1XAHA

Crystal structure of staphlyococcus aureus 3-dehydroquinate synthase (dhqs) in complex with zn2+ and nad+
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
352
structure length
323
Chain Sequence
MKLQTTYPSNNYPIYVEHGAIKYIGTYLNQFDQSFLLIDEYVNQYFANKFDNVHKVIIPAGEKTKTFEQYQETLEYILSHHVTRNTAIIAVGGGATGDFAGFVAATLLRGVHFIQVPTTILAHDSSVGGKVGINSKQGKNLIGAFYRPTAVIYDLDFLKTLPFKQILSGYAEVYKHALLNGESATQDIEQHFKDREILQSLNGMDKYIAKGIETKLDIVVADEKEQGVRKFLNLGHTFGHAVEYYHKIPHGHAVMVGIIYQFIVANALFDSKHDISHYIQYLIQLGYPLDGVQMVLMRQFGDIVVQHVDQLTLQHACEQLKTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 3-dehydroquinate synthase
publication title Comparison of ligand induced conformational changes and domain closure mechanisms, between prokaryotic and eukaryotic dehydroquinate synthases.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 124
structure length 323
sequence length 352
chains with identical sequence B
ec nomenclature ec 4.2.3.4: 3-dehydroquinate synthase.
pdb deposition date 2004-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01761 DHQ_synthase 3-dehydroquinate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1090.10 Mainly Alpha Up-down Bundle Dehydroquinate synthase-like, alpha domain Dehydroquinate synthase-like - alpha domain 1xahA02
3.40.50.1970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xahA01
3UHJA 3ZDRA 5K8CA 4RGVA 2GRUA 1TA9A 1XAIA 1NUAA 5EKSA 1NVAA 1UJNA 2BL4A 1XAJA 1OJ7A 3CLHA 2BI4A 3JZDA 1NRXA 5BR4A 3OWOA 3HL0A 1RRMA 1JQ5A 3QBDA 3QBEA 1NVDA 4P53A 4FR2A 1VLJA 1NR5A 1XALA 3CE9A 1JQAA 4RGQA 3RF7A 5HVNA 1NVEA 2D2XA 1XAGA 1O2DA 5FB3A 3BFJA 1JPUA 1NVBA 3OKFA 4RFLA 4QGSA 1NVFA 3ZOKA 1DQSA 3IV7A 3W5SA 1XAHA 4MCAA 1KQ3A 1VHDA 1SG6A 3OX4A
chains in the Genus database with same CATH superfamily
3RIYA 5E6SA 1R0XA 4Q15A 1V8PA 2BFEA 1MB4A 4R8SA 4RPCA 2DQSA 1KJJA 2HCTA 1XEWY 4YBZA 1OFHA 2LRHA 4FIZA 1C8BA 3TRDA 3CCCA 4UFNA 4GQBA 1H2HA 3SZ3A 2HYIC 4QOJA 2DY1A 3TVDA 1V6AA 4MQBA 4F5DA 1M6YA 2ZSUA 3BAFA 3C39A 2XTJA 1QLWA 4TRJA 3GW8A 5DHTA 1NJGA 1JFRA 3HRHA 3HZHA 3OPYI 4MVJH 2NU8A 4MQUA 3UXYA 1I4DD 3MNFA 1PR4A 4OHYA 3PTAA 2PANA 1K08A 2RHLA 4PN3A 5D85A 4G5YA 3U56A 3MFQA 1I4WA 1KA9H 2J3JA 1H23A 3ZI7A 5LQJA 2ZBDA 1KIMA 4EF4A 3OE1A 2FH5B 1LGYA 3WFJA 2I9KA 3D3KA 3NBQA 3PX2A 4ZAFA 1B8NA 3QX9A 1T36A 1H5NA 2Z5VA 2Z57A 3OTGA 3GPBA 3OZSA 4EFLA 1JEJA 3STYA 1V1JA 1J1ZA 2GVDC 1R6TA 4R1SA 2VF5X 4MQFB 3SC6A 5J23A 3QBEA 1ZJ5A 4MV9A 1PSZA 5DMHA 1SA0A 2JFGA 1VPVA 1WW8A 3HRIA 3K1AB 1XHFA 2JHGA 2X6TA 3G2PA 1E1LA 1SGWA 2DF8A 2G7MC 4JWTA 4BB9A 4Z8XA 3AY7A 3IVRA 6NULA 4DT1A 1M74A 2HF8A 2FFQA 1J2RA 1V1MA 2GNOA 4PRKA 1LFAA 1AZWA 1BE1A 1OV6A 1V2GA 2MSLA 3BB4A 1Z0SA 1N7JA 2PL3A 3N2KB 4MQ4A 3U3RA 3KL4A 1EXWA 1N6IA 5K8VA 4U9UA 4MAAA 3AUFA 3SSNA 1FUIA 4EFKA 4FZVA 3SXPA 3H05A 1HSZA 4U6NA 1C8VB 1K27A 1M5TA 1SCBA 3KR0A 5CW2A 