1TVMA

Nmr structure of enzyme gatb of the galactitol-specific phosphoenolpyruvate-dependent phosphotransferase system
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
113
structure length
113
Chain Sequence
MGSSHHHHHHHHENLYFQGSKRKIIVACGGAVATSTMAAEEIKELCQSHNIPVELIQCRVNEIETYMDGVHLICTTARVDRSFGDIPLVHGMPFVSGVGIEALQNKILTILQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PTS system, galactitol-specific IIB component
publication title NMR structure of the enzyme GatB of the galactitol-specific phosphoenolpyruvate-dependent phosphotransferase system and its interaction with GatA.
pubmed doi rcsb
source organism Escherichia coli
total genus 20
structure length 113
sequence length 113
ec nomenclature ec 2.7.1.200: Protein-N(pi)-phosphohistidine--galactitol phosphotransferase.
pdb deposition date 2004-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02302 PTS_IIB PTS system, Lactose/Cellobiose specific IIB subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tvmA01
3EQZA 2PUFA 4O1HA 4JOQA 1JL3A 4RK0A 4XASA 3RVNA 1URPA 2A9RA 4IMJB 2CHEA 3D02A 1NXXA 5BRJA 4JB0A 1CHNA 4PE5B 2XDYA 3H1GA 4ML3A 2PUCA 4RK7A 1XHFA 4WUTA 3T6KA 2PUGA 1D4ZA 3LUAA 1A04A 1QP0A 1APBA 1KMIY 2MYTA 1SD5A 1WETA 4E7OA 3HXMA 4RDCA 1EWTA 3HVRA 2PE5A 1NXWA 2FMHA 1NXTA 3HUUA 3FFWA 1JYEA 3O74A 1BDHA 1Z25A 1JF8A 1GUDA 1DZ3A 5DGCA 4EVQA 1ABFA 2OENG 3C3MA 1GUBA 4W5NA 1P2FA 3URMA 4ZYLA 4YGXB 4YWHA 3A0RB 3CLKA 3G85A 5TQ0B 1YK0A 1TVMA 4Z4CA 3H5IA 2ZAYA 3NNNA 2LUOA 4XFKA 1U0SY 4KK3A 3IPAA 5CNKA 3EQ2A 4JP1A 3FMVA 3M6MD 2FMIA 3MF4A 4RU1A 2L2QA 4RWEA 4WT7A 2F8SA 4MQEB 3LUDA 1ISSA 3OM1A 2R47A 1QMPA 3Q41A 4RXUA 5FBKA 4N76A 1D2AA 2ID7A 3C6QA 4XARA 4G0YA 5DKFA 4M88A 2PL1A 5KI6A 2PUEA 2GI4A 4MLCA 3CZCA 4G0QA 1L5ZA 5IEBA 2LIVA 4ZJPA 3GRCA 1PEYA 4RK6A 2YHBA 4MR8B 6CHYA 1DP4A 3ROTA 1M5TA 1EAYA 3I5AA 4TN5A 1NATA 2W42A 1EHCA 3GBVA 3EGCA 1MAVA 4DQDA 2E4ZA 3TB6A 4RY0A 1USKA 1QO0D 3O1HB 3E3MA 3P9YA 4KZKA 3LUGA 1LBIA 1DG9A 1MB0A 5KWSA 1M2FA 3O1JC 3H1FA 4L85A 3KS9A 4N03A 3OO1A 4RY8A 1YS6A 3Q15C 1FFSA 3JPWA 4H60A 3IP5A 2JRLA 3LMKA 3OLWA 3BILA 1Z26A 4L4UA 5TPWA 4XLTA 3HV2A 5TQJA 1Z2EA 3F6CA 1PHRA 1DRKA 5CHYA 4LDZA 4OBBA 2L19A 1EWVA 1QQAA 2PL9A 3RVJA 3O2SB 4W5RA 1KRXA 2WRZA 4HNQA 4EY3A 1U2PA 1ZVVA 3KYIB 3JPYA 2FEPA 4EVSA 4LDAA 3UK0A 2H3HA 1YIOA 4MR9A 3H5VA 3QX9A 4NICA 2BGGA 2IPMA 3DLBA 1TJYA 2VK2A 4XXHA 2E4VA 3OQMA 4MR7A 3HK2A 2CD7A 4H3KB 2QU7A 2FSPA 3IP6A 3T38A 2RDMA 5I4CA 4MQFB 2FXIA 5HQJA 3S99A 3Q7TA 3I42A 4RSMA 1ZGGA 1NXVA 1K66A 3HSYA 4NQRA 4D6YA 3RVPA 3TMYA 2DRIA 2E4YA 3KHTA 3O1IC 2JVIA 3DBIA 2J48A 3C3KA 2VUHB 2IOYA 3CZ5A 1BDJA 3L6UA 2HPHA 1DC7A 2IPNA 2VUIB 3RVMA 3JS5A 3OMWA 5GQSA 3HO1A 1USGA 3W9SA 1DJMA 3K9CA 5BQ3A 4Z4IA 5CNIA 1C4WA 3EAFA 4N41A 1YTUA 4E7PA 3MYYA 1RPJA 1D5WA 5IULC 1Z17A 3RVQA 1JH9A 3DGEC 1JFTA 5TQ0A 2MYNA 1C0EA 1QKKA 4G0PA 4EUKA 3GBPA 3HUTA 5EWLA 4IGAA 1XHEA 4YRZA 4G86A 4MYRA 4WWHA 5EWMA 3HEBA 2RGYA 1QP4A 2A9QA 1SXIA 4W5TA 2WJWA 4PEVA 4RKQA 2WY2D 1QNLA 1K68A 2R25B 4Z4HA 5IUNC 3DZDA 4MLDA 2AYZA 1JX6A 4G0XA 1E6MA 2JK1A 1VPWA 4MQEA 5T3YA 1ZDMA 2WJAA 3CRNA 3MA0A 3GT7A 1YVUA 3QLVA 1VLZA 1LBHA 2FVYA 2O20A 3H75A 3DLHA 4Q6WA 8ABPA 3LFTA 4ZMSA 1CEYA 2WB4A 4MS1A 5IEJA 4N0PA 1Y1LA 3FFXA 3HJFA 3IP9A 2GKGA 2IPLA 4YS6A 3KSMA 3RVLA 1JDPA 1OXBB 1DC8A 2JBAB 4B09A 3HZHA 4MS3B 4WZZA 1ZGZA 4MRMA 3EJWA 4F12A 5KC8A 4CBVA 1CYEA 1GLGA 2GX6A 4KV7A 2MSWA 1KRWA 2IDMA 4EGSA 4HYEA 3I45A 1ISRA 1Z18A 2FQWA 3KG2A 4IILA 5IX8A 2PUAA 1QQBA 2QW1A 4OG2A 5KQPA 1H9CA 1A2OA 1RNLA 2PKXA 3NNDA 4Z4GA 2PJUA 3QLVC 1A0OA 3H5TA 3IP7A 3ILYA 3BBLA 5TQ2A 1P6QA 2TMYA 1E2BA 4RKRA 4KQ9A 3KKEA 4DADA 3HCWA 5D2CA 3UKJA 5FBHA 3F73A 4ETIA 3RVOA 3CNBA 2FW0A 2PUDA 1PNRA 4Z4FA 5HM6A 1MIHA 2N9UA 3L49A 4LZLA 4RK4A 4WXEA 4EYGA 4KRFA 2L17A 4KREA 5ED4A 4IRXA 3QELA 3OM0A 3RVSA 3OLYA 4MQFA 2M1ZA 4H3HB 1E6LA 2FEWB 5EWJA 4YV7A 4YCSA 4TLMB 3FDFA 1M5UA 4PZ0A 2X7XA 2Q5CA 3LTEA 5BR1A 3ILHA 5TPZD 4QYWA 4RY9A 3OQOA 4HNSA 3MQ4A 3NHZA 4YO7A 4FE4A 4KPYA 1JFSA 5FWYA 3CU5A 3KCNA 4OLAA 2QVGA 2V0NA 5DLEA 2I6FA 4KFCA 1W9HA 1F51E 1KGSA 2NT4A 3Q9SA 5DTEA 4G0MA 1NXPA 1W25A 2MSLA 3RQIA 1OXKB 3GV0A 3QEMA 3T8YA 3G1WA 4O1IA 4O5AA 4QYMA 4RS3A 2FMKA 2QR3A 2QVCA 1IIBA 3CKMA 3DGFC 3IPCA 3M9WA 1DCMA 1BDIA 2CWDA 3EULA 3CTPA 4JB2A 4OATA 4D6XA 4OLBA 4P1ZA 4Z4EA 4RK5A 3H1EA 3IDOA 2A9OA 2NZVG 4PYRA 3LUFA 4TLLB 5KQMA 4KK4A 1SXGA 1RXIA 1ZN2A 4F8JA 2QXYA 2L18A 4ZMRA 4NCBA 1ZH4A 3HDGA 5C5EA 4F11A 4YLEA 5B3JA 3CG4A 4XAQA 2MSKA 2ZWMA 1ZESA 3K4HA 3N8IA 4LRQA 3BRQA 2KYRA 5DCLA 5FWXB 1EFAA 4LX8A 4MGEA 1YMVA 2JCGA 1P6UA 4LE0A 1NXOA 3OO0A 2P4UA 4RXMA 2AYXA 3RVKA 3JY6A 1XWWA 2LP4Y 4RXTA 3FGZA 5TPWB 1T34A 2PUBA 3H5WA 1JYFA 1DBWA 2JBAA 1GCAA 1MVOA 5TPZA 4MS3A 2VYCA 4IF4A 3VNBA 3M9XA 3QEKA 4KQCA 3LKVA 3TD9A 2NZUG 2P9HA 3BRSA 2E4WA 2JB9A 1J56A 2F8TA 2H0AA 1D1QA 1LJLA 3H5LA 3SNKA 2FN9A 3LOPA 3N53A 3NHMA 7ABPA 2NT3A 4MR9B 1Z2DA 3O2JA 1LJUA 1Z12A 2WMYA 1ZH2A 3A0UA 4NCAA 3VNAA 1FFWA 2MYUA 1DCFA 1E6KA 2IYNA 4WXMA 3C97A 3OLXA 5ABPA 1Z13A 1JFVA 3GL9A 1NTRA 3A3KA 1R8JA 2OQRA 4MR7B 5KQGA 2CHFA 4G97A 2QV0A 4MR8A 4ETNA 1PEAA 3C3WA 4IMIB 4JAVC 5T7BA 