1XAHA

Crystal structure of staphlyococcus aureus 3-dehydroquinate synthase (dhqs) in complex with zn2+ and nad+
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
352
structure length
323
Chain Sequence
MKLQTTYPSNNYPIYVEHGAIKYIGTYLNQFDQSFLLIDEYVNQYFANKFDNVHKVIIPAGEKTKTFEQYQETLEYILSHHVTRNTAIIAVGGGATGDFAGFVAATLLRGVHFIQVPTTILAHDSSVGGKVGINSKQGKNLIGAFYRPTAVIYDLDFLKTLPFKQILSGYAEVYKHALLNGESATQDIEQHFKDREILQSLNGMDKYIAKGIETKLDIVVADEKEQGVRKFLNLGHTFGHAVEYYHKIPHGHAVMVGIIYQFIVANALFDSKHDISHYIQYLIQLGYPLDGVQMVLMRQFGDIVVQHVDQLTLQHACEQLKTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinate synthase
publication title Comparison of ligand induced conformational changes and domain closure mechanisms, between prokaryotic and eukaryotic dehydroquinate synthases.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Lyase
total genus 124
structure length 323
sequence length 352
chains with identical sequence B
ec nomenclature ec 4.2.3.4: 3-dehydroquinate synthase.
pdb deposition date 2004-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01761 DHQ_synthase 3-dehydroquinate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1090.10 Mainly Alpha Up-down Bundle Dehydroquinate synthase-like, alpha domain Dehydroquinate synthase-like - alpha domain 1xahA02
3.40.50.1970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xahA01
5BR4A 3W5SA 4FR2A 5EKSA 1TA9A 1NR5A 2BL4A 1RRMA 1UJNA 1NUAA 1NVFA 3QBEA 1XAIA 3CE9A 1JQAA 1XALA 3IV7A 1SG6A 1O2DA 3UHJA 1VHDA 1JQ5A 1NVAA 2GRUA 4RGQA 5HVNA 1NVEA 2D2XA 1NVBA 1NRXA 4RFLA 3RF7A 5K8CA 1DQSA 1OJ7A 3JZDA 3OKFA 4RGVA 1VLJA 1KQ3A 1NVDA 3OWOA 4MCAA 1XAJA 4QGSA 1JPUA 3HL0A 5FB3A 3BFJA 3CLHA 3QBDA 2BI4A 3OX4A 3ZOKA 1XAHA 1XAGA 3ZDRA 4P53A
chains in the Genus database with same CATH superfamily
5I51A 1G3RA 5LZ9A 5CB4F 2FPLA 3U49A 4B4KA 5EJEA 4R40A 4XGQA 2JD2A 3RKRA 3RIHA 3CRZA 1DFIA 3PVCA 4Q3DA 4AP9A 4AZSA 5AIBA 2GEDA 2GOYA 2BVNA 2PCLA 2WSSD 1NVVQ 2XGSA 3P94A 1IB0A 4X8OA 1QIEA 3UUFA 4C06A 2AEFA 4A6EA 1OXTA 1U9IA 3GCWA 4PS1A 2X1VA 3T35A 1NA5A 3KEMA 3SKXA 1ANKA 3CZCA 1F60A 2JAPA 3P45A 3PI7A 4OBWA 2VN8A 3NOQA 3NOOA 2D13A 3KB2A 1MAAA 4I1RA 1HDEA 2PGDA 3KTAA 3RSFA 4IP0A 2R1TA 2JGMA 4LQDA 3NC1C 4EDHA 3S8YA 1NI3A 1SVNA 4B32A 2F9LA 2BE9A 2YJ4A 2CYAA 1G9XA 3D3QA 4DZZA 3W2IA 3Q8WA 3ZLJA 2ZJBA 2Z56A 3CSSA 4IJ6A 2JS7A 4CPDA 1F8XA 5K2OA 1O2DA 4RQBA 4ZGGA 2Q8PA 2FXVA 3EJ6A 3EXEA 3UV3A 4CMGA 2NU9A 4IFIA 2WYOA 1QG2A 2DP4E 2NUBA 2ZRMA 3JVDA 4ZYZA 3ACDA 1GNPA 1IHPA 1XCJA 2X9LA 4FNAA 4JX8A 4XEUA 5E3JA 4BQOA 4F5WA 3KOWA 3INRA 2AFVA 2BFDB 5JYEA 2A0UA 2BFCB 1N6OA 1AD2A 3EFOB 3LF2A 4DILA 1J9GA 4NJEB 3K96A 1W581 2HRBA 2IYTA 2I33A 4C22A 2O20A 1A8HA 3ISTA 3IERA 2HYIC 1TXGA 2WTAA 4WNCA 1E3MA 1U8EA 4FB4A 4MPPA 4AJNA 3H1EA 1BYIA 3IIMA 1E96A 5B3JC 5KX5B 3V8MA 2AC2A 3K4HA 4HX9A 2RGCA 1X19A 2YWEA 3O83A 1O6BA 2P67A 2QW8A 3CJQA 2AYYA 4LEIA 4CLOB 4ZYWA 1TKCA 1ZW6A 1WB9A 1FZTA 4N01A 1UKYA 5JSZB 4FFNA 3AHCA 2ZEJA 1T8WA 4RA6B 4RK0A 3UTDA 2IS6A 1PWHA 2V4ZA 3C48A 4I9NA 1DPFA 2TMYA 3HNPA 1J49A 3GMIA 4BUJA 3H1TA 3RYFB 1SCAA 2E82A 1WABA 1QHEA 3H9GA 4NCKA 4B8YA 2GK3A 1U0GA 3ZDRA 1U81A 1RWVA 4N03A 2D7DA 1OGYA 1PR5A 2QP9X 4CMIA 3G79A 1AJEA 2V8BA 4S05A 1CVLA 1JG2A 1YOVB 2QRMA 5ADHA 3I9NA 1SXJC 2OZEA 2WTEA 4OOEA 3UJ8A 1RLTA 3QYJA 1II8B 2HSJA 2EVWX 2ADMA 4NPCA 3A2KA 3I62A 3LCUA 1DXHA 1Z6ZA 1VL6A 3FKSA 1PJLA 2C7RA 2XQVA 3BMNB 1XZDA 3BXOA 3PZRA 1GFWA 4HJXA 4HMOA 3V6LA 3WL8A 2WNHA 3WSTA 2ZUSA 2TS1A 4CM8B 4Q82A 1A5SB 1UDBA 1WLSA 2GYUA 4NMXB 5JVDB 3V4OA 2GAIA 4DBVO 1HGXA 3BXGA 4KWTA 3S8MA 3LLUA 3HB4X 4BFSA 3E35A 4QBIA 4UUQA 2Q4RA 4ERNA 4YRAA 2XQJA 4PX3A 4ISCA 4X24A 3QWAA 4G56A 3GLFE 1YL5A 3LH5A 4X45A 2QG9A 3VNQA 1VBMA 2VNHA 4P5EA 3A6PC 5ICFA 1II9A 3A3KA 3MT8A 3E9RA 1UBUS 2CNOA 1EVZA 1Z35A 3ENQA 1PGOA 1W9HA 2V0CA 1LFDB 3ABZA 1SIUA 3GOQA 3O8LA 3RYHA 4AVYA 4JBGA 1ZK4A 1UAGA 1EGVB 3HBFA 1IPHA 4ASUA 1XMQB 2XB8A 4A91A 4AJ4A 8GPBA 4N5NA 3L0IB 2NZJA 1VMIA 1L4MA 3EOAI 3PEUA 4DJDC 2ACKA 2J6HA 1L4HA 3AETA 2A5LA 1M1YE 1A9QA 3NT2A 4BVEA 1SXPA 4YCCA 5HOQA 1NI4B 2ZP1A 2QTVB 2QD5A 2YHSA 1SGWA 4ZQGA 4OYRA 4LA4A 1XD2A 2X41A 3QU9A 4KQ6A 4QOHA 1A95A 3PK0A 5IABA 5AOCA 3CR7A 1RBQA 3PDJA 2NZYA 4XPZA 1MX9A 5IAEA 5TMBA 4IIEA 4AUMA 4YR7A 2FWAA 4RZHA 1XKXA 5G0SA 3G2PA 4RVFA 1S7CA 2BUBA 2O4CA 2YH2A 1E3IA 3NAQA 2DBQA 4BO5A 5I7RA 4RLQA 3CVUA 4OQFA 1JHRA 3N58A 5AMXA 3SDSA 2I03A 3GWGA 3T1VA 1NRIA 4DANA 1I7SB 3CR8A 2IPLA 1QHYA 1PJRA 1GWNA 4BJ5A 1W76A 4HLUA 3BRWA 1BMQA 3TQSA 1IU9A 1JBEA 1GUDA 2W2NA 3K05A 3PDHA 5K8IA 2P6RA 4JI6B 1PT8A 2OAEA 4TMZA 2GAFA 3GT0A 4BE4A 1M33A 3F9RA 3MERA 3WGZA 4MEBA 4FD2A 5AVQA 3EEQA 1V4NA 4F2WA 4ZOCA 2P5TB 3L1HA 3KSAC 1EWKA 4RS4A 4YUZA 1GNRA 4ZCIA 4KRGA 1L9KA 2N3ZA 5DLPA 5JBQA 5JPCA 3ETEA 2PMKA 5CP8A 5BVHA 2UZ3A 2COEA 1U8TA 4NBLA 2YHUA 3CUUA 1KO1A 4JLDA 2QV7A 4WADA 7REQB 4G1CA 3COJA 1ZJYA 4WN9B 4J7CA 3RK0A 3SD7A 3RWOA 4FS8A 5CURA 1ZIDA 1XZIA 4BC0A 2JCSA 1ULUA 2DY1A 3JD4A 1FS5A 3KJQA 4DV6B 4NATA 1VYHA 2PKQP 2HU7A 1J7KA 3DWFA 5AFSA 2C4VA 3W6PA 3T12A 5LOVF 1Y63A 3GFFA 4RYDA 2AN9A 2RCNA 1DTSA 1X80A 4KBGA 1PSDA 1YXMA 4R81A 3OZTA 3WBKA 5C37A 1RXSA 3H1AA 4IO1A 1YNOA 3T9FA 