1XAHA

Crystal structure of staphlyococcus aureus 3-dehydroquinate synthase (dhqs) in complex with zn2+ and nad+
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
352
structure length
323
Chain Sequence
MKLQTTYPSNNYPIYVEHGAIKYIGTYLNQFDQSFLLIDEYVNQYFANKFDNVHKVIIPAGEKTKTFEQYQETLEYILSHHVTRNTAIIAVGGGATGDFAGFVAATLLRGVHFIQVPTTILAHDSSVGGKVGINSKQGKNLIGAFYRPTAVIYDLDFLKTLPFKQILSGYAEVYKHALLNGESATQDIEQHFKDREILQSLNGMDKYIAKGIETKLDIVVADEKEQGVRKFLNLGHTFGHAVEYYHKIPHGHAVMVGIIYQFIVANALFDSKHDISHYIQYLIQLGYPLDGVQMVLMRQFGDIVVQHVDQLTLQHACEQLKTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparison of ligand induced conformational changes and domain closure mechanisms, between prokaryotic and eukaryotic dehydroquinate synthases.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Lyase
molecule keywords 3-dehydroquinate synthase
total genus 124
structure length 323
sequence length 352
chains with identical sequence B
ec nomenclature ec 4.2.3.4: 3-dehydroquinate synthase.
pdb deposition date 2004-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01761 DHQ_synthase 3-dehydroquinate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1090.10 Mainly Alpha Up-down Bundle Dehydroquinate synthase-like, alpha domain Dehydroquinate synthase-like - alpha domain 1xahA02
3.40.50.1970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xahA01
5K8CA 4RGVA 1NR5A 2D2XA 1SG6A 4RFLA 5EKSA 1NVEA 4MCAA 5BR4A 4RGQA 1RRMA 1XAGA 1TA9A 1XALA 3W5SA 4FR2A 3ZDRA 1VLJA 3OWOA 3IV7A 1KQ3A 1XAHA 3RF7A 3ZOKA 1OJ7A 1JPUA 1XAIA 1NVBA 1NVDA 3UHJA 3CE9A 1JQAA 3QBDA 1UJNA 1NVFA 3HL0A 4QGSA 5FB3A 3CLHA 2GRUA 1XAJA 1NVAA 1VHDA 3BFJA 3OX4A 1DQSA 1NRXA 2BL4A 3OKFA 3QBEA 1JQ5A 3JZDA 1O2DA 1NUAA 4P53A 2BI4A 5HVNA
chains in the Genus database with same CATH superfamily
4JU8A 1E7RA 4X00A 4EVSA 1HFJA 2CF6A 4H27A 1Z45A 3V8PA 4R1QA 3ZV5A 3ZHTA 5E6RA 2HGSA 4WXEA 5AVSA 4JXXA 2JVJA 4YCLA 1C4WA 3MT0A 3NDRA 3GLHE 3KJEA 1M1NB 1YS2X 4AMUA 5FUXA 1OQAA 4NNOA 3SXUB 3GRVA 1MVNA 4C3UA 3I23A 1ZBQA 2I34A 4LRTB 4MGIR 2ZE6A 5I9SA 5B30A 1OD6A 4NP6A 4N8DA 4OREX 5F2EA 3CG0A 3MLBA 4TS1A 1AC5A 3UVEA 1NX6A 1SMKA 2IXTA 4OLHA 2ZRCA 1XELA 4M8IA 1KORA 3QKUA 2QRHA 4BNHA 3QXGA 421PA 3WAGA 3KQNA 4RXUA 4HT3B 2ZRDA 1RWNA 3QFTA 4JOSA 3S7TA 1WM1A 2WU1A 4Q24A 5TGZA 1ZCJA 4PRYA 3VU9A 4C6TA 5C52B 4DIBA 1RAGA 2E5FA 1RHMA 3OEHD 1WU8A 1WSWA 4E5YA 5JD5A 5JYCA 1KEZA 3EEFA 5HEKA 3RRYA 9GPBA 3AP2A 1GN8A 1D9XA 5K4GA 2JCXA 2ID9A 4NBLA 4UVGA 5AW5A 3SSOA 4A91A 3UEOA 2GPJA 3A6PC 4FJ1A 3QVTA 2F3UA 4PR0A 5DHFA 3TSZA 4CU2A 3SEQA 3PXGA 1ABBA 1JPUA 3ZCTA 1XAIA 5E95A 4YRMA 3PVZA 2B4AA 4MWDA 2CYAA 2IXBA 4IHJA 4IJKA 5ALFA 1VE7A 4PZCA 2ZRKA 1M5UA 4HHEA 4PC3A 4JNCA 4XKJA 2CD7A 3ZU2A 3IAAA 4AJ4A 2OCXA 1DCFA 4X66B 1SHZA 4IOJA 3ZD9A 5JU6A 4DRXB 3RK0A 1N0UA 2VAVA 1L4NA 4CCYA 3HL4A 1YIDA 1R37A 4FE7A 4H7FA 2NYUA 4ZWNA 4ZD6A 3Q2KA 1GL7A 3QELB 3ZIAA 5DI9A 2PCJA 1ENOA 4L5JA 1JQKA 4MV0A 1W88A 3V4ZA 1FX0B 3G8DA 4XR4A 5ESRA 2ZVJA 3VR4A 1IY9A 1ORRA 2RHCA 4DMRA 1NIJA 4YV1A 1G3IA 2OFWA 1WXQA 2VF2A 4EUHA 1UMDA 4FE3A 5CYFA 1UFKA 2YIJA 1K8YB 3BC1A 3PWKA 2GRJA 4HQNA 2R00C 2H1VA 2ZR8A 1JFSA 2X5JO 3SHOA 4QG3A 3P26A 4J1SA 2DHEA 3HNRA 1S2GA 3A05A 4WINA 3T5GA 3RU3A 4ZJUA 3U19A 4RTOA 4R3UC 2FX2A 1G8JA 1JPJA 3O83A 1W93A 1DX4A 2WKRA 1N36B 3PHJA 4WLOA 1R18A 2X5NA 3SR4A 1YKFA 2ZJOA 3FX2A 4GBMA 1M2JA 4V03A 3V3KA 1K9VF 2P35A 3QVGA 1B2LA 3L3BA 1CVRA 1QLHA 3NU1A 3TJZA 1X7YB 4J0GA 1W4BA 3MCWA 2OFFA 4EI2A 1K6EA 3GT7A 2QN2A 4QYSA 4WNCA 2QD1A 1MZPA 2JH9A 2Q6LA 4QRIA 4RTQA 1PX2A 2HDWA 1QQBA 1FY2A 2VPIA 4R9UC 2QRVA 5CLJA 2D3WA 3DR3A 1KRXA 4H7IA 4D9KA 3WADA 1TCBA 1FF9A 4K6KA 3U4CA 4M9RA 1ZGGA 1C1DA 1JALA 1XU4A 1YQTA 4HWPA 4BBPA 4E2XA 2EP7A 1D3AA 2W4IA 4Y1EA 1KJ9A 4MCAA 4LDZA 4UDOA 5I9LA 1YNOA 1FFSA 1SGWA 1OI4A 2MJLA 1YQ9A 2KWIA 1WHSB 1TW3A 4I8IA 4J1NA 4AVYA 4L4YA 3VKGA 2VIIA 2GNPA 2H1CA 4XD2A 4G0NA 4D3DA 1I1OA 2N3ZA 2I8CA 5CNKA 2FFHA 3OMLA 2UUCB 3QKRB 3WJAA 1GL6A 1P2DA 3P4XA 2X0NA 4LRQA 1VE6A 3MTGA 4DW8A 2HV8A 3QW2A 1EX9A 4LCBA 2IH4A 4IOLA 3H9UA 3ONWA 5HPYB 3LGXA 5KWJA 4X8HA 1EDEA 1Y5NA 4CI9A 2PZFA 2ZPAA 1TUIA 2P75A 3JAKB 3A10A 4FDLA 5DM60 2C59A 1AZTA 2WIDA 1FE8A 4QDJA 3LUCA 3RSCA 1YQQA 4EY3A 1OAAA 2QRJA 4KIFA 4NMWA 2X3UA 4OHCA 5CYGA 3RU2A 4MHTA 3R3WA 1SH7A 4NMLA 5IJXA 5DGCA 2VWHA 2JAUA 3HBNA 3KQQA 3IH5A 2JFWA 3G2OA 1XAGA 1DCTA 1NBOA 1EX6A 1WW3A 2O0MA 3A1CA 3EVZA 4MW1A 3FNEA 4US1R 4LMRA 2Y1KA 4DQXA 3DMTC 3RADC 4ZPXA 2PLRA 1CS0A 3T5BA 1RWWA 1RXSA 1U80A 1KYQA 1X1QA 3BMQA 3KLOA 4XWWA 3A2LA 1ZAYA 1MVOA 2P1DA 2FKAA 4CMIB 1MJGM 1XHFA 3U37A 5TARA 4X97A 4CHTA 2RH8A 1Z73A 3EVBA 2O8FA 2GA8A 2P1RA 3OIGA 2E1RA 4BXOA 3RJ5A 3OPYA 5BR8B 2ZXUA 1LSUA 2NQ2C 3DXFA 2J59A 1VMDA 1NW7A 1YHNA 2F8LA 3HG7A 1Z25A 3LBNA 4RHYA 5D3MA 5HJEA 3HPQA 1WMFA 4JC4A 3S2EA 4JT2A 2P2NA 3KYCA 1PZXA 3GLVA 4I19A 4DCVA 3W2FA 3JTEA 3ZDQA 3R5FA 3H97A 3E9ZA 4JBGA 2WF7A 4FE4A 5T3UA 4LQLA 4JYMA 1ZKDA 2HF2A 3N75A 4LRUA 4TLMB 4YBRA 4C4PA 1Y9ZA 4DXHA 3E7FA 1JHAA 5B7QA 5JS8A 2WB2A 4YACA 3T34A 5CVEA 3GI1A 4K40A 3CE9A 4OLFA 2QNRA 5KU1A 6ADHA 2IS1A 3E1KA 4A2CA 2FLWA 4JUBA 3P9CA 1KH1A 3AFGA 1V1RB 1EZ4A 4XJTA 1CIVA 3HY4A 2EYQA 4QU8A 