4QPJC 4KVFA 1PNTA 5JNVA 2FLKA 1NXSA 1ZAYA 1JLKA 3KYJB 1NY5A 2PAFA 1DBPA 3KTOA 3LUCA 4PICA 5JNRA 3OLVA 3EODA 2HQRA 4JASB 1ZY2A 1L5YA 5JNTA 2HQBA 3N75A 2HQOA 3H5OA 3HM9A 2HJ9A 5TE9A 3RVRA 4TMYA 3MM4A 4MS4B 6ABPA 1YS7A 2M98A 4ZPJA 1SXHA 1P8AA 1FSPA 1YK1A 4S05A 1JBEA 9ABPA 4RV5A 5CNMA 3GWGA 2IPAB 3NBMA 1DRJA 2LPMA 3N6VA 3QLUA 3TX6A 5EWLB 4ETMA 4G0OA 5JNWA 4W5QA 4HNRA 1QP7A 1ZITA 2FN8A 4YP9A 5EWMB 5HSGA 3QLTA 3QK7A 4W5OA 1Z16A 3O2QB 3LUHA 3CHYA 4Z0NA 1ABEA 5JNUA 1SRRA 1GCGA 2FMFA 1TMYA 5JS1A 3QX8A 5F64A 4N47A 1RZRD 3GA5A 5PNTA 3SG0A 1BAPA 1AB6A 4EYOA 3O75A 4MAAA 3TO5A 2RJOA 3D8UA 3LUKA 5IUKC 3N0WA 4OTZA 3H6HA 3Q7SA 3OLZA 4F3TA 4YR7A 2E4XA 3I09A 1FQWA 3CFYA 3OMXA 1S8NA 4MS1B 1AB5A 2QZJA 2WWVD 5E3JA 1TLFA 2HSGA 1DBQA 3SQNA 3JVDA 5JNSA 1FFGA 2YHAA 3EDCA 3QLUC 3T95A 5FWXA 3O21A 5JS2A 3SY8A 4EYQA 1JHZA 2FEKA 4MRMB 2RJNA 1I3CA 3E61A 3JTEA 1MB3A 1BA2A 4QICA 2FQYA 5GOTA 2QSJA 1D1PA 2FKAA 3H6GA 4UHKA 1JWLA 4LE1A 3F6PA 4GPAA 4EVRA 3HS3A 4EYKA 4Q7EA 4FB4A 3N0XA 4G0ZA 5CNJA 4Z9AA 1U8TA 4Y9TA 3GYBA 4Z99A 1UDRA 4LE2A 1BVHA 1M2EA 5TQ2B 3BREA 2B1JA 2FQXA 3FFTA 5KQLA 4GNRA 3R0JA 1YMUA 3F7NA 1U2QA 4RK1A 1LK0A 1U04A 2R48A 4UHJA 5BRAA 2LBPA 2FLWA 4D74A 1TM2A 5KC9A 1F4VA 2PLNA 2ID9A 4RZSA 3SM9A 1EWKA 1VKRA 3QELB 2A9PA 2JVJA 5IBQA 2NUBA 3Q7RA 5HKOA 5IUJC 1RZRA 4NV3A 3LUJA 4DN6A 4S04A 1JDNA 2JVKA 3A10A 5EWJB 5IC5A 1DCKA 3ROFA 3UUGA 5C5CA 4F06A 2FTKE 3HDVA 4P98A 3CS3A 2E4UA 2R4QA 3N0RA 4JA2A 3OQNA 1QPZA 2IKSA 3KLNA 3CG0A 1Z15A 4MPTA 1B00A 4KNYA 3JVIA 2PMCA 4Z9BA 5FWYB 4FE7A 3LKBA 4KMRA 1RXEA 1QO0A 2GWRA 4MS4A 1PUXA 1ZHHA 1VRVA 1USIA 1HEYA 3MMNA 3MIZA 2GBPA 4N0QA 3NNSA 3KLOA 3QEMB 5B3JC 3B2NA 4Q6BA 3SAJA 2B4AA 3KJXA 2MYPA 3RH0A
chains in the Genus database with same CATH superfamily
3PNSA 1E9CA 3D8TA 3M4NA 3VGPA 1OWLA 2Q6TA 3Q6MA 3FA2A 3UVEA 4MV4A 3V1LA 5IF9A 5SZKB 4HB3A 1AURA 2PL3A 4HWPA 5IT4A 5KYWA 1FNCA 1YCFA 2CHEA 3LA8A 5D1NA 4R1LA 4RZHA 5HA5A 5K1ZA 3TSWA 1CEQA 1MB9A 1Y82A 5EUCA 1GRNA 2XTNA 4R7ZA 3RC1A 4AQYB 3SSOA 3M8KA 3CKKA 3VU9A 4GXTA 1KDRA 1SHLA 3FLAA 1Z6XA 3H8VA 2FZVA 2C82A 2A5DA 1J00A 1TEHA 1HE8B 3TNDA 1OA0A 2Q6OA 2E89A 4ZHQA 2X23A 1Q21A 2NACA 2D8AA 2Z4SA 1VBMA 4DWVA 1M10A 2Q4DA 3FWNA 4ZP1A 3TG8A 1MC8A 3ONEA 3SEFA 1Z25A 3LOQA 1JF8A 1GUDA 1NUUA 1Z0JA 2FH5B 3FYCA 1FTSA 1N0IA 5BNFA 3WAKA 1ZSYA 5E6UB 1JHYA 4ODIA 3GJZA 2QTNA 1CVIA 2MR6A 2ZB7A 4K9MA 4MDYA 4AROA 4JI8B 2GPYA 1I36A 4TTRA 3HQ4O 5EHZA 2Z8ZA 1U0SY 4KLAA 4MV3A 4JHXA 4KK3A 2J6BA 4QUGA 3CNEA 1FNDA 4EJFA 1X0VA 3FI9A 1DB3A 2C04A 3TFOA 1YB4A 1SVNA 2PLAA 4AZ3A 3U61B 2QGZA 1FDRA 3DHEA 2I8AA 4HGYA 2NXJA 1KSJA 1UUFA 1B4DA 2CLSA 1BXGA 4NYIQ 5AKLA 2TYSB 3ZHSA 1Z4MA 1THZA 3KUUA 4FMCB 3WRXA 2FP4B 3KJEA 2FMXA 2DFDA 3BL8A 4LY0A 4YPVA 5KYXB 2AJTA 1SN7A 3MWFA 2E7ZA 4IF6A 5DPMA 5B4VA 4AKGA 5D1HA 3ANSA 3G6KA 1RKBA 3CZCA 3DLIA 5LB2A 3UIEA 1J2JA 5DDIP 2NUPB 4RSGA 3FR7A 4M9ZA 1IUOA 4RK6A 1IC6A 4ND1A 1DP4A 1XCLA 4KGZA 3UAVA 3LIPA 3NHWA 4GI3A 1OMOA 4TV8A 1QWSA 2CL6X 3GBVA 3I04A 4C88A 3IJEB 1J2YA 1WZIA 3FZNA 1XRSB 4DLBA 1E3SA 1M7GA 2YR0A 3CZ9A 3OO1A 4J75A 1AKNA 1OXTA 1Z6GA 3FF4A 4R51A 3TQFA 3KXPA 4BBPA 4EM6A 1KZHA 1Z0IA 4M7PA 3HHEA 2AMFA 3OLWA 3KLPX 2W2TA 4I5EA 4KIJA 4NF2A 4PTZA 2J3KA 3V8VA 2CUZA 2DPLA 3GMTA 1ULSA 2A2ZA 2XDQA 4DZRA 1KJ8A 4F4IA 2X8WA 3CY6A 3BRWA 3NWBA 5LXTB 2XGSA 3U9TA 4CDRA 2H4ZA 4FMCF 4JQYA 5F2OA 5EMHA 1KH3A 4M1SA 2O3UA 4HNQA 4A27A 2XNDD 1YB7A 2O3QA 3HYLA 1NMEA 1BX3A 3N2KB 4GF5A 3IBYA 5F7JA 4DMLA 1YDFA 3SD7A 1KO8A 2OCKA 4MR9A 1WZNA 3MTDA 4URZR 3B89A 3UK7A 1ZLYA 3EK2A 1T36B 2R7LA 2NU8A 2IPMA 2QV7A 1DARA 2NWQA 2C9YA 4FFDA 4NE2A 5K3FA 3KSUA 5JAOA 1KPIA 5EJ2A 4RTNA 2NQTA 4TXLA 3NASA 2WFZA 2AR9A 3CSSA 1C14A 4B4WA 3K94A 4HC4A 1KDTA 2OP1A 1YRAA 1JHQA 2MINB 4RAQA 4E2YA 1OIXA 4HGZA 1U28A 2C77A 3IV9A 3DT8A 1JUDA 1KI4A 5JMOA 3DZGA 2GRJA 2OM2A 2Z98A 5JYCA 4FVTA 1G16A 4ZQEA 4U6NA 2X1MA 3KVOA 4ZZ1A 3SVTA 2F9FA 2H0RA 1KAGA 2FPXA 2DLNA 2IYXA 1IZ0A 2FPWA 5DYTA 2BT4A 3QF4B 4M89A 4KQ1A 3VAZA 3IP1A 2FZGA 2ZR7A 4ALJA 2FW9A 2UKDA 2ZS7A 2F8LA 1GU7A 1HLGA 2QY6A 1TZJA 1Y7HA 4KFSA 2E55A 2ZFUA 3TAUA 3E7WA 2D0IA 1PKXA 1QO9A 3VVMA 3PIRA 3PGKA 5DK4A 5AM4A 1IBLB 4N41A 2H2AA 2VPXA 1RPJA 2EJUA 1SHJA 3OTQA 3TNFA 1C7IA 2QL5A 3T5BA 1V48A 3K9QO 4FDUA 5CDFA 1V6CA 3NH6A 2OILA 4QPZA 4EO4A 1UKZA 4XA8A 3RFTA 5EWMA 2VWQA 1CQIA 5IARA 2QEQA 4C2BA 2RGYA 1TIPA 4N0MA 4EHIA 3RHSA 2B4RO 2V9ZA 3D2AA 5DU2A 1OXUA 3PQEA 3ZXUB 1I6MA 1M6WA 5HJ2A 3E4CA 2IOQA 5CDGA 5E95A 3MEQA 1XK6A 1RBZA 2BMEA 3E1GA 4NZMA 2IE0A 4HZIA 3WDLA 3S2EA 3R40A 6PFKA 5IAKA 3N6XA 1TC2A 1DBVO 1W19A 5DXAA 4WN9B 1ZGBA 1COWD 4X54A 4EF6A 2QYTA 2P9GA 4R2KA 5JW6A 2I2CA 3SSMA 3ZCRA 4H18A 5F4ZA 3RGWS 2GJAA 3LFTA 2FFHA 1MFZA 4PWZA 2VN8A 5THQA 2GOYA 4L3WA 1B8NA 5CX1A 3KJQA 3CH7A 3FFXA 4E5UA 1E2GA 2WG2A 4HDRA 3Q2KA 1P9NA 5EIOA 4A8JC 4YONB 2YV4A 3KSMA 2Q5LA 3HJRA 1QV7A 1OXBB 1NURA 1U7DA 1IMJA 1U65A 3LLSA 1DTWB 2Z5GA 3WWEA 1A9XA 4JBXA 3SLRA 3HI4A 1FTNA 1GUAA 1XMPA 3DKKA 4M83A 2FJ0A 4UDYX 4YP0A 1KRWA 3EAQA 3QWBA 5K6RA 2FXVA 3HXKA 4UEOA 4LVCA 3OOYA 1K4MA 2HPZA 2PRIA 4DPLA 5AIAA 1ZIYA 4QVGA 5KQPA 2J31A 3BMNB 4BP1A 2WP0A 3KV3O 4OUDB 5AI6A 1UMDB 2JJ8A 2XZPA 