1P5ZB 4L5JA 1CUIA 1GILA 3K1TA 4MGIR 5E1OA 3R23A 1JHXA 2G36A 1GT91 3T3MB 3HJUA 3RO7A 3RU3A 1ZR4A 1JTVA 2A3RA 2VPXA 4XVRA 3OO1A 2RHRA 4Z9BA 5FHRA 1I9GA 3CLTC 1EYZA 1KRHA 4KQ1A 1XEAA 4CM1A 1LJ8A 1RWBA 1NL3A 1G8KA 2C5BA 2I55A 4NJMA 3U4MA 3AVTA 4IPTA 2BFAA 2H29A 4H1HA 4P53A 2WT9A 1WIWA 1M2GA 1CUYA 1KBOA 1MG0A 3L4SO 4M0DA 1GRQA 2RH9B 3WX0A 3LUAA 1F17A 4D9CA 5BXYA 5C53B 1VI2A 4WBSA 3EOZA 1E2DA 2PD4A 4GGOA 3SPXA 3SZOA 3TJMA 4QBFA 1TKBA 3W77A 5LU9A 1QRAA 2O2DA 2XUZA 3WTCA 5IUNC 2NNLD 1UDCA 1M1YB 1OXUA 2JAQA 3GYBA 2R4UA 4GW3A 2BH2A 1A0OA 2O7SA 3BL5A 3QEMB 1V5FA 2IPOA 2OFOA 2ZJOA 4BNNA 1QU2A 3V55A 4C6TB 2ZIGA 5BV7A 4PNPA 2VI5A 2VJBA 2YXDA 3D3WA 3HY4A 3KOYA 4OKNA 2X0EA 3DOCA 3TIXB 1MH1A 5AK6A 4XWAA 3L6BA 1SC6A 2JFYA 4S24A 4UCFA 5E7QA 4WMLA 3T0FA 2IH2A 3FHOA 3NM4A 3PJDA 5AICA 3EYWA 4EH1A 1IJBA 2RHHA 4IJ5A 3IALA 3LXUX 4B3SB 5C32A 2O7VA 1EK2A 5IJZA 1YVUA 2FMFA 1QC5A 1UPTA 1UDAA 4RIEA 3U7HB 3ZLVA 1NULA 1PT5A 3TNYA 2DC1A 2NACA 1XALA 1EFAA 1OGIA 2QRQA 2IYLD 2QTTA 2I4RA 2I54A 3HWRA 4FFMA 4AL4A 4F9TA 5K8VA 4FI3F 4WUVA 2PUTA 3OJWA 4D9FA 1U3VA 4MV4A 3H5NA 3LLSA 2EKQA 2L19A 3PKJA 1POXA 3QW2A 5CMLA 1FU8A 3H5IA 3SX0A 4NYMR 4N0PA 4N8DA 4A6DA 4HLCA 3ITEA 4G5XA 2AN5A 5E7MA 2IZ6A 2ZQ5A 4IO0A 4XLZA 2JH3A 3LHDA 5KX5F 7MHTA 1MF7A 5FPKA 3T9AA 3W7AA 5EJAA 2B9EA 1L4GA 2IIVA 2I6TA 3EZ9A 3K35A 3L9WA 3M1AA 2ORED 5H81A 4F6LA 2JCVA 3IEXA 2X3FA 3A9RA 1FSZA 1P2VA 5EZQA 3H13A 2C4MA 4IXWA 2ZPAA 2BCEA 1WMEA 3UICA 4B83A 3VR4A 1A71A 1E1LA 2ZU0C 2W2LA 1K5DA 1H6CA 2JHPA 4UM7A 3CSUA 5ALMA 2NN3C 4D9NA 4OQEA 3W5JA 1P5RA 1P4HA 5EHXA 1DKPA 3K9CA 3KXDA 5KQGA 1ZOLA 2C4NA 4XDHA 1P2UA 3P9RA 1T5TA 4IOLA 2AWOA 3VI3B 2GFIA 3PXBA 4AULA 4BGEA 4W1QA 3T1YB 1GPYA 3FMGA 3DUWA 4FONA 4GH5A 1VJ0A 5D00A 2OXEA 1K98A 1KI6A 2DRIA 1FP6A 2VRWA 4JP1A 5B5SA 2W71A 3FBWA 3AF5A 3LVRE 3KUUA 4FOPA 4G4IA 1YS4A 2RHBA 4JS0A 1LPBB 2R8OA 3NU1A 4G65A 4LXQA 5HOEA 4TKVA 2RG7A 1WW8A 2DEUA 2IS2A 2AG8A 3KHTA 4R69A 3WP1B 1NVGA 2DZDA 2PX0A 2Z3ZA 5IN5A 1MOZA 2PXHA 1RYZA 3K2EA 4LJ9A 1JU3A 3DZBA 4FYWA 2IHJA 2DT8A 2ZSAA 2CVHA 3PJFA 5KOJA 1P1IA 5G0VA 2WSYB 4XLTA 2ZWVA 1M6NA 5JVDF 2V7VA 3OOJA 2B4QA 5JZSA 5JO0A 1QVAA 1FMTA 2A5DA 2BISA 3HC7A 1ZA2A 1N2JA 1ZVMA 2LV8A 3GGOA 3WBFA 1TK2A 2WAYA 4C4XA 3NHKA 3ROMA 3IQEA 1KVSA 3QVLA 1B3BA 4C1BA 4GLBA 1J1ZA 3ZS8A 1FIUA 3PC8A 3HUFA 4PLZA 5IKEA 4BYMA 1ZD9A 1FDSA 4N7RA 1A8SA 5KEIA 5CDUA 2FWRA 4OXKA 5IAGA 1Z2NX 4ZCSA 4M37A 2BGGA 4KX5A 3NWEA 4YAJA 4BNZA 1SBHA 1NY5A 5T4HA 1UPUA 3OLZA 1AGRA 1MJGM 1UMBA 3REFA 1ULHA 3TPCA 5KYYB 2NZVG 4OAOA 3OY7A 3JYOA 1C41A 4JLBA 4E5YA 2G4VA 4Z9AA 4FW8A 3KO8A 3DWEX 3TOXA 1QU3A 3T3DA 2UV8A 1J8VA 2WWWA 4R1PA 4J16C 3S99A 1XZQA 3H5WA 3DTTA 4GPZA 1N6KA 4MVWA 4LV6A 1NMZA 4F4CA 1D0SA 4BVFA 2YYYA 3RRMA 1IONA 1UC8A 2FUKA 4MO2A 1VL2A 2XRYA 3OLCX 2H7VA 2P9JA 4G8DA 3DOIA 3C6BA 4WACA 3ZQKA 3N05A 4CUZA 3H0KA 3R5TA 2G0TA 1JVBA 5LN1A 3WICA 4RKRA 1ORWA 4RXMA 1E20A 4WY5A 1U99A 4MV8A 4DIEA 1SOUA 3OWXA 4DUGD 1T9KA 4TLEA 2X8JA 3ICCA 3R3YA 4UAJA 1E6EA 4KQXA 4QBGB 3AKCA 3IEPA 4XW2A 1FX1A 2AJ8A 2P6UA 5AVTA 4EA6A 1DGQA 4R1OA 3TUJC 1PZMA 4E32A 1IMOA 2CNLA 2Q1UA 1SBYA 2PCJA 1JXAA 2HMWA 3N8DA 3ORSA 4V03A 4MARA 5C8YB 1V45E 4GKKB 1B00A 4K9LA 2I7DA 4OHXA 3OC6A 5K6AC 2JGKA 3OCXA 2WU0A 4JI1B 3VR6A 3ZXIA 4EZEA 2FMIA 2JFXA 3TB6A 3KAPA 4QJIA 3JQEA 3S70A 3C3MA 3TE6A 1PWEA 1P3Y1 3AL3A 1REQB 3I2IA 4YQYA 3A70A 2VFAA 1RXUA 1WUYA 3BQ9A 5FA8A 1F20A 2ZYVX 3TMYA 1I4DD 1WP9A 3DEHA 1T6YA 1O7JA 2OYCA 5KQRA 2GEUA 2V96A 3I61A 2D5IA 4HBZA 5ALKA 1U1CA 1ZFNA 1M2EA 4FUQA 2GRJA 2WJHA 3ZIAA 2WLTA 1UOPA 5J4HA 2H1VA 5JARA 3CO5A 3WOHA 4LRYA 4AJKA 2PUCA 3FCOA 3OKFA 2BY4A 3MG9A 2IWHA 2WLSA 2QJTA 5LZ2A 4FGLA 3S68A 3EHEA 1M66A 1SVMA 4LXHA 4LZJA 2YWJA 2JVJA 3RTCA 2O2GA 1JZQA 1OI7A 1I32A 4DG9A 5I9IA 1A2QA 2ID7A 2ZBRA 2R1UA 1P6QA 4OI4A 2QE7D 3TTXA 5JW6A 2C9MA 2PT9A 2VSXA 1HY3A 2X2EA 1LV7A 3PX2A 3QXCA 4U9IS 3VZBA 5EHIA 1F6DA 5TPZA 2I4OA 3AUKA 4JEIA 4K6CA 4D5GA 1NUAA 4U7JA 3I8SA 5KVAA 2O7NA 4ND7A 5CIQA 2FN8A 3D3KA 3SC4A 4HEQA 4JNKA 3ETJA 4IHQA 4LZAA 3NNSA 3RJ5A 1JHVA 1S2OA 1NPYA 2PS0A 3GXOA 2QVLA 2EGUA 2FPSA 5JJBA 3BCHA 4NH4A 1XZEA 4AUEA 2F59A 1OZGA 2IXAA 3MT7A 5B30A 3OIVA 1GRRA 4J3NA 2IYOA 4UUNA 3SM3A 5I45A 4I9UA 1Y7TA 2H1FA 2V0NA 3LC2O 3IP9A 3NGXA 5FX2A 3DMHA 4RZ2A 1O0SA 2W43A 1VECA 4BO0A 5JCJD 4GU5A 2QL5A 2EQ5A 3QTLA 3FYCA 1D4ZA 1W1WA 1IWBB 1VCIA 2P6NA 5EOVA 4EF5A 4LJ5A 1KDPA 2PGLA 1AKNA 4O63O 4Q3LA 3W2TA 1XDDA 3BPSA 3IP5A 5IG2A 1EJ6A 4IGKA 2WIAA 4AG3A 4P0PB 1T2FA 3F9IA 1COWA 3MN1A 5H70A 1IEQA 4XB2A 2ZUTA 2W93A 5CH5A 1E3QA 1U8XX 2P11A 4R71A 4F7WA 3PPXA 1W2HA 3VO1A 4DR4B 3L07A 4F1KA 3DDZX 3R20A 4IG4A 4LYYA 4AJLA 5JRDS 5IK2A 3DE3X 2GBFA 1U9JA 3HQ4O 3O91A 4J76A 4TKLA 3UT5B 1YTUA 4XTCS 4AIIA 3DCNA 3C3EA 3WDKA 5L51A 3PNPA 3K20A 5KTYA 1U3WA 2WQZA 1EM8A 5H16A 1ZX1A 3DF9A 1D2AA 2JHAA 3TSWA 2HT1A 4GOOD 5AUPB 1XCMA 4F84A 4PINA 5EZ6B 4N65A 4UTXA 4H0NA 1VL5A 1HG0A 3ND7A 4NF2A 4Z7NB 1FQWA 2NVUA 2PRZA 4V0RA 4JSYA 4DMUB 1FW8A 2PKYX 2Q0SA 2QX8A 1GR1A 4IDQA 4OQPA 3UK0A 5J2TB 1DJNA 1CQJA 4FHGA 4KLCA 2VBFA 4OL0A 2P4HX 3DR3A 2FPWA 3FMPB 5ALGA 1FTYA 3EFHA 3O2JA 2Q7OE 1P5FA 4A8JA 5IFKA 5JZMA 3ROPA 1MAUA 3ENKA 4U2KA 3O8NA 3DMDA 2X7JA 5CTAA 4Q9DA 