3QPCA 3W7BA 1FFXA 1OH6A 2Z2IA 2C96A 3TNLA 2BUCA 4JH0A 3LOPA 1X80B 4PG6A 2O1EA 3T5MA 1Y6RA 2RIRA 3G2NA 2AXEA 4IS2A 4IWYA 1VLJA 1XALA 3ASZA 3B13B 3DWEX 1RR6A 2GZDA 4R16A 2PFSA 3Q7TA 4TLDA 3VMMA 4D9GA 5HVNA 4WCFA 4XKJA 3FWYA 5FNVA 3H7IA 3H0KA 1MOSA 3M6XA 1X1CA 1KOLA 4LRQA 3HJBA 2PZAA 3E5HA 3HBAA 1QP7A 2HQBA 1GPLA 1MXFA 2XE8A 2ZI9A 1QO9A 2PMFA 3DQQA 3OFNA 4JQZA 4YMVA 4F0JA 2W2QA 1K5PA 3WGTA 4OBWA 2O52A 5I8WA 2XZTA 3PXEA 4P22A 1R8QA 2ENWA 1X92A 4YJ3B 2A0UA 2YFHA 3WDSA 3NRBA 1YRHA 1TKAA 1PJSA 2BEJA 4YJKA 5F7XA 5JH7F 1JLKA 3JD2A 3ME5A 3MXOA 5KTYA 3Q0TA 3ZY6A 1EK6A 2JIPA 2V5AA 1IK4A 2PT6A 4MWSA 1JDTA 2GHIA 3HCFA 5IK2A 5JWRA 4ND6A 1V7CA 2VR1A 4UJ3A 2X0IA 3K8OE 2CL5A 2DCMA 4FHCA 4RMIA 4AO6A 3OUUA 2XCQA 2Y0BA 3EGEA 3OX1A 4LUCA 1PQ4A 1ONNA 3U7QA 1RXUA 1JKIA 1T5SA 4EQZA 3IAS6 4F91B 3WAKA 2B98A 1UT8A 3BD8A 4DRYA 4G2TA 1YDHA 4YMHA 1OTHA 1L5RA 1JB9A 4HOYA 1DKQA 2EWVA 3NW9A 4CKEB 3E5NA 1SUAA 2R8OA 3M5CA 4JJ4A 4JLBA 3BS4A 3X1ZA 4CMCA 2HR1A 3E3NA 3P96A 4LF6B 1QORA 1U5CA 2SKCA 1UFKA 2YXDA 4RQTA 4AMBA 1Q74A 1NATA 4MWGA 2B20A 3EG9A 2CZQA 3H1EA 1VL1A 4OJKA 2OBYA 5IKOA 5EJMA 4D25A 2YWBA 2H4HA 1E7YA 4ZVOA 4RL4A 2Y1EA 4CM9A 1R0SA 2PLRA 3HYTA 4QYWA 3VR4D 4OGWA 5DN6D 5HPYB 5ES3A 5AUQA 3G59A 3O3OB 1J23A 4WNCA 1R5NA 1UT6A 3K0FA 1Q0SA 2B36A 1QKIA 2HDOA 2JRCA 4C03A 5AW0A 1E2EA 3TL2A 1CR2A 4RABA 5AVSA 4P36A 1WDTA 1N2GA 1YQ9A 1E4EB 2ZTHA 4Y67A 2YZNA 5U4XA 3K2EA 3WGLA 1MCZA 2OSVA 4PZ0A 2B2XA 4HL6A 4ZQBA 4YP7A 2OCLA 1I01A 1NC3A 3QXHA 4S2UA 3FNBA 1NJ2A 2O2EA 4KXWA 1VHTA 3C6MA 1XELA 3W6OA 1GKKA 1J0AA 2A9QA 2OM2A 3IQDB 4UE6A 5FBZA 3NX4A 2ARKA 4FC6A 2GB4A 4K5QA 3TDNA 4XSHA 1L5MA 1QX3A 5LP6B 2EFCB 3OPXA 5FPYA 1YONA 2XDQA 3B36A 1J2UA 5KJ1A 1C9DB 3TINA 3M6UA 4DY4A 1P0FA 3OLYA 3FFAA 5EFZA 1A2OA 1KY5A 1XZKA 2IVZA 4DDUA 2QSYA 2GWHA 1IZ7A 2QXTA 3QUTA 1PJRA 4IEEA 3MWDB 1A5SB 4RJKA 4EWLA 2BOVA 2ODQA 2OGSA 1LPPA 4CIYA 1HG0A 2PGLA 4TTSA 3FZNA 4HK4A 3D5TA 1BGVA 5DRTA 3RJZA 1XHEA 5FAKA 1ZJWA 1OGYA 4ZKEA 1A82A 2R6CA 1KMMA 3H2JA 3GLQA 2WJAA 1PUIA 2JJYA 2JIBA 4XIIA 3GUCA 3ZHOA 1M8KA 2DKFA 4KQ1A 5AOVA 3VHXA 3WMWA 4CLHA 3LQQA 1LF0A 3AL3A 4HN4B 1Y7HA 4HGZA 3E9EA 4PSUA 5BN5B 1DP4A 3TPZA 1GZVA 1TJYA 1Z34A 4ZJPA 2NZ8A 3ET4A 3DBOB 2HHHB 5L3QA 1NUTA 4QKQA 1TTPB 2WDPA 4XYMA 2QTVB 3ACBA 3VKGA 1YL7A 4H18A 1T2NA 1C0IA 3C1TA 3ZLTA 3CF6R 4KP7A 5EJFA 5KQLA 3RU7A 5BMVF 5AI6A 3THWA 1XQVA 1N2JA 1UJMA 1TZJA 1GL9B 4WOJA 5K3SA 1HEIA 5BSVA 3O93A 4IPTA 3K3PA 2IH5A 4Z4GA 4B32A 2F8TA 4PR3A 4P3YA 4CXMA 5TB5A 1OXMA 5AUNB 1IB6A 3EFOB 4P7BA 1L6IA 3GJQA 3WJ7A 4ND1A 3D7SA 3K8YA 3S2ZA 4OKNA 2WRZA 1GPWB 5EZYF 1EWVA 3LX5A 2EFDB 1JVSA 4DIEA 1Z7WA 3CF2A 3W06A 3RYTC 4LJAA 3FB1A 3WIVA 3O3MB 3KSZO 2XEDA 1EGAA 4UHHA 4IGEA 1J2YA 1FX1A 1RAFA 3NUGA 4OFXA 2ZS8A 4BWFB 1YQEA 2PZEA 4EUSA 5KNDA 4BUJA 1M54A 1XMIA 3IUMA 3Q7PA 4JIMA 4Y2UA 2L82A 3SR3A 4N40A 4Y1FA 3JAKA 3K5WA 2BH9A 3V4OA 3UMBA 