1TVMA

Nmr structure of enzyme gatb of the galactitol-specific phosphoenolpyruvate-dependent phosphotransferase system
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
113
structure length
113
Chain Sequence
MGSSHHHHHHHHENLYFQGSKRKIIVACGGAVATSTMAAEEIKELCQSHNIPVELIQCRVNEIETYMDGVHLICTTARVDRSFGDIPLVHGMPFVSGVGIEALQNKILTILQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the enzyme GatB of the galactitol-specific phosphoenolpyruvate-dependent phosphotransferase system and its interaction with GatA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords PTS system, galactitol-specific IIB component
total genus 20
structure length 113
sequence length 113
ec nomenclature ec 2.7.1.200: Protein-N(pi)-phosphohistidine--galactitol phosphotransferase.
pdb deposition date 2004-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02302 PTS_IIB PTS system, Lactose/Cellobiose specific IIB subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tvmA01
3H5IA 1E6KA 1FQWA 1CHNA 1ZITA 3FDFA 4WUTA 3TB6A 3O1HB 1DJMA 2PUFA 3BILA 4OTZA 3O21A 4EY3A 2QU7A 4KPYA 1ABEA 1Z18A 1FFWA 1Z12A 2IPLA 1ABFA 3ILHA 2AYZA 4RY9A 4YLEA 3QLUA 4DN6A 4N03A 1BVHA 1DBQA 3QLVC 1SXGA 4HNRA 4RDCA 1GCAA 3Q7SA 1S8NA 1PNRA 1Z17A 3LFTA 4FE7A 2WRZA 5KI6A 1EWTA 2R48A 5JNWA 1P6UA 3OLVA 5B3JC 2PUBA 4OBBA 5FBHA 3JPYA 2FQYA 5EWJA 2FVYA 5FWYB 1BA2A 4MS4B 1BDHA 1C0EA 1M5UA 1JFVA 2L17A 1D1PA 2QV0A 4RXMA 1JWLA 1A04A 1F51E 1D2AA 1T34A 5BR1A 1E6LA 1JDNA 3IP5A 3I09A 4KZKA 3OLYA 3QX9A 5D2CA 4XASA 5F64A 3ROFA 5GOTA 3Q7TA 4OATA 3GBVA 4G86A 4D6XA 1D4ZA 3LUJA 1PEYA 2GBPA 1QO0D 4Z9AA 4Z9BA 2IPMA 1K66A 3BRSA 1M5TA 4WZZA 4EYOA 2PJUA 2A9OA 4MLDA 4RY8A 3RVLA 3JS5A 3KKEA 4N0QA 4NICA 3HVRA 4EVRA 3SY8A 1LBIA 4Q6WA 1YK1A 4XLTA 4P98A 2NZVG 4KNYA 3T95A 3DLHA 4JOQA 2IYNA 1W9HA 2QW1A 1USKA 3EDCA 2E4XA 4IF4A 4B09A 4RS3A 4W5NA 1VPWA 2HJ9A 2E4YA 2OQRA 3GA5A 1YMUA 2RDMA 4MQFA 1U0SY 4RSMA 3T6KA 4D74A 1JBEA 2L18A 4RXUA 4PICA 1MVOA 2GWRA 3I45A 4TN5A 4M88A 1KRWA 1Z2EA 3DBIA 4MR8B 4CBVA 1PUXA 3A0RB 1DC7A 1VKRA 1U04A 5KQLA 4H3KB 3L49A 1NY5A 1LK0A 1FFSA 3BRQA 3R0JA 1MB3A 2N9UA 2Q5CA 3TMYA 1QP0A 3T8YA 3MYYA 1NXTA 1XHEA 4DADA 4LE2A 4NCAA 2HQRA 1TJYA 4W5OA 3OQMA 3I5AA 1SXHA 3N0RA 1DC8A 4KVFA 2B1JA 4OG2A 4G0MA 3VNAA 4PE5B 5EWLB 7ABPA 3JPWA 1BDIA 3NNNA 4PEVA 4G0ZA 2L2QA 4YS6A 3HZHA 3MA0A 1JL3A 3F7NA 4MR9B 3UK0A 1DZ3A 4Z99A 2YHBA 4YCSA 2QVCA 3QEMB 3IPAA 3HUUA 2FMHA 4RXTA 4Q6BA 4FE4A 4RZSA 4WXEA 3RVPA 4Z4HA 3H75A 1UDRA 3F6PA 4G97A 2JBAB 1HEYA 2MYPA 1YMVA 3IDOA 1YK0A 5IBQA 2FEPA 1Z26A 3C3KA 4TLMB 5HSGA 1EAYA 3OLZA 2WY2D 2NZUG 1USGA 3RVKA 2B4AA 3CFYA 3NHMA 4RK6A 4F11A 1USIA 3MM4A 2LBPA 3TD9A 4WXMA 5E3JA 2JB9A 4LZLA 2JVIA 3N53A 4MS1A 3RVOA 1PHRA 5BRJA 3HUTA 1LJUA 5TQ0B 4QYWA 4EVQA 1QKKA 3MQ4A 3G85A 1RPJA 1ZAYA 3CG0A 5GQSA 5TPZA 2QR3A 3H6HA 3QELB 4KK3A 2LP4Y 1TM2A 3O75A 3CLKA 4MYRA 6CHYA 1P8AA 4KQ9A 1OXBB 4MR7B 1OXKB 2FXIA 4H60A 3JVDA 5IUNC 1QNLA 1RXIA 2M98A 3O1IC 1YTUA 3EGCA 4IILA 4ZYLA 3FFWA 1R8JA 3NNSA 4MLCA 2NT3A 1QMPA 4MQEB 4Y9TA 1QQBA 3OM1A 4NQRA 1VRVA 5EWLA 3CKMA 3OMXA 1H9CA 2E4UA 2IPNA 3DZDA 4RKRA 4RK1A 3K9CA 2FEWB 2QVGA 3IPCA 3KJXA 4LE1A 4P1ZA 2IPAB 2FN8A 4MQEA 4ETNA 2FQWA 2H0AA 2E4ZA 1EHCA 1PNTA 4F8JA 5FWXB 1YS6A 4RWEA 4G0QA 5DCLA 1JHZA 4RK7A 1MIHA 4E7PA 3LUHA 5KC8A 4ZMRA 5IEJA 3QLVA 1GLGA 3OMWA 1TVMA 3EAFA 4ETIA 1Y1LA 2R25B 1F4VA 3Q9SA 2IDMA 1VLZA 1URPA 4JA2A 3QELA 3SG0A 2JVJA 3HM9A 4OLBA 3KG2A 4WWHA 2HSGA 3KHTA 3HEBA 4IMIB 4MS3A 2FMFA 2TMYA 1QP4A 2W42A 3MMNA 4LE0A 4LDZA 4RKQA 2M1ZA 3O2JA 2PUCA 2WWVD 3MF4A 5KWSA 3GYBA 4G0YA 1ZY2A 2PUGA 3OQOA 5DKFA 1ZN2A 1JX6A 3C97A 3RH0A 4Z0NA 2MSLA 3RVNA 1SXIA 1JFSA 1RZRA 5IEBA 3E61A 5TPWB 2BGGA 1A2OA 1DP4A 4KV7A 3KS9A 3H5VA 4G0XA 1DCFA 1WETA 4Z4EA 5C5EA 3HS3A 4XXHA 4Z4IA 4QICA 4FB4A 3UUGA 4KK4A 4YR7A 1MB0A 1QP7A 3M9WA 1JDPA 3DLBA 1QO0A 1QPZA 3ROTA 3FFXA 4RY0A 3O2SB 3KSMA 2WJAA 4ZMSA 4MS4A 3RQIA 1DCKA 3LUFA 3RVRA 5JNRA 5DLEA 4UHKA 3N6VA 3H5OA 4MR7A 1DG9A 1Z13A 3DGFC 1K68A 1TMYA 1LJLA 3KYIB 4MR8A 4QPJC 3T38A 2QXYA 4EYKA 4Z4FA 3C6QA 2LPMA 5TE9A 1D1QA 2JRLA 4KREA 3A0UA 4HYEA 5JNSA 2CWDA 2MYTA 2L19A 4YO7A 1APBA 2QZJA 1B00A 5CNJA 3HJFA 2IOYA 4XAQA 2JK1A 2MYNA 4XFKA 5B3JA 5TQJA 2JCGA 5JNTA 3CRNA 5FWYA 4JB2A 5JNVA 1ZH4A 3H1GA 3FGZA 4O5AA 3LKVA 4IMJB 5DTEA 3Q7RA 4N47A 3SQNA 4EYGA 1RNLA 3HDVA 3SM9A 5FWXA 2XDYA 3O2QB 4EYQA 3IP7A 1J56A 3EULA 1NXSA 2PUDA 2KYRA 2LIVA 2LUOA 3F6CA 2FTKE 1YVUA 5HM6A 4Z4CA 2GI4A 2CD7A 3N0XA 1YS7A 3SNKA 1FSPA 4MS3B 3TX6A 1ZHHA 3OLXA 1ZGZA 3D8UA 4JP1A 2AYXA 1AB6A 1JF8A 1ISSA 5EWMA 1GUBA 1P6QA 3N75A 4MS1B 2WJWA 3OO1A 3UKJA 3FMVA 3MIZA 4G0OA 4EVSA 2HQOA 2PUEA 3HDGA 1U8TA 3GWGA 5HQJA 3A3KA 4PZ0A 4MAAA 3HSYA 3FFTA 4L4UA 5IUKC 3KTOA 4RK5A 4JAVC 4RK4A 2J48A 5C5CA 1QQAA 1MAVA 5IC5A 3B2NA 3NNDA 4ZPJA 3O74A 2FQXA 5TQ2A 3H5LA 1XWWA 2HQBA 3JY6A 4LDAA 3P9YA 3I42A 4YRZA 4EUKA 1GUDA 4YP9A 2PUAA 1JH9A 4IRXA 5KQPA 4N76A 2GX6A 3HV2A 4KMRA 4S04A 1NTRA 1DRKA 3BBLA 3KYJB 2HPHA 2JVKA 3HCWA 3OLWA 3KLNA 1JLKA 3QEKA 1RXEA 2MSWA 3LUCA 3CNBA 1KRXA 2CHEA 4O1IA 4N41A 3Q15C 3LUDA 4S05A 5KQGA 3OQNA 4F3TA 3N0WA 1ZVVA 3C3MA 2A9PA 1KGSA 2R4QA 4UHJA 