1XB2A 2ZUFA 2WE8A 3PBKA 1AKMA 2EWWA 4D82A 3DNMA 3KOZA 1SKYE 1HE5A 1NV8A 3GUZA 3V1NA 3TDKA 4EJFA 4JL5A 4L5CA 2O2IA 3WSVA 1CUAA 2YY7A 3P9CA 4JA2A 4LWPA 4BNKA 5L6MB 3HXLA 2VS1A 5B3KA 2MINB 3OQNA 1MB3A 3K1ZA 2P69A 3W05A 1DDIA 2V7TA 1WSWA 4WCFB 3C4QA 3CRQA 2RB4A 3NWOA 4AN1A 1MEEA 2A9QA 2FPOA 4LSWA 3FCSB 2DHQA 1VLMA 3BIXA 1EH5A 2PRSA 3IELA 2XUFA 1ADCA 4NU5A 3F2VA 5DYIA 2GILA 1KEKA 1A5AB 4Z4EA 2YV2A 2Z9DA 3GRVA 4MYTA 4ZHQB 3WMFA 1PBTA 3DZDA 1KBZA 1PR4A 2DH6A 4MVYA 3AIOA 1LC3A 2G1UA 1J39A 1BQ4A 5KIAA 1TVCA 3EVFA 4JWKA 2PUEA 1EAYA 3H97A 3ZDBA 4B2PA 4UCWA 3IA7A 1M5UA 1NPTO 1P5HA 3QLEA 4DRYA 1SUBA 4DRXA 2XZOA 4N0DA 4Q1VA 2RHCA 3PR3A 4EG7A 2DVMA 3AQIA 2PEZA 3GMTA 3PR2B 1C8LA 2GZ2A 3Q10A 3VC2A 3ZJVA 2IP1A 2JB9A 3ANSA 4RV9A 1DOAA 2AOWA 3VSCA 1AK1A 4DCTA 4YRSA 1Q11A 3KR2A 5A1JA 3I0MA 3F4KA 4JROA 4P92A 5HNKA 2YVQA 1PP4A 3MTJA 3D31A 3ED5A 3HV0A 5JEEA 3IBTA 1EUCB 1ISIA 3DGEC 2ZE7A 4II2A 3S1AB 1PRYA 2CCJA 5KVQA 4GMXA 2CL0X 5DRTA 1FYXA 2P9ZA 3P5SA 2A7QA 3ESRA 4DLKA 1D9ZA 4N47A 3R0ZA 1CS4C 2B2XA 4MCIA 5L6LB 3RASA 1Z5NA 2ZYDA 1T0BA 4PZZA 5HIJA 3X1KA 1SCUB 4KXVA 1VIVA 2QTWB 3W6ZA 4XDGA 4BMXA 3Q3IA 4FSDA 4OJTA 1OX4A 3BMXA 1RIFA 3M4NA 4K8RB 1I4EB 3U2QA 5BSUA 4RWZA 1OHHA 1Z74A 3CEPB 4HD8A 1D07A 3FNGA 1NKSA 2E89A 4EQ6B 4A0FA 5I9MA 4G8CA 3GV0A 4RSHA 1K63A 1KQOA 1OIVA 1T1SA 1H5QA 2DCMA 2JLSA 4ACBA 3WIEA 1L3IA 3SC2B 2EHJA 4M1QA 1ZW1A 2I3BA 1B76A 1CS0B 4NENA 5I7OA 3A6ZA 3ZGZA 4L8WB 3Q7QA 1XU4A 1Q2XA 1G42A 4JVSB 3KXLA 1VJGA 3U16A 4LJ7A 2V65A 1XP8A 1FUEA 3HI4A 4XWKA 3DFUA 5C8YF 4BVHA 1R0YA 5EMHA 2XCQA 1U2DC 1SKYB 1PWXA 1YZLA 4IG9A 3VKUA 2A30A 2JCBA 3FDXA 1O0CA 2VDPB 4DLPA 2X8LA 3PEVA 3O21A 3HKDA 3L5OA 2GDJA 3P8ZA 4KIUA 4DE5A 4JLSA 3KYDA 4ZOBA 1J23A 2XBLA 3QNWA 3B7GA 3LMKA 2P91A 3GVIA 3QSGA 4RYLA 3FLEA 3RRNA 4UVDA 5BSHA 4G24A 1EP1B 1AKRA 3KVOA 5DTRA 4JDPA 4A73A 3NMUF 1JR4A 5HCUA 3HNOA 2OZVA 3GEPA 3W6UA 3FOFC 4NBNA 3PGVA 4ROTA 4A0RA 4KNYA 4HH1A 4UU7A 4NECA 3ORRA 5AUNB 1XAIA 2JGJA 4HAIA 1DBWA 3ICVA 2ETXA 1C4XA 1HDGO 2JW5A 1Y5MA 4UOQA 4F5EA 1EP3B 2G5TA 1GG9A 1KH1A 2JBAB 3PP8A 3S4YA 2F9MA 1KETA 3GU3A 5DSZA 4X61A 1Y5NA 1XMVA 2EX4A 2VDWB 1N5RA 4GRIA 3AUXA 4C7OB 2O5EA 2FPPB 4MUXA 5J2UB 4WFIA 4WE3A 2L17A 1KPGA 2R8EA 3M1YA 5BVGA 2PLFA 5A7GA 3CLUC 1T8YA 2B0JA 4FKZA 4FEYA 1OAKA 2G1JA 4RD2A 1RWMA 4LK2A 3KD2A 4TTJA 3ZHBA 2V7WA 1U3UA 4PR3A 3IMFA 1BA2A 4GYWA 1JWAB 1WB4A 4YACA 4YRMA 2Z6VA 3VHLB 4YUWA 2QRKA 3KKEA 1M83A 2EW8A 3WKBA 3VKGA 3V8BA 5FNVA 5IMSA 4B3TB 4GI7A 5HVNA 2JD1A 2DTEA 1ZL2A 2IEGA 3QE0A 1EZ4A 3Q7PA 3MS4A 4ER6A 1DG3A 1NE7A 4DCGA 4OV6B 1G5PA 1WV1A 1ZNWA 2IVZA 2GGSA 4R2HA 1SIOA 3QVXA 1E5VA 2AFIE 1G59A 3IESA 4Z2AA 4EB0A 4OHWA 1RJ9A 3Q3VA 3TRDA 1Q7BA 1FSSA 1WVGA 2J4CA 4ZKDA 2OVFA 3QA9A 2I2AA 3PQ6A 3O9ZA 3WGVA 3JQAD 2WNIA 3VR4H 1D4OA 4HMPA 4ND8B 2PKEA 4E5SA 4Y1RA 4EO4A 1ZJJA 3QFFA 5K0SA 4QJ5A 4H1VA 4K9RA 3NFRA 5CCXA 1QIIA 2ATVA 3PJRA 4I99A 1QFJA 5BUCA 1F5SA 1YA8A 1X94A 5LC1A 5KKNB 5LNK1 1Y1QA 1TCBA 3MTBA 1TM7E 5JANA 4M0PA 3VPGA 1GZ7A 2ZFUA 1O4VA 4K6GA 3UJCA 5KNDD 5IBPA 4WK2B 1V16A 3NDIA 1QV6A 1VJTA 3NIFB 3KQKA 2C59A 3F49S 2Q9UA 3FFXA 3DQZA 1Z45A 3DEIA 4NCIA 2XKAA 2W6IA 4KEAA 3M5CA 3WV4A 2O2EA 3HEBA 5IRCD 2KWIA 4DNOA 3MW8A 3N2ZB 4QUGA 4F9EA 2N47A 2PX8A 3B5IA 4TX1A 1UDWA 3OCYA 5J2TF 4FDAA 1Y8RA 3H17A 3ESYA 3V8QA 3VV3A 4QSMA 1M2OB 1N2CE 2X8AA 3NZEA 3HADA 5D86A 1JAYA 2AR7A 4AMYA 2HZ7A 2CDRA 1C4OA 1G20E 2WG0A 2JAOA 1IY9A 2AI2A 1AV7A 1SU6A 4LCBA 2JATA 5F2OA 2P3QA 4DQXA 4OM8A 2WF6A 4F8EA 4XSGA 3UYLA 3U44B 2RE8A 2CUTA 3IEVA 1C7IA 2PZ8A 1C9YA 4R7ZA 2I3AA 1R4NB 2PFKA 3HUEA 4Q16A 2XXAB 1CRLA 4KH0A 1JQEA 1PFWA 1DAOA 3FRHA 2BBWA 1P7YA 2JRCA 4ODIA 4DYHA 1DAPA 1EIZA 3L4JA 2HU5A 4JJZA 2IDZA 1QLWA 3QOYA 5B1HA 4DM4A 1GM5A 2OSVA 2GJ9A 4H15A 3EDCA 3H18A 3ZU3A 3X43A 2VIIA 4K86A 1GZVA 5E7IA 4J07A 4MUFA 4NYIQ 3OZAA 2PYDA 1UDXA 4FFVA 5UKDA 4K0KB 1ZHFA 1LY1A 3VI4B 4KE6A 1MVOA 4WN3A 3PFBA 5HJ2A 3K9LA 5EIXA 4AY4A 4RS3A 4TQGA 3PRYA 4ZHQF 1V3UA 3IO5A 3OSUA 1JSRA 2WPDD 1J90A 2MTBA 3BERA 1TL7C 1SKMA 3GRFA 2QW1A 3GJ6A 3OU7A 4NZZA 3KQOA 5FWXA 2SKEA 1D6NA 2Q50A 4XXHA 3GLIE 3V7FA 2BFBA 1X1AA 2IYPA 1U04A 1KZ4A 2Y1GA 3MTIA 4LGCA 3DDHA 4KYTA 4WL0A 2OXTA 5BSFA 1HH4A 2ZWMA 1W85B 1SXGA 3QJGA 4HNSA 1BMFA 3MRTA 1UT8A 3VO2A 3RRFA 4NAHA 4B3BA 2ZBEA 5T4EA 4BGDA 2PJDA 2EAUA 3IFSA 3IX7A 2IBMA 4PSAA 2NV0A 8AT1A 2AFIB 4B82A 4ZEVA 1HEYA 4DMKA 1QHHA 1HFJA 2AEJA 4H7KA 5F9MA 2ZSIA 3NV9A 2Q2WA 5TC4A 3WRXC 5ICSA 3ICPA 4OA8A 4BLSA 4KQEA 3A26A 4H0CA 4LFAB 5E6RB 5HIAA 1T8TA 4I1SA 4M6WA 4MWSA 5CA0F 4N5HX 1VE1A 1JVNA 3FD8A 3IAS1 4NU6A 3U7QA 2IYYA 4X5OA 2UUCB 5EERA 3OCUA 3L1VA 1R8QA 4L02A 3UEOA 1V5WA 2BGTA 3DS8A 4JH0A 4KACA 3VXKA 1LS1A 1RACA 1W30A 4XX0B 4JXZA 3ADKA 1YAHA 1EAMA 1T5BA 1JR3D 1EXMA 2Y6VA 4D0GA 4F9FA 2QB5A 4RKYA 2F1OA 1NRWA 1DJQA 2EL7A 3H11A 2YZGA 3I6IA 3QI7A 4JKYA 3Q2OA 4ZOEA 3SI7A 4URXR 4FI3C 2VWQA 4IJQA 5HMLA 4POOA 1RTKA 2VHYA 4MRMA 3HKEA 3UT0A 5KOHB 2VKQA 1KK1A 2A0WA 1RLMA 2XYRA 4JHLA 2OC9A 2OLEA 2HV8A 3ODGA 2AW3A 2OHOA 4PQGA 4RNCA 1UJ6A 3K09C 1N2CB 3I2FA 3EDRA 1ISGA 3K7EA 3KS9A 1RJDA 4L5YA 3I09A 4MJXA 5DM0A 1VXOA 1ZMRA 4KI7A 3RQIA 1G20B 2GEBA 5KDLA 3UH1A 5CT6A 4LYFA 5CIYA 1RRVA 2RH5A 1OXKB 1WQ1R 2ZRJA 