3E05A

Crystal structure of precorrin-6y c5,15-methyltransferase from geobacter metallireducens gs-15
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
191
structure length
188
Chain Sequence
QYPVIGIDDDEFATAKKLITKQEVRAVTLSKLRLQDDLVMWDIGAGSASVSIEASNLMPNGRIFALERNPQYLGFIRDNLKKFVARNVTLVEAFAPEGLDDLPDPDRVFIGGSGGMLEEIIDAVDRRLKSEGVIVLNAVTLDTLTKAVEFLEDHGYMVEVACVNVAKTKEYKMFESHNPVYIITAWKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title CRYSTAL STRUCTURE OF Precorrin-6y C5,15-methyltransferase from Geobacter metallireducens
rcsb
source organism Geobacter metallireducens
molecule tags Transferase
molecule keywords Precorrin-6Y C5,15-methyltransferase (Decarboxylating)
total genus 56
structure length 188
sequence length 191
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.1.1.132: Precorrin-6B C(5,15)-methyltransferase (decarboxylating).
pdb deposition date 2008-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3e05A00
1YZ3A 1P91A 3BWYA 1ORIA 3SSNA 1KR5A 2HTEA 4U7TB 2Y1WA 5D1NA 5CCBA 3ELUA 1JTFA 1UFKA 3VYWA 1R18A 2YTZA 1KHHA 2VS1A 5CD1A 4FT4A 5KQRA 2PLWA 3FUXA 4XUCA 5EHGA 2PT9A 2ZZNA 5IKMA 3FRHA 2N47A 1D2CA 3R3HA 1RJGA 3OE5A 5T6BA 4C05A 4PIPA 2ZIFA 4LG1A 5DRTA 2C7PA 2P7IA 3O4FA 4LWPA 2PWYA 3KU1A 1L3CA 3DMGA 2FK7A 4PYLA 1O9HA 2WA1A 4H0NA 5DM4A 4CKEA 1HNNA 2OY0A 1YB2A 2KW5A 4Y30A 1MJFA 4BLVA 3M6UA 1XCJA 5CVDA 5CVVA 1Y8CA 4X1OA 3V8VA 2R6ZA 2BR5A 4C06A 5GINE 1FBNA 3KKZA 5E1OA 2HV9A 3PX2A 5T64A 2E5WA 2GLUA 3EVCA 3DLCA 3HCBA 2XYVA 5HILA 2EJUA 2I9KA 3PLAE 4R05A 4X61A 1N7IA 2GH1A 3G5LA 4QTUB 4KRGA 4E2YA 1NT2A 3JWGA 2AZTA 3DUWA 3M6VA 3IHTA 2P1DA 2JHCA 3DH0A 3ID6C 2UYHA 1NW7A 2CMHA 3KR0A 1WY7A 2H1RA 3FPEA 1XJ5A 5GM1A 1QZZA 2F8LA 3DMFA 2ZWVA 3AWIA 5GP1A 1Q0TA 2C7OA 3T7SA 1DL5A 1VBFA 1R6AA 2B2CA 1JG2A 3KQYA 2P3LA 3OPNA 5LQUA 1ZG3A 3OU6A 4HGYA 1B42A 1KPIA 1KXZA 4QQKA 5FTWA 4WXHA 2CMGA 3FRIA 5FHQA 3RODA 8MHTA 2GB4A 3LBFA 4PYOA 1QAMA 3LSTA 3BWMA 5GM2A 2NP6A 4PWYA 3LL7A 2P3QA 5EG5A 1L3IA 5DSTA 4GQBA 3TM5A 5LQKA 5FULA 1NW8A 5E9QA 4RTJA 5FA5A 3P97A 3L8DA 1G55A 2FHPA 2ZFUA 3QV2A 3NWBA 4HG2A 4F86A 4C04A 9MHTA 5K8VA 4MHTA 2ESRA 3JWHA 4C4AA 1VP3A 3CKKA 3SMQA 3KR9A 1NBIA 4RWZA 4OBWA 3T7RA 5LQJA 2H00A 2PX5A 4HTFB 1H1DA 3UA4A 4RTMA 5EEGA 1WXXA 4R8RA 1XVAA 3CVOA 2AVDA 4OBXA 5K03A 3EVFA 2B25A 4GF5A 3JWIA 4P7GA 4RVGA 4QVGA 4NECA 2QYOA 4YUZA 2ZIEA 2OZVA 3B3FA 3CBGA 5FADA 3I53A 3FPGA 1RI2A 2ADMA 4M36A 4PYKA 2FCAA 5BP7A 3KR1A 2WA2A 4YUYA 1Z3CA 3NDIA 2G71A 5HIIA 4YUWA 1NKVA 4HRAA 3UZUA 3BKWA 4RTNA 3FUVA 1XDUA 3GRUA 2AOVA 3SM3A 1KP9A 2ZZKA 3HCAA 1PJZA 4OA8A 4POOA 5K01A 5HEKA 10MHA 4PYMA 1R8XA 3R9XB 1G60A 5KYGA 2YR0A 4ER0A 3Q87B 1DCTA 1ZHFA 4AZTA 1RJFA 5DSXA 2PSSA 3TKAA 2GAFA 3EGIA 4P7FA 3KPYA 3M4XA 5C1IA 5CVJA 4A6EA 3REOA 5K09A 2IDJA 2ERCA 3P71T 1EQAA 3G88A 4DF3A 5EVJA 3VC2A 2VDVE 3OZSA 5EMMA 3G8AA 2IH2A 4OX9Y 3KQWA 4EKGA 4QQNA 3TLJA 1OR8A 2ZW9A 3BUSA 4GOOD 3TOSA 3UFBA 4BP1A 2NP7A 3SSMA 1P1BA 3ME5A 2XBMA 2ONYA 2ZBPA 2O06A 1EJ6A 2Q41A 3K6RA 1JG1A 2QE6A 3KPVA 4PONA 5FWAA 3UJDA 2GPYA 4QDKA 2ORED 2PJDA 1RI1A 3FPHA 2PX2A 4DKJA 4PYNA 2AOTB 2WK1A 1MHTA 1WZNA 2ZULA 4GC5A 2I62A 3EMBA 2PY6A 3QOWA 3TKYA 2YQZA 2JH9A 3GWZA 3I64A 5EKXA 3FZGA 3HEMA 5EOVA 5ERGB 1M6YA 4YV0A 3BGIA 3P2KA 2IPXA 3AY0A 3TPZA 3UJBA 1WS6A 5DX1A 3M33A 5EHIA 5C9ZA 4RTSA 4DA4A 3VC1A 1RJEA 3PT9A 3NW9A 5DTMA 2PVCA 5GIPE 3OE4A 5DM0A 2AVNA 3KPWA 4EQZA 2HWKA 1U2ZA 3EVAA 4GUAA 3LKDA 4IWNA 3LHDA 1G6Q1 4MIKA 4C07A 2ZTHA 1XDZA 3DXXA 5EIWA 2AOUB 2PXXA 3CJTA 3KQTA 5ICCA 5KQSA 3A27A 1YFJA 4LECA 2UZ4A 3MERA 3MTEA 4PCAA 3G7UA 4MWZA 1JQDA 4PNEA 4GOND 3UJAA 1JTEA 5FA8A 4YUVA 2NXJA 4AZWA 3DULA 3ELYA 2OYRA 3I5UA 2YXDA 4GEKA 1WG8A 3NDJA 3PB3A 5FHRA 2HR1A 3NTVA 4DQ0A 1ZGJA 5E1BA 1P1CA 1YF3A 4CTJA 3NVMB 4FP9A 4X41A 4BLUA 4R8SA 2AOTA 5DRYA 3P9CA 5EGSA 3HVIA 4E32A 2ZVJA 5C0OE 3UA3A 2G8NA 5K0NA 5FQOA 1O54A 4OQDA 1SVUA 1XTPA 4V0QA 3UJ9A 2K4MA 2ZWAA 1QANA 4PGGA 5GWXA 5DT2A 1NW6A 4EKIA 4CKBA 1KIAA 4HC4A 5DTRA 3EEOA 2PXCA 3FTFA 1RI4A 3DOUA 3FTCA 1L9KA 2G72A 1NV9A 1VLMA 1X1CA 1XDSA 3CCFA 1SUSA 1BC5A 2QM3A 3HVHA 1G8SA 4IKPA 5FCDA 3EVDA 5ICEA 3PS9A 3GCZA 2FYTA 1I4WA 1INLA 2O57A 3HCCA 3GRZA 3RW9A 2P40A 5E9JA 1O9GA 5G02A 4MTLA 2B3TA 4RYLA 5E1DA 3HTXA 1IM8A 2I6GA 2NXNA 3BGVA 3LKZA 3PFHA 4X60A 5DM2A 5CM2Z 4E2XA 1T43A 2PX4A 1IY9A 2P35A 3G2MA 3G2OA 3P8ZA 4KDCA 2BM9A 2NXCA 3B7PA 1AQJA 1G38A 2IH5A 1KYZA 4FGZA 2HNKA 2CWWA 2IP2A 3K0BA 1RJDA 3LGAA 5HIKA 1TPYA 4BP3A 5K0FA 5K05A 4EK9A 4GC9A 5U4XA 4E70A 2DULA 1DUSA 3QOXA 3UJ8A 3P9KA 4M7RA 3G2QA 3EVZA 2B9EA 2UYOA 2AOWA 1L3BA 4GBED 2ZCJA 2AN5A 3LDGA 4KW7A 4AX8A 3FUTA 4ER3A 2CL5A 3BWBA 5K0EA 4R6WA 3SR4A 4DM3A 5E1MA 3UJ6A 4EVIA 2AN4A 3LBYA 4A6DA 4C08A 3B5IA 3KQPA 3C6KA 5CVEA 2IBTA 4YUXA 1BOOA 3R24A 4PINA 3DP7A 3U81A 5KS2A 3VSEA 3I9FA 4R6XA 5EZQA 4HH4A 3GO4A 4YMGA 4CTKA 3OZRA 3SX0A 5FUBA 4AZSA 2V7EA 2ZSUA 5ICGA 1FJXA 1VL5A 3ER9A 5DPMA 1FP1D 1NBHA 2EJTA 3FTDA 3ELDA 4ZTBA 4E33A 1AQIA 4U7PB 3MQ2A 4RTKA 4X63A 4PYJA 5DLYA 4P58A 3HVJA 2A14A 2Z6QA 1VE3A 2C7QA 1M6EX 2BM8A 4KWCA 5EZSA 1IXKA 5MHTA 4YMHA 3HCEA 4LWOA 2O0LA 2P8JA 1UWVA 2G70A 1ZGAA 2PGXA 4FS8A 5H02A 3OCJA 