1TVMA

Nmr structure of enzyme gatb of the galactitol-specific phosphoenolpyruvate-dependent phosphotransferase system
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
113
structure length
113
Chain Sequence
MGSSHHHHHHHHENLYFQGSKRKIIVACGGAVATSTMAAEEIKELCQSHNIPVELIQCRVNEIETYMDGVHLICTTARVDRSFGDIPLVHGMPFVSGVGIEALQNKILTILQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the enzyme GatB of the galactitol-specific phosphoenolpyruvate-dependent phosphotransferase system and its interaction with GatA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords PTS system, galactitol-specific IIB component
total genus 20
structure length 113
sequence length 113
ec nomenclature ec 2.7.1.200: Protein-N(pi)-phosphohistidine--galactitol phosphotransferase.
pdb deposition date 2004-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02302 PTS_IIB PTS system, Lactose/Cellobiose specific IIB subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tvmA01
1OXKB 3EQ2A 1HEYA 3B2NA 4S04A 2A9QA 2FTKE 5HKOA 1BDIA 5DCLA 2L17A 1I3CA 4LDAA 3CNBA 4NQRA 4N0QA 3OLYA 5FWXB 3CRNA 4RXTA 5IUNC 1URPA 2VYCA 1DBPA 3O2SB 1E6MA 1GCAA 2IDMA 3G1WA 4MYRA 3QEMB 2JVKA 3MM4A 1C4WA 1Z15A 3CU5A 2JB9A 3LUGA 4G97A 4YV7A 5T7BA 5CNJA 3OQOA 3OM0A 4MQFB 3RH0A 3QX9A 3RVLA 4D74A 3O21A 2PUAA 1EFAA 4PYRA 1ZVVA 3DGEC 1ZY2A 5EWMB 1CEYA 2ID9A 3IP9A 3FFTA 5FWXA 3BRQA 5PNTA 4MQEB 3A0UA 3H6HA 4EYQA 3S99A 1CHNA 3P9YA 4Z4EA 1SRRA 4KREA 1QO0A 2TMYA 3DZDA 1JBEA 1M5UA 5JNTA 1ZH2A 2LBPA 1LBIA 4MR9B 2OENG 4G0PA 2F8SA 3SQNA 4ML3A 3KTOA 4RK4A 5BR1A 4PEVA 3CLKA 4MQEA 2VK2A 1SD5A 4TN5A 3H6GA 3QX8A 1S8NA 4H60A 1KRWA 1Z26A 1YS6A 4F12A 2WWVD 5HM6A 2QW1A 3C97A 4EYGA 3M9XA 2CHFA 3TB6A 5KC9A 1E2BA 3Q7SA 2QVCA 4RY8A 2PUBA 1U2PA 3QEKA 1LK0A 1P6QA 5ABPA 2FN9A 3FFXA 1QPZA 5IEBA 4YRZA 4RS3A 1NY5A 3O75A 3OMWA 4GNRA 1JH9A 3GA5A 4MS3B 2QU7A 2FEPA 3KKEA 3MYYA 4IILA 1DG9A 1GCGA 3EQZA 4RZSA 1JL3A 3BBLA 5ED4A 5BQ3A 3OO1A 3Q15C 2E4XA 1DC8A 4G0OA 4EUKA 4QYMA 3H5VA 3NHZA 4WXEA 2FEWB 5HSGA 3NHMA 2KYRA 1ZGZA 2VUIB 3CG0A 4MAAA 1U2QA 4FE4A 2R47A 4YP9A 3QK7A 2RJOA 2MSLA 4KFCA 3GBVA 1EAYA 4Z99A 3HK2A 3EJWA 2GX6A 4IF4A 2QXYA 3NNDA 4KV7A 4WUTA 3LFTA 2GKGA 5B3JC 1VLZA 4W5QA 2JRLA 3H5TA 3EULA 4G0QA 3HUUA 2L19A 1QP4A 4G0ZA 1SXIA 4PZ0A 4UHKA 6CHYA 5CNKA 4GPAA 3KYJB 1RZRA 1JX6A 3N8IA 3SAJA 4YS6A 1BVHA 1JLKA 1M5TA 3OLXA 1YS7A 3A0RB 4TMYA 5EWJB 3QELA 5IEJA 1BAPA 3F73A 1E6KA 2ZWMA 1U0SY 1Z25A 4HNRA 1APBA 2RGYA 2PL9A 4F06A 4N76A 2PUDA 4MS4B 3DGFC 3RVNA 2MSKA 5D2CA 1NXWA 4RSMA 1NXXA 4Z9AA 3NBMA 5KWSA 2PUEA 1FQWA 2MYTA 3MQ4A 1MAVA 4WWHA 2CHEA 1DP4A 4E7OA 6ABPA 3HSYA 3H75A 2XDYA 3EODA 2JVIA 4MGEA 5DGCA 4ETIA 1U04A 1MVOA 1JYFA 4Y9TA 1T34A 1TMYA 3N53A 2WY2D 4L4UA 1EHCA 3HS3A 4Z4CA 3F6CA 3RVJA 1D1PA 4EYOA 4RDCA 1D5WA 3O2JA 4XASA 4DN6A 3RVQA 1EWVA 3IPCA 4XARA 3KG2A 3CKMA 1KRXA 3D02A 4O5AA 2QZJA 1JFTA 3O1JC 3SNKA 1U8TA 1VPWA 2YHAA 2H3HA 1USKA 3GRCA 5TQ0A 4KK4A 2V0NA 3URMA 3C6QA 4O1IA 5FWYA 2QV0A 4LZLA 4L85A 1DRKA 4MLCA 5GQSA 1PEYA 3BRSA 4HNQA 1ZHHA 1NXSA 1QO0D 3NNSA 4RKQA 2IYNA 1RXEA 2FMKA 1TVMA 1VKRA 2H0AA 2M98A 3BREA 3FFWA 3QLUA 4LRQA 3F7NA 3SY8A 1RNLA 4RK1A 2JBAA 3OLWA 4OLBA 3OO0A 1BA2A 2CD7A 3A10A 3ROTA 1SXHA 4G0XA 4RXUA 4YWHA 2P9HA 3EGCA 3I09A 2CWDA 1DCFA 3DLBA 3LOPA 4WXMA 3LUDA 3FGZA 1YK1A 2PMCA 4RK7A 3C3WA 2PJUA 1Z17A 4RU1A 4LE0A 3JTEA 4Z4IA 3CZCA 4YGXB 1ZN2A 3K4HA 4ZJPA 1EWTA 4H3KB 1DCMA 2NZUG 2IPNA 2A9PA 1NXTA 2FQYA 3QLTA 1W25A 2RJNA 5JNWA 3QEMA 4W5NA 1Z2EA 2ID7A 3N75A 2GI4A 9ABPA 3T6KA 5JNSA 2MYNA 4KK3A 4HNSA 4HYEA 1BDJA 2NT3A 4WZZA 5JS1A 2J48A 2HJ9A 5KQLA 4IRXA 1TJYA 2QR3A 1A0OA 4ZPJA 2PUCA 1DBQA 4UHJA 4N0PA 5GOTA 3HUTA 1P2FA 1NXVA 2L2QA 1MIHA 4N03A 5FBHA 3M9WA 2HPHA 3H1FA 5EWLB 3RVKA 3KJXA 3EDCA 1WETA 3QLVC 2NUBA 4RK6A 2DRIA 3TO5A 5I4CA 5TPWB 1ISRA 3LTEA 3LUCA 3HDVA 4EVSA 3JVIA 2Q5CA 5JNVA 4W5OA 3HM9A 2FKAA 4LE1A 2PL1A 4G0YA 4JOQA 3W9SA 4IMJB 3T8YA 3CHYA 1TLFA 2JK1A 1C0EA 4EGSA 3I42A 1XWWA 4JB0A 4JASB 3MA0A 2FSPA 4G0MA 3GL9A 4MR7A 1JYEA 4JA2A 2QVGA 4Z9BA 3KS9A 4MR9A 1JF8A 3RQIA 3QLUC 3HEBA 1ZH4A 5JNRA 4F8JA 4CBVA 4E7PA 4W5RA 2RDMA 4MLDA 4N47A 1JFVA 2I6FA 4ZMSA 4Q6BA 1KGSA 1Z12A 4MR7B 5JS2A 4PICA 3LMKA 5TQJA 2W42A 5KC8A 3LUJA 3ILYA 4EVQA 2ZAYA 3OM1A 4B09A 4MS1A 1AB5A 3LUHA 1FSPA 1JFSA 1RPJA 1ZAYA 3OLVA 5TQ2B 1QMPA 1JDNA 3E3MA 3H1GA 5HQJA 4XAQA 4EYKA 5DKFA 3BILA 1MB0A 2FMIA 1QP0A 1K66A 4KPYA 1DCKA 4KMRA 4MR8A 3C3KA 2FQWA 3H5OA 1QKKA 3RVOA 2E4YA 3Q7TA 5C5CA 1Z18A 3MMNA 2B1JA 5TE9A 1FFSA 4Q6WA 1A04A 3HDGA 2FMFA 1ZITA 5T3YA 3RVPA 4KZKA 2PUGA 1ZGGA 4MR8B 4YLEA 1E6LA 3N0XA 3H5LA 1JWLA 5CHYA 1USGA 2FLKA 1L5YA 3E61A 3GYBA 3IPAA 4YCSA 3N0RA 1OXBB 4MQFA 1JDPA 1A2OA 2JVJA 1RXIA 3M6MD 4MPTA 4MS4A 4YO7A 3T38A 5TPZA 1PEAA 5KQGA 1PNTA 3NNNA 2R48A 2P4UA 4PE5B 3G85A 1H9CA 4OTZA 1QQBA 1ISSA 4IGAA 2R25B 4MS1B 2PKXA 1Z16A 2A9RA 2IPMA 4RY9A 2IPAB 4DADA 1Z2DA 4O1HA 5IBQA 3FDFA 1NATA 2WJWA 3QELB 4FE7A 4MRMB 5DLEA 3HXMA 1F51E 2A9OA 5KQPA 4KRFA 4NV3A 3HCWA 2YHBA 3H1EA 3JS5A 3UUGA 1PUXA 1NXPA 2HQRA 4W5TA 2LUOA 1YTUA 1M2FA 1D4ZA 3LUFA 2HSGA 1PNRA 1Z13A 1SXGA 1W9HA 1IIBA 5CNMA 4OATA 4IMIB 2PLNA 2E4VA 3CG4A 