 5LBTA 4UPEA 1KU6A 5KDLA 4PR0A 4ZVRA 2WP8J 1A0OA 1E1NA 3KHSA 2HMAA 2V7TA 4K9DA 1Z45A 4RC9A 2BBSA 4GZ3A 2QN2A 4NJOA 2I99A 1VI2A 5GP1A 1OI3A 1N9KA 1ORIA 2O8EA 4KBFA 2DEUA 3W8NA 1NLFA 1NLUA 3I9V6 4BLVA 3FPBA 1T6YA 3KLMX 1JG6A 2GJKA 1HQDA 1KYXA 1Z6AA 2FF5A 3LECA 1QFYA 1W29A 1OZHA 1RVDA 5BYKA 2CEKA 4WHMA 5KVVA 2FG7C 2PVSA 3AP2A 3DNMA 2CV0A 2KX7A 5BWBA 1YIAA 3ZU4A 1JAYA 4KTVE 1A9OA 1HNNA 4UUOA 2IKSA 3SJBA 1LRJA 3BGDA 3BJEA 1S3SA 5JQWA 1ZCAA 1AKWA 2JGKA 2R9VA 2ZI6A 3AUXA 4G4SO 1GNSA 2J3JA 4NHOA 3TL6A 4BMNA 4BVHA 3CPEA 3ZXYA 1TQ6A 3JQAD 3GDFA 4G8CA 4URZR 3UMJA 3X1YA 4BLSA 4D02A 4Q16A 4YP5A 2KWIA 4K88A 3T3PB 3UT0A 1XR3A 4DANA 3E05A 4LZNA 4REQB 3ECSA 1YL6A 1XVAA 5L8VA 2F1OA 4AZVA 4S0XA 4JYBA 2WWTA 4RLSA 1H05A 4L16A 521PA 4ZOLB 3RE1A 4RZ2A 3EYWA 4S1WA 3FWYA 1D4OA 2NZYA 1RLIA 4GIBA 4HDSA 3A4TA 5DB4A 1T1IA 4EARA 2QL9A 1K08A 4NMXB 4MQBA 4KSCA 2QYTA 5DKFA 3M5CA 1U1FA 1KAMA 4RGVA 5JZVA 5I9MA 2A3RA 3LG2A 5SYMA 1JR3E 1R2QA 1VLMA 4G8JA 4I4LA 1PR3A 4KQIA 4QWMA 5FBRB 2WF7A 1OWLA 4BFUA 1EE1A 1E99A 1P29A 3HU2A 3E58A 4ZOLA 2VH2A 5BWLA 3PDJA 4ZXPA 1FQJA 4CF4A 4IIVA 3QW2A 4EUNA 1HC7A 4N12A 2BEUA 2WT8A 4P54A 1T2NA 4DLLA 3ZHOA 4YRFA 3ZTWA 4EY6A 3BRSA 1Y3IA 1J20A 4Q01A 4LBWA 3ZI0A 2OOKA 4B3GA 1KIFA 2VAPA 2FUKA 2ZI5A 5REQA 1EM6A 3TTYA 4MICA 4U02A 1P9WA 2AN4A 1YRYE 4KAAA 2VEOA 4RTNA 1QTIA 3DMHA 4JGGA 1E6MA 2GARA 2PH7A 4DIEA 1DI0A 4WZBA 4C4YA 2VP9A 3N2IA 4UUNA 1T4CB 2XRMA 3A36A 4OJNA 1JYEA 3OE4A 4ZEWA 3T52A 1NVDA 2WNIA 3G9XA 3JAKB 5K1ZA 3P2IA 4DY4A 1ZK4A 5I7AA 1I6KA 3IDQA 3VDXA 4BAZA 5JD5A 4MYSA 3K5WA 1JDBB 2IGBA 1FSSA 1S3GA 5HUJA 2W48A 2EWWA 3N0TA 1HDYA 1QZTA 5CX1A 4CGZA 2AKEA 2Z6UA 3DLHA 2HC9A 2QVZX 4F91B 3RU2A 4C6TB 1RKXA 1D0SA 2BFCA 2ZDHA 1XD8A 