2R8XA 1U0RA 3AOGA 3CNOA 1DV2A 1WP4A 1AF7A 6REQA 1DEHA 3ABIA 4MHTA 3RJ5A 3MGKA 3BD9A 1E3SA 1UP6A 1PJ8A 2E85A 4I4NA 4M36A 3VDRA 4E5PA 5BNIA 9LDBA 5LQKA 1ILEA 4UATA 5HM6A 4DZRA 1IUNA 3H0CA 1U0OC 3OTHA 4HH1A 1RZ3A 2JI9A 5KTMA 1G3RA 1BC5A 3A37A 4IRXA 1DKOA 1R50A 2VDJA 4CFYA 1C3JA 3SWWA 2P62A 2QX8A 1S2OA 2NU9A 3AR6A 5D7BA 1ULAA 4PZCA 2WHPB 3OC6A 2ZZMA 1VLZA 4YT4A 5C80A 3CE9A 2Q4DA 2A4MA 4ZIRA 3REOA 3LLVA 5F51A 4EG8A 1GL6A 5A5EA 2YWFA 3UK7A 1CS4C 4BVFA 1Q11A 2H63A 4M7PA 1W581 421PA 4YROA 2I22A 2WWTA 2PAAA 5IEBA 3QXGA 3RKUA 3MQ2A 2V6IA 2CUNA 4DJEC 3V8QA 3GELA 4GQAA 4YLGA 1IN8A 1A4RA 4D5EA 2YIDA 3NOVA 4INAA 4RSHA 1M3SA 2VSYA 3I9KA 1TMKA 2ZB2A 4H1WA 5T4HA 5KX5A 4DCVA 4Z99A 3PLNA 2PAFA 4TWZA 4CMAA 2ZR7A 2X7HA 2Q3CA 9LDTA 3A3OA 1XVUA 4EHJA 4RYLA 1M7GA 3H4IA 3UJBA 2VI5A 3PA8A 3KOYA 1J6UA 3A1TA 4MW0A 3QPVA 4M46A 4R9UC 3A28A 4FSDA 1Z5NA 1P0MA 1WVMA 3P2IA 2FSSA 1CUZA 3DE6X 1XZFA 5FTLA 1S8FA 3ROKA 2P7HA 1KYQA 1QO0D 2WAMA 1YR3A 5EMMA 2ZBUA 5C32A 1FDOA 1IATA 1XRNA 5DGDA 3WK9A 4KE9A 4C7MA 4R9VA 1QRAA 3U7RA 1Y8AA 4JJGA 1A69A 1PZFA 1ADJA 1XMSA 2D0DA 1HTTA 2J5KA 2X1VA 3N2IA 3PFFA 4WKBA 3SQNA 5LMZA 2RE8A 1SKMA 1D04A 2GXQA 4XYBA 1N5KA 4DF3A 3JASA 2B30A 4LV8B 4N0MA 2K7ZA 3OZWA 2QENA 3WICA 2Q3DA 4K81B 1MT0A 3ULKA 1VL6A 2JVJA 4IGKA 4Z4FA 3UG6A 5BNFA 3T06B 2WYHA 3JQFA 1WUTA 2H65A 4GF5A 3B6IA 5L3RA 4FOTA 1WX1A 3OEHA 5FPTA 1DS6A 5AESA 1YKFA 1VLVA 2D7CA 4LI3X 4L72A 5H0IA 3FOZA 2ZBGA 3EOZA 1O0CA 4PU0A 4NFLA 3FUWA 2AKEA 3GARA 1LLQA 4QU9A 3O4IA 1CUAA 1N4AA 1RI1A 1DBRA 4B43A 2OYSA 1EDEA 3FB4A 3JPWA 4IRMA 4N54A 1AQ6A 2J7PA 2R5WA 2E4VA 4L15A 4MA5A 3ADPA 1B3RA 4NBRA 4V02A 2EG5A 3UN1A 1V4NA 2I65A 3GFPA 1ZIPA 4ZHQB 3L8ZA 4I50A 3VO9A 3M34A 1XDSA 4Z2YA 3ZNQA 5FOXA 3IYLW 5BQPA 3WR5A 2BHRA 3PDWA 2GN9A 4BFCA 4OH1A 3G02A 1XZCA 2R8PA 4QHSA 4UTOA 2TS1A 3X3HA 3UENA 3OQVA 1DIRA 3LCRA 4W5WA 1E3MA 3HYSA 3P4XA 2AOWA 3ZLUA 3W5JA 4WCFC 3Q3JB 4CQMA 3TVTA 3ORQA 4Q3OA 4EB3A 3E3MA 3S0JA 2O8FA 1NP6A 4KLNA 1OLXA 1YVEI 2LCIA 2FZEA 4M8SA 3L8GA 2VRCA 1ENOA 2Z56A 2XCLA 2AJLI 1OD6A 3BXXA 2ZJOA 1WXQA 3D4LA 1WQ4A 2EFJA 2H0QA 3BB1A 4R6WA 4MWBA 1YFKA 1J8YF 4RVHA 3O3NB 1C0LA 2XHZA 4LOAA 5C5IA 2I2FA 5D84A 4XM0A 1NA5A 4UM9D 2C9BA 4X3OA 1X7WA 2PD4A 3CMCO 3SU8A 2VTDA 5CB6A 1ONPA 4UTZA 4XEUA 3UHOA 3RTAA 5IUJC 4L7QA 3X2SA 1BCRA 1P1CA 1RYEA 3TR6A 1IE3A 4DKJA 4G4GA 2O3QA 1Y5MA 3NC4A 5EYPA 3GC6A 1UOEA 1ZUNA 4MHOA 1NZFA 1XRMA 1U1EA 1MO3A 1GO2A 3EW9A 1PFQA 1J9GA 1DZIA 1UBSB 3G8DA 3HKCA 4LXIA 1N8KA 13PKA 2QAGB 2J4FA 3ONWA 3R3SA 4MW9A 4MQ6A 3PQ3A 3SSOA 4ZMSA 4FD2A 2O8BA 2HQSA 4RD6A 4N6NA 4XM1A 5KNLA 2PSDA 4BVLA 4CEJA 1T9ZA 4UXIA 3WAGA 3RU2A 5FNVF 2BFFB 2RGNA 4AZ0B 5I4IA 1SVKA 3PQ2A 1JPVA 3GFFA 3ILSA 2RH9B 4YMLA 4ARCA 1JWLA 2JGAA 2PFGA 2H31A 4M37A 3I9V1 4B8YA 4YUZA 1AIPA 3C7AA 1II8B 1P5HA 1KKMA 1Z26A 5E3JA 4EUHA 5JYEA 1RJ9B 2QTCA 4F92B 1YWGO 3R41A 1OLOA 2VXYA 3WE7A 4IMJB 4MMYB 