4NICA 4ZMRA 3OQMA 4KNYA 1YIOA 1M2EA 2E4UA 3K9CA 5IUJC 2N9UA 2GWRA 3IP6A 5IUKC 3IDOA 4QPJC 2MSWA 2R4QA 2NT4A 1ZDMA 1RZRD 3HJFA 4DQDA 2FQXA 5EWJA 1NXOA 2FN8A 2WB4A 4G86A 3UKJA 4NCBA 3H5WA 1XHFA 2LPMA 4OLAA 5BRJA 2FXIA 3CTPA 4Q7EA 3TMYA 2PE5A 3HZHA 3ROFA 4D6XA 2AYXA 4TLLB 3KYIB 4ETNA 1GLGA 2FLWA 2IKSA 3GT7A 3SM9A 4YR7A 4S05A 3C3MA 4RY0A 3HV2A 2E4ZA 3LKBA 3GV0A 3N0WA 5BRAA 2IPLA 3GWGA 3MIZA 3O2QB 1YK0A 5JNUA 2OQRA 4MRMA 3F6PA 4P1ZA 5F64A 2E4WA 3HO1A 2LP4Y 3L6UA 3HVRA 3VNBA 4Z4FA 5TPZD 3RVSA 3T95A 2O20A 8ABPA 4Z4HA 5IC5A 3TX6A 4ETMA 1XHEA 2WRZA 4RXMA 3GBPA 4LE2A 1DJMA 4RWEA 5TQ2A 2B4AA 1QQAA 1FFWA 3QLVA 3L49A 1UDRA 4RK0A 3KSMA 2FW0A 2LIVA 5TQ0B 4P98A 5FBKA 2AYZA 2HQOA 4LX8A 1KMIY 3H5IA 4H3HB 4XXHA 1PHRA 4WT7A 2FEKA 3Q41A 5EWLA 1D1QA 1DC7A 2NZVG 1LBHA 3UK0A 1EWKA 3JPWA 4RV5A 4FB4A 1F4VA 1LJLA 4KQCA 2JBAB 3R0JA 1YMUA 2VUHB 3D8UA 5CNIA 1ABEA 4M88A 2M1ZA 3IP7A 3OQNA 3CS3A 1MB3A 1TM2A 3VNAA 1P6UA 2IOYA 2MYPA 2PAFA 3ILHA 1NTRA 3LUKA 1ABFA 4KVFA 4QYWA 4TLMB 4N41A 3A3KA 2L18A 1DZ3A 2MYUA 3O74A 4OBBA 5B3JA 3JY6A 4D6YA 1USIA 4F3TA 4Z0NA 3O1IC 3O1HB 3OLZA 2FVYA 3FMVA 4EVRA 1VRVA 1LJUA 2F8TA 4JAVC 4JP1A 2PUFA 4XFKA 3KLNA 1QP7A 2JCGA 3N6VA 3IP5A 3Q7RA 1K68A 3SG0A 3LKVA 2X7XA 1D2AA 5E3JA 3CFYA 1FFGA 4QICA 1GUBA 1QNLA 1YMVA 4NCAA 3KLOA 4RK5A 1BDHA 3OMXA 4ZYLA 3KCNA 3Q9SA 5IULC 5KI6A 4Z4GA 4OG2A 5KQMA 1R8JA 3JPYA 1AB6A 1B00A 1YVUA 1DBWA 3I45A 3DLHA 3EAFA 4MS3A 3TD9A 1P8AA 5DTEA 1CYEA 3RVRA 4KQ9A 2WJAA 4JB2A 5EWMA 7ABPA 3KHTA 1JHZA 3JVDA 5C5EA 2FMHA 5FWYB 1Y1LA 2WMYA 5IX8A 3RVMA 5TPWA 2GBPA 3I5AA 3MF4A 3DBIA 1ZESA 2HQBA 2QSJA 1J56A 1DRJA 3LUAA 4LDZA 3CZ5A 4XLTA 1L5ZA 2BGGA 4RKRA 4EY3A 1GUDA 4F11A
chains in the Genus database with same CATH superfamily
1BJTA 1PD1A 4KE8A 3HWSA 2BISA 1KORA 3ZE0B 5IANA 1WV1A 4XUGB 4PLTA 4ZD6A 4GMDA 2L17A 5B1DA 5BV2P 1F8UA 3AR6A 3M1IA 3VOTA 1A4RA 2IGTA 1WVMA 3FAZA 2YYAA 2BBOA 3OZIA 4BNHA 5LU9A 3B60A 2IOHA 1YRYE 4NAHA 4OQFA 1X94A 4AKEA 3DWGA 2NUAB 4F4HA 2XMBA 2PZFA 3IPYA 3R3SA 2VYCA 1OZAA 2I1WA 3P4UA 2PWYA 2DUJA 2FPIA 4JJGA 5KHLB 3LECA 3N8KA 3D3KA 2XKJE 2D1TA 3W1EA 2M6SA 4C06A 1G8GA 4DLNA 1C4WA 1CJKC 1VRWA 1XZHA 2K5UA 2IYQA 4I0WB 3AV0B 4NARA 3IUPA 1X7WB 2GYVA 4D46A 3DSRA 3ZVNA 4MQFB 4MVJH 5HHTA 3WAKA 2V1XA 5HRCA 1EDDA 2QV7A 1AGNA 2BFEB 1SQ0A 1H2ZA 5FWXA 1EVKA 4PF1A 4XKJA 3TAHA 3TZHA 1XD2A 4RM2A 5JPCA 3PX7A 1N2BA 2XWSA 1YC5A 4QEDA 3C1AA 3N2NA 4W8OA 2IQIA 3TW8A 4WKBA 3SZUA 3KT8A 4EY7A 5L3VA 4DSOA 2JK0A 3DEYX 2P0EA 1EP3B 2YYYA 3JU3A 3AIKA 4MNTA 4RK4A 5BOVA 4YDQA 3EVTA 5JV5A 3U44B 1A4IA 4FDUA 4R54A 4IJKA 2H1VA 2PKCA 5CFLA 5J2TB 1T9GR 4BFTA 1Y5MA 3V4PB 2IEIA 1EG2A 3RBAA 3V8NA 1ZJ6A 4OQXA 3EZXA 1VXOA 2A33A 2BM8A 2ZRGA 1UAYA 1ZQ1A 1ZJ5A 3EVCA 3L77A 4MVJE 3B1ZA 2CHUA 4EKYA 3RFCA 1HQYE 5BQPA 1E2BA 2QX8A 3C1TA 3SS7X 1KO7A 3AR7A 3MTIA 4LHSA 5T4EA 3WA6A 3AC0A 3ZDXB 2LXNA 4AX4A 3JQDA 1X70A 4O6VA 5K0FA 3QE3A 1USVA 4D5EA 1UWLA 4HX2A 4YRZA 4YT4A 1VKJA 2VTBB 1J0AA 3W1VA 3SMVA 1VBMA 3MTJA 1A8IA 1F3LA 3K9FC 3IE1A 4HQLA 3EPHA 3R0ZA 2JJ1D 1W85A 2WKWA 2ZTLA 2QNRA 4E5PA 2ONJA 5LWQA 1TJNA 1W5BA 3FNQA 1EK6A 3DDOA 1B8PA 1OW3B 3O83A 5BSGA 1YBVA 3BXHA 3A32A 3EN0A 2FH5B 3PZBA 4B2LA 4BBAA 3G59A 4JC8A 1QK3A 2O50A 2YWDA 4O25A 1QRTA 3FGOA 2I2CA 1MRNA 2VPWA 3QU2A 2B2XA 3INYA 4IMRA 3VVMA 4URFA 4J16C 1G19A 3F5DA 4CT5A 1YHYA 2O7QA 3M4XA 3TD2A 2JGFA 3DLCA 4D4HA 3D5TA 2MSLA 1NF2A 4RH1A 5GV7A 5LCXA 1G2QA 4YLYA 2A3RA 4OYLA 1VOTA 1RQRA 2ZR8A 1NVUQ 2ZUBA 3QWAA 1CK4A 4KV7A 4KXFB 4X7PA 1VHWA 5CLHA 3IE2A 4AKSA 3NHSA 1Q84A 5JZBA 3AILA 4RDXA 1AH2A 4IDFA 3E4CA 1E77A 4YREA 5J40A 1TAQA 4TS3A 1Y4ZA 3B3GA 5JDIA 2PFKA 1W2HA 4GI5A 4WCFA 1VFPA 4Y2QA 5ICMA 4OJKA 1V9LA 2LGJA 3DVRX 1D4OA 3D8BA 4IRMA 4E88A 1WCYA 3HN6A 5CNKA 3KQTA 3LF1A 3G7SA 4N0DA 3PXEA 2GAAA 4TL7A 2I5PO 1NDHA 3HCPA 4RQAA 1EDOA 2FWPA 4GX2A 4MVJF 1YS7A 4IS2A 3QPWA 4OXRA 2IIVA 4RHUA 4LJ8A 4ZT6A 1FY2A 4QU5A 1WNTA 1KU0A 1ZRMA 1UQTA 3WLEA 1ZZGA 1NU6A 3KEMA 4PWYA 2RHMA 1I4OA 2JLBA 2RGYA 2WTNA 3MCWA 5IN4A 1KEEA 5AVRA 5LD2C 3TL3A 1I0ZA 2GBGA 2PQ0A 5M2QA 1HTTA 4W1QA 2W00A 3DGFC 1H2WA 4RFVA 1QYRA 1G60A 4K9NA 4CKBA 3EVZA 4RULA 3R6TA 1L5WA 5LZ5A 1SHTX 4BLRA 4ZYYA 1MQ8B 4EP1A 4TQ9A 1YHNA 5ALUA 3M0EA 2X4DA 3O6VA 2PGNA 3UENA 1JQDA 3RODA 2XDYA 3ONWA 2E1PA 5A06A 1GIAA 4LV5B 1VM6A 1U04A 2Y8EA 3WGUA 1U7HA 3OTQA 1BU5A 1C9EA 4KGXA 3WGGA 5TSDA 1NMYA 3B1KA 2QTMA 3ZIAA 4FSHA 2DJIA 4KXMA 4X61A 4XWTA 4RDCA 1D5WA 4HAWA 8ADHA 1M66A 1V9CA 2IU4A 4R16A 1G63A 1WUHS 4RPCA 2QZJA 5IJZA 4JL6A 3L05A 1AK9A 1IHDA 2OK7A 4XM2A 1NJFA 3BN3A 1OPXA 5TQ0A 3ZPXA 4PSCA 4KDEA 1U0OC 1U2DC 3AFGA 2OL4A 3C6QA 3VTFA 3WNVA 5GQSA 3MJSA 5BSFA 3A1NA 3NEJA 2FV8A 2OORC 3L3BA 4M9SA 5CT8A 5EESA 3RFUA 4II7A 2I22A 2HW8A 1EQ2A 4ZVTA 3GR6A 3AJRA 4H1UA 3FFWA 4GKBA 3ESDA 5E4FA 3URKA 1B76A 3ER6A 3R8FA 2D13A 1F20A 1P2BA 3G2JA 1IH8A 1F2TA 2DKNA 3C8MA 4K81B 3L4JA 5AKIA 1E3DA 2YQZA 1T4GA 2O05A 2Q7XA 4RV4A 1WE2A 1TYEB 3C8DA 1TMOA 3LOPA 1NR1A 2W6PA 1UKCA 3FGZA 2HSDA 4QOIA 4UUOA 3ANLA 4RK7A 4OHRA 4AXBA 1V5WA 2ZE6A 4BMDA 3N2KB 1KJ8A 2C96A 2QN1A 3RS5A 4ZOAA 2OY0A 1KYTA 2PVPA 1A9SA 3S0JA 3O4VA 3NUGA 4LDQA 3GY0A 4EB6B 9MHTA 5JY1A 1QGZA 1G8JA 