3ROXA 3SX4A 3W2GA 3F6BX 2BF7A 4QG7A 5DJ5A 5BMVB 3TEJA 4Z1OA 1DZIA 2FXVA 1BKSB 1AF4A 2XMGA 1WV1A 1FK8A 3H9BA 4J0JA 4L5AA 1JYFA 1ZI6A 1PL7A 2F7SA 1AVTA 2HK9A 4GKBA 1DARA 5E4TA 1OF1A 5H80A 2X8AA 1JKJA 2NO0A 3GJ3A 3I0MA 2LTAA 5LA6B 3WP1B 4CMAA 1V8OA 2W2LD 3MA0A 4C6TA 2ORIA 4FYHA 5T5QA 5F1PA 4L6CA 1JIXA 2C61A 1KK1A 3NC4A 2C4HA 3ONNA 3EGOA 1L5HA 1R4MB 3EXHB 1KY4A 3L07A 2VJPA 3DPIA 3OQVA 4Q05A 5IAJA 1JKIA 1I6WA 2Q8QA 3QUSA 5FNVF 3I9NA 1LPAB 1QF9A 5AJWA 4ZARA 2I6SA 3FUCA 3EY4A 3U5TA 4MWEA 2DG2A 2IC5A 3NO4A 5LA6A 4MAAA 5EJFA 2VDRB 4WCDA 3RUAA 3FNHA 3D8NA 5D2CA 2OVFA 1W36D 4ZV7A 1WU7A 5JXWA 4OH1A 5C18A 3E3AA 5LMUB 2VHCA 2DFKB 3G5AA 1U7WA 5JNSA 4M0PA 1NN5A 1R4MA 1QH8B 1WSBA 1GT6A 2Q1UA 3DEFA 3FTEA 2WIAA 3VHQA 2FMHA 3GZJA 1Z5GA 4U7PB 4HNAB 3WLAA 4Q18A 2VCHA 4EGQA 2DH6A 3BIJA 3VKGA 1VCNA 3PUXA 3FR8A 3FVRA 2EFGA 3A3KA 2Q2VA 5DM4A 3RYCA 1QMPA 2UXCB 5ADVA 1RW4A 1SRRA 3PQ2A 4AULA 3QLVC 5H9VA 2WJIA 3P9XA 3B2EA 1G41A 5CNIA 3BHNA 4YGYA 5A9RA 1JQBA 1P7CA 2EU8A 2OHFA 3GJSA 3BAZA 3IXQA 3W6UA 1NHWA 4X41A 4ZV4A 1K0UA 1YDWA 3IH5A 4BWFB 4NHEA 4EMSA 1CQZA 3DUFB 4JLAA 2J8ZA 3KB2A 2C00A 4LE0A 2DR3A 2REQA 3X44A 8ADHA 3WSWA 1Y4DE 1OLOA 5E1OA 2YMLA 3MD9A 2HQ1A 1GXSB 2OILA 4DIOA 3EVZA 1KJ8A 1H2XA 4PONA 5CA1F 1PWZA 3LHDA 3BUSA 3RBVA 3HA2A 2WC1A 5P21A 1CR1A 1CBUA 3FTQA 5EJEA 2EZ4A 5H70A 3K35A 2CV2A 1ZN2A 1W0JA 5T57A 3NWEA 1C4OA 2VDWB 3D0QA 3KZ1E 2OT3B 4OKIA 3OLXA 3KBBA 1L5OA 2H1CA 4W5HA 4CG0A 3DSRA 4CLXA 4DDKA 2G09A 3VM6A 1VI5A 4Z3DA 3EIXA 1HQKA 1DO0A 5FUYA 5G0SA 4Y9RA 4XUCA 5HILA 1WSDA 3T41A 3GF4A 3DLAA 5HR5A 3NKLA 3CHYA 5ITVA 5K6TA 2GNAA 5AHRA 4A0FA 3QSYA 1XMPA 1GILA 3NW9A 1PUXA 3PQ7A 3ESBA 2J32A 3PNKA 5AJTA 3MWEB 2OV2A 1GQQA 3EARA 4NU8X 1KE2A 