3GDGA 1RJ9B 3KEQA 4OB7A 5HWSA 4HNVA 5K45A 1P6QA 1Z0SA 2O59A 1SCUB 1G3QA 4RKRA 2O19A 2IEDA 3MJFA 3SZUA 4HX2A 3I53A 3MTBA 5IDVA 5JFTA 1E2DA 4KWEA 5LDHA 2H51A 5ILOA 3OP1A 2FUG6 1ZK1A 2P6PA 4EB6A 1MIHA 2H1SA 3L49A 4TKZA 3EPPA 4WXEA 2NXWA 5LJIA 3WX0A 3KXDA 2Q8NA 2NU9A 5NLLA 3EUAA 3MBOA 1Z45A 4OHUA 2HD4A 4NMWA 1H85A 3HU5A 4MW0A 3ZGOA 5A4AA 1M5UA 4ZRNA 1U98A 2Q0HA 3SIPA 1QRAA 1X7XB 3LQYA 1BX0A 3LGAA 3WIVA 5KVCA 4XWKA 3ZHTA 4HV4A 4DDMA 2WPDA 3A26A 3NANA 3RE1A 4AT1A 3AHJA 1F0KA 2A0XA 3NORA 3QVMA 4DLKA 1E1CA 1P4RA 5FI0B 2HK7A 3SLGA 1KEEB 3PX7A 5KU1A 3CURA 1VPTA 2NPIA 3RLIA 2HYIC 3VNUA 4UNPA 2PKQO 4R2WA 1TM5E 3A14A 2PXAA 2H4YA 3ML1A 3RSZA 1NXPA 2ZUTA 2ZATA 4PNHA 1JG7A 4DNQA 4XPZA 1DPGA 1BHJA 2C00A 2QVCA 4GPEA 5KYYB 3IPCA 4BFUA 1FW6A 1H4TA 5B3LA 4Q4LA 1WMAA 1T8YA 5CH8A 1ST3A 5LDDC 2W9XA 5JCXA 1H8ED 4B43A 4Z4EA 2I03A 2DPYA 3HFJA 3LHKA 4ZKEA 4JJGA 1U6IA 3IDOA 4W8GA 5F1PA 1JR3E 3WE7A 1VG0B 2Z0MA 1KO1A 3CX8A 4Q3OA 5AFSA 3R2JA 5ICSA 4B35A 1IXSB 3MRXA 1QYXA 4PBSA 3HVIA 1X92A 4YLEA 3CXUA 4TTIA 2CL0X 2SKCA 1I6WA 1E4EB 1YKSA 3E9EA 2QTGA 1UJ4A 5KNDH 2JCGA 3QXXA 2DBZA 3DMTA 3KPYA 4LE0A 1KYVA 3GD5A 4PHHA 1KEVA 4Y9DA 2VYNA 2ES4A 2JGMA 3QBVA 4MVCA 1HXHA 2CJFA 3JYNA 1RWKA 3AILA 3JD0A 2OM6A 3SEAA 1AK2A 2ZIUB 4FDVA 1JYFA 1AS0A 4TSFA 1DBWA 1LPAB 2P27A 1GCAA 4RTMA 2K4MA 5K3CA 5JZBA 4IXMA 4GI1A 5JFOA 4B5KA 3DBLA 4WECA 2P8JA 3UMJA 1LI4A 3T12A 3RYFB 1ZNQO 1P3JA 3KXKA 1T1EA 3JR3A 3EWIA 3AGQA 4BGEA 3U6BA 5LMNB 1XTKA 3L8EA 1F8FA 221PA 2FZWA 2J3EA 2P9CA 4PYJA 4MW2A 3U44B 5JSYA 5I01A 1G8MA 1DEHA 3AVVA 1GZ5A 4P3OA 1J22A 1S89A 4KXWA 1FYEA 2OSBA 5LL6P 2ZI7A 4HJXA 4LGVA 3OPVA 2P2YA 4FJ0A 1KVQA 1JFFB 1U0EA 1Z13A 5FV7A 5MFZA 1I4EB 1RLUA 2GFHA 1R8JA 2JFVA 5JAQA 3T9BA 2FDRA 5FBWB 4E5SA 1U0BB 1A2BA 3CWCA 3BN3A 1N6IA 2HCFA 2KHZA 1GPMA 1U11A 2W6CX 2ZOSA 3DUFA 3OE7D 4EX6A 3RSLA 3PRKE 4EHHA 2VNKA 4ETNA 2LRHA 1XZIA 5T7BA 2VPWA 1EX7A 2EWWA 4YV2A 1JLKA 5KQSA 1OB2A 3A6KA 4BMOB 1BDMA 2P62A 4TGLA 1WVMA 4MSUA 3SIRA 1ECFA 5GV8A 3PA8A 4R8VA 4FLEA 4LKRA 3ISJA 4MQMA 3NATA 4OIMA 3DVAA 3EA5A 1DI0A 1T1RA 4V0ME 1OC4A 1Z4IA 3B3AA 2WD8A 4AECA 4LJ5A 1BWRA 3D8SA 1HKUA 1JMVA 3L6BA 5G41A 1KKMA 4H1TA 4KBGA 2AZ4A 2WJPA 2QYHA 3U17A 1MU0A 3L7BA 3ELYA 1YQEA 1Z6TA 2PT7A 3GXBA 3ZLUA 4U39A 5DGXA 1U6JA 4LBVA 4ZVVA 1XA4A 2BFCA 3MGAA 4UVDA 4C08A 4W5QA 3JALB 2ZI6A 3GLGB 3U7QB 5A5DA 3PQ4A 4JYZA 3KDSE 8OHMA 2BDEA 1E7MA 2BPOA 1YJ8A 5C8XA 3WLAA 2QJWA 3W8EA 1ABEA 2MMGA 1ZW6A 1MC1A 2EFCB 1X2EA 1RKVA 4PGMA 3ZVMA 2VA8A 4Q9JA 2Q3HA 3EF0A 3LRTA 2L0XA 4FQ7A 4PS0A 1QGUB 1QGZA 5SV2A 2PZMA 5A4FS 2XYRA 1SOUA 2IT1A 1T9ZA 2YRXA 1T8UA 3C8MA 3ETCA 4GGMX 2AI1A 4ERXA 4EFLA 2X9LA 4JJZA 1EUYA 3H9JA 1J2RA 1VRWA 3AP2A 1GFZA 1VE5A 3F1KA 4RD0A 2VNHA 5ES3A 3VR2A 1V5WA 1J24A 4BNNA 1HG0A 1NLMA 4YK7A 4ZO6A 2FWRA 4YAJA 3SEZA 4ZQFA 5CA1B 5CUQA 4BTVA 5A4JA 1B14A 2WTEA 5G02A 3I4LA 1UANA 1YZHA 1USUA 2WTBA 1LF5A 4PX2A 3RS4A 3TXAA 3VKWA 1DWPA 1PYDA 3KTAA 2HMUA 1TUEA 3DMPA 2JPDA 1ZK2A 1N2BA 3B7GA 4GKAA 3S2ZA 4CMJA 4ZV9A 3GGCA 1QG2A 2NVWA 2Q6IA 3C7AA 4WZAB 3W7VA 2BFFA 1LLQA 2DU8A 4PYKA 5I9IA 5GOTA 3JZIA 1X1QA 1IN6A 3HCOA 5IXSA 1JHXA 2AG0A 5B55A 1M8KA 1OOEA 2FVXA 4IXDA 3IUYA 4EYKA 4LF5B 1A7KA 2JCVA 4DBVO 5ALVA 2CBXA 1Q14A 3HGQA 3HPRA 3LC7O 4FFMA 1ZUNB 4JKOA 3A11A 3SC2B 4CM8A 1CSEE 1XTPA 2XDWA 3MLAA 3UWPA 5T4BA 1C7JA 1U7PA 5CLJA 3VHLB 3V4LA 2H4FA 3LP8A 3PEYA 4QUHA 3S0JA 2CFSA 2QL6A 2ZYVX 3G0HA 3KAKA 1DUIA 4QARA 1ISMA 3P19A 4GOKA 3PBKA 1PNVA 3CJTA 4I6GA 5L3ZA 2XT6A 4ZOAA 4C04A 3WADA 2LBPA 1TM2A 3WKDA 1OFTA 3A1UA 2PLNA 1J0DA 2JZOA 2WJJA 4M0FA 4C7JA 3EF1A 2BKXA 5D01A 5EE0A 3KP1A 2FWAA 3QYAA 4PQGA 5AHXA 4D4KA 3I5UA 2VCHA 3DPUA 2D4HA 3V7WA 4LXUA 1HA3A 4C6RA 1CULC 1QUFA 3JWJA 3MWYW 4BVHA 4HQLA 3ZCPA 4AM8A 2OWEA 3W7BA 1ZFNA 4X1OA 2JD1A 2XMPA 3FI0A 3VYWA 3MT7A 3C6KA 5HG0A 3F6YA 2PA0A 1MJHA 1P7PA 4NBLA 1HDRA 1K88A 4I55B 2G0AA 2I62A 1VRVA 1EUDB 2IF2A 3INYA 3LW8A 2WYWA 1NC3A 1GAQA 1TFUA 3STVA 1P91A 5CXSA 2PMBA 1D6NA 4K87A 3KZCA 2Q8QA 1OI3A 3JQPA 2C7OA 3NRBA 3AIOA 1E5TA 4Q6BA 1D1TA 3LIIA 4PZEA 3KV1A 4F72A 3GJXC 1U8FO 3T61A 1G291 3GOQA 4KE8A 3NHYA 2GXUA 2OLEA 3BE5A 3ZI4A 5L7WA 3AFIA 3HXOA 4QBKA 3OIWA 1L8OA 1C50A 1DIHA 1KSHA 1N7HA 1NVBA 2GJ8A 1W8DA 2O06A 2QZPA 2UVDA 4Q39A 4J6FA 5CJ2A 1WA5A 3I28A 1NASA 2IYTA 3AL2A 2QMZA 3MN1A 4UFOA 3FZYA 4DXAA 1UMCA 4N0EA 4IVPA 2EGGA 1U81A 1TQ4A 3FHOA 4LRYA 4AC9A 2A9FA 4ROTA 5FEMA 1EXVA 4IM7A 4YMVA 2I33A 2IYZA 2QTVA 2TMDA 3IB6A 4NATA 2WUVA 3AU9A 3HADA 4UVHA 4WACA 4DYHA 4CGYA 1PL6A 3GMIA 3Q5EA 4O4LB 4D42A 1JYEA 2WMNB 3G9ZA 2VQSA 3IAS1 4I55F 4LGYA 1BDHA 4YAEA 3BRWD 2PSDA 3ELWA 4LX0A 4Z86A 4HN9A 1KERA 1LVGA 4WLUA 5TJ9A 1XI2A 3PJFA 3DDCA 4XIFA 2GQ0A 3PC2A 1IN8A 1BJTA 4UAJA 5ALEA 4UPEA 2J9FA 3AP1A 1K6EA 1YZ3A 4OV6B 2ODPA 1E6CA 1BX1A 4PLWA 1SG0A 1CNMA 1V7PC 4YLGA 1JJBA 4JP1A 1SWWA 5D51S 5ALJA 1A77A 3OT4A 4ZCRA 3IHKA 2C88A 1CS0B 4J0KA 5CVJA 3K31A 5ESWA 5B1HA 2V45A 2X8JB 1U8UA 3TLGA 4MQEB 3Q41A 3K9FC 3KZVA 3VI3B 3NYQA 3C3EA 2CFTA 3HBNA 1Z2NX 4MI6A 1A2KC 2VLIA 1JPUA 2NOAA 4KTVE 5DT2A 4PNEA 5KDDA 3FNIA 2GI4A 3SPXA 2G9NA 1G0NA 2AVDA 1TOAA 3QOFA 2LIVA 3RTCA 3MSXA 1C1DA 3TAXA 1EGAA 3IQFA 3HL4A 1KFCB 