5TPWA 3VNBA 4EGSA 1M2EA 1ZDMA 1DBWA 4H3HB 4W5QA 1LBHA 1Z2DA 3GL9A 5JS1A 3JTEA 4HNQA 1EFAA 3EODA 5JNUA 4LX8A 2MSKA 4OLAA 1E6MA 3TO5A 4ETMA 2PMCA 1L5YA 4MRMB 5HKOA 2PKXA 4Z4GA 4G0PA 4YWHA 3KLOA 4GNRA 3IP9A 3M9XA 3CG4A 2FSPA 2ZWMA 2QSJA 3GT7A 3LTEA 3CZ5A 1ZESA 5T7BA 1AB5A 1FFGA 3H6GA 3URMA 2RJNA 5KC9A 3JVIA 3GBPA 3HK2A 3D02A 5KQMA 1P2FA 2PAFA 4ML3A 4RU1A 5IUJC 1DBPA 2RJOA 3QX8A 5IULC 1ISRA 5I4CA 2WMYA 5DGCA 3C3WA 1NXWA 2FMIA 3LUGA 3HXMA 4JB0A 4LRQA 6ABPA 3KCNA 4DQDA 3IP6A 2A9RA 3GRCA 3OO0A 2P4UA 3LUKA 4RV5A 1NXVA 2V0NA 4RK0A 5JS2A 3H5WA 1L5ZA 2E4WA 3QK7A 4KRFA 3W9SA 3S99A 1YIOA 4JASB 4IGAA 3LOPA 1EWKA 2FMKA 1ZGGA 3K4HA 1DRJA 3H1EA 4ZJPA 1EWVA 4W5TA 1BDJA 5TQ2B 3QLTA 3HO1A 1Z25A 1I3CA 2PLNA 5CNMA 1D5WA 5CHYA 2RGYA 2VUHB 4L85A 3RVSA 2FN9A 2WB4A 4MRMA 3LUAA 3BREA 4N0PA 4KQCA 5IX8A 4NV3A 1SRRA 3ILYA 1NXOA 2FEKA 1Z15A 9ABPA 3QLUC 1NXXA 4TMYA 4YGXB 5ABPA 1JFTA 1C4WA 1XHFA 2R47A 3CZCA 4F06A 1BAPA 2VK2A 3EQZA 3N8IA 3GV0A 1PEAA 2FLWA 1U2QA 5PNTA 3A10A 1SD5A 2MYUA 2PL1A 3QEMA 2NUBA 2JBAA 4MPTA 1IIBA 1DCMA 2PL9A 3E3MA 3CU5A 5TPZD 2ZAYA 2ID9A 5FBKA 3G1WA 3EJWA 2VUIB 3RVQA 4E7OA 1CYEA 5T3YA 1U2PA 3LKBA 4XARA 4F12A 5ED4A 1JYFA 3Q41A 1RZRD 2I6FA 3CTPA 2FKAA 5BRAA 4W5RA 2F8SA 5TQ0A 4KFCA 5CNIA 3M6MD 4WT7A 1TLFA 1KMIY 1E2BA 2O20A 1JYEA 2FLKA 5EWJB 4O1HA 2YHAA 1M2FA 2DRIA 3RVJA 1A0OA 2IKSA 2H3HA 1ZH2A 1CEYA 1NATA 5EWMB 2VYCA 3RVMA 4D6YA 3L6UA 3NHZA 4MQFB 1Z16A 3H1FA 4MR9A 2CHFA 5CNKA 4TLLB 2P9HA 3CHYA 4PYRA 3SAJA 4GPAA 2NT4A 3OM0A 2OENG 2FW0A 4YV7A 2F8TA 3LMKA 2E4VA 3DGEC 3NBMA 3H5TA 5BQ3A 4NCBA 1GCGA 4MGEA 2GKGA 2PE5A 3F73A 2X7XA 4QYMA 1NXPA 2A9QA 2ID7A 3O1JC 3CS3A 1W25A 4HNSA 3EQ2A 4Q7EA 8ABPA
chains in the Genus database with same CATH superfamily
3OF5A 4YAEA 1VBNA 4U0JA 3V00A 3NTUA 3VX3A 3PV0A 3FTDA 1BN7A 3BILA 3C1TA 3I0NA 5H68A 2I0FA 5JAQA 2WHPA 3WB1A 4IQGA 4PHTA 1XDWA 3V2UA 3GLQA 3O21A 4G25A 4IO1A 4N5DA 4IUBS 2PM8A 1OBHA 2QYSA 4HAVA 2CNWA 1HNNA 3W9UA 4B46A 2IC5A 1NZJA 4MKZA 4HFMA 4DCNA 5K7SA 1NJGA 4CKBA 1OBOA 1ZGJA 2FWMX 3F0TA 1DO8A 1Z3CA 3LDUA 4O4JA 3QNWA 3DV2A 5HIJA 2FK8A 4Z3DA 1PGPA 2IOHA 5CPBA 2WRZA 4LUCA 1ADGA 1ZVMA 5JS7A 1WM1A 3IUJA 4X94A 1JEQB 1SBCA 1PJSA 3W9YA 3IOBA 4X65B 3Q8XB 3PEUA 4FFSA 3WGYA 5ADUS 1JFFA 1I9CA 1NKTA 3CBQA 3M6XA 5ITZB 1C7IA 2P8SA 2GKSA 4YLYA 1OVMA 1HQYE 2ZB4A 5BVGA 1R27A 2WE7A 3FOWA 3D6VA 2B9VA 4UEJA 1JFVA 3NBKA 1JAZA 4QSHA 1QZUA 3ORFA 4ASUA 1MB2A 1QCYA 2AS0A 1ZJZA 3NX4A 4HRYA 2PBFA 1R6VA 1PWZA 2J3HA 4XASA 2IKQA 4P22A 1K08A 2RI1A 3PG5A 1GPDG 4LDQA 2WJPA 1Z6ZA 4TS9A 4N9QA 2BI8A 5HJEA 1H1LB 4PZYA 4ZZ1A 2I4OA 2I29A 3C43A 2YY6A 1V35A 4ZGWA 1XI2A 1K5GA 4PC7A 2PR2A 3VZCA 5CRIA 1HH4A 1F0KA 3WJ2A 3RS5A 3S6JA 1WZIA 3EDOA 2QTFA 4Q6WA 4U3JB 3LV8A 3V7NA 3WKBA 3FOCA 3S3TA 3UJAA 1U8YA 4NABA 1AKNA 2JH3A 4QL3A 5BW6B 3ZWPA 4B2PA 3D64A 3PIDA 4TYPA 2P2DA 3DLHA 1SCNE 1F2UB 5BWLA 3DL7A 4JEHA 2Q45A 2Z08A 2Q46A 4Q00A 1RM0A 1L0BA 4EGFA 3B2QA 3SBOA 4ED9A 1BO6A 3PD1A 1DKMA 1PAUA 4A36A 3NO4A 1QC5A 2ZJ6A 3L1UA 1JQJC 1WR8A 4RPKA 4B44A 4D74A 3MGAA 3PNVA 2VOEA 1OYYA 4FPXA 4KMOA 1BEEA 4M88A 1PV4A 1Q22A 1Z2EA 3GMSA 1H42A 1GSAA 4FC7A 4D1YA 2ONZA 1NG9A 4CBVA 4HGNA 4MVJI 1Z5UA 1D0IA 2EIXA 1SVOA 1RLJA 1GUYA 4KR0A 4GX5A 5F98A 2OG2A 4ZVTA 2XZDA 1NXTA 3FYUC 3I2IA 4R8RA 1Q3HA 4AFNA 3DOCA 2O2DA 2QTLA 3AB3A 3G7NA 2JIOA 3FM9A 3JRWA 2OTCA 5ELMA 5IAJA 3R9WA 1AY0A 2W4IA 1NAHA 3LXXA 3HJNA 2HDHA 2QGNA 4JENA 1EFDN 1D09A 3NANA 4UARA 2JI7A 3RUCA 3ETHA 3QJGA 4DE5A 5JHGB 1VB3A 2E6KA 1MGPA 1SD2A 2UUCB 3PHGA 3T1TA 1RZUA 3NAMA 1K7CA 1UQUA 1GSIA 1Y89A 4JSYA 4YCSA 3EC1A 1HC7A 1J8FA 5A3JA 1XTBA 4QYSA 1GVHA 1SOUA 5I51A 5IDVA 1SC4A 2ZVDA 4FMCB 4AURA 2X1MA 4DDVA 5BT8A 3DFIA 1KYVA 1YCDA 3IDOA 5LQNA 4OVKA 3WL3A 3SQXA 1J20A 1K0FA 5DHPA 5EZYB 1CLEA 1CB7A 1UWKA 2BFCB 2JAHA 2OPBA 2QPTA 3D59A 2EJVA 3NT5A 2B6NA 1NZDA 1ONNA 2XGGA 3KR2A 2XNKA 3MC1A 4E4RA 5KTYA 4C7KA 1ZWKA 4D3FA 4NZNA 3I04A 1WLSA 4V0OA 3LIPA 3CEMA 4EG3A 2FPSA 4QYWA 3GLSA 3HJRA 4M4SA 3I2GA 3G85A 5T8KA 2YBEA 1SMKA 2AOWA 2WT8A 3DBRB 4PYOA 5ALWA 3QM1A 4KDCA 1E9EA 1SVKA 4KXQA 1Q77A 4A5OA 3S1LA 4ER6A 5DYYA 4B3GA 1F0YA 5A4DA 3NIWA 1U9JA 2WU4A 3EGIA 1N6NA 1DVRA 3NP9A 1KZ6A 4DIOA 1P8AA 3EZGA 4MCHA 4UDYX 4WZBA 4IV8A 4OHVA 5ILGA 4ZCMA 4NRDA 2EG5A 4UM9B 5KJCA 1NQWA 4B34A 3JQRA 2P2GA 3P0IA 4D79A 1U2SA 1XA0A 2IP2A 2AN3A 3BMCB 2EYQA 2RG7A 1A5ZA 1XMSA 4IHAA 3K0CC 3GLUA 4XUEA 1G6Q1 1TQ6A 4J7XA 2KHZA 2BP7B 3ID6C 4M7RA 2JLYA 3C7TA 1KDRA 4BNZA 4M1QA 2CMGA 3FKJA 2E21A 3N2KB 4MQEB 1DQNA 1A2QA 1K4KA 1T0JB 1T43A 1WSBA 1FRFS 2GRAA 1LDNA 3FJOA 3KJIA 4J7CA 2FZEA 3PNOA 5EWLA 5HILA 5TIIA 4LHSA 2GJAA 3D8NA 1QORA 4J6EA 4RKRA 3AWDA 2FEWB 4IZOA 1JZSA 4CMIB 3C45A 3H86A 2YWHA 3HE3A 1ZICA 3HU5A 4YMLA 4INJA 3JYLA 2ACVA 1TYCA 2C98A 5P21A 4BFXA 1ESEA 4C7BA 3JQAD 2R66A 1M7BA 1O2DA 1ZM7A 2Z6VA 2E5LB 2R2AA 4KXVA 3G8YA 1UZUA 2NADA 2PA3A 4P8RA 3A4MA 4DSUA 3ZBQA 3K7EA 1G16A 1C50A 1M2NA 1T3LA 1ULSA 3CR7A 1I4EB 1H0HA 3PX2A 2EKLA 4KAAA 2A0XA 4LVNA 2BFFA 3FPKA 3LW8A 1XNHA 1YAHA 4UZEA 4HN9A 4JVNA 4ZO4A 2BBOA 4ZA2A 5EFOA 3UC9A 2H48A 3DTVB 2WYOA 3I30X 3WAKA 1LCIA 1D0VA 4C6SA 4G0NA 3RD5A 1KAGA 2DM6A 4CEIB 4ZAVA 1TMOA 1EINA 