3ESZA 1N57A 1VJ1A 4MGIR 3M1AA 3RUDA 3ZWXA 4WZAA 2PX8A 1GYPA 3JQQA 1FW8A 1I4EB 2X0JA 2PJDA 2QN6A 3M81A 4G1CA 3LHKA 1XEWX 1WW3A 1LD3A 5DSTA 5JQWA 3I39X 2ID7A 4HSGA 3RCBA 4GX5A 5U4XA 3T12A 3ZYCA 5KWEA 3IMEA 1CZOA 1AKVA 4WMLA 4TYQA 3SQDA 5KEIA 4NSNA 4EA9A 1U0EA 3Q5DA 4Y0VA 5D7NA 2WEKA 4YJ2A 2ID8A 2WYOA 3X43A 3H19A 4KLNA 3WKCA 1I6LA 3COVA 4ZPJA 4ZAWA 3RARA 3OJ0A 1QRUA 2WKRA 1CUEA 2X14A 3ZLUA 2FFAA 3NS7A 2VT3A 3AFHA 1P5JA 2BTEA 3WLLA 3TZ6A 3K6SA 3UNXA 3JQEA 3ROGA 1JDTA 4BKMA 2R6CA 1C7FA 3GEGA 5AVZA 2C0QA 1OE0A 1UOEA 3KJXA 4X84A 3OEED 1E9AA 1JHQA 1JHVA 3ELDA 1ISRA 1SD2A 3PXDA 3C43A 4RMNA 3IUNA 1N36B 3FYDA 4JJIA 4YRQA 2X86A 4Y6PA 2FKAA 3D3EA 4LE1A 3T3PB 4D5GA 1I4LD 3W9SA 5AJYA 3AUUA 3DBLB 4WIAA 4D0RA 2JK1A 1WQ1R 1NBMA 3D6AA 2P6UA 4JASB 4RNCA 3ZJ5A 4C7JA 3DM9B 5BY2A 4MR7A 4HWTA 5GY7A 2ZRJA 4NMXB 5CB4A 1WLYA 5E4JA 3NHUA 2O07A 4BVHA 1ZH4A 2PBLA 5JWOA 3F6YA 4YUZA 4CBVA 3V2GA 3IQGX 2VF2A 4PG8A 1NBAA 2OCPA 3HCCA 2HBQA 2JH8A 5F76A 4HWSA 1CJTC 3FCUB 3HR7A 4REQA 4B6PA 4RSGA 3FVRA 3MGKA 2C88A 5KSOA 2YXPX 1G3MA 1CKEA 3JQBC 5IXSA 1JECA 1MEJA 3QPVA 4FKBA 3GNLA 2QRVA 4JC5A 1UMCA 1YZKA 4JYCA 4OGGA 4XGKA 1NXQA 1Y42X 4UHFA 1JEEA 3E23A 3LOQA 3SC6A 4LI3X 5HQJA 3WADA 4YAGA 5AW0A 2IEDA 1DVRA 2R8OA 4TKVA 2QRGA 1U7TA 2PA0A 2IQ5A 3KWMA 1ZD5A 5EZYF 1GTJ1 4G1UC 4MR8A 2XOKA 4Q47A 5JCZA 3H5OA 3C98A 3FLBA 3CNQS 5DBEX 1C1DA 3SP1A 3VZQA 4UAUA 4D1YA 1SKUA 1OHHD 2HMYB 3HDGA 4DQXA 3AB3A 5AVKA 1V5EA 1XTTA 3RBZA 1UIMA 3NKLA 4X95A 1F8GA 1ZGGA 2OXRA 1E6LA 3L8FA 3O8CA 3AUFA 3H1PA 3TR5A 2BYTA 3SJBA 2VHCA 4TLBA 1C4XA 2VJBA 4GL4A 2CJXA 2FLKA 1C1XA 1LZKA 3G5TA 4MS4A 2OGWA 4ASUA 4QBIA 4DXDA 4XFDA 4EHHA 2OV4A 4KWTA 4OHBA 3E7PA 1PZHA 1KY5A 4R1QA 4TWAA 3WQSB 5C8YA 4DCJA 1L6IA 5JSQA 3HXLA 5EKTA 3H9BA 1O8BA 2GNPA 2XE8A 2R25B 1AA6A 1PR6A 1J8YF 2OSBA 4R2LA 3NWPA 3ZQUA 5IBQA 1X3SA 2W4IA 3Q3VA 3NC4A 5DFAA 2Y67A 3OEHD 1L5GB 4K1LA 3A4YA 3RT9A 2W6JD 1NF8A 2VQSA 1WO8A 3K5IA 1PR3A 1T6NA 4F3YA 4IEEA 1SVKA 1Y8CA 3FSEA 1T43A 1NNLA 3Q6MA 4QXPA 3VR3D 4D99A 3OPYI 3PDUA 3GRVA 2W4QA 3L8GA 4KQXA 4OP2A 1Q0LA 3MERA 3I9JA 1RCFA 3I05A 5ECWA 2VG8A 4C6TB 1F6WA 2L0XA 4NICA 4MGKR 1TT5A 4XWYA 3GLFA 2ZKLA 4XE5A 3LQ1A 2N9UA 1BOFA 4JJ6A 4BFSA 4G5GA 2R1VA 4N01A 4KVAA 5ALMA 1JDUA 3M4NA 3KSAC 1HWYA 1IVSA 3A2NA 2YUTA 3GBSA 4B73A 2H4ZA 2GZAA 1ONNA 4OYRA 2OVFA 1KSJA 1RPAA 4UVGA 4BC0A 3ZGXA 3AUSA 3EWIA 1RKXA 3WYCA 4DBLC 3LXMA 2IV7A 2DLNA 1U6JA 2IE0A 5DTRA 2FFQA 3EISA 2GCOB 4AJIA 1UODA 2YWBA 4EQ6B 1MC1A 3QF7A 4RIGA 5JWRA 4S05A 1N3YA 3F9RA 3BKXA 4YI3A 4LYHA 4RY0A 1NBMD 4P53A 3NBYC 1YRWA 3IUQA 3PHHA 2C7OA 5FH9A 4O02B 3HPQA 4WCFB 3NO4A 3WJ2A 2YOGA 1ZZEA 5FHRA 4LOKA 5DHTA 4MICA 5JWHA 1G8HA 4A2QA 3BD6A 3AIOA 4ETMA 3L4BC 2Q1YA 3EDMA 1NT4A 5H9VA 2PX5A 3HUFA 1HDEA 2JHFA 1L5NA 1JFRA 2LDXA 3FYUA 1X7GA 4P4LA 2JNWA 4PLFA 1M8GA 2OFXA 4Z1OA 4I81A 1RS0A 5D3MB 3SLKA 5LQAA 4L73A 4E30A 3WMWA 3EH2A 3EGWA 1KMIY 3MS4A 3PXUA 4Q12A 5ANRB 3Q0EA 4CW7A 3CZ4A 5FT9A 1CZRA 3H04A 3K9LA 4QATA 3F46A 5G1OA 4QG3A 3DE2X 2VJDA 2Y1DA 1FRVA 4A23A 2D7CA 3H84A 4DRXB 2JHPA 4U6NA 2NZVG 3KWLA 4Q4JA 2BR5A 4DREA 4MQ4A 1Y5NA 1NSYA 2DX7A 3PTAA 2C1ZA 3R0JA 1AQUA 3ZYZA 2ZG6A 3UC5A 2LKCA 5I51A 5KVSA 1TE2A 3NW9A 1N2GA 1QKIA 3KD3A 4CLOA 1AKUA 3WYDA 1GPMA 2Q62A 3OJWA 4YRIA 3LCVB 3RO7A 1QAQA 2QROA 4YEDA 2X58A 3P2YA 3WXMA 4RD2A 3LP8A 2NP7A 5F21A 1TF7A 2O5VA 5EJ9A 2IEZA 1TW3A 1Y5LA 2I2XB 4V3CA 4HCJA 5EGNA 1FDWA 2IV3A 4EO7A 1W1UA 2P2CA 3KZNA 3EVNA 3VBEA 2HT6A 1P91A 2B8WA 2YWEA 1P2UA 1Q74A 2OV2A 3RSCA 4CMGA 3GVPA 1Y6RA 3CUSA 3FTCA 4RVFA 4A0FA 3G2IA 3KOZA 3DE7X 1YI1A 3OOEA 4CYMA 2FLVA 4BNYA 4B4OA 3N28A 3BT7A 3VKHA 2IPOA 3K8QA 8OHMA 4W8HA 2PIDA 3OQIA 4KQJA 5F1YA 3UY4A 3Q6IA 4PZZA 1GG8A 2F3QA 2JIZA 3B20A 1YJ8A 4BVGA 1A9YA 3KLOA 4H1VA 4PZLA 4I66A 4ZQHA 3VI3B 1J20A 5ARBA 3Q7EA 4ESHA 1HQCA 2G6BA 3GIDA 4ENVA 2JIQA 5KCMA 5E1BA 3L8CA 2XTJA 4D0NA 1RC1A 5E1MA 1BA3A 3SZMA 1H0KA 4WBXC 3CVWA 4V0RA 1U11A 4CEIB 3KM0A 4MWOA 4AICA 5HRUA 1NJ8A 2OP0A 7ABPA 1KWKA 5F9MA 4TMKA 4LRUA 3L5OA 4CM1A 4GICA 4WZAB 3RVMA 3HU1A 3W77A 2FPGA 5EPEA 5CXUA 4UUMA 3AO0B 3DR5A 3OT1A 1SM4A 2J0UA 3SHVA 4IZ6A 1WHSB 2HXSA 4GX0A 2Q4OA 5BYJA 1ZMTA 3GJTA 4EY3A 2RAUA 4PYJA 2Z8YA 1AMOA 2OA0A 5KOJB 1K08A 2WG0A 5I48A 1I6KA 3AWIA 3AVTA 4PTZA 1DJNA 4DCVA 2B7CA 3WGYA 4R69A 3KIPA 4IHJF 5E1DA 5BMVB 1UP7A 3LK6A 1PRYA 3C3DA 2J30A 4JCCA 5BUQA 4FGLA 5JSFA 2ZAGA 1EZ4A 1N0VC 3QMPA 2E4AA 4LWPA 3HBFA 4QTZA 1HQDA 1MRZA 5F7ZA 5FWXB 1DWUA 1WP4A 3BGSA 3H5NA 3S55A 2XCSB 2CVFA 3JXEA 1QZXA 2GSWA 1BFDA 1YJAA 2B20A 4Q7JB 4WPGA 2W83A 2WPDA 4B3XA 4Y2TA 2MR6A 3IDQA 5T7BA 1OV4A 2VYQA 4IHQA 4R2XA 3OM0A 5DI3A 5C3MA 1FP2A 2BKEA 2QAGA 5C8VA 3X1XA 3MJTA 4IQ8A 4D74A 3ICCA 2DERA 4YYEA 6REQA 2HQ1A 2P7HA 2WJVA 4NMWA 5IT5A 5E3IA 3BB3A 3MC1A 5DGHA 2WG1A 4JFRA 1RCTE 3K70C 3S99A 2HDOA 2DULA 1TJPB 5DM60 5KVCA 2WABA 4R5HA 4IZHA 5IKOA 1W8IA 2X8WA 4QYSA 1R9MA 4P4SB 2IYLD 3NH9A 4CUKA 3O93A 4NOLA 4CM4A 4XIYA 2QQ5A 3VI4B 1EXNA 1ZX1A 1HETA 2JH3A 3OPMA 3PGMA 5T64A 2XECA 3H6GA 2XZOA 4D4IA 1J2JA 5HPYB 3I6MA 1JMVA 4MX8A 2DJ5A 3WK6A 4MDYA 1N9GB 3DNPA 3WLPA 3IDSA 1EP2B 2XA1A 3UT5B 5LD2B 2XLCA 2CHFA 1OC2A 3D4LA 3ZHRA 1PJTA 2AD1A 1RHRA 