5TT0A 5KSZA 2B2NA 4QJ3A 4GR9A 4MPRA 4TLAA 3ZYCA 3EQZA 4OI1A 4C4AA 5IYZA 1DXHA 3DEYX 5KYVA 1ICEA 4IDCA 2PUBA 1HLGA 6LDHA 1DIGA 5LNK1 1MH1A 3D7NA 4OFBA 1BDIA 4YMUA 2HMSA 3KYBA 4R1LA 5TVGA 3WLPA 1KMNA 2F3SA 2XUIA 4LV8B 4P5EA 2C4HA 5BMOA 3ORRA 3AO0B 1I94B 2IWRA 1JZSA 3LXRA 1E3JA 1JEQA 4RJJA 3WLKX 1ZRHA 2CFIA 3MT8A 1HFEL 5DB4A 4O4LB 4RM3A 1XXHB 3G2PA 1QIFA 3L1HA 2C9DA 3TLEA 4RENA 4EATA 5F9HA 1YZFA 4R2JA 4G0OA 4KXVA 3ZEIA 3A3KA 4HDAA 4RAOA 1LH0A 3ZGZA 2B4YA 2DR3A 4LTNA 1H2ZA 2W2MA 1RWVA 3E6AA 4JCOA 4RELA 4FZVA 4V39A 2WC1A 1H9BA 4QUHA 1DDOA 1DFGA 2K4MA 4W7SA 1P61B 3L04A 2XMBA 4MTCA 4Z0NA 2HDHA 5C8XA 4WLFA 4EF5A 2G4CA 1CE8B 2WE8A 1U28C 1Z2CA 3V00A 5JYDA 3H4IA 1G20A 4FN4A 4HK4A 2BLLA 3KWMA 4LYFA 2EL7A 2PT7A 3JZAA 3FBGA 5SZJA 4QVKA 5JCJA 3IP8A 3JSAA 5CIQA 3AWDA 1QVWA 3OZEA 2O2XA 2DG2A 4Y2HA 1QF9A 3ZG6A 1U9CA 1Y4ZA 2GYVA 2R8PA 4BO2A 3EASA 3EULA 3MJEA 5IDYA 4UDNA 4AW9A 1DX9A 3JY6A 1X9HA 4RVGA 4OMDA 1M1ZA 2YUTA 3C7KA 2NM0A 3QPCA 3MMXA 2ZYTX 2W83A 4H7HA 4QODA 1IHUA 3EXEA 4D81A 1RHKA 2PR2A 1J70A 3BTUA 4JP8A 4UEWA 3RRFA 2HDNB 1CX9B 2QN9A 3UCEA 1EX7A 1NVDA 1AM4D 2P5UA 3HSSA 4WKCA 5E4TA 3H3JA 4YP1A 2HT1A 3SC4A 2FRXA 3BN3A 4FX5A 4GKVA 1CDZA 1J33A 1FB5A 1KO1A 4NL4H 3UBTA 3HDTA 5E3HA 4FDMA 4FLFA 2MMCA 4RY9A 3BRQA 4ARCA 3KQUA 4KMMA 3WGZA 4D4JA 1U0GA 5GAJA 2BE9A 1W76A 4EJMA 3QE4A 3DE1X 3SNKA 4INAA 1ZK2A 4F91B 3EPJA 5JV5A 3BD7A 2G5TA 3AI2A 3DDOA 4I3HA 1OFHA 3P9RA 3FNBA 3LT2A 4FU0A 5K4HA 5F2KA 4DDKA 1KI4A 2AC4A 2QLNA 2G70A 5T5QA 2PCLA 2W7TA 4MVXA 3AW8A 4QHYA 1E7YA 3CF6R 5C5CA 4DR7B 1C7ZA 1HQKA 1RYFA 2JI9A 2YS6A 3IMEA 4OCZA 1MXFA 1H8HA 1WDMA 1Z7EA 5C46F 2P90A 4MDHA 3RE1A 3TUIC 4DGQA 1UDRA 2CT8A 3PEYA 1N7HA 3E82A 1SWVA 3O4FA 1H9AA 2B7CA 2WU4A 3OA0A 4B0OA 1QYVA 1FP1D 3SM3A 5I4IA 4D8WA 1K6JA 1URPA 2PD3A 3PX3A 5JXJA 1O1YA 4LOKA 4B40A 1IN1A 3G5LA 2XSZD 3SAJA 1HTBA 3GGJA 3QENA 2GH1A 3A4VA 3W6NA 4ENWA 1E92A 3QSGA 2AJBA 1KVUA 3R40A 3T0IA 1E2HA 4EW1A 4LMPA 1LS1A 5KYKA 2IBTA 1YL6A 2Q6VA 4TWAA 4KVGA 1ZK3A 2VP9A 4UD6A 1VPDA 4YPFA 4YXWA 1Z3IX 3PX2A 4I50B 5TNXA 1WV1A 3FNHA 4K3VA 4AF8A 1EIZA 2D0OB 4FOOA 3EAQA 1BQ4A 3LO8A 4S1NA 2WP0A 2FJUA 1GYQA 1U8EA 1YL5A 3GA5A 4GSKA 2Y1LA 5F12A 4C78A 1E79D 1HR0B 4EPTA 2CJFA 3KB2A 3KQPA 3L7KA 4LMAA 3VU8A 2LUOA 3F0TA 3HEAA 1FJXA 4UREA 1HE5A 1VYVA 1WXIA 3DDNA 4PYMA 1BFDA 2ODNA 1LV7A 2F43A 4IDOA 3V34A 4FB4A 1YA8A 3PNLA 1KEKA 2YZGA 3PLAE 3OEEA 4PAQA 2CMKA 2WJZB 1DBQA 1U1IA 2H2IA 3DBLB 4OIMA 4UKDA 1YVPA 4RGQA 3CXUA 1IOZA 5DBOA 4I9HA 1H4TA 1KZ4A 3G02A 2C2BA 3NYQA 1VKOA 4KR0A 4MRSA 1VP3A 4GKAA 3UK6A 3ZDDA 4C7KA 2IPAB 1GUYA 1ZH6A 2XE8A 1Y3CE 1M2OB 3IP9A 3ZJ5A 3HE3A 2R6AA 3DCYA 1F5SA 5ENZA 5GONA 4YMIA 2MT9A 3LWNA 3MS7A 3SSNA 2A3NA 3EFOB 2QOEA 1UH5A 3PUKA 1Z6AA 2HFKA 5JQGB 3SJ7A 3D3KA 1QQAA 3J7TA 4PZDA 2P6UA 5H3HA 4GHWA 1NUTA 2XDAA 4KJXA 1GRNA 3D5EA 5LSAA 3TJRA 4HAYA 2J0QA 4BC0A 3MJ4A 3OJWA 4X1KA 4XOIA 1D7AA 1XL0A 2RHLA 1SVNA 4YJHA 1QPGA 1FUIA 1XTJA 1BMQA 5HJ7A 1G7TA 4AICA 1V25A 5JS6A 3ETCA 4JT8A 5LD2C 3U1VA 1RYEA 3A9RA 4JEMA 1C3LA 1TT7A 3AKYA 5DT9A 1YXMA 3SFTA 3T4XA 5A02A 4JBLA 3UENA 1DEHA 5F4BA 4DWVA 1QIGA 5LN1A 1IK6A 1TMOA 1ZSVA 3CLSD 4NENA 2QUHA 4Q0MA 3RKSA 3ZE1B 3ZCSA 4HNTA 3HEBA 4YJKA 2BH9A 2WG1A 5AKYA 4QTYA 4UOEA 3W3ZB 1QO9A 4AMVA 1W36B 3KYDA 4JBXA 4X1KB 1U0OC 3NYWA 2PZEA 4FONA 2H9IA 1DPGA 1M8GA 3NHJA 5T8KA 1YA4A 4J8PA 3V5NA 2WPDA 2HXGA 2B35A 4RH3A 4EY6A 1LTQA 3RT1A 1YS1X 1UC5B 2VAMA 2V9CA 2AN1A 2W8BB 1Z39A 4L0MA 3VR2D 2BFCB 3FDZA 2X3FA 3CUEF 3SKYA 1J0DA 3O26A 4XQ0A 1Y80A 4P3NA 4RJKA 1GZVA 5ER9A 2XDQA 3KR2A 3M6AA 5I7FA 4OBEA 1I6LA 1KMHA 2AJDA 4BKUA 4I14A 5CVVA 2ON6A 3WRYC 1MG0A 5FLKA 5JARA 4D9CA 1WY7A 3L7BA 4OATA 5CMLA 1KMMA 1W5EA 2GK4A 2R1VB 5H80A 3UHPA 4LY3A 3K70C 5F9MA 1IL0A 5G3ZA 4BY9E 1MX3A 1TQ4A 2Y1DA 4UM5A 1G20E 3BFKA 1T8UA 3I8XA 4DT1A 3ZKWB 3HDVA 3BL8A 3AP1A 1I3NA 2HL6A 2H08A 3P0JA 3PC3A 3COZA 2PGDA 3WWCA 5E7QA 3IIMA 1EP3B 3GNLA 2FRDA 2Y0EA 3I5XA 1XCJA 5BV7A 1H2AS 3ETLA 2XNCA 3G85A 1SU6A 4G9GA 4Z5XA 1FYWA 1AHPA 5JR3A 4HNSA 2EAUA 2QLMA 1KJNA 4I55A 1ZN7A 1D03A 2PMKA 1SM4A 1TKAA 5EFZA 4JC0A 4X6XA 3UMFA 2UXDB 1E1KA 1TIKA 2I55A 2O8CA 3A7DA 4ONEA 2ID4A 4CF6A 4PQEA 1DC6A 1WV0A 5K8VA 2V65A 4H08A 5BQ5A 1NJFA 1XP8A 2G17A 3HKEA 5JZ9A 2O3SA 1YTUA 3ZZUA 4KR6A 5E6SB 4YY3B 1THZA 1C9NA 2ECPA 4CTJA 5DM70 5C1OA 1Y3IA 3MRSA 1DC4A 2BFFA 1A72A 1DKNA 3IAM6 3HGTA 3OAAD 3S1LA 3KETA 4BO5A 2V8OA 2XB9A 3DYVA 3CLSC 4LHWA 3IUNA 1XQXA 3M6IA 2V96A 2DXIA 1KQNA 1JMKC 1NRIA 1OCEA 1TI7A 3VNRA 4S1OA 4Y98A 4DXDA 2QYOA 1JG3A 1U4SA 2CUTA 1XK6A 2GPBA 4GX1A 4XTRA 4AJEA 3TG2A 4NNPA 3K5HA 4H4DA 4PX3A 4DMCA 4GOMD 1AS2A 3KB1A 6YASA 2PPLA 5AHXA 2OBYA 4G9EA 3H8SA 2M32A 4Y2TA 3JATB 4BIIA 4BWVA 4HVTA 2YY6A 3VHLB 4F5WA 1EFCA 3FKQA 1Q83A 2QLFA 3SDSA 1CP3A 4Z1OA 2BEUB 2FRVA 2BI8A 5EY5B 1DV1A 1GNPA 2YJ3A 3T7IA 1EUCB 1P75A 4R7TA 2WW8A 4YXFA 3HXTA 1PJTA 1K7CA 3BDVA 1GD1O 1N75A 4R41A 2Z2IA 4LNUB 3SZLA 4DM7A 4N40A 2QW8A 1QV9A 5K0ZA 1K7YA 2WD7B 1Y3DE 1LCIA 4LAFA 3NEJA 4ETNA 4EPVA 4W99A 4UOZA 2FPWA 3GCDA 2JD0A 4YS6A 4BNNA 3VX3A 4KW7A 1TT5A 1Y1TA 4NFYA 4TWBA 1R6XA 4UAVA 1GQFA 5DFAA 4AO8A 5JQGF 5F2NA 1ZN9A 1E5VA 3KV3O 5G1NA 3AUJB 2FDXA 4I8XA 3U7IA 2GD1O 3H2IA 3UTCA 1XKQA 2BR3A 3KHUA 