3T5AA 1M9NA 1Y1SA 4I4TF 1OYVA 3W1EA 3EFOA 4X71A 2QAIA 1DAKA 1H93A 4HBZA 2O14A 4FN5A 4D9JA 4M1KA 4NE9A 3KAJA 1C4KA 2EHDA 3E82A 4Q3LA 1KI6B 3SF8B 3HJBA 4FWBA 1QORA 2VJYA 3N0TA 1D6SA 2AW5A 3O1JC 4N03A 2G63A 3G1UA 5DWDA 2XADA 4TS9A 3JPWA 3ZDEA 1L3BA 4BMPB 4NZZA 1XPRA 1J2EA 2XRMA 4E5KA 1DDGA 2Y67A 3GJTA 1OYWA 4M38A 3IOCA 2IZ0A 1ZUHA 3HWX1 4K9PA 2XCTB 1SUEA 3B3GA 2O2XA 2NVUB 3MJ4A 2DWOA 3T4EA 4E1AA 1JG1A 4FBMA 2AEEA 1UINA 1ZCZA 4BGDA 4IJQA 1QQAA 1V8BA 2PL9A 1MNAA 1EE1A 1ZC4A 3C7KA 2OVFA 3B6JA 3ND6A 4U7WA 3SYMA 3ZQ4A 3NP9A 4C0LA 4DMMA 2DH6A 3OPMA 2AT1A 3G2HA 3THYA 1DXOA 1CY1A 1TB4A 3PXCX 3QVUA 4GKVA 3U16A 3HXQA 2D5AA 2P9QA 3AOGA 3RUHA 3T5TA 2OBNA 4BQOA 1ZD4A 3YASA 3IAM6 4KIFA 3RIEA 4E3ZA 1PCXA 1W5BA 4LYEA 4EENA 3A6ZA 3SSAA 1XZNA 4JBNA 4OHYA 4GICA 4U7GA 3WGMA 3WL5A 1DELA 4ND8B 4OLJA 4CKCA 5JADA 2ZIAA 3L77A 1RPAA 1CETA 2QTWB 3BZWA 3T3OA 5BNIA 1F4LA 2HX1A 2F9MA 1L5WA 4CMGA 4GYKA 5KOJA 1J06A 4UEQA 5I9BA 2QT0A 1AKWA 3RYHA 4YT8A 4RGBA 1FMLA 2E1PA 4OH7A 4TLBA 4CM6A 4OY3A 1MT0A 2HB6A 1YA6A 3B9QA 1ODCA 3VNRA 2I99A 2IUSA 1CS4C 1PZEA 2IZOA 1U2GC 1ZM3A 4KX5A 2YQZA 5EE5B 5FBZA 5H59A 3RT7A 3VR6H 3WJAA 5I7WA 5DCYA 3U09A 1CZKA 1Z28A 4JJIA 3OE1A 3THSA 2B4QA 3JYPA 1ZRNA 2WW8A 3K9CA 1H5NA 1Z7EA 1T1IA 1A8IA 1BMQA 1J8DA 2XB9A 5EIBD 2WM8A 1UDCA 2Q6LA 4EUNA 3OH8A 1TJ5A 2EW1A 3RVQA 3QE3A 4F60A 4C0WA 2EIHA 2J9ZB 4GSLA 3N6RA 3MJDA 4A7PA 1XRNA 2AWOA 4XEUA 4ZYYA 3R3ZA 1H69A 4WWHA 2J4FA 1ZUD1 3TD6A 2GBLA 4A2QA 4RMGA 4HATA 1VMEA 4GG1A 4PRLA 4TLEA 1P7CA 2OHGA 4RKFA 1ULAA 4W5TA 3D0KA 3DS8A 2QTZA 5HS6A 2R25B 4DW8A 3A8TA 4MLDA 4FB5A 5KTRA 3MCZA 4H7KA 4BY9E 3CRNA 1Q0RA 4AMUA 1U3VA 3CPSA 5DLYA 1U0LA 2UUAB 1AGRA 3HKCB 3A2KA 4TQUS 3FNRA 1UBJS 3TOCA 4BAZA 1VLZA 2PWBA 2QYSA 1TAHA 1G1MA 1LQTA 1IVYA 1JIJA 1LWNA 3UOGA 4CM1A 4UM5A 4EDFA 4LW8A 3OTGA 2WB4A 3USCS 4NIMA 2GAAA 2VAMA 2QLJA 2VSXA 3EYWA 3PUVA 4LFCB 2WPDD 3S27A 2I1QA 2NTYC 4EO9A 3PS9A 5E9JA 3GFSA 2P5UA 3GJ0A 3WHLA 1R5BA 1E1RA 2F1JA 3EUWA 1R2QA 3NDJA 3FW1A 4R1OA 1L7PA 4CR8A 1Z0ZA 1MQ8B 3ETNA 5BWLA 4MLPA 3I2IA 5JWOA 3B52X 4OFBA 3SWWA 4PSVA 3SHFA 4Q1FA 4Z7OB 3T52A 5L3SB 4PLCA 4H1HA 2DTXA 1IVSA 4IW3B 1JHUA 3NHJA 4P3PA 3PJRA 3NEJA 3MB8A 3E05A 3TAHA 5A04A 3WJ7A 1RWMA 1ZL0A 1TTTA 2AJDA 2Q27A 2R1TB 5A3JA 1WKVA 2VDQB 3FYSA 1R18A 2GN2A 4HAZA 4JJFA 4W99A 2JLZA 3PFBA 2B7CA 4G07A 4I1IA 1XE3A 5F5LA 2Y2UA 4KN9S 2H59A 4KFUA 1QZXA 1Y3DE 1J1ZA 2R7AA 4WINA 2Y2VA 1O7JA 3QWHA 2C9MA 3M2PA 3CMMA 5DN6A 3U39A 5CT8A 2C0CA 2WYIA 1JSZA 3KKEA 2H85A 5CPBA 3WMWA 4I5DA 1Q1QA 1BE6A 2WDPA 1W6UA 3I6ZA 3F73A 2Z2IA 3TSYA 1VG1A 4Q4HA 3AM1A 2H5LA 1TM3E 3RS5A 2G6TA 1Q7GA 1W4BA 2DHCA 3RW9A 3K6KA 4GMGA 4UUNA 1CIVA 2D74A 3H17A 1JR2A 4M1YA 3WMFA 3LQKA 3VH2A 4L0MA 2R11A 2Q4RA 4I2NA 1PHPA 2VHWA 2C2BA 2CDBA 2ZBQA 3K0AA 2VYND 4JS0A 2JLBA 3NT2A 1WB5A 3GPBA 3PNMA 2P9FA 2JF0A 2XKJE 4TSFD 4HP8A 2YHIA 2IVZA 5C8YF 3K53A 3WL3A 1IUKA 2G25A 3L4SO 3V1YA 3P0HA 4XQ0A 2AH5A 2FRDC 2RHTA 3ICWA 4B8YA 1SY7A 2Z9BA 1S6YA 1PN3A 3VU1A 1U1IA 4HZUA 4HDSB 5A5GA 1ZL2A 2C99A 2DFNA 1KA9H 2EWMA 2PS0A 1V3UA 3TE7A 2NX2A 3X2SA 3H3FA 1T3LA 1UZNA 3O8OB 3NHFA 1XMQB 4CU2A 1LDGA 2FPPA 1SH7A 1VSVA 2QP4A 2WSBA 3MWLA 3D43A 1B6RA 1QVZA 3MGBA 4S2UA 2DB3A 2FMKA 3GO4A 1WPGA 2R1VA 3M9WA 1S3SA 4RESA 3U37A 1YBVA 3FCAA 1GFSA 3WQRA 3ZN2A 4JB2A 3CTPA 3K1TA 4OLBA 4GE0A 2XOKA 5DO9A 2QX7A 2EU8A 4JL6A 4ZEXA 3KYDB 1IPHA 2QQ5A 4UEKA 3TR6A 5GIPE 3MUNA 2GJKA 1PDOA 5LP6C 2YL2A 1II0A 2II6A 3S81A 4FGZA 2W6JA 3QXSA 4FZJA 2AJBA 4MWEA 4OJMX 3S40A 4E5NA 1NBAA 1SD1A 1XWFA 3HDGA 4LZZA 2R6R1 3KVRA 2ZCUA 1XDWA 3A4MA 3UW3A 4FYYA 3PUXA 3RANA 1FXSA 2D3WA 5FWXB 1XB2A 1AUPA 5K7SA 1RKQA 3KQSA 5HF8A 4DC9A 4RHUA 5GINE 4YEDA 3MS2A 4XYMA 1SR8A 4JT2A 4DR6B 3LRPA 2AC7A 4O2AA 5E4TA 5JSHA 3EVFA 2P5YA 2GRUA 2X1LA 4MI9A 5JQGB 4HD8A 1R00A 2GCPA 4JQZA 2FF7A 1NV8A 4HFRA 2HW8A 4OKIA 1T34A 5AYVA 1SBHA 4O0MA 5SYNA 3BOSA 4JC5A 4XIJA 4GXQA 1XBTA 1Z29A 2GAIA 4KRYA 5E1BA 3S1AA 3LK6A 2ILTA 2Z3ZA 4FYWA 4IG9A 5AICA 2UZ0A 4H0CA 2BC9A 3TQOA 4QKQA 4PBTA 1WS6A 1LRJA 2RHBA 1QK5A 1D1QA 3H5LA 4M0UA 1GJRA 1U63A 1H1LA 1DIBA 1EZ4A 1HPLA 2PZGA 3DL0A 1ZH2A 3NDPA 3LO5A 1Q3TA 2O2EA 1TT5B 5EL0A 1CEXA 2G1AA 1I2BA 1NN0A 5CJJA 1ORIA 3EGXB 3TYXA 1IM5A 1S02A 4FJ2A 4Q1EA 4YCAA 5ILQA 2CEAA 3OOJA 2V9CA 4QG3A 3ZJVA 1J39A 2ZIWB 3VR2D 4GZMA 2H48A 2YJ6A 4Q9DA 1KEZA 5LUAA 4O4IB 1E1LA 3G2LA 3QVSA 4MHOA 1MVNA 1U8YA 1FP7A 3QE9Y 1PNTA 3QY0A 1G5IA 1ACLA 3K70D 2QZ9A 1ITZA 1QFMA 1JQ5A 5DHRA 3CKYA 5FTWA 3UH1A 5EHIA 3DFFA 4B8WA 1NI4A 2G7ZA 2YVUA 1NRIA 4BUJA 5JNTA 3QVGB 2POQX 1REQB 5ITZA 1HRKA 3H5OA 3C8DA 2ZJ2A 5REQB 3TIGA 5LZ8A 3DW1X 1MCZA 4BQIA 2R5FA 2REQA 4EFKA 4BFZA 3NIWA 5LSAA 3AR7A 2AF4C 4S05A 2GK7A 2QRKA 1QG0A 4OQYA 1NFQA 2VDWA 5ENZA 2WM2A 2G17A 4IDOA 3O8BA 3NUGA 1KYZA 1CJSA 1DRJA 1E3MA 2NN3C 1M2VB 2QI9F 4MRPA 4L78A 4D7AA 4Q3EA 1ZITA 1GRQA 2I2WA 2OXTA 5EZYF 1N2XA 1YUMA 1T5OA 3D54D 1CERA 1AGXA 3F97A 3PYLA 3P5BA 2DTDA 4WESA 3CHYA 2AG6A 4BXOB 2O8EA 3CVJA 3OX2A 5EZ5A 5JS1A 1DJNA 1XALA 3DO6A 1XCMA 2BKVA 1A5AB 3AP3A 4IJ6A 4KACA 4E4RA 2LDXA 3E1SA 4HS9A 5B5SA 1L5HA 3DBHB 3LX5A 3ACCA 5C32A 5TVGA 4PSUA 4KI0A 4BNZA 4I3FA 4Q02A 2VDUE 1ZIOA 4LK3A 2ZYSA 2HY7A 