3RS2A 2VRWA 4RPIA 2Q27A 5TMPA 1II0A 2HWXA 2IYVA 2ZUWA 3BUSA 4G5QA 4BO0A 3IEXA 5ITZB 2V58A 4B7UA 3MAGA 3H97A 4CM6A 2Q4RA 3GJ4A 4D9NA 4UMVA 3RBVA 2VJDA 1YS7A 4RVFA 2EJBA 4J7AA 5G4LA 3FCSB 2V65A 1O8BA 4NS4A 3TZCA 1XK6A 3OPNA 2JIRA 4FYHA 4R51A 5I8ZA 4O8ZA 1S4QA 1GXSB 3WP1B 2Z83A 2XBMA 1O6FA 3VYVA 3DMTA 4TKUB 3NETA 2P1ZA 4O0LA 1GRRA 2UYGA 2HF2A 3PVSA 3EQ6A 3WVNA 3JQPA 1XTUA 1UANA 1Y82A 5JO9A 1MB2A 4CQJA 3W4JA 2BR3A 4FWIB 2WD9A 4JP3A 4URXR 2XWQA 3UMRA 5JMWA 4H6XA 1DAPA 2BEVA 1DL5A 4HY3A 2OBXA 1N1DA 5GONA 3U7HB 2CLCX 3LKZA 4WK0B 1U7WA 4AJ1A 2JK1A 2MDTA 3V97A 2CXSA 4BGVA 3T5GA 1QIGA 1WZCA 4M60A 3U0VA 1Y9JA 3JQ8A 4G8CA 3ZX5A 4AQYB 2BN4A 3UW1A 2CLOB 3AFGA 4AD8A 4B2PA 3PEYA 2WG0A 1IHOA 2GEFA 2P3LA 4HDSA 1FNBA 5HK9A 1KYTA 3K94A 4QA9A 1XZMA 2Q6OA 3AG6A 4BRSA 3ZDAA 4XASA 4RTJA 2C9CA 2CZGA 3PT9A 1E9SA 1RHKA 3SNHA 4COOA 1E6KA 1WB6A 1L9KA 3GEBA 3HB5X 3AVWA 1LWNA 1Y7LA 1LH0A 2C4MA 4HDNA 1N32B 2Y1CA 4RGYA 1N0VC 2FJPA 4OB7A 3O95A 1A9XB 4YRFA 2EU8A 1XZAA 1JJ7A 4P53A 1YNOA 3UB2A 1P4AA 3S1AB 3ROQA 1I3MA 5KTNA 5BYKA 1GGKA 2FRVA 1W4ZA 1Z6GA 3TQSA 2OAGA 4OLHA 4FYYA 2JH8A 3VYUB 5LDDC 4ARZB 1B6RA 3C3KA 2AXNA 4GU5A 5IASA 4MIEA 2Q1XA 1NW7A 4JC5A 2NO5A 2WD7A 1DAOA 3I6ZA 2F3TA 5TSDA 2QWXA 5HZHA 1XZGA 2HKIA 2X1LA 3F7MA 5BR7A 3MBIA 3L4EA 1XZEA 5KNCH 1HQKA 4PVDA 1S2IA 3D5EA 4FGJA 3E7DA 5EWJA 2CV2A 3PYXA 1L7NA 5P21A 1O0SA 1NQAO 1NTRA 2ATXA 1GDTA 4C05A 2XF2A 3C74A 3D5QA 1DKLA 4YHBA 1D2HA 1X14A 1FLDA 3IOYA 2D5CA 3IR5A 1RFLA 1OXXK 2O8EA 1X39A 4EEZA 5DW3A 1VCIA 2AKAB 4KZKA 3L4BA 2AVNA 4GI7A 4HS9A 4K1LA 4BFVA 3A6PC 1VIAA 1YBFA 1JG4A 3L7BA 1J8DA 3DFUA 2ODEA 5BQFA 5HA5A 4MCIA 3U7IA 5ELMA 3NDRA 2DWPA 3B53X 4EHIA 4OB8A 1VJCA 4ZAVA 3GZJA 3U9LA 4BHTA 1HEUA 2WPDD 5IHXA 1FLAA 1OGJA 3V4ZA 1F6DA 4CW7A 4AY2A 3BG5A 1J8FA 2FZ5A 2IY9A 2EVWX 3D4OA 1BG6A 3BICA 4LSGA 1NQVA 1I3NA 1U8YA 2Q3JA 3HEBA 4ASUD 4UJ5A 3KR2A 1TJ3A 5B3AA 3LC0A 3O4HA 1RWOA 2VQ6A 2WWGA 1DC5A 1KMHB 2IZOA 1II9A 3O8DA 5CYOA 3WKCA 5CB4F 2HC9A 2QX4A 4JBIA 1XNRB 4M9CA 2CVZA 2Y9PB 2JZNA 2PRYA 4OG2A 1T15A 3CINA 4X91A 3U2QA 1T6ZA 4FOLA 1AGNA 1N2HA 1ZRNA 3NTOA 1FS5A 1QZXA 3GLIB 1JR3D 4ZCSA 3EPKA 5JHHB 3K20A 3LDAA 4IDEA 1FU4A 1OASA 2D54A 3IEMA 4K0KB 1D1QA 5DGTA 1J0EA 3IA7A 1CS0A 3W8EA 1C8LA 3HSKA 1HKUA 4IJ6A 1C9KA 3QY9A 4E5KA 5HP4A 1W4BA 5D01A 3H19A 3ANMA 4X97A 3E1GA 2GBPA 1W0JD 2FY8A 4OXKA 1RWVA 1SXJA 4XOIA 4BLSA 5LQNA 1JKJB 1V5GA 3RODA 4Q1AA 1D0IA 1VCHA 4MEAA 4G25A 4OREX 4G67A 3BL8A 2ZUBA 4YRPA 4FEEA 4YMUA 2FZWA 1DI0A 3AERB 3KELA 3W5SA 1JU3A 3I0MA 4G63A 3ENVA 3ENKA 3L1HA 4Y6PA 1E1RA 2NMVA 4Y98A 3JQFC 1SC9A 3DHWC 4IHJB 4QYMA 2I87A 4KEAA 5L3SA 2JLVA 4H3SA 2LDBA 3VNBA 3V1TC 1DX9A 3LVRE 2C8VA 4LNUB 5F52A 4Z4QA 1HSOA 5AW1A 4KMSA 3KJEA 4OHPA 4XGKA 2GTPA 1MNQA 4QU0A 4HYEA 1Q1NA 2QL7A 1JR3E 2A78A 3EY4A 1WO8A 1EA7A 4QUHA 1PBTA 2FQQA 3OM1A 4WLUA 2CFCA 5AI5A 5EJ6A 4O6VA 2AK2A 1P4JA 2IS4A 1KO7A 