2VDWA 3UJ6A 2EC5A 4WI1A 2HHJA 4YRDA 4FFLA 3N2KA 3AHIA 5B58C 1CDDA 2BCGY 4DLBA 4ARZB 4CM4A 3LGXA 5HBRA 1YJBA 1NBEA 1NT4A 2ZB3A 2FFRA 4R81A 5GV7A 3ZY3A 5JSZB 2IBSA 3W5DA 2HXYA 2JAXA 3VO2A 1UM9B 3EN0A 3HCDA 4V0MA 1XLWA 3H0EA 3D8RA 2J5RA 1J7KA 4UU0A 2W58A 2WAMA 1C4KA 2BY4A 3NRBA 1GRRA 2HQBA 1V4VA 3S5JA 4RSHA 3UMVA 2PGJA 4HTFA 5AI5A 1U2RA 3VX3A 1VL0A 3DVAB 3IBGA 3THSA 2UVPB 2O59A 1B3BA 4ARZA 2JHAA 1VMEA 2E21A 1L4EA 1OZ0A 1CYEA 3ZHTA 1LQTA 3HXKA 4E30A 2PZMA 3NNNA 1MB9A 3VDMA 1RRGA 4OVKA 5BVGA 5JXJA 2G1UA 2WZCA 3FW1A 4KG7A 5FBWB 4QULA 3RU7A 2NZWA 1WMDA 2XSZD 2WM3A 3I28A 4MUNA 3SD7A 3RVSA 2FFQA 2ZWAA 3DVAA 4IFBA 1B6GA 1MFZA 3LQ2A 1J00A 2JCSA 3JQAB 4NATA 2HMUA 4M87A 1M73E 2QRHA 1S89A 3BB1A 3IO5A 2HSDA 2NO5A 3CG4A 3O8QB 1TQ4A 3CLTC 3A2KA 1DEKA 5AOCA 5KCMA 1T1EA 4QEZA 3OECA 2O5EA 4H27A 1KOJA 2IUYA 2NTVA 3V1MA 2O0MA 1RPJA 2AI2A 2PPVA 3OUUA 5TT0A 4CKCB 4M6WB 5IUKC 5AM0A 2G1AA 3ADPA 4B2LA 2ZATA 1ENZA 4G65A 4JU8A 4F5YA 1N6PA 1O4WA 3CZ5A 5MGNA 3EULA 4GT1A 1UAAA 1FX1A 5HQTA 3VGJA 3CH4B 2VRCA 1VI6A 3KZXA 3PGLA 4MK4A 1APBA 3AKYA 4QXMA 1VIYA 4ENRA 2VH5R 3MHPA 3DE4X 2Q46A 4MULA 2JEOA 1UXOA 3WMGA 4EKEA 1DL5A 2ZIVB 2CHQA 1WD5A 1IXRC 3EBPA 1GTMA 1YMUA 3L7YA 3NUZA 4U3JA 4BKMA 4ZHQB 1QE0A 3TFQA 1U7DA 4EW3A 2P2DA 4FGLA 3KQLA 3A1VA 4RPCA 1Y7LA 3C6YA 1MR3F 2TSYB 3FD8A 1P18A 3G82C 3LYLA 1JDPA 4MITA 3DE5X 1USGA 3F0TA 2VXOA 3JATA 2KPOA 2P11A 3PTZA 4TXLA 3W5VA 1IJBA 3L6CA 4QRDA 1SBTA 3I8XA 3F2VA 3B1FA 4RVCA 2YWBA 4K9NA 4YR9A 2VBFA 3O2SB 4UNNA 3JAWB 3V1YA 2PLAA 4YRSA 2NXCA 2ANCA 4EF5A 1N6IA 3K9QO 3PI6A 1DTSA 3LOPA 3VR3A 2W2VA 4IVNA 4PTZA 3ILHA 2XQGA 2QTVB 1X9IA 5KSPA 2A30A 3HADA 1NM5C 3JALB 1THTA 4HDKA 2XYHA 1XAJA 3KEGA 4HX5A 1Z4KA 1BDMA 1P17A 3ND7A 