3E05A

Crystal structure of precorrin-6y c5,15-methyltransferase from geobacter metallireducens gs-15
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
191
structure length
188
Chain Sequence
QYPVIGIDDDEFATAKKLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSIEASNLMPNGRIFALERNPQYLGFIRDNLKKFVARNVTLVEAFAPEGLDDLPDPDRVFIGGSGGMLEEIIDAVDRRLKSEGVIVLNAVTLDTLTKAVEFLEDHGYMVEVACVNVAKTKEYKMFESHNPVYIITAWKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Precorrin-6Y C5,15-methyltransferase (Decarboxylating)
publication title CRYSTAL STRUCTURE OF Precorrin-6y C5,15-methyltransferase from Geobacter metallireducens
rcsb
source organism Geobacter metallireducens
total genus 56
structure length 188
sequence length 191
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.1.1.132: Precorrin-6B C(5,15)-methyltransferase (decarboxylating).
pdb deposition date 2008-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3e05A00
3HVHA 4GBED 3T7SA 4YUYA 3DXXA 1KP9A 3NJRA 4OBXA 4E33A 5FQNA 3BGVA 3CC8A 5HIMA 4DA4A 5EIFA 5KQRA 3P2KA 4MWZA 4HC4A 1RJDA 2ONZA 4OA8A 4P58A 5EOVA 2IGTA 2YX1A 1L3BA 3LCUA 4QQKA 3TM5A 4PYOA 4PYJA 2C7QA 1HMYA 3DXYA 2Z6QA 3LDFA 3BKWA 2R3SA 3JWHA 5FA5A 1AF7A 1NW7A 5FWDA 1VLMA 2AVNA 3UJ6A 3FUTA 4HGYA 5GM2A 3O4FA 3GGDA 1JTEA 2JHPA 3LCVB 4GC9A 3LL7A 3HA7A 3R6TA 3EMDA 1G8SA 5LR6A 5IH3A 2GH1A 3NVKI 5DSTA 1FP2A 3HCDA 3CJRA 2R6ZA 3GJYA 5CUQA 3HVKA 1EAMA 4P7FA 3G2QA 2VDVE 3TPZA 3NWEA 5EHIA 1KPIA 3SSMA 4PCAA 2BZGA 1KHHA 3PX2A 1JG4A 1KYWA 7MHTA 4CXMA 4RTNA 3SX0A 1QZZA 5K0EA 2B3TA 2E5WA 1ZHFA 2QY6A 3A27A 2ZWAA 5E8RA 5EVJA 5HEKA 3RIEA 5CD1A 4PIPA 2K4MA 1NW8A 3VSEA 2NXEA 5LQAA 2IDJA 4X1OA 2OBFA 3BWMA 3GO4A 5E1OA 4K6MA 5DM4A 2YR0A 1SUIA 4LG1A 3TR6A 4OA5A 5K09A 5K03A 1PJZA 1N7IA 2IIPA 3B7PA 3LECA 5IKMA 1VBFA 1ORHA 1VIDA 4HG2A 5B1SA 3HVIA 2AN3A 4HRAA 5EKUA 1I1NA 4PINA 2H1RA 2PXXA 3BWYA 1SQGA 2HWKA 3KPJA 3EGIA 2ZIFA 3LSTA 3OZSA 4FS8A 4G56A 4M36A 4E2YA 2WA2A 3FUUA 1D2GA 2QRVB 3HEMA 5EMKA 2CL5A 3A25A 3LGAA 2Y1XA 3P2EA 1R6AA 3MAGA 5DPMA 2IBSA 3DTNA 4M7RA 4XUEA 1KIAA 3M33A 1RJEA 4DF3A 2AS0A 4MTLA 3ELYA 4FP9A 4C06A 1D2CA 10MHA 3DXZA 2YXEA 3MCTA 3EGEA 2YUIA 1P1BA 4DZRA 1G6Q1 2DULA 3UJDA 2EJTA 3MB5A 3BWCA 3IHTA 1M6EX 1SUSA 2AN4A 2ZWVA 3DLCA 3FPHA 3M6UA 5HZMA 8MHTA 2B25A 4X61A 1ZGJA 5GWXA 3TKAA 3BGIA 2BM9A 3KQYA 4E30A 4FGZA 3P97A 3NVMB 1WG8A 1L3CA 2GPYA 2P1DA 2Q41A 3I5UA 2PT6A 4GQBA 3TRKA 4CTKA 3FUXA 4YUZA 3FPEA 4A6DA 2PSSA 1JTFA 1KPHA 4M37A 2ZFUA 1AV6A 1RI3A 1FJXA 2KW5A 2ZCJA 4YV2A 4YMGA 2OO3A 3O31A 4IV0A 3ER9A 3KR9A 4FSXA 5CIYA 2O07A 5FHQA 2Z6UA 2EX4A 3KQWA 4RTOA 2FPOA 4RX1A 1FBNA 3SMQA 5FADA 3BGDA 3SXJA 4ER5A 5FUBA 5K0JA 1L1EA 4C4AA 4XUCA 3OFJA 1NW3A 2IP2A 4C08A 4QVGA 4C03A 3PTAA 5KS2A 5LQRA 2ZZNA 2QE6A 1VP3A 3V8VA 3O7WA 1NBIA 2ZBQA 4IV8A 4YUVA 3FRHA 1MHTA 3DH0A 2I6GA 2YVLA 5EGSA 5KVAA 3OCJA 3VC1A 2ORED 4HH4A 1ZQ9A 3KKZA 1SQFA 2BR5A 3SR4A 1JG1A 3KR1A 2ZIEA 2HNKA 5HOQA 2XYVA 3P8ZA 1KR5A 3TKYA 4GC5A 1IY9A 4DM3A 4YV1A 2ERCA 2IPXA 3GRRA 5ERGB 5BW5A 3DULA 3C6MA 5HIIA 3P2IA 1VL5A 3UJ7A 3NTVA 1YF3A 5HFJA 3BZBA 3DMHA 2UYOA 5HIJA 3MHTA 5GOZA 3CJQA 2P35A 2P40A 1X1DA 3IV6A 3HVJA 2NYUA 3OE4A 4P7JA 5FWAA 3P71T 4YV0A 5EHGA 4RTMA 4RTSA 1UWVA 2VDWA 3F4KA 2WA1A 4IWNA 5FA8A 4MQ4A 5K0NA 4E2ZA 2AZTA 3PFGA 2IDKA 4U7PB 2HR1A 2GAFA 2P41A 3FZGA 3AXTA 3PT9A 2HV9A 3FPGA 4X60A 1G38A 4QPNA 3A4TA 5EMMA 4BLWA 2G70A 3E8SA 1XJ5A 2AOUB 3FTEA 4AZWA 3ID6C 3B5IA 1KPGA 2HTEA 4GOMD 4PYKA 4DQ0A 4QTUB 3KPWA 3EVDA 3KQSA 5DRTA 2B78A 3EVCA 2IFTA 4HTFB 3MERA 4CKBA 3ERCA 4KWCA 1G60A 5FQOA 1BKYA 4NECA 1RJFA 2ZBPA 2UZ4A 3HCAA 2UYQA 3OU7A 3GDHA 2PVCA 3E05A 1OR8A 3PVCA 3UJ9A 2G71A 4QPPA 2OKCA 2PLWA 4E31A 5EMJA 2AOVA 2PWPA 3KQMA 4PGGA 2GB4A 3R9XB 1R8YA 4PCLA 3SGLA 3UZUA 2CWWA 2PWYA 2LD4A 3P9CA 4P7GA 1F38A 1N7JA 4E2WA 4EVIA 3Q7EA 2AOXA 3LKZA 4RV9A 3NMUF 3C6KA 5EPEA 5CVDA 3LDUA 5E9WA 5E2BA 2G8NA 1EIZA 2XYQA 5DM1A 2ZVJA 3REOA 2B2CA 3HP7A 4BLUA 4ER7A 3SSNA 5BW4A 5E2AA 2H00A 3KR2A 3ME5A 2ADMA 3FTCA 4BLVA 5CM2Z 2OYRA 1WY7A 3TLJA 3FTDA 3OPNA 4MIKA 4PGHA 4U7TB 3JWJA 5EC8A 5EKXA 3B3JA 4JXJA 2C7OA 2PX8A 3ELDA 4V0QA 1AQIA 4EQZA 2AOTB 2QYOA 2OB2A 2YTZA 4BP1A 5KYGA 1YUBA 2DPMA 2P3QA 4WVLA 4EKIA 3BKXA 1Y8CA 2PXCA 2QRVA 4ER0A 5JR3A 3UBTA 4AZSA 2IH4A 5F2KA 4KW7A 3C0KA 4RVDA 2I7CA 5DTRA 3M6XA 1JQ3A 2YQZA 3EVFA 1L9KA 4OQEA 2ZIGA 5FCDA 3KQOA 3M6WA 4POOA 5E1BA 5DSXA 3THRA 4AZTA 5DT2A 2PX4A 3AY0A 1X1BA 3M70A 1Q0TA 1RI2A 3PFHA 1G55A 4R6WA 1RJGA 5K0BA 5K0GA 3QV2A 5F2NA 5K01A 5GIOE 1TPYA 2CMHA 4HGZA 4C05A 2OZVA 2BR3A 4PYQA 2UYCA 2Z6AA 3A26A 1I9GA 3DMGA 3FYDA 5EIWA 1RI4A 5T6BA 4YMHA 3EVZA 3AJDA 1QAMA 3UA3A 3JWIA 5DTMA 3KPVA 5GINE 3CGGA 3NWBA 2WK1A 3E23A 5HILA 3ORHA 5E9JA 3UJ8A 2V74B 4DCGA 1INLA 3ELUA 3KHKA 4KIFA 1M0EA 5E9QA 4R8RA 4RTPA 2EG5A 2G1PA 5LQJA 3I9FA 1YFLA 4RVHA 3SSOA 2AN5A 2IH5A 4C04A 4F85A 4GEKA 4P7KA 1R18A 2XVAA 2BH2A 4L7VA 1QAQA 3RODA 3HTXA 4ZTBA 4MHTA 4DCMA 3R24A 5ICFA 5C0OE 3G8AA 3T0IA 4ER3A 2V7EA 2PKWA 3AWIA 3LCCA 4AUKA 4E32A 5C9ZA 4RTLA 3DMFA 5DX1A 3S68A 5ICEA 2IH2A 3G89A 1ORIA 2C7PA 2JJQA 2O57A 5BXYA 3G2PA 5K05A 1FPQA 3G2OA 3UWPA 4FR0A 3EVAA 2PX5A 3LBFA 5GIPE 