5EJ5A 2LDXA 1VJRA 5B2FA 3VZDA 3LT4A 4H6WA 1ZJJA 4PAMA 2Z6QA 2BEKA 3NXKA 1P2VA 4UPDA 1Z37A 4H7DA 4YMVA 1E77A 2D1QA 3GZNB 3NWOA 1AKEA 3ZDDA 2A4MA 3ZU3A 5ALMA 3Q6MA 5GJCA 2JI6A 3D6AA 3OCCA 5DKFA 1ZN2A 2O7SA 2WUDA 2D6FA 3OZUA 1KAHA 5B1YA 2B4QA 4KE8A 5J63A 1YJ8A 1TTPB 3RR2A 4I55A 4GUDA 4AN4A 1DP4A 4B6FA 3QE9Y 2GEJA 1SKQA 3U1TA 3H5VA 2ZAGA 2GD1O 1HKHA 1HDEA 1O57A 4Z4EA 3LL7A 3SJZA 2C2WA 4EHDA 5DHSA 3R1IA 1E3JA 4P83A 3X1DA 3L8ZA 3FOAA 4GVLA 3TTVA 2QVBA 2N46A 2XECA 2EFJA 3MT0A 4LXTA 3D8TA 2CKDA 4O2LA 5ERXA 1Q0RA 5KO2A 5ILOA 4U8HA 3A4IA 3M9WA 2RH8A 1J9GA 3NOQA 5HCIA 2JIMA 1RYHA 1Y5LA 4K9MA 1A8IA 3K70D 3O2SB 3KSMA 3P52A 4K5QA 3K73O 2QB5A 1L2TA 4NYJR 5TX7A 1SRQA 1H69A 1RJ9A 1K27A 1OFIA 2VTEA 4PR3A 4DMRA 1SFRA 2OYSA 2ZIEA 4QPJC 3T38A 2ZI4A 2AFIA 4GMDA 4IDBA 4C5AA 2ZIFA 5EUQB 3D31A 4ZOAA 2R96A 1L5HA 3ZTYA 3F78A 2JRLA 2WWVD 1DUVG 1UEXC 2WNHA 2XLCA 3L5OA 3LU1A 3AESB 4S1TA 4FC6A 3U81A 4DM7A 1XZ8A 2FJ0A 4DR3B 1P80A 1QH8A 1L5MA 1WMBA 2VT7A 2XRFA 1RI2A 3EXHB 3R3SA 4MK4A 4CI0B 3RADC 1YULA 3PLAE 1G41A 2YOFA 4OOEA 1MC1A 3RVDA 5AVWA 2AX4A 2JCGA 5M34A 5EJEA 5MN4A 1ZZEA 1CFJA 2QZPA 4B47A 2EFGA 5LBTA 1GGKA 5TLSA 3BDVA 3UOGA 4A0RA 1NBOA 2QRPA 4N47A 2QE6A 2YYYA 1RNLA 2BMEA 1X42A 5K1ZA 4AY4A 1HK7A 2DPMA 2F90A 3V46A 3HLKA 4M76B 4Q1VA 1JBKA 1YZKA 4EYSA 1LNQA 3T7RA 4DIMA 2PUDA 1PSWA 4LRSB 3PHCA 1GTRA 1OF1A 2D62A 4GR5A 1IUNA 1GR0A 3Q9UA 1Y82A 2JFFA 4IZ6A 5FI1B 3EBPA 1GCIA 1UAAA 3N2KA 3JD1A 2ZYRA 4MVJH 4EA6A 4OGKA 3FUXA 2PZ8A 3GEIA 4LXHA 4PCVA 3HNRA 4QM7A 5HE8A 5C8YB 4NU8X 1AA6A 3BMQB 3N75A 4LZAA 1IBSA 1GXSA 1VCNA 4LXQA 3UKJA 4B6OA 1VPTA 4C3UA 5ULLA 1YE8A 3T4XA 1U7TA 2IHNA 3WGQA 2GCPA 4YMIA 1U31A 3KB6A 2UYCA 3GFBA 3SYNA 4A2PA 2Y77A 5TB5A 5KYUB 2IITA 1S7CA 1OBCA 1I94B 5LJIA 1R4NB 3RUAA 2OVBA 1GPWB 2IOFA 5F5NA 2VSYA 3LT2A 4JJKA 4R05A 1KOFA 1XRNA 2R1TA 1VZ2A 4Y2RA 1SUCA 1UJ5A 1TRKA 3HP1A 4I2VA 5G0WA 2O05A 4Y2JA 3V1YA 2DHDA 2GHQA 5KKAA 4PSCA 3CGGA 2PXXA 4JT8A 4PPFA 5LOVB 3DTVA 3ZZ1A 5ICFA 1II9A 3KOWA 3AF6A 4KODA 3M4YA 1BGWA 3L0ZA 4DCJA 2B78A 1L4GA 2B25A 3ZV4A 2PUAA 1DAPA 3PJGA 3GLRA 3GWZA 4DCVA 1ZXLA 2AOXA 1VXRA 2NIPA 3H18A 3NZEA 4PZLA 1VE6A 4MAMA 4F84A 4CN8A 3VU8A 1U1FA 1HLFA 2Y0DA 3VC7A 4HDQB 4HC4A 2VYQA 3B1WA 4Q9KA 5JIBA 3ZH2A 4JBXA 3IT3A 3WYCA 1RLMA 4I81A 1ODKA 3Q11A 5FOXA 1DAMA 1G4UR 3KQNA 2QIOA 3NFYA 1EI9A 1B1CA 3ROEA 2Q1XA 3CRVA 1S2LA 3GU3A 4EQ6A 1TE2A 2CL0X 1XYYA 3OZBA 2FFHA 3HPQA 1J99A 3N70A 4HWTA 4L27A 1LZKA 1XU9A 3B48A 3ZX5A 1RS0A 3AUSA 4XDHA 1N2IA 1KVRA 1MORA 3IUBA 4HPWA 3A28A 4LX8A 3DFUA 4R0NA 4BTLA 2V6GA 4C0HA 1MNQA 1UP6A 5HKOA 2I8CA 3LFUA 3N3AC 3WYBA 2V3CC 3LPAA 3L4EA 2O2EA 3H4IA 1E9RA 1HE1C 1PVDA 1YZTA 3GUHA 5DNWA 5LZ5A 1FSGA 1HM5A 1W2GA 4PLYA 1FP4A 5E1BA 3S29A 5AQ1A 5BQXA 3K0KA 1XZQA 2VKTA 3M5WA 3QKTA 3EAQA 5CB4F 1ZA2A 3MB8A 1G6KA 2EJBA 1E3SA 4IS3A 2CCKA 3L0YA 3RO7A 4FEEA 3E1KA 4FDUA 4HO1X 4TUYF 5T4EA 3P45A 1PZEA 3CA8A 3RV4A 3QX8A 2FRDC 3GGOA 4EF4A 4AF8A 5ISMA 2CV0A 2WMYA 1SQ0A 5AHXA 1AXGA 3C3WA 2BTQA 2ODQA 4DZRA 3U44B 6LDHA 1E1CB 3LYAA 2I76A 6ABPA 5LDGA 3PGVA 1Y6RA 3BCHA 3MJEA 3RT9A 4DSOA 3O90A 3VDMA 2GF2A 4Y6PA 4UUQA 4F97A 2OZEA 4MTCA 3IJRA 4YAKA 3W9SA 4I50F 3FLMA 3DH0A 4ZEWA 3WDMA 4MRRA 4QFBA 2YV1A 1MABA 2ZS8A 1EWKA 3WQQA 4KC0A 3K4HA 5F4ZA 5IVPA 1PU2A 2QLFA 3GY0A 1YRLA 5IXYA 2P9QA 1QS0A 2BHTA 3WKCA 1XCJA 3QFRA 4UBNA 3HFSA 3LXMA 3MTBA 4DAOA 4K8OA 4Y0AA 2PT7A 1M2VB 3REFA 1AHPA 2GNAA 1J9EA 3JATB 5AM0A 2XE8A 3FB4A 2DPLA 4NV3A 3CUEF 5I7FA 3KSUA 4EI8A 1Q15A 5J3JA 3QLUC 4M0LA 5BN3A 5EJMA 3T1YB 3AEXA 1XHFA 5BMVF 5CH3A 4ZVRA 2CXNA 3GRAA 1HSZA 3V8EA 2NVWA 3L7BA 3SHFA 3B78A 1RAIA 5C1OA 3ESXA 5E95A 9GPBA 1ENOA 1KJJA 2Q4EA 5EPUA 5BMVA 2VTBB 1E5XA 1YDMA 2G72A 1IQUA 2BDTA 3E58A 4LOLA 4WVLA 1GUAA 3FN4A 1XD2B 2SECE 3CNEA 1H22A 4EGJA 3JVEA 1CJVC 2V9ZA 2IY7A 1E98A 3BWVA 3EMDA 4FQ5A 4N7JA 3ZDQA 4D42A 1KEEA 4NESA 4W5RA 2IS1A 5I01A 3FBTA 2HK8A 2I4LA 3ES9A 2Y67A 2XB8A 4TV8F 5ALNA 3FOZA 1S2MA 2H31A 3C5CA 5EWJB 4LWPA 4MW9A 4ER7A 1R6XA 4G3XA 5F77A 1WSWA 3HZRA 1P2UA 2IKSA 2H3HA 2K2WA 4PGAA 3CRQA 1E8NA 5DISB 2PJRA 3BERA 5E6RB 3NKLA 2GBIA 4LZNA 3I8XA 3SKVA 1ECGA 2ZIZA 5JR3A 4A8JB 2YVKA 2GPJA 3QY9A 4HXYA 4OHUA 3LP6A 3SYLA 2YXBA 2XA9A 4L5JA 4HVTA 4XFJA 3KAPA 1FFHA 5A4MS 4Y1FA 3KQUA 3L1HA 1U9IA 1Q50A 3UQZA 2F8TA 2G9QA 3MPUA 3J81k 1JQLB 4DLPA 3EGDB 3UJ8A 4GGPA 4EGCB 2PE5A 3F4KA 5DYWA 1D1SA 1NVBA 2NQTA 3OC6A 4X1YB 5BOSA 2GPAA 1KZHA 2JFZA 4PSKA 1RRVA 1RWMA 4L0DA 1UBNA 4EY8A 1H3EA 2FPPB 4BO7A 1FQWA 4RJKA 1TTHA 1UADA 3TB6A 1TM7E 2X77A 1L8XA 1O3YA 1QE0A 3ICVA 1UMDB 1ZRMA 1NUAA 4EZIA 1PJCA 2BT4A 3N74A 4EY3A 1Z7BA 5D3QA 4KN6A 2GARA 2LDBA 2POCA 4X44A 5DHAA 4L6CA 3DZCA 4P58A 3V33A 4AU1A 1VP9A 4J0FA 2IPLA 4BAGA 1VMKA 3H9GA 1MXHA 1I9GA 2ZREA 5I8ZA 1NBEA 4XSVA 3L8GA 3RJ5A 1WCXA 5AW0A 1W0JA 4LZOA 4RDCA 3L6OO 3DWGA 1U3VA 4ODIA 2JFBA 2EC5A 5A02A 4FE7A 2OORA 1TC2A 4PGFA 3SJAA 1QM5A 1UP4A 4RETA 3R5XA 1OJLA 4Q3DA 3UHAA 2LCFA 4NBSA 1T1GA 3EEQA 1BD3A 3WG9A 1PFKA 1U7UA 2XYPA 3K1AB 3OT1A 1I2ZA 2CXQA 2FVYA 4EBFA 1EFVB 4DLUA 4WDQA 1G20E 1DXQA 2A1TS 4RVCA 1YJAA 3EWNA 3I32A 1GPNA 3NTXA 3IR6A 3PCTA 1MG5A 1TEVA 2WFAA 3DEKA 3E5MA 3R77A 3O82A 4LNAA 2RMKA 3WHIA 