2J7PA 2W5UA 3PUVA 4X6UA 2OPBA 2X8LA 3ZE8A 3R7WB 1XZPA 4EPTA 3TJMA 2RI1A 3FMIA 2ZUFA 1WHTA 1L5QA 2Y93A 2YJNA 4MW9A 4CLHA 3RLFA 4QUHA 2WC1A 3DP7A 4BP1A 3FTNA 3QJ5A 3LQFA 1UXJA 5AXDA 4N7JA 4YT8A 1U65A 5F73A 2P9EA 5CVDA 5JO0A 1H9BA 4A82A 5MN4A 2JLWA 2JC3A 1GCGA 4I4TF 4JP2A 4NZPA 2O0LA 5B6PA 5IJ0B 5HUJA 5LXTA 5T4BA 1KMMA 2VTBA 2VHXA 4HQOA 1AUQA 1OGIA 3HCEA 2IBMA 4NFHA 3SJCA 2ZTMA 3E2MA 3UAZA 1IQRA 5ALVA 1K27A 1PZMA 5JNRA 1Y7PA 2NX2A 1N2EA 3PF9A 2IOFK 1PZXA 2BF7A 4G4GA 1BXKA 2Y2VA 3AUJB 3LVBA 3O8OA 3TQIA 4MV8A 2QTVA 4YP9A 1VMDA 3ZCTA 13PKA 3DT6A 1SMKA 4RF4A 1OFVA 2C7BA 3T1OA 4AURA 4LV8B 3HK2A 3PQ3A 1KRHA 5ALLA 4BDTA 1TUBB 4I5IA 1IBRA 2HNKA 2OB1A 4MCJA 3NH6A 1XP5A 4E31A 4HWGA 5BUZA 3E22B 2W98A 2ETXA 1FU7A 1UMBA 4Y6LA 1GOTA 2J3IA 1GXSA 3TRJA 2LCIA 1UK7A 4XJSA 4AQDA 4GH5A 1XKTA 3CX7A 1Z7GA 2D2VA 4HWRA 3NP7A 3FTEA 2PV0A 1P19A 2QLLA 4YRLA 3ZVKA 1M74A 2WNSA 1F60A 3OCXA 4RH0A 3X1WA 4JGBA 1MQAA 3LYAA 1IVYA 1OAAA 3EF3A 4N6NA 2Y1LA 3KYJB 2VPPA 4WZBA 3EDRA 4C2TA 5BW8A 4Q1AA 2IX9A 3B70A 2WM3A 5BWMA 1V48A 2JRCA 4I1SA 2ZAIA 1ULZA 3C1UA 2Y1FA 3SVZA 4ISBA 3KYDA 4OQYA 3O91A 3JRWA 2ZI3A 1YO6A 2GLTA 1KZ6A 3NHJA 3IDZA 3G02A 5I9LA 2AS0A 1LWOA 2XMDA 5DULA 5ILGA 2Y99A 4JZKA 1NXWA 5DHPA 3RANA 4X64B 4CIAA 4Y9RA 3QHPA 4LECA 3VHXB 4ESEA 3PFNA 1NQUA 5FOUA 1FTNA 3A6LA 1Y98A 3LYUA 3HVJA 2XYPA 2HSWA 1XRSB 2J59A 3AU8A 5JC1A 1U0FA 1QKJA 4J0FA 1SAYA 4B0PA 3E7XA 1QGUA 1R0YA 5REQA 4MHSA 4TZKA 1TO2E 4QT0A 4BATA 1RI3A 5A1TA 4E4RA 1RKVA 3D6TB 4Z3OA 1V95A 2H6EA 4UU7A 2GJ9A 3EJ6A 3NPAA 4JX9A 5AJUA 4IP0A 1DC4A 2ZE5A 5IKEA 4YK7A 3T7CA 4WTOA 3ZBPA 2OCYC 1GSOA 3RD5A 1W88A 4HJXA 2IHNA 3KZVA 5AHRA 4WL0A 2VPIA 1Z37A 1VKNA 2Z5GA 4ENTA 2FPPA 3OEEA 2O3QA 1KERA 3FF1A 1DO0A 3TQRA 2G9NA 1VJRA 4WVFA 1XLUA 1VKZA 3D3WB 3KU4A 4V2UA 3N2KA 2BGTA 3VU3A 2OSVA 4F7WA 3H8JA 1ATZA 3VO1A 1O97D 4NOKA 4AO8A 4EB6A 5IBCA 4AD8A 5NULA 3WSVA 1WCIB 3X44A 3RKSA 2CXTA 2NSDA 1RNLA 1UM8A 3EIHA 4BLOA 4OXNA 1MXFA 2BBSA 1O95C 3IOMA 4YJ3F 1TUIA 1P1RA 1AHHA 1BJKA 1G5FA 4G0XA 3TOZA 4OQDA 3VSBA 5CFNA 4M55A 4D9BA 2UYYA 3KZXA 4LWZA 2AXQA 2EKDA 3CLRC 5CIQA 2QT1A 3LHFA 4QBFA 1UBUS 4KXQA 4NNJA 2RBKA 4UQOA 5CBPB 4Z54A 2V7WA 1E9DA 3E9MA 4HH4A 4OA8A 3WYBA 4LOJA 3V4ZA 4JI7B 1YCDA 4D8UA 4F6RA 1EUZA 1JKFA 2XF8A 1W25A 2VS1A 3DCYA 1L7QA 4LI0A 3I2JA 3TNYA 4A4DA 5K2OA 4W5NA 2EHDA 3T35A 4MCHA 5E95A 4KXUA 1R4MB 4RL6A 5JSUA 9ABPA 3T3IA 4IQFA 2QT9A 3COPA 4RMHA 2IYWA 3WGNA 4O08A 5K0SA 3I61A 1O5OA 5HJEA 2BBWA 1DUVG 3SXUA 4QJ4A 4GGPA 2OLKA 2GVNA 4AXXA 1GR0A 3N6RA 4O3FA 1V43A 2CDBA 5WRFA 3DMHA 3AKZA 1OBOA 1U4OA 1ULHA 1E20A 4M46A 5KNDA 5KX5A 3H97A 4P33A 5ESDA 4KBYA 3MWDB 4B32A 1EQAA 3NP9A 4P84A 5CX1B 3R0QA 3V46A 3L8ZA 4H77A 2EGHA 4DG9A 2NQ8A 2AJBA 2B6HA 4GKVA 4CTNA 1Y9JA 4INPA 3F3SA 5CB4B 2CNKA 5AKXA 2XUQA 3PNPA 1I2BA 5JNLA 5EG5A 2VTDA 3GG9A 4E2YA 1M0SA 5IF3A 4QHTA 3LUCA 5EJFA 3SBXA 3C3YA 3D6NB 3GFRA 4YI5A 1TK9A 1V8DA 1U2GA 2B92A 3DV0B 2A14A 1GG2A 1I24A 1QIFA 2GM5A 2OZLB 4TWZA 3COZA 2D2EA 1TTQB 3G0GA 2HF8A 4NECA 4CMIA 3GLFE 3EIOA 5K20A 3N07A 3S1LA 5MFZA 1T8TA 3BTUA 1LF0A 4PO8A 3QV2A 3H11B 1FCJA 2XGMA 4G0MA 2VP3A 2Q6IA 3RASA 4BV8A 2B9EA 3GNTA 4ILEA 1B8VA 4NF2A 1ZBQA 4HDNB 3EXEB 3ER8A 1UMDA 1E8NA 1TOAA 1WKCA 2YCLA 1RWPA 2Z04A 1MHPA 2ZT7A 3F8SA 3C6YA 4J07A 1Z6XA 4TTPA 5HEKA 1KDZA 4E7PA 4F8JA 1NI5A 1D1TA 1JFVA 2WSLA 1LTQA 1PWEA 4MR7B 5AKZA 1U1DA 3QE9Y 3AM1A 3NGXA 3EHDA 4PGGA 2A7QA 1MGPA 5DB4A 4URHA 6AT1A 5K45A 5KC8A 1NE7A 2WVHA 1KJYA 4B09A 1R0KA 4NMMA 4FFSA 1FSPA 2DSNA 1E61A 4RLHA 2G1PA 1E79D 4M0UA 2O14A 4A8TA 4D41A 2VH5R 1P29A 1Q44A 3P2EA 4OGFA 1UKBA 5EJ6A 2FWMX 3K70D 2NO7A 2J08A 1VIYA 1NSFA 5CM8B 4E13A 5EFOA 1DIOB 2QLBA 1BX0A 1DNPA 2Y1GA 6PFKA 1PI3A 2I9KA 5ALJA 2MU1A 1IMJA 4JIGA 1Z5UA 2EBHX 4OFZA 4AYXA 3EPLA 3N2LA 1YRAA 1JAXA 2A9FA 4TVKA 3RHSA 2F67A 1J70A 5HS6A 4EPXA 5L51A 1Z18A 1E5QA 2J3KA 3Q3EA 5DWDA 2JAXA 2FSIA 3RAEC 1RJWA 2DQ4A 3MUNA 1PN3A 1AKNA 3Q9LA 3CW2A 4H6XA 4CEHB 2QY9A 3ON5A 3GZTB 3GHYA 1TI7A 2Y68A 2AXEA 1V9SA 1S89A 2YXLA 2VLBA 4MR8B 5ELXA 2VUTA 1XPRA 2VYND 4AQYB 1USGA 2ZRAA 1QQ7A 2NQ2C 1CQPA 2HT1A 3R5KA 5E6UB 3LPAA 2G1KA 4LXHA 4AN4A 5DO9A 5FJJA 5KYGA 1QFSA 3SZLA 3M6WA 3MN1A 1CDEA 1KQNA 3G85A 1N8SA 4L3OA 3STXA 4YAUA 4PYMA 2GEFA 3B6IA 3QQ5A 4KNWA 4ZO8A 1Z0FA 4O1HA 1M2VB 2OZPA 3PKJA 3FI9A 3K1JA 1XRMA 1Z2CA 1GRCA 2QRHA 4U8HA 1SU4A 1L7NA 3GLRA 2OC9A 3VISA 2DOKA 2CJWB 4MZXA 2G77B 1V3TA 3FCSB 2JLQA 3CVOA 3JALB 3M2TA 5GV8A 2OBXA 5FDFA 1PUXA 1Z4IA 3TTSA 1ZNQO 5LPNA 2CNLA 2HIHA 3TZLA 4KXVA 1KOLA 3MLAA 4L8VA 4M36A 1YB4A 3T3MB 1HZJA 2VF8A 1D4ZA 3OY7A 5LJLA 3U3MA 3ORSA 4GM0A 2QQ0A 4OQNA 3EPJA 2RD2A 2WHPA 3C70A 4FSDA 4G9BA 4ZZ2A 2B82A 7ADHA 1U7OA 1MN6A 1XAIA 1C81A 4NFSA 1OILA 5D8DA 3RIEA 3WYGA 4AZSA 1M2EA 1UFRA 3K9CA 4DKXA 4EBBA 5HKBA 1VHDA 5IWAB 5GPBA 1F1JA 5JW6A 2PSHA 4D97A 2AZXA 1TUEA 1X9HA 2Z2ZA 3QLEA 1N6HA 2GUGA 5FYQA 3WGHA 1JSXA 4CIDA 2IU3A 1E2DA 4DQDA 1T5SA 1QU2A 1KYZA 2KHZA 4QBTA 5C7LO 4I6JA 2I91A 3DFMA 4KI0A 3EK2A 5AO9A 4C5AA 1MJNA 4JT9A 2MTBA 3Q0TA 1JU3A 1H0RA 1YQXA 2E21A 1Z8FA 1OXMA 1E1CA 1W6UA 2D54A 3R3XA 4M9CA 3ANNA 2TECE 3D8TA 2PZJA 4M9QA 3FIJA 3KOWA 3UJAA 2WYHA 2EFEB 5JZVA 2B4RO 2NU8B 