1X38A 2VP2A 5EPEA 3GXBA 4DJAA 3HVUA 5BYBA 4IVNA 1NXTA 2MYUA 4XKJA 3ZHYA 5JXWA 1H3EA 1PTJC 1IK4A 2J07A 4DUPA 2BHLA 2VYND 1T9HA 1XMJA 1Q7EA 1H8HA 4YT2A 4MRRA 4NEQA 2GFQA 2YRWA 4M99A 3VR2D 1CTQA 5CEEA 1F8UA 4CLRA 1S0UA 1YU6A 2BEUA 3DNPA 4JLAA 2YVAA 4OQQA 5AYVA 5BO5A 4CQMB 5ES3A 1YE5A 5F21A 1X39A 3VISA 2OQRA 1WSBA 4C7KA 2HL6A 4NFSA 1T6XA 5EIAA 3T3HA 3BE8A 1ABEA 2AMVA 1QZ3A 1E1CB 2R751 3H86A 3BFJA 2A9PA 3NYIA 1ZZGA 3E5NA 4G37A 2IU3A 4LXGA 5CK5A 2VHCA 3PENA 1Z2OX 4FE3A 1UJ4A 2YYAA 4ZEOA 5EHNA 4F38A 3MMXA 4GPIB 4LOLA 1RXCA 2DSTA 4V0LA 3RWMB 3DD1A 4X66B 3B8HA 1US8B 2O6LA 3GLIB 2F90A 3BM5A 4A36A 2IW3A 3PFNA 1AGYA 5J2UF 3EGVA 1TQ6A 1YTLA 2BGUA 3BTVA 4FYHA 1CQIB 3LHIA 4JT9A 4DCVA 1E7WA 4WBNF 5CCDA 4AJPA 4ZGBA 1J2EA 5CB8A 1ML4A 4RMJA 3ZX5A 1YJQA 3IGFA 5BSKA 4C4TA 2CHFA 2GEKA 1VLJA 2X5JO 2Q4TA 1FFBA 4F3YA 5EWMB 3HG7A 3Q3JB 2C78A 2UYYA 1ESZA 4JKIA 3NQ41 3T0GA 2B8EA 2RGYA 3TQHA 2QRHA 3DYBA 4MW4A 1G8SA 2EFHB 1NYQA 2JVKA 4X54A 4TTIA 3RJTA 1K7EB 4FOOA 3TL2A 4P0QB 1BJRE 1TT5B 1WCXA 5DASA 2IEIA 2VAPA 2Y8EA 3S28A 4M0MA 1WQ4A 3RJZA 5MHTA 4DPMA 3IMGA 3TXXA 4MZXA 1RRMA 1QTIA 3SZ3A 5D01A 3GLGE 1N2IA 1BFDA 2RHLA 4R8VA 2PVCA 4TKMA 4TXNA 4E3ZA 2PRIA 1PW5A 3GLKA 1UEXC 3QM1A 4TV8B 3SZRA 4C4SA 2VPZA 4JU8A 4JU9A 2CD9A 1E2UA 2RJNA 3VU0A 5T8KA 3TBFA 5C80A 1WS6A 1E6LA 1RRCA 2HLPA 2Q3EA 3EXHA 3IQWA 4CEIB 1Z6AA 2Q6OA 1RKBA 3PFGA 2WSBA 3HN2A 2MSDB 1GGJA 3OPYA 1BW9B 1GIAA 3FPSA 4L50A 3A1NA 4F3CA 4B6PA 4EBBA 1Q83A 1UMDA 2N9UA 1BDIA 4NXNB 4IR7A 3F3SA 1EVEA 5JSYA 1Y80A 4G5SA 5HS6A 2YW2A 1TEHA 1FNMA 3Q6NA 4EY6A 3FYUA 1DQZA 5JSQA 1I6MA 3C1TA 4KLNA 3ZCRA 4ZVTA 1RLUA 3AUJB 3ROKA 1M2VA 1X7DA 3PDIA 3R3HA 4YECA 4C20A 4PSKA 4DBZA 1XRSB 2PKCA 2Q3FA 1S2NA 1EFLA 2AFRA 4DKJA 3QFHA 1F12A 1KQPA 3CA8A 4BKUA 3AUAA 4C87A 3IBSA 3UJNA 4Y6RA 4PBSA 1UK6A 1E5QA 3KXIA 3QA3E 4Q3CA 4JUCA 1QGZA 3G5UA 4CIXA 1ZO8A 3QYPA 2JFWA 4S0ZA 4H16A 2WT8A 4B17A 1U0HC 3IUJA 3O2NA 2ZROA 1A72A 1C9KA 2AH5A 4RU1A 4ZPJA 1R5BA 5A04A 2BKEA 4I8XA 2IXGA 4LGMA 1N6IA 5EINA 2GYWA 4M54A 4NCJA 2VT6A 2X5NA 5C7LO 2G9QA 2QMQA 2HQ1A 2I22A 1FMCA 4AZ3A 1YI1A 2BP7B 3AXTA 1PX0A 2KE5A 4Y2SA 4FYVA 5G2OA 4BMPB 4F56A 2HF9A 3F6SA 3U9SA 2QLJA 4G9GA 4BECA 5FO0A 4QGFA 4L4XA 1PN3A 2JLXA 3V4LA 1RABA 2QGFA 4CF3A 3RT1A 1NMXA 2OE2A 5A9TA 2CVPA 1Q77A 4CL3A 2LNDA 2D1RA 1M6VA 3L0ZA 3A6HA 4EJSB 1NG1A 2BFEA 1C3EA 1DIAA 2HQSA 3DJYA 3I73A 4KXLA 3SSOA 4AIRA 4BV3A 2C5EA 3NHWA 1ZP6A 1UPFA 5F4BA 5HPYB 2W83A 4AQYB 1N2BA 1LBHA 1MC8A 1VRVA 3VC7A 1F2TA 3R6GA 4XYGA 5ALRA 3TVDA 2H2FA 1DQPA 1SUDA 1A04A 3N2KB 4N49A 1VPVA 4NBTA 2I7XA 2W9XA 2J09A 3OOYA 3VX3A 5LBTA 3VBCA 5DN6D 1F0KA 5BRNA 1JA9A 4CHGA 2PYZA 4J4HA 5KCZA 4TL8A 2YNMD 1AF4A 1YBFA 1ZUIA 2IOYA 2PT6A 3HKCB 3GUYA 3R5KA 4YIHA 4FDLA 5JMWA 3GLGB 2SCUA 3VH1A 1ULZA 1K66A 2GEVA 4RF2A 3RADC 1E3WA 3EE6A 2Z8ZA 1PK8A 2UZAA 3CVXA 3QUSA 1LQ2A 5GOTA 2D1SA 1SKAA 1NSTA 1PI3A 2C4TA 4HLDA 3T4UA 3O9MA 2CKDA 5K0LA 3VYTB 3HZHA 3K1AB 1CZOA 2JIZA 1UP4A 1UEJA 3PPWA 3IHWA 3G8YA 1KJIA 3LQ4A 5DNUA 1IBLB 3I9OA 1MUUA 4M98A 8OHMA 5LPNA 1ZMBA 1KO7A 1TZMA 5TARA 3W4JA 1DBQA 3THRA 3V1YA 1AUQA 3CLSC 3PTAA 1L5YA 3HZOA 4RPCA 1DARA 4C21A 1GDHA 1MNAA 1USWA 2CK3D 2XVXA 1LCIA 2REQB 3N0WA 3IPRA 5A4AA 5JDCA 1M1NA 2K5UA 1NXQA 5EHGA 3RIMA 1M1UA 3FVVA 1H5NA 4RAQA 4JLKA 1MAVA 1LPOA 1SOVA 2ECFA 2HTEA 2PEYA 5DCWA 3RVNA 2D1FA 1USVA 2FZKA 2HRDA 3LT1A 4HKTA 1JB9A 3GGPA 1VSQA 1UMCA 3I4CA 3P19A 1A7UA 5LKAA 5F2EA 2EARA 2Q2NA 5F51A 3QE3A 1I7PA 1QV9A 2A1UA 2ZYRA 1Z68A 4OLHA 2VNIA 5CFLA 4MQEA 3RM3A 2PGOA 5DDIP 1NIPA 5CB0A 4AC9A 2O1EA 4GM1A 2QIPA 5TVGA 3VSBA 5LXTB 1OH8A 1SU8A 3F90A 4Z4HA 1GKUB 4BCDA 3L6CA 1Y4DE 1MOSA 2O8FB 5DGHA 4V39A 4X44A 3JQQA 3GT4A 1QCYA 3O93A 2FUG6 2J45A 2WFMA 3FWNA 3NIWA 2W2MA 4GIBA 1N2HA 3IAEA 4A03A 2AZXA 1XIVA 2ZIAA 4PYMA 4DARA 4M21A 3TMAA 3V2UA 1D2RA 2W2QA 1Y4AE 4BWGA 1QH8A 1CX9B 4QEZA 3GHHA 3W3AD 4ETIA 3CG0A 3WDMA 4NLLA 2L42A 4G09A 4BVLA 1YRWA 1WF6A 2VEOA 1XELA 4RK5A 1H6AA 3FZGA 3BORA 3F8WA 3KNZA 3OKPA 1CUDA 4Q1FA 5P8WA 4KO1S 6YASA 1I3OA 1YBHA 4DG8A 4R3WA 1JUDA 2VYCA 3PLAE 2X42A 4MWBA 2BR4A 5F1YA 3WQSB 1VIMA 2WSIA 4JQZA 3UQYS 3ZHSA 5CXUA 4UVIA 1UM9A 2JFGA 2F67A 4LYAA 1M6HA 5CDHA 1CR0A 1Z47A 5GWXA 3GA7A 2EDAA 5H80A 3UC9A 3UBMA 4QIHA 4F96A 1VIYA 2A4MA 3D7RA 4KAFA 5LU8A 2FH5B 3PICA 1O95D 2CNWA 1C8BA 3HEAA 4BX0A 3IKTA 3RBZA 1OI4A 5FEMA 1FFWA 1DJLA 3MWEA 2F43B 3PGMA 1U5CA 4B31A 1NJ1A 1ID1A 3N7UA 1XZAA 4YDHB 1SBTA 3ZKWB 3PX7A 1JTEA 4AKGA 1OFHA 1VYTA 4YCDA 5SY9A 2R8XA 3M82A 1YS9A 1QQBA 4ABTA 2BTEA 5K09A 1JH8A 3N07A 4TYQA 4X9XA 4S3MA 2IHBA 2CVZA 1P81A 5K0NA 4BVGA 1EUQA 1O9GA 4RMNA 3OTOB 1N1EA 3WIOA 2ICAA 2O1XA 5IZCC 3PG5A 3HB9A 4MS1B 5KSYA 4KH1A 1ZRSA 1D2CA 1Z0ZA 3OECA 3Q7EA 3ZE2B 4K9NA 2NQ2C 5BQOA 3D4OA 2WSSA 3JRNA 1PNOA 5HX7A 1GKLA 1ZIXA 1DEHA 1UDRA 2DPLA 3G9XA 3TTTA 5EUCA 4F4DA 5C35A 4U6QA 2FUNB 4OGFA 4TV8F 3WQRA 1PNTA 1ADYA 4IIFA 2BGWA 4I8IA 4FIZA 1JYFA 1A97A 2XJ4A 2O14A 2SECE 4GC9A 4K6OA 2YZMA 3IBGA 3W5VA 4WSOA 5ERYA 1BXGA 2R6GA 2XTJA 1Z6GA 3PPVA 4EUEA 1ZN7A 4FCCA 1DINA 4E03A 1CC1S 1P31A 2ZU6A 3KZKA 1H69A 5B53A 2B9VA 4II7A 1P7CA 1RZ3A 4EVQA 4LWQA 4RSMA 5JG7A 2PZJA 5TDHA 1E0SA 3LC7O 2GFHA 2A33A 3JVEA 2AV6A 4YRBA 4AZ0A 2LKDA 1E9DA 1BEEA 