2SKCA 4K6MA 3V2HA 1P45A 3M89A 5K8TA 2PUHA 3OTHA 4Y7CA 4BNUA 5LQCA 2J07A 1P81A 2XQGA 5CW1A 4K28A 4IG9A 2JARA 4L6AA 1N6PA 3RSFA 1WXFA 1R5JA 4BX0A 1HXHA 1XDUA 2F4VB 1IY1A 5LB4A 1TPYA 4X8OA 4AX8A 1CEYA 3QEJA 5C7LO 2VXCA 1XZMA 2FCRA 2WUGA 2FW9A 2VT3A 1YRLA 1E6MA 3DOHA 1DEAA 1M1YB 3I12A 3L4EA 3OM1A 4ILKA 3TX2A 4JDPA 3KPUA 3VKUA 4DG8A 2YHSA 2A9QA 2IY9A 3M5CA 3LQ4A 3HKBB 3AG6A 2Q5CA 2I2DA 4Z4GA 4ZRNA 1I3LA 4MV8A 1T4CA 2ESRA 2H17A 3A25A 1K5GA 1ULHA 4HDCA 2E6UX 1L1EA 3KUXA 4R7ZA 3WYBA 1VOTA 2TMDA 1TIPA 1T9HA 3B1FA 3VHRA 3EGWA 2Q4TA 2AWNA 1JBEA 5ALWA 5DX1A 1W5SA 4B75A 1CJSA 1NFQA 1QG4A 1IATA 3GRCA 2OD9A 2JCBA 2PL5A 4GE3A 3Q9UA 2IZ1A 2QYTA 3P2JA 1COZA 1Q1ZA 2J4DA 3L1VA 3OH8A 5JNSA 1OGIA 2H0AA 4DJ5X 1LPOA 1X8JA 2EFYA 1DXOA 4B6PA 1VSUA 3R41A 2WQZA 1NLYA 5KNBH 5AKHA 5T6MA 1TDJA 4JLMA 3K6SA 4EA7A 3IDAA 1SKUA 3FXAA 3FGOA 3N39C 4MJ7A 2IK8A 1B6RA 5FOUA 5AM3A 5CDHA 3THWA 4WHMA 1Z5ZA 2ZSIA 1XLTA 2VSNA 1ULZA 3EZLA 2XVAA 3AIKA 3GGCA 3JRXA 3NKLA 3O95A 4Y6OA 3IB3A 4ZO9A 4KQJA 5H70A 1EQAA 4B8WA 1SD1A 2ZJ1A 3EDQA 3K16A 4M37A 4BCDA 2NUTA 1G6OA 3LVBA 1M2WA 1XDBA 2Z4RA 2DLCX 1N5KA 2I91A 3UJ9A 5JASA 1KJZA 2OG1A 5KAMA 5EJ9A 2QNBA 1P7PA 3OQOA 4NYMQ 2V4ZA 2YXNA 4I4LA 4IDHA 3UAWA 2DERA 1C1XA 2VI5A 4EPYA 3W04A 2FPXA 2BHRA 1NATA 4M8KA 3T7JA 5A5VA 4MDEA 2YJTD 2IPNA 4KE9A 1UJMA 3VGJA 4XWKA 2CHQA 5BW8A 3KZVA 1Z36A 3SSMA 3EB9A 3RGWS 4MWCA 2P9EA 1E94E 5IX8A 2BDUA 4RSGA 1V8FA 1JDNA 1V9LA 3WGVA 1A5AB 3AKZA 3L2OB 1T6NA 3U3KA 1F8YA 3FNQA 2JRLA 3WLSA 6REQB 1RFGE 3TXYA 2AOWA 5A5FA 3QU4A 5B1DA 4NDZA 1WCXA 1MA3A 5EKDA 4A73A 3OKCA 4R5HA 1E89A 2CW5A 3M83A 4PPYA 2RH5A 5K3AA 6GPBA 2X86A 3ENKA 4EGAA 1JEQB 4FEEA 5J1SB 1Q1NA 3KEOA 4MA0A 1Q1EA 2GM9A 5JFTA 5KOJB 3N74A 4C7OB 3NDPA 2EW1A 1KYZA 3K8YA 4BV8A 4BEBA 1YL7A 2QR2A 2YZ2A 3E15A 1D1TA 4Z0HO 1OWLA 1WHTB 1ESCA 2AX4A 4H1TA 4ZAXA 3DBHA 4U6QA 5B36A 2EFJA 5IVKA 1UF9A 5EESA 2LIVA 2ZITA 2FWNA 3B1ZA 5IAGA 5F7XA 4ALNA 2O54A 1IU9A 1C81A 1G64A 1PJZA 1A2OA 3FIUA 5JD6A 2NUAB 3UH1A 3LW8A 3UCXA 2BDEA 1RZ3A 1H5QA 2R60A 4JV5B 1ISJA 5LLTA 4PQRA 1SNYA 1XEAA 4NZNA 4D6YA 5JMTA 1UEIA 4AJKA 4XH9B 1YVUA 3PV0A 3DBVO 5AHWA 4ZOLB 3WGNA 1FQWA 3VX4A 2PJZA 2X1LA 2E3JA 2WSSD 3ETJA 4EZBA 4KLRA 1JEYB 1ZNZA 3FI9A 3D31A 2BH2A 1JA0A 1O97C 1QU2A 1ZGCA 3N59A 2XGJA 1NR7A 4KK4A 3SJBA 1QKJA 2RHJA 4AMGA 1L1RA 3FDFA 3ZD6A 3RYCB 1ZDMA 1ULUA 2OP0A 4OQPA 4ZQEA 1FL9A 3FSEA 4YJ2F 4PGHA 2NX2A 4EYOA 1CS0B 4FQ5A 4CG3A 1C3EA 2Y68A 1KSGA 4PIMA 4H17A 4OHZA 4QM7A 4RDXA 1HO3A 2Z8YA 4RX1A 4E07A 4GQBA 1SC6A 1UKYA 3PB3A 1S9DA 4K1XA 2REBA 4HD8A 4Q47A 2G1KA 4ZVLA 1NGSA 1EU1A 1DMSA 2QTGA 3I2IA 4N5DA 2I62A 5HKAA 2FQXA 2RSLA 3C87A 5LJLA 4P80A 3T1OA 1HE4A 2DQ4A 2QMOA 4LS3A 5A2GA 1T26A 3CH4B 2CYCA 1E9RA 3H8JA 3ONVA 3A06A 1OTXA 2OHOA 2VQ6A 2H9YA 4GI5A 4EFDA 2AN5A 3O92A 5JFOA 4WKBA 3O7WA 2XXAA 1YC5A 4OQLA 4J1TC 2X5XA 3TR5A 1A9XB 4G37A 1Z4PX 4CKWA 4PFSA 3RUPA 1DUVG 4QOEA 1EFTA 3EF0A 2WJ6A 1NBWB 1NVTA 4M3NA 2PZMA 3ET5A 2Z9DA 3ZR4B 5EEGA 5FAKA 1J49A 3R9KA 2AOUB 3TXXA 4FB5A 3VNQA 3PNSA 5E8RA 5I48A 1W48A 2NACA 3D1LA 3K9NA 1L6RA 4BQPA 2Y6VA 2OZPA 5J5AA 4Z4IA 2VF7A 2XD4A 4IO0A 2YFQA 5DF1A 1ZH8A 1P17A 5AOBA 1X13A 3VPDA 3QHQA 3VVMA 2HIMA 5KYWB 3FOCA 1KDPA 3TLKA 2LW7A 4XVHA 4DGSA 3DOEA 4YRSA 3HLYA 1XVUA 2AE2A 1GKUB 5L3QA 3RC8A 1XRPA 5DYNA 3LA6A 4GOND 1ML3A 5MN6A 4Z49A 1CQIA 1DLIA 4PFJA 2PXAA 4FDAA 1J24A 1IOVA 1D04A 1H69A 2HJVA 3PVCA 3RIEA 3V46A 4W5TA 3WB1A 3CVJA 2QG4A 3NFYA 3IOCA 3T61A 2CSXA 1EGQA 3A1DA 3KXKA 2ZBRA 1AUOA 1BS9A 2C98A 4JOBA 1P0IA 3HR4A 3EGCA 3QMVA 1NL3A 1KI8A 1CJUC 1I24A 4II7A 3ABZA 3KU4A 4MQEA 3JWJA 1UBFA 2WE7A 3PRKE 3EZGA 2ZS9A 4PYNA 1L5KA 1PZMA 2UV8A 4KMRA 3IHKA 5BT9A 3U7QA 3VYTB 4HDOB 4EP1A 4GI7A 3FROA 3N28A 5CT9A 4ETIA 5LLDA 3IKVA 2PXCA 1G42A 4U2BA 4TV8B 3U1BA 2KPOA 1T5HX 3SLKA 5C37A 1TJYA 2ZEJA 3OOWA 2DLNA 4Z2YA 3DEFA 1RD4A 4FI3C 3P9XA 3S1SA 1GRRA 1M2KA 4JBNA 2ECQA 4B6QA 5DBGA 2P2YA 5I5EA 1BE1A 2PYZA 2I4OA 4NBSA 5JRDS 2BC9A 1JFVA 3ZU6A 1LD3A 1RYMA 1BH6A 1I1NA 2DPYA 3A9TA 5TSDA 5LYJF 3FF4A 1GP2A 1Z37A 3D8RA 1SA0A 2G06A 2FPOA 1F38A 2B25A 2WF5A 3O1IC 2P4EA 2ZIXA 1JBKA 3G0GA 3TL6A 1TUBA 2IUFA 2XB8A 1G9SA 3VSCA 5AIBA 2UYOA 1UQUA 4ZAVA 4BNVA 3WJ1A 3BD9A 4RHUA 1ZOSA 3OQPA 3RRXA 3WGHA 3W5CA 1Y8AA 2YMLA 3I45A 4C0KA 3IOMA 2JAWA 2JZNA 2VSYA 5IWCA 5AR1A 2QTCA 4E46A 4OSEA 4MR8A 1M34B 1NZDA 3EOAI 1KY3A 2AG6A 4CF4A 2I78A 2Z98A 4G0PA 5LUBA 1XZDA 3QTBA 4HR7A 3RKUA 1JHOA 4DAOA 5IC4A 1MIHA 4O33A 4F9GA 1FTWA 3TTUA 1DPFA 3IV9A 4RK1A 5HM6A 4IIFA 4LBWA 1V3VA 2FSPA 2N75A 5G2OA 1YGPA 4KBYA 5CA0B 5IC5A 3R3HA 3CCBA 2G25A 3TLBA 5KIAA 4N8EA 7REQA 3FMPB 2JS7A 1UZUA 2ORED 3QH4A 1ORTA 2AUTA 2AX3A 4PYRA 4Y0NA 2WQ6A 1B3RA 1KDRA 1N5DA 1SRQA 1T24A 5IC6A 4EVQA 1YT5A 1C7FA 1C0EA 3HLTA 4JJ7A 4P82A 1K5HA 5F4ZA 3TRIA 4YAWA 1XQVA 2HA0A 3WTCA 4BV2A 3VKFA 4OIFA 2X76A 3TD2A 4ND8A 2B5VA 5FFFA 4B3HA 5LQDA 5JPIA 4JI4B 3TD9A 4MWOA 5D8DA 5CRIA 4BNWA 2ZBQA 1WETA 2WJWA 3E9NA 1RKBA 2VYQA 3CTMA 4WLVA 3M9XA 5A7HA 1VM6A 1Y5LA 1TEXA 2WOOA 3EF3A 5AD1A 4JWKA 1XC7A 2ZRJA 1UIRA 3QBDA 5EE3A 3GU3A 3GB9A 4X1IB 2RI6A 3CWCA 3F3MA 4HNUA 1L5OA 4F2PA 3EQ7A 3STTA 3FPBA 1GAJA 1IJBA 3ENZA 3KCNA 4P93A 5AKEA 4CTKA 4A2QA 4RMIA 1QNLA 2L42A 3KOOA 1P8JA 