1IMJA 1LV7A 3E9RA 3BE5A 3JQ9A 4CFZA 1IWBB 3CEPB 4IDDA 2IL1A 4DCGA 5T41A 1PJ4A 2EZ4A 1PNVA 5C81A 3PK0A 3VRHA 5JYCA 2F43A 3AKEA 3OTIA 1BTOA 4BJ1A 4TGLA 3S40A 2PGIA 3B6KA 3DP9A 4OHRA 1A0OA 3EAGA 2XMQA 2JVIA 2J4DA 3GXBA 3AB7A 3H4MA 3QKRB 1L4HA 3IPLA 4BO4A 4N76A 1DCKA 1TK9A 4NZNA 1EK5A 1QIHA 2X8WA 3FOCA 4OA5A 4KR0A 2GZHA 2NWQA 1Z7YA 2HOQA 4TWAA 2DLNA 4KFSA 2E6KA 2TMYA 1WR8A 2IYQA 4B6JA 2F55A 4YJ2F 2O50A 1G4UR 2HMSA 4FKZA 4JX9A 3U7EB 5B1EA 4J43A 2CJWA 3E3OA 3I9FA 4QOHA 5GOTA 2V7PA 2AG1A 3MAJA 4CDGA 5CTJA 1UM9A 4H7PA 1VMEA 5G4KA 3RT9A 5C1PA 2HLDA 5MHTA 5JCZA 5K3FA 4UOZA 4DLPA 2I6FA 5L7TA 4KR9A 1E5QA 3KPVA 3Q72A 2VWPA 5G40A 2JHAA 1AC5A 2VDQB 2QG6A 2ZJAA 4QHYA 1LI7A 4C4YA 4G0VA 2HA3A 1MIOB 3EK2A 3IX7A 3G88A 4DR5B 1DINA 3D3WA 3KSUA 1WMSA 4I50F 1D8AA 1S3IA 2DG2A 3D3JA 4P58A 2OZEA 4JVSB 1ZONA 1OFVA 3K2QA 2I4TA 1GRQA 2BM1A 3Q2IA 3QHQA 1QOZA 4Q05A 4WLNA 3RFCA 1KJWA 1UFOA 1G6Q1 2P6OA 2CB9A 1P0IA 3UHFA 5C5DA 1G5PA 4PTYA 1V41E 3O4VA 4YDQA 2P3OA 1D8TA 1M75A 1VDZA 2EF0A 3F5FA 2YRFA 1BHJA 3HUFA 1MVOA 3NYQA 1KH1A 1ZD5A 2RGNC 1LJLA 4FYWA 4MRSA 8ABPA 2DZDA 3MIZA 4CV3A 4ZOLB 1NKVA 3LXUX 3DDNA 2JKZA 2OUKA 3GFVA 3I2IA 3NHSA 4GPEA 3W2GA 4EHAA 1NXWA 3OTWA 3UAOA 5JATA 3LF2A 3NS7A 2XLBA 1KFCB 4JASB 4A36A 1SZDA 2OBNA 4O3FA 4R7ZA 4XGQA 2C5GA 2N9UA 1LI4A 3K9QO 1E6MA 2HT6A 3TM5A 3ZHTA 2V9PA 4BZWA 3DLBA 4YV2A 1RVDA 2ORVA 3GA0A 3CEJA 4D98A 4N0QA 4WTOA 4OL9A 1QPGA 1RCUA 3KZKA 4OQFA 3I28A 5TJHA 4C7VA 4B4WA 3CSDA 4YUWA 4Q48A 2QAIA 1PF7E 1HR0B 3VGJA 4CTMA 1XWIA 3TXXA 2H3EA 3LNTA 3WTCA 4K9LA 4BGEA 4DM7A 3P2JA 2GCOB 3AM5A 3OSZA 5AW7A 2X15A 3T3OA 1JJVA 2ZBRA 5AICA 1EBFA 4M1ZA 2IS1A 2LKCA 4KXYA 4G0NA 2JAHA 1P7WA 3KRTA 1O0BA 2ZKLA 1GD1O 1JTEA 1W5TA 5CCDA 3ZHVA 1FFEA 3I34X 4KN5A 3SE7A 2DPHA 5KOHB 2PRJA 4C87A 2BC9A 2BMEA 3INTA 3ZV6A 1CUJA 3EXHB 3C3BA 4HX9A 4DQKA 4L51A 4H7EA 1UKVY 4HAVA 5DH9A 2XB8A 2ZSAA 3FNFA 4YNBA 3SN6A 4G1VA 3MF4A 3ZK7A 1J5EB 3HK2A 2X0FA 1FQOA 1RQ2A 4NSNA 4JEIA 2J48A 3EG5A 3LBYA 3OLVA 5HBGA 3UMCA 3S55A 1W5BA 1OXKB 4W9RA 1XRJA 1CHDA 1GA1A 3LHSA 2WUWE 3FMVA 2NYUA 3M3PA 3VR5A 3LZCA 4W63A 2CVHA 5ERGB 3PL5A 1RM4A 4B48A 3ECCA 1KDVA 3AEXA 1QQBA 1TVKA 4OYRA 3T8YA 5EWLA 3BE4A 4BMCA 1CUFA 3T41A 4OY3A 3RV3A 1ONSA 5LQAA 3MSXA 2J4CA 2E89A 2HB6A 5H3HA 4C6TB 3RFXA 3EIUA 1E1KA 3JTEA 8ATCA 4BNYA 2X8BA 3VC7A 1DAKA 4C4PA 3LFUA 3BXZA 1P8JA 4BASA 5DK6A 1ZHOA 2E1PA 1PIWA 1IY1A 3C87A 5HIMA 1IUPA 4TUYB 3IQHX 4D43A 2K4MA 4B6OA 1UUFA 4AS2A 2DOKA 4F4HA 4UC0A 4UBOA 1DADA 3JQBA 4IFBA 3UMGA 5DNDA 3I9NA 3T12A 4PHGA 3NHBA 5JAMA 1BO6A 4YMSA 3L7KA 3USCS 1XEXB 2A5GA 5JG7A 1U9JA 3FVVA 1M34A 2IP4A 4G5SA 4MR9B 5TS2A 5BUZA 1V5FA 4RTOA 2PR7A 1NPTO 4Q66C 2BGMA 2DH6A 3GF4A 3RJMA 3WWYA 3ZD6A 4GOND 2C7QA 1SBZA 4EF6A 2G82A 3BRWA 3P19A 1R15A 1L5KA 4X1IB 3I73A 5HUHA 3G5LA 2H1VA 1XZBA 1W30A 2GM3A 3G1UA 4O4JB 1B8OA 1IXKA 3TLGB 4DUZB 1MJGA 5ESWA 3K32A 2OBBA 5LQSA 