4AUKA 4CKCA 3UBTA 3E8SA 2IH4A 4RV9A 4FR0A 1XXLA 1NW3A 3HP7A 2H11A 3IYLW 3MCZA 3E7PA 3P2EA 3TFWA 3UWPA 2I7CA 1VIDA 3SGLA 3FYDA 3JWJA 3RIEA 3HNRA 3ER8A 3TRKA 3GRYA 3EEYA 1V39A 2OBFA 3DLIA 4AZVA 3FUWA 3E05A 3G5TA 1TW3A 4GOLD 5HFJA 3GIWA 2JG3A 4QTTB 3PVCA 4ER6A 4DZRA 4DCMA 1Q0SA 3T7TA 3T0IA 5M5BA 3BXOA 3NWEA 2NYUA 3BZBA 1R74A 2Z6AA 3HA5A 3MHTA 2QY6A 1X1DA 2BR3A 4KIGA 2OXTA 4M37A 5DTQA 3FYCA 1UIRA 3EGVA 3SVZA 1I1NA 1XCLA 2VP3A 3C6MA 3O31A 4RVHA 4RVDA 1R00A 4O29A 2XVMA 5LQNA 2YXEA 3B89A 4G56A 3TQSA 2ZZMA 1X1AA 4RX1A 1F38A 3HM2A 2IDKA 1PRYA 5LSAA 3GJYA 3GRVA 4V0RA 1YZHA 2BZGA 3BWCA 3ERCA 2AN3A 4PCLA 5K0GA 1RI3A 3GU3A 1VQ1A 3I58A 3EPPA 4MQ4A 4Y2HA 2JH8A 2IGTA 2Y1XA 2QRVB 4QPNA 1AV6A 3NMUF 5K0BA 3HCDA 3G8BA 4KVZA 5K0CA 2YX1A 1VPTA 2PX8A 3NJRA 2EFJA 2ZBRA 2XVAA 5EMJA 4DMGA 2FRXA 5LR6A 2XYRA 3R0QA 2PT6A 3C0KA 3OFJA 3OFKA 4ER7A 4DCGA 1FPQA 3GGDA 3IEIA 4E2WA 3PTAA 2VDWA 1KPGA 1TW2A 3P9NA 5EQJB 3HVKA 3THRA 3V97A 4YV2A 3E23A 1P39A 3P9IA 4ER5A 2BR4A 2GA9A 4IV8A 3EGEA 3F4KA 3MTIA 4B17A 3EVGA 5HZMA 1JR4A 3FPJA 2OPBA 4ISCA 3BGDA 5E2BA 4UOEA 4BY9E 3UJ7A 5LQAA 3ANXA 2FK8A 2G1PA 1X19A 2YVLA 1JQEA 2NXEA 3A25A 1AF7A 3LX6A 1HMYA 1QAOA 3MB5A 5EEHA 3GXOA 3O7WA 1FP2A 3HCFA 3P2IA 5K0LA 5P8WA 3M6WA 2YUIA 3MCTA 2YXLA 1SKMA 4IV0A 1SG9A 3KQMA 5GIOE 1KPHA 2JHAA 4QPPA 4FZVA 4WVLA 5DX8A 3WSTA 1JQ3A 3FUUA 2AOXA 4KIFA 5DXAA 1EJ0A 1EG2A 2OKCA 4YV1A 1EAMA 3C3YA 5K0JA 4FSXA 3LCCA 2P7HA 4HGZA 4E31A 2PBFA 3D2LA 3M6XA 3IV6A 3HA3A 3KQQA 3KQSA 3KPUA 1SQFA 4BLWA 4PGHA 4JXJA 2QRVA 1NW5A 3NVKI 4Z2YA 3HA7A 2IBSA 3GDHA 3LECA 1JG3A 5BW5A 3PX3A 2R3SA 3AJDA 5E8RA 2OB2A 1M0EA 1QYRA 3DXYA 3AXSA 3FTEA 3ELWA 4ATNA 1NV8A 4L7VA 5BW4A 4QVKA 3BT7A 5DM1A 2IIPA 4GOMD 3TM4A 1D2GA 2PXAA 3OU7A 4RTQA 4RTOA 4RVFA 2O05A 2ZBQA 3SSOA 2FPOA 4OA5A 3KR2A 4RSRA 2DPMA 5E2AA 4QDJA 5E8JA 5KVAA 1JSXA 5IH3A 4HSGA 2JHPA 3DMHA 4C03A 2HMYB 4XUEA 3GRRA 2EG5A 4E30A 5HOQA 3LCVB 5FQNA 3SXJA 2OB1A 5F2NA 1SQGA 1JG4A 2CKDA 3TMAA 3KHKA 5CUQA 5CCXA 5EIFA 5EKUA 2P3OA 1I9GA 3X0DA 2ZIGA 1G8AA 5FWDA 4KDRA 3ORHA 3M70A 3G89A 1N7JA 5T67A 4CWAA 5LQRA 4RTPA 3H2BA 1D2HA 2P41A 3CC8A 3OU2A 3DXZA 4PYQA 7MHTA 4M38A 5DXJA 3FPFA 4PYIA 4HTFA 3EVEA 4XUDA 2XYQA 3PFGA 1ORHA 2ZLBA 2PV0A 3A4TA 5F2KA 4XCXA 3DTNA 1SUIA 3B3JA 3GNLA 1L1EA 5EMLA 1BKYA 2AOUA 3Q7EA 4P7JA 2B78A 5D1HA 2PKWA 3CJRA 5EC8A 4F84A 5JUWA 2NNWB 5GOZA 2AS0A 3EVBA 1X1BA 3BKXA 3CGGA 2JJQA 5E9WA 3A26A 2IFTA 1EIZA 2ONZA 1NE2A 4FT2A 4E2ZA 3THSA 1QAQA 2AR0A 3OZTA 1JSZA 1KYWA 5CVUA 1RI5A 4PIMA 4F85A 5CIYA 1VP9A 2Z6UA 5BXYA 1BHJA 3R6TA 5B1SA 1ZQ9A 4FSDA 2BH2A 3KQVA 2PWPA 2EX4A 3DR5A 3AXTA 4EMSA 1N2XA 3EMDA 5EPEA 2GS9A 5DWQA 3A7DA 3G2PA 1WXWA 4CXMA 2O07A 4RTLA 4RTRA 3CJQA 3LDUA 4P7KA 4OQEA 2LD4A 1ZKDA 4K6MA 3S68A 5HIJA 2UYCA 1YUBA 2C7RA 1YFLA 1F3LA 5HIMA 5ICFA 1R8YA 3LPMA 3A7EA 5DX0A 5EMKA 3LDFA 2UYQA 3B3GA 3TR6A 2OO3A 3MAGA 3UJCA 5F2OA 5LQCA 3KPJA 3KQOA 3C3PA 3LCUA 3MGGA 2VDUE 2V74B 2VZ9A 5JR3A
chains in the Genus database with same CATH superfamily
2ATXA 3LUDA 5B3LA 2DE0X 5FA6A 5F5LA 2OCLA 2R68A 3L1VA 3EXEA 4B82A 4YWJA 1KR5A 5A0VA 1NM5A 2BE7A 5KKNB 1Y1PA 2P0EA 3HDTA 4DSAA 1KHHA 2G9QA 2PGNA 5L4LA 3AVOA 1T6YA 1VA4A 4M9ZA 1EP1B 2QX4A 4HK4A 1SXJE 5JALA 2B99A 1GSAA 5KNCA 5F7XA 3FRHA 3R3HA 4LRYA 4IXNA 3OZGA 3SDSA 4E7PA 1XHFA 4W5QA 1SPXA 1JVSA 4LG1A 5EJIA 3YASA 2OBXA 3LC2O 1USIA 3ZE9A 1L3CA 5DM4A 4RKEA 3HL0A 5HRUA 3A58B 3NETA 4WY5A 3OY7A 4G8JA 3SCZA 3MA0A 2KW5A 4DQUA 4ZGWA 4D8VA 1U4NA 1CJSA 1YULA 4KUHA 5F5NA 1V3UA 3F8SA 3NHRA 2BEJA 2QG6A 3M2TA 3N8DA 5LBIA 5JHHB 4MWEA 1UXJA 1QG6A 1C7QA 3EXFB 4O4LB 1E59A 5AXBA 2RGEA 5M3BA 1KAEA 2FF5A 3KJIA 4BKOA 2BI4A 2EJUA 3RQIA 5MGNA 1B8PA 2AD5A 2CFIA 1F1BA 4YS6A 5AW8A 5JASA 1JWLA 5F5XA 1E0DA 1B6TA 2PYIA 1AHPA 2AZTA 1VYUA 1XN1A 2REQB 1GRRA 4BO8A 1WEHA 3ID6C 4YAIA 1D6MA 2JFGA 2EQ5A 1NF2A 2H57A 2UAGA 3FPEA 2HA7A 1GAJA 4YECA 1E1QD 1ISSA 1QZZA 1E58A 3ZHSA 1NVFA 4K81B 1ORTA 5JAMA 1WHSA 4TYWA 2XDAA 3PENA 4G65A 4RSHA 5KJ1A 3ON5A 5EZYB 2G8LA 2J48A 1PNVA 2QW1A 3TB4A 1BX3A 4QWMA 3TLAA 4AWAA 1KPIA 4B32A 1C7RA 3I2JA 3QY9A 2BFBA 3W1VA 1G9SA 4KG7A 2GB4A 5GMOA 4C0WA 3R7WB 3BWMA 3FPSA 5HRAA 2PMFA 4TOIA 1C8LA 3ZI4A 4LXXA 3ABZA 2P2YA 5B3JA 2MHCA 4JKOA 4UTNA 3O2NA 5DYIA 5K0SA 3SVTA 2GZ2A 5AW5A 1SCUA 3I52A 2FUNB 3KJXA 2CKMA 3L6RA 3L8DA 4L5AA 3RIYA 1F17A 1ZN9A 3PA6A 3X1DA 3AM5A 4C7BA 2DVMA 2QN9A 1VP3A 2I6SA 2QL9A 4JJ6A 4XARA 4YC7A 4R8KA 4EY4A 3QBTA 4TYYA 3NXSA 2BKAA 4TWBA 5LQJA 3DNFA 2Z0MA 4D79A 4GR9A 2JLYA 3UA4A 1LDEA 2E7ZA 4RTMA 1RKVA 4N8DA 5BNZA 2SCUB 2X1VA 2HUPA 3KE8A 3AZOA 1WMAA 4RVGA 4B83A 4JXKA 2AYXA 3FG9A 5LD2C 5JCZA 3B3FA 3N7TA 4D9JA 1MLDA 3AR4A 3H7IA 4OMFG 5E0KB 4F3CA 1FLAA 2HJRA 1KMCA 3G0GA 4H18A 1QX4A 13PKA 3H1PA 2ZBFA 4D98A 3MGCA 1NFFA 3UM9A 4BWYA 4RTNA 2BSQA 3SM3A 4BMCA 1V4BA 3DZFA 4RHUA 5C8ZA 1O95A 1HK7A 1PJZA 3DZKA 3EOZA 3HCAA 3K31A 4M8NE 4R5HA 1P18A 3T0GA 4C0XA 3TXXA 1G3QA 2ZVPX 3KJZA 2VDJA 3KEFA 1C1DA 1I2CA 1T2DA 1DCTA 4H31A 4RK5A 3Q6IA 2EVWX 3OJOA 2QUBA 4P7FA 4MJ3A 4CLEA 4EI2A 4B9EA 3R7LA 2HADA 1A4RA 4A5SA 4GX2A 1O0CA 1KL7A 5GTDA 1AS3A 3PHLA 1JDSA 4B4DA 2Z6AA 2FP4A 2ERXA 2REBA 4HWRA 2CLOB 3NOXA 3O4GA 2AFIA 4GLOA 1Y5MA 