2I80A 4TS1A 1VCHA 2C2MA 3ROFA 3DE0X 4JMPA 2MYTA 4DTCA 2H7CA 1Z33A 4HH3C 2P2NA 3W2EA 1WW2A 3S40A 4FB5A 2YN4A 1X7YA 3SICE 2FRVA 1Z2DA 4PEVA 2ZYGA 5FR2A 2J9GA 3GROA 5JAPA 4QYIA 2GZ1A 4PS0A 2YJNA 2ZBPA 1XTIA 1BE6A 1XN4A 3C0KA 3S6JA 2CLDX 2G6TA 1WDLA 3UMCA 2R2GA 4PC2A 4QULA 5DT9A 3U7RA 3OLYA 3GQVA 2V74B 5JMPA 4EGQA 2E87A 1XROA 3GFOA 4IY1A 3M34A 5D6OA 2J3MA 2VHVA 1M75A 3CEAA 4MQ6A 2I6UA 4IQGA 1MQAA 3VMMA 5KTOA 2C29D 3QPUA 5HE8A 5EJ2A 2LPMA 4BVAA 1NLUA 4Q00A 2VT3A 3GRYA 1QQ6A 2G88A 3SXJA 4JXXA 1QKIA 4ISBA 2CL7X 2EF0A 1A2BA 3IUQA 3JWHA 4Q7JB 3L7BA 2QDXA 2L0XA 4ZV4A 5B6JA 1CYDA 3DE5X 2ZCJA 3CV3A 5I9SA 2W6ZA 3S8EA 4CNBA 4KN8A 4TXHA 2IOFK 1TNDA 4Q93A 3K8YA 3RB8A 3BAZA 3KJNA 3DZJA 1NG9A 1ORDA 2ORIA 1ZI9A 1VLVA 2GBLC 1SXIA 3CNHA 3EIOA 3IODA 4GXNA 4HCJA 5FPQA 2RAPA 4O4JB 1SUEA 4RCVA 4C7BA 4ZIRA 3AEXA 4C6HA 2O8DA 1XLTA 3BWEA 4RDHA 1WUHS 2QU8A 2GM5A 3FSRA 3CCFA 1U1EA 4YV7A 2Z2JA 3VPBA 3TRIA 1BKDR 4KQ2A 4P5DA 4CM4B 3OT4A 4J7XA 2NPFA 1OW3B 1WO8A 3FFAA 4JR0A 5HDBB 4OHZA 2H17A 5CFQA 2OV4A 4KRYA 1SIWA 3VYRB 1AMUA 3LHFA 4B8WA 1IQ0A 3MHPA 3D3JA 4N9WA 2FPGA 4MQFB 1U80A 4UHEA 3SNHA 4DMRA 1TAQA 2FWIA 1CZLA 3CKYA 3CWZA 4L7QA 3UG7A 1SUIA 3MGGA 4JY7A 4B7XA 4U02A 3DDSA 2DQ4A 1AU9A 2NO7A 3PS9A 4URFA 4C04A 5TS3A 2ZSBA 3THWA 1N33B 2ZYUX 3L41A 3NHPA 3O95A 4JT4A 3T3PB 3OPXA 4MRNA 1GGHA 4X1IB 5BW6B 2WJ4A 3EPKA 4GG1A 1FLNA 1YJCA 2F3PA 1FDTA 3GF4A 4HNHA 4G8JA 3KDAA 5SYAA 3NTUA 1P62B 4BGIA 3FZNA 1KY4A 4IWNA 3N76A 4BU0A 3ADBA 3ED1A 1NRJB 2JBHA 3LZ6A 2ORYA 3JYQA 3G17A 3BE5A 4OTZA 1G1AA 3FOEC 1R6VA 1CUFA 3KT6A 3A9WA 5B3AA 4RTNA 2I9PA 2ZR0A 1TLTA 3A6GA 3B53X 4MV3A 4ZQCB 3PUYA 4HGOA 1M2KA 4NOJA 5DCLA 1B73A 4MR7A 1MFZA 2WY2D 2C9OA 2F1HA 1FJGB 3B5JA 4D1YA 5HG0A 2D2FA 1V3TA 2F3QA 3JS5A 1P6UA 1ZCJA 4I2VA 4PQFA 1DQSA 4LYDA 4YK7A 1U1FA 2CDAA 2J5RA 2O8CB 2ZBQA 3F67A 3C87A 4YO7A 4GOMD 1R8JA 1ATIA 1EMDA 1K6MA 4V0SA 2AOVA 4DJEC 5LQCA 3AVVA 4QDXA 3WFJA 4TTSA 1R4ZA 2HA4A 4U8HA 3TQQA 3QXJA 3OD5A 3EXIB 2D0IA 4KREA 1SD5A 4P4SA 5L9AA 5LXTF 4W6ZA 4RACA 1ZU5A 3D81A 1PK7A 3GRRA 4AJ9A 4QOSA 5DMHA 4C4YA 1H8ED 3AUSA 4CKYA 1NVXQ 1GPJA 3PIRA 3GUHA 1E8MA 1YMUA 4BZPA 5I3ZA 2UUBB 4YQEA 2ZTMA 4FGUA 4R8KA 1ST2A 4BRUA 4MULA 1NF9A 4N3NA 3WDLA 3LT5A 4D4KA 2BPOA 4UMDA 4OBBA 3UMBA 4B5KA 4NTZA 2PIAA 1V11A 2O0HA 1Z07A 4MPDA 1JJIA 1LJLA 1RQ2A 2VYVD 3QPBA 3IIEA 2AXQA 5DHAA 5FULA 3ZJ5A 3T3OA 3TSOA 1NW9B 1B1CA 4IHAA 3UT6A 1EE2A 3TNFA 4P7FA 3ADPA 4R1MA 4X1YB 5CH3A 4JI2B 3IDZA 3NUQA 4FYIA 4JN6B 1HNXB 1RQXA 1SVKA 4QUEA 4WCFC 3ZDDA 1OH5A 4P4TA 5TQ2B 2HNAA 1T2VA 5DZSA 3X2EA 3LO5A 4W5WA 3LE8A 2B83A 2ES4A 3O0DA 1R0LA 3QJYA 1Q0UA 5BQ3A 3CF4A 1OWOA 2PX6A 2FW6A 4B7AA 1W96A 3KV1A 4C89A 3FUCA 3LA6A 4FLMA 5IF9A 2J31A 2VP3A 4MVXA 1FLDA 3A1VA 2ZJZA 1R88A 3CNEA 4BV8A 1LX6A 3N2IA 1U90A 3RYIB 2Y3IA 4RXTA 3WKAA 3NASA 5A2GA 5JS7A 4JBXA 3OOSA 1PG2A 3EG9B 5EMNA 5GV7A 4GKVA 4L2IA 3ZW9A 2HQRA 3QELB 5JAIA 1Z4NA 2DHEA 4R16A 3W2FA 3EPLA 4WI1A 4AJ1A 2IS1A 3WYBA 3ZN2A 3LFTA 3BSYA 3P52A 3QVJA 3H2SA 4PWZA 1I5EA 1FX0A 4DGQA 4NOKA 1H0RA 3FJYA 1X1RA 1RYNA 4MUKA 4EGAA 1R50A 4NCHA 4RKEA 4LF4B 3DLCA 1QIHA 3WZLA 3LKBA 4QOGA 5JS2A 3W34A 3G8DA 2PY6A 2Q6LA 4KMMA 1AA9A 5FL3A 1LRLA 4R2XA 4HT3B 3IUNA 2WKQA 3DJFA 2ZSDA 3E9CA 1TF5A 4LKRA 1ADJA 2F00A 1AQNA 3EVGA 1EFDN 2PUWA 3GMSA 4BQEA 1W88B 4UPDA 1UC4B 1XQ9A 3TG8A 4PXSA 2O5CA 5T41A 3A6LA 4BV2A 1DXYA 3ICOA 3NLLA 3FTPA 4UDYX 4OHPA 2XZDA 1RJFA 5CD1A 4M1SA 3QEAZ 1S96A 4YJ2B 2F4VB 2Z3VA 2XSZA 1T4GA 4RVOA 2C5FA 4KO8A 2LVBA 1L7NA 3V4RA 2DLCX 3SHVA 3EBPA 4MV6A 4CKCA 1JKFA 4EY7A 2E3JA 3IPLA 1K3FA 2BM9A 3I52A 3RRXA 4Q24A 1IN7A 2XYPA 3MGAA 4GYKA 4E13A 4JUDX 1NJ2A 3D6JA 1AGPA 1Z12A 3DAOA 1EQ2A 2QX4A 3HSKA 3SF8B 3B9BA 3JAWA 4G07A 5SY4A 5LVAA 4N48A 2FEOA 1IULA 3O38A 1QG6A 1DE0A 3GEEA 4HS9A 3ZVKA 2I6FA 4ZK6A 3ESBA 3NT5A 1KORA 2EBFX 4PYRA 4TPKA 4YROA 1FP2A 3ERCA 2ZBGA 4N0QA 3DFFA 4KKXB 3B7WA 3FFWA 3KYIB 4ZKEA 1OTXA 1YCDA 5FFFA 1CQWA 3CC8A 1Y1TA 3I6MA 4LF7B 4TUYA 4I6GA 1QHXA 1T8PA 2SKCA 3L82B 4MGEA 4JOQA 4YJHB 1SZCA 3L9XA 2R7LA 5GVSA 5BMVA 3BBLA 4Z9FA 3A4MA 4KRFA 2XWBF 1NAHA 4HH4A 3PUHA 3E9MA 4HDMA 5JFOA 4Y9SA 4X95A 1H2EA 2I91A 3EYAA 3G6KA 3DZ8A 4L76A 4G5GA 2OCBA 3DEAA 3EY9A 1QIDA 3FKQA 4O4JF 1NU8A 4PLWA 4UUBA 1AIPA 1EVQA 1UPCA 3C1UA 3FMVA 4U0KA 5F33A 3WQQA 3E1SA 4EFKA 3UTCA 2X0IA 3DXYA 1EX1A 4BLPA 3W9SA 2P78A 4DN6A 5DW3A 1H42A 3D7LA 4HUQB 4JLNA 1RKXA 3KYBA 4JR2A 5KS2A 2QRUA 4PO9A 3MEQA 1HQKA 1Z8FA 4FSXA 1T1RA 2QXUA 1B0ZA 1DCKA 2XR1A 3RFXA 3DAPA 5AHWA 4YJKA 3L6EA 3GEGA 5DHUA 1AKTA 4BB6A 2HMSA 2WHQA 2ZT8A 4ZVQA 4AF6A 4E07A 5JY1A 5JE8A 1QJCA 4KCGA 1JIQA 1HMPA 3BMQB 4QGAA 5H3HA 1WPXA 4U6NA 3UJHA 3ZXXA 2OO5A 4BGUA 2FEWB 4BIMA 4UMEA 5BNZA 5HUQA 3KDPA 1JHQA 4FHFA 1MB4A 1HX7A 4EHHA 4PYKA 2FZCA 1R9MA 5HGJA 4HS4A 1ESEA 5HZKA 1V8BA 2VSNA 3EMDA 1QPBA 4UM9D 3U1TA 3MRXA 1H22A 2OCAA 2ZS8A 3BTOA 3QFRA 4IIYA 2GXSA 4YB8A 4E0BA 3EX7C 1C0EA 1H9BA 1VMEA 1DEKA 4JVMA 3DBIA 2PZBA 4LJAA 4ALNA 4BAUA 3LUFA 1GQRA 3H1BA 3DDUA 1G5IA 1K5HA 3FPCA 3LIIA 3COWA 1EFKA 4CE6A 5COQA 1EA7A 4AS1A 2QXYA 1UODA 4L4SA 4F21A 2H4FA 4ARZB 4NKRA 4ZAYA 4F5ZA 3FOWA 1WRBA 3BWCA 3V3KA 4QXMA 1JVSA 3FZQA 5FQOA 3OEWA 4OGLA 4ATNA 1C29B 5D8DA 4C9BA 3QX9A 2ZYTX 2AL7A 