2W4QA 1Z73A 5DHTA 3O92A 3KZXA 2B3DA 1SFRA 2A3RA 2J0UB 3OMXA 2Q1TA 1C9YA 3Q3CA 4HAWA 1KJWA 2YV5A 1T1SA 1EX1A 1M6YA 1ND6A 2YWBA 2WWVD 1Q1AA 2CDAA 5BQOA 5JNSA 4LRXA 1FFGA 1XNJA 2ZKLA 1E96A 4PF1A 4HUTA 3HDTA 4F1WA 2ZSKA 4H7PA 3RK0A 1B0ZA 5L6LB 3LTNC 1JH8A 3ONWA 2LV8A 1XU9A 3GEIA 4H59A 4XWWA 3B7PA 1FP2A 1Y81A 2JGFA 5KAPA 3D3KA 3SZLA 2QX6A 3P7MA 1FUKA 5DLPA 1MB3A 4OB6A 5A9SA 2XHEA 1X7DA 3TI7A 1R0LA 4QU9A 1ISJA 2RB4A 5AUPB 4Z53A 1LK5A 4R8KA 4WXHA 1NW8A 4JYBA 5JDCA 5GONA 4K5QA 4V0KA 3DXYA 1L4YA 3FTNA 1W93A 3AEXA 4J07A 2GVNA 5CNJA 2GBFA 2BHTA 2ODEA 3A9UA 3AF3A 3FSGA 4F7DA 1H1DA 3FWPA 3ZLVA 1X9GA 1TAUA 4QNRA 3VTZA 1MRNA 4HRAA 4KG7A 5AOBA 3VI4B 5FX2A 3U31A 1ECLA 1FQJA 2F8MA 3GYGA 4Y9RA 5JZ9A 1KVRA 2E1RA 3FUVA 2VPZA 5DX0A 4AL4A 4WL0A 2Q9UA 1E2QA 1G5FA 3H1BA 3SI7A 1E1NA 1Z74A 4OQZA 1FMTA 1G5RA 3AJ8A 1XEWY 5C5DA 5GWXA 4KQGA 3QELB 2VEOA 4LY6A 3WIBA 1FTQA 2UZ3A 5IBQA 2HRQA 1G19A 5FOUA 3MJVA 1C3JA 3UWSA 4EMTA 5DOZA 4EHKA 4EYSA 3R9KA 2AJ8A 3GNSA 5IT0A 4LMRA 1ICEA 1PDVA 2J09A 3DDSA 2O6LA 1YOVA 1YQQA 5CFMA 3P45A 3D5TA 3RT1A 3SHTA 5HYVA 1RHUA 3P0EA 2WJHA 1GLNA 4FI3C 4WJKB 1A50B 1PGOA 5D3MB 1Q7TA 3SJCA 2IKSA 2BZSA 2YVLA 3PQ8A 1GXSA 1MO6A 1OBVA 2POCA 3F9CA 3T94A 4KMRA 2EFDB 3K5HA 3UHOA 1E9DA 3W5DA 4QU0A 4LOIA 2IC5A 3H18A 1I94B 2PY6A 3IXLA 4NG4A 1NJ8A 2IY8A 1P60A 3STHA 2W11A 3NNSA 3KLOA 1LPNA 3QEMB 4J0GA 2F1HA 4HDKA 2OV8A 1BD4A 3AF6A 3OA2A 1BKSB 1IM8A 1JS1X 1YXMA 3EY4A 3KLMX 4CUZA 3UV7A 3V4ZA 1EAMA 4EKGA 4BO0A 1IPEA 4LSWA 4KMSA 4COOA 1C7ZA 1IU9A 2R8ZA 3D1VA 3DE4X 3FTQA 1U3FA 3U0BA 3CM0A 4P2BA 4V0LA 3L4EA 4WFKA 4ZEWA 1NXXA 1OIWA 4JR1A 5T8KC 1RI1A 1JAYA 3H1GA 3MC1A 3MTEA 4EY4A 5JH7A 2CDCA 4X7MA 3JAMA 2CN1A 1KMHB 4LYDA 1NP6A 4JEUA 4XQ9A 5FA8A 4E5PA 5BN1A 2O8FB 5LVAA 1SWVA 1XVVA 3DZ8A 1X7YB 2BELA 4B6GA 1WETA 4E7OA 3D7SA 1KI7A 2CXQA 2WSMA 5ADVA 1YAHA 4OPMA 1TF2A 3SVLA 4XR9A 4ZREA 3VGJA 4DR5B 2ZIVB 4R1NA 3UAXA 1KGDA 3L1IA 1T1JA 3LVQE 4BP3A 1PGQA 2BEWA 5I7AA 1PR1A 3QNWA 1OX4A 4L8FA 4XQEA 2PO5A 2Z6AA 1P2FA 2RHMA 2EP7A 2MSCB 3CCCA 3O4HA 4QFMA 3C1OA 2APJA 2W4IA 3E8SA 2BFBA 4BO7A 5HIAA 3DAFA 2OD9A 1DRUA 2VDRB 5ALWA 1IK4A 3UJ7A 5TR9A 5CAEB 5FR1A 2ZBPA 1GKKA 2FGJA 1FFXB 3VXKA 3LYLA 2YS7A 1RPZA 5ERYA 4B71A 1IOZA 2FPIB 1PJ3A 2J30A 3CX3A 4EFMA 3J81A 1KIAA 3NCHA 1T9AA 1U0NA 3TINA 3VO1A 5BR4A 4N76A 1ACMA 1YL6A 1N57A 4L5CA 4AJPA 5FEUA 1QYCA 3JRNA 5AJWA 3TCKA 1SEVA 5IKOA 1DE0A 2GWHA 3TQRA 3ZHXA 2R7KA 2B8WA 4LRSB 2HCJB 4PZUA 4F7WA 1GYRA 3BMQA 4DCCA 1Z56C 3PXAA 2G5GX 4LJSA 1YOBA 5KIAA 1JPJA 4ZOEA 1L4MA 1RWBA 2J45A 3T15A 3U3ZA 4E3WA 4R40A 4B87A 3PDJA 2OQ2A 5K0JA 1HGXA 4OMCA 4UMEA 3U4QB 4WOPA 2WU3A 4JOSA 1UPFA 2I3AA 1QFJA 1QX4A 1U2DA 3PXGA 2HA0A 3SQDA 3U81A 1P9OA 2XGMA 2PCJA 5HGJA 1X7WB 3DLAA 3TGWA 2F55A 2I6GA 2F62A 3C1TA 4UTPA 2PZKA 1IH8A 1LDNA 1DXYA 3BBPA 3KKOA 3GA7A 3AXTA 1ZKDA 2Z43A 1MW9X 1FDTA 3DTVA 1YHZA 2C9ZA 4MEBA 1WHSA 4BMDA 1NY6A 3GI1A 3WB1A 3S2YA 4E6EA 4BC0A 4DE5A 1UDBA 3ETJA 4JELA 4HEA1 1T43A 4B7ZA 2JKYA 3IEXA 3QG5A 4DMHA 3UT6A 5KYUB 4BEBA 5I7OA 2H18A 3GGJA 3TNYA 4FX5A 4C0KA 1DKRA 1GDHA 4AZSA 4RQBA 4AI6A 1KNXA 3L8YA 1TJYA 2W70A 2YZGA 4PFSA 1VP9A 3IHTA 1EM8A 4PYLA 3GLVA 2QR2A 2ZAOA 4KVGA 1ODJA 2DPMA 1N2HA 4R1QA 4YJHA 3SYRA 1S2MA 3OHPA 1QQ6A 1WKBA 4KCGA 1C1XB 2WE7A 3KO8A 4PS1A 3VKUA 3W6PA 4X93A 1IZZA 3I42A 4JC8A 2OBYA 4IHAA 4O4HF 3RFVA 4OQEA 4YFYA 3WL7A 3WNDA 4CR7A 1E1RD 3KQKA 1CUJA 1S8FA 4ZO9A 3K15A 1QHYA 2Y1CA 1XOIA 3FOFC 1DSSG 5F78A 3S4YA 3F6EX 1Q50A 1V6AA 3O1IC 3DBIA 5CCXA 2XUJA 2TMKA 1EVKA 2WHXA 3HP1A 2O1SA 5ER9A 5BV7A 3OZIA 4MUMA 5H02A 5EUQB 2FWIA 2C5LA 2OL4A 2QD3A 4HPXB 3KE8A 1QKIA 1TADA 3WWPA 2RARA 2IYPA 1KH2A 1NC1A 2QTRA 5K0FA 1X1DA 4U2BA 3ZVKA 3LDHA 1NR1A 3GG9A 4JJEA 1T8PA 5BUQA 5FT9A 3NDBB 5FQOA 3ZHZA 4E7PA 4EABA 5MGNA 1D5WA 2QTAA 1WTAA 5E6UA 4ECAA 5DP1A 3N1UA 4PV7A 2AG8A 5JSUA 1KDOA 4NBTA 1EP2B 4L5JA 3ZE2B 3QUBA 1ARZA 2P4SA 4IMPA 4IUBS 4LOLA 1U2EA 5K8UA 1A9TA 5FLKA 3GHYA 2PFKA 4F5DA 2H1OA 2Q2NA 3C0KA 1PT6A 1Z6PA 4DIDA 3B13B 3K71B 1GL7A 5C53B 1UC4B 2JHPA 4P5PA 2PH5A 2IYWA 4L1KA 1A27A 2D0DA 3PD1A 1EK5A 4PEVA 3Q7PA 4DM4A 4ABTA 2ATCA 4JJ4A 4X6UA 2VL7A 2HAEA 1XDSA 4TSKA 4UJ5A 3NVMB 4B85A 3OG9A 4LF7B 3R5TA 3WRYC 4ZYUA 2WJAA 4U5QA 1DJLA 2GM5A 3NM6B 4GM1A 5KYXA 1YVUA 2JLUA 1GUFA 2IUUA 1XJWA 4BATA 4TKMA 5C35A 5KX5B 3H75A 2I7XA 2V6IA 4B84A 1AMUA 3OCVA 1XA0A 1K5GA 4G4JA 5KTOA 3HVUA 4LJRA 3K9NA 4F1KA 2V6FA 2NUPA 4FYHA 2GUGA 1QZ3A 4KQKA 3D7MA 4G01B 4KQWA 5L3QB 2C54A 3P71T 2QPTA 4YS6A 3U7JA 4CTKA 1JDPA 2WPNA 1GILA 4MV7A 1Z7GA 3FY4A 4JFRA 1R5OA 3OZVA 4DJFC 1IL0A 2XOXA 2WWRA 3E2IA 1O94D 1ZGZA 4IZIA 2RKBA 3AR5A 3TTYA 4BNFA 5BUSA 4QPCA 1ZMBA 2Q2WA 1X87A 2ZVPX 3EQ6A 2GVDC 3VR5A 3TW8A 1AY0A 4RE5A 2J9GA 3OJXA 1TAQA 4KQHA 3WGVA 1KEPA 4M76B 3ESQA 4OG2A 3ZBPA 3COVA 2PZ8A 2P67A 2D54A 3NRCA 4YRFA 5LXTA 1PFWA 2YN4A 3RAFC 3ADKA 2B25A 2WZBA 4V0QA 3JQ7A 4PG6A 3R7NA 3STXA 1A95A 2FY8A 5LZ9A 5HTOA 3NONA 1NI5A 2C0PA 2VAVA 3BMCB 3ED5A 3N2KA 3UMBA 4QOSA 2W6JD 5AKZA 1P0PA 3PEVA 5D2CA 4AJHA 1GKUB 1O6GA 4DEVA 3X2FA 1E6EA 5E3IA 1R0WA 1Y6JA 2C0QA 5EXDA 3PZBA 1PVVA 1XWIA 4KXXA 3M6UA 4LOHA 3RWMB 2QDKA 2VDNB 1U3DA 1R4AA 1CDZA 4KREA 1OUMA 1XU4A 1WG8A 