2YR0A 5CB6A 1NP7A 4R3UC 1U0BB 1XXHB 4QNRA 3F3SA 5IVIA 3QGMA 4CV0A 5EJFA 3A9TA 5FKJA 1E9SA 1HZZC 4HDRB 2QN2A 3GPIA 3MJTA 3V6LA 5KKNB 4JT4A 3H7AA 2POQX 2YZ2A 1XD9A 1AMNA 3DZHA 3KWFA 1DSSG 3M3PA 4L78A 3VR3A 1V71A 5CFZA 5FT9A 4YJFA 3K5IA 3F8WA 4LYYA 5DULA 1BWRA 1Y8QB 5EKDA 3LA8A 6GPBA 1RM3A 2O7RA 2D1RA 1QE3A 4KACA 4CM8B 4OHPA 2ES4A 2XBUA 2QRHA 4D4HA 1XLVA 1DKNA 3CJTA 3MXOA 1KI8A 1SBQA 2XE6A 4EHFA 3F5MA 2TMDA 5LP6B 1I3LA 4QXAA 2G71A 3MJ4A 1R12A 1ZZGA 4KXNA 3SI7A 5C81A 5TJ9A 1QSGA 2WHEA 1PK8A 5BSKA 1NSYA 1UMBA 1UMCA 2FG6C 5EIWA 2R62A 1XMIA 1ZG3A 5KOJB 1R4ZA 3E2MA 4ZV7A 1GU1A 3DBIA 3LHFA 4YO8A 2JIQA 3TL2A 2BGUA 2WJJA 3M1AA 3LVBA 1PK9A 4Z7OB 1RPTA 2CMKA 4ND2A 5HDBB 2IYPA 2ZE7A 3TQRA 1ZXBA 1QCDA 5B64A 2I2BA 4XD2A 3CSUA 2AG5A 1UKEA 5JDCA 2C8VA 3HBFA 1KAOA 3FYSA 4MI1A 1G0OA 2LW7A 1V7CA 4BMNA 1QE5A 4HWRA 5KBYA 4E12A 1ZM4A 2WV9A 1RXCA 1CJBA 1U28C 5TMDA 2HT6A 1M2HA 4PEVA 1NN1A 4CF5A 5JJCA 1V7QA 5AJXA 4ZOLF 1X7XA 3O2NA 5ENVA 2OHGA 1P7CA 2ZIGA 3L4JA 4LVCA 4OI4A 3TQOA 2X8BA 3U19A 3NUGA 4PCUA 5DTQA 2JBAB 5CB0A 2O48X 2QMYA 3LLVA 3EEBA 5IKPA 5K8VA 4PGMA 3SZLA 1UFQA 4X9XA 4JI6B 3FYUA 3PNPA 4N5LA 4W1QA 1IBKB 4HT3B 4Q4LA 4RAQA 3QPCA 1ADBA 4LHXA 4WFQA 4KR7A 2GN6A 1BRMA 3EIFA 1VL5A 3R6WA 4L8GA 3TD9A 3ZHBA 1SBNE 4RQTA 2J3QA 2BUCA 2VSOA 3ZK9A 5K3DA 5IBCA 1C9EA 3DNPA 5K3FA 1SOMA 1KFEB 2AKAB 1FUIA 5GQSA 3OOWA 4X1IA 3WNVA 1W75A 3IBGA 4P80A 1H65A 2WD9A 4WAUA 1B3RA 4MROA 2DP4E 1J06A 4KK3A 5CDTA 5FEUA 3RYCB 1M5RA 1CUBA 1GPYA 1JVBA 1YJQA 3C1AA 4IYRA 1HORA 3UN1A 1WULS 1YS9A 4P86A 3DW3X 4PVCA 1BHSA 5DM2A 3DMYA 4V1CA 1WB6A 1NQVA 2O52A 2ODEA 3KXDA 5FTKA 1EMDA 2G6TA 3OPYI 1TKCA 3F7OA 3GZNA 2EFDB 2XHEA 5DGHA 4X00A 1EDDA 2X5OA 3JD4A 3U62A 3CH5A 4BB5A 3R8CA 2WVJA 2XNDA 2V1XA 3SBXA 3PFNA 4INPA 4U2KA 1I33A 1FUUA 2XCIA 3KSAC 2O8BA 4ZREA 1U5AA 2I87A 2DMRA 1JQDA 3F3KA 3FCAA 1Y80A 2QHXA 4TKZA 3EH2A 3WLAA 1SIUA 3AU9A 1S2DA 5LU9A 2QYHA 3RFUA 2AN9A 1X14A 5F52A 3ASYA 5TF4A 5KTTA 2L82A 3DD1A 4BQRA 4RPGA 5FNVF 1P45A 2H7XA 5CFPA 3VV3A 5FLKA 2OCXA 3QLVA 4CV3A 1YB6A 2F4NA 1B76A 2EHDA 3CIFA 1HZZA 2OLJA 2EXXA 2QG4A 3JXEA 1YVEI 2Y71A 1F4VA 1P0MA 2CFRA 2CHGA 4WK2B 2CV2A 1QTQA 1BSVA 3EPHA 1A8SA 3ZZTA 3K09A 2YX1A 1QX4A 3A9RA 4G24A 2B8TA 1SC9A 4U7PB 2G70A 5LLSA 4KWEA 4L7QA 3MMNA 3OJLA 5AOCA 1LK5A 1Q21A 2OFPA 1W19A 3WNBA 5CA0B 3O8DA 1K6MA 4PHCA 3TCKA 1H3FA 2YXEA 4FYHA 2DFVA 2XV1A 4MRNA 4RVNA 4YBZA 2ZSEA 1U1IA 1HLPA 2ZBPA 3CM0A 3RS2A 4XYLA 3BXGA 3RU7A 2X2FA 2ISCA 2UYOA 3COSA 4RULA 4GBJA 3AEYA 4FKZA 1J0AA 2GNOA 3FNRA 4ISCA 1VFNA 2MJLA 2PT9A 2QPOA 1OREA 3BIJA 8ADHA 7GPBA 2GVDC 4IUYA 4RNDB 1OZ0A 4QU9A 2CB9A 5BV1A 2P1RA 1CW2B 4QBTA 1O7JA 2J09A 4GP7A 1C3EA 2XKBA 4K88A 3TLAA 3FR7A 4Q93A 2O8BB 2W2LA 4KV7A 4H7EA 1DRWA 4G0XA 1SURA 4FGSA 4ND5A 3WO0A 5I7SA 3K9FC 1W48A 1T6BY 1QHIA 1BROA 5D8DA 2QW8A 4PG5A 2A7XA 3VJMA 3R6TA 4FW8A 4B4OA 4CM4A 4N5IX 1MN6A 1CY0A 4MA4A 2I22A 1XZPA 3DBLA 4AG5A 1TFUA 1UKCA 2JA1A 4ND8A 1JKFA 4WZBE 1EFUA 1XTQA 5BRNA 2BKLA 4ZMSA 4CW7A 4OXIA 2XMPA 1PHPA 4ESHA 5LDHA 1ZRSA 3NCTA 1O96A 2YYZA 4RENA 4M8LA 3OZTA 4P0TA 3AFNA 1NFQA 4JU8A 5B7NA 5TE9A 5JTTA 1L7AA 4X8OA 5HJ7A 3PGMA 5J2UA 1N5DA 2ZT5A 5IVDA 1W1UA 5E1DA 5BVHB 4LEIA 1K06A 1AK9A 1QAMA 3ECSA 3WYNA 1X94A 4J91A 5I7OA 5FI3A 1S3IA 2PLFA 4NBNA 3VFDA 3GIDA 2FPUA 3I58A 3ABSB 4JYPA 5TQJA 2DPYA 4OAQA 3ZLTA 2I3BA 2QP9X 3SICE 3JWEA 5HKBA 3W6PA 2EZ9A 1HETA 5DTEA 2B21A 2PH3A 4CG2A 2YJGA 2PHZA 3DBHB 3LX6A 1LTHR 4Q1EA 4AVYA 5CB8A 2PSSA 3CLVA 4OHKA 3C7CB 2R0QC 3BSYA 4HY3A 3FCEA 2Z5VA 1P73A 3JAWA 3DWIA 3UGQA 2NZ2A 2VDNB 3RYFB 3DLIA 1X0VA 2GAOA 2SKCA 1LDYA 1J07A 1KA9H 2RSLA 4LXGA 4ZQHA 1MHPA 3TGWA 4FNAA 1P2GA 4MRSA 3SLKA 1GU0A 1V96A 1C0LA 3MB5A 4IIJF 3MOIA 4OFWA 4L8LA 1QHYA 3JQFC 1VC2A 4H4DA 1JN0A 3ZIDA 1TCVA 1CQXA 1JT2A 1W581 1W5FA 1WD7A 3IALA 2ZSHA 5CK5A 3UWKA 2VDVE 5FTJA 3LCJA 5HRUA 4ZQBA 3TOSA 4L4UA 2XB9A 4NQZA 4LNUA 5LQCA 3JCZA 4ZT2A 3R3ZA 4V3CA 5B4TA 1C8VB 4UMEA 2CFSA 3WAGA 3TNJA 3MBOA 5B55A 3LWBA 4OX9Y 4PLTA 2D1TA 3H5AA 3HADA 1SUEA 4JGBA 3RGWS 4E22A 2HQSA 2JI8A 3A7DA 4TS1A 3EOAI 2WZBA 4WE3A 1JHMA 5JD3A 1P0IA 2ZOSA 3FNBA 5AW4A 3LSYA 2HQBA 4LDAA 2QM0A 2OLKA 2Z95A 2FMTA 5E9JA 5IJ0A 2B98A 2R86A 3PUJA 3OZEA 5EE0A 1GAXA 4P9NA 1Z7EA 5AJYA 1HFEL 1Y8RB 4GE3A 5CD9A 1X7DA 4KRGA 4O4LA 1LDGA 4PZDA 3KYJB 3Q3JB 1Q7RA 2H2GA 1B6GA 3K1YA 5LKAA 5AW5A 3V4VB 3KQHA 2IQ5A 3H8WA 3NT4A 3CNBA 1E1CA 2QVYX 4PPYA 2Z2ZA 2NV6A 3UWSA 3U13A 3GRRA 1OCEA 3OZSA 3AHHA 5LNK1 2QUBA 2J9YB 4KAFA 1J8VA 1MAHA 3LF1A 3LDGA 2QJFA 1QQTA 5GY7A 5A9SA 4GPTA 5DM0A 3ZWKA 1ZVVA 2D5CA 2Y1KA 1NVGA 5DTMA 1L4MA 4ZT6A 4MCIA 4EFDA 3IGFA 1RAFA 5DN6D 2N1MA 2EJTA 1HE5A 1TJPB 1Z4JA 2VA8A 3ZYZA 3K9HA 3IRUA 2Z0MA 1QH9A 3AM3A 3LP5A 2XT9A 4TWIA 1R5BA 1RAGA 4MV5A 2PZMA 1CG6A 3U7QB 2QD4A 1MVLA 4Y6LA 2WKWA 4I4IA 1B8UA 1RSZA 4QRIA 3I72A 4EPYA 4G5HA 3TO5A 2PKXA 3PUXA 4E5PA 5CBPB 4J9UE 2H0QA 1D6MA 1XTIA 3P19A 2F1KA 5FLEX 2GS9A 5B3AA 3DAOA 2FP3A 4U1RA 1SA0A 1CIPA 1ZESA 2W37A 1MU0A 2QRKA 3C8HA 4UVDA 4X1KA 2GESA 2OEPA 4MQ6A 3I9LA 4MUHA 2CVPA 4WH0A 3TS1A 4F04A 3OLCX 2P11A 3HJTA 4CKXA 4ZVLA 2JFVA 2OV4A 2GZSA 3ZX4A 4BP1A 1KYZA 2BM1A 1C0IA 2QJTA 1W4AA 1N0VC 1T4CB 2WYIA 4ISBA 