1GUZA 1YUNA 1WX1A 3K9HA 3QVJA 4XWGA 4BP1A 4U7DA 2B1IA 1V3QE 1D1SA 5JIBA 1WLYA 1EVIA 1YFKA 3PDCA 3QU5A 2PSDA 5TS2A 3T7JA 1ES9A 3ZUGA 3ZWPA 1ZH6A 1K8ZB 1UXHA 2QENA 2ZRHA 3FNHA 1P3JA 5JADA 1Y5RA 5KOYA 1KO8A 2YZ7A 4NNPA 3Q3GE 3G9XA 1L8LA 2OUKA 2FZVA 3C70A 1JXMA 3T5BA 4DWVA 4X66B 1H1TA 4DV6B 2KQUA 3DZIA 2JASA 4NWIA 2XMRA 2JH9A 3QKSB 4LS3A 1F4LA 1PK7A 1BFUA 4UUNA 4DA9A 5B58T 4EW6A 5AJYA 3O47A 3HUDA 3X1YA 3ZLVA 2BTEA 4ZEVA 2WSIA 2R44A 1MPTA 1Z6QA 4N0EA 1K3FA 3AJ9A 2WM2A 1IXYA 4Z2AA 5FPYA 2XYPA 3NW9A 1WQ4A 4GOJA 5C81A 1AK9A 5ALWA 4DIKA 3MWDA 3Q11A 5ADVA 3ND5A 2WSSA 3PFKA 1DXQA 1G41A 4PSAA 3WJAA 2PXXA 3IEUA 2Q6LA 1LDYA 2ZYVX 2J3JA 2XV1A 3NHSA 2DWUA 4BBPA 3FX2A 5I8ZA 4DCTA 2QJTA 4TZ6A 4ZCQA 1W2WB 1QYXA 1IIRA 4E07A 5REQB 4O4HB 2ZATA 3IPAA 2PZJA 4LI0A 5FHRA 5JLJA 2JGIA 3DHYA 5AVSA 4FXOA 5LLSA 2JIZA 2M32A 1V96A 1IN4A 3W9UA 4BLUA 5I4KA 3P9CA 4DC9A 2JGKA 4KPYA 4I4TB 1N32B 4AP5A 3W5VA 2CLDX 1C0KA 2FAXA 1K89A 4QHSA 5L9AA 3L8HA 2E85A 3K2IA 4A1FA 4OU4A 4EPYA 1L5HB 1WJGA 1FQWA 3R5XA 2ZTUA 1E4EA 4YI3A 3TAUA 3VISA 5ALDA 3W6NA 2QQ5A 1DWOA 2QAGA 1U0FA 4OQ4A 3V7UA 3ZYCA 1FUKA 5LOVF 2XB9A 1EX7A 1U3FA 1T2UA 2Y0BA 3FCAA 3G5AA 3KKQA 2QPLA 2IHBA 4KACA 4XGRA 4YRLA 3V1YA 4DBVO 4EKDA 4QBKA 1PNRA 1TM2A 3M82A 4S2UA 3CLHA 121PA 3GDGA 1G9XA 2YV1A 3LT0A 5F3RA 3TTYA 1F0KA 2FW8A 1FMTA 2VSFA 3HCCA 5CYPA 4U0JA 1CJMA 1HFWA 4OKIA 1Q7CA 3CRW1 3BIOA 1R64A 4RYLA 3SDZA 1F2TA 1WHTB 4GSYA 4Q6BA 3BHJA 4V0KA 3LKZA 1SCUB 1OLOA 2IYPA 1EG7A 4GMDA 4ZI5A 4KDCA 2ZI4A 2EWWA 2GUWA 4YMIA 1TEXA 3GJ5A 3Q9LA 3LT2A 3SOPA 4BCDA 4C5AA 3OOSA 4KRYA 1ESZA 4CQMB 1AQNA 2Z2ZA 4ZT6A 2BJHA 1TECE 5GV8A 5A5FA 3D6HA 4KWEA 4EJFA 3O7MA 2RCNA 3HYSA 3Q5DA 1Y4DE 4PYRA 2UYOA 5LZ2A 4M0MA 4UJ3A 4MYSA 3W5IA 4BAZA 2AN5A 4KW7A 4Y1FA 5JT1A 4LRWA 1FE8A 1T5IA 2HKIA 1DLIA 1ZK1A 3A6DA 2ZT5A 3DE5X 4KFCA 2G6BA 3HVUA 5AVWA 5E1MA 1OI3A 3AEUA 1EGAA 1XFAA 1J2UA 1N5JA 4HNRA 4BYMA 2J1LA 5IEBA 4LDPA 3I30X 3R24A 1ND6A 3L0YA 1LPAB 3QE4A 1P0IA 4S2EA 1FMJA 1W2GA 3EBLA 3F46A 4TMTA 5JNLA 1IHPA 4H7KA 3TECE 3KKMA 2M6KA 1I36A 5ADHA 3LNTA 4CTKA 3W78A 4LEIA 2PUCA 1VG0B 4LZNA 2CXHA 2X9GA 4FK8A 5ICGA 1FFBA 1HH4A 1QE5A 3QPVA 4TT3A 4CV0A 4DEXA 1CUJA 5ITSA 2EJTA 4GMFA 3F4LA 4IX9A 2PMWB 2IYZA 2QTWB 1XZGA 2GFQA 4ZRDA 4GX1A 4TKVB 3MQ2A 4IEIA 1CUUA 5EHNA 5CA0A 5LL6P 4WCFC 1M6EX 2F9MA 3C5VA 1I4EB 2QSYA 2Q7OE 2XXJA 1DAOA 3E9QA 3AUKA 3IXLA 1HOTA 4ENUA 4YMHA 4YJ3B 1EZ4A 2MDTA 2OQ2A 3O0TA 3N8GA 2YVQA 5I51A 1ZGAA 2Q5OA 2CJFA 3EASA 2RBGA 4TMVA 1DTWA 1RKBA 1OSNA 1RAHA 5C80A 3AETB 1E2NA 4Z0TA 2BEWA 5FLYA 3VHQA 5BORA 1U2GC 2GA8A 1Z73A 1J1UA 2J6CA 4WOKA 2NZ8A 2A9VA 4HDAA 1T6BY 1PE0A 1HPLA 1U28A 3DZCA 3S2GA 1IB6A 3SS9X 5I9TA 1GR1A 2C7VA 3QFFA 1B0AA 1V39A 2UZAA 3NEPX 3PP8A 3QNMA 4FPXA 4HLCA 2XQKA 3AOEA 2WFZA 2VSQA 2ZYUX 4XEUA 3UAGA 3W3AD 2HB6A 3ZU3A 4YT8A 3ZDYB 4TTSA 4Y1RA 2K7FA 4GDFA 4FDLA 5E6UA 3K4QA 3WGQA 1MV8A 1PFKA 1RZRA 1LZKA 1N8SA 3GJSA 3T99A 3EQ2A 1X1DA 3DKKA 1CJUC 4E5VA 4UM7A 2GN8A 5DVZA 1L5SA 3CRNA 4L02A 4RK1A 3C6BA 3TSAA 5CDHA 4ND6A 2VP3A 3SS8A 4RVDA 2XA2A 3JD0A 4G8BA 5HXAA 5KWSA 4EGSA 1U9IA 1R4NA 2YZ2A 1II0A 1PRYA 3VU9B 2FFJA 1FLVA 4JL5A 4P3PA 3R23A 1F6BA 2A35A 3JVDA 3JPYA 1UEJA 1CF4A 2IYQA 2ZBVA 4R1TA 3ROFA 2ZITA 4D46A 1P8JA 4LOJA 5DBIA 1EBFA 4WOCA 2IGTA 4EY3A 1S01A 4HDKA 4EP1A 3L4BC 4WXEA 1I14A 3ICWA 5E6UB 3P32A 4YDRA 1N3YA 4ZCTA 5EJEA 4WKBA 4FM9A 3F1LA 4HUQA 3EOBI 2CEAA 4R1UA 3HNOA 5DGHA 5F33A 2R8ZA 2Q4RA 1E2QA 4BO6A 1QGDA 1U2PA 2CXNA 1T13A 2W4MA 4TMXA 2P78A 2YFKA 2WHEA 5J2TA 4ITVA 3N3BC 1BMFA 3IUQA 1M2OB 3FMGA 4C4ZA 1ABEA 2A1TS 4LJ7A 1X1QA 1GU7A 3Q1LA 4RCYA 3GLFB 1HDZA 3MNFA 2IXGA 3PRJA 4R98A 2VI5A 3DP9A 4PX5A 4RFVA 4RSGA 4R16A 4DV3B 2WHXA 4Z0PA 1Z2EA 3O7WA 3HCFA 4Y9TA 2YUIA 1WUHS 2BFDA 4PNPA 3ZQJA 4B33A 4C14A 1ITZA 2IHNA 2IUTA 1JPJA 3VTAA 1JKJA 2HMAA 4IF6A 4ASUD 4KIFA 3DTVB 3N0RA 3QPUA 4RZSA 3FHCB 4WY2A 4NJEB 3WBKA 4UNSA 3SF0A 4E31A 1ZGBA 2A5LA 2IZOA 2X5KO 3JU3A 2ALJA 1GO2A 1N4DA 3PR3A 1ULHA 2PM8A 4MUHA 4WN3A 4AKTA 4OFBA 4XEHA 2O5VA 1BVRA 2WWHA 3NYWA 3O94A 4RF3A 3DL0A 2OG1A 1L4KA 2ODBA 2CLFB 3O93A 1ZU5A 3AJDA 2X2EA 1VGRA 1XZKA 3EG9B 4OTZA 3DXYA 4QYWA 3TYXA 5DLPA 4L7VA 1WUIS 4WGFA 2NV2B 4KLZA 3BT7A 3LK6A 1VI6A 1S02A 2NU8A 4BWFB 5B2FA 3EZGA 3TXYA 1MOPA 3L0CA 4O0MA 1VHDA 4Y2UA 1ZN2A 3J7TA 4IS3A 5HE8A 3ZH9B 4AROA 5FI3A 2LP4Y 3D7LA 2UUCB 3JQEA 2JHFA 3AU9A 3NTLA 4JX9A 3WLKX 2PE5A 2AC7A 2BI8A 5LUBA 1Y8QB 3KX2A 5G0WA 5H81A 4CUJA 4UMVA 3LYLA 4Q02A 2NUPB 5J43A 1ZO8A 4E5PA 2ZPUA 3ORHA 1Z2OX 3KHTA 3LV8A 2R25B 1N7JA 1PFUA 3MMNA 2XT6A 2J59A 4CWAA 1K6XA 1G8MA 1LS1A 5AICA 2FW9A 5EERA 3CEJA 2O2GA 3M3PA 4RL4A 1LJUA 2AG8A 1NLUA 1PLJA 2BGIA 3FNQA 4BVGA 4BJ5A 4EW1A 4TWJA 4GPD1 3C3EA 3I01A 4H7IA 4EKEA 3G68A 5AIBA 4BNZA 3URKA 3K70D 2LWIA 3OHSX 1EBBA 4V24A 4LZPA 2X8BA 3E3NA 2NVUA 4RYDA 1KNQA 1PFGA 2PBZA 3LQ4A 4LVUA 1CTQA 1DC8A 3FF4A 1PLKA 3R7NA 1RYHA 1QF7A 3O1HB 2AOUA 4K40A 5SV2A 3W7AA 1Z15A 2BKLA 3FSJX 4RLHA 1OWMA 5KTOA 4F84A 1EUQA 1U2DA 4BMYA 3C1TA 3PQDA 1Q84A 2AS0A 2C97A 1P4RA 2PZGA 2ZYTX 3BKXA 4JCCA 4F4UA 1JT2A 1CPYA 1H2RS 3A36A 4M7WA 2YXNA 1MG0A 4TKUA 5KVCA 1ZVVA 3RSQA 3P9XA 3EEQA 1A95A 1KAMA 4MDEA 1RRFA 3U3KA 2R7AA 1TM7E 3U4HA 