2VDLB 4G8BA 5DP1A 1PF7E 3WGGA 4ENPA 3AUYA 4PHTA 3B3QA 4DNPA 3AEXA 2DU8A 1V2HE 2G04A 3H84A 1QG6A 4J1SA 4RD4A 3KU1A 4X1YB 2ECPA 2QPLA 4W9RA 3OCWA 2E4UA 1KF0A 4PLTA 5E7IA 3KR2A 1RRMA 3N2GB 4BVJA 1L7NA 1KI6B 2I2AA 1P9NA 4HGOA 3F90A 3D0RA 3HFGA 4IV0A 4BU0A 4YUZA 3CFYA 1HV8A 3HJTA 1UC8A 5F1KA 3U1TA 3RK4A 2AR7A 2WLTA 3AGQA 1G2IA 2H4JA 3DB1A 1JFRA 3DLTA 3ADBA 1WDTA 3AR2A 1TC1A 4YJHA 1LGYA 1ZCFA 2D59A 2I6XA 4QBIA 3T5CA 2P40A 4PBTA 4ZQCB 2XUPA 1LA2A 2A0FA 1Z39A 4DARA 4RO0A 5BY2A 4K86A 1EJ2A 4IV8A 2NV0A 1UKZA 1L5MA 3OIFA 4KYTA 4PZCA 4C06A 3UMYA 5L6MB 1NDQA 1V26A 5GADl 3T1YB 4ZVOA 3QU2A 4C0LA 2CDNA 1ZJ5A 1IOLA 3IQDB 1ANKA 3KYDB 3LBFA 4KGXA 1UXJA 5LZ8A 4J90A 1EXDA 1PJQA 1XU9A 3MCAA 3WL4A 1XT6A 3RS3A 3CNQS 4ZT4A 2QP9X 1W36B 3H4VA 3HVKA 1WAMA 5JNTA 2A9JA 1Y9EA 4QYXA 1H9BA 3HM9A 3DV0B 1ZUIA 2GBLC 4I4TA 3X2FA 2C2HA 5IN4A 4ZP1A 3LLMA 3HBFA 1EHIA 3AC0A 2L42A 2SKDA 5CCDA 2H65A 1WF6A 3CF6R 1Z4NA 3JS5A 2BDUA 3U4AA 4YV7A 4IBOA 3KPWA 5I47A 3OTWA 2I7VA 5DYGA 1XJWA 5K2MA 1UWKA 4H7IA 2QRLA 3CS3A 4DNXA 1QHYA 2QW8A 5HJ7A 5KYXB 1DKOA 1QRSA 3PWSA 4QJ4A 1WWKA 2H4YA 3NBKA 3SYLA 3TXXA 1U8YA 3VR2D 4DM7A 3HYNA 1LJ8A 4N7MA 1OZGA 3UK0A 3WIUA 3ZDEA 5I9IA 3PXEA 5JWHA 3R5TA 1UWCA 3FDFA 3V1KA 2WHQA 3HB9A 1T15A 3UB4A 1M34E 2I4MA 1RYDA 4RXMA 1GPWB 5HRUA 4I1PA 4KBGA 2QL5A 3AUUA 3G8YA 4NTZA 3SSMA 1E3EA 4D6PA 4F1WA 1TQHA 4QO8A 3QKTA 4CDNA 2R66A 1JEAA 1JG4A 4FXPA 1Z2DA 5DRTA 3BZWA 1G38A 4DZRA 5JD4A 1VB5A 2ADFA 1XA0A 1DG1G 1GZ3A 4RFSB 4N41A 2PZBA 5AUQA 3DMPA 3VYVA 2BP7A 3PYMA 3C48A 4HAOA 3ZKAA 1R15A 3A4NA 3QLVA 2NYAA 4ANFA 1QE5A 5DHRA 2NSHA 2FA9A 4DV1B 2ZAOA 3DDOA 2BGTA 3I2FA 3H18A 5SZJA 4DNOA 2A59A 4M76B 4Q93A 4H17A 1ARZA 1Q77A 1VHTA 4DBZA 1XF1A 4L28A 4FN4A 1ZOPA 