4XPIB 5A4AA 2I6XA 4M1OA 5CT5A 1FYVA 3W6NA 1OXVA 5D01A 2E85A 4IINA 1ADJA 2ODTX 1D07A 2Q3CA 4V0SA 5AKHA 1M0TA 2WQ7A 2FEXA 2EBUA 2PSFA 3DCYA 2AQKA 1ZK1A 3D8SA 3GLKA 1ENYA 2XZTA 2RB4A 4JK3A 1DG3A 3TPCA 1A5SB 1X1TA 1JUDA 3O9ZA 5I48A 1XEFA 2Q5EA 2QTRA 2PRZA 3HR4A 1N2JA 1QBGA 2I2AA 2MSNA 5TQ2B 3IAXA 4RGYA 1K0UA 3ND8A 4NATA 3ZDYB 2GEUA 1Z6TA 3EZXA 3UK2A 4BVLA 3EX7C 3AYXB 3O0TA 3VH1A 5CDFA 4AI6A 3B5IA 1ZH6A 2J85A 4MDHA 1AS3A 1L7XA 1N7JA 4KXMA 1KZGB 1PQ4A 3RU9A 3RVSA 3WYFA 4DHWA 1IIRA 3MINA 2CLEB 4ZI3A 3KZOA 3RYTC 4DIFA 3VA7A 2I9KA 3R3HA 4G65A 3WNDA 5THQA 1P9LA 1DGQA 2GO1A 4O2BB 2I4TA 4P5EA 5E8RA 3ROMA 3TMKA 1E6UA 1DEOA 1VHQA 1SK8A 4L72A 2JGRA 2PRJA 2FPPA 2QRVB 5CEJA 1YF3A 2DECA 4I1PA 1CZKA 1R0YA 1Z5OA 3QNMA 1C80A 4MPTA 1CZLA 4DWWA 1M1NA 2PVCA 2ZT6A 3GXBA 4PYNA 5EP3A 2DJIA 4IL5A 5FBKA 2BR3A 1C2YA 2BFEB 1COZA 1GPBA 3BXFA 3DFZA 3RVQA 4ZOLB 3CZ9A 3U3DA 4BVKA 2G40A 4GSLA 5F9HA 2QRQA 3CTPA 1ETUA 3T9EA 4JL6A 5E9WA 3TJZA 4BV2A 3O73A 4DLBA 1VJ5A 4GWKA 5LIRA 2Q29A 1XCMA 4HWGA 1EGHA 1TQ8A 3HBJA 4EZBA 1WMDA 5LMZA 3K16A 4CMBA 1B14A 1O03A 2HXYA 5CJJA 2HH9A 3MPOA 2NO7A 3K2EA 3NBYC 4RPHA 4Y8VA 4CM7A 2Z04A 3LX4A 1BQEA 3EIXA 1PFQA 5C35A 4ZK6A 3ND9A 2IEGA 1FU8A 4OQDA 2ZM6B 1RR6A 5LR6A 4ZTUB 421PA 4XTRA 4TLLB 1AKVA 3UWDA 4BBAA 1YTLA 2ZJYA 1J8DA 3CHYA 3L01A 3W1VA 5LDDC 1X80A 1CQJA 1NJFA 1JJ7A 4B3CA 4BNDB 3KVNA 4HS9A 1VE7A 2AR0A 3EPJA 3DGEC 1MC4A 5AXAA 3H5TA 1ZGCA 4MYUA 5DYNA 4BNTA 4TXNA 4G0WA 1XZNA 4NE9A 5F21A 4D8TA 1FSSA 2X0RA 2NYAA 3OH8A 2WHRA 3REOA 4JHXA 1RYZA 2HYIC 4H27A 4LOIA 1Q12A 3ZHYA 1Z75A 2XUGA 2R1VA 3OQIA 4N3CA 4R8VA 2VXYA 4RYLA 4RTKA 1BOFA 1PX0A 4ONEA 1V16B 4MV9A 4MI6A 1FYFA 3AI2A 4V1CI 4G1EB 3LL4A 2F17A 5A3RA 2JFYA 5F1PA 5FBVB 2PFKA 1T2AA 3WTBA 1LVUA 1C8KA 4RY9A 2PMDA 1O89A 3RKRA 1XRQA 3EUEA 5FADA 3KOYA 2XAUA 2ZYIA 3B1KA 3LFTA 5JNWA 5JG7A 6PFKA 2GYYA 3ZK8A 4URZR 2C4NA 4G4JA 4IF6A 4R2WA 1IHPA 5JAPA 1VDMA 5TVGA 4BNIA 5HZHA 3L79A 4BLWA 3CX7A 1OWLA 4M0MA 3NHKA 3IKJA 1RADA 4ZO8A 1WF6A 4Z4QA 1C0EA 3QG5A 3A9WA 1JKJA 3M33A 4YMWA 2SNIE 4GP9A 4B3JA 5JCPA 1RIFA 4XWKA 1T34A 3RV3A 2H5JA 2ZAIA 3O3NB 2C7RA 2FZKA 3SDSA 4BP9A 3B6MA 5LL6P 4NBKA 2P6RA 2NWQA 3C4VA 4TXHA 4PVDA 1I7SB 5EE3A 1FP1D 4BNDA 4D6XA 1ESNA 1LC3A 4YRNA 3MNFA 3DLTA 2DQ4A 4TV9A 2NUPA 2WW8A 2Q99A 3M34A 1KPGA 4GAEA 2NVUB 1WPXA 3BRSA 3QW2A 1ZQ1A 2CJWB 2I2DA 3KXKA 4YT8A 4KTTE 2WKPA 4L9SA 4GUAA 3VOSA 3GVCA 1EB9A 3KKEA 5AVOA 2HTEA 3FMFA 4JYAB 2NPIA 2CHVA 2JDIA 4TT3D 4UXJA 4GKAA 5AVJA 1LBIA 3LOQA 2H85A 1WW3A 3B36A 3ZN2A 2QTVB 3GVXA 4US2R 2G5TA 2IYNA 4EA8A 3IOYA 1AQLA 4FUQA 4FEAA 3LY7A 1NW4A 4LRTB 2PGIA 4PXAA 2CJYA 1MV8A 4HAUA 1XZIA 3N2LA 4K46A 4LVOA 4NYJQ 2ECFA 2R6JA 1KI2A 2XMRA 2PKQO 4TWBA 3BB4A 3GEMA 5CTAA 2R6AA 4CKBB 3DMGA 3KQQA 1YI1A 3PD7A 4KO2S 3HY4A 5LFAA 2D7DA 2UV8A 4UU0A 4AZTA 2F3SA 1UBLS 4PYMA 1IPFA 2QDXA 3HH8A 2XCTB 2FDXA 1VG9B 2W2XA 2JEOA 4FX2A 4D9FA 3SWWA 1N0WA 1S9HA 1CNFA 2J0UA 3NGLA 5LZ2A 3KLMX 4DR4B 3GGCA 3I6QA 2ZTVA 1P4HA 5ALJA 5EN4A 1J42A 1XHEA 2VPXA 4DADA 4E6PA 4KFSA 4BNWA 1QG2A 4DNXA 2BEVB 3QI7A 1L5FA 2NZJA 2QX6A 3TRKA 2WTAA 4KVFA 2DLDA 4X92A 1JEOA 5JPIA 3S7ZA 7ABPA 3BGWA 1XEXA 2VJKA 4EQZA 3AL0C 2B5WA 2X3FA 3UK0A 4JEIA 3LS2A 2B9EA 1HYQA 3OPVA 3RVBA 4YDRA 3CH6A 3R0VA 2FMHA 3SZ3A 2P68A 3DLCA 4Z4GA 1A9OA 3EASA 1W34A 2QTGA 5DOZA 1HWYA 3DULA 1JZQA 1YMVA 2OZLB 2C9MA 2YTZA 3FTPA 1C3VA 4YXWA 1VP3A 1NYRA 2XF8A 2VZ8A 4OUDB 4ZU1X 1J49A 4JI0B 1THZA 1NW7A 2X0DA 1I2CA 1U6IA 2CFCA 3JQFA 1KJ9A 2F8MA 4LJ9A 3BRWA 1EAYA 3C1OA 3KB1A 5KUTA 5B58C 2GHTA 3H9EO 2C2MA 1FTNA 4X97A 1G5RA 4DQKA 1M1YA 3SEAA 5B3KA 3SZMA 3UCFA 1L8OA 4QWMA 1YB4A 4E70A 3RVOA 2Y0EA 4J03A 2JF0A 1Q1BA 2C58A 2YMLA 2KLBA 4K9LA 2EZTA 4TKLA 1OLUA 3MELA 2WIAA 4PZ9A 2H2WA 3WLFA 2C42A 1QC5B 2P27A 2CDNA 2NXJA 1V7ZA 2XOKA 1Z0FA 3C6KA 3WDLA 1JB1A 1P5RA 1RAEA 1NT2A 2UZIR 3CWQA 3FWYA 2A0FA 1LDEA 4RDHA 5AKGA 3CF4G 2ZSAA 2QN8A 5LBUA 1QNLA 4D8UA 2ZRBA 5JATA 3MT9A 3O1IC 4XVQA 4X6YA 4ZDKA 4YV2A 4TN1A 3UGKA 2AXPA 2GN9A 2O2IA 2P4SA 3FMOB 3QJYA 4ZT7A 2QVXX 3WB9A 2V7UA 3L7DA 3G7UA 4YPFA 1MLDA 1VHDA 2XADA 4R0VA 1AGYA 2GUGA 1XLUA 4OMFG 1F20A 4CE6A 1YE3A 3W2HA 5FFFA 4G0VA 3EXG2 1CY2A 3ZU4A 3QUAA 1TD1A 3JD0A 2BF4A 5F9MA 1T4MA 1C7FA 4QOGA 3DFMA 2ZUTA 4NBTA 2HUNA 1QHSA 3C6ZA 3K6SA 2L0XA 3MCVA 2E4ZA 2K87A 4L5BA 2ZR0A 4TWRA 4RWEA 2F1IA 1VBKA 5AQEA 4DGSA 4G0QA 5DCLA 1ISHA 1BEUB 5KC8A 4ZMRA 1BRTA 1JTVA 1WOYA 4KIJA 4FOOA 1Y5MA 1JJIA 4QBKA 4ZZ0A 4RTPA 4DRYA 4X7BA 2JGAA 1G7CA 3CPJB 1QP8A 3EC7A 1U4SA 2FSVA 3R7DA 1IY8A 2QYTA 1Q2UA 4KLAA 5HS6A 1GRRA 4CQMD 4S24A 2KBFA 1P9OA 1RTTA 1URPA 2O2HA 3JYNA 3ZD7A 2J6BA 1N6LA 3KG2A 3Q0IA 2HSGA 4LJLA 2Q1YA 1N0HA 1NMQA 4ZGBA 3GNQA 1M6YA 4J0KA 5EJ7A 2J3DA 1MC8A 3BIOA 1U9CA 4UJ5A 5C31A 3V8RA 4QLAA 3GFOA 4A6PA 1EJBA 1D6SA 1UPTA 1Y3AA 3CV3A 4LMAA 1SEVA 4N8SA 1R4AA 1UMDA 3HB4X 2DERA 1X8KA 1QF7A 4CLOA 5AKZA 2WIBA 3RUDA 4UBOA 1UC4B 1YUMA 3AU8A 3OX3A 1VG1A 3TZQA 3O2JA 5J1TB 1TA4A 1T1JA 1YQQA 4H08A 3TW8A 1CJTC 2VQDA 4J4BA 1B8NA 3GT3A 3L9WA 3KYBA 1M2OB 4EG8A 4OYHA 2CHUA 2YYAA 1XYVA 2D2EA 4MV3A 1M8PA 3RBAA 1YL7A 2ZUBA 1DEHA 1SXIA 3KHSA 4I99A 4KZPA 3IJ5A 1OW3B 4TS4A 5DBHX 1ODLA 2X7HA 4JOBA 4QA9A 4WCFB 