1VKRA 3BK7A 4J16A 2TECE 2VDNB 4JBYA 4AJOA 2XCQA 2FSGA 2VR1A 4ZVSA 1HNZB 4NPAA 3EMDA 2XMSA 1OTXA 1U7DA 3INGA 4N6NA 1WXWA 1Y9JA 3GEHA 2Q0SA 3HCPA 1P0PA 3BZUA 1M0TA 1XTVA 2PBLA 5JC1A 3U9SA 1A5BB 1I4DD 3GOHA 4TVBA 4JMLA 5ED0A 3C97A 1F14A 4W5HA 4CR7A 3ZE7A 4M7PA 1H5QA 4FJ0A 2CDNA 3K0FB 4JK3A 1D8AA 3RREA 1VFPA 2GD6A 2VT3A 5K7SA 4ND7A 3A7EA 1L5KA 3VOAA 5FX2A 4KHPB 3E5NA 3TR6A 2OXEA 4QX6A 4XJVA 5JNRA 4C4TA 4N65A 3SEZA 3UUFA 3CUTA 1BXRA 3VHXA 4AJLA 1LZLA 2VF7A 3E27A 4HH4A 4IKEA 4JB3A 4ZI2A 2UVQA 1EBUA 2I2AA 3F6PA 4LJYA 4QBFA 1QE3A 2JD0A 4TV8F 3ADPA 3GLGA 1MXFA 2FX2A 4G0PA 2Y1WA 3WE7A 4YJ2A 2P69A 4MKGA 3GX1A 1QE0A 1Z75A 2XH8A 3U3ZA 3MMSA 2ONCA 4JJAA 1TF2A 4PCUA 1OREA 5IWCA 2ZZNA 5B7GA 2J32A 1SQ6A 1Z5PA 3IQGX 3LKBA 4HAOA 4NZ9A 4B5LA 4DT1B 1MOZA 4MV5A 4GUDA 4EFDA 2J9FA 1ZMBA 1ECCA 5EJMA 5I9IA 3R76A 1ONNA 2ZRBA 4QJBA 2FK7A 1UFQA 4FYWA 2O59A 3GHHA 3FNEA 1VL2A 5LQSA 1AZSC 4DFDA 5JS8A 1MJFA 3DOEA 1OLUB 1SFRA 2H2IA 3DEAA 3GL9A 4BLVA 1L8AA 1O96B 2R6ZA 3U6BA 5E1OA 2XKKA 2Y6VA 4RZUA 1OFUX 3OJEA 4ITUA 4Z9XA 4Q7KA 3OT1B 2K2QB 1ZLXA 2I78A 2GLUA 2VHTA 4OU5A 2A57A 3IVRA 5EJ5A 1VJCA 3OIFA 5KYVA 5CEEA 2VAXA 2XYVA 5B7QA 4XX0A 3OCVA 3CH7A 3H2KA 4ZOLF 5HCIA 3GT4A 4Z7JA 4X7PA 5ICMA 4CI0B 5BRJA 5IUJC 2V4MA 4U7GA 3IHTA 3X1WA 3JQCA 4E46A 3U31A 3QVUA 3WOHA 4J9VA 1DC3A 1ZA2A 1ZK4A 2WIDA 3E3OA 3IV7A 4GP7A 3V8BA 2B1JA 2W2NA 4J1TC 1FSGA 1ZHOA 1SD2A 3Q6NA 1JFFA 4LVCA 2CYBA 3B52X 3IAHA 1WO8A 4Q16A 1C9YA 2IIBA 3GFSA 1Z82A 4B6QA 4PHTA 2JVIA 3K2EA 1JJ7A 4A0RA 2C3PA 1RZRD 4U8GA 2P67A 1S8NA 2GM5A 4LMAA 5HKBA 3CF2A 3FFXA 4IHJF 1IZ7A 1OWOA 5FULA 5BR8B 1NW8A 5FTLA 4D43A 4W9MC 3L4SO 5IVKA 3PE3A 1GPJA 1OOEA 1G55A 2ZRCA 4MA5A 3NVAA 2ESRA 2B1RA 5FLEX 1BW9A 3ANTA 1O03A 4RKWA 5F3DA 4BMNA 1UMKA 4NXMB 3SZMA 3TDKA 1XQ6A 4R0MA 3PIRA 3TRFA 1SKAA 4P4UA 1PNQA 1T36A 4CCYB 2RK4A 5JQGB 1WDLA 3VDMA 4AKGA 2ZRMA 1ZH8A 2MR6A 4Y98A 1R8SA 1XNGA 2A33A 2J3KA 2QY9A 4RBNA 1V7ZA 2IHKA 4Y3UA 5EFOA 1SKYE 5B7PA 1YL7A 1SHUX 1GZ4A 4K6KA 4E21A 1E6EA 1C50A 3WGNA 3AF1A 4L0DA 3OQNA 4DV1B 1GPMA 3WSVA 2D3TA 2RK6A 3ZHYA 4KZPA 5IAOA 5CG2A 3CVVA 2XITA 1L5RA 3QMPA 2IZ7A 1ZH4A 2HCRA 4IHAA 5H7XA 3RUEA 2P5TB 4L8WB 4TS3A 4CEHA 3JQ6A 1VSTA 1KP9A 4H77A 4HEHA 1O4VA 5DLEA 1FP4A 2LCIA 1OYWA 3PC6A 4G86A 1ZUNA 1PQ4A 2E1PA 4EY5A 1QIKA 1MAVA 1IXSB 3ISTA 2WVHA 3FI0A 3QEJA 4O08A 3W8FA 2OLJA 5B6IA 4DLWA 4OQNA 5J2UF 5CDYA 1RXUA 3S1AB 5BPFA 4ZVQA 3VC2A 1UP6A 4UHFA 1WR8A 3RFVA 3SR0A 4KTVE 3DV2A 3QVTA 2M1XA 4PBRA 1T8RA 1CIJA 3ZGZA 3AERB 3SHOA 1ZD3A 1JEAA 1T1GA 4RF5A 3E7FA 4RZHA 3SJCA 2XNDD 2QRUA 3UFBA 1X7YA 1WMFA 3Q3VA 4S12A 5JD5A 5TT1A 3CCBA 4P31A 4J4HA 1RAFA 5TPZA 2Q1TA 4BJHB 2HCTA 1YE3A 1GADO 1NVKA 1HZZA 3AR7A 1XZLA 4LQ4A 3Q8LA 2VYND 5G4LA 3CUEF 1MCZA 4G0QA 4CIYA 2VWPA 2DPYA 2VP9A 3CHYA 3ESAA 2M6LA 4EJSB 1UZMA 1DJQA 1U0JA 1KBZA 1A4IA 1LY1A 2GYWA 2EFGA 1YR6A 3ESZA 1YKSA 3NAZA 2PA3A 4TXJA 4XR9A 2B8WA 3QXGA 1RWXA 4DDHA 2C03A 4YUAA 3UK6A 1Y8ZA 4OM8A 4Q9IA 3A31A 4FMPA 4IY1A 4ZIRB 1L8QA 3JVIA 4MRAA 4ZEXA 1H05A 3ZDCA 4FW8A 3CINA 4IV5A 4CM9A 2BEWB 3VSCA 2ZAGA 3H83A 2VXBA 1L5FA 1ZM9A 3QMVA 4LZZA 1FL9A 1KO4A 2HJVA 2WPNA 2ODQA 5KQSA 5DK4A 2UZ4A 1XJQA 2CMFA 4P4SB 1KQGA 1SVOA 2XVXA 2C3YA 2HZ7A 5IJAA 2E3JA 3QTTA 5I9MA 4JI2B 3OX2A 1IZZA 1CZRA 2YXDA 3IBFA 1OKKA 3I42A 1J4AA 1LBTA 4HFMA 2WQ7A 1IEWA 1M73E 2DUUA 1P1CA 2AC4A 1UFVA 1DC6A 2LCFA 2PV7A 1T9DA 2JFWA 3AHJA 3BL8A 3NBFA 1UBGA 3N2KA 1UMDB 1RZUA 4NR0A 2ZVJA 4O2RA 4D6YA 1BS1A 5INTA 3PQ3A 5IC6A 1ONOA 2Q1UA 3BE6A 2XB4A 5DV9A 4OVKA 2CSUA 4RKYA 4TLMB 5DT2A 1KDZA 4RZIA 5AK6A 2ZWPA 2H18A 4RLSA 2QLMA 5AHKA 3TKLA 2APJA 4G6ZA 3V4VB 4CKEB 1RD4A 2PMKA 2QL7A 5AUOB 5HM6A 2G72A 3GT7A 5EWJB 4B3XA 4V03A 3IDAA 1C0IA 3P4XA 1U9YA 3FTPA 3FPKA 3GCZA 3KFXA 4WBSA 2ZRLA 3H87A 3PR1A 4B80A 5CB4F 3FMPB 1V26A 1Y3FE 2H29A 5T8KC 4ZYUA 4ANFA 3CPJB 2IYVA 1BDMA 4AAYA 3HG7A 2JARA 4XH9B 3DT8A 1E18A 2B34A 3P0JA 4G67A 2R1UA 4XJSA 1E7WA 1NN0A 4ZQIA 5G0SA 4LFCB 5AKGA 5HFNA 4E2FA 4X5OA 4FNGA 3ANYB 2HWUA 4P3NA 1J97A 1UFOA 4FGZA 4MZDA 1P17A 4J1QA 1BCSA 1V5WA 3NRBA 4KK4A 4O4IF 3B9PA 5JNWA 2FW7A 1OXSC 2VHQA 3BA6A 1H2XA 1U3GA 1EFTA 5A3SA 3RF7A 5C1BA 1PN3A 1A96A 2VLIA 3I2FA 2J0EA 4AYWA 4NY1A 2BTQB 4Z9BA 3L18A 5GPBA 2QP3A 3T3GA 1ESEA 3FYUC 2QTBA 5JU6A 4GSKA 2VJNA 1WU8A 2EYQA 3DQZA 3S5JA 1UJ2A 5JCOA 5K0EA 4FKMA 4UNNA 3KKOA 2P2ZA 3OOJA 1HKUA 2FSUA 4C29A 5JYBA 4F1JA 1J8FA 4IQGA 3ZZ0A 4YUXA 3UMBA 4C20A 3ZZNA 2GF2A 4IDBA 4UE2A 5ALNA 3IKTA 1H3NA 1OGYA 4MTCA 1E7MA 3OHMA 1BGVA 3NKVA 5H4HA 1BXKA 3MW8A 3EULA 3M5WA 4K3VA 4YQYA 5FUBA 4U6SA 5LKRA 2LCQA 3HY6A 1IDOA 1NBHA 1P1IA 3AM3A 3EQ9A 4NMLA 1CD5A 1O89A 1KFJB 4GRAA 4EHJA 2OFOA 1Y6GA 2RDMA 2X0JA 2UVDA 3AFIA 3FIUA 4MRPA 2P65A 3RS3A 3SFTA 1W36C 2AFIB 4H4CA 3MOIA 1NBWB 2J08A 3GBSA 2H4JA 3DKVA 3CLSC 3PK0A 1HDOA 2XTJA 4GFDA 1X7HA 5H02A 4BFVA 1VFNA 4AY4A 2PU5A 3BH0A 4TTAA 1NVXQ 2UZ1B 4G0YA 4IYJA 3UAYA 3UBTA 3HU2A 4V39A 3VMMA 4K7JA 4KDEA 1NJ2A 1M8FA 3RJ5A 1XRMA 4I1VA 1E64A 4DSOA 3O9ZA 1UZAA 5CT9A 1BDBA 1YU6A 2XQIA 2AZDA 5HGJA 3EA0A 1OWLA 3GARA 1PZHA 1YXMA 5AK5A 3FUWA 3OECA 4JSTA 2UZ0A 5HFJA 2YZGA 1KNXA 3MXOA 5JSYA 1B74A 2XLCA 1IMJA 2H9AA 3PBKA 4JU9A 3RYFB 3S6JA 3TRJA 9LDTA 