2PX2A 2YXDA 1ZKDA 4ATNA 2A14A 3MTEA 2JHAA 3G7UA 1R8XA 1MJFA 2OPBA 4FZVA 4PYIA 4IKPA 5LSAA 3KU1A 5DM2A 5DTQA 3THSA 1SVUA 3HCCA 3P9IA 4PIMA 4CKCA 3X0DA 4KDCA 4QTTB 1DCTA 1Q0SA 2EJUA 5K8VA 1WZNA 4QQNA 4AZVA 4BP3A 5H02A 2VS1A 2CKDA 3GIWA 1JQEA 3OZTA 1EQAA 3KQPA 5CVVA 3UA4A 3VYWA 5T67A 2C7RA 3LX6A 3KPUA 2QM3A 2P3OA 2N47A 3H2BA 1QAOA 4O29A 4PWYA 4GF5A 4RYLA 5F2OA 5C1IA 1QYRA 1KYZA 4X41A 3B3GA 1H1DA 2NXJA 5EZQA 2FCAA 3WSTA 1L3IA 1X1AA 5CCBA 2P3LA 3TFWA 3NDJA 3FTFA 1N2XA 1QANA 2JHCA 5ICGA 4DKJA 1SKMA 3U81A 4OBWA 1FP1D 1PRYA 3DP7A 2I9KA 2PXAA 4XCXA 1RI5A 3HNRA 2AOUA 1NT2A 3IEIA 4GOOD 3R0QA 5E1MA 3FYCA 3TQSA 2AR0A 4UOEA 2JH9A 3AXSA 3HA5A 3EVGA 4Z2YA 1EJ0A 1UIRA 1RI1A 4R05A 2UYHA 2AVDA 3NW9A 3CKKA 1V39A 4V0RA 4B17A 1JSZA 2FHPA 3I58A 1T43A 2ZULA 3GCZA 4HTFA 4RVGA 4FT4A 2FRXA 3BWBA 5DX8A 5MHTA 1XDUA 1XXLA 2GLUA 3M6VA 4LWPA 5EQJB 3T7RA 3OZRA 2NXCA 5D1NA 1I4WA 4F84A 3FUWA 4CKEA 3UFBA 1F3LA 5DXAA 5LQNA 3EEYA 5FULA 2NP6A 4ISCA 4Y30A 5DM0A 5LQKA 4X63A 4CWAA 1NBHA 4QDJA 5ICCA 1WXXA 3KPYA 5LQCA 3PS9A 1AQJA 3P9NA 3CCFA 3HM2A 1U2ZA 2ZSUA 3B3FA 3Q87B 2O06A 3QOWA 3FPFA 3UJBA 1JG3A 4FSDA 3UJCA 2B9EA 3G8BA 3BT7A 1WS6A 2FK8A 1XTPA 1X1CA 3I53A 5T64A 2GA9A 1NE2A 2G72A 1ZG3A 3EVEA 3G5LA 3BUSA 1YZ3A 4YUWA 1BHJA 2NP7A 1NV8A 5GP1A 1JSXA 2ZTHA 4BY9E 5K0FA 5FTWA 1O54A 1BOOA 2FK7A 2PJDA 1Z3CA 3FPJA 3LBYA 4GOND 3V97A 3LKDA 4E2XA 2P7IA 1VPTA 3E7PA 3G2MA 3KQVA 3OE5A 4EKGA 4HSGA 9MHTA 2AOTA 3ELWA 3GNLA 4AX8A 4YUXA 1XDSA 3GXOA 5M5BA 1D2HA 2PV0A 3HCBA 4XUDA 1SG9A 2NNWB 2EFJA 1WXWA 2CMGA 3DR5A 2BM8A 3CJTA 3GRVA 3VC2A 5DXJA 1IXKA 1YZHA 5K0LA 4WXHA 3HCFA 4EK9A 3GU3A 2ZBRA 3LPMA 4E70A 3GRUA 1O9HA 3R3HA 3MQ2A 3A7DA 3GRZA 5DWQA 2AOWA 2PT9A 1ZGAA 3IYLW 3ANXA 1JG2A 1DL5A 3OU2A 3GWZA 5EEHA 3DLIA 1NKVA 5P8WA 5EZSA 3B89A 2YXLA 3HCEA 3TMAA 3T7TA 1VQ1A 3C3YA 2HMYB 1M6YA 1X19A 2GS9A 3L8DA 2P7HA 5DX0A 4Y2HA 3LDGA 5U4XA 4H0NA 5BP7A 2JH8A 2I62A 4QDKA 1IM8A 2O05A 3DOUA 1EJ6A 2FYTA 3KR0A 4GOLD 4PNEA 1P91A 1XCJA 2ZW9A 3EVBA 2IBTA 5E1DA 2ZZKA 4QVKA 3G88A 1NV9A 4OQDA 5EMLA 1P1CA 1XCLA 4LWOA 3G5TA 5KQSA 4M38A 4PYMA 1TW2A 1UFKA 3OU6A 4GUAA 3I64A 4KDRA 3K0BA 4EMSA 1O9GA 2PY6A 1YB2A 3RW9A 3ER8A 3EGVA 2P8JA 2VDUE 2O0LA 4LECA 5E8JA 3LHDA 2NXNA 5EG5A 1KXZA 1R74A 3GRYA 4RVFA 1YFJA 1G8AA 3TOSA 2ZLBA 4RTQA 5HIKA 2VZ9A 3PX3A 1NW5A 4RWZA 2Y1WA 4PYLA 1P39A 1JQDA 5FHRA 2OY0A 5CVUA 2OXTA 5JUWA 1BC5A 2PGXA 4A6EA 1B42A 5DLYA 3K6RA 4KRGA 2XVMA 2ESRA 2OB1A 3MTIA 1DUSA 2XYRA 4R8SA 3CVOA 3PLAE 3FRIA 3OFKA 4OX9Y 4C07A 3C3PA 5EEGA 1VP9A 1R00A 3EPPA 3KQTA 4R6XA 1EG2A 3NDIA 2VP3A 3QOXA 4RSRA 3SVZA 4KIGA 5LQUA 1TW3A 3M4XA 1NW6A 4FT2A 1VE3A 3MGGA 4KVZA 4PONA 2ZZMA 3MCZA 4DMGA 5G02A 4ER6A 3PB3A 4RTJA 2XBMA 4PYNA 3JWGA 3TM4A 3BXOA 3EMBA 3P9KA 1XVAA 5CVEA 2JG3A 1JR4A 3CBGA 3FUVA 3SM3A 2PBFA 2F8LA 2BR4A 1XDZA 5GM1A 4CTJA 3D2LA 3KQQA 5K0CA 2H11A 2ONYA 4RTKA 5CCXA 3HA3A 3UJAA 5CVJA 4F86A 3DUWA 5DRYA 1HNNA 4RTRA 3EEOA 5D1HA 3A7EA
chains in the Genus database with same CATH superfamily
2DTEA 3QG1A 3EGDB 2YRXA 4MRAA 3ORSA 4RXTA 5DGXA 1DQZA 3IPRA 2YWGA 3BB4A 2L2QA 3M34A 3JD2A 4Q4JA 1FSSA 3V8EA 5A02A 5C8VA 1QHSA 3JR3A 5JJ5A 1U9YA 4LDNA 4Q18A 4CODB 1O6ZA 2QGZA 4JOCA 5BUZA 2VCHA 1F20A 4DA9A 3IJPA 3I9V1 2P9HA 4RSHA 3UG6A 1TGYA 4HAYA 2HPAA 1HMYA 1LV8A 4ISBA 2I4IA 4ZHQF 4OLJA 2CMKA 3ANYB 3KNZA 4MYSA 5KOHA 4PXSA 5I7FA 4CBVA 3F90A 1EA7A 2O50A 2JGAA 2NU7A 3WXBA 2VWGA 5TJ9A 1VZ2A 4UUBA 1RXSA 4RDIA 3NEAA 3UCXA 2TSYB 1LDEA 4H3SA 2B37A 1E2UA 2EERA 1ZUHA 1X8LA 3EAGA 4U2FA 2FZLA 3AFGA 1USWA 4B47A 1VMDA 3CT6A 1MO2A 3UK1A 1OLSA 2DQSA 2RC5A 3EXIA 5K8UA 4QVIA 5EHIA 3PVZA 2FEOA 3MBOA 2BZGA 4PCAA 3LM8A 1ISHA 3VHXA 1YTUA 4BQFA 4YMTA 4PSCA 3O4HA 1IY1A 3ZWBA 1RCFA 1TK9A 1G21A 2OLEA 4A3SA 4KX3A 4OKIA 2V3WA 4L78A 4LRTB 4Y9DA 5LQAA 2A5GA 1YV9A 3ZGLA 3D8UA 3M89A 1EEXB 3MXTA 1OIWA 1S8AA 1FMFA 1CY2A 5KBYA 3WLMA 5LIRA 1DKOA 3G02A 5A4AA 2ZYVX 2COEA 1T34A 3AUFA 1Y6JA 4TZ6A 2GF0A 1XLTC 3NJ4A 4NOMA 1HRDA 1K6EA 3D81A 4HG2A 1YQQA 3TRIA 2P75A 4KUHA 4EFDA 1L7NA 3QP9A 1Z22A 2H16A 2HU2A 4R69A 1GD1O 2XUOA 1TQ6A 4Z4EA 2PXXA 3DMNA 3ML1A 4Y8VA 1DNPA 3GJQA 1HT1E 4BFSA 2XGSA 1P2SA 4M2LA 4PAWA 2O3QA 4BMPB 2GN8A 3IMEA 1RYNA 1MOPA 2ZXUA 3LQFA 3CURA 1EFVB 3U3ZA 2QVXX 3WQBA 2G1KA 5F9HA 3BORA 4IS2A 4PG4A 4CRWB 3I37X 3ETCA 4L9WA 1Y3CE 1LKZA 4BPBA 1AQNA 3CUTA 4HEHA 3OJWA 2VT6A 4Y7CA 4LXUA 1DKRA 3QITA 1TJNA 2FNAA 1EX7A 2GTIA 4HV4A 1ZAKA 4AKHA 2BGTA 1RZRA 1MNQA 4K6HA 5L9AA 1HDGO 1E9DA 1OWMA 1B26A 1PD0A 4PSUA 4EX7A 4MITA 1RYMA 5HK9A 3SVLA 2W0SA 3LBHA 3P97A 1L3CA 3OPXA 1VCHA 3O3CA 3SXPA 1Y1LA 2CE2X 4UOQA 2PLRA 1ZOLA 1X3SA 1PQYA 4JLBA 3GHYA 3KT3A 4Y0VA 1GYRA 4WFJA 2KW5A 3GLFB 2ZCJA 4D57A 3TTTA 3GAFA 1M8KA 4AYTA 1HWYA 1DKQA 4G63A 1MJHA 4TKUB 4BVGA 4DAOA 1FBNA 3NOQA 3SXJA 3LWBA 1BDIA 4ABTA 4P0QB 1FJHA 1ARZA 1AXEA 1L1EA 1R6TA 3LCMA 3W0LB 1WSDA 2JI4A 4URVR 1AS3A 4MV0A 4IHKA 4DSZA 3F98A 3RLIA 2GD1O 2REOA 3MWJA 1WP9A 5F5NA 5LQRA 5L8VA 3KVNA 2RAUA 4OQQA 1KXJA 4IV8A 1XTJA 4MUGA 3RG2A 1SQ0A 2WAOA 3RKSA 3GFBA 4DIMA 3U1VA 5J23A 2IUYA 4IQ0A 3PHBE 1GQQA 4O4JA 3A4MA 4H17A 4J90A 3KKZA 2BR5A 1NJ1A 1ADJA 2C88A 3KR1A 4EMTA 5B1HA 3IQZA 5IUNC 3AUJB 3P8ZA 5HHTA 1W5TA 