3GPDG 3W7VA 2OQIA 4YAOA 3WJ1A 2ZXUA 3II6X 4BWGA 4MPPA 4ILEA 4FGZA 1YO6A 2R79A 3HS3A 4R1UA 5JYCA 5DTJA 2BBWA 1CR2A 1B74A 3HL4A 1U7WA 4QICA 2QSYA 5EP4A 1RPZA 3W5JA 4GU5A 3DMFA 2JLZA 3RHZA 4FR2A 3DXYA 3QXSA 1KYYA 1TB4A 3OUZA 5CXUA 1FY2A 4ATNA 1HPLA 3G9TA 1E0KA 1SG9A 4M8IA 1Y1QA 5DEIA 2CNKA 5IZ4A 3AUAA 2FW7A 2J9FB 2FFAA 2AW3A 3OX2A 5IJXA 3WMEA 2O8VA 2N1BA 1YRHA 1V3UA 1Z13A 2AZMA 1AM4D 1JALA 1K68A 2ZCUA 3EFBA 3KE8A 1S3FA 2O0MA 2QXYA 3LK7A 1KJWA 1D9XA 3PL5A 3QBDA 5DW3A 4NH4A 5C8YF 2JI4A 5IAGA 5EP1A 4V39A 2OV2A 4QVGA 5EJIA 1R0ZA 1IJEA 1RBMA 1V3TA 3UWPA 4B3IA 4Z54A 3VPAA 4DR7B 5WRFA 5H1YA 2IOYA 4XIGS 2HBRA 2QNRA 3F5QA 4N49A 1T1EA 4FQ7A 3LCUA 1K89A 4LIPD 3E7DA 4DVJA 4Z8XA 3CNHA 4O5AA 1AKTA 2G04A 3AUJB 3AX6A 4G01B 2R84A 2R8ZA 4ND3A 2AFVA 2Q3LA 2ATXA 2ZYUX 4QBGB 3UB3A 4AROA 3U26A 2O5RA 1V5WA 3OJ0A 4Q47A 3GRYA 3UMYA 1NXSA 3FETA 3NKVA 1JDJA 2WA1A 3N7UA 4JUDX 3RWMB 1XUOA 4GPBA 4KH0A 3MN1A 4FZRA 4WGFA 5I8PA 2HXGA 5AJZA 1KIMA 5ALPA 3W5IA 4BFLA 4L73A 4R1NA 3TX6A 4A8PA 3D8UA 3PP8A 5IM5A 2O54A 4EFMA 1QFXA 4FJ0A 4E21A 3SEFA 2REOA 5F1KA 1Y1PA 3OEYA 3P5BA 1NMZA 2DJ5A 3AP3A 2NO4A 1CF4A 3E5NA 3QYFA 2GAFA 3B12A 3WQRA 4BB6A 2HU8A 4WVFA 2AGVA 3JTMA 1U3WA 4EMUA 1FTQA 1KVUA 1OE0A 1XWIA 3FFTA 3HUFA 1IZ7A 1PQWA 3ZGNA 3WLTA 4BGVA 3R0ZA 4K9DA 4Y0VA 3QPAA 3HGTA 1TL7C 2GAIA 3LVRE 3QTLA 3QKRA 4FMCF 4G63A 4H1UA 4NR0A 621PA 5IC5A 3OTWA 3K5PA 1Z5NA 4ZRDA 4FD3A 4EHAA 4KUGA 5KB3A 4BO2A 2B30A 4MVJE 2PH5A 1FLAA 5DV9A 3JY6A 3MJVA 4D6PA 1OAKA 1NBMA 1LLUA 4FGJA 3WE7A 3LCVB 2EP5A 1CR4A 1KI9A 2V3VA 2UDPA 2A9JA 3JQ9C 4FCWA 4WXPA 5DYGA 3HZOA 4YDHB 1J9ZA 1DOZA 1Y8QA 3L4BC 3WIDA 5DBOA 2E5FA 4YR9A 1RBQA 2WJGA 1TUBA 3D9QX 1P31A 3LHIA 5DBIA 3SHOA 4PN7A 1JLKA 2B4RO 3FG9A 5AW8A 1MX5A 1BHQ1 3MJSA 3C3BA 5HNKA 1CEQA 3QVMA 4RJTA 3LQFA 5CLJA 1JLLB 4Y3UA 4HR7A 3ZHZA 1T9GS 1PR0A 1ZBQA 2MSEB 3L43A 3VMFA 1TU0A 3B6ZA 4BUZA 1EX6A 5A9RA 1KERA 2JLUA 2GXAA 3I4LA 3Q10A 1RI1A 8MHTA 2PZFA 2IYSA 1B2LA 3L02A 2XUQA 4INAA 5DLPA 5U9CA 1I51A 2X4IA 4A8TA 3TLJA 1QG0A 1EK5A 1Z7YA 2BEWB 2Q6OA 1D3AA 2W8ZA 5CLFA 4W5QA 3RS0A 2AG1A 2O0HA 3AKCA 2ZI3A 5A7GA 3KWJA 2R00C 3EODA 2Q4BA 2MU1A 3K9GA 5FNVA 1QNFA 4P7GA 1KE1A 1RP7A 1E58A 4XB1A 1NVEA 5I9MA 2KX7A 3P9CA 1S3SA 2KI5A 3JQAA 3BZBA 3D1JA 3HXOA 1NVMB 3M9XA 2QRMA 5E4JA 1U0NA 5CK4A 1J22A 3F6BX 2RAPA 4TTAA 4EI2A 4MRPA 1WEKA 2QU8A 5FV4A 2G5GX 1CQWA 2ACWA 4C4XA 2AR9A 4F5EA 4C43A 5A62A 2VP4A 4KQMA 2Y93A 3BXXA 3H6GA 2VT2A 3NBAA 4AO6A 3LGXA 1H9AA 2X2EA 1HFWA 1M1NB 1XQWA 1NQTA 2PGNA 3QVLA 4FLFA 3RIMA 2H29A 1RWWA 3IUEA 9ATCA 2ATVA 1D2EA 2F64A 1X3LA 1GG2A 2FE4A 2RJOA 2AOVA 5ALOA 1G8PA 5DN9A 4BWYA 5GTDA 1RACA 1N2EA 2QN6A 2YVAA 3O3CA 4D3ZA 3I9JA 4BE9A 4QTYA 5I7UA 4CXMA 2ORED 5I45A 2XB4A 1P3Y1 1UPBA 4HEQA 2P4UA 3CF2A 4X71A 2NNLD 1PF7E 2IZ0A 4JQSA 2E4WA 4JC0A 5KYKA 1EEHA 1JU9A 4GWLA 1KC3A 2HCFA 1TA9A 3ET5A 3I2YX 3PUKA 4HQ6A 4FFPA 1KVTA 5LQSA 4DNFA 1XPOA 1L6IA 1F8YA 1G7TA 1TTTA 3AFHA 3DO8A 3FJ1A 1M6VA 4R2XA 5IC6A 1RHRA 1R9NA 4EX7A 2FZLA 2XMBA 3HO1A 1Z5PA 2GDJA 3PJEA 3S4YA 3QFCA 4J7UA 1B8VA 2VUHB 1H2RS 2VNAA 3FNEA 4O08A 5IX8A 2WB4A 5CTJA 4N12A 5JSZA 1VL0A 2ZRQA 4G07A 4RA6A 2CVFA 5EHIA 1DBSA 2HK6A 2VHEA 4NI5A 2PT5A 4D4JA 4EENA 4ZU3A 2RGAA 1YBMA 2V0CA 4Z49A 1PG0A 1ISMA 3GV0A 2ODNA 5PNTA 2V6FA 5EP2A 1K4YA 4YUVA 1PJRA 5E1MA 4OM7A 4Q05A 4EDHA 4GI7A 4UHEA 3FI9A 4TRJA 5IXSA 1U4NA 3BSSA 3TD2A 2ID9A 5B37A 3H2SA 3FPHA 1OV4A 4C6RA 4MWDA 1D7AA 3KZCA 1JYFA 3GARA 3Q41A 4EBBA 1T1IA 1T9AA 1GDDA 4HFJA 2W9XA 1AU9A 1P44A 3PHLA 3WA6A 3WMWA 4L4SA 4C0SA 4HNVA 3WFZA 1M7GA 3MRSA 1KDZA 1IULA 1WKCA 1FJGB 4IYJA 1KVSA 3IIEA 3W6OA 5IJWA 4F4HA 5ICEA 1YZLA 2RARA 1A0OA 2I6QA 3VHXB 2IWRA 1T10A 3PQ6A 2CB0A 5HYVA 5EZ5A 4HRAA 4LZWA 1VJGA 4NZOA 5FULA 2DUWA 3RYIB 3VR5A 2BGMA 2RIRA 3EIHA 3G13A 4KPFC 2CCJA 2WYVA 1PJ3A 2D0DA 1KDPA 4R5HA 2JC3A 1TMKA 2DPHA 2J7PA 4JIGA 1ZAKA 4JJFA 4YV7A 2OENG 1QG6A 5E6SB 5BOVA 5AVQA 4WZAB 1R50A 4YJGA 2CSXA 2E4VA 4OB6A 3PHJA 4Y67A 2JAQA 4MGEA 1V9CA 2XEXA 3OKPA 4X91A 2ZPAA 1RHUA 3DHWC 2JL1A 2WJHA 3A04A 3PEEA 3QWAA 2F7SA 3EQ2A 3WADA 4Q7EA 3AI1A 1KFKB 3HR8A 2PRIA 4XM0A 3U4IA 4ALLA 3TW4A 3VZQA 2OFXA 2Y1CA 4DQUA 1PBTA 2PDAA 5E2AA 4RKFA 1H8EA 3I04M 4II3A 1GGNA 4O2BF 1GD1O 1BDBA 1RAAA 3ZC3A 2IELA 3ZHRA 1SZCA 3IAEA 4IDGA 5I7WA 2IHBA 5FH9A 5I8WA 4D82A 4AKGA 2PT6A 4CTNA 2WI8A 3NR2A 4K9OA 4RMHA 1G8FA 2P69A 3K20A 4YLEA 3WWOA 3WAJA 4B83A 2IHVA 1TW2A 5JO0A 4QECA 4CCSA 1WE2A 5KNCH 1PDOA 5REQB 1C1HA 1NF2A 4Q12A 3VO9A 2JJQA 3GN2A 3PZBA 4H4CA 4HK4A 3GLGB 1S89A 1LB1B 3F3MA 5BN5B 3OJEA 1OC4A 3A3PA 2D0PB 4KFUA 4DKXA 1NQAO 2P6NA 2X0NA 3DE1X 3DF7A 4OFXA 3AR2A 3QH4A 4IFEA 1DIAA 2B69A 3CX6A 2WJYA 4P4SB 2TECE 1K7XB 3AEUB 1Z68A 2ECOA 3ORRA 4X20A 4YAJA 3TRFA 4ZEOA 1BA2A 3L82B 4MS4B 4ZVOA 5LOVF 1SIBE 1D1PA 4FJ2A 3GX1A 1A04A 2WFMA 4R2KA 1GTJ1 4I1YA 4HLUA 4E33A 1Q0QA 3LY5A 2BSXA 1LX6A 2NSHA 2ZJ8A 4DG5A 2GFQA 4A23A 1E0SA 1W93A 1ZJYA 3B7GA 1PFYA 4QAJA 1XDGA 5BVHA 1WMFA 1GZ4A 5AW2A 1EFCA 3TF5A 3DQQA 4BNGA 5JI3E 9LDBA 2PA0A 1B26A 1RRMA 3IQFA 3ONDA 4IW3B 4F86A 3E5HA 2J6IA 2P1ZA 3KDPA 2IT1A 4GHWA 3ND7A 2VQ3A 3NPAA 3T15A 5CGZA 2O1EA 3U3KA 2Q7OE 3M49A 1VFPA 1U2ZA 5KTNA 5M5BA 1YHNA 