2R2AA 4NC9A 4K8OA 1V3VA 3LFHA 3LVQE 4ITUA 1T0PA 1M7GA 3V46A 4QT4A 5AD1A 3ONFA 1J2EA 4H15A 1X8LA 2W43A 3NBMA 1AY0A 4L95C 1II8B 1SPBS 1I0IA 2YCBA 4YDQA 1YFZA 3BWCA 1G8YA 3RTAA 1PVVA 1I30A 3RWOA 1PTKA 3B1YA 3OH8A 2IPMA 4FLMA 4LC9A 3JY6A 3LXMA 4FI3C 4GXNA 1F17A 4PSCA 4QVKA 4YWJA 3OBBA 5KTMA 1J0EA 4IEFB 3KVOA 4DJAA 2DR2A 1P44A 1EIZA 1CF4A 2F1KA 1CNEA 1NNUA 1XKTA 2PFGA 3DE3X 1RLJA 2CK3A 2EQ5A 3KD3A 3GEBA 1TVMA 2B4QA 3IP6A 3LY9A 5EUBA 1GL3A 4EAAA 2BTQA 2CNNA 4Z7JA 3NTXA 2IU4A 1JSZA 2FPMA 5LOVA 5A02A 3O4RA 6REQA 2X9VA 2WU8A 1NJ1A 4CFSA 1O9BA 3LI2A 2PU7A 5JT1A 4G0WA 1CE8B 1S7GA 1VE6A 1R16A 2RGYA 1V45E 1O87A 1WPQA 5DO9A 2NU8A 1FQKA 3FFAA 4EI8A 4DIFA 5CDYA 1SCDA 1SHUX 1VIDA 3DH0A 4YXFA 1V48A 3ZQJA 3ZCQA 5GJCA 5FUMA 4RTMA 1E58A 1T1GA 1UBGA 2GD0A 3MTQA 4GC5A 4XDYA 4CIXA 1X7XB 1FFWA 1TO1E 3LF1A 5L45A 2CJWB 4DN6A 4UNRA 2XADA 4B3JA 1HEIA 1QHIA 2AFVA 3ADKA 5C7YA 1AM4D 1T8WA 2ODNA 2VSYA 1M67A 4COOA 1ULZA 1FB5A 3O4JA 4TLEA 4MR9A 3TSZA 5IMSA 4B7ZA 2WMOB 3EXG1 1RC1A 1U99A 1M8JA 1SUSA 1CY2A 1M8FA 1CR6A 2WUDA 3H3FA 2CZQA 4X62B 4CEJB 1PW7A 1QWOA 3GHHA 4NOJA 1BGWA 1NR1A 3TO5A 1P1HA 1NG1A 1RXUA 2Q3EA 2Y9PB 2Q5HA 3C3AA 1MC4A 3GLHB 4GH5A 3OZTA 5LU9A 4WY2A 5C8ZA 2WF5A 1ATIA 2R60A 4PG7A 2ZRBA 5F9HA 4WK2B 3UOWA 3PGKA 1DLJA 1TYAE 1OA0A 1Y3DE 2F8LA 1U4SA 2B8EA 3D4LA 3HYTA 3LT4A 3C3CA 2JG3A 2Y92A 4KR3A 2O1SA 1T0HB 1Z73A 2GXSA 3G68A 4CEJA 5CT8A 2M6LA 3R5JA 4CMBA 1WL8A 4UZSA 1QQ6A 1YKFA 3LL4A 4Y9DA 1YTUA 1SCIA 4M99A 2ZIXA 4JENA 5DLPA 4DEYA 2H9YA 4PS0A 1P5JA 3G2IA 5DEOA 1UXKA 3TGLA 4Z1MA 4XARA 1J42A 2JJQA 1AS3A 1U6IA 2IIBA 3GEIA 4UUBA 4EGJA 3CZAA 3PQCA 1H0HA 4I19A 1RBMA 3UY4A 1BEZA 3T1VA 3HDQA 3TSAA 1P6QA 1GRCA 4AT1A 3GJQA 1QYRA 2AR9A 1SUBA 1BO6A 1TCUA 