2H2WA 3GEHA 3QKIA 4H6XA 4KXQA 4RGYA 4CDGA 2G5PA 3TOXA 3IAAA 1AGYA 1IE3A 3ASUA 1WVMA 4O3FA 2FZ4A 2J3MA 5CFQA 1F0YA 3NM5A 1Z6PA 3TL3A 1I4DD 3EAQA 4TL6A 4HNTA 1A5ZA 4A8HA 2BH9A 2A59A 2QVCA 2P9TA 3HBFA 4U2DA 3UNXA 5LOVF 2WICA 3IOYA 1MTZA 4NG5A 1X1DA 1RAGA 1VL8A 3C3EA 1TCUA 2JGJA 3CXRA 1WZIA 2II6A 3LUPA 4PBSA 4IWNA 5FA8A 3KXKA 2FRVA 3I52A 2IDKA 1PK7A 5KB3A 1JI0A 3V4OA 2K2WA 4RF3A 3T9DA 3ZWDA 2HV9A 3CUKA 3FPGA 5IMSA 3KETA 2DT5A 3MUFA 4LHYA 2C03A 2WJ3A 4I3GA 1BDBA 1YVUA 4HPWA 1C1HA 3L7JA 4AIRA 1O3YA 3H11B 4V39A 3W4JA 2G6TA 4P8RA 3PNPA 1D2MA 2NGRA 3SHOA 1NXXA 5DRTA 3HFJA 4ENTA 3EVCA 2QRUA 3JQ9C 3I2KA 4IOLA 2IUUA 1W52X 3FCOA 4URHA 5HMLA 5BR4A 5IDWA 1BKYA 4NECA 1CZRA 3H2GA 3LBIA 3R7WB 1Z7BA 2YY5A 4ID3A 1T26A 1YC5A 3FCAA 2QPTA 4KO4S 2NU8A 1ZUD1 1IOLA 2PVCA 3QXCA 4AWAA 4JXZA 1RHQA 3QE4A 3PVCA 1A5SB 1Q74A 4TTIA 3QQ5A 1UBMS 3GT4A 4NCKA 4QPPA 4A4DA 8ADHA 5IWAB 2OORC 1LWOA 4YDHB 2GBLA 3SD7A 3KZCA 2QRZA 4TUYF 2WHXA 4XTCS 2YJ6A 5EINA 3W34A 5LUAA 1S1MA 1LF5A 2WTEA 3A4YA 3B6KA 4KOEC 3WK7A 3GOHA 5FOTA 4JBYA 4M6WB 3WXMA 3B78A 4JBGA 4OHVA 2GBIA 3EC1A 3REOA 4AP9A 1GLGA 2YC2C 2NV6A 2XSZD 3CLRD 5KIAA 1CX9B 2XQVA 5CB8A 3IJEB 3EF1A 2Q29A 3D6VA 4JI7B 4OJTA 3LHFA 5HS4A 2B0JA 3C74A 4NZNA 3UTDA 1VL2A 2R0QC 2RK6A 1SHZA 4NU0A 1JEQB 1QB8A 2B6NA 2AGVA 1G5PA 3BWDD 4RZHA 2FTKE 3AJ8A 2CXTA 4FK8A 1V8BA 1NC3A 3U61B 1JBKA 1K7EB 2H4FA 1NA5A 4LJYA 2F43A 3OESA 1JQKA 1PFQA 1TDJA 3AJAA 3H84A 4TTJA 4X3CA 3AQ4A 5ICMA 4ZXPA 2WAMA 1W1WA 3DM9B 1L5GB 1E2IA 5EXEA 5GOTA 2DTDA 4O25A 5H16A 3EVFA 4A2PA 1KZ4A 4BX2A 4D9KA 2J3QA 1E5XA 2RHHA 3KQOA 1R4ZA 1FFGA 2GETA 4TS9A 5HJ7A 5KCZA 1Q19A 5KQLA 3THRA 1ZEJA 3WICA 1C8KA 1X1BA 3UQYS 3VTKA 4PAMA 3WGHA 1I0ZA 3TE6A 5K01A 1X38A 2G7MC 3VR2D 2WQ7A 5LA6B 1YH3A 1TF7A 3LYAA 1NY5A 1WXQA 1SD2A 1A82A 2AK2A 3IP8A 4I14A 1GL6A 1RWBA 2Y9MB 5BWLA 3R6DA 1XHFA 1ZK1A 3EVZA 4KWEA 4QD3A 3RWBA 3SQLA 3ZIAA 1N5OX 2RK4A 2OYCA 5L4NA 4WY2A 1WQ3A 2EF0A 1M0TA 5MDHA 1OH7A 5BYJA 3V1LA 3VDNB 3L77A 3OO0A 4F2DA 1Y3IA 6REQA 1DIAA 3HU5A 5ALHA 1JYEA 1INLA 1GUAA 4YNBA 4YR9A 2KBEA 4GL4A 1TU0A 4FOTA 2X5XA 3QY9A 2YVKA 3J80A 2SICE 3ET4A 4RHCA 4YP0A 1A3CA 4RL6A 4F85A 3IBFA 3KT6A 3NONA 4D8UA 1M1XB 2X0IA 4RM3A 4PO3X 3PD0A 3BWVA 1E9BA 1JLHA 3D3EA 3T5PA 1VMEA 3H9BA 1KDOA 2VSQA 2PKWA 3AWIA 3T3PB 3L41A 2IEDA 5K3DA 4R0NA 1IEVA 1PU2A 1SU4A 1Y9ZA 1TYEB 3D1LA 4MWCA 1A5BB 1QHIA 3O8NA 4H16A 3OMWA 2R8OA 2G9RA 1B14A 1HYQA 3LUFA 4PBRA 4RFLA 4NX2A 4EBFA 2Z5GA 3MTEA 3VSAA 2B9VA 3CLRC 4ARSA 5C32A 1NN3A 1VIVA 3MWEB 2I3ZA 4TN1A 3ROKA 1QRRA 2X1MA 1W2GA 1ZICA 1JG7A 2GILA 5CJ2A 5HGJA 2C5BA 3OTWA 1ILWA 3K9LA 4QTTB 3WGOA 5AKXA 2G0AA 3EQ6A 5JJCA 4JC8A 2YJ3A 1TD9A 4UFPA 6ABPA 3H0EA 4Z0PA 4PC3A 3GIWA 1EVKA 4RJTA 4F3NA 1QP4A 1K0FA 3EUEA 4ZAGA 2WLSA 1UC4B 2ZRAA 3IUJA 1BU5A 2ZB8A 4GGOA 3TJZA 3UMRA 3MBKA 3ZZTA 3HVRA 2NXJA 4ND8B 5E4FA 3U37A 1TXGA 1GTJ1 3VV2A 1A2QA 3RRBA 3V6MA 3VOAA 1XXHA 2HJRA 5H8WA 3FTFA 3DWFA 5CLGA 2PGAA 3VU0A 1EM6A 5BYBA 3TI9A 4JCOA 2WV7A 3TAHA 3SJZA 1JA9A 1D8AA 1RQ2A 2C42A 1WXEA 3Q40A 3Q9LA 3QU5A 4HMQA 4RPHA 2YJTD 3RT1A 4D9CA 4KR2A 1TB4A 6Q21A 3IUYA 4JLAA 4Z2YA 4D81A 1AGXA 1DKPA 2LBPA 4LHWA 4KFCA 1M34A 3SICE 2A5LA 3A6FA 3AFMA 3PHLA 2V4UA 5E6RB 4GYYA 1Q50A 1NIPA 4FJ0A 4XASA 4EPTA 3S7ZA 3EHEA 3HYRA 3ZDFA 1J07A 5BN3A 4AMUA 2GK4A 4R2JA 3I9MA 3FUWA 5EUQB 3T5MA 3QY0A 2HK8A 3TW0A 5LP6B 4B3GA 2NP6A 1HETA 4P4TA 3L8YA 4YEDA 1DLIA 4A8TA 1LI7A 4CFYA 3DNMA 5DLEA 1A9OA 5E3IA 1L4YA 3FVRA 1LX6A 3MINB 1XLVA 4PFQA 2P30A 1G3QA 3HUEA 2R1ZA 3KK0A 5IXYA 1ZNWA 4A36A 1QF9A 1YR6A 3VZDA 2ZDGA 2IXAA 1F51E 4S1TA 3CUUA 1Y8ZA 2GBGA 1CRWG 1SBZA 2X8AA 4BTVA 3QLVA 3U44A 3TZKA 4RKEA 4MA5A 1YZVA 1X1EA 2WINI 2WIDA 4C78A 1DMSA 3WL3A 1T6YA 1QHXA 4PICA 2C3UA 4OQPA 4F9EA 2ZYGA 3NWJA 1TEHA 4D02A 5TVKA 5DNEA 1O54A 1N9GB 2FK7A 2QR2A 1ZONA 3D2BA 3QWAA 5AI5A 5HKLA 2Z2ZA 5E0OA 4AX8A 1T5DX 1Z0IA 1XDSA 4RESA 5DGHA 1OVMA 4KXWA 3PC4A 1P4JA 1OFGA 1VTKA 5IC6A 2M6LA 3RTCA 3F46A 3UVEA 5HE8A 2CMGA 4IDBA 4TV9B 3I1YA 1PWEA 4FJ1A 3GU3A 2PKRA 2VSFA 2VF2A 1U0LA 2V4MA 2XCLA 3PITA 3AEQB 4EJ0A 4UVHA 4XARA 3PTZA 3KKQA 3KZMA 3KBOA 2JFOA 5TIIA 3IYLW 2ZM5A 3ANXA 4D92A 2PTGA 3D5TA 3ZCTA 5KX5A 1ZN2A 3RSZA 3T1OA 3U3MA 3GMTA 3HJTA 4IQ4A 2PQ2A 1H69A 4TMYA 1HQKA 2D2VA 4G5XA 4G8DA 3U4AA 1GGMA 2VJAA 3C7AA 5DYYA 5C1PA 3ICCA 1YZNA 3CCBA 4GQAA 1OX5A 3TEJA 4K0KB 1BTOA 4Q1FA 2IHNA 2R7MA 3MSCA 4TV8B 1XZHA 2B4QA 3K09C 3MB8A 1KFBB 1G3MA 1ORDA 3QX9A 1C1DB 5K8LA 3QWIA 1XAIA 4HQLA 2JLYA 5E1DA 4EKDA 2VKTA 1LQ2A 2BBWA 2O2HA 1GSAA 2QU7A 4DOMA 1H6AA 4YJHA 3ZGNA 4PTYA 4AJLA 4B3RB 1JMKC 3C43A 3WKDA 1FQJA 5FFNA 1A9SA 1U2DC 4DVJA 4RVFA 2VK8A 3E0XA 2HDNB 4ZKEA 3TZQA 1KDTA 1V3TA 1IAQA 2LZ0A 2Y1WA 2D62A 1PYOA 4MWTA 4PCUA 3DCYA 3MJHA 4UFOA 5F1KA 3GVCA 1GPH1 4GQIA 4O8ZA 4QU8A 2G5CA 2B1IA 4W5QA 1QYVA 1FJGB 2QL6A 3ZWKA 1W93A 2QL9A 3L82B 4X93A 5JH7F 3QVSA 3RRJA 2C2XA 4JB2A 3C6XA 1TUBB 3M8KA 2XV1A 1EDEA 4R6XA 4U7HA 4EELA 3GLGE 2FN7A 1IBKB 1KWGA 4RY2A 3V8NA 2PDAA 4I9NA 1TW3A 1MC4A 3TL6A 4YJ3F 1PEAA 3KEQA 4Z7NB 4Q24A 1A2KC 2Y1LA 5B36A 2ZZMA 4FFMA 3GFRA 1UBHS 4D6PA 5LBIA 1Z4NA 1UBLS 1R0RE 1SVKA 1NJ8A 2J9RA 3TM4A 2FY8A 1Z2CA 3ASVA 1KWKA 4K46A 2C4KA 4HRXA 4DG5A 3JAWB 