3OKAA 2YIDA 5AK3A 3S8MA 4MO9A 4DSTA 2QLTA 3ETGA 3M0EA 5I9MA 2XVYA 2OENG 2X77A 3BMNB 3NC4A 2Y0PA 3OQIA 4Q5IA 3R20A 3R8FA 4KLCA 1I5OA 3KXDA 4X1IA 3SDBA 4C6HA 3CLVA 5JYEA 4UNPA 1EVKA 1KEPA 3PKJA 2QZJA 1BKDR 1DKLA 1KEEB 1P9OA 2Y1GA 4WCFC 2NYAA 2VHTA 2Z3VA 3PWSA 4Q3DA 1KSFX 3CRNA 3K0FB 1DAIA 2ZJAA 3D2LA 3UB3A 4ZVOA 4D9GA 3EIOA 4NATA 5KZMB 1Z83A 4RW0A 2BUAA 2W2KA 3CNEA 3DO5A 4IR7A 2HRCA 3AJRA 4EFLA 2FU5C 4UFNA 3EZYA 5IF3A 5KB3A 3TQOA 3A0RB 2EJUA 1P0FA 4IHJF 3TFWA 5KMGB 1P74A 2IU0A 3A6JA 3TLZA 4V0KA 1Q95A 1E9SA 1ND5A 2BE7A 4C5AA 1E18A 5E0OA 4ARZA 1HEUA 2OZVA 1DELA 2F8MA 2FUCA 4FS3A 4BVAA 2A30A 5DTEA 1TJ5A 4G5XA 3O2SB 1Z15A 2BW0A 4UJ3A 1EA5A 2CDCA 3EVTA 4EG7A 3D3NA 3K0KA 3VR4H 4X6UA 3EIXA 3S55A 3SDZA 2CVOA 3NONA 1CUUA 1WXEA 1EDBA 1USVA 2IC5A 4ENVA 3DUFB 5G41A 3V32A 4S24A 3HJRA 1QK4A 5KMGA 4M76B 1RLOA 3DLAA 5ED4A 5FUMA 1P7CA 3V80A 3LY8A 1CUEA 3E4CA 1E2IA 5G02A 1WSDA 1CZNA 1W34A 3MOGA 4IKEA 1A8UA 3MS4A 2HA2A 3FAZA 4RADA 5BNFA 1M6EX 5DGHA 3RS4A 3ZDRA 4RFSA 1P18A 4NE2A 4EW2A 1PJ8A 1YQEA 1XVLA 4WKOA 1XMPA 5B1IA 3UMGA 4YJFB 4AS3A 2JGFA 2Q6IA 2W2LD 1GFSA 2QY9A 3OE7D 4BLTA 1LQTA 1T4GA 3OURA 1W0CA 3P2MA 4WOJA 1QF7A 2ERYA 2C3OA 2DRIA 4WZAA 3KFXA 4YYEA 1H2BA 1WDLA 1AKNA 4MV9A 4RA9A 1E5XA 3U4IA 5LJIA 3IKJA 1FP2A 2A5FA 2O0HA 4JL8A 1XRJA 3IP7A 4N5NA 2FG6C 1TEVA 1G5HA 4ZVPA 2XDQB 2GZMA 2A59A 3UCFA 3BHMA 1P4HA 1Y33E 3AEKB 4DMKA 1X7WA 4TT8A 3DE6X 3S2FA 2H5LA 4MEAA 2XYVA 4A6PA 1RYDA 2G9NA 2HO4A 3ZHUA 1FFWA 221PA 1WIWA 1YVRA 2J3IA 4LFCB 4RMJA 2CXRA 3UV3A 4JYAB 4B79A 3DUWA 4FMBB 5ES4B 3U7FB 4CIVA 5GWXA 4EMUA 3EY9A 3L6CA 3TG8A 1S0UA 1PSWA 1A27A 1JDPA 1RAAA 3SS9X 4W1SA 2HY7A 4HVLA 1SKYE 3DWFA 1NNSA 2A7QA 2WFLB 3P2YA 4CEHB 3QI2A 1NBMD 1JHQA 2IYVA 3I2FA 3AERA 4GG1A 4QSMA 4KQCA 4P92A 4HEQA 4B17A 5DNYB 5L95A 3OM9A 2IYOA 3AFHA 5I01A 5AM1A 1DOZA 1LJLA 1FNDA 3LC7O 3S27A 2UYYA 4OI0A 5TMDA 2RK6A 1GUBA 1N2SA 1Q1GA 3AL2A 3P9PA 1PL8A 3MN1A 4PXSA 3ZJVA 1VB5A 3UK0A 4EF6A 4EVRA 2C88A 3JD3A 1QHEA 3K0BA 3CH6A 2KLBA 1YRHA 3GLRA 1ZOIA 2UUOA 1TCAA 2J3EA 4DJJA 4BL5A 1XHEA 1JPVA 1XLVA 1C1DB 1AUQA 2WFLA 2HPZA 3IUYA 5F2OA 1YVDA 4KR2A 1GA1A 4MYUA 5LUAA 5H3LA 2YNMD 1YB2A 3ED1A 1TCUA 2C8VA 3AHCA 4HPWA 1XP5A 2X8JB 4OFXA 1AO0A 4S3MA 4A03A 1U8AA 5C1BA 5G4KA 1YQDA 3IUEA 4KYTA 5BURA 4YRFA 4RKWA 3BFXA 1VPTA 1Q19A 1A3CA 4FYXA 1PR3A 2G40A 2YVKA 3H9EO 1N1DA 3PTZA 1QU3A 4TKVB 3KQKA 3TH5A 2DC1A 3GFPA 3LKVA 4FFDA 3DTVD 3JYPA 1ZBDA 1I6WA 4RKEA 5CEFA 4C05A 2J3MA 4D9FA 2IE8A 3C8DA 2PH3A 2CK3D 4KSYA 5E2BA 4HH1A 5ESDA 4DNQA 2ZUSA 4WUTA 4CIDA 4NCXA 2UUAB 2AIRA 1JBQA 2Q9UA 4EJSC 5CB6A 3MFQA 2GGSA 4NU5A 1NE2A 1AN0A 4ZI3A 1ZH2A 4YUVA 4V1CB 1Q2UA 3AIIA 3HYSA 3NGLA 5K6TA 2O5RA 3FD8A 3H2HA 4IUYA 1V3QE 4W5HA 1A8PA 2CFTA 5E1BA 1Z56C 3NNSA 3N76A 5C5EA 2AMLA 1GGMA 3DM5A 5K8IA 2P5YA 1MQSA 1GPAA 5KEIA 5FHRA 4DJAA 1L5SA 4QDXA 2ORIA 4JT4A 4YEDA 1Y7LA 2O5CA 4PHCA 4YQYA 3ZVRA 4ZCRA 4S1VA 3LXUX 3QEOA 4GRIA 3ZVLA 2B4QA 4OJYA 5B3JC 3TEMA 4AYTA 4WXPA 3ZLUA 2NU9A 4Z9XA 5EZ6B 2PUEA 3K09C 3K1TA 2QJRA 2P2LA 3JARA 3O4HA 4PCUA 1S8NA 3LY5A 5CT8A 5D86A 3TIIA 4GKJB 3ROKA 5L51A 5LMNB 3AESA 1OU0A 2IHBA 4K9NA 1B43A 1H2WA 5HS6A 3UW1A 1AXRA 1Y89A 1HQYE 1PL7A 4BAUA 2ZI3A 5HYVA 2O8EB 2C7GA 1JECA 4ZMRA 1QAQA 1XTRA 3KYCB 3MD0A 3FCUB 2IXFA 5JDCC 4RQTA 4IMJB 4Q18A 4MUMA 5EGNA 4D2IA 1FJ2A 2HMWA 2WVAA 2FFBA 3CRZA 4W8HA 6AT1A 5K0SA 3E9DA 3BVPA 4G41A 3CLKA 5CFRA 1KETA 3KQHA 2BY4A 4MJLA 1O95D 1G5QA 3M3DA 3VYWA 5ICSA 1CQIB 1DC5A 2K87A 3KU1A 3PC6A 4Y9DA 3BE4A 3PR2B 3H7AA 1VI6A 3BSWA 1L8AA 1T9BA 3DO6A 1N6LA 3G2QA 3N0VA 2A4KA 3DAHA 4XCXA 1V43A 2CNWA 2FSIA 2P6NA 4U7JA 2IDZA 4Z9BA 3S4YA 2ZGVA 4UPEA 5BVGB 4LF9B 4ER7A 4P4LA 3O74A 3OX2A 3HU3A 4MQ4A 3HKDB 1FXWA 4FGKA 5A5DA 1S9HA 3OX1A 4ESHA 4B3GA 3EYWA 3B85A 3E61A 3MCUA 5IDXA 3ELWA 2DKOA 5F98A 4MS1A 2D2EA 4TLDA 2IOFA 2VDNB 2CKDA 2NU6B 1XTTA 1QHFA 3NV7A 4PFKA 4BLRA 5F7OA 1WWKA 3IIJA 2LXNA 4NXNB 5DWDA 3FGNA 3IMCA 4BFUA 1T1EA 4WCVA 1Z6PA 1G0NA 3VXKA 1HA3A 1VL0A 1LFAA 4BMCA 2FN4A 3L6BA 1ORIA 2YWJA 2QTTA 4Q34A 4D4HA 4LA4A 3NNDA 2JB9A 3BIWA 3CZ5A 4G25A 1Q3KA 3UF0A 5BUQA 2FWBA 2PQ0A 4ZAFA 2J9FB 1Q15A 3H42B 4X92A 1AOXA 2MR6A 4KNVA 4RA6A 3TW4A 4JI5B 1DZIA 1U0TA 2G67A 3WDMA 3A2MA 4C1BA 4BXOB 2FW6A 1CLEA 5TS3A 3RC1A 3Q3VA 3SJCA 2GN4A 4ALJA 4YCMA 3AR9A 3OIUA 2H59A 1FDVA 2JBHA 3N2LA 4LSMA 5D85A 3U9LA 2CFOA 2OGTA 1ZRNA 3ANXA 4WV3A 5AW0A 4R4JA 1RBQA 3TIGA 5LMCA 2AHRA 1KWKA 2JCGA 4EKDA 2FEKA 1QONA 4S05A 4XLZA 4PSAA 2JLSA 2ATEA 1JB9A 3K9CA 4WDQA 4Y9UA 3VU9B 3U5TA 3QK7A 2YIVX 3PUYA 4N6GA 2CXNA 4F5DA 5GM2A 4N3NA 4PWYA 3TTXA 1BH2A 4LRYA 5FBVB 2GPAA 3Q6MA 2QR3A 2VQEB 1PWYE 1ECJA 2J7PA 3I92A 2EDAA 3HCFA 2AUMA 3JYNA 3K0AB 1KFEB 5LZ8A 2D2FA 3ND8A 3RUHA 3NJ4A 1FFHA 3B8HA 2QV7A 3IUBA 3TSCA 2QPOA 3N0XA 3W9SA 1T0PA 2GSDA 2W0SA 1Z0KA 1D6SA 3G89A 3KTFA 4Y1RA 5CM9C 4BAZA 1LKZA 2RARA 1OI2A 2UVPA 3TDNA 3W8DA 1XMVA 4BLVA 2O20A 1FOEB 4QC2A 4AB1A 3U16A 2GK3A 3WRXA 1ZGHA 1WPQA 1KY4A 3RS9A 4DLWA 1K8XB 4QL3A 3E18A 4WJZA 5IXYA 4MLDA 4JI7B 1W9HA 3IE2A 3M5WA 4WZAE 3R9IA 3GGGA 4AY2A 1ZCBA 1K3TA 1ZKMA 2ZIWB 3AL3A 2AR0A 2Q0QA 5GOZA 2NN3C 1UDWA 3HXMA 3CXRA 3K0EA 5FPSA 3TKYA 1YACA 2NW6A 3LXXA 3SEAA 4G0UA 4IEIA 5CT4A 3NIBA 3D1VA 2L82A 1VLLA 3WGOA 