3OF2A 5KQLA 1NUSA 5EWJB 2QTCA 4JB3A 2YHAA 5D00A 2X8WA 3K92A 5KQPA 1A4IA 3P4YA 1DEAA 2C4UA 2A78A 1OQAA 4D0NA 1RRVA 1WR8A 3HA7A 1E2DA 4JH0A 3HZHA 3REOA 3HJGA 1JPUA 3GA5A 2IH2A 3L82B 1QK3A 1TZMA 4LYYA 3V2GA 1R64A 1JR3A 4LJKA 4LAFA 3DGFC 3AEQB 3IOEA 1L7DA 2XI4A 1DRKA 3GP3A 1P31A 1OYVA 2P6MA 2JDIA 2B36A 4O2RA 2IKQA 4D43A 2NADA 3STVA 3OIDA 5DTQA 5KNBA 3A3NA 1G6HA 1DRWA 3HBAA 3MVEA 4JU9A 1T0IA 2ZSDA 1L5GB 1E1CA 1TFUA 3A14A 4JROA 2H2AA 2NXWA 3WNVA 1GQRA 2X8LA 5FDFA 2FQQA 4YAWA 4CKZA 3KWMA 2C4TA 2IUSA 3CEPB 1L5VA 2CJXA 3IQGX 3KKNA 2CD7A 1ZIDA 3CJRA 3K20A 3MLAA 1SHLA 2OBLA 3OEHA 2HQOA 1NM5A 4OXXA 1Q7BA 1T4DA 1J8VA 1R7RA 2JNWA 4EUSA 2GN6A 3LUAA 4YMUA 1DEOA 2OP1A 4WXRA 1YQQA 3U3MA 3B70A 1EGVB 4TSFD 2R65A 1NHGA 5L4NA 2WWWA 1U0NA 3GJYA 4L0QA 4D6YA 3KJEA 5KDDA 3ORYA 1Q16A 2JLWA 2AFHB 2AE1A 4NCHA 3QFHA 5EJ2A 1KC3A 3CSDA 3DBRA 4IDPA 1RWKA 4K1LA 3ZY2A 4WNYA 3IX7A 4MRSA 5MN6A 2AWNA 2XEXA 1S2IA 1NAIA 2AEEA 2ORVA 1WB6A 2II6A 2X8JB 3A9TA 3PHLA 3R6WA 3C45A 1BKDR 1F20A 1T0BA 1WOMA 2PV7A 2MT9A 4MROA 3F5FA 2ACKA 4YPFA 4ADSG 1LV7A 4TROA 5KTKA 3LBYA 1Q91A 1ID1A 4GPIB 5I9BA 2AFHA 4MV8A 3D7LA 2FK7A 4OREX 1X1EA 4W1SA 3GFQA 2MU1A 4ZAZA 3AIMA 4HDRB 1P0IA 3OHMA 3W05A 4YP6A 1J99A 1QKKA 3CUWA 4J0HA 4QRIA 3L8YA 3M1LA 3P9RA 1DC4A 4G5HA 5ITSA 4EF4A 2X8JA 3CRMA 3OE1A 3KV1A 4IHJF 4PEVA 1G8PA 3WOHA 4EP1A 3VNAA 1T2UA 1W5SA 3OC6A 4HT3B 3CM0A 3FSJX 4DV7B 2Y8EA 1JQEA 1J23A 1ZCJA 1JHYA 2FWNA 3IUEA 4GZ6A 4CIBA 3L8FA 2PSJA 1PJTA 4AUNA 1NR7A 4PGFA 5KX5F 3L01A 2P2CA 5KSZA 2GBLA 3LCCA 1IG3A 4FMDB 1SBYA 1U7OA 2DQYA 3DE2X 1GRQA 4IW3B 4M0MA 2P0AA 3MB8A 3QF4A 1OGYA 4C89A 2CFRA 5K2OA 1JDVA 4N0EA 7ADHA 3SZ3A 5E7JA 4R40A 1N0WA 2HWWA 2ICAA 2LKDA 3EF0A 4FCWA 4KFSA 2Z98A 