3FPGA 3PHIA 1ULAA 4FUTA 2ACVA 2P6OA 3HV2A 3QENA 2PKYX 4MW6A 4RCZA 4X3CA 2Z5VA 4D9MA 3WLMA 1OZGA 3K9WA 4G5HA 2VHYA 2XEXA 4RBNA 1ILWA 2FB9A 1R6TA 1T91A 5EXSA 4BQNA 1G8AA 5F64A 2R0QC 1GNPA 3LLCA 2AEEA 2F3SA 2H7CA 3L6UA 4V39A 3TB4A 3AETB 1KO5A 1ZRNA 2A0FA 2WFLB 2EKLA 2JFGA 3EXIB 3LLSA 3UJDA 1L6RA 1LSSA 1RWNA 2PUWA 2YRWA 4MRAA 1ISPA 3H2ZA 3F7TA 3DA8A 1P3Y1 3WWCA 1VJDA 1E1MA 1OLXB 3U7GA 3QLVA 3ZY4A 3DQPA 1DSSG 4KL8S 1E5XA 3KYDB 4TWRA 3JATB 1K9SA 3WRWA 2LCFA 2P4SA 4WLOA 3ILSA 1PHRA 3I1FA 2UVQA 4Q16A 4U7JA 1P3JA 2WSSA 1CJMA 3FUVA 4FDLA 3K09C 1TQDA 1BCRA 2OHGA 3W5BA 2GPNA 1G7RA 1V41E 3IR7A 3T9EA 3U4HA 3ZDBA 5BSMA 4RO0A 2PMBA 3TDMA 2JBAB 2ODTX 3BQNB 4IWYA 4B2IA 1SOAA 2JS7A 4YCCA 4KQGA 1H94A 4I4TA 3CS3A 4US0R 1E8MA 3KOMA 4YRAA 4G5XA 4P34A 2J3QA 3Q3CA 1JDJA 5CYFA 2DECA 2C94A 4LJ6A 4CODB 5L3QB 1X2EA 1WSAA 4P8RA 4ENQA 5H0IA 1KK0A 4V24A 4OMUA 2CDAA 3LV8A 4PZAA 2R7MA 3PT5A 4QREA 4R2JA 5EQJB 4UEWA 4D25A 1UM9B 1I8TA 3GOQA 1HT2E 2UUAB 4Q15A 5BYBA 3ONEA 5LMCA 2EZUA 3OFNA 1K8QA 2JARA 4PANA 4WXYB 1EIZA 2CUZA 3WL4A 3QMVA 2LD4A 5I9MA 5AK6A 4BEVA 3CSSA 1DEHA 2EGUA 1WA5A 2DFVA 3EFOB 4AS2A 5AW9A 2PEYA 5B64A 2GO7A 3FUTA 3W9YA 4M6WB 1Z07A 4TSKA 4WXRA 3KKKA 4X1YB 4TYWA 1RM3A 2AX3A 2P2GA 1BEUB 4K8RB 4II3A 4QGFA 3TM4A 3UJBA 1E2NA 4IIBA 3QWIA 1TEZA 2NG1A 3NLLA 2ZJFA 5KI6A 1E0DA 3VR4A 4TMXA 1WHSA 2OAQ1 2RONA 2VDPB 2AC4A 4WBNF 3L7OA 3QBEA 2CN1A 2QX9A 1J0DA 1PL6A 5KOJA 2DWUA 3CZPA 5CK5A 4EY4A 4YCMA 1LW6E 1MJHA 3R74A 5KWIA 4B43A 1CYEA 2I6GA 1P4JA 4MV1A 3F4KA 1JZQA 2DTDA 1IK6A 421PA 2PEZA 5I7SA 5IX8A 1LH0A 1CEEA 1H65A 2PSSA 3E0QA 4WQMA 4ZI7A 5EKUA 3W5HA 1RXWA 1NX9A 3NWOA 2QRZA 1VSTA 3RGWS 1W36C 4BX3A 3PHBE 4FDAA 4F4IA 1G7SA 5B4UA 5BOSA 3DTVB 3CB2A 4Z0HO 3T7JA 4CF6A 2YYZA 1QR6A 4FPXA 4X45A 5A4JA 2CLOB 1A76A 5DHSA 5LBTA 3LYLA 1TM5E 2GEDA 2IEAA 4AWAA 3CA8A 3S8EA 1BKSB 3LRPA 1O4WA 5ITZB 1HRKA 3B1YA 1Z5PA 2PV7A 3V33A 3KFLA 6REQB 1Z7YA 3LQQA 2HFJA 1E9CA 3MYRA 4D3FA 1FRZA 4N0QA 2EGGA 2NVWA 5JI3E 1TCCA 1CRZA 1YUMA 1WLSA 4JXKA 4XDHA 3P4XA 3AHEA 3NEPX 2BKUA 1MG0A 3ENNA 3VDNB 4FGZA 2X5JO 1U8EA 2QZ4A 2NZ8A 3O47A 4XA8A 3MM4A 3KUCA 1HOTA 4GVXA 3HJCA 1I30A 1FS6A 5D7BA 3PQ7A 3MWFA 1XXLA 5EJ8A 5IJ9A 3EWNA 1HPLA 1OZFA 2KLHA 2OO5A 3LXXA 1KDYA 2ONZA 5IVIA 3WLTA 4A26A 5BVHA 3EZNA 5GGYA 4F4UA 1JZSA 3H6KA 1B73A 4EFDA 4UMFA 3AW9A 3EE6A 2BY4A 3OFVA 5G0UA 5FI0B 1KL7A 2PXHA 4HEHA 4XTRA 2IHTA 4ISCA 4DLYA 1TCBA 2P9TA 1DIBA 1Q7GA 3KTAB 1LBIA 3C2QA 1UPXA 3F74A 1Z5GA 4MYHA 2GETA 4JVSB 3L18A 3ED1A 4PLVA 1OX4B 2JATA 4C5CA 5IKPA 2ETVA 1SUWA 2AUMA 3GDGA 3Q88A 3KAQA 4KN5A 4K9RA 2VHEA 5CT6A 4R3NA 1S8AA 2LVBA 5D00A 5EINA 4J0GA 4F12A 2B99A 1SURA 4JOCA 4F38A 2GRAA 2IA5A 4C0AC 3HLYA 3B6ZA 1OT3A 2QRNA 1IK4A 3BD7A 1CS0B 1U80A 1U2PA 2V4ZA 1FVHA 3Q1LA 1P6QA 4ZVSA 5JY6A 1QTRA 1ICEA 3UCEA 3U39A 5IFLA 2ZRFA 3G68A 4KGDA 1FNBA 3TMKA 4G5SA 3AVVA 4TTQA 3DBHA 1G20B 1ST2A 3D7RA 3AFOA 4O4JB 4Y2SA 2JGLA 3PNLA 2E55A 1VHTA 4RS4A 1Q19A 3IPRA 1H5UA 4L27A 4RD1A 5AP9A 1LLFA 3UFXA 4AZTA 4U7FA 2J09A 3L6RA 4B82A 2YINC 3TGLA 5K0CA 4ND4A 1TEHA 2E4XA 1JTVA 2GZ3A 3E22A 3ENVA 4OHVA 5HKKD 1E4EB 1ZLXA 2OHXA 1UMBB 1GGVA 2IOQA 1YACA 1CIVA 2YS7A 4UJ5A 4EKDA 4GS5A 3CH7A 1AGRA 4CF4A 4AY4A 2NV2B 3BE6A 1BQ4A 2V45A 3TECE 1QOQB 1OLOA 1U2SA 3CISA 1NLYA 2L42A 3AJDA 1EAYA 4YDSA 4BMCA 3KKOA 3TLYA 3ADDA 4WFQA 4XSHA 1R4NB 4MDFA 3REOA 4JYAB 3EF1A 2P77A 3GHHA 5FTKA 1SEVA 3T7KA 3KT0A 1G66A 2NPFA 2B8EA 3TTTA 2FRDC 3WL3A 2D7DA 2GASA 1NJGA 3AF1A 1QHNA 1H2EA 1RIIA 2PSEA 2VT7A 3MJHA 5UKDA 5FPHA 3UJ8A 3HZZA 3CVJA 2AZDA 4PZ0A 3ZWNA 3TGWA 4AC9A 2FQ1A 2G7ZA 1ND6A 3QG5A 1FQOA 1IC6A 1MC5A 5JANA 4Y9DA 1JPUA 3M6IA 4N3BA 3OPYB 4YMUA 2ZB2A 1AD2A 3EQ9A 3I58A 4GYJA 3SM3A 3WQRA 4XIIA 1SUFA 3IIIA 5LP6C 3QPDA 2HSZA 3SAJA 4F92B 2XNKA 1GQYA 3A0RB 3B1JA 1UPAA 5ERYA 3TIIA 3DZCA 1BAPA 4KO1S 2WQ7A 4Q9DA 3TIFA 4M0FA 1L4EA 3GFPA 3Q8LA 3X1DA 1XTQA 3ES9A 2XIJA 2IVZA 1U4NA 1WTAA 3AWDA 1SXJD 2XQJA 3K0AB 4M1MA 4Y2RA 3S2IA 1ADCA 1D7OA 2FJ0A 3KYCA 3EXAA 3NBMA 1FQWA 4ON9A 1G8YA 1EQUA 3KLBA 5CAEB 2XXAA 4HYYA 2BEWA 3FSGD 4DLLA 3PX2A 2GBIA 3ETCA 4JOBA 4NU5A 4OP3A 1JYFA 4IJWA 3AYZB 4PLWA 3A6PC 1MORA 3KJZA 4L50A 1I0IA 4Q3KA 3GJSA 2OILA 2QRMA 4GR9A 1EHCA 5EFZA 2Q1WA 3PL5A 4RPJA 3O2JA 1FFAA 4MQLA 4XASA 4EX6A 5LA6B 2VT6A 3BXFA 1T4BA 1ECCA 2VAWA 3HP7A 4WESA 3WBJA 1ZJ4A 1B1AA 1TCUA 2Q3JA 4R41A 1T13A 5JIBA 3DLIA 1LC0A 2CHGA 2EX0A 4KCGA 1LU9A 1KTIA 3AYXB 2RGAA 4L4RA 3SKVA 1GTSA 2O3TA 4KHZA 3ZOZA 4BPBA 1N4AA 4DRZA 4KXYA 221PA 3MWEA 4O2AF 3CH5A 3PXBA 2QL6A 4E09A 1GQQA 1A8UA 1BGWA 2I80A 3S81A 1TQHA 2X0IA 4CR8A 1RI4A 2WWRA 1ZK4A 3TEFA 4C03A 4KWHA 3O82A 2UYQA 1Y81A 2PZKA 1DCTA 4F85A 4QA9A 1DHRA 1Q7TA 1VE9A 2G1JA 3K6RA 1JAHA 4RJ2A 3U0VA 4LQ4A 1DKNA 4IWNA 5FHQA 2MSNA 2HIAA 3R5SA 3QFCA 4L5YA 4ZOLF 4ZHQF 2IUFA 2WZDA 5JAQA 2Y1CA 1XJWA 1Z34A 3A3PA 5I9SA 2X0DA 2CNNA 5BQFA 4ZRDA 1XQYA 1JEQA 3D7KA 3AF5A 3AR4A 3AM4A 3OTGA 3AGQA 2YN4A 2I6QA 2V8BA 2CLEB 3CPHA 3IP3A 3PQCA 2G09A 1NFRA 3QNWA 2CXHA 4ZAGA 3QEAZ 2H9AA 4GEKA 3V7FA 2XX3A 3TSOA 2AFIB 2JANA 4K9LA 4R8MA 5P21A 1B0PA 1XQ9A 1DADA 1LSJA 1XE3A 2NPIA 3DCIA 3N75A 3W5UA 1KH1A 2MSDB 5G3ZA 3TDNA 3MTGA 4TL6A 3OIUA 2CXSA 3ORRA 