5BSRA 2BF4A 1RI2A 4REQA 3JZMA 2UZ3A 3T1QA 1L7PA 4PZLA 2OQIA 3WLPA 3U7FB 3UK0A 4YQYA 3NV7A 2YFKA 1U80A 1O4VA 3OIWA 1U2SA 3KZNA 2CXNA 1XJWA 1XXHA 2P4EA 4N3CA 4QUDA 5D87A 3SBXA 5BUCA 4AU1A 3FNIA 1GUYA 1QXSA 4CDRA 3RQIA 5PNTA 2QT1A 1N3YA 5ALIA 2IRWA 3ZHUA 4HDQB 2WSSA 2P2GA 2V6BA 3JVDA 4U2CA 4LMPA 4ALJA 4A6PA 4KQ2A 2IW1A 3RUCA 3HCEA 4XFJA 1T2CA 5E6UA 5HKKD 4ZVRA 4OQNA 1P81A 2PX8A 1R8JA 4YCBA 1NXXA 2JIMA 3ZWXA 1TNDA 2JJ2A 3G6KA 1E4VA 2C07A 1B8VA 1RQPA 2FUEA 3H1AA 4RK5A 4W1RA 4HMQA 3TIFA 2ZJ1A 2QTWB 3E2MA 1Z4OA 3R3ZA 4QOGA 2ZS7A 2P6UA 1JF8A 4YBRA 2INGX 3F9IA 1F3LA 1A77A 2NW6A 2W71A 4TMTA 4AJ9A 3DDOA 4C0LA 3M4NA 4PAMA 3QU4A 1AGRA 4FT4A 3P9SA 5AJHA 3WS7A 4B85A 1F51E 4FFOA 2XT0A 4FINA 4YC7A 4EKDA 1Q77A 2P1DA 3PQCA 1ID8A 4E51A 2P9FA 1UMDB 1C9EA 4F96A 1I1QB 1Y7IA 5CYFA 3B2EA 4PBRA 3JD1A 2QN7A 3WYNA 4HPXB 4GP6A 1EVKA 1Z16A 4HDOB 4M8NE 3E8MA 4LGCA 1SXJC 4Z86A 3T15A 1TUIA 1Z15A 3W6ZA 4RQUA 4IGFA 1DXQA 1H2YA 1NJFA 1RKXA 4AY6A 1PL0A 5HQ3A 1JH8A 1RI4A 2IYZA 2NNWB 2OECA 2AWOA 3HA7A 3ODGA 3FHLA 4PANA 1CNFA 2ZE7A 4ZEMA 1XCJA 2CKMA 3BGWA 4CQLA 4LTMA 2D5BA 4PLCA 2TMGA 3GCDA 1TRHA 2H48A 1JHPA 1PV2A 3O73A 5L7YA 3GN2A 3KJQA 1E5VA 1WHTB 4PLWA 3TQCA 1UBLS 2Y1LA 4MVJP 4WEQA 2C3MA 3EWAA 3HCCA 1KAOA 2GI4A 5IMBA 1KK0A 2RJ3A 2FN7A 1AV7A 3FHJA 4UEKA 1VJ0A 2O14A 2R4UA 5J47A 1GGNA 3A7DA 3ILVA 4HXEB 3P9YA 2PJRA 3DE0X 5DWQA 1DIGA 1U1IA 4D74A 3T3MB 1LW6E 4PXYA 3UMVA 1CEYA 4LHZA 1I10A 2BCEA 5KREA 1PVDA 2WV7A 1R0CA 1H6DA 1GGEA 1ZKMA 3N8KA 3JQ9C 4GZLA 2VDOB 4LZLA 5I6DA 5BYAA 4MWOA 1A1SA 1A2BA 2GN1A 2ZS9A 4BNGA 1QZZA 5IHPA 3IQGX 3K6KA 1YS6A 5CHEA 2BZGA 3BWVA 3N2EA 5KUTA 3GDGA 5FP0A 5F35A 3FYTA 3Q85A 7REQB 1N5OX 4TT3A 1XCGB 1XLTA 2XNDD 3LYHA 5DCUA 3A11A 3SKVA 1YB1A 3WFZA 1SQ0A 2K5UA 2V55B 4Y2QA 2RAFA 5GJVC 2CLKB 2WJJA 2ADOA 2EX4A 2OKGA 4MQFA 4N65A 3ITKA 1UJNA 4LSWA 4P3XA 5CRIA 2JJ1A 5T67A 3TLJA 4BQOA 1XTJA 3OO1A 4YP9A 3K1AA 5IH7A 1R0YA 2NN3C 4HFNA 2HIMA 3IP7A 1KEPA 1P5ZB 1U90A 1ECBA 1UK8A 2AKYA 4XVHA 5I51A 2IDZA 1AKVA 2VZ8A 4M53A 4DWWA 2X13A 2A1IA 2XRMA 3IQZA 4FP9A 4GMFA 4RC9A 1J8MF 2WJPA 3EXG2 1AK2A 2FZ4A 3N2KA 4HNGA 3GRYA 2IKSA 1T4DA 1PNRA 2Z95A 4DMHA 1C3LA 5I3ZA 1SOMA 1SZCA 2I7VA 1M1YE 4CCWA 1T2UA 1EH5A 1CJSA 4YACA 5IYZA 2Q50A 4R8MA 1VIMA 4XPZA 3JTMA 3WHKA 3L6EA 4PYMA 1ZJJA 2YWRA 4YECA 3U1TA 4UTXA 1X80A 4P92A 1UXOA 4PSAA 2MYTA 2FUNB 2QMUA 2H18A 3MM4A 4UUQA 2G8NA 1KS9A 3FDXA 5EXDA 1BU8A 1XCOA 4BFYA 2ID8A 2H57A 4MR8B 3VZRA 2A88A 2IY8A 2WU1A 2BMVA 3OI7A 2C97A 3PHLA 2W70A 2QNIA 4YPFA 4EHFA 1OOEA 1COWA 3GG9A 1A8QA 4RKFA 1K1EA 2BRUA 3EMVA 1GKUB 2V7GA 4Q7LA 3OJ0A 5FTKA 1KPIA 2ZATA 4FLMA 4MUAA 3E3AA 3OZCA 1RAAA 4JUIA 4XWTA 5MN4A 2CCGA 4BJ6A 4HB2A 3CH5A 1PFUA 4Z54A 4YJ3A 4BRUA 1NYQA 1L5FA 2BELA 5K3AA 2ZREA 5DHPA 1H1TA 1NSTA 521PA 2VT2A 1NMSA 2V4MA 4RTMA 3B1FA 2Y6VA 1GARA 1IHYA 5DHUA 2ZUTA 1YZTA 3O7MA 5I5EA 4B6FA 1IWPB 2SNIE 4I4IA 5AM1A 1IJBA 