1CZRA 3KKNA 4XUEA 4BCCA 3R8FA 3AVWA 2CMGA 1SPBS 1XMXA 1RVDA 2JD0A 2MINA 2FEWB 4PTLA 2I54A 3CCBA 4WGGA 4DLZA 4CMAA 3H2JA 4C3ZA 3I4FA 4GKKB 4CDNA 1IAVA 5DXFA 1JQBA 4DSAA 4ARSA 1CUBA 3NAGA 1GPJA 3DE0X 1VJGA 3QA9A 5CB4B 1GPBA 1P19A 1ZBQA 2REOA 2ZYAA 2I4LA 5CM8B 4CQLB 4HDNB 4FE4A 2FLVA 4MW9A 3I9KA 3SHVA 4D3YA 5JG7A 3ZCXA 4CLOB 1PWXA 2H9AA 3AG5A 4NZNA 4N65A 2IHVA 1TL7C 4GX5A 5B57C 4NPAA 4X8MA 1VJ0A 1SIUA 3GLUA 1W9HA 5TVKA 4NJMB 1LPBB 3LKDA 5BURA 2FZCA 4X0EA 2FPGB 4L8VA 1OXKB 4FKBA 5C8VA 3U3XA 1PT8A 3G1WA 4CVNA 2GEUA 2IXFA 2Q3DA 1EGHA 5JCPA 4ZC1A 1Y80A 4YCDA 1MIOB 4KPEC 3A31A 4JX8A 5E38A 5F5XA 4B32A 1YIAA 2XSZA 3X1DA 2GERA 3KZ1E 4MUNA 3ESXA 4LVUA 4YUAA 2BKUA 3WP0A 1SXQA 4P35A 3UM9A 3OPYI 3FJOA 4Q24A 3G7NA 5B53A 3G59A 2QG6A 1SXGA 3WYGA 4P80A 5EXTA 1U80A 2DUWA 4INPA 4NQZA 1VZ2A 2FCRA 4Z8XA 4RIGA 3IVGA 2Y8EA 1KZ9A 1FYVA 3DNFA 3U19A 4LRQA 2IXTA 5COQA 2C3PA 2V4UA 2VNAA 3GPIA 2VYQA 1X94A 5D6OA 2D2VA 1N6OA 3GOHA 3LQ2A 4FPXA 4UNRA 1P6UA 3C4QA 4MPRA 3IQGX 5EIWA 1JB9A 3GD7A 4R3NA 4NENA 5LU9A 2AQKA 3LBFA 1UBCA 4MUFA 4U7JA 5HK8A 3SK0A 3L0ZA 2O2SA 2CLEB 5KDLA 4CHTA 1OH7A 4MKIA 2PHZA 1DTWA 4ISBA 4OGGA 4KOEC 3VNBA 3RSGA 4DV7B 3UT0A 3TJMA 5IVIA 1QHHB 1U7UA 3TVYA 1OY1A 4RJ2A 4HLQB 5GV7A 5K9ZA 3EGIA 3LOPA 4YMSA 2EATA 1L1EA 1FU7A 1JU9A 1LTHR 4XVQA 2NT3A 2A5LA 4JT4A 5IDYA 3RYCB 3PE3A 3S3TA 1FUEA 3TQCA 4OMUA 5D84A 1WQ4A 1J9ZA 2TECE 2H1RA 3AUXA 3JVUA 1UMDA 2QUIA 3FSEA 3GL9A 4WVLA 4DABA 1KVTA 5AI0A 1DOHA 4QBFA 3UC5A 1S7CA 1SCUA 3USES 4TL6A 4UJ3A 2C83A 1NT2A 4C7XA 3NG1A 3TFWA 1CBUA 1DTSA 2TS1A 5J2TF 3FSJX 1GNPA 4BLOA 2FR8C 5HW0A 2F4VB 5DP2A 3ZWMA 1EBUA 2B1IA 2ZXUA 4BFCA 2WJ3A 4NYMR 2RGUA 1FTWA 3LXUX 2IX9A 5KTSA 1WR8A 4CMCA 2W2KA 3DKVA 1ZY2A 5CR9A 2WKQA 3O90A 3ILXA 4NBNA 2DT5A 9LDBA 5B3KA 3R1IA 3WB0A 5AKIA 1JIVA 3MJEA 5DRYA 1IXZA 4LYYA 1S4QA 4FYIA 4MS4B 1YS7A 4Y6GB 1AMNA 4D0NA 1C81A 1L7EA 2D2XA 4M7OA 1GCOA 2BD0A 3RS8A 3WC4A 2WUWE 4YJ2F 3M1IA 5HPYB 3X43A 4GZ3A 3N2LA 3B3FA 4N7JA 4KKXB 2LPMA 4WHMA 5SYAA 3HB1A 5IZCC 1KEEA 2QA5A 2O7QA 3H99A 1G3IA 3PDUA 3HA3A 2YMPA 4KR0A 2A5JA 4RZIA 3PRJA 3QLTA 3WIEA 4AXXA 1E32A 2XE6A 4G1EB 4UVEA 3MCAA 1NNSA 1HYBA 1C4OA 3PDCA 2H0QA 3R3WA 1UBRS 4UTOA 1J2UA 4UQPA 5KYYA 1SPXA 2H54A 1OB5A 4BBZA 2NO1A 2RAFA 3VHXB 4DCMA 3LP6A 3HCEA 1MF7A 1OKKD 3F74A 1EMDA 1HFKA 2VRCA 3FM9A 3G9TA 4FD3A 4LJ6A 2HBZA 4PX9A 2NV2B 4EGCB 3M3DA 1MKYA 1WSWA 3A4LA 4F4DA 4AY2A 4J4BA 3UWDA 3WWDA 4E31A 2WNSA 1DX9A 3D8UA 1GQYA 4G56A 1OLUB 1T5LA 3OLZA 4F4JA 5F21A 3PXUA 4V0NA 2DM6A 3E2MA 3L43A 3W6UA 3FYUA 2B7BA 2RCYA 3HV0A 4EW2A 2WYOA 3AUYA 1XVUA 2Y93A 2ETXA 2QZJA 3IMGA 3IUNA 1DBQA 3KVNA 3JVDA 3MCVA 1ZU5A 5KU7A 2UXCB 2PKRA 3ZE7A 4PFQA 3LLUA 3MWDB 3R20A 4FCCA 1T25A 3CWZA 4BB5A 4EYQA 2PS9A 2ZDQA 3JV7A 2QW8A 2WKWA 4GPD1 4O59O 2F17A 3S1LA 2EF0A 3GLIB 3E61A 1THTA 4LHEA 2H7VA 4WD3A 5JATA 1BA2A 5K0EA 2DBYA 2FW1A 3C98A 4LJ8A 4PXYA 1UC9A 2B7LA 4QXMA 3TLYA 1NQWA 3HKEB 3R5SA 4UU1A 4EHNA 1G98A 1NJ1A 4OXRA 4W7HA 3KTDA 4OMDA 4BE4A 1FU8A 2VP6A 4TMWA 4XDHA 4KLCA 3UV6A 2OYCA 4DEYA 1O97D 1SNYA 4ZI7A 5HM8A 2ORED 5MN5A 3P52A 4WDRA 4WGFA 1T9DA 4HY3A 4D5EA 1BVHA 1M2EA 3L8DA 2LZ0A 4BUZA 1X7ZB 2ICAA 3JQFA 3LBIA 1WLSA 1G8PA 2QR5A 2NSDA 2ZPAA 3MGGA 3R0JA 5FJIA 1J5EB 2G80A 3HYSA 2HO5A 2NZ2A 2XUIA 2FLWA 4LC9A 2I4RA 4LOAA 2ZJ6A 2J08A 5DTMA 2FZKA 5EXXA 4D92A 3ZCQA 1I4DD 2X9VA 4IIJF 4LV8B 3W8RA 4BL5A 5JVDA 4JLAA 2A9PA 5CLIA 4CKZA 4U00A 4KBFA 4BLPA 4R5HA 1JEOA 2I3ZA 5BW8A 3CLRC 2WINI 5DBGA 3ONNA 1GQRA 1N5MA 1XD2A 2FTKE 2P9JA 1RDFA 1ZU4A 3E9RA 3JVEA 3SQLA 3ZIAA 4BX2A 5C7LO 3H0EA 5K2OA 2Q1SA 1KI1A 4X63A 1WXQA 2X3FA 2ZTLA 2EJCA 4M8NE 4WCFB 5LYJF 3A04A 1SVMA 2JH8A 1E5VA 1B00A 2O1XA 4NYIR 2E49A 3RIMA 3W9BA 4IQ8A 2EL7A 2V7QA 4EY5A 1PZXA 1TQ8A 3N7AA 5LMZA 4ESHA 3I0NA 4IOLA 5IYZF 4N6NA 5G4LA 3QU5A 2WQ7A 3KR9A 1QIMA 3AETB 2XMZA 2KI5A 4OUKX 1OQAA 1W5EA 4YQEA 2JEYA 3V55A 2DGDA 4C76A 1P1CA 4MQ4A 1VA5A 5E4YA 3Q8XB 4M1QA 4A2CA 3LKZA 1XCGB 3ZDXB 4PRYA 4A5OA 4HUQA 4DLPA 1GTRA 5EZ6B 2OPHA 4C7OB 1WCWA 4BO2A 2VVTA 1JSXA 3SC4A 4GHWA 1IBMB 3CPJB 1N8TA 3HABA 5CK4A 1NDQA 4IUCS 4OYYA 3F6SA 3JALA 3EB9A 3LZCA 5FFMA 2NO4A 1J33A 2QN3A 3KQOA 3U7QA 3ZY6A 1LZKA 3C45A 3SQWA 3ROQA 1T8TA 2OHHA 4HMQA 4CKYA 1B23P 4JB0A 5IKXA 3M5PA 1FMJA 1VG8A 3MT9A 5DCUA 3L0PA 4XTCS 3T6KA 5LFAA 3KYBA 3LGXA 3MQFA 3WGNA 4J16A 4KSBA 1QGUA 5AHOA 5TMPA 1PVOA 4I99A 1YQTA 4ER0A 5FPSA 1IJBA 2MYTA 3IUMA 4D8XA 1PS0A 4E15A 5C80A 4HH0A 2H1FA 2G9VA 5MN6A 4IQ4A 2C78A 1IHUA 4IOJA 1O5OA 1YRHA 4ITRC 4XGRA 1EVZA 3N2GA 4OB8A 1BW9B 3DTVD 4ZN6A 1B6TA 2GSDA 4YTEA 3SNHA 2OENG 5CA1A 2PXCA 3R9XA 4ZQHA 4CEJB 3DL2A 1QOQB 3A0RB 3G85A 4HADA 2WHYA 2ZG6A 3IBSA 5LB4A 3K20A 5AHRA 1YRBA 3FNFA 1NQVA 5FLEX 1ISHA 3A4VA 1PT9A 4F5YA 2DMRA 4M46A 1T5IA 1XTBA 2A0YA 1DWQA 3IRVA 4X8LA 3TZBA 4ZYVA 1KZGB 1M1NA 3L3BA 4I5IA 2PBFA 4UASA 2IEAA 1V43A 4LMPA 4NU8X 2R6DA 1YBAA 4F5EA 4A5SA 1ESZA 1LCIA 1R0YA 1E2JA 5IJ9A 3U5TA 3EPHA 4RPCA 4MWBA 2F8SA 4DNOA 3ZY4A 3S1SA 4G8CA 1ISSA 2O2YA 2R47A 2RIPA 1TQ2A 3RC3A 1D2AA 1ZUNA 2A14A 3C6QA 4N8SA 4UPDA 3SC2A 3GLSA 3OJWA 3D3WB 4CQNA 3HM2A 3U3MA 3ZGXA 4M9QA 3OOWA 1UAYA 3JXEA 3FNEA 1HLDA 3E9DA 4X66B 4G0QA 4QBGB 4Z54A 4DXDA 