4DCMA 1X15A 4QU8A 2YXPX 1JQJC 4DLYA 1DSSG 2NYUA 3EUFA 5T4BA 2C0PA 2HM7A 1NHWA 3DL2A 1NPDA 4TWAA 3WL3A 2I1WA 4RPLA 1ORWA 4GPBA 2GHIA 4IZHA 3WWYA 4FYPA 5M29A 1NZJA 2ZE6A 4LJ6A 1KC3A 2O7SA 5CA0B 2OSBA 1IVYA 1Y98A 4WKCA 4YT4A 1W4ZA 3AR5A 4KQXA 1PT5A 4TZ0A 1U28C 3HM2A 3B1YA 4PY2A 4BO0A 1UBOS 1J22A 1QZXA 1RWPA 1AGYA 3FPCA 3I4FA 1QO7A 2GPJA 4I5GA 1D4OA 1N0WA 1VQ1A 3GLVA 3NT4A 4TMFA 1KOLA 1VKNA 4BVKA 5KOJB 3H1EA 3FBTA 4ZV9A 1OH7A 4XGQA 1RSZA 2QUIA 3H65A 1JEQB 3AR9A 3FFWA 1C1DB 3U17A 1AUQA 2K5UA 2WAAA 4FOTA 4V0ME 1RZVA 4EY8A 3L1KA 3R0QA 3TINA 1E69A 2C2BA 4NZOA 2ZYHA 3DNMA 4MWTA 5L3SB 1ZK0A 1FVHA 1P75A 3VAZA 4N5LA 2REXB 4MWCA 2NZXA 3G9QA 4RJKA 1LQTA 1O97D 4E5KA 3ZVMA 4JOCA 1SUPA 2R4UA 3EVGA 4PAWA 3FPJA 1HM5A 2O1SA 3MCVA 2ONJA 1TL7C 1ZESA 1MEOA 3OQMA 1SPBS 3DOFA 3PR2B 1JQEA 2SCUA 4DMKA 1SBZA 4BNJA 1T0BA 5FBRB 1C8KA 1U3DA 4PPGA 4R9NA 2I66A 4E1AA 3ZZUA 3G2LA 5A5VA 4WVLA 1GTL1 1BWRA 4MUBA 1AK1A 2WU4A 4ZQHA 1C1XB 2OKCA 4IOJA 1QV9A 1CUBA 2O2DA 2WP8J 3EIQA 5HZKA 3HBAA 3LCCA 1UC4B 2ETXA 4JQOA 2XUJA 2HA2A 3UHOA 4BVHA 1BZYA 2QU8A 5F3WB 4CTNA 4Q5IA 1QP4A 1GWNA 4HFRA 1GTRA 1BYIA 1ISMA 4OQQA 1S0UA 2GJ8A 3E81A 3FN4A 1A9ZA 4Z2YA 1AKMA 1M34E 2C4HA 3TR0A 4N5MA 2FFHA 4BVFA 1G5IA 1BXGB 3CEHA 4IIVA 3RBZA 1IHOA 3MFYA 5E8RA 1M0EA 1RC8A 3RHTA 4BP9A 4QXPA 1MA3A 1ZOLA 4Q7EA 5KYYA 2ZUDA 1VHQA 1C29B 3BH7A 1M0SA 5NULA 5HS4A 3X1MA 3LRPA 1Z17A 3LO5A 1GDHA 1D2GA 3A3OA 1K3TA 4O8ZA 3WG9A 7REQB 1C5KA 2YOFA 2BP7B 1PUIA 3E9YA 3WV4A 3ZJYA 4MUYA 2F4VB 4PC3A 4GXTA 3H2YA 1DEKA 4LY0A 1TAUA 2IHZA 1PTJA 2QD3A 4HH0A 3D0RA 5CH8A 4R81A 4C03A 2HMYB 3CIFA 4C9BA 1TLTA 1YS9A 4ECAA 1DGQA 4E30A 2WU8A 3NPAA 1EXWA 3DWEX 1T1EA 4YRMA 4WBNB 4MGYR 4EHLA 2O8BA 1PEDA 3H05A 2G28A 4QDXA 3T5PA 2GCOA 5JARA 4QXOA 1KJ9A 3PHJA 1X9IA 3K7EA 3W2TA 3G8YA 5T67A 1CBUA 2A78A 3NEYA 4RTPA 3K5PA 2ORIA 4F71A 1NIJA 5J4YA 4XVHA 4QYIB 5LLDA 2IHUA 3WFJA 5E4JA 4EB6B 4M38A 1GGVA 3T1OA 3VUEA 2Y0CA 1Y7PA 3KSBC 5FNVF 2TMGA 4Q3OA 3MRVA 3VH2A 1W75A 2YVKA 1OTHA 4JUBA 5BV2P 4TLDA 3AJAA 4KUGA 4L8LA 4EY6A 1L1EA 4KAAA 4EYSA 1C80A 2PKWA 5D1HA 2OL4A 5ALPA 5EC8A 2NNWB 5GOZA 1NUTA 1RTKA 1JWAB 1GEEA 1JYFA 4MUJA 3NHPA 5E9WA 1G1AA 1EIZA 3CZQA 3EXEB 3SSOA 3TDNA 2W4QA 3LDHA 2R6GA 4A0SA 2BDTA 2HDWA 4MGHA 2ZUCA 1KYWA 1O4WA 2PG3A 2QROA 4IIBA 3WQHA 4PIMA 4C7VA 1KIFA 2I7VA 1DQZA 4CN9A 2PK3A 3O4RA 2AZXA 4ACBA 3GPDG 1GKKA 4I8IA 4DLRA 4RE6A 3HJHA 1HORA 3H4MA 4QJ4A 4GKVA 3NOOA 4HMOA 4QJ5A 2ZUSA 3PIDA 2FR1A 4HR7A 4NE9A 2HSWA 1I0IA 4UEWA 3A7DA 2QX8A 3G2PA 1Q14A 3WYAA 1PJCA 3IODA 5CK4A 3MWYW 1L7OA 3LQKA 5EE9A 1KSFX 2FWPA 3IUJA 4F06A 1U6JA 5HIJA 5H80A 4JLUA 5EP4A 1VE1A 2Z5VA 4BL5A 4BIMA 2A0XA 3V2UA 3I4CA 4YQEA 3DDNA 1I5OA 4YRJA 4HUQB 1S7CA 1YZLA 1K4MA 5LJLA 4HP8A 5JCOC 2RAVA 3KPJA 5FOQA 2P4HX 4WXMA 2X3FA 4KFSA 2J9YB 3G2IA 2IOQA 4N5HX 3V9PA 1ZZGA 3PUYA 4N41A 4WNIA 1OILA 1UFKA 1V8BA 1R18A 2C31A 1O95D 2RKWA 3IP9A 4LCJA 2B21A 4QQFA 4LGMA 1CKEA 2GX6A 2PLWA 4FZRA 3MC1A 3TTUA 1JFFB 2QAJA 4KGVA 3B51X 1CUGA 2IU3A 4XPIB 5IKMA 5B55A 1F0PA 2DTXA 1LDGA 2ZIZA 1FZQA 1Z0DA 3CRZA 5AXAA 1M2KA 4OB7A 1KK3A 5TJHA 2C7PA 3R5FA 3BL5A 3QWIA 2OHJA 3CR7A 4DIFA 5FBVB 2OZEA 3K4HA 5L3QA 4Q3DA 2Q6TA 2YWFA 4OI1A 1VGQA 4FN5A 1K66A 3L5OA 4NMHA 1I6LA 4D25A 4YP5A 4DHEA 4HF7A 5GINE 2C4NA 1C9JA 2HU8A 4MOWA 3BQNB 5DBFA 1UOPA 1ZRSA 4GD3Q 3JQBA 2G4CA 3M8KA 3IL2A 2FPPB 2NUBA 4Y2RA 1HDIA 2XBUA 3VU8A 2OG2A 3QFCA 2I9KA 3L3BA 3EQ6A 1ENOA 2PZBA 1FUUA 4P5PA 2ZRKA 1H6DA 2GH1A 3F6SA 4R68A 1IU9A 1EZZA 2HK8A 2HF2A 2HGSA 2YHIA 2XAAA 2BT4A 1I94B 2HBRA 1SEPA 3N75A 4WQMA 3B1KA 1VJRA 4QPCA 3TBHA 3MIIA 2JLQA 1MOSA 1KF0A 1T4BA 2F90A 2QN7A 1HLPA 4JLWA 1A7JA 5GONA 3T3HA 1BAPA 3UN1A 3AVXA 1IY2A 2A5GA 3DBVO 4UZEA 5A6SB 4DB2A 3JS5A 4KMSA 4XIYA 5HKAA 4LNHA 1P9LA 2HSDA 3AUSA 3LK7A 4MAMA 3RGWS 3TRHA 1XZQA 3WB0A 2CV2A 2Q46A 1SOAA 3V4SA 4UBJA 1B42A 1QH9A 4DNOA 4I99A 1IZ8A 1QCCA 1UMCB 1AKYA 2VO1A 3E8XA 3LBFA 3KP1A 3O03A 5GVRA 3IALA 4ALNA 4YR9A 2Q0XA 3FDXA 4W4TA 1CY6A 3QBEA 2VXYA 3GLSA 4RJLA 1U7XA 2VH1A 4K46A 1KAOA 4HFJA 2BKVA 3KV3O 3L77A 3W5CA 2R4QA 5B6JA 1SXQA 3P97A 3CZCA 1OV4A 2FWJA 2VSNA 5KWVA 1RR6A 3T4XA 5B1DA 1KI6B 4X54A 1J9GA 5TGZA 3E48A 1XI2A 3IURA 1RHMA 1XWIA 1RCFA 1NBIA 1WXEA 4KUEA 1J5PA 1PZGA 1TFRA 1VJTA 3GNQA 4F9GA 4JSRA 1RXWA 2QW8A 3TG2A 3D3QA 2J33A 2V4UA 5I8WA 3DZJA 1NVTA 2IT1A 3KOMA 4FHEA 5CX4A 5BWCA 4DR3B 4GF5A 4PO9A 5AM1A 3GGOA 2UXDB 3PQFA 4NECA 1TGVA 5HTKA 4BATA 1PGJA 1RXCA 3IPCA 3CBGA 2WQZA 3GAFA 5FNVB 1NN1A 2FSPA 3V7WA 1FU4A 2UYYA 1A3CA 4WN9A 2W58A 4Q00A 3MUEA 4F46A 1TJ5A 3P27A 1NY5A 1Z6XA 2LW7A 4HRAA 3I28A 3G85A 4DCCA 3I01M 3L9WA 2BOVA 1MAAA 2YYAA 5F2EA 3QIVA 4LXTA 1R8XA 1JJVA 1MB4A 1H66A 4QUGA 4QDOA 2Q0HA 4RZ2A 5EJGA 3TLKA 4CR8A 4O4JA 1L7EA 5IJZA 1N6KA 2B92A 1RJFA 5DSXA 4CNQA 1P5FA 4JZYA 2PGJA 3VKFA 2YIDA 1DIRA 4M1OA 3GLFE 2J09A 5ELMA 3RS2A 2PR2A 3P71T 1EQAA 3OOEA 2O2JA 4ASUA 2FY8A 3E9NA 3VA7A 1ULUA 1CDZA 1UKAA 3NHZA 1I0ZA 2X9QA 4D45A 2J5KA 4J91A 2L18A 3RBXA 4G24A 1DT3A 1I2MA 4RAOA 2IOHA 1RRVA 2WYIA 5T4EA 3WB9A 4B3FX 2ADOA 5DO9A 4Z7QB 1JILA 1M6WA 2Q41A 3ESYA 4Y2PA 1NVMB 3E5MA 3FYTA 1KMMA 1C1YA 4M1QA 4RVNA 1G6HA 1Y1LA 2ODAA 4JJFA 3VU9A 5CDFA 2P4QA 3ZI0A 4MWOA 3VZSA 