1FXWF 3GFTA 3QUBA 4BQQA 4G8CA 5JAZA 3SQXA 2BE7A 4AKIA 2QQFA 1KI3A 2QR3A 4IRXA 1Y9EA 2Q46A 3FETA 4UHJA 1DOZA 3ESYA 1O58A 1CRQA 4RLQA 3V8EA 3VR2D 3HUTA 1PK7A 1Z8DA 1ZINA 2YZGA 3LSYA 4IV8A 4OYYA 1WR8A 1F2TB 2Z9DA 3GCXA 1JI3A 5FBHA 3RROA 4XB2A 2C0PA 4R9VA 4EUEA 5LP6F 2O8EA 3E03A 3M5WA 2VPXA 3JWGA 1I3NA 4WZ6A 5L3ZA 4OM7A 5TJHA 3UIEA 3K9QO 4JWTA 3H0EA 2FN4A 3RM3A 1VL6A 2YHUA 4IIJB 2KI5A 4HQ0A 4YQFA 4W5TA 2NVOA 1P45A 2JCXA 3IQDB 2P35A 4JNCA 2FMTA 3EARA 4H0NA 3MZ0A 5F2OA 1EE2A 3Q1KA 2FFRA 2YL2A 2C3YA 1IFXA 3GGPA 3KJGA 4O4HB 3HB7A 2WT8A 3JQ9A 4QEZA 5HKAA 4J0QA 5DIFA 4X00A 1REQA 2AFHA 1RE1A 2AUTA 2I33A 1RQLA 2MCFA 3BRWD 1DFHA 3L0CA 1ZP6A 3C5VA 3QFHA 4JSRA 2OYSA 2PFGA 3VPBA 3QSGA 3OQIB 3F90A 1VDZA 1VJTA 5DYWA 1X38A 4L8FA 5TV2A 3QLUC 4JMPA 4CR7A 1T9DA 3K32A 1XB2A 3BFXA 4PSUA 4WADA 5U1PA 1WXHA 4OPMA 2DH5A 3GDWA 2BUCA 4HH3C 4OOEA 1E66A 2I6FA 4Q1CA 4R51A 3GH1A 2CDRA 4RGYA 4P5PA 1XC7A 5GONF 1CF9A 1N5KA 3QBVA 1JVNA 2W42A 3ILYA 3U4CA 2I99A 2MMGA 3D0QA 1I6MA 4M0CA 4WACA 4GZ6A 5H80A 3LUHA 3WQHA 1R5NA 3PYLA 1B74A 5KJFA 1XYVA 2AJLI 4LKOA 4CL8A 1IOVA 2FFHA 3FTDA 4K5QA 2EFDB 4O4IF 3CWZA 1PT6A 3QW2A 4Y0NA 5BSTA 3H05A 3PNSA 4OO3A 5COAA 3RDPA 5JI2E 2DPXA 3CM0A 1QWOA 2ZB8A 4HS4A 1IY8A 2FMIA 2P2NA 2V0CA 4ZT4A 4OB7A 3HKBA 2B4YA 5ALXA 1L4HA 4ILKA 2WYVA 3WNBA 2CXUA 1VL0A 1NVTA 2C4NA 2Q50A 3EVEA 3JZMA 3X1YA 3T3DA 5C3UA 1OBHA 3JVVA 5AVVA 2H4XA 3KJFA 5K9ZA 1HDOA 2BI4A 1EZ1A 2FOXA 1PEKE 3HDTA 3TTYA 3KC2A 1HY3A 2WG2A 2ZB4A 5AFSA 1C7RA 2F3PA 2PX2A 3A9UA 3FPLA 4YLEA 4RGQA 4ZEOA 3H5LA 3KTAA 1KHHA 3L0OA 4JENA 4F21A 5IDQA 5KWJA 1F38A 1PSWA 1XT6A 1JSCA 3DCJA 3QF4A 5E38A 1JXMA 3U7HB 1ND5A 5J2UB 1KVQA 1TECE 1E2GA 1CJBA 1E32A 4H1TA 4CL2A 4WI1A 2P4UA 2GLUA 2CJPA 2WT4A 4DW8A 4FCTA 2SNIE 4UATA 3T7IA 3DZFA 2YHSA 3KZ1E 2IWRA 3WB9A 3K09A 1KJIA 1VPEA 1M1YA 3ID6C 4IHKA 4CCSA 3WMEA 2A9RA 3DL0A 4LTMA 1GN8A 1UP4A 1XZGA 2Y1OA 3D6UA 3FNHA 3K20A 3Q85A 4LBZA 4XM0A 4BYMA 1AJEA 1DU4A 2CB0A 2OQIA 3PC3A 2V5AA 2WWXA 2PGOA 4MRMB 4P4GA 3ZS9A 4PIMA 3R4CA 3SE0A 2CEAA 4C2BA 3HCWA 4RESA 4ZU1X 4TMZA 3ZD7A 1SGWA 3PGLA 4B4VA 3EDQA 4RTQA 2ZFUA 4IJ6A 3STUA 1X7ZB 1D04A 1YIDA 2C5EA 1M2FA 1A97A 3NV9A 2PT9A 3S4YA 1JKMA 4PLZA 1AXGA 2HWWA 4LOHA 1ENPA 3HYNA 4EUSA 2BGMA 4CCYA 3EY4A 3VV2A 3K0FA 4UVHA 1KAOA 3SIPA 3ZHVA 4OX9Y 3ENWA 2FZCA 1LBTA 2ZIEA 2GN8A 3ICVA 4IMPA 4RWZA 5T67A 2JBHA 4AUEA 4AO6A 4ZKDA 2J45A 5LDHA 4Q21A 3FSGA 3OIFA 1TCVA 5J1TB 1RI5A 3PE3A 4KQKA 1RABA 1RWQA 3I9KA 3NBFA 1JAZA 1PJZA 4A0RA 1ZSYA 4R71A 1XHFA 2FP4B 4BS9A 1YVDA 4JFAA 3MAJA 4N1AA 4QYIB 1Z3CA 2QE7A 5L3QA 5F3WB 2GZRA 4KDRA 3S7ZA 3DDCA 1HRDA 3E0XA 4FC6A 5J4KA 3G0OA 1IBLB 2C9ZA 2QLMA 1KE2A 2PYZA 3K5HA 2BZSA 3IT2A 5GP1A 2H65A 1SR8A 3MXOA 4BNXA 5LSAA 2R5NA 4NE2A 5LKAA 1DLIA 4MUJA 2HBYA 2ZS8A 4IDAA 2CXRA 1GPAA 1C7ZA 4ZAZA 3ZZ0A 3UWDA 5K4GA 1CE8B 4TUYA 4B71A 1A4XA 3B2QA 4AN0A 4WBSA 1I1NA 3LXRA 3AUKA 5FBLB 1MHTA 1XR3A 4DCPA 4LYJA 1IEXA 3OCWA 2O20A 4R8LA 2BP7B 3FKSD 3THOA 3TX6A 4PPFA 2NLOA 2BFNA 3GPDG 2FEMA 2UVPB 4ZYUA 4KR0A 1FVOA 4L4ZA 1L5KA 1U99A 5ELLA 3U9TA 3KJHA 2PJRA 1WZ2A 4H6WA 5IM4F 1TQ8A 4RVCA 5CCDA 4RDIA 2OV6A 3PU6A 3BL5A 5DHUA 4ZVKA 4CIWA 1SH7A 4F97A 3ZQJA 2GM9A 3ESRA 1T3LA 2RI6A 4Z7JA 5EJ4A 1FUKA 2W2NA 2FUG6 4ZMBA 3Q7IA 2FG7C 4KQ2A 1G20E 1T3ZA 1ZICA 2Q49A 3EAQA 4B7XA 1I9CA 1DTWB 2PRIA 2Q9BA 2WF6A 3BMCB 5IXJA 1ESCA 3IP7A 3QKTA 1MC8A 1ECPA 1BCSB 1PJ4A 3QFRA 1M72A 4C3UA 4NE7A 1EFRD 3BHIA 3LUKA 2PX4A 5AI4A 4GOMD 1DZ3A 3LWNA 4KPUA 4FYVA 1W0KA 1HYQA 2F3UA 2RC6A 3OBBA 4M86A 3OKAA 3PWZA 1NYTA 2QKYA 3LJKA 1NONA 2JKYA 1HO3A 1WMBA 3GRPA 3IP1A 1U31A 1G3UA 1N8KA 4QUDA 2WU1A 3S29A 3U3OA 2QNBA 5EMLA 4Y30A 1U5CA 1NNUA 1WL8A 3GLQA 1EHYA 4C7XA 5DWQA 1RMQA 2JHCA 3RYIB 2RGEA 4C4OA 4V0OA 1SHLA 5FUVA 2ZU6A 1BMQA 2NVUB 4CI9A 4XYGA 4J0DA 5EMMA 3ZDEA 5BWNA 2G25A 3BOSA 3KCNA 4PX3A 2OXIA 2AVNA 1M34E 2HA0A 3A70A 3BG5A 1O9HA 4V38A 5CDHA 1FDTA 1H3NA 2WQZA 4NZNA 3TTUA 4D0SA 4UFPA 2EW8A 4DPLA 5DTEA 5FOWA 3DE1X 3MGAA 3A1SA 3VYSB 3VZDA 3G2OA 2W4MA 2E9SA 5DW3A 5EWMA 1B1CA 4UEKA 3E8MA 3SNHA 4TZ6A 2HMAA 4R31A 2OHIA 1JHZA 3FMFA 4N7BA 4REOA 2A30A 2ZXEA 3D7MA 5BMOA 2QA5A 1PJ3A 2O2XA 5K8JB 1LBSA 2HAEA 3N0TA 3T5PA 3V97A 2VNJA 4L2IB 1CVLA 3UFBA 3ITEA 2QZSA 3ZH9B 4TRNA 2YJTD 2REQB 3I6IA 5EHZA 3OFKA 4KGVA 3KK0A 2OUKA 2CYBA 3O90A 4NAVA 1Q50A 3HGMA 1GHTA 2O54A 4J4TA 2VZ0A 4OFWA 2YY5A 1YJBA 4XI9A 4EA7A 1MB2A 1QCZA 4AB1A 1QVZA 4QTTB 3I1YA 4RV9A 1TK2A 3A2KA 1JHYA 1H1LA 1J5EB 1KPGA 1IAQA 5BPHA 2Q3FA 3BB4A 2XTNA 3L7KA 3L8YA 3M7IA 2VNKA 4Q9LA 2WDPA 1LF5A 2IYXA 2GD0A 1GCAA 4FZ3A 2BL4A 5AVQA 4V03A 3BIOA 5CVVA 3UHPA 4CM9A 1NAIA 2JAOA 5K3AA 4I36A 1U0HC 4FFPA 4X20B 2Q5EA 1CDDA 2B25A 3DFKA 5KJEA 4EATA 3R6WA 1J0CA 3NAGA 5IXYA 2V54A 4C5BA 3AQIA 3B7WA 3QVMA 2FX5A 2ASEA 1L7VC 3H6HA 4LY3A 1F4PA 4X44A 3ZWWA 4C3ZA 4ESOA 5A02A 1G59A 3IHTA 4X41A 2I3DA 4ZODA 1CUBA 1JBEA 1DL5A 4HGYA 5LP6A 4CT0A 1ZHFA 3IGFA 3EWSA 5CX1A 4OOFA 1IQUA 3NVAA 5JVDA 4ML3A 5EOVA 4ZOLA 3OZTA 1GSHA 5KAMA 4CTMA 1G17A 1EVQA 1S0UA 2VYFA 1Q6YA 3GLHE 4L0MA 3U6BA 2F4VB 2HMVA 4UJ3A 3SYTA 3T3HA 2X8JB 4QPZA 3LOUA 2BHLA 2NW6A 3MCZA 4C29A 1CLUA 1SUDA 1OXUA 4IIUA 4HB2A 1A5TA 2FN9A 1IUPA 2WF8A 