4Q1FA 4I6JA 1DINA 5AK5A 3WK6A 3KVRA 4H7DA 3ZQJA 3QHAA 3NHSA 4QU9A 5CA1A 3LKDA 1D5CA 2DB3A 4Q9IA 1D7OA 5M34A 3F2IA 4LK2A 5COQA 1XEWY 2ZSUA 4UHFA 1J2EA 5ILQA 5A3SA 3UJDA 5ALQA 3SQWA 2QENA 4C4OA 2G0NA 4G4SP 2QA5A 2Z0MA 4ZCQA 4BVJA 1YI0A 3BK2A 4TXJA 4PO1A 3GNQA 4P7GA 3UUFA 4JI6B 3PTLA 4IYRA 1KFCB 2AH5A 3EGEA 3FTQA 4D3XA 3WP1B 4QPJC 1M2FA 4WVLA 3QYFA 2QRMA 3A1NA 3B53X 4NOKA 4O4IA 2IYEA 4R1NA 1NMSA 5K0EA 1NHWA 1CEQA 4NYJR 4H0FA 4EW6A 4DV1B 1BFKA 2FEPA 1BVRA 1Y4UA 1OBCA 5LZ2A 4Q9NA 2VJQA 2XUFA 3K70D 3OUTA 1YRQA 4D9NA 4EO4A 1YVEI 2FR0A 3GD5A 1L7VC 3LX6A 3OHSX 4UU1A 1EUQA 7ADHA 4CDGA 4KXNA 3TQQA 1O6BA 2FFRA 1V3UA 2GBGA 4L3WA 5KNBA 1E77A 3DAYA 4BKOA 3V8QA 1ZMBA 1QBKC 2IYUA 3UMBA 5D2CA 4JL5A 3JRNA 1DJQA 1JQBA 2I7CA 1XZCA 3DMHA 4TTRA 1SPXA 3E05A 4XWYA 3HB4X 5JPDA 2XA9A 3GGPA 4MW2A 2QUKA 2G82A 5DNAA 2N42A 2PIAA 3E9CA 1JKIA 3SYTA 3WGTA 4UM9B 1SVMA 3EPRA 1TOAA 1UMCA 1UZNA 1Y5MA 3O4GA 4D82A 5CB4B 2OZLA 3COJA 2G8LA 1PEYA 5T4HA 3SS8A 2HSWA 1U7XA 3O3OB 1ZI8A 3S2IA 3GA0A 2NXCA 4IJUA 4OM7A 3T9CA 1KQ3A 4INZA 3BUSA 5CB8A 5J23A 1EJ0A 1O54A 5KVCA 4QXOA 4N48A 1D9ZA 1X70A 2HA3A 3K2IA 3MSXA 1GARA 1E9VA 1U2SA 3ICOA 2O0LA 3LPLA 4GX2A 1KJWA 2C00A 3BFJA 3BEDA 1A9YA 1GG2A 4AJ1A 1XN4A 2WDZA 3DZCA 3LHKA 4XGRA 1C1YA 5DGXA 1AJEA 1RE0A 1WEHA 1ZM7A 2OB2A 3EQ9A 5BQOA 4L4UA 1RI5A 4AT1A 1YF3A 4ZVTA 1HQCA 1PUXA 3D81A 4P0QB 2QSYA 4A6XA 2EIHA 3K20A 1DC3A 1RI3A 3KP1A 3G2JA 1HLPA 4KFRA 4BFXA 2CJYA 5EPUA 2BFBA 1Y48E 3DM9B 4FW9A 3UMJA 4ASUA 1U1CA 4TLCA 4J75A 3E5HA 3UXYA 3HI6A 1II8A 4P2GA 3F5DA 4RC9A 3UWPA 3VH2A 2FWAA 3ENQA 2JKZA 2XF2A 1GYRA 1EKXA 4LNHA 4Z9AA 4EFMA 1IBCA 3IP6A 5EUCA 3PIIA 1SBQA 2ZIZA 4HTAA 4RCVA 3Q8MA 2B8WA 1BJRE 5FOXA 4E70A 3UOGA 2YYSA 3PFKA 2XT0A 4R6WA 1LK0A 5HQ3B 3ANNA 4GC5A 4WW0A 1EFAA 1XXHA 3CZMA 1MQ9A 3KZ1E 3RYIB 2BFBB 1W75A 3ONFA 4B4UA 5AJVB 3NTQA 2JG3A 4QVIA 4QXMA 2A6PA 3T7TA 4FFPA 1YB7A 2E87A 2AXQA 3HB1A 5H9VA 2E85A 5DSTA 1YB5A 1TTTA 2ZRQA 1S96A 2OD2A 4JJAA 1CR4A 1YV9A 3KYIB 4GEGA 4WFJA 3EF1A 3B2EA 3DTVA 5DLPA 4XLTA 3PL1A 4RVFA 1RW4A 4L75A 2JAPA 1EMDA 5A5GA 1SXGA 3TIVA 1EK1A 3EMKA 4JLSA 1P77A 1N9ZA 4PYQA 2C0CA 2A9OA 4UUBA 5BNZA 5ADWA 3MMNA 2VC2B 3U7QB 5KWIA 3PTAA 1X7GA 1BXZA 5B7PA 5EJMA 2I99A 4TRMA 5K3FA 4X93A 4J1TA 1TMYA 2CXQA 1EM8A 3AFOA 2H54A 2P5TB 1NZFA 4OXNA 1JR4A 4L76A 3R5JA 1E3TA 4E22A 2BFWA 2AQHA 1JEOA 1WUTA 5EJEA 3H04A 4WN9B 2Q5FA 5DHRA 2O1SA 4ZVQA 2NTVA 3TXAA 3OLQA 4Q4HB 1R8SA 3DGEC 4M0UA 1WBBA 5JMPA 5K6AC 4QOJA 2HIGA 5LYJB 3G0BA 2ZSKA 4MEBA 2ZZNA 3NBXX 4CLRB 1QDUA 1QXSA 2ZJBA 3CLHA 1RQ7A 1T6XA 4RVNA 2YWXA 4IIHA 3K6KA 4LOIA 1Y82A 4GNRA 4F92B 1Y42X 4IF6A 3RBXA 5LNK6 1G8HA 1TAHA 2JEOA 2PKYX 3DOOA 4J03A 1BZYA 3PYXA 3RSOA 3QGMA 4JYBA 1KXZA 4R83A 3RRZA 2E49A 3SOZA 4BOYA 1ENYA 5BORA 3FF1A 2C2HA 4Q03A 2R6FA 4OOFA 5IKXA 1Y63A 3PK0A 3HRIA 3VOTA 3MJHA 5C7IO 2C99A 4LWOA 4MVJM 1T8SA 3BOSA 3SNHA 2EARA 3D4OA 4GYWA 5DCWA 5BYKA 3LVFO 2QE6A 5TMBA 2C2KA 3AI1A 4HX5A 4G63A 1ZISA 4HEHA 2HM7A 4GM1A 4MP8A 3MWLA 2W11A 1POXA 3U5ZB 2YBEA 2ZRLA 2ZOSA 2AI3A 4FOLA 4IUCS 3UN1A 5C9ZA 1VMAA 4DLSA 4O4HF 1LVGA 2B20A 2WF6A 3E2MA 2Z3ZA 4G1MB 2FMTA 2X8LA 3N2IA 1JFFA 4PCAA 4X1OA 3QX7A 4BFTA 3A6LA 3E23A 2Y2VA 4YIHA 2ZRBA 4JJFA 4HATA 5DCLA 5AVZA 1WCV1 1K5PA 3EZFA 4UXHA 5B3LA 5K99A 2P9TA 2HZ7A 4UNNA 3BHNA 2FG7C 4B47A 1RLJA 2VTVA 3U62A 4M8NE 2IU6A 1X0XA 1RWQA 3DZHA 3NP9A 1ZL0A 3KSRA 4UBMA 4J3NA 5AESA 1CF2O 1ZH0A 1WMEA 5NLLA 2QQ0A 1WXGA 4IV8A 3C3DA 3M34A 4KVZA 4KXYA 3TBKA 3UV7A 3HNOA 2GVNA 2PAAA 5AWFC 1K4MA 1MB4A 3RVPA 4M87A 1O89A 1E2BA 5JO0A 2W0MA 4PZLA 3VAYA 3NHFA 3L79A 3KUCA 2P8SA 1PGNA 1SVWA 1C3JA 1BHO1 2QLBA 1F2UA 4BLPA 5KTRA 4G4IA 4A0GA 1ZQ1A 4DZRA 3CNQS 1WA5A 1TA4A 3AXSA 4OVKA 4HEJA 5FOWA 5JQWA 2V7EA 2E4VA 2AEMA 3WQSB 3A7EA 1RXEA 3L1IA 2DX7A 5KVSA 1ZHOA 4EMSA 3I83A 1W30A 3U17A 1TM7E 1FUYB 3B13B 1IBRA 2ZUCA 2G08A 4OM8A 1XZJA 3BMNA 3OQIB 2RGYA 4FVTA 4TV9B 1K68A 1KDYA 4KDEA 3W7BA 4G0YA 4IOKA 1RBYA 3OECA 4RTMA 3IEVA 4RUKA 4JD5A 2H4XA 1ZC4A 4EHAA 1IBSA 1QDEA 1CNMA 1II9A 3QX3A 1CV2A 3Q5DA 2I4LA 1OREA 3LY9A 5IJWA 4W1QA 5FUVA 2IT1A 5JNRA 1QF6A 3H5WA 2FK7A 3M9WA 5C4GB 3G9ZA 3N7TA 1P3JA 4BLOA 3UV6A 4YMLA 3HXKA 4IVQA 2IHYA 4H60A 5JCZA 2GUWA 1QWSA 2B8JA 3FLAA 1IZ8A 2HBZA 3R6TA 4ID9A 4YV0A 2FPSA 3RNLA 4R9NA 3GLFB 1U0EA 1I0ZA 1FC0A 2X0EA 1G63A 3BB4A 3UXMA 5IANA 3R0ZA 4JB2A 2GOYA 4CMAA 5CDFA 1PJRA 2GJAA 1FDTA 3TINA 2ZFUA 3DCIA 2ZJ6A 4N49A 4PONA 2BHNA 4Q4HA 1RFLA 5ECWA 4YRGA 1T1GA 1W5FA 4WE3A 4WBSA 1R6VA 3I9JA 1HV8A 2DTDA 2YWCA 3F5MA 3PHGA 4ECAA 5IZ4A 1M7BA 3SHFA 1QCDA 1HOXA 2IYLD 2HRZA 2P41A 3F7MA 4FBMA 2RIRA 1SOMA 2F17A 5CB4F 1DAGA 1SUPA 2J0EA 2FSFA 1U4NA 1VRWA 4KI7A 1TRKA 4MARA 5DHUA 2ZM5A 2NAPA 4OGLA 4UUMA 3PENA 4RBNA 3C14C 4MB0A 4GOXA 5IPFA 2ES4A 2WT8A 2WT9A 2VBIA 3IPAA 3RH0A 2QM3A 4N41A 3D8UA 2IUTA 2Q3EA 3OJFA 4AURA 3ITDA 3L41A 5CVDA 3PDJA 5KSWB 4H3KB 4OF4A 1PR1A 2Y9MB 3OT1A 3BXOA 4U63A 1MDFA 3K9WA 2R3SA 3FHOA 1XCBA 3NH9A 4XARA 5DNEA 5FI0B 2VR1A 1COWD 5JHHB 1SCJA 3VNUA 4E5NA 4HMPA 1B16A 4OD0A 2YYZA 4OOEA 5GONF 4E5UA 2J0UA 4UUPA 1E3SA 1ZOLA 1R0CA 3FCCA 4JLVA 1SHUX 4ZEVA 1MH9A 3Q3IA 4XX1A 3CEMA 3SF0A 1Z7GA 3LZCA 1SVSA 2CLKB 3CF0A 3SEFA 3V4SA 1EG7A 3U4AA 2IIPA 1UBUS 3LYLA 4A0HA 2YRWA 