4G63A 4RORA 3EYWA 1RIFA 3ANNA 4PXAA 3WLOA 5CDGA 4C6TA 5EOVA 1JHUA 2I4TA 2EP8A 2XHEA 5FPSA 3T4EA 3AO0B 3EZ2A 4NAVA 1AN9A 4QNRA 3WIUA 4GKJB 4RTSA 1XZPA 2VEDA 2ZAOA 3M33A 2IZ6A 3QMWA 1HYBA 4MQEB 2GVDC 4HNGA 1ECPA 2OQVA 3NYIA 2FE1A 1QOQB 1QGUA 5DTMA 5FD8A 1NVUQ 2WTAA 2JCBA 3N8HA 4DMRA 3CKMA 1N2EA 1U4SA 2HUNA 2X19A 4FMBB 1TQ4A 1I33A 3L5KA 1JR3A 3LHFA 3DXXA 3ORQA 4Q4LA 4QG3A 2VDRB 3LQ1A 1XK6A 2PNFA 5CBKA 4KGZA 5CEFA 3H1FA 1CUZA 3ENWA 3JZFA 4NZMA 2G9NA 1NU8A 3K70B 2AMJA 3L4JA 2OFFA 1GITA 3BIXA 3ODGA 1G5RA 3GUHA 3PD1A 4GEKA 1S8AA 1ELOA 4AG5A 3N28A 4F45A 1ZGJA 5DXFA 2C2XA 1XLVA 5IUNC 5KNDH 1N25A 1VRVA 1KDYA 4Z7NB 3DC2A 4MQEA 3R0XA 1CR4A 1AM4D 5T8KA 1FVFA 5FQOA 2X22A 1O54A 5ALEA 3WYCA 2H4YA 2I67A 3IO3A 3NGLA 1TRHA 3BH6A 1KYYA 1W0CA 3CWQA 1UK8A 1DFHA 4MVJM 2R6AA 3TTSA 2JBHA 1LNQA 1Y89A 4BDTA 3PNYA 1Z2DA 4U3JA 3PE4A 2B36A 4FQ8A 4F6RA 3G1UA 1OHHD 1NV9A 2NSDA 3N2GB 1LF0A 4C7XA 2OBLA 1OX5A 1SUSA 3QVLA 3JYHA 4TTQA 4X95A 3TVYA 4FGJA 3CVXA 1TM5E 4O4JF 4GLBA 1W4RA 2DUWA 1DPGA 3NXKA 4HADA 4ML3A 3WKAA 3ZW9A 3F4BA 2G77B 3ROPA 2WB4A 3MCAA 1N92A 4TKMA 1CQZA 1QF9A 1QMPA 4JUAA 3MGBA 4M9CA 2D5CA 2HZBA 2VNKA 3A4LA 3ANLA 5ICSA 2LGJA 3AEKB 1U7PA 3LD9A 3PFHA 2J0SA 4I50B 1PVOA 1I7LA 1P4HA 5FORA 4ND4A 1B93A 2PX4A 4ZI7B 2DLNA 3VFDA 5BMVB 5KYNA 4ZEWA 1SN7A 1YAJA 5AI9A 4JI1B 3ZIAA 2IH5A 1ISFA 4C22A 1TDJA 4MK4A 3LUBA 3JAKB 4YAEA 3GLIA 3QBDA 3PTZA 2XRZA 2DULA 1CRWG 5B12A 2W7TA 4HX2A 2F64A 2NO1A 3G2QA 2QD4A 4FOSA 4KAJA 2HC9A 4NDZA 2WJWA 3O38A 4QASA 3RJZA 3WYDA 4CIVA 2Z1MA 3K96A 1NVAA 2D7JA 5IM4A 2AL7A 4EA6A 2ZDHA 3SC3A 4JB2A 1R0WA 2COKA 1W36D 1BE8A 3A6HA 2VUIB 1MT3A 4ZN6A 3ZIUA 4I5IA 2AJCA 1Z2NX 4FNAA 1QGED 2G9ZA 4WLFA 1XEFA 3WYGA 1WPGA 4G4JA 2C88A 1VJ0A 2WFLB 1FRQA 4O2AB 4QG7A 4C78A 5A3RA 3VSEA 4B43A 5L6LB 2HIHA 3MPOA 3QOYA 4GXNA 1V4NA 4B45A 1FEZA 3FYSA 1XQ1A 4YMGA 2XTAA 3OZRA 2HO4A 5K8TA 3ND9A 3AHGA 4YH1A 1CHDA 3I2HA 2OWDA 4JQZA 2Z2YA 2EKPA 5KNCH 2GD1O 4PYJA 3FFBA 1Y34E 4IOKA 4RDXA 2Z6QA 3HL4A 4FYXA 4OL0A 4UBKA 1YOVB 1VIAA 3P45A 1DFGA 3QUSA 3CF4A 4MMZB 4LWOA 5HF5A 1L7AA 3CZAA 1CVLA 2ZG6A 3BFVA 3K72B 4FGWA 4F4DA 2Q8QA 2X2FA 1AKQA 1T2VA 2QLFA 3CX7A 3PNVA 4H16A 5H82A 1ETHA 2VT7A 3E7PA 4X44A 3I39X 4F4JA 3NFRA 1STOA 1COZA 3GA0A 3Q0TA 1HQCA 2GN0A 4OMCA 4M0PA 2OGWA 4RQTA 2AIRA 2ZJ3A 3CPSA 3HWSA 4E5MA 5KINB 3OPYA 2ZAMA 1NT4A 5KMGB 1YVRA 3QBVA 2Y3IA 4YMUA 1ZX1A 4OEHA 3WC4A 1IN7A 4NMMA 5BYJA 1JPVA 1QV6A 2VNAA 1QPBA 1VPDA 2JEZA 4RFSA 5M5BA 4KSCA 4H35A 3OT1A 2N1BA 3PJDA 5H9VA 4K3UA 4LGVA 4KQIA 3OQHA 2BR3A 2J4FA 3TMYA 4PE5B 1JHDA 4HDRB 1HLDA 1A8QA 1ORDA 1XQXA 2IHYA 2WRZA 5BRNA 4IXWA 4KO3S 2EWVA 5IABA 4RVHA 4H27A 2X23A 4OXRA 1WCV1 5AM0A 1VDMA 2E37A 4GRDA 2RGAA 3T7AA 4RX1A 5JZMA 3FWNA 4D6PA 2WR8A 3JAMA 2DTDA 3AW9A 4M86A 3JWPA 2ZRNA 4NYIR 4F5WA 2C94A 2AN3A 1QTRA 2D2IA 4NJEA 4YAJA 4BQEA 1QHYA 5A05A 2EP5A 2AEMA 1YZUA 2V58A 3I58A 4G3XA 2WP0A 3HFGA 1YKFA 5FOWA 3TSWA 3ENZA 1VM6A 3EW7A 3FCEA 2NN3C 1ACLA 1FP4B 1SCAA 3CWZA 3NJ8A 1JAIA 4H7DA 4HB0A 1L0BA 4OB8A 3HCDA 1T1RA 3OTGA 4KVZA 3AL0C 5EXDA 4JFAA 3U7QA 2GEBA 1HF3A 2Y76A 5G1NA 5AW7A 1T35A 3C0KA 4BZQA 1GZHB 5TT0A 3UWMA 4CNBA 5AVUA 2A9QA 3PQ8A 4FTWA 4E2WA 1GD1O 1AHIA 2FEWB 4MV7A 3B53X 1YZGA 1A9QA 1G7CA 1XROA 2GA9A 4MV6A 3Q7TA 4KTTE 1IBLB 4IQ4A 3T1QA 4BJ1A 5IULC 4G0MA 5LDDC 3O8QB 4C0JA 1P73A 5BUZA 1PQPA 3WIOA 5DCLA 1SC3A 4RZQA 2JKYA 3EIWA 1QYCA 5TLSA 1DRVA 1NUQA 2QW0X 4PZ0A 5EP1A 4EUSA 3H9BA 2A3NA 1EFPA 1H42A 1MIOA 2JAWA 5BXQC 4EIWA 2D4HA 4ENSA 1KDRA 2ZSKA 1XO1A 4GPAA 3PRYA 4W7IA 1JJBA 3M34A 4PF1A 4UHDA 3ICPA 5DXAA 2GVZC 3E18A 4PZPA 1YI1A 4YV1A 4RMGA 1BNCA 1BCSB 3TSZA 3D5EA 4PRYA 2WYOA 5TQ0B 4MVJF 3T5CA 4WEOA 3S99A 1F6WA 2QTLA 1X94A 4OHCA 1NHGA 2VA8A 4L9SA 1UWKA 2GO1A 2IYOA 2QR2A 3BDVA 2ZUTA 3ZQUA 1EPUA 2VJQA 3LECA 2J3MA 3LMKA 2O1WA 1PNOA 5BMVF 2AXEA 3OQJA 4DQLA 3SLRA 3KEMA 4C7MA 3G8DA 2VEOA 4I1PA 1GPAA 4X71A 2H3HA 4OHPA 5LBUA 4RCZA 3GC6A 4P5EA 4GOMD 1X14A 1YC2A 1OI4A 2IW3A 2QG4A 3IESA 1JLKA 5JAQA 3ZDEA 5DTEA 5CA0F 3VPSA 3GJZA 4N0PA 1RAAA 2GK6A 4DN6A 2FEPA 5A6SA 4BAGA 3HCNA 4LYYA 3PNKA 1DMSA 2HK7A 4PHHA 4XUEA 5I7WA 3K92A 3GFPA 5G0UA 1T0PA 1L5QA 1OA1A 3HB1A 3BCUA 3DMNA 4OLFA 3SFVA 3VTZA 2J0VA 1E99A 4EEZA 5JCPA 4EYOA 3ET4A 4AY3A 1QH8A 3MJHA 5DNVA 1NQXA 4YHBA 5KMGA 2X0NA 1ZNWA 1JG6A 3EY4A 1GG9A 1NBMA 3G82C 2P41A 4J4BA 3OU2A 4HY3A 2AG5A 4RV5A 3QELB 4INOA 4U2FA 1MX1A 2H08A 4M9RA 1KVTA 1KO1A 1W5TA 2PXHA 1V4VA 3O2SB 4R2HA 4RFSB 5H5JA 2BEUB 1HXHA 3VRHA 5CW1A 1OVMA 4H1TA 4O33A 5FBHA 2IEYA 5IDYA 1UMCA 3KKPA 1WETA 1ORHA 4C7OA 3NHJA 1W30A 2Q9UA 1C7JA 1EZ1A 4XCXA 2G40A 1QRDA 4P7JA 3BHIA 4MRNA 2G1UA 3MTQA 1KDOA 4RV4A 3EJWA 2ZTSA 2QV0A 3EVBA 1RLIA 3CM0A 4M0DA 3T3EA 2VJDA 2EW2A 5CDTA 2DBZA 4TSFD 3GFOA 3M6MD 1Q1ZA 1QAQA 3OZTA 3I9V6 4XQ0A 1UT8A 2D06A 4LJSA 3CE9A 3NONA 4LDJA 5CVUA 1RI5A 5T5QA 1JVBA 3PFWO 1FRNA 3HU5A 3MTDA 5KJ6A 1YR3A 3LRXA 5BXYA 3QLTA 1NC1A 2FZWA 5FTMA 1A2BA 1QLHA 3KKLA 2BH2A 2OILA 4M8LA 4YJKA 1RM4A 5JEDA 1N2XA 2FCRA 3KB6A 3ZZ1A 2J4DA 4C0SA 4EX7A 2DX7A 1CQJB 1Z3IX 4RANA 1K6JA 3C7CB 3D0OA 3LL4A 2FR8C 4UM5A 3NHAA 5KNBA 2Q49A 3LPAA 2C8LA 4ND3A 1TU3A 3WJ7A 3LDUA 5KTMA 2BE9A 3C3MA 3CUYA 3I09A 4MKXA 3TAXA 3WLJA 