3BKWA 1UBTS 3JZAA 1T6YA 1Z5UA 3WK5A 4CLEA 3E1SA 2HV9A 4TQAA 1E92A 4N1AA 3WJ1A 4FR5A 3HI6A 3OQHA 3TLXA 1OILA 1SUSA 2JS7A 1L5YA 4JHXA 1KL7A 4M0FA 4MDEA 3H2IA 1L8QA 1W5SA 4CKEA 4NEQA 5A0FA 2PU5A 2P9GA 4EKNB 4YY3B 5FOUA 3M8KA 5CR9A 1E2DA 3M5DA 3TW8B 4UXHA 5FUXA 3NHKA 2Z2KA 1NAHA 2VHUA 2OV4A 3EIXA 3IELA 2J87A 4JI2B 5EKSA 2ZAYA 2W6CX 3RM3A 5IANA 1OLUA 2ZFUA 2Z58A 1UK6A 3RVSA 4M3NA 2XQFA 5CK5A 2YXEA 2H11A 4E03A 4F6RB 2HQOA 4E4YA 5ECGC 3CF4G 4LOHA 3D2LA 2E7ZA 4B3GA 1E4EA 4RLSA 4JYPA 5LU8A 3I6YA 4Z0HO 3OF5A 4MKXA 3TW4A 2HHLA 4C88A 3DLHA 1HORA 3D6MA 4PNPA 4DMRA 4J94A 5TGZA 3WL5A 2UUCB 1WV0A 3I4FA 1FP1D 1NMQA 1CV2A 1I7NA 1TJNA 1U4OA 2PWPA 4JGGA 4QUBA 5CW1A 4XOUA 3UCFA 4BQQA 2WIBA 4QNRA 4EHNA 1G8FA 2YIVX 3KR1A 4U5QA 4BP3A 3MJ4A 2QIOA 2PTHA 3KPJA 3IDSA 2BE9A 3FOWA 4HKTA 1ZN2A 4QT0A 1IXSB 2FMHA 4B34A 5FH9A 2P75A 5F3DA 5FEUA 4G24A 1DNPA 2V7WA 3H6KA 4R68A 5D6OA 1DC7A 1H0SA 3ELWA 5AKJA 5D86A 1GAQA 2I2AA 2PWYA 3MWDA 1IQUA 1NVTA 2WT8A 3FYCA 1ESNA 2I2BA 3LCJA 3HCBA 1SN7A 4FHEA 1C80A 3PUYA 2ZULA 2QL9A 3UJPA 3GLGB 3S5JA 1Q6YA 4MIKA 1UAGA 3SI7A 3VZBA 1ZN7A 3O0TA 3UGJA 1AH2A 2B4KA 4GECA 4ZI5A 3T1OA 3M7IA 2CJPA 4JN6B 1QCZA 3AR5A 1YU9A 1CQXA 3JQBC 3CVXA 1W5EA 2H59A 2C77A 4HFRA 1V5EA 1T3LA 1YZYA 4M9XA 4URYR 3KJIA 4ICIA 3D2CA 1EEHA 4MQEB 3T7AA 2R96A 1L5QA 2V54A 2Y6UA 3ZIUA 1NLFA 3I1FA 2OD2A 3VPAA 3X2FA 4HZIA 4JQYA 4L3OA 3IE1A 1YRQA 1ZA1A 2EV9A 2QTVA 1I7PA 2NZYA 2ZK7A 3FTDA 2G07A 1ZCFA 3LO5A 3BSYA 3O9ZA 4IMRA 4Y0NA 3UAZA 1TVEA 3WKAA 1VQ1A 4FFVA 3NEPX 2B9EA 2I34A 2IHUA 1JIVA 2CFTA 1NYRA 3CO0S 1XYVA 5DGHA 1W59A 2I4OA 3WWOA 3ZWNA 3NMUF 2Q62A 1L4BA 2IYXA 2DUNA 3N59A 2Y0PA 1W4AA 1U63A 4BIMA 1GZUA 3F4BA 4DEVA 4J0QA 3JYNA 4JL6A 5BQOA 3H8WA 1IBLB 1FZTA 2GAFA 3H5IA 2J45A 1SCKA 2AOVA 4BOYA 4MVCA 1T5OA 1KDRA 3GUYA 1M6NA 2HCBA 1OIVA 4WVFA 4ZVUA 3DP7A 3V6LA 4KNWA 2GTIA 4MUFA 1VJRA 4W5NA 4JJFA 3HYRA 1JXAA 1JHYA 5AP9A 4QBTA 4BWYA 2ZETA 3CX6A 1CW2B 1GILA 1OKKD 1B93A 3OLWA 1JSXA 1PEYA 3DNPA 3K5HA 4NNOA 1OE0A 1FTSA 3I9JA 1ZC4A 4YEDA 1SOUA 1FFBA 2QJRA 2YY7A 3SQLA 2CL0X 1AXGA 2VTBB 1ONOA 3LP5A 5KVAA 3UAYA 3N8DA 5JMPA 2FEXA 1I1NA 5JTUA 2P2LA 4MULA 1J25A 3GHHA 4AKGA 6PFKA 4YTEA 1UKBA 1W49A 4PQFA 4DBLC 1R3UA 2ZJ5A 3H2SA 3VNSA 2AUNA 3WHPA 4IV0A 1F60A 1N9KA 3OT4A 4H16A 1FNSA 1SHKA 5I8PA 3RWOA 4I99A 1KJ9A 2WHPA 3OMXA 3FJOA 2ILTA 4J90A 4L8FA 4MYRA 4M0CA 1SWWA 2ZW9A 4N6OA 5EZQA 5KVQA 3GT0A 3MOGA 3OWOA 1LTHR 2AJCA 2HTFA 5KWSA 3HRKA 3A9UA 2EG9A 1U0FA 3SHQA 3FJYA 4P2GA 1Q22A 4S12A 4DS3A 1M7BA 4B44A 1DRKA 3AQIA 5CX1B 3G0CA 1IHXA 1VMDA 3CHYA 1X15A 3D4IA 5LKAA 1A98A 2HRBA 2QSJA 4DXDA 2XUAA 4PYRA 3FMOB 3THYB 1UAAA 2IHKA 4J03A 4MTCA 2OO7A 1LCIA 5HZMA 1SG6A 1RT9A 4I6JA 4B82A 1BCSB 1F06A 1Z6AA 4D44A 3SHVA 5HOEA 3JQAB 1UXKA 3UXEA 1J2JA 4R8RA 4U5XA 1TEXA 4M1MA 3ZDEA 1F8XA 5AI8A 3D31A 1R10A 4O3MA 4UD2A 4LXHA 4OGGA 3PVCA 2OSBA 1PHPA 1Z45A 1F2VA 2XGMA 4U8HA 