3V9AA 2CJXA 4LJ4A 3KT0A 2A30A 3ZK7A 1TA0A 2DQYA 3VR3A 3PA8A 2J3KA 4GS5A 3ZHQA 2HREA 1CUZA 3T5CA 1GAXA 1W88A 3FSRA 1YIOA 2OD2A 5A6VA 3D4NA 1OH6A 1SGWA 4TMVA 1YS4A 4AY4A 3U4HA 3VHLB 3RVKA 3FDJA 1BHQ1 2JIMA 4NABA 5KJCA 4GW3A 3T9FA 5F5XA 2IPAB 1VPEA 4BPRA 2VG8A 4I1IA 1M6VB 4QYTA 3CZRA 3H17A 4I1PA 3H13A 3K32A 4F3RA 2DPXA 3OKCA 1CBUA 3A1TA 3OIYA 3SOZA 1P7YA 2R9VA 2XNCA 1KZ6A 4FC7A 2B7BA 1W4LA 4CLHA 4N40A 2O5CA 1HDEA 4YWHA 1TM3E 1U3FA 2A0YA 2GXAA 2WNIA 4QBFA 1R9MA 4IOJA 2ECOA 2HIAA 2YASA 2LE0A 2P3SA 3EYAA 3QX8A 4LJ6A 4TVKA 5SZKB 2BFFA 3UMGA 1MRSA 1DQYA 4D9MA 2BAGA 5DN6D 1JDJA 4NC9A 3HR4A 2XGGA 3BRQA 4LY3A 1QZXA 1DAEA 1L7DA 5CNMA 2XWPA 2Y0PA 2XUIA 2BGRA 1K86A 3B6IA 4C29A 1HXHA 1IHXA 1Z45A 2I6TA 1G1AA 3F1KA 3OAAA 1F6WA 5HEKA 2QZSA 3GPBA 4JITA 3TNFA 1CR0A 3ILSA 4XLZA 2OBFA 3JAKB 3ROXA 4O5AA 1K6MA 2J32A 1ZRNA 5A05A 1SU6A 3V4FA 4DABA 2AQKA 3OECA 2QQ0A 1Y8RB 3PJFA 4BGDA 1YL5A 2VCYA 2IXTA 4WNIA 3HRHA 2IIPA 2R4TA 4ZPXA 1JFFB 3K5IA 3TQOA 2R60A 3BDVA 1Y9DA 3DOFA 4BB5A 1JLKA 2JFGA 3PKIA 2Q4OA 4NONA 3QF4A 4M9XA 3IDQA 3LPNA 1EHCA 2E4WA 4DMRA 4RORA 5JQGB 1D2GA 3I6YA 1EK2A 3R1IA 3VA7A 1Q3HA 4HCJA 3P2EA 4UHEA 4YO8A 2ID8A 1KIAA 2NZUG 4D56A 3DAPA 3GBSA 5EIOA 5JATA 2VQ3A 2W6OA 3DTYA 4QQFA 3H8SA 1CEYA 1NNLA 2NNLD 4KQ2A 4R7TA 1Z5WA 3IC5A 1CF4A 1QS0B 4HK4A 4JASB 2XDYA 1VPLA 4KP7A 1D4OA 3TEFA 2Q0SA 1VJ1A 1C29B 1XQYA 3MRSA 3NANA 3IO5A 3PPXA 1FNBA 1TK2A 4MR9A 5CLQA 4BNYA 3GLGB 2V45A 3QOFA 3SZGA 2DT8A 5BNFA 1JFSA 1X7XA 5I9IA 4Y9SA 4PPGA 1IMJA 1VECA 1CYDA 4LRQA 4CI0B 2C95A 2ZIXA 1D7AA 1W5BA 2ODWA 2Z0MA 3DAOA 3F3SA 1L4MA 3TSCA 5AW0A 3NBZC 1JTFA 2JIZA 2JCGA 2VHTA 3CZQA 4M37A 4LEIA 1AV6A 4DYDA 2B8WA 2HRZA 3O2NA 2RH9B 3ISTA 4XD7A 3CVVA 4GWGA 4CCYA 5FHQA 1XNJA 3UM9A 4EHFA 4EO7A 5LC1A 2WP8J 4JMPA 2ZE5A 1I4LD 1UFRA 2FX5A 1J1ZA 1IJFA 3NV7A 4IHJB 2VOJA 4RZUA 2RHJA 5H3LA 5H4GA 4F1KA 2O3SA 5BSFA 4CV0A 2GPWA 4ESHA 3AIIA 4Q4HA 2AUTA 2C4VA 2ENWA 4N8SA 2H63A 1TM7E 2A0FA 2PVPA 3Q8XB 2ZZNA 3EXFB 1WMSA 1QGDA 3H1BA 3IBTA 4NEQA 3HBMA 1O6BA 4IXMA 1N5RA 5B30A 4EX6A 1L0BA 1YS7A 1NMQA 2QOEA 3R5JA 1IULA 2NSLA 4WHMA 3L1VA 3OCJA 2FZGA 3I4LA 5ALOA 4X9XA 3WV4A 5KU7A 3D7LA 3TAUA 3B2NA 4EFKA 1GFIA 4X62B 3W6PA 3VYRB 3S8EA 4PZ9A 3K2EA 4QUDA 2O2XA 1B73A 5ADHA 4CKCB 3VR5A 2ZB4A 2OZKA 5CH5A 3NHZA 2XDQB 3DZGA 2OBNA 3MFQA 4LKOA 4DM3A 4DJEC 4MB6A 4YV1A 3K0SA 1M1NB 5DGCA 4M1MA 5FLYA 4F71A 4PSAA 2BE7A 4FNOA 3TPCA 1E66A 3IEMA 3DULA 3H3FA 3KO8A 3PL5A 4L51A 1RYDA 4ME6A 1VL5A 2DSTA 4MW7A 4RV4A 5ECGC 3HWWA 3NGLA 5CFNA 3WRYA 1TTPB 1K75A 4N0MA 4GLLA 1XTVA 3D3QA 2GN4A 4G1MB 2RI6A 4RTMA 3N6VA 1YB7A 2NYUA 4PHFA 1ZXLA 4PSVA 2VDWA 1QZ3A 1T5OA 4WFKA 4RTSA 4FYVA 2J46A 2NXWA 4XA8A 5CFRA 3UAGA 2ZSHA 2VXYA 3GYBA 4YROA 3F49S 1Z38A 1TFUA 5T4HA 1QH8B 3SZ3A 2ORYA 4TM7A 4ROTA 2WIFA 2J8ZA 1T15A 2HPVA 5D3MA 1RWVA 3HMKA 1GGHA 5LLSA 2I55A 4HGOA 4YB8A 3OX2A 1Z4QA 1DG1G 2DHRA 1KAEA 2HU8A 4IL5A 4M86A 4QGFA 4OEHA 2X8WA 2EIHA 4BMNA 3RUHA 4UREA 4GBMA 4Z54A 1XF1A 3HZRA 4CEJA 1JU9A 3EWAA 3SHWA 3DE1X 3QELB 5SY4A 4FXOA 4IF4A 1E3IA 1OWPA 3HCOA 4EYSA 4II3A 4UE2A 3KQNA 2ATXA 4H3KB 1KK0A 4G4IA 1U9CA 1T36A 4G25A 1T6XA 4EHNA 2PWPA 2QT9A 4YJ2B 4QSHA 2Q8QA 1S2MA 2CWWA 3C3AA 3F3MA 2QQFA 2WUGA 4HJRA 4OHMA 4LBYA 5CVCA 3RC9A 5JS1A 3BMOA 2FRDC 3E3LA 1TVCA 4R3WA 2B4AA 3EA5A 3BRWA 5C5EA 4KYTA 4YV7A 1Z5UA 3V3KA 2G8NA 4U00A 5TT0A 4BV8A 3DQPA 821PA 5GVSA 1CR1A 5BW4A 2FXVA 2C2BA 1KY4A 2AJ8A 1QHYA 2G4VA 3M6MD 4IVQA 1N2CE 1X7WA 1SXGA 2O4UX 1FTNA 4GLFA 4PX3A 4QFCA 2BDEA 2G7ZA 2UZAA 5CM2Z 3UOWA 4DE5A 5FBVB 4U7TB 2O2YA 1X14A 2GCEA 2GHTA 3LV8A 3TDMA 2QGNA 4OGWA 1AQIA 1HRKA 1FMJA 5A5EA 3KWFA 4DREA 3L4SO 1EESA 1YSCA 3BJRA 2HAEA 5IC4A 2CHEA 3VYVA 3M6LA 3F6YA 1JIQA 1UFQA 3NTXA 2VHWA 4LOKA 3RUAA 5K2OA 1T35A 1Y8CA 4RDCA 1UMKA 2DPHA 4F3CA 2ZSAA 2NUAA 2AJCA 3R8XA 3PQ8A 1CR4A 2JA2A 3E8MA 4DB4A 4NPAA 3EIOA 4GRDA 4HNUA 3TGWA 5JD3A 1Z73A 4O4LB 2X1LA 3KOOA 1ZLXA 3HFSA 1SEVA 4UBLA 5KVSA 3M70A 3HXQA 1RYHA 3RKUA 3H65A 2HA7A 1FX0B 1XWFA 3WLKX 4JLNA 3N3AC 4PANA 2O6LA 1C3OB 2F55A 4J0EA 1IPHA 2PH5A 1KERA 1BXRA 2XKJE 4DBLE 5BYKA 4P83A 2V96A 4Q3DA 4ZVVA 2JIDA 1OTHA 4RF5A 4DILA 3U7HB 2XLBA 1GNSA 3CPEA 4QLAA 1DKNA 2WF6A 2XUZA 3JTMA 2HXGA 4I9GA 1O5OA 5JZSA 2XVXA 3ELUA 3U7FB 1CIVA 1OFUX 3DMDA 3EK2A 3OKPA 4R8RA 4BAUA 1Y6ZA 5CB4F 3T99A 4Y2GA 2HC9A 4HX9A 4UM5A 4RVHA 2WAYA 2WV9A 2X9LA 4QT4A 1R5NA 4ZYXA 3AHGA 1PZNA 4JR2A 1KJ8A 1XE3A 3W3AH 4MHTA 2MYTA 2XUAA 3HUTA 3R24A 4KK3A 2HDOA 5DZSA 4MV9A 1XF9A 2H9IA 3IBSA 1LDMA 1XZAA 1A71A 4OF4A 1V8DA 4ZC8A 1AKEA 2H8GA 3Q1KA 2IZOA 1QGUA 4A0FA 1LBTA 1KU0A 3G89A 1Q1BA 2UZ3A 5BT9A 3ZW8A 1M1YA 2VTVA 3G0IA 3QMVA 4YA6A 3VO2A 3PT5A 4FDMA 4BAGA 5JH7A 5K05A 3S2EA 3HL0A 1A2OA 2IYWA 1KYXA 4R68A 1E1CB 3HHPA 2PX2A 4ATNA 2E21A 4KBYA 2VUHB 1JH8A 5JFGA 4OYRA 1I7LA 1Z2AA 4OB7A 3JQPA 2AK3A 1MQ8B 3EXAA 4GMDA 4B6PA 3IUMA 4U9HS 3AR5A 5DBEX 3P9IA 2DX7A 3DBRB 4U2GA 3QA9A 3I45A 4KVGA 2GHRA 5K8VA 2G04A 1GG2A 1O57A 2JCBA 1DX6A 5T5QA 4JXKA 2W7TA 2IKSA 1CJBA 2DUNA 5IJAA 1QXSA 2BHNA 5EZYF 4R9VA 4D8TA 3LX6A 4G2TA 1N0HA 2X19A 5MN4A 5K45A 3GUHA 4J2OA 1VGQA 3MYYA 4RJJA 1OZGA 5B53A 4S1WA 5EZQA 1V8OA 5B3AA 3ZI4A 2P9JA 4JB3A 4FNMA 1L3IA 1QYIA 2NPIA 