4I6EA 2C4WA 1O97C 3N5CA 1XP5A 3HDVA 3R3YA 4WBXC 4XWKA 1AU9A 5ICFA 3TLYA 4HLQB 3SEQA 1YB4A 5KNDD 1ZD9A 3BJMA 2BMVA 4NEGA 3EIEA 2P2CA 3EZLA 1X80A 1M5UA 2ZR8A 4LHSA 5EQDA 4RDCA 3KRTA 1OB2A 1JPNA 3G49A 3RG8A 4OLHA 5FYDA 4YMWA 3I3OA 5JR3A 1USVA 5L3ZA 2WLSA 3T8YA 2H31A 1HT0A 3PITA 3NHFA 4DR5B 2GHTA 4Q9KA 4XQGA 1KGSA 1Z6GA 3F6CA 4U7TB 2J67A 2ZGVA 3HCRA 4BLTA 4DBLC 1QB8A 1GSIA 1Y9AA 1FP7A 3D8SA 5CNMA 4DEVA 1UXOA 3W4KA 2HA6A 3WYEA 4RXTA 1U0HC 4NESA 2B83A 1YS4A 2ZIFA 5JWRA 4HVCA 5CTAA 1TJYA 1RKXA 4Z4FA 1UK7A 4D2IA 1JE0A 2Q6VA 4XXHA 2PTGA 1J5EB 2I2FA 1LTKA 1SXHA 2P30A 2NU7B 2WYWA 3BC1A 4NQZA 5DYWA 4ESEA 1KEWA 3F6BX 1RLMA 2ARKA 1VTKA 4WKOA 1HC7A 4X1OA 5TV2A 3RFFA 4IIHA 4TV8B 2PSHA 2XNCA 3IB6A 2QSZA 3TEFA 5HS6A 1IPHA 3DQPA 3CUWA 4HZIA 4OHKA 1CLEA 4OXXA 1EYZA 3K1ZA 3BE5A 4EUFA 3A1UA 4Y0NA 1P1KA 4DNFA 2OO7A 4KLAA 4KE9A 3SPXA 3GWGA 4X61A 1T36B 1J0BA 4UULA 3ADDA 1N8NA 1GYQA 4C2AA 4WFJA 2IX3A 4UXJA 3P4YA 4DCNA 1FFCA 1GYPA 2QYHA 4QUIA 4FE3A 4DANA 4ALIA 3AKZA 5F4BA 3Q8MA 1LRJA 1K7EB 1NTOA 1OQAA 1BQEA 3NBZC 2H1CA 5GZ6A 4NIMA 5LVAA 1S8OA 3DMFA 3N0VA 4JNCA 1SVNA 2XQFA 3S29A 3ZWQA 4BCCA 1TYDE 2P5SA 1KS9A 3CLRD 4J94A 2JJ8A 2YKGA 5ECDA 4JLAA 1RM5A 3KQHA 1WEKA 4UOEA 2UZ1A 2DFTA 4PV7A 4YCAA 1JX6A 1DZIA 2VK8A 5H83A 2J9FB 1PHRA 4JDUA 1K6EA 1L3IA 3TM5A 1XMVA 1CUWA 1CY4A 4ZDKA 3AY7A 3EIXA 4HQKA 2XA1A 4HG2A 5JPCA 4ZYLA 2AKYA 3HY3A 1Q0LA 3WL4A 2IF0A 1YQUA 2CUKA 4OBWA 7REQA 1NKTA 1S96A 4HTFB 3IFSA 1J09A 4B4WA 1UBKS 1KDVA 3ZU5A 1I13A 1TLLA 2YHIB 1TM4E 2G0NA 3EVFA 3DEIA 2WV9A 4D02A 3AB8A 2I2CA 2W6NA 4KGDA 2QYOA 3KXLA 1YIAA 5FADA 4JUIA 3I53A 4W9RA 1XJWA 3KXDA 3M6IA 1H85A 3IP1A 5IDXA 1TK9A 5BP7A 1R27A 5DI3B 1T5HX 4XGIA 3NDIA 2VG8A 1XHLA 4RHTA 3E7WA 4BKMA 4C4XA 1ZXXA 4GBJA 5TVKA 4CHTA 1ZK3A 1OC4A 5BQ3A 2XZLA 4YP1A 3H9CA 3MWJA 3VKGA 2RGNA 5C35A 1RYEA 2ZEJA 3N2NA 1GSHA 1XQWA 3H5IA 2Z4RA 3JWEA 4QUDA 1BEUB 2HSJA 1XXHB 2G08A 2PSSA 4G97A 2PT5A 3EGIA 3G5UA 1AHHA 3WRXC 1VCIA 4A6EA 3REOA 2BMEA 2IDJA 2PUJA 3I9LA 3OA0A 5BQFA 1ZVJA 1PV2A 1N0HA 1HZJA 2C98A 1JU4A 1KRHA 2H92A 3FVVA 1W73A 3JASA 1AS0A 5BN5A 1FFSA 1C3LA 1J8QA 4OLAA 4CM8B 1FZTA 1AC5A 1AUPA 4OHUA 1OR8A 3T41A 4R3WA 5FWXB 2HD4A 3BGWA 3M1LA 5KPDA 5G3YA 4QGSA 4AT1A 3HABA 5ILGA 4G5QA 3N6VA 2O06A 2WU1A 5LQKA 3K6RA 3HJNA 3QNUA 2Q3FA 3T1HB 1ODIA 2F1IA 3A1VA 2OHOA 4JZKA 1KAGA 4OFZA 2PJDA 2R6DA 1P80A 4U8HA 1BE6A 2AOTB 4TPKA 4WFIA 4YMSA 4H0CA 1AUOA 2E49A 1RFGE 2QX9A 3O4JA 3BDIA 4E08A 3IOEA 2NU7A 4P92A 3ASZA 7MDHA 3S27A 1M6YA 1N2JA 2GF0A 2YJGA 3AX6A 1AQLA 3FI9A 3GEGA 3PT5A 4FFLA 2HNAA 4H2DA 1X7XB 1Z4JA 4J0EA 4XVRA 4EFNA 1T6NA 1KTIA 2O8FA 3Q6MA 3RBAA 1QBGA 3W79A 1OFHA 4HX5A 5IK2D 4E88A 2A84A 2AVNA 1QJ4A 1Y3IA 2H48A 2YWDA 4MNTA 3DEYX 1U2ZA 3UOAB 1RQNA 2RGDA 2ZIXB 5ULLA 3ETGA 3PI6A 4WE3A 3RNOA 1U5BA 1YRWA 5K6TA 4AMBA 2WMNB 5IBQA 3NALA 3EIUA 3T5MA 1ACMA 3FOWA 4G81A 4P84A 1TCAA 2J8ZA 2ODTX 1N2CB 4K86A 4PHGA 1JEOA 2Q4EA 2QRHA 1ZZEA 2ZB8A 3WTCA 5A9SA 3JQPA 3JY6A 2HR1A 1E3LA 5J58A 3Q41A 2C77A 1YF3A 1GYRA 2Q21A 1W35A 4I1OA 1WABA 4X41A 3QU4A 8ADHA 2RK3A 2BFBB 4NULA 4UCWA 3D5QA 4LTDA 3E3MA 3JQ9C 2V03A 3R1IA 3KTOA 3NBAA 3QKUA 4JB8A 5AOVA 3ZD7A 2VNJA 2HJWA 2H1FA 2GHRA 1XTPA 2CV0A 3GP8A 3UMMA 1T5OA 1GFZA 2D2FA 3NR2A 1NW6A 4NCJA 4ZANA 2QMUA 2QTHA 3DOUA 1SB8A 1PX2A 4GO1A 1XDSA 5KCMA 3AVYA 3OT4A 1N2CA 3TF5A 2NO9A 4MO9A 1CUHA 4EMBA 2QTNA 4YRNA 2IXTA 5HKLA 4CUZA 4JKYA 4XRGA 1M8PA 5JSQA 1I4WA 4MWSA 4B3JA 3E03A 4QICA 4QTZA 1KFCB 4PX3A 3DE2X 5E9JA 1UJ5A 1Z5OA 4J3NA 2QQ0A 1SCQA 2I6GA 2O7RA 2ZM5A 3EHEA 1N5OX 2PLRA 2PS3A 3KB8A 4ARZA 4D9IA 1YR9A 1SQSA 2D7DA 2B4YA 1JHRA 3KD2A 3AIIA 1CEQA 2QRNA 4XD7D 3IMFA 3X2SA 4BJ3A 4GC9A 4JYAB 3LF2A 4BUZA 4YJ3A 1YONA 3OY2A 4AY2A 1Q22A 3I62A 1XTTA 1I8TA 3HBNA 2EW1A 4G09A 1DBQA 4LOAA 4B3DA 3RVRA 1IAVA 2PD4A 5BSHA 5JE8A 1JJIA 4UVHA 2FUKA 3ZY2A 5T41A 2R1TB 1P31A 1GNTA 3H9GA 4JR2A 3UJ6A 3ZCQA 4B6EA 5J2UA 2B8NA 1JHOA 3G9TA 1TPZA 3DCIA 4RS3A 4WESB 3IDSA 5E6SA 5A71A 1NXOA 1J8MF 1FDTA 2QIPA 5AKJA 4LF9B 4CEIB 4DR4B 1GU1A 2VT6A 1ZRHA 3RJ9A 1EVYA 5B1IA 5HSGA 5JPIA 3EIHA 5ARCA 1NXSA 2PZLA 3FDIA 5DTJA 4YYEA 3LQQA 1PL7A 5E6RA 5KAMA 2QXTA 3IEMA 3ED1A 5A0FA 2ZSUA 4J7XA 4JJ7A 5B2EA 2Z3ZA 3KB2A 2GKSA 1E0SA 5EI5A 4H3SA 4O2LA 3WKBA 1W94A 3L04A 1JZQA 3AI3A 2ZI9A 4ZODA 2R8PA 1XAGA 1LSOA 1DRWA 2HJGA 3LKVA 3R4VA 1T0IA 3RJMA 4YPOA 4X3PA 1U81A 5FNVA 2YXBA 3BBPA 3WOVA 3ZG6A 3NB0A 3NT2A 2G0TA 2J3DA 2O0LA 2BHNA 5EQFA 4EGQA 1N7HA 2OCIA 1Y82A 3ZLUA 1PDVA 4CDRA 3L7OA 5AQ1A 4PIVA 3HJUA 4BC1A 5FDFA 1P2FA 1ZICA 2PEZA 1VBKA 4QOIA 1VIDA 3CIOA 2L2QA 3JWJA 3RIEA 4QBIA 1DOAA 3OD1A 3TRKA 3VPGA 3N07A 3LBAA 2GCEA 1C3EA 1XRLA 3BJIC 3IJPA 4IIDA 4WLOA 1NP6A 2WWFA 5H4GA 4RMNA 1Q6YA 5I3ZA 3T7TA 4U39A 5K5EA 4FIZA 4ZCMA 4NMXB 3B8EA 3BJRA 4ZU6X 3MHTA 3JX9A 2P6UA 3UUEA 2AE1A 1NVVR 3MS7A 5HDQA 1RIIA 3I61A 3JCZA 1IBKB 5B5SA 3CBQA 2LPMA 1JLLB 3PVZA 4BQFA 2JEYA 2XGMA 3V7NA 1FFWA 2CLKB 2XVMA 5BOSA 3HN7A 2XT0A 1C4KA 4FD2A 4DIEA 1N1GA 3ZTTA 2XNSA 1KVUA 2GPAA 3L84A 1F8FA 4V0RA 4KQFA 1SZPA 1ZCZA 2QMEA 4PS1A 1NXVA 3MPUA 2JBWA 3FWKA 3GU3A 4FFBB 4ZU3A 1JDUA 3W7VA 3RU2A 3EPPA 1E2DA 1OE0A 2WILA 4IP0A 6YASA 2I3AA 3LXRA 1LTQA 1ZCBA 2O8VA 2BBSA 3QYAA 