4MCHA 2P3LA 3CCCA 2WUVA 4JQSA 4ZVRA 4I55B 4LNAA 4HFNA 5K6RA 1PQUA 1QS0B 4ESVA 3JTMA 1V6CA 1YI8A 2XTJA 3DTNA 4MRMB 1JFTA 4KPFC 1R7RA 3JYOA 3DDCA 2A0KA 2CMFA 3FDJA 4FFRA 4C2TA 3OETA 5TPZD 3W1EA 1PP4A 2QXUA 3EXIA 2NXWA 5DKFA 3F6YA 1MF7A 2W98A 3NFRA 3DKRA 4RKFA 1QHHA 2H92A 1RPJA 2ZRAA 1EVIA 4BO9A 3U4DA 3V7UA 4PX9A 5DN6A 5KYNA 1DQRA 2RAUA 1MHTA 1CQJA 3FOFC 3SN6A 3KJNA 4IJWA 4HGYA 3SHQA 2VJYA 2HYIC 3AZQA 1X6VA 1TD9A 2YV5A 1GRCA 1W1IA 1UXIA 4Q1DA 3L7AA 3JQCA 4YXWD 1R9GA 2X15A 3MRTA 3BWMA 1PWZA 2CL0X 3TSYA 4CT0A 621PA 2C9CA 2JIZD 1PJBA 4EPXA 5H68A 2HF7A 1K0UA 4KLZA 2YV3A 1E2LA 5LP6A 1G5PA 1VI5A 3QU9A 2Y9PB 1P6QA 4CIAA 3TI9A 1IWBB 2IZ5A 3PUIA 1HY3A 1A71A 2OLKA 4XJSA 1R00A 4V0OA 5SYNA 1DRJA 3C5CA 5CNMA 3W5JA 1OSNA 2D0DA 3ZGXA 1OT3A 4TV9A 2JI4A 2VDMB 5E3JA 3GOQA 4MVJD 4DSAA 2WUFA 1ZONA 1UJCA 1XZAA 3GLUA 4X3CA 1R6UA 4AZ3A 3CW2A 4OMUA 1F4PA 4EY5A 3GR6A 3FOWA 5G0SA 4JKOA 4UHBA 4L73A 1Q7CA 1T8RA 2WTAA 3F3YA 3HP1A 5HKLA 1E3EA 1N6NA 2FUNB 3CG4A 2B4TO 1NBMA 5HIMA 5FWAA 4AY3A 1RC0A 1U9YA 2JW5A 1IQUA 3MTBA 3SF8A 4JYCA 5A3QA 2X5OA 1P19A 2P65A 4A1OA 4YPOA 2XXBA 2PX2A 4RETA 2R6DA 2XRZA 2J5XA 2YWFA 1D2GA 3KTOA 1SU8A 5IEBA 2FXIA 1AZSC 3NX4A 4OHVA 3RVSA 3TOSA 5FEMA 1YR8A 3WGGA 4ER3A 1ID1A 4B48A 1H42A 4J9VA 2XF8A 1CR6A 4M7PA 1IZ0A 2CFCA 2Y4NA 2BMEA 1FA9A 4QO7A 1RIFA 1XWWA 1X0VA 4RE5A 3EW7A 4D74A 4EHIA 3EMBA 1REQB 4AKTA 5DHTA 2NPFA 1YJ5A 3C4VA 4HAUA 3LCRA 4W6ZA 3ZZ0A 4HJXA 1UAGA 3GUYA 3UK1A 2QTMA 2ZJ4A 3IPLA 3CVWA 1W0JA 5J43A 2J4CA 4BNJA 3G5MA 5K0NA 4EHDA 1WULS 3MMSA 1WMDA 1P1RA 2ZQZA 2P40A 1XF9A 3H9QA 3HKDA 5J9FA 1OTYA 4BFYA 4DMMA 1X42A 3GDGA 2QY6A 5CG2A 2M9MA 2QGNA 3A4LA 4LNUA 1KTVA 2FUKA 3O4JA 4UPVA 2QF7A 3D7SA 4CG0A 5KYGA 1PZNA 4O4IB 1Z4KA 5TQ2B 5AJXA 2QD5A 3MWEA 3BH0A 3OY2A 1PSDA 4FT2A 5IAEA 5FAXA 4MUKA 3LKBA 3FCOA 1EAMA 3IR6A 3BIFA 5CP8A 2IDKA 3OMWA 4QQNA 1AKWA 2OP1A 3I2GA 4I3FA 4EENA 1ZRSA 3WRWA 3P94A 1L1QA 1WVIA 3H2JA 3I9OA 3OTQA 1W85A 1P7VA 2ZSJA 3L4SO 1U7ZA 2GO1A 2XVZA 3DKVA 3IPRA 3T0FA 4BNTA 4HUJA 1CF4A 3HBAA 4U0KA 1L7MA 5AVTA 2MHCA 3SZGA 3TUJC 4BMNA 4FNAA 2GPNA 4NESA 3HP4A 2NG1A 1XF1A 2OXRA 3OQVA 4Y2RA 4Z1MA 5AW2A 5KKNB 3M4JA 1R5OA 4MQFB 3PFIA 4HAVA 1YBHA 4N5HX 3HKCB 2IEZA 3A9UA 3I9V6 2VJOA 1A77A 1TUEA 3MTDA 5AO9A 1NAIA 2X0FA 1U02A 1LI4A 1T35A 3GLHB 4JZYA 4NU6A 1WUKS 3RWBA 4HLDA 3C97A 1PT8A 2VYNA 2C57A 3VZRA 1UIMA 5JVDB 3W5VA 2D2IA 5K1ZA 4B8YA 4US2R 1ZW6A 1UCFA 2C3UA 3KM0A 4IFBA 1QFSA 4IGAA 1NY5A 3UQZA 3FPEA 4JJEA 3D6TB 5AI6A 4M0LA 3IAS1 2YX1A 2OV3A 1SA0B 2D74A 2B3TA 3TW8A 2GD2A 1Y98A 4QA9A 2IU3A 1F4LA 1MJ5A 4XDYA 1OZGA 3PPIA 1YKSA 4L85A 4KGVA 3ZE2B 2F00A 1SUEA 2H2FA 4B3TB 5JSZB 2O8BB 1MO4A 821PA 2HKIA 1U1EA 2VBFA 3F7OA 3QEBZ 2BD0A 1WJGA 2B8TA 2DCUA 3D64A 1NY6A 3GVHA 3P71T 3UG7A 4CEIA 2VP4A 4KWHA 1SFRA 4DLUA 5DCYA 1KKLA 3DE3X 3OQ1A 4R1PA 4L4SA 2ZYAA 1ONNA 3EK2A 3D6JA 2FOLA 4KXXA 3Q5GA 4EG6A 1LZKA 2Y76A 4DBVO 2ZANA 3E9MA 1AMOA 2H48A 2PQMA 4NZYA 1X1RA 4XOUA 4ZC1A 4JXZA 2IRWA 3Q2IA 1RQGA 2IHJA 3H1TA 3LP6A 1MEJA 1GL3A 1KO5A 3A58B 2QTWB 3MMPA 1PZGA 5M7EA 4N3AA 1Q0HA 5CG1A 5FUBA 2OVFA 3FYUA 3QUTA 5AJUA 4RKRA 1MMFB 3VZSA 4BGUA 4EKYA 3HWSA 4PO3X 4Q48A 3N8HA 2Q7XA 3A1FA 3M33A 3EQ8A 3JQBC 4AZ3B 1RM4A 3O8BA 3AHHA 1YRBA 2FMIA 1GL9B 1XPOA 3I62A 1GSAA 4GAEA 4PZZA 5DGDA 5JS7A 4CZ2A 5CH8A 2VJNA 3Q8LA 2HHLA 2QX8A 2ZTVA 3ZW9A 5JALA 4NK5A 5KDOA 3CEPB 3H1GA 4U02A 8LDHA 3JQAA 1LLDA 3U3DA 2OCLA 1SEPA 3ROTA 3JV7A 1TTHA 1PEKE 3FR7A 3MERA 4MVJI 1N0VC 1ZG3A 4I1UA 4WK4B 4ZO6A 4PC7A 5IVDA 3RRMA 3WVNA 3DXXA 3PGKA 3R6WA 1G38A 5HTOA 3EA4A 4I36A 1KARA 4P33A 3TTWA 1ZI6A 2ZIGA 4UNSA 5SYMA 5JXHA 1LK5A 1NJ6A 1WF6A 4HDSA 5D84A 4X1YA 1W94A 2SKDA 4N7RA 4CMJA 5I3ZA 2VQ3A 4HUQA 2PSDA 1VFNA 5AHKA 2H4JA 3BILA 1XMOB 1FEZA 4BATA 4OYRA 2PGIA 4EJFA 1BE8A 1YZ3A 3AETB 3KQSA 2O9JA 3EGDB 1H6DA 4ZI2A 4TLLB 2JIQA 1COWA 1W4ZA 4DWWA 1D8AA 4MRNA 3T3PB 3T5AA 4JUDX 3PNMA 3GLIB 3OE5A 1M34A 2DFNA 5EHZA 1T0BA 2ZJ2A 1AGNA 4D9EA 2VT2A 5A62A 1DXQA 4OHUA 2Y99A 3R0VA 2VH1A 2BDTA 4YT5A 4Q4LA 1Y81A 2VNJA 2IUUA 5CB4A 1ONSA 3GEPA 3H2KA 4JIMA 2EKBA 4F7DA 5MF6A 3CVYA 2C58A 2FWMX 3QEMA 2LTAA 2ZT8A 1U3VA 2CLCX 2WG0A 2YJ5A 1OX6A 3KSZO 5TF4A 5CPFA 1CY4A 3R8XA 2ZAMA 3TZLA 5M29A 5IUJC 3WHLA 5A4KA 2H1IA 2BGTA 1KAMA 2I4IA 1GTL1 3L0SA 1YDGA 2E5WA 4A82A 2C29D 2I3BA 3VVCA 1R15A 2JGDB 3PUZA 4NOMA 4KIJA 1X1SA 3LVRE 2X1HA 4XB2A 5DOZA 3NTLA 2G1JA 1CIJA 2VJMA 1KAGA 4BAGA 4BB9A 3BQMB 4IX1A 1DO8A 1DJMA 2QX7A 4WLEA 3PD1A 1OAOA 4HTFB 1QIHA 3RVLA 3D0RA 4I5GA 4CMCA 1XNGA 4ZMSA 2VLBA 3D0KA 3U31A 3EPLA 5KCZA 3PIRA 1JP7A 1PTJA 5AM5A 1FMJA 2XUJA 3B60A 4B6EA 1JH8A 1TO6A 5K8CA 2ETVA 4LGYA 4R8LA 4D57A 1VHWA 2W6JA 4MKZA 4P34A 1F0NA 1B1CA 1LF0A 2IXDA 2QIPA 3W5AA 2HQ1A 2D3TA 1VIAA 5IKMA 5BSGA 4GGMX 4MYTA 4F9FA 1S8AA 2DWQA 2YOGA 3HABA 5K0FA 4I2VA 3FSRA 3Q72A 4HXYA 5BSVA 1TFUA 4BLWA 1TZBA 2BEVA 2XBLA 3TMAA 4EUFA 3QW4B 4GUAA 4V02A 3WFIA 2R84A 2ZBEA 1OFUX 1ISPA 3I3SR 4OKSA 3BGDA 1TKRA 2IZOA 1HL3A 2XUPA 3U7GA 1JYEA 1A8IA 3H0EA 4ZVNA 4FFMA 2O2ZA 3K9HA 1HLFA 2Z43A 1OBFO 2BF4A 1WY5A 2EX1A 5DTQA 1GNTA 3GNSA 5GJCA 5HFNA 3B36A 3ZDEA 3ZY4A 2IPOA 2VKTA 1LC3A 4Q05A 4RM2A 1C8KA 1ZHHA 4XX0A 5ALMA 3WLAA 2QAGA 2OCKA 5DHAA 1BDHA 5SY4A 3VU1A 2DUNA 4X3PA 