1JEJA 1K92A 5B3LA 3ZW8A 2WG1A 4BXOB 1M1YE 3DW1X 1LI4A 1XCGB 2C9CA 3AR4A 2XPCA 3HJGA 2QD1A 5DU2A 3DDHA 4P7FA 1M1ZA 2PCJA 1W9HA 4JP3A 2QW1A 2JIBA 2H5LA 3FZEA 1N36B 5CMLA 5EZSA 1JDVA 4GX1A 4AJKA 4NCIA 4RH3A 3T61A 3UT5B 2V6JA 4QT4A 4HXGA 2FZWA 4I55B 5FOTA 3WGMA 5K6RA 1JAYA 3NHWA 2D2XA 3FHTA 1G64A 4HWKA 3A0RB 4MW5A 3PENA 4R9VA 3TK1A 8GPBA 5KQRA 4O0LA 2DR0A 4BY9E 3PFWO 3RTEA 1VG0B 2UKDA 1CS0B 3OEHD 4DC1A 3ZNOA 2FUG1 1PWEA 4QOIA 1AVTA 2P67A 1DJNA 1NU8A 1T9DA 1SC1A 1X7HA 3CLRD 1T29A 3FZNA 5LD2B 1D9ZA 1QF9A 3OUTA 3UKDA 1TT7A 5BWCA 3LY9A 1Y3CE 3T99A 1D2HA 4A1OA 4E46A 4UD6A 3S68A 1JV2B 1XSEA 2O06A 4HQNA 2HV9A 1M0WA 4Q1DA 2IIVA 3D4LA 3BHJA 3H17A 4LZZA 1DQYA 1M67A 4UTXA 2EWVA 4D5EA 4J16A 4Z4HA 4XYBA 5FUVA 1O4VA 2HJWA 2II6A 1W5SA 3DL4A 3ZZ0A 2GZDA 1R66A 4MVJD 3GHHA 4TLBA 3Q8MA 5JC1A 1N0IA 3IDFA 1BJTA 2Q2QA 3C3KA 3USZA 1IOWA 4LAFA 2Q1SA 3SX0A 1G8SA 1S3GA 3IT0A 3PPYA 4Q3EA 1A5TA 3RVKA 4N0DA 4W1PA 4UAUA 3FYDA 3E22A 4IXNA 3RRNA 2BFOA 4IX9A 1YVDA 2NZXA 4J49A 4U0KA 4LF4B 4D25A 1QGZA 4S1PA 2YS7A 3NHJA 3BFJA 1QKKA 5JWRA 1GRCA 2Q9CA 4IXWA 2PD4A 4OAOA 4F5DA 5D3KA 5FTMA 4OQEA 1LW6E 1PG5A 1RPJA 2JI9A 4IJKA 1GGHA 5U4XA 4OHFA 2XGSA 5TPZA 3CF4A 2HDWA 4RAOA 1PV2A 2NYVA 2WZQA 2FZGA 4S3MA 4WGGA 2JAOA 2C4TA 2HRCA 2R8BA 3COYA 4PO8A 2IYWA 1GA6A 3UHOA 4WCVA 1WDMA 2V6BA 2W2PA 1S2NA 1L4NA 2AE1A 1PO7A 2FXIA 4FYKA 1N3LA 5T3UA 1ZMOA 4CLOB 3OTOB 2HHHB 2I67A 3DMPA 4BU0A 5EZQA 2QRGA 3AHEA 1DC5A 1VSQA 3M89A 4KE9A 1ZSYA 4WKOA 4K6CA 2OKCA 4RD3A 2H16A 1GXSB 1JFLA 1QG4A 4EO9A 4O4HB 5CPFA 1Q83A 4LBVA 2NO0A 2BE7A 2R97A 3CC8A 3PC8A 4NQRA 4RM2A 5D5HA 4JXZA 2ZWPA 3C3XA 4RW0A 1V26A 3F9CA 1NPDA 4II7A 3MG9A 2I80A 4L28A 4OK5A 4D8WA 4QQ8A 4KI0A 5JMWA 5LZ4A 1USVA 1ZEJA 4W8HA 3TQCA 1J0BA 5HOEA 3RUFA 2R65A 3VH4A 1IVNA 2I8LA 3UUFA 3TR6A 3NCHA 4P0QB 1VL6A 1YFZA 2WNSA 2YCLA 1EZZA 4L5CA 5DXFA 5HBRA 2BEUA 3CX8A 1WXQA 1OWNA 4TMXA 1PFUA 1GTL1 2I55A 5I7RA 5MGNA 1JEEA 2R5FA 3V8VA 1Z33A 3NORA 4RF3A 3A4NA 4GE0A 4JXJA 3ZWYA 3NV7A 4DJDC 4RSGA 5KSPA 1P0PA 3P32A 2PSEA 2XDAA 4PGGA 3TTSA 1CFZA 5BYAA 5IYZB 1EE9A 4M9QA 3ETLA 2LWIA 4MVCA 3DC7A 1X8LA 3TWOA 3S8MA 1E79D 4RIFA 2Q1UA 3AB8A 4AJ2A 4L02A 1ZIOA 1XZJA 2HRDA 2P1DA 3G9QA 4HF7A 3TB4A 3UJ9A 4MUYA 4GBMA 4TSFD 1V16A 1T8WA 4QJIA 2UYQA 4LKOA 2GERA 1XPJA 3MF4A 1G18A 1VE5A 3WKAA 2PMFA 1QUFA 1E99A 2IH2A 1LWNA 4PPQA 3OQOA 4DV6B 2GF9A 3UG7A 4HX9A 3RSZA 5AW7A 9LDTA 1ZMXA 5JCJD 5L3SB 2FPKA 1SVNA 2BWJA 4HMQA 4ID9A 1V1JA 5E4YA 2JHAA 4BDSA 4ZYVA 1M0SA 3UHFA 1FC0A 1TLTA 2ZYTX 3LVFO 4UM5A 2GPNA 3E48A 4YP5A 3AONB 3OEEA 2B7LA 1KQPA 2VNSA 4FDTA 4ZOLA 3T06B 1TO2E 4HVLA 3FYCA 5ALGA 1E1RD 4B4VA 2VR1A 2WIDA 4Z51A 5HIKA 3AFMA 1O5TA 2CL7X 4IXTA 4A0FA 4TM8A 3G9UA 3FGPA 3HABA 5KNBA 4INZA 2CFOA 1Z7WA 1UT5A 3R09A 5B1IA 3TYXA 4CDMA 3FF1A 1T9ZA 1KJ8A 5C46F 3IUSA 4JY7A 1J1UA 3EXIA 2I6SA 1NRXA 2WTMA 3V32A 2D1FA 4NZZA 1TZBA 4F3YA 2I3AA 1PFGA 1NQOA 3DHVA 4U2EA 3L4KA 3NOVA 1CQJB 5IK2D 1QZZA 2QMOA 3I37X 5FXMA 4H6XA 3RFTA 1OH6A 1XKXA 4FLEA 1SQ5A 1UH5A 4TUYB 4PG8A 1KTIA 2JJ2A 3QIVA 4M55A 4NENA 1UCFA 5HMLA 5JNTA 1TZ2A 3DCJA 3LBFA 4JB2A 4OHYA 1BCRB 1JE1A 4CF7A 1L9KA 1VKZA 1BFKA 2FJUA 1ZUHA 1L1QA 1KI1A 2B5VA 1W88B 4DWOA 1ESMA 3BF8A 2JCVA 2EZ8A 5FR1A 1N2CB 3T4EA 2E18A 5BQOA 4AB1A 4L57A 1HMPA 4XIIA 4ARZB 3HKCB 5JVDF 1YSCA 5A4KA 1XU4A 3BD9A 1C1DA 3NU1A 3R9XB 2Y99A 3T1QA 3BHNA 2O8NA 4N3BA 1PKXA 4P5DA 3FUCA 1ZSNA 5EPOA 3Q6NA 1JTFA 1W59A 2QMHA 3M6AA 1KBOA 2R6GA 2P5YA 3CUKA 3HPRA 5DW0A 4EJ0A 3W5AA 4CCYB 1EVQA 1JF8A 4EY4A 3BHIA 3FMVA 2C3MA 1AC5A 4B3FX 2HQOA 4L0QA 3HDGA 1WU8A 2W5UA 3DZIA 1PNVA 2YVQA 3EDQA 1BQ4A 1V1MB 5HQJA 4CMKA 2O8DB 1HRDA 1LZLA 3G2IA 3S2ZA 3IO5A 2XOXA 5EQDA 2QT0A 4HOYA 1WSDA 2AEFA 1RT9A 3DT9A 4AXBA 1XDBA 1C4OA 1QHHA 1QLWA 4F96A 5CA1B 3UNXA 1X7GA 4MVJF 5DSTA 2WQ6A 4MB2A 3QE4A 4A4DA 2XUHA 1NNEA 1T5SA 1K63A 1N2SA 5C2JB 5GONF 1W0KA 5TC4A 1TKBA 1WY7A 4P82A 4XUDA 5ALEA 4NU5A 3DEYX 2GB4A 5BUCA 2ZRKA 2G9UA 5EIOA 2I3ZA 3HV2A 2ZM5A 5HKKD 2BFCA 4ZHSA 2E4AA 3LBNA 3NMUF 1RLOA 1VIAA 1W88A 3ETGA 4PZAA 1Z0UA 3KKOA 1KVQA 4HD8A 4TV8A 2ZTUA 4JVMA 4W6ZA 3S5JA 1P81A 2ID4A 1SBIA 3C5HA 1I6LA 3K6RA 3ADCA 1DTSA 1VCMA 2QGZA 1IZ0A 1QYXA 3R3WA 4NSNA 2IV2X 4BVFA 4CTJA 2AT1A 1ECJA 2J3JA 4ZC1A 2NU8A 4HJXA 3R9KA 2UZAA 2JGEA 4YPVA 1KKMA 1IBLB 3WGOA 3IMCA 4Z9XA 5J2UB 1QYCA 1D8TA 3H9UA 3U4QA 4EGSA 4M9ZA 2WSIA 2JRCA 5DHFA 5CDHA 4Y2VA 3GFFA 3VGJA 5JYDA 3FLBA 3DAGA 4FM9A 1ZD9A 1L7OA 4AS1A 4A26A 3QNUA 5F1YA 3U7HB 4J4TA 1V25A 3ORYA 4OQNA 5JNUA 5CFNA 3HYCA 3N39C 4Z7JA 2YWCA 3GQBA 1L5YA 4KLNA 4WLUA 1QB7A 3DDUA 3JQ8B 4DSNA 3IVXA 3D1VA 1P7WA 1UQTA 1SJ9A 1KR5A 1E8DA 1J2UA 4X45A 4HX5A 2ZKIA 3FNHA 2OLEA 1W4BA 3URMA 4K1LA 1AN0A 3RHSA 4WXHA 1E4YA 1KIFA 1V6SA 5EG5A 3ED1A 2YHIA 1XQVA 4LGYA 4F72A 5KIAA 3IYLW 4KXUA 5IUJC 3ZJVA 4TXLA 3BL6A 5J23A 3UMSA 5JBIA 2VJYA 1WX1A 5DGCA 3TSWA 4D4MA 1XJ5A 1NXWA 1H94A 1ZGHA 1IXSB 2VJCA 4M0CA 2HCJB 1THGA 1MZPA 1LFAA 1YGPA 4N7RA 1F14A 1LQUA 5DP1A 2FR8C 2C94A 2IDKA 2ILTA 1ORVA 3ZI7A 1L5ZA 1X8JA 5ED0A 4YCLA 1F7UA 2H1RA 4IZHA 2HGZA 1XNQB 4X63A 3H83A 4H16A 1P18A 3PDIB 3O4GA 4TTTS 3WLMA 3NALA 2M1XA 4GS5A 3WQBA 1DG1G 1U3GA 1Z82A 2PKCA 2XB2A 3FTFA 1VSBA 2IUEA 3IT2A 