3CURA 4IVQA 3F73A 1STOA 1D6JA 1XAGA 1YAHA 2FEWB 4H4CA 2WIFA 5D6OA 1LS6A 4HX9A 5IAAA 4ML3A 4RY2A 5K6RA 1I01A 3ROEA 1U3GA 4JCCA 1A77A 1NU6A 2Q1SA 5EJ9A 3RTCA 4S1TA 5TF4A 1CZNA 4KN6A 2DLNA 1YJXA 3PQEA 1KO5A 2MINA 5FHQA 4AL4A 5A6SB 1O1YA 1RZUA 1NRXA 3F3MA 3ZD6A 2ACEA 3A2MA 5L95A 1IY2A 1T9DA 2RE8A 1DFHA 2H16A 3FVVA 5JAUA 1WBJB 1E5VA 4LJYA 4HNUA 3I9KA 3KZVA 3T9AA 4K9SA 1G6KA 2PX5A 4H1VA 1UOPA 5KIAA 1LPBB 2HEGA 4NCAA 2KB0A 2XOXA 3KKOA 3A2NA 3RIGA 4RTJA 1I4TD 3TM5A 2WJJA 1YRHA 1Z36A 2WTEA 4HBZA 4NARA 1Y1RA 4LRXA 3WQRA 3CUVA 2A5FA 3VDNB 4BMDA 1IM2A 3R0QA 5ALUA 3X1WA 5K8CA 4MGZR 1G8AA 4ARUA 5IJ9B 1X94A 1GAJA 1TAHA 3KUXA 3AF1A 1ZVQA 3C6QA 3W8FA 3UGJA 1RYBA 3AP3A 2ZYHA 4FU0A 4ND8A 1HBJA 3GWZA 3JYHA 2PK3A 2IA5A 4PHGA 4U6NA 1NF9A 4MJ7A 5TDHA 4CM1A 5IJXA 1W8IA 1L6IA 2YXNA 3JVUA 3ZU2A 2DFTA 3TJMA 5KHAA 2C3YA 3FB4A 4DIKA 1UDAA 5AYVA 3T7RA 1DAOA 3U4MA 4RHYA 4JR2A 3PHIA 3SLGA 1C1XB 2YVLA 1FDSA 4EJ6A 4PV7A 5E6SA 4A92A 2P9JA 1CJTC 1SKYE 3HBMA 3H9CA 4M1SA 1REQB 2J59A 2V6GA 4CF5A 3G0GA 2BFNA 1SC6A 1N2JA 3JX9A 1IYZA 1WETA 2O8FB 3MJRA 2VTKA 1CUWA 4H6WA 2F3UA 3TOVA 4LYDA 2Z2IA 4ZODA 3R77A 4X94A 4DJFC 2QK4A 4L2IA 3S2UA 1UBTS 1I13A 4YQYA 1N7HA 2ID7A 4YHBA 2WHEA 3A1SA 3DEKA 3F98A 4IXWA 2J9RA 4KR0A 4XI9A 2PIAA 1Q0PA 5FV7A 2O2GA 4HAXA 1T3SA 4HYEA 3SF8B 4JLUA 4WE3A 4Y2TA 1ORVA 4CKEB 4ZZIA 1P5FA 1JXQA 3NLLA 1S9HA 3RFXA 5A1TA 2CSXA 2WVJA 3V42A 1AN0A 3KYJB 4UASA 1XDGA 2ONZA 3RJ9A 2Y0EA 4I50F 2RH4A 1SHTX 2QN8A 2WSIA 2X0FA 5J5VA 3ZLJA 4J07A 4CF3A 4JT2A 3TRIA 1FNBA 5BMVF 4HCJA 2WICA 1X13A 1Z07A 2VCYA 3TWOA 721PA 3TTSA 3SF8A 2E89A 3WV5A 5FTLA 5F7OA 2EP7A 5AVKA 1QLHA 4CKEA 1XLVA 5LCXA 2DFVA 3BHMA 3V7WA 5B7PA 1MEJA 2X6RA 3WIBA 3BJMA 4PC7A 1KTVA 2HJSA 4DMKA 