4PC6A 5EGSA 5CTAA 2ANBA 5JLJA 4LMAA 4L02A 4Z0PA 4WBNA 2WSIA 4RS3A 4R1SA 4FYMA 4V3BA 2G72A 1Q3TA 3COYA 5DEOA 4ENRA 4MS3B 3E5RA 1FTSA 3NTRA 2VNIA 3A14A 4HMPA 4CMAA 1DG9A 4CQMB 1WXWA 2PA3A 4A1OA 1P77A 4W8GA 4C30A 4G5YA 4OXXA 1IPHA 1WB5A 3CKYA 3Q15C 3PXXA 4CF5A 2C82A 2W6MA 2WMNB 1ICIA 1Q83A 3OAAD 4BJ3A 2PMDA 4EF6A 5BR4A 3NHMA 1C30A 2CCGA 5FNVB 1PL0A 2I1QA 3E70C 5B4VA 1QMGA 4WFKA 3I34X 1U2QA 3D6MA 4FE4A 3AK4A 2G9ZA 3NVDA 1XNRB 2WP0A 3LBFA 2XGJA 1N9GA 2QSYA 2VH2A 3FZYA 4L9SA 5J2UA 1YU6A 4C7MA 1HFJA 1BMTA 2HDHA 3K1AA 3W05A 3ZGYA 2QRQA 1ZUWA 4IF4A 1A71A 1RDFA 3QM1A 4M9UA 1X1CA 4MW0A 3ZQ6A 4AMUA 4UTNA 3DUWA 1G291 1XA4A 3GQBB 4WUTA 1PV4A 3L7JA 4B33A 1P0QA 4XOUA 3C7KA 3FWYA 1VGRA 2XDQB 1W59A 4D45A 3K2BA 4TLEA 1OFGA 4B35A 3BFJA 3D3QA 3UC9A 2M2IA 2IYTA 3GLIA 1J9EA 4LF5B 3E3LA 3AOGA 1XXHB 1DV2A 2WPNA 1W5FA 1YONA 2RHWA 2YJ4A 1CNMA 3GEEA 3JX9A 3H7AA 2YCBA 3JQ7B 3TWOA 3H4IA 4MPJA 4E94A 4BV2A 4HL6A 1XU4A 1BZYA 3KQOA 4FIDA 3M3PA 2C5FA 2HDWA 2CLLB 1N5RA 1GTVA 2CUKA 3CX6A 3RIYA 3PLNA 2Z4SA 1O8CA 1EYZA 1M5TA 5IEJA 2B36A 1D5CA 1SBYA 1UT8A 1JHUA 2P2DA 4RA6A 3TLEA 3PXGA 3U7FB 2EFGA 3BJRA 1GQRA 1T2NA 4JUDX 2QGZA 4B47A 4K26A 4MVJA 1P7YA 4DMMA 1SC1A 2R2AA 1IN8A 4DZTA 1X1RA 1J2EA 4Z2AA 2XB2A 1KEVA 1B42A 3BDIA 5MN6A 5BN5A 3RQSA 4FZVA 1NXXA 4WXHA 2SHKA 1EE1A 4Z9AA 2FZKA 1J00A 4GNKA 4QVKA 3VR3A 1PGJA 3UOGA 1NR7A 3ZCSA 4FYXA 2OP1A 2PWAA 4E7OA 3L06A 4D4KA 3UJCA 1MX5A 2CLHB 2QZ9A 1TMYA 4LK3A 4ONEA 1AMNA 1OVMA 2JFNA 1NP6A 1Z29A 2SECE 2ZJ8A 5JAUA 2J5KA 3PC8A 1X80A 2VRBA 1T5IA 1X42A 3QHQA 2VHTA 2AQIA 4RD4A 1OZHA 2B7BA 3VHRA 5HTOA 3OZWA 3GJ4A 2K7ZA 3SNKA 1JG6A 3BH0A 3OOJA 1M6VB 4DNFA 5FBZA 3G6KA 1ZC4A 4XX0B 3T9FA 3ZKWB 1VI5A 1W4AA 3D1LA 3SC3A 1OUMA 2UVPA 4URWR 4ETWA 1R6AA 3UB3A 3DAYA 1RLJA 4DQLA 5BNZA 5BWOA 5C18A 5CDSA 1A8SA 2AFHE 2CCKA 1Q5PA 2IDJA 2IZ7A 1ONOA 5CYOA 3IX7A 2C4KA 1JA0A 3T4UA 4XUEA 3V2IA 1US8B 5K0LA 3TFWA 5B57C 5B1SA 5IK2D 3B9QA 2SCUA 2Z30A 1E3JA 2FAXA 4LX0A 2VBIA 4V1CI 5E9QA 3QEJA 4JKOA 4YQEA 2DHCA 4D9GA 1JEOA 1JFLA 4IH9A 2PJUA 2PH5A 4GO1A 4BCCA 2CJFA 4D8YA 2OPHA 3L1UA 1XCLA 4OX9B 3K4HA 4RTNA 1EWTA 2Q5JA 3V8VA 1V16A 2HX1A 2NZUG 1EX1A 4YRFA 3ZHOA 2R751 3BXOA 4MWDA 1FRNA 2GSDA 3WLIA 4D8TA 4QTYA 5I7OA 4ARCA 2RJNA 2XNDA 3GJ7A 4ZVUA 3ESXA 1RHMA 4AS3A 3INGA 3GI1A 2AEFA 3A31A 4H1HA 4EHNA 2PMKA 3NHFA 4ID9A 2VQ3A 4M1QA 1SB8A 1O3YA 2R8EA 3PHJA 3QA3E 4UMDA 1RBZA 2NT3A 4GI7A 1PEDA 1HGXA 1RLUA 2VXBA 4D0GA 2HJ9A 3KSZO 2LE0A 1K3UB 3IJ5A 1I2ZA 2VXCA 4ZIRB 3PJGA 1GQOA 2B5WA 2HHCA 5E2AA 5EC8A 5HIKA 1QDEA 2RGGA 3PG5A 4UDYX 4L7VA 1ZXXA 1QC5B 4PYIA 4G0NA 4Q1BA 4U3JA 2X2FA 4KX3A 4TZTA 1E18A 3OURA 4D98A 2E37A 1QVRA 4IY1A 1Z2OX 5AOCA 3ISVA 3PDIB 5TEWA 3VJMA 4DIMA 2OM2A 4RKYA 2VN8A 1L7AA 3SKXA 1ORTA 4BN0A 4INZA 1JE1A 4K6OA 4LISA 4OY3A 4UE6A 3QE0A 3U3JA 4ZYVA 1H1TA 1O94A 2Q5CA 2Z3ZA 1QE0A 1CUHA 2Z1NA 3ITNA 2ZRCA 4M1TA 4F6RB 1LRJA 2PX6A 1JR3D 3L1HA 2V3WA 4JOQA 4B80A 1XVUA 3AHDA 4B34A 1TLFA 1KKMA 3BE4A 1D8AA 3I42A 3WLOA 2OXEA 1I51A 1UBLS 1YQWA 4DJAA 2VBFA 4XW2A 4Z0TA 3TD6A 3V1UA 3HC7A 1YRHA 1AKTA 2PPLA 3F7OA 2X76A 4LNUB 1TIBA 2Y0PA 1GDDA 4UM7A 1HLPA 2HJGA 4Y2YA 2F4NA 2AW5A 3LQYA 4D44A 4X1OA 3RAJA 2D3TA 1U9CA 2GCEA 2D1RA 1YRBA 4BX2A 2JASA 3FIUA 3P97A 4NEQA 1Z12A 3N76A 4MGHA 1NHWA 2VH1A 4HPXB 1H2AS 2Z56A 3GUUA 3R41A 2FPRA 3BHMA 1JTFA 4AG6A 3K1ZA 2PWPA 1X92A 3LUJA 1AVTA 3SZGA 3QGMA 1L7XA 4TQAA 3SOZA 2ACWA 2ZBPA 1QS0A 2ADOA 2GTPA 1SC3A 2FG6C 2CFSA 3G2LA 1V35A 4MS1A 4PX9A 5D5PA 3PPXA 3U1TA 3JYQA 3PEUA 4ZARA 5BVGA 1Q1GA 3KAKA 4FE3A 1U0NA 1O6CA 1H66A 3EZ6A 4EYKA 5JHGB 3B3JA 3VC2A 3NOQA 4N0MA 2JI4A 1PIWA 2Q2OA 3VSEA 5JJBA 2X2PA 2CV2A 2V7EA 4R1NA 4UTOA 4Q6WA 4IIJF 5AK3A 5ENZA 3LA6A 5DHQA 2IC5A 1WXXA 4LJKA 4KZKA 3OM9A 2PRSA 4MV5A 4OHZA 5A2QA 1VE3A 5A5EA 5LU8A 3DKIA 1U2EA 1L5HA 5LP6B 4PVDA 3RU9A 3OIGA 4EECA 1Q15A 4QBHA 1NZDA 1KRXA 3ZHZA 1P4GA 4MQFA 1ECBA 3M6MD 2C83A 5FPQA 2JJ2D 1HT3A 2AF3C 4MPPA 1F2VA 3R6DA 4J7CA 2P5UA 4J03A 4PE5B 1POWA 1A1VA 2H4YA 2JD2A 4O4LA 4B40A 1QQBA 4B6EA 1Z16A 1I13A 4BNDB 2HRBA 2R8ZA 4QDKA 1BXRA 4H7DA 4DWVA 5JYBA 2O4CA 2WJWA 2VQDA 1U1FA 3QELB 4L8YA 1FLAA 1LX6A 4QUBA 3O8LA 4RDHA 3OT4A 2FSVA 3DW1X 5DLEA 1WUJS 2YC4C 3L8DA 4U6SA 4NV3A 2MMCA 5IJ0A 3JS5A 2QMUA 4MEBA 4ALLA 1TD1A 4JVMA 2Z08A 3QFSA 4AFNA 1RRVA 2I54A 3HFRA 4IRUB 1T8RA 3UB4A 3QKRB 4PG7A 2D1SA 3WO1A 3CF2A 4IX1A 4OATA 2CSXA 4UDXX 3OQMA 3QBTA 4DLBA 1PZFA 3LP5A 3ZHCA 3LVQE 3COSA 1T2UA 2GWRA 2ILTA 2ZSJA 3HU3A 1SK9A 1MW8X 2P40A 2CL0X 1R8SA 3CY6A 3E1GA 4H7HA 1IRXA 4LGCA 5ALKA 5B6IA 2GCPA 1GZ6A 1TPYA 5K8LA 4S1VA 1AKYA 1DEAA 1TA4A 2HV8A 3Q8WA 3OC6A 2CXQA 3A26A 5BMVF 1C1XB 3CTPA 5K0JA 1T3TA 2PCJA 1Q12A 3A06A 4ZREA 3TW6A 4X7BA 3HZHA 4XQEA 3K2EA 4FNGA 4NK4A 1RLIA 2NN3C 3IEKA 4RJKA 2FW9A 2HLHA 1XXHA 1ZOIA 2KMLA 1R16A 4IFEA 3SBDA 4RIFA 4JBXA 1KRWA 1SK8A 3QBDA 4C0QC 3WHPA 1MR3F 1PJLA 5E9AA 3ZDYB 4C7KA 4UC0A 2C8LA 1SELA 4DV7B 2Z6QA 1JSRA 1IHOA 3DMRA 3UMRA 1IQ0A 1KIMA 1TU0A 2Q2NA 1PDVA 3VAAA 3VV3A 4QYXA 1QQAA 1RRMA 3L7CA 2FPUA 3TE7A 5CD1A 3QUCA 4K3VA 3LPDA 1ISGA 4NCKA 1EG7A 4IVPA 4KIGA 1XU9A 2QMQA 1Z6GA 1ZXLA 3CLRD 3OP4A 5DDIP 3DH0A 2NXJA 3WBBA 1PTKA 4GP9A 2XNHA 4CM9D 3D5EA 5KYWB 