5I7VA 1WMSA 4ZDKA 1PUJA 4O1MA 2BTQB 2ZYWX 1T0PA 2IPXA 1WOMA 1YDEA 3FW1A 4LZZA 5DM1A 3RI3A 1SOMA 2EEZA 2J9FA 1HURA 1SHJA 1BROA 3E7PA 2PJZA 2GHRA 3HDGA 1C7JA 1FTGA 2CXSA 3IT0A 4I08A 1U98A 3ESXA 3H9JA 3CZRA 4MUAA 1NP3A 3KQSA 3WGTA 1R6DA 3PRJA 3WMRA 4AURA 3RVRA 4DUGA 5HJ5A 4LHVA 4MW7A 3AI7A 3E5HA 3UHPA 4DCOA 4N12A 5JCOC 2PQMA 3U3MA 2I66A 3K15A 3VPFA 3LBHA 3SR3A 1QMPA 3CJRA 5JMOA 3THXB 2O2HA 3A9CA 3P97A 2IU4A 2Q6TA 4HDRB 3TLKA 3ELBA 3ZY4A 1KI8A 1XTVA 3D4NA 3FYTA 4FMDB 1OZ0A 2HDOA 1TUEA 1V2HE 1SH7A 2EW2A 2QPAA 3P4XA 1U3TA 1K7YA 1PUXA 1WDKA 5AK4A 5HA5A 3VJKA 4ZK2A 5BWLA 1V8DA 1R9GA 3RAFC 3OX2A 2VPWA 1I94B 2F1KA 3UANA 1IN8A 2F64A 1IBRA 3Q9UA 1AC5A 3KPVA 4ZO7A 3FZEA 4TLCA 3BA1A 3NBUA 1QZUA 4J0KA 2Z6AA 4WESA 4MAAA 2P4UA 5FPSA 2BM0A 3RS3A 1MLDA 1IZYA 2PGNA 2R68A 1JHOA 3VZQA 5FT9A 2YWHA 1H4QA 4EHFA 5BR4A 4N7BA 4WZAA 3SJ7A 3HDYA 1EQUA 3ANTA 3KJIA 3M4JA 5DBGA 1H05A 3NR2A 5E4YA 1I3KA 4L4YA 1KE2A 4EM6A 5BR1A 3ST7A 5A5FA 1CJBA 1ZDMA 2VH1A 1I4LD 1BFUA 4P22A 1GQYA 2ZVJA 3DOOA 4BEBA 1TYAE 1FS4A 1TEXA 2RARA 1L9XA 1JBQA 2W2KA 1E9VA 3KT0A 2QE7A 2KW5A 4XEHA 4CG2A 4W1RA 5KMGA 4DNFA 5HZMA 3CT4A 3HB5X 1WG8A 4XFDA 4V0MA 1JFSA 3MS7A 3CKKA 1S8FA 1QKJA 1P7ZA 4AYTA 3EBLA 3OJ0A 2A35A 2QU7A 2CBZA 2O48X 4IV0A 4CQJA 2WRZA 3FB1A 1ULBA 4OSOA 3IQIX 2XD4A 1RWKA 3ICQB 4XB1A 2I8CA 1EXVA 4JQYA 2FR1A 2WF7A 3LNCA 1MO3A 3NM5A 3OEHD 4TZKA 2R6DA 2BL4A 3NH9A 4NBKA 2CFRA 3IR7A 4LJLA 2F62A 3SIWA 3T5MA 3WA7A 4WXEA 2B7CA 4YRQA 2G8LA 3CKMA 3EIXA 5E9AA 3A2MA 3NYWA 2NXCA 1GGMA 4AWXA 2J3JA 3RANA 4B34A 3FM9A 4X20A 2J5QA 4M8KA 3W5CA 2CV0A 2O6HA 5JCJA 1OVMA 4FOTA 1PJAA 1QRTA 4J6EA 5ALJA 2P2CA 1Z37A 1EP2B 2JLCA 1ZAKA 4GC5A 3IAHA 3ZK7A 1GV1A 5AXDA 2QQGA 4KNWA 1EVLA 4YWHA 1VFNA 2INGX 3KZ1E 1H1LB 1ZMXA 5CDYA 1KDYA 4LYEA 1IFXA 1WMAA 3KD3A 4L8VA 3KZXA 2PUHA 3HU5A 4YJ2F 2XOXA 3AOGA 4BP9A 1K3TA 4BMDA 1JQKA 5IVDA 5CFNA 2ZM5A 2OBNA 1DEXA 1CULC 4P36A 4FNOA 3LUHA 4RNDB 4DCNA 3MS2A 4R98A 4HRYA 1IQPA 4YP5A 4ZAXA 4D9HA 3G8BA 4BC1A 4KGDA 4IUCS 3RVPA 3TW8A 2PBRA 4GUAA 3U7JA 3O8QB 4HZIA 2N42A 4PBTA 1I3LA 1KMMA 3M0EA 5JC8A 4JX9A 3WL3A 1FUUA 1PE0A 2FN3A 1Q1ZA 2VDLB 3KZNA 1N0VC 3WOVA 1V5EA 2DWCA 4QHYA 2HA7A 2BMDA 4ZRMA 3MWGA 3M4YA 3KOMA 3QLUA 5FIUA 3Q6IA 1RWQA 2XRZA 1J5PA 2AK2A 2E4VA 2JPDA 5DHPA 3D2CA 4W1SA 4RDXA 1SVUA 2XEXA 2JHGA 3WB2A 1HNZB 5EE5B 5JQGB 5J1SB 3IA2A 5BV2P 1EWQA 2C9BA 1QP8A 3MXTA 2ZIFA 4EHBA 1GAEO 2NP7A 1MZVA 1C9JA 3WXBA 3HVIA 1JHZA 4E4YA 1V8PA 3FUVA 3C3PA 1Q0HA 2OK8A 3V1UA 1GCUA 1YBAA 1YS6A 1BN6A 5ENDA 1CQZA 3BMCB 1B8UA 3CLKA 4D6YA 4N7JA 2K2WA 2VTEA 4MLPA 3TH5A 1A1VA 1JG7A 1KAMA 1VJ1A 5AVRA 1G5QA 2HQOA 3B3QA 4DPKA 1FFDA 3QW4B 3OWHA 1QZXA 3ZGVA 1UFVA 4G23A 4YNBA 4YAEA 4G0PA 3RHFA 3TN7A 5JZVA 3VDNB 1NC3A 3WRYA 3EMVA 1PGJA 1N5DA 2VPIA 3O4JA 4Q01A 2O3TA 4O4LB 1PD0A 2FX3A 2OD2A 4JSRA 3KQYA 3TM5A 4BO6A 2PZEA 3RVQA 4MUYA 4BTLA 5AVVA 3ZD7A 2C2XA 3AB3A 2JGLA 4S35A 4LFBB 5IKMA 4YJFA 4EW1A 1APBA 1SBCA 2B1RA 2YASA 5AK3A 5KSZA 1RM3A 2V6FA 4OD0A 2NO1A 3U31A 5BN5A 2ZUEA 4M0FA 1U0FA 1RJEA 4HTFA 3RRZA 1NZFA 3L0CA 1QP7A 1WHTA 3F2IA 2OQVA 4UBMA 1HOTA 2QUZA 1AUOA 2ZB8A 4ETWA 3L4BC 4O2RA 2ODQA 1BU5A 2D4AA 3M2TA 2XTNA 4NYJR 2O52A 4LQCA 3KSRA 2FK7A 2H08A 4RA9B 4D3FA 1S8OA 4BUZA 3DM5A 4OHVA 5E4JA 4CKEB 2WFLA 3FCEA 5TVKA 1NW6A 4RIIA 4KLAA 4E1VA 5C5DA 4U1RA 1Q3TA 4WIAA 3JQBA 1J24A 3ZWQA 2JAWA 4D45A 4TLBA 4D99A 5ITZA 2D1TA 4KLRA 5FUQA 1H2FA 1VJDA 1XI2A 2WD9A 2XHEA 2ZKLA 3GJYA 3KDSE 4G0YA 5EWJB 3PUZA 1ADFA 4TTTS 5IJXA 4HDQB 4GOKA 4ZO6A 3IMEA 3BIWA 1YBMA 5K0CA 1R5JA 4CV0A 1F4PA 2XCLA 1GLGA 3G5LA 2ZZMA 1GTSA 5EKXA 2YVKA 3M6VA 2AE1A 1QGAA 3R24A 3ZXUB 3UHOA 3DYVA 3C5WP 3P0HA 2KQUA 1PR6A 2WZCA 3OY2A 3DKKA 5A3QA 1JIXA 2WIJA 5LR6A 1D5CA 2VDKB 5DP1A 3A3OA 4CKXA 4F7DA 3TLGA 5L4LA 5K8UA 2F55A 3LXMA 4RHUA 4QOJA 1XX6A 1A8PA 2KMLA 1THMA 2PVPA 4MRAA 1IHOA 3CBQA 4RHEA 5EI5A 2LUOA 3QUTA 1RJWA 4YCBA 3V8VA 4I5DA 1U2GA 2QN2A 3OIWA 2R25B 3R0XA 2ZSJA 1UWKA 3OE5A 4LJ6A 1B15A 4HF7A 1HI9A 1GADO 4HN9A 4J0CA 1ZBDA 2HOQA 3HVKA 4MUNA 4ZU6X 5FH9A 3N8HA 4G0VA 2ACWA 1TUBA 4QVIA 2CF6A 3KTAB 4KNVA 1UKAA 2R1TB 3AF6A 3DV0B 3F6PA 3B85A 1WXFA 1HNNA 4CETA 1Y7PA 3D4BA 4D0NA 2ZUWA 4D97A 1SCBA 4L9SA 4Y2RA 4FMDF 4UMVA 3MT9A 4EGCB 1U3CA 2R1VB 2J87A 2Q6KA 1AS2A 4A15A 3SYRA 1FRQA 2NOAA 2WUWE 4GLJA 4M9SA 5HQJA 2IYEA 5LA6B 4Z7QB 4XUGB 1Y4ZA 4R6XA 3EXEB 2OMEA 2WDPA 4D42A 2QBYB 2KYRA 3ZZUA 1JZTA 2YCLA 1KKMA 1U28A 4WK6A 5HIIA 4RD6A 3SIXA 4Z6KA 3DP9A 2Q21A 4IM7A 4GI3A 2NTEA 3AG5A 1W49A 5AKGA 4CM3A 2QVCA 4EJSC 5CBPB 2IRWA 5JHHB 1CEEA 4MI6A 1L1EA 5ERXA 3B6IA 1CB7A 3FI0A 4IXDA 4Q48A 4QRHA 4NBWA 3ZVMA 2OZLA 1PYDA 1RXWA 4FFWA 4O1HA 4QGSA 4KODA 3H9CA 4MIEA 3KJEA 3Q2KA 1S2GA 4LAFA 1N5OX 1F5NA 1NONA 1ODJA 1YVEI 4DF3A 1WZEA 2ZT7A 4RHTA 1T1EA 2F4NA 3Q6MA 1LW7A 4Z4CA 4F6RB 4Q4AA 2HO5A 1N7IA 2C98A 2AE2A 2CLMB 1GPMA 1WDMA 1KDVA 2HA5A 2BZ1A 4ARAA 3BJEA 3L5KA 3LK6A 4ZYYA 2O8BB 2WU1A 1XD8A 4W9RA 1SVOA 1P80A 4MUIA 1PJ3A 1UADA 3EZ7A 2ZDQA 3KVNA 4YJGA 5I7WA 1YMVA 4FKBA 2UKDA 2O57A 2Z0MA 3A1DA 3HDTA 4BCBA 3W5IA 3I37X 2YZNA 5KDOA 1OYWA 4ZODA 4R7TA 1HT2E 3F1KA 2FEPA 1QCCA 4JASB 5C34B 2WYIA 4DNQA 2XYQA 2AI1A 4H7DA 2DR2A 2VT7A 1P33A 3D8SA 2YINC 3HU2A 3JXEA 2WG1A 5AI8A 2Y1WA 1OYYA 1FFCA 