2YV1A 1YE5A 1PS0A 5LBUA 3SZRA 1XMOB 2J7PD 1NRJB 2BSXA 2DWOA 3AONB 2Q7DA 2NLOA 3U81A 2JGIA 1ESZA 3V2HA 5LDHA 4Q93A 1US8A 3U26A 4B7UA 3HNRA 3QYJA 3T52A 3FOBA 3H9QA 3I5YA 4DA0A 1O5IA 3T3NA 3F8WA 3IP1A 1DS6A 4GT1A 4OQ4A 1FQOA 1O9BA 1UIRA 4RKFA 4O1HA 4AP6A 3NRBA 1Y3AA 5HQTA 5JYBA 1PJQA 5C8YF 5F3DA 4B17A 3ZKAA 5FWXA 4ZMBA 7MDHA 3SFZA 4BZWA 2GA8A 3HJAA 4QICA 3PD1A 3HXLA 5TMEA 2YMQA 2OKGA 3IAUA 2V0NA 2P68A 3N74A 4OL9A 4B73A 3LBAA 3IBYA 4HL6A 4XYGA 3WV5A 3ZV7A 4CR6A 4C4SA 2BJWA 4CKEA 1T8RA 2JAPA 3QVOA 1E3LA 1ND5A 1YRBA 2P5SA 2Q45A 3A1FA 4V1CA 4Y1RA 2J0SA 1WXXA 5BUSA 4NV0A 3TINA 4Z9YA 2EKBA 4H31A 3B82A 1R64A 4RBNA 1P2TA 1P2DA 3RYIA 4N9WA 4B79A 2OAGA 1QP0A 1OX4B 1XA0A 3CCFA 4JFAA 4OFWA 3HUDA 3CUYA 5BV8A 1PT8A 1PCXA 3I6MA 5EUMA 3RFTA 3FPFA 4GICA 1JG3A 4LWQA 3EQ7A 4IOMA 4ND7A 3BN3A 4IJVA 4XR9A 3O74A 5DNAA 3RFCA 3GJ7A 3W7VA 1LD3A 4BEJA 5A9SB 5DB4A 3A3KA 1NE2A 3GNSA 3PQ3A 2YY7A 4N5MA 3C3XA 3C7KA 2R4UA 4C22A 2BEJA 1C3JA 4BJ5A 4HN2A 3K6SA 3MJVA 1IWOA 1GDHA 3MELA 1H2BA 2AT1A 2OILA 2PJDA 4UBIA 2FWIA 2LWIA 4GOND 3LKDA 4KMSA 1V2GA 2PK3A 3RUIA 3KJQA 3TJMA 1NXSA 3AFHA 1NXOA 1YB6A 5LQSA 1DG3A 1UQTA 1W581 3ETHA 5JXIA 4IIUA 3O8QB 1I1QB 4R8MA 1F5NA 1MJNA 1WXWA 3EXG1 4EK9A 4EENA 1BEZA 4UM9D 1UL1X 4L4UA 5B4UA 1W4ZA 5KQMA 1ABBA 1GRQA 5C7YA 2JCXA 3GROA 4TMFA 1RW4A 1KDZA 5EWLB 2V3CC 5AM3A 3FKQA 1JN0A 1WU7A 3SX4A 3LQRA 2C5SA 2J4DA 4O33A 3HFGA 1UDCA 2OZPA 4U8GA 1VB5A 1E4OA 2HK7A 1ZAYA 1WRBA 1AM4D 4YT8A 5AIBA 2ZT5A 5P8WA 5EZSA 1SURA 4J16A 3FHJA 4AZ3B 4YI5A 5JNWA 1K3TA 4GSYA 3T3IA 1AKTA 4R1LA 3IP6A 5E6UB 2G76A 4MRMA 2VFAA 5JAOA 5U4XA 3OIFA 4IFTA 4IJ6A 2C5LA 1V6SA 2RHCA 1QX3A 1TM5E 4PZEA 2IUTA 2H9YA 2QVZX 3F7OA 4PY2A 2GBFA 4GOLD 1EJ6A 421PA 1OXBB 4HS9A 2UVDA 3EVBA 3H3JA 1MV8A 5IHXA 3G9QA 5DK4A 5TXGA 4FE7A 3AR6A 1P1CA 4US1R 3VH2A 5FA6A 1M2EA 5A06A 1F7VA 2Z98A 3U40A 3ZVNA 4IIJF 1XFDA 2PRKA 2ILVA 1AMNA 4MS3A 4MVJH 2WUDA 3LC7O 1DMRA 3T1QA 1PS8A 3KFLA 3QLUC 3GLIA 2AZ4A 4YT2A 4BVFA 2DH6A 2DKFA 2CMFA 2VBCA 1V71A 4KX5A 2QUIA 3K0FB 4ZC1A 1I7DA 5KTMA 5FTJA 3T94A 3K53A 3FLAA 4HUQB 5TMBA 3I9V6 4KRGA 1EFHA 3WFJA 3NRCA 5C18A 1HQYE 2XYRA 3D1JA 3GJ6A 4WBNF 1N1EA 3UJPA 4A2QA 2OO5A 1GSOA 2C4MA 1FMLA 1QK3A 1Z18A 1ZD5A 2GEDA 3BSYA 4PU0A 4QUJA 9ATCA 3NDIA 5JDIA 1SZPA 1UDBA 3ECCA 2VJPA 2XNSA 1VLVA 4G9BA 4PSDA 1ML4A 2LGJA 4XIIA 1FSPA 2BP7B 2QAGB 5ALUA 7ADHA 3HDQA 4WOJA 3RFFA 1UDXA 1ZIOA 3STYA 4L73A 2ST1A 3UGQA 4ARIA 2C7GA 13PKA 1C2TA 1KOFA 4MYHA 4JY7A 3UHJA 4ZU1X 3EFOB 3RS7A 2JG3A 3D8BA 3WQRA 5B3JA 4XYEA 4Z49A 2ZYSA 4Q3AA 5AKYA 3PPIA 3HR7A 4UU8A 4CCAA 1Q57A 1Y6QA 2VYND 1ZHOA 4DG8A 5EHNA 1I8TA 1RSZA 1O95A 1C9DB 5CCXA 4WD3A 3QBEA 1Y1KE 1HNNA 1BDJA 4Q4JB 3HR8A 3HVHA 1OHHD 1AHHA 3VNSA 2EJWA 1CJKC 1ACLA 4Q03A 1NVMB 1XI2A 1ONPA 2GTPA 4D1YA 5KC8A 4LX0A 4R1PA 2IWHA 5BSGA 4M1TA 1E3JA 1YQEA 3N07A 4J9UE 2PNJA 1UR5A 1Q83A 1XRRA 3SBOA 4QQKA 1TVKA 5JSHA 3I9KA 2O8EB 1ZGGA 5LBTA 4GFDA 1HQDA 5JLJA 2GAOA 2DQZA 2MT9A 4F9FA 3DXFA 2XZTA 3DO8A 1VL6A 3L4EA 4J2HA 1UM8A 1OV6A 3WB2A 4CKBB 2J41A 2JHPA 3FLMA 3WQHA 4ENUA 5FTKA 3P0JA 3FOEC 3U60B 1DFGA 2PG3A 1PNOA 2CFOA 1NU6A 2AG6A 4WN9A 3RSQA 2CNKA 4JVSB 5TV2A 3DAHA 4KIUA 5E3HA 1GP2A 4WKCA 2FW6A 3RSFA 1FP2A 3E6AA 3JYLA 2PH1A 3AB3A 3RREA 4DBVO 3A3NA 2A33A 5JD5A 1TVEA 2O54A 1X7DA 1HNXB 2FR0A 4FX5A 3FTQA 3R9KA 5ITWA 2DHCA 3ENWA 2BFMA 4JR1A 2IYTA 1SVSA 5BSRA 1XRQA 1TIPA 3V46A 4UZFA 3SX0A 4DYHA 3E8XA 4QJBA 3ZHSA 1SQSA 5ES3A 3TZ6A 1EU1A 3OOHA 4WOPA 1G7CA 1L1QA 1KF0A 3MCVA 3C3MA 3EGXA 1BCRA 4W63A 5B1IA 2DMRA 2NPFA 4A8JC 4QXRA 1ESNA 2PV7A 1SUIA 1VLHA 2OHGA 3TR6A 5JWOA 2ASEA 1C7IA 1EFCA 4MS1A 1CR6A 3EA4A 2XITA 1C4WA 1N7IA 2IYZA 4ZV9A 1SNYA 2WZBA 3JARA 5G1PA 3SQNA 1NASA 3EBLA 4MGEA 5BUCA 1FYWA 3FR8A 4BJ1A 3AVUA 1TX4B 1R0XA 1WDLA 2AEJA 2QMUA 1P31A 3FE2A 4KXYA 4QSMA 4F2HA 1NBAA 1KZ1A 1BJTA 2HPZA 2P4UA 1DWUA 4I55B 4LXIA 5JRDS 4KQCA 2ZJZA 1M0WA 4TRRA 2PJRA 3B9QA 3EUWA 3K1JA 5ELXA 1XMJA 4I1VA 3MGAA 4KPGA 4CG0A 3Q4GA 1H4SA 2DLDA 2XT6A 4EBBA 4IZIA 3A1UA 3GGOA 4EUHA 1YQUA 5BMVF 2YZKA 1IJBA 1UP6A 2Y93A 5FFMA 3QEAZ 1T2CA 4O2BF 2LIVA 2P79A 1T0JB 3DXZA 1B6GA 3AEUA 1DUVG 4MR8A 1OBFO 1LLDA 4QDZA 1K5DA 1G59A 1GVHA 3HGQA 3FPHA 2QORA 2FMXA 2WEKA 3BAFA 4OREX 5J5VA 2YH2A 4UAVA 3LUCA 4OHUA 4GX2A 4H6VA 2AZXA 3WK6A 1Z34A 5FOSA 1Q7CA 4P08A 5L3RA 3OICA 4IINA 3FETA 3WJAA 3ZVLA 3PXDA 1ABFA 1IB6A 1HE1C 4JA2A 1GSHA 2A5FA 1AXRA 3QJGA 4YREA 4AXXA 4ARUA 4C4PA 4KKVA 1UP4A 1YFKA 2GZMA 4MW9A 4YMGA 1WJGA 4UARA 3ER9A 5C52B 4KWIA 1I2DA 4WESA 2M1ZA 3HI4A 3QVGA 4GNKA 5EIBC 1P2GA 1JRLA 1IDN1 3SMQA 4X1YB 1DJPA 2ACWA 2CF6A 3AIKA 4WRRA 3K94A 1AUQA 2Q7OE 4NWIA 2AI1A 2TS1A 5K3AA 4WZAE 3AY7A 3JASB 2CBXA 1W96A 2ZBQA 1YZYA 1NXVA 1TT5A 3LCRA 2MIIA 3OZAA 5KYKA 1XTSA 3S27A 2E3JA 3T1HB 1X77A 5INTA 4YLGA 4GRIA 3ESYA 2V7PA 4ZAZA 1TM2A 5IN4A 4MYUA 1ZH4A 3BOSA 5BPFA 3T7KA 3O4JA 3AB7A 2D6FA 2GGSA 2WFLA 5HKKA 5IEJA 3M9LA 3ABIA 5KNBH 3ZWPA 2IPXA 3NEYA 1GN8A 4PFKA 4LOAA 1YR8A 2PZLA 3L0YA 3C6MA 2D2EA 4UHKA 4ENSA 1D07A 1RD4A 3BK7A 3UJ7A 3WKAA 4B6GA 2HSGA 2TMGA 2WJWA 2BZSA 2XLCA 2YWEA 4JJ4A 4A23A 3EZFA 2P40A 1KSFX 2AF3C 3LWDA 4FGSA 1CUDA 5L7WA 2JJ1A 1M5RA 4LRWA 1N1GA 1FZQA 2BMFA 2WA1A 2FDRA 4X64B 