1QUEA 1XDUA 4O4LB 4UE6A 3L1VA 5EUMA 5A3JA 3USCS 4TV9F 2OLJA 1NW6A 1TTQB 1ISGA 2E6UX 2AZXA 4JP3A 5LXTB 1D9ZA 4DDWA 1H1DA 1ZRHA 4K6MA 2ZSHA 1Z47A 3C6KA 3CF4G 3NHPA 2B0CA 3UUGA 3ZU3A 3V8QA 3JQ6A 3PVSA 4K6CA 3MWKA 3SVTA 1HT1E 5TX7A 3NWPA 5KNCH 3D2BA 3OTGA 1AXEA 5C1IA 2XUDA 1Q7CA 1AQIA 5J2UA 2QNBA 1VKOA 3K9GA 3NP9A 3W5UA 2PA3A 5EKTA 2IBTA 3L4SO 4F4CA 2W8BB 4O4LA 4JUDX 3B1VA 3FE2A 3OURA 3RM3A 1Y5IA 3L9XA 1R4NA 1XTPA 2H8KA 5TB5A 3A10A 2O8CA 5JEEA 4J2HA 1SKQA 2JBWA 2JJ1D 2WB4A 2A1TR 4HUQB 4QLAA 3SHOA 5JCJD 4CM8B 2O2JA 1B43A 1BFKA 2BFOA 3JARA 3OJXA 4C76A 2HBQA 3RAFC 1B8NA 4DWWA 5IXYA 1QGED 1A69A 2ZR0A 2R1VB 3NNDA 3WJ2A 3L9WA 4D2IA 1NIPA 2NUAA 2OZLA 3G7NA 1WEKA 1FDOA 1NFRA 3MSXA 3OTIA 4DLUA 5TMDA 2VAMA 4RMNA 3S2IA 4DG9A 3HFJA 2PT7A 2W2XA 3PUIA 3N5KA 4I4CA 3T95A 4FFSA 1YSCA 3DZBA 5EMMA 5CFOA 1VE7A 3FI9A 1AKTA 2NV2B 5DV9A 4FM9A 2YV5A 4MDEA 5IVKA 4GKKB 3MG9A 3D7SA 3CWZA 2CVQA 2BVNA 5BSVA 2VYCA 1R8JA 3M6LA 2D54A 3OCZA 4D3DA 4B4DA 4HZUA 2R1VA 2JKZA 2QI9C 2YVAA 4E2YA 4DCSA 2VHXA 4K9LA 5C3MA 2UYHA 3WBJA 4L27A 1FS6A 2C7QA 4RVNA 3TIGA 2JGNA 1W96A 1KORA 3DEJA 1XYGA 1NRIA 4I1IA 2WYOA 1NUAA 5ICGA 3TFWA 3MILA 4FXOA 4NYJR 2D5LA 1NVGA 4W5QA 3EZGA 3K2QA 1PNOA 1ODLA 3TTWA 2X2PA 2C8VA 3CLRD 2V1UA 4LF8B 3H5IA 1KI9A 4U7FA 2BEWB 5EP4A 5DHQA 2QX6A 4TKZA 3OOSA 1JKXA 4MRVA 1NGSA 5BWNA 3CKMA 4LZJA 1HOTA 1XWWA 4UC0A 1VMDA 3NIDB 4K26A 3KNZA 1SUIA 5G0TA 4MIKA 3TDMA 3KUKA 1NVXQ 1HG0A 4EGCB 4JBNA 4BU1A 1K9SA 3TSYA 5EG5A 4KX5A 4X7MA 1Q95A 2AEJA 1A50B 1J90A 4X97A 3DD1A 5GY7A 5K3FB 4AYWA 2CNWD 3Q8LA 4Y9UA 2ZSIA 3PIIA 3D4NA 3OZVA 4IR7A 3ZWPA 4TKUB 3SJZA 2WVHA 1CY8A 1HYEA 2XB9A 3U80A 1RE1A 3C8UA 3H2KA 4FGUA 3ULKA 3F7OA 1KVQA 2C8LA 2ILTA 5ENDA 5JD6A 1I5OA 2XNSA