1ND6A 4OQ4A 5TV2A 3VPSA 3ZGOA 4CDMA 2GF0A 4PLVA 1BOFA 2OAP1 5DCUA 4D56A 1HE3A 3N2YA 1AN9A 1G8AA 1ZI6A 1F14A 5EEGA 1A77A 4BMYA 1R0WA 4RJLA 1NSFA 3SKYA 2HPZA 2ZUDA 1P75A 2C9ZA 2P3OA 3B5EA 3ZDFA 3ZW7A 4ESHA 1U0NA 2XCSB 4DHEA 4EMUA 5A4MS 3P2MA 1YB4A 3O5AA 1CT9A 2Z08A 5IBRA 3ESDA 3T4EA 2LP4Y 1U7OA 4IDOA 4LSZA 1I80A 2H8GA 2O2CA 4HO1X 4L72A 4YUYA 5IT4A 1R9NA 3GI1A 3HHPA 4OMCA 4QPZA 1DXQA 1PJ8A 2E4ZA 1GLVA 3RUCA 4EA8A 5CA1B 5CBKA 3UMJA 3BFKA 5CLLA 3V4SA 2R7AA 2J59A 1DB3A 1G6Q1 1JHAA 2P1ZA 1ZI8A 3W1EA 2XEDA 1NUQA 2V03A 1CUSA 1PJ2A 1ND5A 5AW3A 5AXAA 1JSCA 1QHSA 1ZH6A 3OLVA 5EJ9A 1YS7A 2PX3A 3DTVA 3H7IA 3QFCA 4BNDA 5KNDA 2GXQA 2HIMA 2R6ZA 1JE1A 4NBSA 4V2IA 4BEWA 4ZI2A 1EQAA 2WM9B 3CH6A 2OL4A 1NP6A 4BP3A 2JDIA 5DI3B 4ENQA 3WK8A 2Z6UA 1C3OA 4GWKA 3OWOA 1C8VB 3AU9A 1QZTA 1UXHA 4UVEA 5JJKA 4G5RA 4MKXA 3PGXA 3IBFA 3BTSA 4HAZA 4OI1A 4DSAA 2DPYA 2VJOA 2QZSA 3O4VA 1PTKA 3AETB 1IN6A 3RGWS 1UK7A 4B4DA 2AEEA 3R4VA 3WL5A 1U9CA 4HMQA 5CH8A 3NVAA 5KTPA 2EIHA 4IOJA 4EY5A 2Q4EA 4X0EA 4KPGA 3MWFA 1PS0A 2RSLA 4K9OA 3WHLA 2FY8A 4BO2A 1K2VN 2EQAA 3HJAA 1QCZA 3D3EA 3D59A 3K9BA 1U2PA 3U7IA 2X7HA 2WVJA 1KAEA 3DT6A 4JJ7A 3JQ8A 3S0JA 2W48A 4DY4A 2OHXA 1QYIA 4IHKA 3CF0A 4K9QA 3K0CC 2FP4B 2WAMA 3C6XA 4D0RA 1TEZA 1YCGA 2W42A 3RVMA 1HTWA 1VGQA 1AZLA 4JUFA 4PCLA 1VI6A 4J7UA 1QJ4A 1SELA 1Z08A 4OP3A 3PVZA 1USKA 3B2EA 1CUXA 2TYSB 1TU4A 4FYXA 4IVPA 2VTDA 5KAMA 3VOSA 4HYTA 4L6IA 4X7RA 5M5BA 4F2HA 4BVKA 5JAMA 3HCNA 4IVRA 3C8DA 3FVQA 1AS0A 1NN0A 1KFKB 4O4LF 3FCYA 1U2QA 4W9NC 2QZ9A 2YX1A 3RLFA 1CDZA 3DLHA 5CXSA 3AERA 3IT1A 3X3HA 5DPMA 2ADOA 2HWXA 4QICA 3TD6A 4ZV9A 3I1IA 1EGQA 2GT1A 1KY2A 3E22B 2B92A 4ENWA 3TQIA 1TKAA 3UW1A 5HBGA 3JZDA 4MKIA 2QTLA 3GJ7A 1NBMD 3K2BA 5B3JA 2ZIXB 4U3JB 2DF8A 3I0NA 4HH0A 4RFSB 2XGMA 1I33A 3OFND 3ZTTA 3LK7A 5CITA 1N7GA 1A27A 4D2IA 2HRQA 4UBLA 1CF9A 3BS4A 2XUHA 2AOUB 2DWUA 4QA9A 4TTAA 4EEKA 1XP5A 2Y1DA 1SJ9A 1ZH0A 2GAOA 3MCUA 5K0FA 3R9WA 1CEQA 1KL7A 1DSSG 1UKZA 5EXPA 4AFNA 4PIPA 2VJMA 2ALJA 5F2KA 1SY7A 3OMLA 4Y3UA 4EMSA 3I04M 1WY5A 1N7HA 1V48A 2C04A 2KX7A 2OXFA 2R7KA 3P2YA 4KDFA 3FPAA 5IDWA 1WXDA 2YXBA 3H9QA 2NUTA 4AS2A 1MHTA 3DEYX 3CSDA 2AMLA 4NV3A 1LPPA 7MDHA 2NO4A 1GTJ1 1KO4A 4FN4A 1V6CA 3MJTA 3GT3A 4NJMB 1T43A 1Y3HA 3OM1A 4ED9A 1I2ZA 2V4MA 3DVAB 3R5SA 3WRWA 2IBSA 2WUDA 3HJHA 5EQFA 3KKZA 4R8LA 4C0WA 2OV1A 5AO9A 4KZKA 2V7UA 5DB4A 1D6SA 4LNUA 2QR3A 4ZVUA 1JLMA 2Q8NA 3UCFA 1G1MA 2PU7A 3AJEA 4B5LA 2VDOB 10MHA 2RD2A 1LK7A 1W0KA 2CBXA 2GEJA 3PGLA 4K87A 4AO6A 4DMCA 1TIKA 1V3VA 5HYVA 1UJNA 1OBCA 5F3WB 1M2NA 1PEYA 5K3FB 1Q15A 2Q5LA 3L46A 1E7MA 3DDOA 4HSGA 1XQ6A 2A9OA 1E61A 5CYPA 3KOOA 4B6JA 2F8SA 5HF8A 3RTDA 2O2SA 5LQRA 2JCYA 4UNNA 1XPRA 1J09A 4X85A 4XQ0A 3P2OA 3KT3A 4D74A 2BTOA 3MOIA 2HAEA 2Q46A 1C3VA 3DB1A 2VYNA 3QPCA 5LA6F 5KJCA 3ZGXA 4HNAA 1XV5A 1U4NA 1E32A 1KYIA 1NASA 2JC3A 2NUPB 3AIKA 1SBQA 3HI6A 2ECPA 4R2MA 1QC5B 4R84A 2W6JD 2OQ2A 3SKVA 1N8KA 4XR9A 1E6MA 1SG0A 3IVGA 4AMGA 1O87A 3FTQA 3GEDA 2DQYA 1ZSYA 2JLRA 3N59A 3OQIA 3X1MA 2QG6A 4Y9TA 4O8ZA 1IPFA 3F7TA 5K20A 4KR6A 4K8OA 1UBJS 2B2NA 1TGYA 2Y1LA 3EDYA 4G5QA 1EPUA 6LDHA 1UQRA 4ZQEA 5H8WA 1EZZA 3LF1A 4IRUB 5AJZA 3IV6A 2ZBVA 1W6RA 1UBTS 4J2TA 1C14A 2BEKA 2DE0X 5FBWB 2VRCA 1EINA 5IEJA 1L5ZA 2YS6A 1E2LA 1IJEA 3NM6B 1NWCA 4GMGA 1IVSA 4HFJA 2WKSA 2WIDA 2QTFA 3OVMA 3EVAA 3O94A 3BEDA 4UATA 3NKLA 5E9WA 5IJ9B 5I7UA 3P9IA 5IX8A 2PUAA 3RYCA 1D1QA 1E1QA 2YY5A 1PV1A 3KPUA 1IL0A 3IXQA 1RKQA 1Q0SA 2VUSA 1Y7IA 4XQGA 1IUPA 2AXNA 2VDVE 3EGXA 4WNAA 4Y2HA 2P1RA 4GXTA 3LUGA 4HGNA 2JH9A 4A6XA 1ZM4A 3JW8A 2W0SA 3QVOA 1JA1A 1Y3BE 3HP7A 4V0OA 3KX2A 5DBFA 4DMFA 4FLEA 2PHZA 1QGUA 1T2NA 1T1JA 5F7OA 2NZ8A 2BN4A 1RHRA 2ODTX 1JMVA 3E7XA 4HNTA 3REQA 3CUVA 4UU8A 3LUKA 1EXWA 2P9QA 4FNGA 4ALIA 3ZPXA 1YOBA 1CUCA 3AUUA 4DA8A 4MMXB 3BILA 5E38A 1WAMA 5IXJA 4EB6A 3A0RB 1BCRA 5FHQA 3RJ9A 3TM4A 1TCAA 1LTKA 4M9XA 4Y9DA 2PH7A 5B4VA 1KHHA 3LPDA 1MBZA 2BGLA 2V9CA 5EKSA 4K6MA 7AT1A 1XRMA 4YGYA 3JTMA 3HBNA 3H42B 4P7JA 4XYLA 3DR5A 2ZYAA 2F48A 4HQNA 4M7WA 3W3ZB 1Q7GA 5K05A 4EVSA 3OT1A 3QKRB 4HC4A 3TF5A 3WNDA 3OUZA 4M55A 1XZLA 4U5QA 5CA1F 1D1PA 4FVTA 1ZCBA 4B8ZA 1CJUC 4Y98A 1XZJA 4UZSA 3E2MA 3SZGA 3GBSA 2HYDA 4Z0NA 3K0HA 1N36B 1YA4A 1N2ZA 1MR3F 2XZTA 4L8GA 5I9TA 2QN3A 4DDTA 5ALIA 4UTNA 3IEMA 3ETCA 1KHTA 1Y34E 4QBHA 3KP1A 2X86A 1HQCA 2G0AA 3IRVA 2O3SA 3SBDA 3MD9A 3UGKA 4DIUA 1KEUA 1Q7CA 1UMBB 2WMDA 3IPXA 3U3RA 4X60A 4EPWA 1JG1A 4D98A 1XQWA 3J7TA 4M0KA 2YICA 3RU2A 1TA9A 1ZICA 1RFLA 2PZLA 1XEWX 1NVFA 2J3DA 4RZQA 4DOMA 2Z2XA 4GKJB 4MYUA 1VG1A 4I50A 2Z30A 2CHUA 1VMAA 4BE7B 3ZWVA 1OLUA 1SB9A 3G2NA 1XHEA 3ISVA 4M89A 1WDWB 1AHPA 3FVWA 4YRJA 1QP0A 1XCBA 4MITA 5F3DA 2NPIA 5IH3A 4JJKA 4LHZA 3I2HA 1HG1A 1NXOA 2Z5LA 3H8WA 4NAUA 3BXZA 4EFMA 3V7NA 3MTAA 2BBOA 4IGIA 2OCXA 3KVVA 4CLXA 5I5EA 2QAGB 3Q5GA 1YCFA 1E6CA 2P90A 5FFMA 4QWMA 3OP1A 2R6HA 2VDJA 1H9AA 3L7OA 1E6WA 2FMKA 1OLOA 5KYXB 5JRJA 3RS8A 1WETA 3T0IA 3ZXYA 5IBQA 4DCUA 1K92A 3NXSA 1HLPA 1K5GA 5F77A 4K6KA 3PJGA 4N3GA 1L4YA 2C99A 1XNJA 1W2GA 3A1FA 4L0MA 4WUTA 3R7FA 1KDOA 4EGJA 1OXVA 1KDRA 2JFBA 3K70D 1LI4A 4ZCQA 2G9ZA 2XD9A 4MV0A 5HCNA 3HL0A 2ZR7A 3DAFA 5FOWA 1QQAA 3HJFA 4C7JA 3ANNA 4WOJA 3HY6A 2YXLA 