1LPAB 1LLCA 2K2QB 4RD2A 1AU9A 5EHXA 1NSTA 3TRJA 3IP7A 1JXAA 3NTRA 1U0NA 1ONSA 3K1YA 4S1VA 1J0AA 4KVAA 5K7SA 4G0VA 1XTRA 3IDAA 4C7OB 1E2HA 1U1EA 3Q72A 2PKCA 2BD0A 4OG2A 5JVDB 4DQ0A 1U7XA 3LK7A 4G1VA 1N3BA 4OX9B 4S3MA 3LZCA 3OSUA 1VL1A 1YWGO 2XB4A 1QRDA 2I7TA 3KDPA 3OCVA 4HMOA 1OJ7A 1G60A 2G77B 2I2XB 1QC5B 4MGHA 4WBSA 4LI3X 4ZJPA 5B58T 4QDXA 2HCTA 3F5SA 4N54A 2H08A 3JX9A 2XQJA 4DC1A 3IRVA 3U4QA 4GR9A 2K6GA 2YBEA 5J59A 2PLWA 4BMZA 2B8JA 4PGGA 4RANA 4OU5A 4YAJA 1ONOA 1R8YA 5CLFA 1DXHA 3AEZA 1AG9A 3TZBA 4E2WA 2QRPA 1U8YA 1T13A 1F60A 2YMMA 3PEYA 3G2IA 1DZ3A 2AUMA 3QVWA 3T6KA 3DFUA 5KQGA 4DCJA 3BL8A 3L9XA 3LDUA 2Q5JA 4DV6B 4EYKA 5CURA 1CRZA 4KR3A 5JQWA 1EIZA 2Y76A 2XYQA 4AKSA 4DB2A 1WUYA 1DJQA 1ZVKA 3GG9A 5ERYA 3GX1A 4OHFA 4EF6A 3I62A 3QSGA 1FUIA 1ENPA 3IUSA 4L0MA 2ORVA 4JMLA 3FTCA 4MJ3A 2BTQA 4XFJA 3QWHA 1K8YB 5JY1A 3KVVA 4K28A 1NXWA 2FGJA 1ISGA 3ZJ4A 4Z4CA 4I1OA 4MJXA 2E7ZA 1S3SA 3BXXA 2ZR9A 1J20A 3ZG6A 1PHPA 1TCVA 1OWLA 4N6OA 3TVTA 1XKXA 1VMIA 2EGGA 2YJNA 4K05A 2OD7A 4JBWA 4XB1A 2YWCA 2ZT6A 5F4BA 3VPHA 2CXOA 2IH4A 1R0KA 4IYJA 2BFCB 3N75A 1XMIA 1RZRD 3KELA 5EP3A 3MOSA 2Y68A 2VDPB 5G0TA 3U6KA 2C96A 2GUWA 5E1BA 3GA7A 5DSXA 1CF9A 5ARBA 3TW8A 5DT2A 3DC7A 3DF9A 4XWAA 1KRWA 1XKTA 4I66A 4B0OA 5CCDA 2J87A 1DO0A 1U4OA 4A10A 1Z2NX 3SC6A 1YS1X 2YS7A 2B8TA 2JZCA 3O21A 1FTGA 1RYFA 3CVWA 3FB1A 3CLUD 1VFNA 3JVUA 3LT4A 4WLVA 2VHJA 4D4IA 1LLFA 3Q2IA 6REQB 5DKFA 3HDHA 3JWIA 3EXEA 2RHMA 4FMDF 4LNUB 5DTMA 1WCYA 2NG1A 1REQB 1R0LA 4RGQA 3BRSA 1A5TA 2E49A 3A6ZA 3GFPA 1JSLA 5A62A 2EG9A 2EW8A 2M2IA 4JLKA 4URWR 4B8ZA 2DXIA 2CF5A 4I4TF 4BV3A 4MO2A 1GOTA 2AHOA 4KRYA 3JQ7A 2VF8A 3PHCA 3SSOA 1ML3A 2AN5A 4Q9AA 2OUKA 4B6OA 1OH5A 4KGZA 3RBVA 4OUDA 1Z0KA 3RYFA 3NHWA 3G8AA 4OXKA 1XVVA 1DQNA 5EYPB 3HSSA 3OFVA 3S68A 2LCFA 5ILOA 2ZE7A 3ZWWA 5A5DA 2JJQA 2FLKA 2VDQB 1HG0A 4TL7A 9ABPA 3BILA 2JANA 1ECJA 2PX5A 3LBFA 5EKUA 3SC4A 1PFWA 3DHYA 3RU9A 5BY2A 3EJWA 1LRJA 5I9MA 5AKKA 2O2GA 2JFVA 2BDUA 5DHFA 2D5BA 2CL7X 3U9SA 3VV3A 1VIAA 3W90A 4HZIA 5KYUB 1SVUA 3FVQA 2XCUA 2AMLA 1JZTA 4RIGA 1NF2A 5IWCA 4QA9A 1JQEA 3D5EA 3QBJA 1XTIA 4LTNA 1PG5A 2JFFA 2Q4EA 2XECA 4OFZA 3TZHA 2QN3A 1QGED 4FLMA 3CMMA 3QPUA 5C1IA 4BY9E 2QNRA 2XZLA 1KYZA 5T4FA 2AR9A 2GFIA 1XXHB 3GFFA 4RPJA 3SQOA 4B3CA 1FIUA 4Z3OA 2FLVA 4Q6WA 2Z5VA 1T3SA 4QQ8A 3RUFA 2H5LA 5JPCA 5HG0A 4H6PA 2LPMA 2O2CA 4CM5A 4ZHQB 4HGQA 1YCDA 4GPTA 1W9MA 4AO8A 1HSZA 1PRYA 3UMSA 4IH1A 1OXUA 3A6DA 3CEHA 3ZGYA 5KOJA 4TMWA 4YJGA 1EBBA 1P7CA 1M34B 4ND2A 4P53A 1KHTA 3X1XA 3QSYA 4JC4A 4LPSA 1NUTA 3CLUC 4NHOA 4Y6PA 4ZI7F 1N78A 1W6UA 1PZEA 2C84A 1V4NA 2HDWA 4DQLA 4QZVA 2W83A 3FSEA 4Q47A 1GTVA 2AZDA 2ZULA 4E5DA 1MORA 5DX8A 5KHLB 2HEIA 2BMVA 2IDZA 4PHHA 3ZXUB 4MRNA 1F17A 2O52A 3EEYA 2G4CA 3PG5A 4R1TA 5ALXA 2P9YA 4ZCTA 2P9ZA 1NMZA 1XCPA 4GO1A 3PLRA 4M3NA 1P4AA 4Y0AA 3W06A 1MW8X 3HNPA 1PFYA 5E9AA 3I3OA 1MG0A 4PNHA 2C9DA 4EYOA 2NQ2C 4UU7A 2B9EA 1ZRMA 2Q9UA 2EYUA 2OFOA 3AX6A 2HT1A 3FZEA 5E6SA 3R74A 3WJ2A 3UUGA 3ZY3A 4C88A 1AQYA 1JE0A 1UUFA 1NW9B 3ENVA 1C14A 1OC4A 1TKAA 2BFAA 2CJYA 1SN7A 2JFQA 3IPLA 3K20A 3KZOA 3KUXA 3O1JC 2ZTHA 4NNPA 3TBKA 4E12A 3WKEA 5K0FA 3EUFA 5FUWA 3WGLA 1IN4A 1KO5A 1L2TA 3AY3A 4ZCPA 1X1QA 2HO5A 2RJNA 1DLJA 1O96B 4OY3A 3VU9B 2FUKA 4A0RA 4KGVA 7REQB 1BMTA 5JXWA 3DZCA 1XZGA 2PV0A 4G1EB 2GK7A 3ZHXA 2VUUA 3VC2A 2CMDA 2E89A 2HTFA 2JFWA 1CUEA 2YV2A 2Z1NA 3FMIA 2NVUA 3R5XA 4MMXB 3RJMA 1V8PA 2D59A 3WAKA 3VC7A 1ORWA 3R3JA 2NTEA 4N3GA 4RNDB 4UDXX 1XA4A 4BNDA 3FNRA 4KGXA 3ZIAD 5J47A 2W6JA 1T9BA 2NACA 3UY4A 4E0BA 2P6RA 1NY6A 1G6KA 1RAEA 2P6MA 4ITUA 5JCJA 1X7HA 1PHRA 3D02A 4DA7A 5AW6A 1RZUA 3ZVKA 2W4MA 1U80A 2PLNA 1VQ1A 4FCTA 1MRNA 2J08A 4AROA 3EOZA 1N36B 4MWSA 3RF7A 2PPVA 4HH3C 4TGLA 3F9IA 3B6JA 2EFCB 1CD5A 1VXRA 3FGNA 3JCZA 4EA9A 3QFSA 1YONA 3UUWA 2XB2A 1J8QA 4YCSA 4IEFB 2O19A 1TIKA 4TLCA 4C87A 2PMKA 2C07A 1Z28A 1S3IA 5A7HA 4YJHB 2RKOA 2X5NA 1R0CA 3G88A 3GLHB 3VKUA 4Z51A 1Y4DE 2FWMX 4KQXA 4LNHA 1WXGA 2LDBA 2WU0A 4GUAA 1M2NA 3K7EA 4D5GA 1ZIPA 2VH2A 3W5HA 3AVVA 2CLDX 2QTVB 4GSKA 1ADBA 4IMPA 4GR5A 2QBYA 5EG5A 1JLMA 2QZ4A 3E1KA 3AEKB 4XSGA 4D44A 2FP3A 2D5AA 5B1YA 5JNSA 4G65A 2DHQA 1NW5A 3GAZA 3SKYA 2ZB2A 5HM8A 1P39A 1VI2A 3DYIA 3KAQA 3X1WA 5IHPA 1H85A 3DZJA 1PR0A 3L8ZA 2AMJA 4R98A 4FB4A 5JOQA 3BMNA 3GFQA 3LP6A 4PZDA 1AKMA 3DBOB 3NHKA 3C5CA 2OB1A 1DELA 4N3CA 4HDNA 4YECA 1T9GR 2BJHA 4F8EA 3CW9A 3O94A 1UBJS 1QZUA 5DDIP 5EEGA 1VP9A 3ZGOA 2ZSIA 1HV8A 3ZYCA 1BWSA 4AULA 2FG6C 3DYVA 3M3HA 4YXWA 5LOVB 1CY7A 5LQUA 1XV5A 1B93A 3AJRA 3FSGA 5L4LA 2R8YA 3GLQA 3I1JA 1VE3A 4GMKA 4H7KA 4KE9A 2SCUB 3OQMA 3WLQA 1E0JA 1H66A 1P9LA 4WXPA 2DAPA 1RWPA 4K6OA 3ZOZA 5A03A 5B6PA 3D6FA 1J5EB 3K0AB 1N0WA 3F67A 5CHEA 4DWOA 4PLFA 2VNIA 4EKNB 5ECWA 5C53B 4AJEA 2QJOA 1FFXA 4B2YA 5I3ZA 3KDSE 2GAIA 2QIOA 3ONNA 4CTJA 2NSDA 1QHFA 4JHXA 2FWRA 1VLQA 2NYRA 3HPQA 3P9YA 4UNSA 3WL5A 2F4VB 3CG0A 1VOTA 3DUWA 4P80A 2X9QA 5DRYA 1SC6A 3LAWA 3NWOA 2Q3EA 3QWFA 1HEUA 4M1QA 3ZE8A 4YAKA 4AY6A 3CC8A 2D7DA 5K9ZA 1XN4A 4G1FA 5FT9A 1ZK0A 2CV2A 4V0MA 2GRAA 3TQFA 5LXTF 4RKRA 3PWSA 3NVAA 1L3BA 2XUFA 1N8SA 2LVBA 2CDAA 2H0AA 3LDFA 3LOPA 1BYUA 3DS8A 1W9HA 4L07A 3LD9A 4MR7A 