4EPRA 4OU4A 5DTRA 4UEJA 3A2NA 3EBPA 5EIHA 1ONNA 4M1ZA 2E48A 1MEEA 3RI3A 3I5AA 3PKZA 3QBDA 3ZJTA 3CUWA 4HS4A 1RAGA 2EXXA 4WOBA 3TOVA 2F59A 2C1EA 1YTLA 1PV1A 1P4GA 2IYEA 5JYDA 1G4UR 1LBIA 5EIXA 3RQSA 4CKWB 3SR0A 3ESBA 5CB6A 2OHFA 2XTJA 3G1TA 1I6KA 3FPAA 4DWWA 3FRJA 2C3OA 3LDUA 3ANTA 3T7DA 3ZY5A 2BGTA 3J81k 3OZSA 1WY7A 4L4UA 4YA6A 1DKMA 1CZHA 1LW7A 3DKIA 4JITA 5LD2B 4B4DA 3LK7A 1N6RA 3ZVRA 1HTWA 9MHTA 1W4CA 2ZJ5A 4LDZA 3JQDA 4OBBA 4QOGA 3O6VA 4DWOA 5LIRA 3Q9NA 4N3AA 1ILEA 4P4SB 3ZWQA 2QK4A 1V3QE 4PYNA 3TS1A 3HR7A 4BB9A 4D99A 2GN6A 3ZTYA 1EUDA 1YZQA 3ROZA 4AMZA 4Q9IA 2X9QA 5JCOA 2Z6UA 4XIIA 3HCBA 1ZMRA 1TCVA 1Y7TA 1KQNA 3ZXXA 4ND6A 5BYBA 1P6XA 1QRRA 3C3DA 4D9GA 4EARA 1QF6A 1VJ5A 5HOEA 1HYGA 2ZWAA 1QGED 4ARZB 3OZGA 4DIMA 3MTGA 1ZM9A 4OXXA 3M6AA 4CV1A 2JLRA 1F12A 1F9AA 4FMDB 1YNSA 1AHNA 5FNVA 3NKLA 4ALNA 3R9WA 2IEYA 1JILA 1XQ9A 1R10A 3HSYA 2WD7B 1GYQA 4HRXA 1R4MB 4NQRA 3ECCA 1OXVA 4Q3CA 2NSYA 3DB2A 3OLQA 1J90A 3AHCA 3OSUA 1RKUA 4G5GA 4NHOA 3BWMA 2Q7OE 2P3QA 4TZTA 3WV4A 1GT91 3PHGA 3PUIA 5IDQA 2EIXA 4YXWA 2AQHA 4BMCA 3CO5A 3CZRA 3D4LA 1RWXA 1SBTA 1X14A 1N7IA 2GAOA 2NADA 1WUHS 1R16A 1I01A 3H9UA 4L22A 1IEQA 3VR5D 3VYVA 2PZBA 3ZWBA 2CB9A 2IUTA 4O4LA 3O3OB 2PUJA 1V16B 1D2NA 1WF6A 4G5HA 3GROA 3JQFC 1RRKA 4P3KA 3VHRA 2R0QC 1C4WA 2BFWA 3A3NA 2BN4A 3OEHA 3QKWA 3IHWA 1FYWA 1E0SA 4LV6A 4FHCA 4C0XA 3DGEC 5AESA 4QATA 2MYNA 3WGQA 1QKKA 3GBPA 4HQNA 3A1WA 3KOXA 4U2KA 3K70B 2FFJA 2GJSA 4G86A 3DMHA 3TDMA 3UMVA 4XGKA 2Z2XA 4CLXA 1HH4A 4ENPA 4N3BA 4WAUA 3Q0IA 3LQQA 2CF6A 2NXCA 1D07A 2XWPA 2X0EA 4AJKA 3CC8A 1F2UB 1ZI6A 3NHAA 3Q3JB 1KFEB 3FPLA 4GOMD 1U31A 4WKOA 1CS0A 5AW5A 4AJOA 5KDOA 2X8JA 1ID1A 3AEUB 4MQEA 2YZ2A 1W88B 5CLHA 5DOVA 4PPNA 4W5HA 5KTMA 4DIFA 3AONB 3P2IA 2V7VA 3ASYA 3HACA 4M98A 3VPGA 4ZCIA 4EJ0A 4IIHA 4X97A 4B3HA 1GG5A 2JD2A 8ABPA 2V4ZA 5K3SA 5I9LA 4TMFA 1B41A 3VPHA 3IB3A 1VE7A 3F4BA 2ZS8A 1G2OA 4JGBA 3IFSA 4NOJA 2YMQA 4C7VA 2J3LA 3FPSA 4XX0B 2Q0XA 3WMXA 4W8HA 4DANA 4YRBA 3REQA 1QVAA 1F0PA 4OXNA 5K8LA 4TQAA 2ATXA 1YV9A 5EKDA 4CN9A 5LJLA 3IDZA 3AUFA 3SF8A 1N3IA 2O3JA 3OT1A 1D8TA 2Q49A 1L6IA 1UC8A 1JYSA 1YS4A 1V95A 2V5AA 4TWJA 1PWEA 2I34A 4EPYA 5JCZA 2IDMA 4KB5A 4A6PA 1WIWA 4QNNA 1Z18A 2BKEA 4DLRA 3OCZA 4K9KA 3BORA 4B6QA 4QRDA 1HORA 2QJTA 2CJWB 3HLYA 4DQKA 1OHHA 1XXHA 4H7HA 1M34B 2GZ2A 2X0IA 1H9CA 4JR0A 2O8CB 3R41A 3DE2X 1PZNA 1X15A 1FFBA 2BYTA 2IXDA 1ZLXA 4BVKA 5AW0A 2TMYA 1SUPA 4MICA 5FQNA 5A6VA 3C3JA 3G0CA 1X1SA 2UYQA 4EB8A 2AZTA 2W2LA 3IS3A 1N0HA 1T0BA 3LQ1A 2QX9A 4E94A 2PUDA 3SR4A 5E9WA 1N7JA 4O8CA 1DQRA 1Y1TA 4TTQA 3NKVA 4LFAB 5AVTA 1GPDG 1S2LA 4KL8S 3SCZA 4B3TB 1YASA 1C8KA 5DTQA 4LHZA 4TUYB 3ODPA 1L1FA 1KMNA 2GN9A 3DJFA 4H27A 2SECE 3EASA 3BCSA 2CK3A 3FTDA 1J9EA 1X19A 2ZWOA 1S8OA 3NWJA 3NC0C 4MDHA 1SELA 2Q1XA 3GJQA 2LCQA 4DNPA 3GRPA 1W36C 1ND5A 2O7SA 3H2IA 1K6JA 4C5AA 2G88A 4MA4A 4V02A 3BTSA 4QT4A 1RE1A 2C9BA 4JJAA 4B3BA 2J32A 5G4KB 4QODA 4B9EA 3R5XA 1M1XB 2IE8A 1TDJA 2VNJA 4ITUA 3FLMA 4LIPD 5E9QA 3X0DA 2X5NA 4QGHA 1QGAA 1RI2A 1SD2A 4YRAA 2B8EA 1M1UA 1T2VA 3ICQB 3ACBA 5IFKA 3D0QA 4TV9B 4YMTA 3PEEA 2NT4A 3NHPA 5DTEA 1LLCA 3TSOA 3X1MA 1ZAKA 1KVSA 2YXPX 1WVIA 4Z3DA 3WL4A 5CDSA 2WF6A 4F3RA 4WFJA 4QYMA 3IR7A 4Q9HA 4L4ZA 3S5JA 1V41E 3HL0A 3RDPA 5J40A 3TMAA 4KE7A 2X86A 4MUAA 3WL6A 3TTXA 4IH9A 4AYTA 1XTJA 3VYSB 2DBVO 2YYYA 5CHEA 4K6FA 4BPBA 1YF3A 2FSUA 2VSQA 3GLFA 1Y6QA 4EITA 4DIEA 2E2WA 3JQ8B 1JQJC 5AVRA 4H7JA 1GAWA 1KEUA 3EBOA 4I8DA 1EGMB 4I6EA 2FE4A 5CCDA 3ZYCA 1XD9A 3Q12A 4D9BA 4YMLA 5CIWA 1A8SA 5C5EA 4NCBA 1ACJA 4M1OA 5FDFA 2EFJA 2FUCA 3COYA 3HKCA 3PNPA 2RHCA 4I7EA 2MSKA 1XZFA 2KLHA 1B43A 4ZARA 1E9RA 1WQ3A 5A7GA 2NGRA 2KLBA 4MA0A 1W1UA 3OZCA 5D5QA 4X6LA 2A0UA 3PHLA 4YDQA 1CTQA 1NXOA 2H1HA 2BMJA 4OQLA 1GWNA 4C03A 1FSSA 1FA9A 2G4VA 2GYVA 2PA3A 2JGIA 3ABZA 5L45A 1EB9A 2WOOA 3FFAA 3OTWA 3W3ZB 3X2EA 4DQXA 3CF2A 3RVBA 2FSHA 1SULA 4UVIA 3TF5A 2JIRA 4ZGGA 2QX8A 4FFNA 4G5RA 3EXEA 2YCLA 4BFLA 3CJRA 1GKYA 4MP8A 1Z4LA 2ZRGA 1E2IA 3OQBA 1KAMA 4ZQGA 2HF8A 2A58A 1HC7A 2DSTA 1JG6A 1JLSA 4NBSA 5FPYA 2XVZA 1AZLA 4OL0A 4C0JA 2K2QB 4HDMA 3THWB 2QLBA 1Q84A 1Z0AA 2I6QA 2VH1A 2XZDA 1QCZA 4BKPA 2OV4A 2VRCD 2CBZA 5JD6A 2IYNA 3OLXA 4G1VA 1WXWA 3NHBA 5FADA 3IAAA 5EMMA 1KS9A 4KIUA 3C5HA 2JFZA 2JGNA 3RC7A 1HLPA 4XDYA 3UJCA 4NDNE 1PS9A 1IXKA 1QCYA 3HWWA 4OAOA 4HGNA 4W9NA 4H3VA 2Z2ZA 4K1XA 3T5DA 5B36A 2IXGA 4H16A 1HE1C 2D4AA 2P6OA 1E3DA 3KOMA 1ZAYA 3KYJB 4GWKA 3QUAA 1ZZEA 1WCIB 4AY5A 2J0SA 3M2TA 1U5AA 1Q5PA 3TEJA 3HE3A 3TTTA 5K3EA 1YZGA 1QMGA 2ZRDA 1S2GA 1Q0HA 4PG7A 1MR3F 2IODA 3WGZA 4KO3S 4ATNA 3EH1A 3D6AA 4FXOA 4P81A 5TRTA 4UHFA 3SR3A 1H4QA 3EVEA 6ABPA 4JLDA 2WU1A 4EG5A 4L72A 1QQ7A 1XUOA 4JI1B 5HZKA 1P8AA 2B69A 1L7VC 3OFND 1DJQA 1VJDA 2OLKA 1JAXA 3L8CA 3NI2A 1HNXB 2X4DA 3RIGA 4DY6A 2OECA 1T9HA 1H2BA 4S1NA 4M1TA 1X1EA 3GUVA 2A5YB 1VXRA 3Q10A 4M3NA 4D26A 1VE6A 3F49S 3TLCA 2HUNA 2F1KA 3AEYA 5EWLB 4KN5A 1XCOA 2YFHA 3U7RA 2GB4A 1WZCA 1Y8RB 4K9OA 2KS6A 3BJEA 2WU4A 3O8OA 5DNCA 3MJSA 1XV5A 5KWEA 1MX3A 4PLTA 1SIBE 5JS7A 4X8OA 4RZ2A 3CX7A 3VJKA 4BKUA 3J7TA 3GLGE 1CC1S 1I3LA 1NUPA 3ASVA 2FMFA 4PLVA 5BXQC 4DV2B 2VKTA 1A72A 4N47A 2ZJ3A 1C7FA 