1U0GA 1CVIA 1UXOA 2X41A 1EHYA 1Z25A 2N75A 3K0AB 4DTCA 2B2CA 1UPCA 1E2NA 1OFVA 2AJBA 3QYPA 4ALMA 4B6GA 5L3ZA 3CEJA 5HF9A 4TKUA 1I13A 3L8YA 4ZI7B 3EB9A 4DT1B 1JGTA 3ISTA 3W2TA 1EP3B 3IODA 1NPYA 3LYUA 1LGYA 4AJEA 3A27A 4J3FA 5A1JA 4IEFB 2FCAA 4MVXA 1MJHA 3LLCA 3CZCA 1LDBA 3IBYA 4BZQA 4QD3A 2EQAA 3IHKA 2MYUA 2Z3WA 1ECLA 4MPRA 2E1RA 5CU7A 4OKSA 2GA8A 4F60A 2NUBA 4E2XA 4GM0A 4Q01A 5BSVA 4CEIA 2A0KA 3IJPA 3ZWWA 3IMKA 3WJAA 1F6DA 4F12A 2D5LA 3ZGXA 1JW9B 2O0LA 3QENA 4RZUA 3BD6A 2RHHA 3E7FA 2EKDA 3GXOA 5CGQB 3ZXXA 4DARA 3FTNA 2X8JB 2IYQA 1P1IA 2WE8A 1FVXA 4KDFA 2X0FA 2EKPA 2VJDA 4PSDA 1PUJA 2EX1A 2XGOA 1M2FA 2DRIA 3IIIA 3PC3A 4O1HA 4TVSA 4FN4A 1EA7A 1WBJB 1H1DA 4HS4A 4ZRNA 1GA4A 1L7NA 3UAZA 4BLPA 4RMJA 1GT91 1AMUA 2BM8A 2NXEA 2R5NA 2LRHA 3EQ9A 4ZYXA 2HNBA 2YUIA 1GSOA 2BAGA 3H97A 1US8B 4EG7A 1SH7A 4OA5A 3NBFA 4AJJA 4F21A 4PHHA 5EIEA 1FZQA 3S8EA 2CHFA 2SKEA 4JZKA 2RBEA 4H7IA 3KO8A 1JT9A 4BBJA 5FQOA 4F7WA 2YDYA 1QR2A 4OYYA 3K9LA 4QM6A 2OGTA 2P78A 5FYDA 1JIIA 2FKNA 1GKYA 3IAUA 3T12A 3JZFA 2ISSD 5EJ6A 3ME5A 4MUAA 3ZHQA 4BCBA 3CS3A 1DOHA 4DV0B 3FDZA 3H1BA 2OAP1 1U80A 2HJVA 5JCJA 2Z3ZA 4ALIA 3RU3A 2IPOA 3ZPXA 2AG6A 1G3RA 2VJOA 2X5KO 4B7ZA 5JY1A 4AIIA 1NU6A 3ABQB 1II8A 1KYTA 1QFMA 2AC4A 1EKXA 3MQ2A 3RFFA 4BUCA 3OPMA 3QWFA 4YRRA 3JAKA 3MJCA 2AUTA 4FFWA 4QVKA 1Z18A 4LJ8A 4MW4A 3U9TA 1TEZA 1XQ9A 1GQRA 1E79A 2J3LA 4ND7A 3CLUD 3EW7A 5ERGB 3X1KA 2C00A 1DIGA 4LWQA 5DTRA 2RGUA 4G89A 2UUAB 3FAKA 5AJTA 4BEWA 2SKDA 3C48A 3OLVA 3D0QA 3T0FA 2YVLA 4FUTA 4ALJA 1NM5A 4HAZA 3OJOA 3RRJA 1IYZA 4P4NA 2V7VA 4MGIR 3HL0A 2QLMA 2L17A 3NDPA 4XQ0A 1U1GA 2YY7A 3E0QA 4FONA 3EA4A 2C3PA 3V4SA 4CM5A 2OG1A 1NFFA 1MO6A 1TGVA 1FXUA 1I0ZA 1RI5A 1XHLA 3BD7A 2RHLA 2BMAA 3GHYA 4TLAA 3QX9A 2RAFA 4JI4B 1BEZA 4NLLA 3HWWA 2WJ4A 1WBBA 4JBIA 1M1UA 2B34A 4C7OB 4V0MA 1N2BA 2VJPA 4QG7A 4X66B 3BWXA 4WN9A 3ZY5A 2DG2A 4N18A 3L92A 1CY7A 1WDTA 2WJZB 2W6MA 3GLHA 3ZCRA 4WZZA 5LVAA 3JYHA 3WSTA 1RABA 1YDFA 2XGJA 1D2MA 1DKLA 1GAWA 2FI1A 1NUTA 3HGMA 4FWIB 1IB6A 3E8SA 4K9SA 3JS5A 4X6LA 5DXAA 3ZCXA 5BPHA 4AJNA 1MT0A 3JSAA 1NN5A 1FDRA 3VNUA 3F47A 3SVZA 1R00A 4PRZA 5EIAA 1KH2A 3G2KA 5HZKA 1ZR2A 5L8VA 4LJYA 4M1TA 1B73A 3EIUA 2RAUA 1KXZA 3FDIA 4RHTA 2VYNA 1A69A 1GUFA 1OILA 3BJEA 3P94A 3IUMA 3RW9A 4EF5A 2FWNA 2BBSA 4MUBA 3F3YA 2PH1A 4ZN6A 3KFVA 4GYYA 1PVOA 1ZD3A 1X39A 3LBYA 4O8CA 2OWEA 4DJ5X 5HGJA 5JFTA 4LQCA 4PICA 1PT7A 1Y8CA 3MWKA 3K9WA 2O8CA 3UBTA 5H9VA 1EIWA 1WO8A 3ANXA 4GR4A 5HOQA 4R1MA 3CLSC 4DRXB 1C4XA 4M0KA 3PQ5A 1E2IA 2GJ4A 3TR5A 4DA0A 5KSYA 3PHBE 1QP0A 3Q98A 1IN4A 4YRFA 3DE6X 2HRQA 3ECCA 2B4YA 3MT8A 2Y4NA 4ENWA 6YASA 4NCAA 3EVCA 2IDJA 1TJYA 5AVZA 1U9YA 3AR3A 5JQGA 3RAFC 4DTIA 3G3EA 1TUGA 5H4GA 5IVHA 1WDLA 3HKDB 4P5PA 4C0BA 5EWLB 4MNTA 3QSYA 4JV5B 2NYUA 3UMFA 4H77A 3KYDA 1WP4A 2L2QA 4G0ZA 4MXDA 3GR6A 2OCKA 3DE7X 3F7NA 1DZ3A 3RAJA 3J81A 3VVCA 2O5CA 4TLCA 3UJHA 3L93A 2XNHA 3QU7A 1RWXA 5CHEA 3U7IA 4ZC8A 2OB2A 3U7FB 2PKRA 3RT1A 4QUKA 1P1KA 2R6HA 1ZL0A 3H0EA 5DYTA 3HVUA 2FUKA 4MYSA 5F3WB 3DDSA 3AFOA 4XJTA 2GETA 1GJRA 1EM8A 3K4QA 4LQLA 1L4FA 2WY2D 1OASA 2ZIVB 2XKAA 1MZVA 2GXQA 1VCIA 2XITA 4C3VA 5J58A 3G0GA 3QITA 3SR4A 4BCDA 2JB9A 2IVFA 4DPLA 2IEZA 4QXOA 4YMTA 1AUVA 1WOMA 4Y2QA 4XE5A 4F71A 4TRMA 3MQ4A 3QWHA 3L05A 3E4CA 4MWZA 1W36B 3TAHA 1CY1A 1OXSC 5BW4A 2OFOA 4A91A 2XWBF 1L5GB 5F2KA 1S6YA 4XLLA 4DCCA 2QLTA 5D7BA 4EO4A 3RCBA 5EEHA 4YCNA 3M4XA 3ZGLA 2OVFA 3Q7PA 4UVHA 4C5BA 4GWGA 4DDMA 1EFRA 3RARA 3D4BA 4NTZA 2AOTA 3AEQB 3Q5DA 4TKVB 5FNVB 1XC7A 4HVCA 5C1BA 2C3YA 1IBCA 1MO4A 1T91A 1Z2AA 3MLBA 3U7QA 4MP6A 5IS2A 3C2QA 2OGZA 3P0EA 4JUBA 3B89A 1OLOA 3T7AA 3IDZA 1U99A 4N6NA 5KYXA 3EGCA 3H05A 4DFDA 3DV9A 4YACA 4CKWB 3V8BA 2VBIA 4AY6A 1HDOA 5CA1F 4CEJA 3D4PA 3E9CA 1U63A 4BQOA 4IDAA 3AINA 3SBEA 2JGMA 2R5WA 3ZVLA 1Z4KA 1QK3A 3D7KA 4YRPA 3TRIA 2GZ3A 5EFZA 2GD0A 4RCZA 2CSUA 2C8LA 4LGCA 1GRQA 3QFHA 3T9DA 3TLGA 5G1NA 4U7FA 3QVGB 3MAGA 2XWJI 2F55A 1YS6A 2Y2VA 2XVAA 2Z09A 2ZLBA 4TLEA 2IS2A 1C9YA 2VDPB 4YJKA 5H3LA 2WOJA 1S96A 3AERB 1A5BB 1MDFA 3Q5GA 4YV0A 2VZLA 3BTVA 1GLGA 4LDNA 3ZHTA 1N3IA 2FWIA 1T5OA 2PN1A 2SCUB 1JHPA 1ORDA 3VZSA 4AZ3B 1H1TA 2DKFA 3V7FA 4B4KA 3Q9SA 4ZT5A 2FP4A 1Y48E 4E5KA 3GGSA 3DONA 3HM9A 1L5LA 1F2VA 3HEBA 1X2BA 4X60A 3S1AA 5GM1A 4FIZA 3FDXA 2DEUA 1SCJA 1GNQA 1JVSA 4QYTA 2VDRB 1G3QA 3OQ1A 1KARA 2WVGA 1NF3A 4LPKA 1K75A 3TJMA 5IC4A 3V9AA 4KQ1A 3WRYC 1ISJA 2JIRA 3V8MA 3WYAA 4W5JA 1SHZA 1NLMA 4M1EA 1FYDA 2PYDA 1SK9A 1N1GA 3EEFA 3TIXB 1R0CA 4JX8A 1DFHA 4QDTA 4TMVA 2C5BA 3X2EA 1NLFA 1R8YA 4XWYA 4M98A 1L5NA 2PMKA 2WD8A 2QP4A 3OE7D 2J31A 3OE7A 2VDMB 3B1ZA 2PMWB 1T13A 3A4TA 4IJ5A 5KJ1A 2WF5A 1OLUB 2RJ3A 3FB1A 2ORVA 4G26A 3ZW9A 4C0QC 2ETVA 4BQQA 3MMXA 1WWKA 1ZXXA 1BW9B 4J2HA 3VTZA 4ARVA 5COAA 3G0CA 4D02A 4CL3A 3HTXA 1XRSB 2XUDA 3O8OB 1SUIA 3W0LB 3DVLA 4C7JA 1SA0B 3KQVA 1QO0A 3TDMA 3ROTA 1G55A 1OZHA 1NVAA 3KPYA 3PX7A 5F35A 2F62A 4BGDA 3EY9A 5EY5B 1RIIA 3RK0A 1T0BA 1W35A 4NS1A 3EGXA 5H83A 1O95D 4D0RA 2VPPA 1IK6A 1NFRA 5L6MB 2G25A 1Z5ZA 1VIMA 4WD3A 2R7NA 3TZ6A 4E94A 4P0PB 4DMLA 4XR4A 4EPXA 2P35A 3TLXA 1KJQA 2MYTA 5CA1A 4RVDA 5EMLA 1O9GA 2FPWA 3K70C 4UW9A 3PFKA 5DCYA 4N6GA