1TA0A 3WKDA 3D1JA 2IZ6A 8ABPA 5BYJA 1D2MA 1XEWX 2R48A 2V6MA 2OL4A 3JYQA 4LYHA 3RUEA 1CK4A 2PZGA 1V7QA 2VPZA 1S2MA 4X5OA 3IBTA 4EABA 1UJ5A 4D0LB 4YDQA 2JKVA 1KSHA 3U4HA 2HSEA 4MV3A 4XB1A 1P7ZA 4N4AA 5I9BA 1KL7A 1M5RA 3CVOA 3KKKA 2PE5A 4X63A 2OYSA 3M6MD 4J76A 4MA5A 1MD9A 4UQOA 1WVMA 3L46A 3RU7A 4KACA 3ZS9A 5IJAA 3JQ7B 4DIUA 5H82A 3G0CA 3WQHA 4TYQA 3ME5A 1NVFA 1XCMA 3F98A 4UTRA 1G6KA 2N1MA 2OCGA 4QYWA 2JIZA 3CPJB 4A5SA 2MYTA 3HJBA 4PLYA 4JJ8A 5EKXA 2IQ5A 1RQLA 3N8KA 5CA1F 2F2TA 4O2LA 3F96A 3ZE8A 4IF4A 2DPGA 2VH5R 1ND6A 2HUPA 3CYFA 1TLTA 3LCUA 3IP5A 2XOEA 5L40A 5TY0A 3UZUA 1J2JA 3PFCA 3OCCA 3NVAA 1OIXA 2XYHA 1RS0A 1G8SA 3CSSA 3NOOA 4FGSA 4FKMA 2FTKE 1I3KA 1T6BY 2CHFA 4NJEB 4EY4A 1P6UA 3WFJA 1T4MA 2YTZA 4RY2A 3FB4A 2HMUA 1U2EA 4CIYA 1XDZA 4HDSB 4QE3A 3AP3A 3KRTA 2A9KA 2XIJA 2PUVA 4H18A 3AR2A 3LHFA 4PW0A 3EMDA 4PZEA 2WJJA 3G0OA 1BJKA 4QQ8A 5FWXA 3VAZA 3KSUA 4FR5A 1U1DA 3JVDA 4K0RA 2EZ4A 4ZXFA 5L3RA 5KKCA 1Z8DA 2GERA 3LM8A 1SQFA 1LBEA 2GLTA 1T2VA 4E7PA 5B6PA 2SICE 2QZ9A 1J99A 4ZOLA 3PQ8A 4JP2A 3VNAA 3KT0A 1IN8A 2QLJA 4CUKA 1RM5A 5FTLA 3QLVA 4IS3A 1UZMA 1IJFA 1GR0A 2JJ1D 1H8ED 2IYRA 4G1BA 5IJ0B 3H9JA 3UOAB 4C89A 3RYCA 1KXJA 2PV7A 3MS2A 3T52A 4DDVA 2WLSA 3Q8KA 1KQOA 4PG8A 1OYOA 1YS6A 1D1QA 1L7AA 1RLUA 2R8BA 2FUG1 3AEKA 4IS2A 1E3MA 1KK0A 1FNSA 3C39A 1ICIA 2BTQA 3H2ZA 1O0CA 2V1XA 4ND3A 3G59A 1RM0A 3U3JA 2Q6KA 1N2HA 1X7ZA 1IIRA 3HADA 4JSTA 4L72A 4RQBA 3EISA 4WKNA 4C7JA 1X92A 1TXGA 4CLRA 5KHLB 1P72A 4TQUS 5EIOA 1EUYA 4GLJA 5SY6A 1NNEA 3MF4A 3SG0A 5HKBA 2RKOA 1Y0BA 4P84A 3D8BA 1I7QB 3GFBA 2XCSB 4FKZA 4W5NA 3OLYA 5I8WA 4X95A 1M0EA 3CUSA 1FNNA 3MAAC 3QU7A 3IIIA 4TYNA 3T1QA 3NBYC 3WLTA 1XXHE 4Z7OB 5FX2A 2CWDA 2QZZA 1T2CA 1G3QA 2A94A 2ID8A 1HRDA 4AF6A 3NBFA 3ZS8A 1QYXA 3GFSA 4IIYA 1G8AA 2ZPTX 4KQEA 4YRIA 3CSUA 2CCKA 5M2QA 1Y6RA 2UVDA 4XCVA 2WKPA 3OFVA 1J07A 1SPBS 1VSQA 2BVNA 4C7XA 2C4WA 3UMVA 4K1LA 4EIWA 3K94A 1YFZA 4LXUA 5LZ7A 1TC2A 3JPWA 2B37A 4WLNA 2ZRMA 4CNQA 3LPDA 2HEGA 4W4TA 3KUKA 2D5AA 4ZU6X 1GXSB 1HFKA 1U2DA 1JIVA 1ZU5A 3GAFA 2H51A 5CBPA 1AKYA 1QH0A 4FC6A 3KSBC 2ODWA 4ALMA 1EHYA 1Z18A 1V1MB 2DPMA 3UMRA 4D97A 4YJ3A 4FYPA 3ZWVA 2XR1A 5AW1A 1YDMA 4Y6LA 4GR4A 4D41A 1F12A 3CZAA 5B1EA 4U7TB 1U31A 2DBRA 1ODLA 1UMBA 2OO3A 3X2EA 3ORSA 3RVDA 1P4JA 3KQLA 4ZCTA 1A5TA 1V5EA 1U5BA 4ZREA 5AXDA 3I2HA 1SCUA 4K9MA 1K8ZB 4F93B 2XZDA 4RTKA 1KHTA 2ILVA 2AOTA 2OZEA 4XPZA 5L7YA 3Q9NA 4BC1A 5JAQA 4QULA 2DP4E 1QHNA 1TX4B 4U2DA 3LLUA 4L6CA 4PGGA 1PJAA 4WVFA 2NVUB 1XKXA 3S1AB 3O4VA 3EXFA 2JAOA 4QOHA 3SIXA 2B1JA 4EYEA 2R1TB 3T54A 3EX7C 2YVAA 1W8IA 4O2AA 3S3TA 1WOMA 2HRBA 1M8JA 3NC1C 4M0KA 4F6CA 4S1PA 3A9VA 5A0TA 1GKYA 5AVUA 3IKMB 2HC9A 3AF2A 3GG2A 4HAIA 1KJJA 3GJ7A 1O97D 2W2KB 3AMVA 1L4UA 1C0LA 3EGVA 3WNQA 1LF5A 1RWBA 2R6R1 4JBHA 1YH3A 3BXEA 2F48A 4V0SA 5LKRA 2QW0X 4KH0A 5JCXA 5HHTA 3LK6A 4B82A 3QE3A 4AIIA 1DJOA 3RB8A 3STHA 1YZHA 2ZB8A 2IF0A 1QH8B 4HMQA 4BLUA 3ESCA 4JJGA 2O19A 4JOQA 5FWXB 1FYVA 3OIWA 5EJ2A 2ZUFA 1MO2A 2PBFA 3GUUA 4BJ6A 4BU1A 2DWUA 1J1UA 1F2TB 1HH4A 2XWJI 1TVEA 1B2RA 2YY7A 1G20B 1Z8HA 3OP4A 4LOAA 5DYYA 1QC5B 3D8TA 4B35A 5JRJA 1Y6ZA 4D4KA 5FLYA 2PX4A 1Q74A 4ABTA 2HJHA 1PUIA 4Q4JB 3KYJB 1SWWA 2CJXA 5DI3A 1ZD9A 1OU4A 4J7CA 2V3CC 1XD9A 4LFAB 5F51A 2XMZA 3H8VA 3BGSA 3EFOA 5AK0A 4E4TA 2JFXA 3GGSA 3TRHA 3I9NA 4C0AC 2VYVA 3GFOA 1FW8A 4PSKA 1ECPA 1I1QB 4RGVA 2Q8PA 3FNRA 3NAGA 3WE7A 4Q1BA 4EG4A 2VP6A 2NZWA 1NN3A 1NOKA 2WVGA 2YYYA 5EMHA 1MLDA 1ML4A 1N2CE 3M6WA 3IS3A 4FYJA 5LWQA 4HCJA 3E2IA 1L5WA 1N9GB 2IP1A 2C2ZA 4YC7A 5IK2D 1SUCA 1PYGA 1ZD2P 5HZHA 2WJGA 3U44A 2JZCA 2VUHB 1TYBE 2VUTA 4CTNA 1Y37A 1SBNE 2NP7A 2PMDA 2YWRA 1YFKA 1YK0A 2HU2A 2W6JD 4O25A 4PYLA 4Z7JA 1GY8A 1GDTA 2HZBA 4CM6A 1LZLA 2QWXA 4P3OA 2BUBA 3F8TA 3V97A 4F5ZA 5BSWA 2ZUWA 2NZVG 3JQ6A 4AO7A 1NOJA 4ZQIA 1E2MA 2VPTA 4EB6B 5BR1A 2PL9A 1TM5E 2OWEA 4Q7EA 1H2YA 2I80A 1T6ZA 4CUZA 3LQ2A 4Q6WA 4KXLA 1JSLA 4MYSA 2JGRA 4G2TA 4R7GA 2Q50A 1DEXA 4UM7A 4B3MB 4CQLA 4M1KA 2UUBB 4B7CA 2D00A 4OP3A 1IBMB 2YH2A 1FDOA 2PVPA 2ZJYA 3I73A 4OLJA 4RSHA 3RT9A 4H15A 4B31A 3CB4A 1MGPA 1RRKA 4RIGA 5ALKA 1Z0JA 3LCCA 1F0KA 1NBHA 4E30A 1E1MA 2QVZX 4NQZA 2JZOA 2ZJZA 2YDXA 3GK3A 4LF4B 3D2AA 5JSZA 2O8BA 3V1LA 1VKZA 4KO8A 1ZX1A 4NHOA 3MG9A 1RT9A 4WCFB 4ZVSA 2WU0A 1BROA 1QOPB 1WO8A 2GN1A 3A6HA 4LDPA 4N54A 4AKEA 5J2UF 1OFGA 1NRJB 4IJVA 3GEDA 4OXIA 4R98A 4CQLB 4MI9A 4K6GA 2CXPA 3CCFA 4WNIA 2R6HA 3A2NA 3S7ZA 5DHSA 2R8ZA 5C0OE 2ZIFA 4JQZA 4YRCA 5ARBA 5EP1A 4AMYA 1M34E 4HH3C 2C0PA 5FTKA 1LPMA 3ZLBA 4BRZA 4DLKA 1NAHA 3EEOA 3RIGA 1ZUD1 4DFDA 4AQDA 2VJPA 2ZYWX 4JI8B 1PZFA 1ZOPA 3HVUA 1A7AA 3TM4A 5EZQA 1GU0A 1MRZA 3GAAA 4I1RA 4NMMA 4U5XA 4EHLA 3O3NB 4LYAA 3VI3B 1CFJA 4D1YA 2K7ZA 3JAKA 4GP7A 3GCZA 2WZDA 5ALSA 1W36C 1YFLA 3E3AA 5FHQA 3STWA 2QMEA 5AI9A 4CMBA 2PSEA 4KTTE 5JG7A 2PMEA 5DGTA 4YUAA 2ASVA 2A4MA 5ETJA 5K3CA 5LU8A 1Z2DA 2FR1A 2CXXA 2C3YA 3AI3A 1PI3A 3HR7A 3KTDA 4BBZA 1HETA 4OLAA 3IJ5A 2Q4BA 3V4OA 4CKZA 4OXQA 4BMOB 3H1BA 1RRMA 2YRXA 3FPJA 1KI3A 4QPCA 5CXXA 3P27A 4OXKA 3TN7A 3UUEA 4B5LA 4UQLA 3BQ9A 3M6XA 1X1AA 5FUYA 1Y5RA 2GBFA 4YWHA 1YAJA 3RTAA 4POAA 1NXWA 1VRCA 2F3PA 1CERA 1S2LA 5KPDA 2A9VA 3AVQA 1L5RA 1TCCA 4PXAA 3KEQA 2FSSA 3U48A 