The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
20
|
sequence length |
113
|
structure length |
113
|
Chain Sequence |
MGSSHHHHHHHHENLYFQGSKRKIIVACGGAVATSTMAAEEIKELCQSHNIPVELIQCRVNEIETYMDGVHLICTTARVDRSFGDIPLVHGMPFVSGVGIEALQNKILTILQG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
NMR structure of the enzyme GatB of the galactitol-specific phosphoenolpyruvate-dependent phosphotransferase system and its interaction with GatA.
pubmed doi rcsb |
| molecule tags |
Transferase
|
| source organism |
Escherichia coli
|
| molecule keywords |
PTS system, galactitol-specific IIB component
|
| total genus |
20
|
| structure length |
113
|
| sequence length |
113
|
| ec nomenclature |
ec
2.7.1.200: Protein-N(pi)-phosphohistidine--galactitol phosphotransferase. |
| pdb deposition date | 2004-06-29 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02302 | PTS_IIB | PTS system, Lactose/Cellobiose specific IIB subunit |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Rossmann fold |