1E32A 5DI3A 1Y4ZA 4KC0A 4HGYA 4TUYB 4D9JA 5CXQA 5KYTA 3KYIB 4G5FA 2FXIA 2I4RA 1Q22A 1NF9A 1HL7A 1Q84A 3NXSA 3R6TA 3TMYA 5BV0A 3F3KA 4L76A 3CR8A 2PSHA 3D8TA 4D9EA 5BXQC 2J6IA 2IEZA 4LYFA 4EJMA 2PUGA 3F4LA 1JKMA 2PRSA 4HADA 1JR3E 3SX2A 4ZI2A 2GN1A 4OAOA 2O59A 1GITA 3CX8A 3G2QA 3EEFA 1XMXA 2VDVE 5G0SA 3DL2A 4KR0A 2LKCA 4CQMA 1WHSB 1XNQB 1L4LA 4B8YA 5LYYA 4DLNA 3QIAA 3AKEA 1VIYA 3I39X 3W05A 2MU1A 3OHSX 3H6HA 1THMA 3TRFA 3HYCA 4DC0A 3AR4A 3IP9A 4XW2A 5BMOA 2YHUA 1U7WA 1ZR4A 3DKRA 1CQXA 5F64A 4K3UA 4X8LA 1BFUA 4CMKA 1CV2A 1JS1X 1XZFA 3K9NA 3BMXA 2WM3A 2ZR8A 3RHFA 3T9BA 2XCTB 3PDUA 5LD2C 2IHBA 2O6HA 4RZ2A 4X1KB 2HYDA 1WMDA 1IH8A 2MR5A 5K09A 1WB4A 4IQGA 3U0BA 2FPGB 4FI3C 1T8SA 2Y99A 4G6ZA 5HW0A 1BJKA 3NHBA 4MHSA 1BS9A 4A0SA 3DWGA 3TI7A 5EGNA 4PFSA 2ZT8A 3A6GA 1NP6A 2YHSA 3D6AA 2X0EA 1UINA 4P3YA 1A9XA 1NTRA 1Y0BA 2BUCA 3PFIA 4N01A 3MRXA 4Q3EA 4LYEA 4DGSA 1GGJA 1F5SA 3DTNA 4G2NA 5EQFA 3EF0A 4C4ZA 1JLRA 1RXIA 3Q9UA 3SS8A 4R2HA 4UMEA 5COAA 1D0VA 2YUIA 5M29A 2JGEA 1SCNE 2CHQA 2HF9A 1H94A 1XJCA 2FSSA 2JBAB 2YHAA 4GRAA 4IOKA 1WVIA 2Q5IA 4XD2A 2QTMA 2EW1A 3IHTA 4R4JA 3DLCA 3NBQA 5D8DA 1F06A 4ERNA 1PVOA 5C3UA 3ZHYA 2ZIXB 4UBOA 2BW0A 1CZHA 1QCZA 1QIJA 4P81A 2Y71A 2B1RA 4LRXA 1NR5A 1HOXA 4I19A 3GFOA 3DTVA 5GGYA 4NJOA 1KY3A 4NU8X 1I5OA 1Z0FA 4QXOA 1VXOA 2QDKA 3QVJA 4ROSA 3T41A 1FVXA 1HDZA 4U9UA 2PSSA 4G0WA 4PG8A 4CCYB 1L6RA 3C45A 3PWTA 5C1OA 2CJPA 1UMDB 3IEUA 1U65A 1DADA 3CWZA 4JB8A 4W9RA 1LFDB 3V7NA 1IN6A 3NHSA 4GOXA 4AN0A 3QLVC 5EJAA 2ZREA 3KQWA 4AWXA 4Q4HB 4QHTA 4NXNB 4XIJA 2CLLB 4ZPJA 3S1AA 1ZMXA 2GARA 2GYWA 1DJLA 4MP6A 1YOVA 4RH0A 1Z0ZA 4MQFA 1PJBA 1T6ZA 3A0UA 3E3OA 3NEJA 1P0CA 1Z0DA 2QLTA 4JD5A 4P5EA 3SIRA 4E08A 4XM1A 3I12A 4Q6BA 4B3BA 1QLHA 1I32A 1MB4A 2JVKA 3Q8WA 3B20A 2O8NA 3I32A 1C4OA 5EGSA 3KKNA 3FOWA 1VIMA 2Q0HA 1P9WA 1U2EA 4S0ZA 2J9GA 5ER6A 2VLIA 3UB3A 5A5GA 1EXMA 4LDRA 5CDUA 3U7QA 3EVNA 1H1LB 2D74A 2ODQA 2NO5A 1DO2A 3VQTA 4F9TA 3GRPA 1WVGA 1KFJB 4XSHA 4B3HA 3VR3D 1EUCB 1HI9A 5SYAA 4ZYLA 1OXKB 2FWAA 3AWDA 3EZYA 3AF6A 3HZHA 1N0UA 2ENUA 4F3KA 4L85A 5C51B 1ZJZA 2WR8A 3MHTA 1DBVO 2ECKA 2XCOA 3DCJA 1J39A 3GMDA 4L6IA 3GN2A 4GPD1 4TLLB 5KWJA 1DXOA 3F97A 4J43A 4WH0A 4UNNA 5D87A 5KTPA 2C4TA 3P4UA 5K0ZA 5L7TA 1LZLA 2FETA 3IOBA 3L6EA 4BEWA 4HLNA 5HF8A 2RCYA 4QBIA 4U7PB 5D3MB 1M75A 4P34A 3HXKA 2A78A 2W90A 3VJLA 1S2OA 5U1PA 5DN9A 1LJLA 4K5QA 1LPOA 3M81A 5AMXA 1M8JA 3RASA 1TMYA 1V35A 3KTAA 4IYRA 1OU4A 3RRMA 5AVUA 4UD2A 1T4CB 2VHYA 1K7XB 2ZDQA 2JL1A 4ENPA 2ZT7A 221PA 2X2EA 1N57A 1Q7TA 1DC7A 3BE5A 3C98A 4UUPA 1NURA 1FDTA 2DBVO 3HV0A 4XYLA 3BYZA 4B43A 4P2GA 2AEMA 2B98A 3K2BA 2WWHA 3CONA 5AUQA 1USUA 4U3JA 3WZ2A 1IIRA 4C4XA 1RWXA 5JCZA 5EJ9A 4N65A 2ZCUA 1GA4A 1H0SA 3HKDB 4NMWA 5DOZA 1BKSB 2VPZA 3DJFA 4FHGA 4HQRA 1LSUA 1Y1TA 3OAAD 2RHBA 5TDHA 4B5LA 1E96A 3EPHA 1TJ4A 3SN6A 1N9ZA 2LD4A 2O48X 3A1VA 1T2EA 4PV7A 4RV9A 2XWBF 3BXZA 1Z17A 4YT4A 4DMLA 4GD3Q 1GTG1 3NKFA 3UB2A 2GFHA 5F52A 4ZGBA 4M76B 1N1MA 3AQIA 4MKHA 1WUHS 5DM1A 5NULA 5TB5A 3ZVMA 2X4IA 3SSNA 2JD0A 1PJAA 2F3TA 1GCIA 4G85A 5DOVA 1W4RA 4WL0A 1HEIA 3D0OA 4LCBA 1M1ZA 2ID7A 4MI9A 2XNDA 1EWYA 4TYQA 4P6VF 2VOEA 1RS0A 3VX4A 1FTQA 4JXJA 4DUPA 3SOPA 4B6QA 3U7GA 4MQEB 4O63O 1V3QE 1R8SA 5CYPA 1EK5A 1WDKA 4NFYA 4BNJA 1X9HA 2WWFA 4RK0A 3LC1O 1VJGA 4K3VA 4NATA 2X0DA 5CVTA 5KYGA 1YUBA 1ZM9A 4ZMRA 4P93A 3KKMA 4DPLA 1J8YF 3WWOA 4EI2A 1KZ7B 3CX4A 1N7GA 1Q0UA 4RVDA 2GYYA 2MTBA 1OAAA 1IB0A 1VE6A 1VA5A 1YNSA 2R1TA 2RHDA 4OLHA 1X7GA 4G0UA 1V5GA 4U2CA 3EMVA 3OQ6A 2VXBA 3HE3A 1JZSA 5KVCA 4LISA 3G2JA 1Q12A 3AY0A 4RMJA 4FD3A 5LMNB 4NBLA 5FNZA 5F2NA 3N2KB 2JIZD 2Z6AA 2ZJ3A 5FUXA 3HVUA 3FYDA 4GWLA 1EWRA 9MHTA 3AJDA 1A4RA 1HT2E 4ZRNA 5H82A 1KSHA 5KJ1A 1MIHA 2B8EA 3PU6A 3RDPA 2RGEA 4CF5A 5B58C 1UMBB 1QRTA 4RCZA 1W76A 2QW1A 4U7DA 2EV9A 2P5TB 2Q3FA 5DLDA 2YZ2A 3I9FA 1K89A 1LPBB 3H5AA 4HQ0A 3EEQA 3MRTA 1GTZA 1R18A 4GEKA 1M8GA 2YVAA 4HYQA 2HA3A 1P2FA 1QGUB 2ZQ5A 3RVPA 4AECA 2W2KA 1M1YB 4BQEA 3RTBA 3LXXA 1R3UA 5JH7B 4TLMB 2EU8A 4IGKA 3K4QA 4E32A 4NZPA 1RQPA 3JYQA 4K1LA 1LS6A 4XPIA 1NBMA 3TRKA 5JADA 1YBFA 1BO6A 2QNIA 2A9RA 1V3UA 4J75A 5THKA 4B3IA 1U2SA 2CK3A 2PZEA 3OQPA 4YJ3B 3VR5D 5A0VA 5GIPE 3KUUA 3R9WA 1IHOA 1P7VA 2ZU6A 4C7XA 1F0KA 1N2GA 2DVMA 4GE3A 5B7QA 4PSKA 1DAMA 5ANRB 4X6XA 2UVPA 1F4LA 3R41A 3UBMA 2IU4A 1U9IA 3TLGA 1UOOA 3F8TA 1U7ZA 4BB0A 1KJYA 1TO2E 1TC1A 2RGXA 3ZY6A 4BN5A 1PYGA 2UUCB 2KJQA 4TWBA 1DCTA 4TQ9A 1Z8HA 2R1VB 2XWQA 5H02A 2JS7A 2WTUA 3LGSA 1SUWA 3STTA 2JAOA 2Z09A 3I73A 5T6MA 3TTVA 4NMLA 5C8ZA 4DKXA 5HZGA 2BN4A 4E03A 3BGWA 1KGSA 4L5IA 4KIJA 1QYRA 4M7WA 3VDXA 3ZD9A 4X20A 1NHWA 4KFTA 4MVWA 2G07A 2OC9A 4NICA 4FEAA 4PLTA 1QSGA 2GD2A 3UOAB 1PTJA 1KJ9A 1OFVA 1QOQB 4BZQA 1IVSA 1US8B 3IHWA 2IHVA 2P3LA 2ZWOA 5AICA 3GD7A 3STVA 1JHYA 3T4EA 4ETWA 2AFIB 4CMAA 1SAYA 4L8FA 4HAVA 2X7HA 3MUOA 1D1QA 3PC3A 4YALA 5DWDA 2AOUA 1PX0A 3AF5A 5FWXB 2HF2A 5KAPA 1Q3KA 1NWHA 1H0HA 4BO1A 2ZITA 4RAQA 3ZNPA 1QHGA 2P65A 2QMHA 3CKKA 3MZ0A 3P26A 3EGCA 5EWMB 3I5MA 3GMSA 3KTFA 5J4KA 5D84A 3I58A 3GCZA 4EG7A 2FR8A 1NUAA 3OKAA 4JQOA 3SXUB 1IN1A 4RZQA 5CAEA 3A58B 4HQ6A 1Z33A 4UVDA 1P1HA 2IRWA 4CT5A 1I4WA 4Y1RB 5JD4A 3BRWD 