4MVCA 2COEA 3PICA 3WLLA 4BNFA 1G9TA 3GLFA 4M86A 4JVSB 3HVJA 3AY7A 3E27A 3HB0A 4L0DA 5CXUA 1G41A 3UFXA 1FBNA 2O7VA 1KZ1A 2JI8A 1T1JA 2ZDGA 3JQFA 4B2PA 1JKMA 4EKEA 3QV1A 2JI6A 1N2XA 2Y1CA 1Q0RA 3W6ZA 4DNPA 3LL4A 1D09A 1MGOA 2C7PA 3AU8A 3GLTA 2H1WA 4AJOA 3T7KA 3UY4A 1F6WA 2P7IA 3EGDA 1Y3BE 1LC0A 4DQUA 3SR3A 1Q3TA 3ZTYA 4A1FA 1GU1A 2Q6OA 3ZIUA 1Y6QA 2NSDA 3E4DA 3LOQA 5L3SB 2XUZA 1UBTS 1Z07A 4XD7D 1CUBA 4OI4A 3HTXA 1ZJWA 1H5NA 1XRLA 1V5IA 4NV3A 1FXSA 1JJAA 3HVHA 4PAMA 1OH8A 1GPMA 3LQYA 2HCTA 2PO7A 5JOQA 2BSXA 4EKGA 5LZ9A 3GLGE 1CZOA 3HV0A 3RS2A 2H7VA 1DOAA 1QR2A 2AFIE 4J0KA 3CLTD 4YDHB 2GCPA 1G8FA 2WJHA 5TEVA 5J1TB 3VSBA 1OMOA 2C5SA 4G5RA 4LZWA 4NCKA 2X9VA 1D4FA 4XPIA 5KC9A 2OMKA 5B7NA 2JGKA 5EHQA 4YO8A 3DEKA 4DB4A 3OZ7A 3O4RA 3PEWA 4UCQA 4HQ0A 3UT5B 1Z4JA 2CVHA 2YL2A 1KFJB 1OWMA 3MJTA 3ZU4A 1Z75A 2PWYA 1V6AA 3H1PA 5JC8A 5FKJA 1ZD8A 2V0GA 5HDBB 4LMBA 2QB5A 1OTHA 1O8CA 2C7RA 4O1HA 2P0AA 1YMVA 4QHSA 1K7FB 1BTOA 4G2NA 1V35A 2J33A 4RIEA 4PV7A 4X64B 1IRXA 4KWIA 1ACMA 3LIPA 4XPIB 3HR8A 2P9CA 2VF4X 1U0BB 1QK3A 1N1MA 4CCYB 2PK3A 2RBGA 3DSRA 2E4ZA 1TZJA 1UAYA 3KB8A 5FEUA 1A76A 3QELA 1UODA 3L7NA 3MEQA 5A4FS 1QO0A 2IF2A 1YSCA 3FNGA 3I04A 3NCTA 1VP9A 1N5RA 2YXBA 3IODA 4QYTA 3FMOB 3H4VA 4PCVA 4CYMA 4DYVA 4GL2A 5EWMB 5FPPA 1PFUA 4P81A 2WKSA 2C78A 2A88A 2QTRA 4FZ3A 1LNQA 5UKDA 1N33B 5C8YB 5G4KB 3MGAA 3AKDA 5TQ0B 3NHLA 4GOOD 4Q19A 1XB2A 1M66A 3TYXA 1S8OA 5G3YA 4RDCA 1DIAA 3MXTA 4HSEA 1TZMA 3A3NA 2D1SA 3L6UA 3PJFA 2GHRA 3AR8A 1HDXA 2FW8A 3PQEA 4GGOA 1B23P 1DBWA 1JG1A 2AOXA 4Y9TA 2QRKA 2HV9A 3THXA 1X1BA 1SXPA 2PMBA 4KFCA 2V7BA 1NVGA 4HAOA 4KITB 1GWNA 3PHBE 1U11A 4OHPA 3PDIA 5KBYA 3C1TA 3KKNA 1E58A 3FYCA 2AJTA 4ND4A 1OPRA 3CZPA 4RCYA 1NBAA 1Q0PA 1JI0A 1D2RA 1DNPA 3GC6A 2PKQP 4V1CA 1I6MA 4HRXA 4BNLA 5LQKA 2E4XA 3FAKA 3LO5A 4YAKA 3UAZA 1XRSB 4HNAB 2F1HA 2HLHA 3CRVA 3ZHRA 2QBYA 3PU6A 1E66A 1XFDA 2H2GA 3ACBA 4H0NA 3SQXA 2Q5LA 1CR2A 3OPQA 3RDPA 3UQYS 2OCDA 2G83A 1FLVA 2R1ZA 1NMEA 5B2ZA 3RYTC 1CNFA 1VPVA 1VCIA 3R3XA 5A6VA 2PD6A 5JMWA 2WBLC 1LBIA 4AZ0B 3WL6A 2J31A 1Z8FA 4JJIA 4Z8YA 2GA9A 3QU5A 5I8ZA 4RJTA 4J7XA 1N7JA 1WABA 2YXDA 2XX3A 2CV0A 4FGWA 2ZTUA 3ANYB 1FFXB 1QH1A 4GZMA 4BNDA 2P1ZA 3FA2A 4ZJYA 3RG2A 3SWWA 4XEUA 5IHPA 4IDPA 4MJXA 2CJWA 2UYGA 3RU9A 3AVYA 1JVBA 3EZXA 1HL7A 2Q5HA 3EDMA 1PNQA 3HHPA 1ST3A 2PKRA 3NHPA 4IJ5A 1UANA 4IJQA 4KIUA 4L74A 3RWMB 5LDHA 3GP3A 1P39A 4PGFA 1NNLA 2BFPA 1G2OA 2XYGA 2Z04A 3HXPA 5JLAA 2PU7A 1UK8A 1H3NA 2BSQA 5A4AA 1CSEE 1JHUA 2FMFA 1WXXA 3GJ0A 3MVEA 3NT4A 2QAIA 1LX6A 4WOKA 4CQMD 4GMGA 1PUJA 3IE1A 2WAAA 3EEQA 1P0MA 1KOFA 3PQCA 1T5BA 2VT7A 1S3FA 4UBJA 2CJWB 5B4UA 3VNSA 4Q9AA 1DAHA 4LYJA 4O2BF 2JHCA 3O82A 2COUA 4OFWA 1RABA 4CV0A 4TYPA 4TYYA 4MRPA 3C41J 1XU7A 3MAGA 3GUVA 1AKEA 1BCSB 2VHUA 3HCOA 4EUKA 5GTDA 3GJRA 2C61A 4MCJA 5KHOC 5KOHA 1AA6A 4LFBB 3WX0A 4A23A 2W6PA 1WSBA 2DQKA 2IV3A 1D8TA 1PWHA 1WMBA 4RF2A 1V39A 1KK1A 4L50A 2WWWA 5D3MB 3UMMA 2ZAIA 4LHXA 2WAOA 2BEVB 1Q14A 4OEHA 3ZUPA 1KVTA 4JLNA 3ZJYA 4AMZA 2D1TA 2XMPA 3BH6A 2WTBA 3JYLA 2MMGA 1VECA 1T4BA 1EVLA 3AUKA 2PSJA 3V4LA 4RK6A 2JIPA 1E1QD 4MUXA 4GT1A 1W9MA 3GFTA 5CK4A 4E51A 2O6HA 3QLJA 1DUSA 1ZEMA 3IHTA 5LVAA 4BP9A 5ESWA 3T5TA 5CDYA 3BK7A 1GRVA 2YCLA 3B9QA 2ZIEA 3ZV7A 1JE1A 4BS9A 4L3VA 5TQJA 2AD1A 3KHKA 5AI8A 1G7RA 1XVAA 2AI2A 1R8QA 1EFVA 2C77A 2YFYA 4FMPA 4R2XA 4PXYA 4YJFA 1DSSG 4FFOA 3ZK7A 2ILTA 4F5YA 3DWIA 4L2IB 1GXSA 1PT5A 4OGKA 5E8JA 3MMZA 5EI5A 5TQ0A 2RHTA 4LX8A 4JQYA 1CTQA 1RWXA 3B1VA 3G79A 1E3DA 5DI3B 4DUPA 1IN7A 4PC2A 4KIGA 1RVV1 4HRAA 2FG5A 4P2BA 4Y6GB 4UM8B 2JRCA 3BMCA 3N07A 4MS3B 3JWHA 4RPLA 4EARA 4ES6A 4Q9DA 2QVCA 3OEED 3DB1A 3H1FA 2GFQA 3HL0A 3WOVA 3Q5EA 4AUMA 4A0QA 5AVWA 2IYFA 4FCWA 1ECLA 1XNRB 1EGMB 1QZTA 4QXPA 3S68A 4R8MA 4R51A 3SVTA 1VMIA 2C1XA 2O3JA 1GTZA 4MUEA 3KO8A 3Q7IA 2YHAA 3QNWA 2IOFK 1DUIA 1CJBA 2ZAGA 1U3WA 4YP5A 2YHIB 3RO7A 5IN4A 4B6OA 5KNDH 2WA1A 5FBZA 4MUBA 1PVVA 2G7ZA 4HN2A 3RYHB 4COOA 2KSQA 3ZHVA 1ZWLA 3PC8A 2AQKA 4OPMA 1QGYA 3O8DA 1T3GA 3PRJA 4EG5A 2BBTA 4BFSA 5F21A 3TBHA 1AUVA 5FV7A 1ZUWA 3IXMA 2W2TA 2FWPA 3DF9A 4EA8A 3I1YA 2GXUA 1DT5A 5CD1A 2HHCA 5EIAA 4UHKA 3L1KA 3VQTA 4DA0A 3VSEA 2B1QA 2FPPB 5KCMA 1KGSA 1RXUA 1BMFA 2R25B 1LA2A 4RPKA 3AB8A 3U3MA 3CLUC 4XXHA 3VV3A 2XWSA 5E1OA 1RI1A 3EUAA 4XD7A 1KDOA 1ONBA 2HBQA 2X6QA 3GBSA 3IFSA 4G1VA 2CXHA 3KZXA 1HEIA 4BEJA 1UAAA 2XOXA 3G5UA 3MUNA 5CFZA 3W3AD 1NJSA 1Z0DA 2FVYA 2WWHA 4K6HA 5FI3A 5FP0A 4ZXPA 4LJ5A 3ZXIA 4X44A 2IEGA 1VYHA 3ZGYA 2IEYA 2FEAA 1A95A 2O07A 2WM2A 4KN9S 1S3GA 2BTQB 1L9KA 3CVXA 1Z5WA 1RRVA 2VDRB 3I32A 4HZUB 4CKCA 4M8LA 3VZBA 1H1LB 4RTRA 1L5QA 5FR2A 1WHSA 2XOKD 3R5TA 4HWKA 5PNTA 4P4SB 1T10A 5EKUA 3RAJA 3L7CA 4L4RA 1UK9A 3TQFA 3PJDA 1QFZA 1GPYA 3JAWA 1RC1A 1DFIA 2V6IA 5THXA 4QYIB 5KJ6A 3QPVA 4E5KA 1IRIA 2AMVA 4K9SA 2YV4A 1F7VA 3VM6A 1JHMA 3FFXA 4WN9A 2MYPA 3CUTA 4WZZA 3TNDA 1E1RA 2XADA 3IRUA 4B8ZA 3DCJA 1IVNA 4LDNA 4R9RA 3CPEA 10MHA 4OUDA 8ATCA 1N78A 4MH0R 4RL4A 1FP4A 3L06A 3GT0A 3QVXA 3RSQA 1RRFA 1UC9A 1CUAA 5DEOA 4BJ1A 2QT9A 2SCUB 1Y3HA 3P8ZA 1NVVQ 1P5RA 2FZWA 2IX9A 2QE7A 4G1CA 1AZLA 2OZLB 3WGUA 5C8YF 1XJ5A 1AK9A 3MYRA 4RPIA 4IZOA 1UPUA 4HLUA 4IGIA 4F1KA 1M6WA 3SY8A 3RRJA 1KC3A