1TQ2A 4YRZA 4CMBA 3VU8A 1DNPA 2O0JA 3AO0B 3OU2A 5DN6A 1ESNA 2ZJ1A 3F6YA 4CG1A 1PR3A 1NHGA 1OLXB 3LHSA 3GUUA 1XMPA 1EFRD 3LT4A 4GI1A 3LGSA 5FTNA 4U7HA 4QATA 3JQ9C 3RYTC 2BE7A 1R6BX 1TAUA 1GPWB 1CQXA 3VVMA 1TC1A 4JB8A 5GIOE 1Y1RA 1VG9B 2WM2A 3HPRA 3K71B 5AKYA 2WB4A 4IDPA 2MU1A 1L3BA 4UARA 5IT5A 4OLAA 4I1IA 2CJYA 4BY9E 1W8IA 2B1GA 4OHUA 3ZLTA 1CXZA 3G68A 4LPKA 1T4CA 2DWOA 3E3NA 4ZMRA 3O4GA 5IFLA 2G6BA 4PX5A 1JJBA 2J9YB 1V26A 3MJFA 1A7AA 2R85A 3SN6A 1NX9A 3V1KA 3WNVA 2QNRA 3DLAA 4LZPA 1I7DA 4KXUA 1RI1A 1RLIA 5FOSA 3DE6X 5ULLA 3RBAA 4S0XA 2AZDA 2ZKIA 2FNAA 2WWGA 1QG4A 3E3LA 3FGPA 3FROA 4M8IA 1RKVA 1ICIA 3QG1A 4N76A 2CDBA 2XUJA 3NC4A 4L4UA 3T06B 2FF5A 1LLDA 4MEAA 2D8AA 1NW3A 4Z1OA 4D8YA 2CZGA 4OGGA 1OFIA 2CXPA 3FNBA 3C85A 1YA6A 3UWKA 5LYJB 1EK5A 5DHSA 3T1QA 2AN1A 4FFOA 2ANBA 4RV5A 2VQDA 3AY0A 3RTEA 1KVQA 3FNEA 2C2KA 1NJGA 2C7QA 4BO7A 4V1CA 2BBTA 4A0HA 2JIOA 4XM2A 4ER7A 4QARA 4XX1A 2C2BA 2MWMA 2NLOA 5CVVA 1NM5C 2C4WA 2X9VA 3IILA 4HNRA 3BVPA 5IAOA 5KYKA 1P4GA 2CMFA 4OI2A 5LB4A 3R9XB 1HE1C 1XTSA 1GTL1 5JNVA 4TT8A 1C1XB 3B3AA 4MYCA 5FD8A 1N25A 3RAPR 3EC7A 1CZNA 2P3SA 3OD1A 3IXMA 3BCSA 1B8NA 4D8TA 2ZIEA 2PKWA 2Y1FA 3QVWA 4E2XA 2VJAA 2HA2A 2PQ0A 2FSUA 4XZ3A 1PVDA 2AIRA 4DXAA 1A9YA 4Z0TA 2C4HA 2I29A 5A0VA 3LJKA 4C3ZA 4F11A 1S01A 2DWPA 4GX2A 4J16A 1LLQA 3WVNA 4NDZA 3O3OB 1MCZA 1Z0KA 2CWWA 4JLPA 3EWNA 2VPYA 4NHEA 4HB0A 2QT9A 4P93A 2WP0A 2RH8A 1W8DA 4QDKA 3WJ7A 5IVKA 5JO9A 3MUEA 4DYVA 3MC1A 2O8EB 2B61A 1ZNYA 4OQZA 4MS3A 2ZQZA 4I7EA 4DJJA 1KF0A 1O95A 1V1RA 3IUEA 3SF0A 1SOAA 1B2LA 2XA9A 3C3CA 1AY0A 3LBYA 4NCBA 2HMVA 4E4TA 4J9UE 3TX2A 1WHSA 3GJ4A 5G1OA 2FCAA 1Z3CA 3T5BA 3ONWA 4A8JB 4U7TB 3H0EA 1YRBA 3OBIA 4PZDA 1W93A 3DEFA 4Q4DA 4EG4A 1QFYA 4NPAA 4OXXA 1X1CA 3PHGA 3X44A 1YT5A 4BRZA 1J22A 3LU1A 3ZDAA 4TKZA 1QO0A 3AESA 3E9QA 2Y2VA 4LMAA 1KMNA 1DOZA 5IT9A 2PZMA 1N1GA 2HGSA 2ISSD 2JGDA 1ZGBA 3CW2A 3T7IA 5JBNA 1M10A 1K2WA 2G5PA 3F6BX 2X40A 4UNSA 4WZZA 3ZHXA 5JBIA 2CT8A 2QMYA 2VYQA 5JXGA 2JBWA 4J75A 4LECA 5K6AA 3STWA 3BQMB 1KKLA 2HRCA 2LIPA 4OJKA 1PWYE 3ER6A 4R8SA 4WRRA 3ANYB 5KNDH 4RTQA 1C9NA 1N32B 3S7TA 3STXA 2FPIB 4JGGA 1DIGA 3HCWA 4MYSA 4RPIA 3QX3A 3DMRA 4FEGA 1H3NA 4PLTA 1OR8A 1MVNA 5LIRA 3V1TC 1E2EA 1WKBA 2BFFA 1YDMA 1ITZA 3MCAA 3Q3EA 2QYTA 4RVSA 1BWPA 3RQSA 6GPBA 3WMGA 3CNQS 2XE8A 4IGEA 4F71A 3U7GA 1EVKA 2W4IA 3OH8A 1EUDB 1CQPA 4CR6A 1ZRMA 5B1IA 1OXBB 2ZIVB 1PHRA 5F73A 1RWXA 1V7CA 2JLYA 1NUUA 4FE7A 4YRFA 2DAPA 1QH1A 2FWBA 2Q0HA 4RE5A 4X1KA 5CFMA 4RH0A 4X3PA 3IAM6 3TGWA 3U60B 3LT0A 4KQMA 5JXJA 4MQBA 3WY9A 1F7VA 2QL6A 4PFJA 3U1BA 1TAGA 3G88A 3OEEA 1N6PA 1IMJA 1SUFA 2CFIA 2IYAA 2F8MA 1FQKA 4I5EA 4NEHB 1PT6A 1PR2A 3VR4D 1ENOA 3ZNOA 3E0XA 1EG2A 5HTOA 3HA5A 4BQFA 5I8PA 4KXXA 4WCDA 3JX9A 4HHEA 2W2LD 5BYJA 4PN3A 4JYPA 1TLLA 3IOYA 3ESQA 4CFYA 3E70C 1T8SA 4IXTA 3EEOA 1E77A 1U65A 1SULA 4ITVA 1W73A 2CNNA 4YLEA 4ZVSA 1GRVA 1JLLB 4ZWNA 4ES6A 5I01A 2FSSA 1NGSA 1GZ6A 1XRRA 1Y82A 3A2LA 3DD5A 3MA0A 3UMRA 4B4OA 3SQWA 3SQNA 5BN3A 1G38A 4ZCTA 1I51A 1U2TA 3IEKA 3HWX1 2XDYA 3N7AA 4QD3A 3TCNA 1WBBA 4HZGA 3K0EA 2BGRA 4YRKA 4C0BA 4E2YA 3SEFA 3TOSA 1OX4B 1UBNA 2D2VA 4OVKA 4AJOA 3MZ0A 5CTJA 2OHIA 4L9WA 1P1KA 4GOLD 4CLDA 1T29A 3SVLA 3R44A 2A9JA 3P96A 2YV4A 2PL3A 4I3GA 4ZA2A 2ORWA 1Q1AA 4QEDA 3LPLA 4YMHA 1I24A 1VPWA 3FCCA 3AKYA 2RGAA 4LBWA 5E3IA 1QVRA 4E5PA 5CVDA 5EFZA 4DC1A 4OSPA 5EJ6A 1A9ZA 3D6HA 4FJ0A 3UJAA 3W4KA 1XXHA 2FRDC 2ZRAA 2Y68A 3ITDA 3K1JA 2D5BA 4CVNA 3MGBA 3DUFB 1B23P 1QMGA 4NZYA 3E4DA 1L1FA 3RREA 4QU8A 3ONVA 4K05A 4RH3A 1SG9A 1OWMA 4BQNA 4FKMA 4XCVA 3D0RA 3DBHA 4LQLA 3RS4A 3TSAA 1NXWA 4TWZA 1R6AA 4CM7A 2LRHA 1Z0UA 2VNKA 2G0NA 2CFOA 3G7UA 1YV9A 5A05A 4FBMA 4BNVA 2G9RA 3SOZA 1FNNA 5ALXA 1VKNA 1U0SY 2RGXA 4CTMA 4BLRA 4GRDA 1T2DA 5JZOA 1SUPA 4U8GA 1AGXA 2NXNA 2QZPA 4LBVA 2CUKA 3Q5DA 3WJ1A 2VXOA 1PQUA 3ZNNA 1TKRA 4Y30A 3BWDD 3LQKA 1DO0A 1BWRA 1XJ0A 5EMMA 1P2GA 4BU1A 1HDXA 3OZRA 3FETA 4ZFNA 1I2MA 1YIAA 2BGIA 1LJUA 1V71A 2IHZA 3MUFA 2WVGA 4WJKB 3ID6C 2VG8A 2MDTA 4HDSB 4LSGA 4HGQA 1KJNA 3CRNA 4DV1B 3FTDA 5M34A 4KIFA 3IYLW 1XAJA 2NTJA 2BFMA 1VHJA 2N1MA 4LOHA 5BUQA 5CEJA 1NW8A 1LTQA 2JI7A 1A4RA 3O75A 1R6UA 3U0BA 3WGUA 1QFZA 3M6XA 1K4MA 3BH7A 2DBYA 2IZOA 3COYA 1N6LA 2EOAA 2C2ZA 3L8DA 3HJTA 2EG5A 4WZBA 3TFQA 1CYEA 1Z34A 1KYYA 1HFEL 5IYZB 4O2AB 1AQLA 2I78A 3WK9A 4BNIA 1VG8A 4B79A 2DKFA 2B4KA 2IGBA 2HK6A 4EPVA 4M0CA 3AVPA 1K0UA 3MGKA 3N9IA 3USZA 4BASA 5LYJF 1T8UA 2W98A 3BGDA 4R3NA 2VOEA 5CB4A 1BWSA 2R87A 1MJNA 4YRDA 4Z2YA 5L3VA 1UJ5A 2FE1A 2LD4A 2H1LA 1X77A 2HSGA 2LKCA 2CB0A 2XVAA 3B82A 3QBVA 1GSOA 1XA3A 4MA5A 1CPYA 1IDN1 4PG5A 1RJ9B 2Z4SA 3DCYA 2X4IA 2PX4A 3QUQA 1L5KA 4DT1A 2O4UX 3KT8A 3VNVA 1PGNA 4TSKA 2FPXA 4CG0A 3B7PA 4BRSA 5TQVA 2ERXA 4XVUA 1PNQA 3MLEA 4DB4A 4FHEA 1KK3A 2Z1NA 4Y1RB 1QQ5A 3CUTA 1RBMA 3GJ8A 1LLFA 2RGNC 2ERCA 3HE3A 4G4GA 3VKHA 2VYVA 1CB0A 2Q1SA 3DMNA 2I2WA 2J3HA 2PLNA 3MMSA 4IEIA 4UDXX 4KPEC 2Q7XA 4TXLA 5E2BA 1MQSA 1O4WA 3QF4B 3PI6A 1NI5A 1V16B 2CNKA 4LF6B 3I4FA 1T9GR 1WOYA 1P61B 5EAIA 3DXXA 6REQA 1GZSA 1A98A 4M83A 2ECOA 4YUXA 2FW0A 1S89A 3F4LA 1EX9A 5K4GA 2BCJQ 3TLJA 2ID8A 3DL4A 3ZVLA 4KITB 1R16A 2NPOA 3JAMA 3O26A 3BTUA 1ESMA 4Z7OB 2UZ1A 3NHSA 3ZV5A