3H5LA 2X15A 1V26A 2HUPA 3HP4A 3IQGX 4MW6A 5KQPA 3CS3A 2BRUA 2W11A 4HF7A 5BPHA 2OCXA 2PS3A 3KJHA 4R5MA 4JOBA 3ZNQA 2ES4A 4QUIA 3RRXA 2OBXA 1NP3A 4MSUA 4QDJA 1UWKA 4KXNA 2OQRA 2W98A 3AU8A 4RLSA 1W8IA 4XD7D 4C0SA 5LM3A 3LFTA 4YAOA 4DWWA 4MP8A 3HDVA 4BB9A 5D7BA 3GDWA 4IIYA 5B1DA 1U1FA 2F64A 1RRCA 2E37A 1WS6A 1K7CA 5MF6A 3G9ZA 2VTBA 2BKLA 2NZWA 2ZYDA 3ISJA 4CMIA 1X80A 2GBPA 4OGGA 3LKVA 1YJQA 1V37A 2EP8A 1BHJA 2GR9A 4XLTA 1YJCA 1P2VA 2VLBA 2YN4A 3N0VA 4RYDA 1DOHA 3WB9A 3WRYC 5KYXB 4DV2B 1VPWA 3V97A 3H2KA 2ICAA 3B8HA 3WP1B 2PRJA 3ZJ5A 2HWYA 2Z4RA 4YRSA 2AOTA 2BFDA 3B1XA 4BUJA 1SCQA 3E7FA 3I2IA 4H18A 5J4LA 2I6XA 4UHHA 2X41A 1YXMA 1HFEL 1MC1A 3DZHA 2ZIAA 2ZUVA 4J6EA 4NJMB 4RD1A 4IDPA 4NZ9A 1I9CA 4PG5A 4HDKA 3OX3A 5IRCD 4D3DA 4CN8A 4M8KA 3DD1A 3PRJA 1A72A 4C0JA 5JSZB 4ZKDA 2AOWA 1ZOSA 4CNQA 2QTBA 2OLKA 5IM4F 4H4EA 2IYAA 4MV7A 3NNSA 3A9UA 4WINA 4OK3A 3T0GA 2F9MA 3STWA 1AGPA 3S2YA 2C00A 1I80A 4MRMB 4R0VA 2A5DA 5IASA 4KBGA 3IEKA 5COBA 5JRJA 3CH4B 3AYXB 3TMAA 4F8JA 3WYAA 4YPVA 2EZ9A 1NQXA 4RHYA 4C0LA 1T1SA 4EY7A 5BP7A 1CR2A 5AJHA 2OCKA 1K97A 4EAAA 4YAUA 2OOSA 4PG7A 1I3KA 3GP3A 3N1UA 4H7JA 3B38A 3D7NA 4YQZA 1HK7A 2JBWA 4XQGA 4EPXA 4KTVE 3PZRA 1THGA 3OZWA 4OGKA 5I4BA 1HKHA 4M38A 3F9CA 4MS3B 1Q7BA 1KH2A 4PYMA 5DSZA 2OZEA 3IPXA 4MW2A 3SM9A 4BP8A 4EMSA 3GLIB 3B7GA 1QFJA 4AI6A 1WWKA 2Y1DA 2VYFA 1Q2UA 1XDDA 1CTQA 1WHTA 3ETDA 1DTEA 4KG7A 4LCEA 5DHTA 2H92A 3QTLA 1PW7A 1Q92A 4DJTA 2MYUA 5FHRA 1TAUA 4AG5A 5GJBA 1BC5A 2G63A 3R75A 1B42A 2H1IA 4NJEB 4HVCA 1JVSA 1IY0A 2EC5A 2XMZA 5TMDA 3ADOA 1UZAA 4JELA 4TXHA 1R6BX 3OFKA 1GKKA 5CDHA 5K6RA 4CIXA 4ZO4A 1JSRA 1XPUA 5IDXA 1R00A 5EIEA 3KKKA 5LQMA 1WSWA 1P0IA 2J9FA 5BWCA 5L40A 4G8CA 5CLHA 2OCAA 4EW1A 4BLTA 2GWHA 1QX4A 1NW6A 1Y3BE 2ZWMA 3M4XA 4KU4A 3RWOA 3C97A 3VH4A 2FJPA 2RHGB 4OQYA 1FX1A 1S7CA 1VJ5A 3OJLA 3U4CA 1R0ZA 3QXHA 2BI4A 2VRCA 3L6OO 4GX1A 1C30A 1NX6A 4RK5A 3QU7A 2GERA 2Z8ZA 3OE7A 4P9NA 3L6DA 2I6UA 4JX9A 5ITZA 3JQFC 1NQ5A 2WYVA 1CF2O 1PUJA 3P9KA 4UAJA 1P77A 2Z4TA 4ARZB 3ZWOA 4LYJA 2O8FB 4PLWA 2PBFA 2AN1A 5K5EA 5DT9A 3CTMA 4D99A 1LTHR 2H4WA 4II2A 4N3NA 1YBVA 2ONYA 1S2LA 3SYTA 2JKYA 2WYIA 3SSAA 4MUHA 1AOXA 3PC8C 1GARA 1J8FA 4GLBA 1M2OB 4GPZA 1OD6A 1Z35A 2HMVA 2H1HA 3T7SA 2Q3MA 3VI3B 2HIHA 4DAEA 5LL6P 4C3VA 3CXUA 4OTZA 1IY8A 4A2CA 3CHYA 3OWHA 2HHLA 4YCDA 4CG3A 5KINB 1WY5A 2QD1A 3EAFA 1MW9X 5C8XA 3K0EA 2YX1A 3TM5A 1KA9H 4PYOA 2FPXA 4IJ5A 1JFLA 2DUWA 1SBHA 2AVNA 3BICA 3ASZA 3HBNA 2BMEA 1MFPA 2VR1A 3H9GA 4WN9B 5GM2A 3VHQA 2JEYA 2PZKA 3AK4A 1JFTA 1ZA2A 4HAWA 3QU2A 2XCRB 3AZOA 5I7RA 5I9NA 4DNOA 2JJMA 1GNTA 4KK4A 1SM4A 4Q82A 3ZDBA 5IT9A 4XVQA 4N82A 3P9SA 4ZEXA 4JIMA 3LA8A 1XAGA 2O14A 3JAMA 4F4HA 4HSEA 5JSUA 2VF4X 1VGVA 2N46A 3QJ5A 2O1XA 4OLAA 3KS9A 2B3DA 3UMBA 5JV5A 3NWEA 1YKSA 4LFCB 1J1UA 3N53A 1UT8A 5LN1A 1VSVA 1N5LA 2PT7A 3K92A 1NRIA 3L5KA 4PF1A 2J31A 3EGXB 1BCRB 2E5WA 5IBQA 2O7VA 2Z57A 4PIPA 5LJLA 2CL0X 4H7EA 3UAOA 3DGFC 4MS1B 4G37A 1LWNA 5MFZA 5IVDA 3EISA 3PFKA 1FNMA 3JARB 4K6MA 4YRMA 4UU0A 5CCEA 2P2CA 1C1YA 1E98A 4LG1A 5BSWA 2JGRA 3FTNA 3K1ZA 3LECA 4HRVA 5IJWA 1VIDA 1BD4A 2LP4Y 4JA0A 5DTEA 4BN0A 1OZFA 2XUQA 3R3WA 4ZVMA 2NPOA 4ZN6A 1KVUA 5B4TA 2QHXA 1YU9A 2Z8YM 1TEXA 5FUVA 2GTHA 1JAZA 1TOAA 1XPJA 3OZSA 1KZGB 4G56A 4NARA 4LPKA 3KKPA 4BWYA 2WA2A 1N2JA 4F6LA 5AD1A 4OHWA 3AHJA 5BQPA 1QNFA 5G53C 5C34B 4Z4HA 1Z6AA 2Y1XA 3OQIB 5IC5A 4V1CI 3FY4A 4IVPA 3SC3A 4XUEA 4DRXB 1KEEB 4MR8B 4K9LA 4M8SA 4DF3A 3PRYA 4DJDC 4MTLA 3S29A 1SHUX 2HWWA 4F21A 1PWYE 1QYCA 3VU8A 4DDKA 5EA2A 1O0BA 2DULA 4BZXA 1NPDA 1KIFA 3BWCA 4KWTA 3UGJA 3M6UA 1A69A 5CB4B 1P75A 4QHSA 3BE6A 4M8LA 3AM3A 1MEJA 4BCCA 2PL5A 3TOVA 4GL2A 2DWQA 1Y6RA 3MLAA 1QH9A 1SOMA 2AR7A 3EG9A 4XLLA 3I5UA 2MSWA 3W6UA 4EI7A 1RQRA 2DJ5A 3OOYA 3RS4A 3TUJC 4A6DA 1EPUA 1HDYA 1GZ4A 2B0CA 4XWTA 2FW0A 3QVGB 1TM4E 1UPUA 2JKZA 1JP7A 1YDEA 2J5BA 1XDWA 5IDYA 4CKWB 4IV0A 3FI9A 1H22A 1CQJA 1IC6A 2NTVA 3GRCA 4JXXA 4EUEA 3ROPA 2X3UA 4RX1A 1U7DA 3HCNA 1FNCA 1UOEA 1M6HA 1PLJA 2DE0X 3IKJA 3R5FA 4EGJA 3UMFA 4BV9A 4EG0A 1KQ3A 4Y1FA 1ZDMA 3MPOA 4C4AA 1ZK2A 3LYHA 4FBGA 2K7FA 2YWJA 3WYGA 2E6KA 5JZ9A 2KI5A 3DO5A 3H4IA 2A35A 2CYBA 4J0JA 1NBIA 1VLZA 4ALMA 5MN5A 4EHJA 1G19A 3LYUA 2P2YA 4NBTA 1G4HA 3DL0A 3K8OE 2WT9A 5ICSA 4DLYA 2I6GA 4ZOQI 5CIWA 5EZYB 3E03A 2WFLB 3GUZA 2FFAA 1CLUA 2YJGA 2X86A 5TPWB 4BNZA 4GM1A 4D3SA 4R8KA 3FF1A 4YP5A 3UTCA 3IP3A 3PICA 2OPHA 3E3MA 3QTTA 1IY9A 4H7HA 1O95D 3SQXA 2HSWA 2PH3A 3QXGA 3ILXA 3THYA 2R44A 3ZH2A 1U3VA 3DDWA 1V1MA 1T10A 4G8BA 5CX1A 1YF3A 4XX0B 4H77A 5GOZA 1NOKA 2EWWA 3KU4A 4OJMX 3IV6A 3FFBA 1EUZA 4LV6A 4NL4H 4NFLA 4I8DA 2V6FA 4OYYA 4D3ZA 4UEKA 5ESXA 1UBUS 3HJCA 5C8YB 2W6ZA 2O8DB 3PFGA 1RLUA 3Q7IA 3D8HA 3L79A 3Q7TA 2QR3A 3IKLA 3FZGA 4KO8A 4CIYA 1YJ5A 3OLZA 1U5CA 3PT9A 4M1ZA 5L3VA 1F2VA 1VLJA 4QPNA 4H7PA 1L7PA 5D6NA 1GUYA 4G0OA 4BEVA 4A6PA 3L05A 2WWVD 2IUSA 4Y2SA 4GOMD 5HKBA 3L8HA 5ITSA 1I2BA 1MPTA 1ABEA 1CKEA 2COUA 2PCLA 1L8OA 2C77A 4P82A 1XVTA 1RZ3A 4HRYA 5DVZA 2E85A 1G291 3K72B 1B1AA 4D80A 4PLZA 2ATIA 3KLOA 1NVVR 1QWSA 3VAZA 3ENZA 3PGLA 1NVFA 4GX5A 3FBWA 4JI5B 3LT5A 3UJ9A 3T5AA 2F1KA 2Y6UA 4HAUA 4N0EA 5FPSA 3K9GA 1MJGA 2VAWA