1ZSNA 3QE4A 4XVRA 4EJMA 1QK5A 2K4MA 2BM9A 1J25A 4GSLA 4RE5A 3OZEA 4NOMA 1EWKA 3JYNA 4D9HA 1FJHA 2P75A 4L6AA 3IMFA 3VPHA 1W96A 3OWOA 2JI9A 1Z4JA 1ZU4A 2QUAA 3KTDA 4WKGA 1QCCA 1KP3A 2I7VA 3M6FA 4GC5A 5DK6A 5EN4A 2PL3A 1MC4A 1Z88A 3FPSA 3V80A 1G21E 2XGSA 4Q18A 2YZMA 2WUWE 3RAGA 2UUCB 5I3ZA 3D3WA 4LRSB 2CNWA 4WINA 3OTWA 1XTBA 1RJEA 2X6QA 2HOQA 3MINB 3OF5A 3RJZA 3ZDZB 2BEVB 4NZOA 4C22A 4A10A 3AESA 1N0UA 4ZEVA 1BCSA 4OU5A 5FFFA 5JZ9A 1NHGA 2LR0A 4UUPA 4EW6A 1DAOA 4NYJR 1LCIA 2GRUA 1JG2A 5H81A 1N8NA 5FKJA 2J6BA 1ZCBA 5FBWB 1ZW1A 4UXIA 1F7UA 2F8SA 4RHCA 4KR2A 1LS1A 2OTCA 4EAQA 4NJMB 1NZJA 1Z0IA 4LJ7A 4R9NA 5AI5A 5EMKA 3TEMA 1HZZC 1UC8A 2WUDA 4NCAA 5THQA 1UKYA 3NHYA 4B44A 1T6ZA 3MAAC 4ZYLA 3G9UA 5AW6A 2XZLA 4HRAA 3TZQA 1YVUA 3VAYA 3UK6A 3TJZA 1PNOA 3BSFA 4HXGA 4ZVPA 4Y6OA 3TKYA 5EUQB 2WILA 5I7FA 3UGJA 2NVUA 3OLQA 1MJGM 3RVRA 3S28A 5I7EA 5KIAA 1YZNA 5EUMA 2IHVA 1RJGA 1ECFA 3FDXA 4UZEA 1R4MA 3O3NB 3K96A 4UCFA 4XVQA 1QRDA 3ETDA 3RRYA 3KDSE 3DZGA 2DY1A 4NAUA 3ZDAA 3A4LA 2O8FA 3GLHA 3EX7C 3IIJA 1UM9A 2EARA 1BD4A 3K73O 2ZYRA 5G0SA 3UMBA 2Z9BA 5ICSA 4ZALA 4ADSG 1CG6A 4U63A 3UEOA 4NDZA 1VG8A 3ZWAA 1YE3A 5BUCA 3RADC 1LEHA 2W8BB 3I6BA 4M0PA 2H51A 3KUKA 2AWNA 4TMFA 4V2IA 1ZD9A 5ULLA 1V8PA 4KFTA 5CIYA 3MT9A 2JGEA 1R4AA 5GZ3A 3N39C 2HEIA 2JFZA 4ZIRA 2H63A 2AMVA 2HZ7A 2WOOA 4Q93A 4QU8A 2GAOA 2GT1A 2YJ6A 2NQTA 4UW9A 3OLYA 3PVZA 1SCUB 4OI1A 2B0CA 2ZSKA 1QU3A 2RHOA 2AN1A 1H93A 3DDNA 4BQEA 1L4YA 3DV0A 2ERYA 4KRXA 5F12A 3JQGB 3W2HA 2ZUTA 4BN4A 3I52A 1SXJB 2HDNB 3PENA 1C3EA 4UU1A 2VA9A 1KVSA 3B1WA 1DBVO 2R66A 2EKZA 3R23A 2YHIB 5AIAA 1RIFA 3N2ZB 5BSKA 3I01M 4HDNA 1GKUB 3BVPA 4HN9A 2OHVA 3FFTA 3TBKA 3P9XA 3DMYA 3UZUA 2HRQA 4QLBA 3DG9A 4J3NA 1SXJC 4DYHA 1KPHA 4KREA 4ZTUB 3NC0C 4FR2A 1T6BY 1OZ0A 2CVHA 2LBPA 1U6IA 1JT2A 3CNNA 3H16A 4EYSA 4ZZ0A 4NDAA 4F9FA 4NIMA 3EFBA 3FMOB 1DKRA 2YV1A 4IDCA 5F52A 5TRTA 4G63A 3UGKA 1S2LA 5EMHA 1YS6A 4EGQA 3TW0A 3EGDB 3YASA 2QW1A 3REQB 2IH5A 3FTQA 2QVXX 3C97A 5ADWA 2HSEA 1C8VB 1NI4B 2B3DA 1E1RD 1KP2A 3AF3A 3RUEA 2AXNA 2PUBA 1JJFA 2QTBA 1ZGHA 2C29D 1EK0A 3HLTA 1HI9A 3FFXA 3RTCA 3SEFA 4AULA 4CMJA 1Z5OA 2BT4A 1E2MA 4JL8A 4DCGA 2C5SA 4FN5A 4TSRA 3OP1A 3P9NA 1G2PA 3WG9A 1T4CB 2V5UA 2QU7A 2QORA 5ALDA 1NBHA 1MW9X 3KEOA 4FMDF 2PU7A 3EQZA 4RZSA 3S5UA 2C3UA 3QVGA 1YZVA 4LC0A 3UJ6A 1AZWA 1I1OA 1GPYA 4WERA 5BWLA 2H2HA 3G9TA 3HGTA 4RSHA 3EBLA 1N5JA 4WBNB 3HY3A 1C2YA 4QU0A 3QFTA 3ZU3A 1Q14A 2XDQA 4EUKA 3GPBA 1SPBS 5JBIA 4IQGA 4K9KA 1UBHS 3CC8A 3G0BA 2PUTA 1ZK0A 3DBLA 3PT9A 4PLPA 2C7GA 5KB3A 4MUFA 1CUYA 1C3JA 1VLHA 2HLNA 2GB4A 3MJRA 2OHHA 4IBOA 2RJOA 2I66A 3KLMX 1AUPA 4PHHA 2NP6A 5JVDF 1E3WB 4R0MA 1KETA 2C7RA 2E5FA 1TIPA 5JS6A 3MTBA 5CXSA 4CM4B 1D9ZA 1P60A 3KOYA 5TY0A 2VDWA 5L45A 2GKGA 3DOJA 2P0AA 3GVIA 1V11A 5JH7A 4MVJD 2B1IA 3FWKA 3R3VA 4XSVA 4EJSA 4HBZA 1AV6A 3EQ8A 4FKMA 4LF8B 1Y4UA 4EG8A 1JUDA 4ES6A 1FP4B 2QE7D 1LVHA 2L19A 2WHPB 3KJNA 4UDOA 4DM3A 5JARA 1G5HA 1G20A 1COZA 4UHKA 1ZBDA 3GQBA 5AVXA 2PZGA 2YZNA 5HBGA 3QQPA 1BXGB 1ONPA 3GJ0A 2G63A 1CB0A 2QUIA 1WULS 3FBWA 2WVAA 1Z5ZA 1BWSA 1BVHA 1JLKA 4UM8B 3WIDA 2FYTA 2Q2QA 4E33A 4H1WA 2QN9A 2ZIXB 4Z5XA 3ZWYA 1ZWLA 4KFSA 5HZMA 4DV1B 2QVZX 1W4LA 4MV7A 3UJ9A 2I55A 1ODIA 1QTIA 1SIOA 2X4IA 4ARVA 2J5XA 3S8MA 2R86A 4XCVA 2PUDA 5DHFA 4CZ2A 2RE8A 1OU4A 1EXMA 4KXXA 2H31A 4BP9A 1OT5A 1GL7A 2NUPB 3PI6A 4UBMA 1E2FA 3N86A 5D5QA 5JYCA 2N1BA 5ESXA 5KWSA 4Y9UA 3WR5A 4GM1A 3BZWA 4MGEA 3VHQA 1KMNA 2QRJA 4BVJA 5FTNA 3BFVA 2EP8A 3OOYA 4L9WA 3T5GA 5MFPA 2V0GA 3M83A 2DUUA 3B38A 1T2CA 1Q7EA 3KO8A 1YFKA 2H06A 1E0AA 5KTTA 2Q3DA 2HWUA 2PQMA 4LVOA 1SVUA 4Y2PA 4FYWA 4FFWA 4GRIA 3RVJA 4MQMA 4EYOA 3Q8KA 2BPOA 2YMQA 4XQ9A 4AYWA 5A3SA 5LXTF 3W8EA 4DEVA 2WHXA 4EJ0A 1LFDB 2AJCA 1YDEA 1DKMA 1OLXA 4O5AA 3FMGA 1T0UA 4IEIA 4Q4HA 5DNAA 1NV8A 4KKXB 1ZCFA 2YHAA 4MP3A 4RVNA 4KFUA 3WLJA 4DCNA 3JATA 2A86A 1GL9B 5E9WA 4GVPA 4BBJA 2GWHA 5DRYA 3HJBA 1YUBA 5HGJA 3PNQA 1VCNA 4F04A 1FOEB 3PV0A 4RF5A 4EF5A 5K3FA 2A0UA 1HT0A 1R6BX 2DT8A 3JASA 5CFPA 3O8RA 3MHTA 1R0XA 3W79A 2R1TA 5K0BA 1N1DA 2JBAA 1GYRA 3PB3A 3RSQA 2RHGB 4Y18A 1ID8A 1E89A 4J8PA 4I19A 3PA6A 5DXJA 4DUGD 1DAFA 1TZCA 5JTUA 2GD6A 3I09A 2R6HA 2OFWA 1YK1A 1QIJA 1OMOA 4P58A 5DVZA 1UOPA 1G8FA 3LC2O 3WNCA 3AVOA 5K3EA 1PKXA 2GOYA 1GA6A 2I6SA 2JD1A 5D3MA 1J1UA 5FAXA 1Z5NA 3PGJA 3L6CA 5H3LA 3V55A 2GBCA 2WV9A 2EX4A 3W6PA 2XAAA 3PITA 1L9KA 4UHCA 1R8QA 3CTMA 5CH8A 1R0SA 2WWHA 4HUQB 4DMCA 3QEMA 1G3IA 2BE9A 2DQYA 3G2MA 4I46A 4EUHA 1MTOA 4G1MB 5FLEX 1BC5A 3UB2A 2VXOA 3TQOA 3VR6A 4F96A 3IV7A 1OI2A 2WTBA 3V7NA 4P3YA 2EWMA 2WU3A 4HNSA 1Q22A 4DKJA 2IYEA 4UPDA 1NMSA 4M22A 1N5LA 1G8PA 2FE1A 2FGJA 4MQBA 3BJEA 3JYPA 4C4SA 1JLMA 2YZKA 3CWCA 1FX1A 4WRRA 4Q3BA 4OHKA 4N0PA 4BYGA 4ZK2A 4DSTA 3BMCA 3I9V6 3JSAA 1U3DA 3W3AA 3KEFA 4RPHA 4EHKA 2NAFA 3RHFA 2EW1A 5E9JA 3LTNC 4ZC1A 3FB1A 2GCNA 2Q5OA 3DWFA 2ATCA 3H13A 1SVSA 4I5DA 3ITKA 2VDRB 3E5MA 2HRZA 3VH3A 4AM8A 2DRIA 5ALHA 3IVMA 3ZWCA 3ZCUA 4PN3A 1YDMA 1WKVA 1X1SA 2YFKA 4MDHA 3GCDA 1EI9A 5ALPA 4DXAA 3BGDA 3QE2A 4ZI7B 2N47A 1SOMA 1Z3IX 1L7OA 3OA2A 1PR4A 2Y0EA 2IH2A 4F3CA 3I2HA 1R5BA 4G0YA 2QTNA 2Z4RA 4RPIA 5E2BA 3CHYA 3KDPA