2VHXA 2QA5A 2PUWA 2GK7A 2NZYA 3SYLA 2EFJA 2XXBA 4W5RA 4G9BA 1VLJA 1E7RA 2XYRA 2ZJ5A 1GQOA 3FPLA 4KXUA 1MB2A 2DQYA 4ZZIA 1NG1A 2P27A 1N3LA 2WJGA 4I1YA 4AICA 3WGUA 5IVHA 4XOUA 3LYUA 2A1UB 4LJ5A 1KPGA 3ST7A 1MDFA 1OFTA 1WCWA 3AG6A 4UHJA 1I1OA 3E23A 3PUIA 1UAAA 4JENA 4JLVA 1WZCA 4BV2A 2H2AA 1MC4A 2OBYA 1TC2A 2JCXA 3BRWA 4M76B 4CL2A 4M88A 5FPHA 4NENA 5C34B 3K3PA 3BGDA 1FSPA 4ZVMA 2QJRA 5C31A 5I5EA 4MB0A 3ZBPA 3KK0A 1KFEB 1Q2UA 1KAHA 2DHDA 3ET5A 2G25A 4WDQA 3ZW7A 1R2QA 2PLAA 2JZOA 4L9WA 4Y6RA 1E3JA 4YRQA 2BKEA 5EPUA 2YXLA 4MR9B 3VHXB 5J4VA 4WASA 5THKA 2JHAA 4MYTA 1PS8A 5I9BA 1H1LA 1DTSA 2CXOA 4QHTA 5AR1A 3HBJA 2FA9A 2NTVA 3IAS1 3H2SA 4JVNA 4MGEA 5IG2A 3EAGA 1I5EA 1O3YA 3OF3A 2GD0A 4CLRB 3GLIB 4RXMA 2ECKA 3FDZA 4MO2A 5D7NA 3OQBA 5CM9C 3ZWWA 4CLOA 2O4CA 2RSLA 3UAXA 3KLPX 3QVKA 3VPCA 1HYGA 4FDUA 1TQHA 4LJKA 4DUZB 4JASB 3PX3A 1SMKA 4XGNA 1YHZA 3IVMA 2I8AA 1GCOA 2QVGA 3WJ2A 4QA9A 4BNWA 4FZJA 3L0DA 2NU6A 1CHNA 3G6KA 4QVKA 2IPMA 4RD4A 2QTTA 2OXFA 3FVWA 1IK6A 4HDMB 1UUFA 3PLNA 3PUXA 1Z29A 3GBVA 1EAYA 3EODA 4RO0A 3BL6A 4QU5A 1DI0A 2B1QA 1P0MA 2G7MC 3A70A 5AVOA 2YVAA 2CVOA 3LVBA 3F3YA 4O4LA 1WWKA 2B98A 1N5KA 3OF2A 3UCEA 1OWNA 4J6EA 3A0RB 5TDHA 1QQAA 2OB1A 1QRAA 1SQGA 3VR1A 5L7TA 2IOFK 4FVTA 4WRRA 2H2WA 1T8TA 4PC7A 1Q0PA 2YDXA 4M89A 4EYEA 3JZIA 3B85A 3LH5A 1LLDA 3IDZA 4KWHA 5GJWC 2VFAA 2G4VA 3GEDA 4KJXA 2WI8A 1KI6A 2PEYA 5D3KA 1GEGA 1Q50A 7MHTA 3DCNA 4OI4A 1W7AA 2F59A 1QP7A 3VKHA 5ALFA 2B61A 1RCUA 1XRSB 1I1QB 1UBLS 3AB3A 4DJFC 5B30A 1LVGA 3NLLA 4J2HA 1U80A 3WDLA 2QUAA 2EJWA 2D59A 1D5WA 3GA5A 4DQDA 2ZLBA 3KUCA 2LR0A 4J07A 1KEKA 4PG6A 3GZJA 3T34A 4GWKA 2ZS7A 5FOVA 1OH5A 1EUDA 2BWJA 1B7GO 2O8NA 1WTAA 5CFOA 3MN1A 4I50A 4QEKA 1LKZA 1GZ6A 3AP1A 2ZB3A 1UPAA 1DWUA 3FYUB 1SOUA 1X1BA 4NH4A 2JJQA 3KALA 3QEAZ 3ZQ4A 4DG9A 2ODNA 3GGCA 4FFBA 5KVQA 2V59A 3THSA 4WT7A 5AW9A 3EGOA 5CIYA 1E6MA 2GAAA 1E5DA 1OBHA 2FX5A 4RK0A 1FDIA 2CVFA 1T9HA 3VJLA 2SICE 3W8NA 4AWBA 4AQYB 3EEBA 1SVIA 2VK1A 3OIDA 5EKDA 3WK7A 1ZY2A 2I2WA 1U2TA 2PWPA 2PKRA 3PHIA 3ZHRA 4UOZA 1IEXA 2Q5LA 1EFHA 1MB3A 3UPUA 4MQLA 2HWWA 1LWOA 1HDEA 1M5TA 1VLVA 4EGCB 1X6VA 3RUIA 1Q1GA 1UL1X 3C85A 1ZJWA 2PD3A 4OQEA 5AK3A 3RU3A 2MSWA 4BYGA 1KEPA 3NTOA 4ENWA 4C0QC 2UYCA 3W2HA 3LLMA 3INTA 4NE7A 1SUCA 3LPMA 4BWGA 3I1IA 1M34A 3ZDAA 3S2FA 1PDOA 4KITB 3MJFA 1B2RA 2OGUA 4M1YA 4X8MA 1E3QA 3O95A 3QLEA 4V2IA 2I4MA 4YWHA 4YXWD 1IK4A 4Y1EA 3DOJA 4CEIA 2GYVA 2DH5A 4MI1A 2E4ZA 3KZXA 5EXEA 2FW6A 1APBA 4YI5A 1J1ZA 1HFJA 4F4FA 3A2NA 3MWEA 3RRFA 1MJGA 2B5WA 1OPRA 2W2KB 3T7CA 4IZIA 1PJAA 4MQMA 1PR5A 4YCMA 3FKSD 1QBKC 4IDHA 5CRIA 4X7MA 1IWOA 3T0FA 3OE5A 1FXUA 2OZKA 2Z9CA 2FEMA 4FYIA 3IILA 5CH5A 5EZ6B 3ZE1B 3OQVA 1LK5A 1DELA 4LWPA 3HS3A 4NFSA 2E5FA 3SF8A 4BNGA 3HO1A 2HRZA 3P0FA 4H0NA 1XVUA 1Z5WA 2YC4C 2FMFA 1PZMA 1TLFA 4U02A 3C7DB 3T94A 1J7JA 2FRDA 3L92A 3QWBA 2NQTA 1JR2A 3IE2A 3GLQA 3O84A 3FB4A 4R2JA 1IBSA 1QFYA 2EZ4A 5JWHA 3RS8A 2H2HA 2Z9DA 5DYNA 4NFYA 2NPIA 1SRQA 3NIGB 1A50B 4XZ3A 4BO3A 2OECA 4O6VA 1OXXK 3OZBA 1WZ2A 1G64A 1O6GA 3LIPA 1KKUA 3G5LA 2W6JA 3IHWA 3U5ZB 4GM4A 5C8YB 2WZBA 5IDVA 3RYIB 1I24A 1MH1A 2QPOA 4N01A 4X85A 5DE3A 3SE0A 1CULC 1NR7A 2IEIA 1L7DA 1LV7A 1UPXA 2WTMA 4NJMA 4HAYA 3QEKA 1QQTA 5EZ5A 3U4QA 3HXLA 2C2GA 2PGLA 3FVTA 3I6IA 1RHUA 5DI3A 3TQIA 1IBCA 2DPXA 1U8FO 5KDDA 3U4AA 1ILWA 1FS4A 1UWLA 5JY1A 2P3LA 1N4AA 1NN3A 4NBKA 4V1CA 3RODA 4MVCA 2AHRA 4DV4B 2IYYA 3V8NA 5IF3A 1KIMA 1MC5A 4DS3A 2P5UA 3FSGD 3MJTA 4RPKA 1C9NA 1WUYA 1VGVA 2OC9A 3OJFA 4QUAA 4YFYA 4CIXA 1SEVA 2BONA 2R00C 3MMZA 4MAFA 4NONA 3T4PA 2V6MA 2ACKA 4D74A 2ZFUA 2R6JA 4F86A 1Z25A 2MCFA 3T9DA 1XEAA 2Q4BA 2QR5A 5JCJA 2O8DA 1W9HA 2JKZA 3JWHA 4TROA 1ADCA 3RF6A 1EVLA 1IJKA 1A5TA 1XZ8A 4YRPA 4ZKEA 1KXJA 4L6CA 4KNWA 4ZAGA 3TQHA 2HV8A 3C98A 5TMEA 1PS9A 5JXHA 3EBOA 4FCTA 1XPOA 1WXXA 4R8RA 4DMLA 5MFZA 1YJ8A 3I73A 4FKBA 1H9AA 3QZUA 3IKMB 4DLKA 4J76A 2A1UA 1LTHR 2FG7C 3BMCB 3NKFA 1PZFA 4QL3A 4Q9LA 3HUTA 2OV8A 3G0CA 3GFGA 1QHNA 3GF4A 3WQBA 3EDMA 1SA0B 1VKJA 1YJ5A 4NFLA 2IIVA 1ZUWA 2FCAA 4H1HA 4YUYA 5IJ0A 1A1VA 3IMGA 5HIIA 2MYTA 3DC7A 5ITZA 1MGOA 2RHHA 4YO8A 4UFPA 1YZNA 5FL7D 2X6RA 4H08A 4X0EA 3F98A 3L1HA 4KB5A 4AC9A 2UYGA 4EUKA 1JNXX 2WE7A 2DAPA 1BXGA 5CYGA 1IZ9A 1E1KA 1YOBA 4FIDA 3QXHA 5AI8A 5A7GA 4J9UE 3I0ZA 3F6YA 4J1TA 1I7NA 4TS9A 2IJGX 1YR8A 3S81A 2L19A 4XTRA 2GEVA 4YRFA 1NVVQ 3JQDA 2TMYA 2VLBA 3QUBA 3W4IA 2XY4A 5I7UA 4ENQA 3E35A 4KXFB 3TOSA 2XX3A 4L4XA 3DBRB 5CB4A 1FFEA 1MBZA 3ZX4A 1JI3A 4OO3A 1XK7A 2J7KA 1RWKA 1F2UB 2H51A 4IDEA 4CV3A 5BQPA 1T9CA 4JR0A 1R66A 4PLWA 2WK1A 2FPIA 2PZMA 1QF6A 5EY5B 4I4CA 3VZPA 4D44A 3RH0A 4L76A 3OJWA 1KWGA 3NV9A 2IYXA 1M76A 5AK0A 1TYAE 3COJA 2YQZA 1GPKA 4UXIA 1NXQA 3ZDDA 1SUBA 2CBGA 3P2KA 2W6OA 1W85B 1PTJC 3BF7A 5EWMB 5C9ZA 3QVGB 1QVWA 5CVTA 4W82A 1RJEA 2P6NA 2P62A 5GIPE 1YBAA 5K4HA 3OPMA 2OFWA 4M21A 4Y2VA 4MMXB 2QNIA 4MI6A 6NULA 1JQAA 2IKSA 3DBRA 5F51A 5KREA 4NCNA 4RMHA 2IV2X 1X2EA 2AQ8A 3DL4A 4AUEA 1THZA 4MSUA 3O21A 2WJYA 1YMQA 1H4TA 4CU5A 3IHKA 2Q5HA 1RHRA 2ISCA 4I5DA 3ROGA 2C5AA 2P9HA 2WNSA 2NMVA 3I2IA 3U44B 1L7RA 2J30A 2WNHA 5H59A 3OESA 1P9NA 1CUCA 2VHUA 3PB3A 2M98A 2BFCA 2WABA 4HAZA 1C9EA 2JS7A