3K1AA 4M1EA 3NUZA 3HVKA 4G1FA 2X2FA 2BMAA 4XGIA 5AKJA 4XIGS 3N28A 1JAHA 4PZPA 3GFFA 3PUJA 5KPDA 3N0WA 4YLYA 3H6HA 4X6YA 4F3TA 1RCTE 4GRDA 4BNUA 2ATEA 4AO8A 1KFBB 5IRCD 2DXIA 3UCEA 3UFXA 5C34B 1AB5A 1DDIA 1I3KA 1KMQA 3KK0A 5JWHA 2ENUA 2Y27A 1YGYA 4DCUA 1F4PA 5IZ4A 5GJBA 2V7QD 1QOPB 1SRQA 3OM8A 3GDFA 2R60A 5IABA 3UBTA 1QFZA 2EF1A 3PQ6A 5FWXA 1I0LA 3GLTA 1MV5A 3JWGA 5JS2A 2VRWA 3UN1A 5HF6A 3G2MA 1JHZA 1S3IA 3WP1B 2L82A 1P2UA 2R8YA 3QVWA 2RJNA 2Y71A 3IUJA 3RNLA 2I4MA 2MTBA 1PS8A 2BZGA 5EHQA 3RIYA 5JJ5A 3V8RA 2OGZA 1SVIA 4DRZA 2ZJ7A 5KNDA 1G21A 3OX1A 1O2DA 2FEAA 5CD9A 2PBRA 1G5TA 4JUBA 3AQ4A 4DMCA 3K2EA 1H2YA 1CG6A 1N6KA 1OE0A 4W9RA 2FG6C 4DR4B 3TRHA 3F6RA 2YHSA 3GYBA 5ADWA 2HA7A 2PX6A 4X8HA 3V48A 2IV3A 4TZ0A 2OCXA 2Z95A 3FPKA 6NULA 2R6JA 2ZPTX 2H7CA 3CH5A 4ND5A 5AJZA 5JV5A 2VP5A 1H94A 1IN7A 1KAHA 1NQUA 4B6SA 4CV2A 4BOYA 2AFRA 3N07A 1GV1A 1RM5A 8ADHA 2FX5A 1R6VA 2V7BA 3AHDA 3EGXA 3BEDA 3MINA 1BE8A 1VKRA 1IQPA 5J4VA 4HFNA 5HGXA 1KQOA 4D4HA 1JQAA 3A58B 1U0RA 4FTWA 2JJ2A 2IIBA 5FA5A 3TBHA 5IC5A 3RJZA 4P93A 3BE8A 5TB5A 2WBLC 2GEVA 1B0AA 1L7OA 4KVAA 3T7TA 2QORA 1E1YA 3T35A 4I8IA 1RT9A 2OPBA 5HKLA 2GTPA 2QN7A 4FYXA 4FWTA 1Q0UA 4U5XA 1JLHA 3HNRA 2WF8A 4TQGA 1I3NA 3PDHA 3QUQA 4JZYA 2IY7A 3QVGA 5KINB 1U5BB 2A35A 2PMCA 4FSXA 3HBJA 3K9BA 4NDAA 2ZB2A 1SCIA 1JJIA 3L6OO 3GLKA 3QSYA 2OGTA 4P34A 2Y77A 1VMAA 4DV5B 2R6FA 4UM7A 2RJ3A 3BULA 4Z9YA 2QMHA 1X8LA 1XRPA 1K27A 3HU2A 2ECOA 4ND2A 1T10A 4DNFA 4NMXB 4EUEA 5J2UA 3QMMA 1T91A 1TCAA 4UBOA 1NSFA 4MVJM 2BLNA 1Z5OA 6YASA 3IE1A 1N3YA 5JAIA 2I4OA 2ACVA 2XLCA 2NYRA 1PJ8A 4RA9B 3JQAD 4R5MA 2OHIA 1NW3A 4S0XA 4JB3A 3KJZA 4OHBA 2W90A 4Y0VA 1YKFA 2V7PA 1WXEA 2FSGA 2V96A 1NUSA 1GQFA 1ZM4A 3IT1A 3K9WA 2XD4A 3H4VA 1RWWA 1XHFA 4UDNA 1AQIA 3R6LA 3QBTA 4G84A 5BOSB 4JI3B 3EPJA 2ZYDA 3AJ9A 4LNAA 3X1WA 1BVYF 3NHLA 4DKJA 4BQEA 3ZZTA 1M54A 1L1RA 3KFLA 5EUBA 4N8DA 3P9QA 3S2SA 1Z83A 3VR3A 3HVRA 3CEHA 4CZ2A 2F00A 2J5QA 2WNHA 3EXIA 3HBLA 1TA9A 4ZVKA 4O29A 4LJ7A 4YJFB 3GUZA 5AM1A 4MQLA 3V3KA 3GUCA 3QPCA 4PRKA 5FBRB 1ABFA 2JHCA 3IIKA 1Z08A 2O2IA 2WWHA 4HYTA 4X85A 4UE3S 3E18A 4RVFA 2A1TS 2H5EA 2V0GA 2NYVA 1ORVA 1GUYA 4QEDA 1E2LA 1JT9A 4N5IX 4XWTA 3OHMA 2OD2A 1N2CB 1LBTA 1Q2XA 4C78A 2GRAA 2WZDA 4BWFB 1JKXA 2RK4A 1W9MA 4Y0AA 3VOSA 4ZANA 4IICA 2FG7C 2ZROA 3FPFA 3FX2A 4JJ6A 2I1WA 3CLUC 2OO7A 5DI3A 4LISA 4BDTA 2JAOA 3ZI0A 3LCVB 1JB1A 3LUDA 4NNJA 4TZKA 3BK2A 5BSWA 2EEZA 6Q21A 2B94A 3GJ5A 1YVEI 4C0SA 2DUNA 1P9RA 3WWYA 3K30A 3HDYA 2I65A 2PL1A 5EJ8A 4HQRA 1WSDA 3B9BA 3UTDA 4TL9A 3NPMA 1Z36A 3V7YA 3N2NA 1Z2PX 2ZGVA 4WSOA 4N4AA 1JALA 1L5FA 2BUAA 2P30A 2YHBA 1LPOA 1ZI9A 5AM0A 3TLZA 4E46A 4KNWA 3DFKA 4M55A 4YXWD 1Y98A 3P4UA 5EJGA 1RAIA 2CNBA 3BD8A 3OVMA 5G0WA 1A71A 2FW6A 1EZZA 1MAVA 3GEBA 1FFCA 4DQDA 3BC1A 2CLOB 2JH3A 2FAXA 2VHEA 4KZKA 3TB6A 3CINA 1D4OA 3W6ZA 4OHWA 1V1RA 1MZPA 3MXTA 2DBQA 4IJKA 1JDBB 1KDPA 2X58A 3KS9A 3L6EA 4RY8A 3GCDA 2OCDA 4XSVA 3DXZA 1KYXA 1TLTA 3I62A 1RRMA 3WAJA 2GZMA 3I9V6 5AVZA 2A1TR 2Y0CA 1PVDA 3MILA 3DEHA 3O0TA 3DZJA 1ZMXA 3DLCA 3CLSC 5TQJA 3UW1A 1YDEA 1YS2X 1RI5A 3ZY3A 5BYKA 4XUDA 1CVRA 1ZC3A 3F8TA 2DH5A 4WE3A 1J2TA 4EG4A 4BO4A 4G4IA 4BLVA 1ZPDA 1YGPA 1OGIA 3SQOA 3WY9A 3EF3A 4B31A 1KIMA 1GTL1 2CUNA 2JATA 3SZRA 5K6AA 2XX3A 1XXHE 2GDJA 4DMGA 2H3HA 3KT0A 2X2OA 3FOCA 1MUUA 1YNOA 3RF6A 5A7FA 4A3SA 4PQFA 1W85A 1QQTA 4EMUA 3VSAA 3OQMA 3E9CA 1RYBA 4QGFA 1JLMA 4U8GA 1FP4B 4U02A 4BX0A 5E0OA 2E21A 3MCTA 2QXUA 3IP6A 2XR1A 1DFHA 3R3YA 4MQFB 3TUJC 3L0SA 1UJBA 4LDNA 2QM0A 3OE4A 1KI9A 2OO3A 5I47A 1TCUA 4MCHA 4AX4A 5HKKA 4Q0MA 4EMBA 5JDIA 1GN9A 2YYSA 4HK4A 2D5IA 5KYVA 2O8FA 3W5VA 2GSWA 1T35A 5ALTA 5LYYA 3P8ZA 2ZSJA 5HDQA 1AMOA 1IMOA 2PGIA 4I19A 4RYLA 2P0EA 1BVUA 1VIMA 3IVCA 3BKXA 4LHXA 3VNSA 4BTEA 3W9SA 4LXIA 2ESRA 5FBLB 3T1NA 1WD5A 5J5CA 5B1DA 5BQ3A 5KZMB 4JCOA 1NL3A 4L5YA 4EBBA 3A4YA 3EFHA 4D80A 3MBIA 4XWYA 5CGZA 4FM9A 4IIFA 4W4TA 5J4YA 1KKLA 1RJGA 2FUKA 3GLHA 1BG6A 1CF2O 2QI9C 2YJ4A 3RJ9A 4DGSA 3VH1A 1JH9A 3H2GA 2CVPA 4KDRA 3GELA 1E2UA 4JP3A 3T1OA 5D00A 3A3OA 2XXJA 2ZVQX 4B7XA 2FDCA 2A1UB 1TJPB 4QDXA 5CAEA 2W2LD 1M6HA 3J80A 2PJDA 1FFXA 2A9QA 3BICA 4KFTA 5CFPA 5KYKA 1QP4A 1KOGA 2OO5C 4D1YA 4PGFA 1Y63A 4BZZA 4MIOA 4QDJA 3C87A 4Y8VA 4A26A 3QVTA 2HWWA 3W8NA 3G89A 1O6ZA 3DPSA 3GLFE 1ODLA 1KFKB 1JHAA 1ZSVA 3GT7A 3PR2B 4L0CA 4US0R 4DMRA 4OGLA 1UKAA 3A1FA 2ZWVA 2WI8A 3U7GA 4C4PA 1U0FA 5ARDA 4D25A 3K8YA 1R88A 5TF4A 3AO0B 3HWSA 4DUZB 1TA4A 1Y1LA 2OESA 5I48A 3KHUA 2PMFA 2O23A 2AZDA 3RG8A 1PQUA 2QD4A 2RB5A 3LPLA 3RHTA 1OZFA 4ZO8A 4XQGA 1PKEA 2WJIA 5JLAA 1XMJA 1MX5A 1JIXA 3U4QA 3UHJA 1X1BA 3UY4A 4DBLE 3BERA 3K6SB 1Y1RA 2VQDA 1Z5VA 2PT6A 2HLNA 5C0OE 2WIDA 3D0OA 2W6OA 2MSWA 4UUAA 1KYTA 4Y2PA 4EGSA 1Y3FE 4W7SA 2Z2JA 3I45A 4IILA 3VJRA 4D56A 2X0FA 1LBSA 4KPUB 1TM7E 1L5SA 2Y1KA 2KPOA 3OU2A 3CMCO 2VSOA 2Q5QA 1AUXA 3QLVC 2HA2A 1KOLA 5IJ9B 2HMTA 3PUZA 4QOHA 1DAMA 4PYOA 1QYDA 2ZJ0A 5KYUA 3KOOA 4QBTA 3SFVA 2QT1A 8ATCA 4P0QB 1TUBB 4IKOA 4RIHA 4ETIA 1CQJA 1VB3A 3PFGA 5M04A 4MIYA 2PZAA 1T3GA 4X61A 5U9CA 2OZVA 5ELLA 1Y42X 1BXRB 3OF2A 4JBWA 1A4XA 1GSOA 2DBRA 3BMXA 4EYGA 1XKQA 4Y0NA 1L0BA 1E5QA 1P31A 5ECWA 2AD5A