1U3CA 1RLTA 1QGUB 3PWTA 3Q40A 5EIAA 3B85A 3LUHA 1RCFA 1MAAA 5JYDA 4W9MC 1JDJA 2PQ0A 4GLOA 2IZ7A 1R27A 3LGAA 4FDAA 1BQ4A 3M1IA 1MN6A 5C8YA 4CKXA 3A1SA 2QN1A 2K2QB 4KMMA 4NU5A 2WG2A 1X1DA 5D00A 1NW3A 1ADCA 4GR9A 5AK3A 3VFDA 4CCYB 8AT1A 4RDCA 2DBRA 4D26A 1SD2A 4DLKA 1MA0A 3QEAZ 4GI3A 4WW0A 2V98A 4URZR 2XHEA 2H7CA 3KDPA 4HEA6 3CV3A 3WRYC 4BKPA 3LY9A 5HZKA 4ALMA 2FG7C 1C3EA 1IHUA 4N7JA 1B3BA 1EKXA 2R4QA 3GHYA 2EYUA 2FW7A 1JAXA 5AOCA 2YMMA 1N6OA 2JRLA 1XLTC 1QIJA 1FDSA 2C1ZA 3P97A 3PT5A 5FTNA 1H4QA 1OU4A 3SLGA 1L4EA 1MZVA 5HQJA 2XUJA 3IXMA 2PE5A 1VA5A 2XWPA 5FL3A 3ROFA 5KSYA 2HCJB 4RF3A 3FAKA 1BROA 3IJPA 5A3SA 3MT9A 4F9GA 4HRYA 2EKDA 4KYIB 2YJ5A 4DPLA 3ETCA 5I7VA 1BRMA 1N75A 1O4WA 1ENZA 2DQKA 4ZKDA 5DBEX 2EW1A 2BP7B 4MYCA 4II3A 3I3OA 4R2HA 1E2BA 1T8WA 2H2WA 2FCAA 1K7FB 2SKEA 1YZVA 3N9IA 2XTZA 3LPNA 4Y1GA 3RSZA 4JI8B 1HE2A 2WI8A 4ZHQA 5E7JA 4IXMA 4LZAA 1P2FA 1TEHA 5CA0B 3SX4A 3UYLA 3WWDA 1NV8A 2N1MA 5K01A 3FY4A 4ND4A 5DM0A 3L40A 1GQYA 5G0TA 2D2EA 1RYDA 4AWBA 4F4UA 4L5YA 4Y7DA 2UU9B 3L07A 1K89A 4FB4A 4X93A 1U7UA 4KX5A 4OHXA 1GPNA 2OR3A 4R2LA 2Q46A 1C9YA 1TYAE 4NI5A 3DAGA 1WBJB 3KSMA 1LQTA 2Z2ZA 2BRUC 4H7DA 4BFTA 2LUOA 4E94A 4Q02A 1V6SA 1PWHA 2EBWA 1ZITA 2W6NA 1XSEA 2OHJA 4CG1A 2EL9A 1HNWB 2YUTA 2ZJ0A 4E08A 1ZJYA 1LTQA 2P2NA 1JLMA 3CO5A 3VC3A 3WGJA 4AUNA 1E1CB 1T9DA 4RZQA 5K0LA 5JNTA 2QM7A 3BH6A 1NVDA 1OQAA 4Y9TA 1F2UB 1DKMA 1TK2A 2SCUB 5LYJB 1E0AA 3NM6B 3ODPA 1FC0A 4FBMA 5FNZA 3DBIA 3ZJYA 2C7PA 2N0SA 3I1IA 1KQOA 1Y9AA 1UEXC 3H8VA 3LQRA 4AMZA 3QEJA 3OE4A 1N92A 2Q0SA 2XTNA 4MRMB 1YGPA 4Y6QA 4KIWA 3OFND 1NDUA 1R0BA 2FZGA 1YE3A 1QR2A 2Q0QA 3Q9UA 5AHWA 4OLJA 3SQMA 5GGYA 4B46A 4CIDA 1SOVA 3HPQA 4DSNA 1IRXA 2FJUA 4H3HB 1Q0PA 3OQMA 1OR8A 1PSWA 4KG7A 2BFBB 5IUKC 2R68A 5L3VA 1JR6A 1J09A 4CYMA 1D2EA 2O3UA 2QAGA 5AO9A 1E1MA 1XQ6A 3FD8A 1V3VA 2AGVA 4QTZA 1ZY2A 1Y6GA 5IK2D 2ZSHA 4NQZA 2NOAA 1RHUA 1QG2A 2ZKIA 2ZRAA 2BFFA 4AZ0A 3WO1A 4IVRA 4YP0A 2R1VB 3GRUA 3NBFA 1AHIA 3H0EA 4ER5A 5TS3A 4GZ3A 1XDWA 1RLJA 4PZZA 1II8A 3C97A 4OFWA 2AZMA 1RJ9A 1CY0A 1X8KA 2J9YB 2QY9A 4WRRA 3ZR4B 1HNZB 3ZWAA 4BVJA 3KZVA 2QMEA 4H4CA 2XNHA 1EJBA 2QA5A 4YJ3F 4YJGB 1EWYA 3RJ9A 3VO8A 2E4UA 2EBHX 3MEQA 1MC1A 3QG1A 2KBEA 2PV7A 3C7TA 3O03A 4YI5A 3CG0A 5EA2A 3ZE0B 4BEWA 5LQMA 3NVDA 2HF7A 2YS6A 3WLHA 1HZZA 3UT5B 2FMFA 4E3ZA 3WQSB 4KQFA 4FB5A 2IBTA 4N4AA 4CKZA 3CPJB 1ONBA 3K92A 3L7YA 4CM9D 3CG4A 3M2PA 4JBLA 1GXSA 1PW5A 1DRUA 1Q20A 1K7YA 1X1SA 3C48A 3PDIB 1NFFA 4K87A 4MI6A 3Q6IA 4TKUA 4RGBA 4IOJA 4QNNA 3HDVA 1TA4A 1PT5A 3OT5A 1EG2A 5J4YA 2Q3FA 3CW2A 2BPOA 4OJQA 4P4LA 5HIIA 4GKJB 5AXDA 3TLZA 5ERXA 4NXMB 1GLNA 3SG0A 4EA9A 5HZGA 2E4ZA 5JXWA 2C5EA 1E7QA 1Z6XA 3GLRA 5H7XA 1RXCA 4PEVA 1LDMA 3MT8A 4OAPA 3EVCA 5IDQA 2BFWA 2W2XA 1XLUA 1HKHA 1S2MA 3VPFA 2JIZA 5B7GA 5LR6A 2XNCA 2J67A 1CEXA 4GPIB 4N47A 1WMDA 3ND9A 2AVDA 3SF0A 1T9AA 4X7PA 2FP3A 3OZUA 4RULA 2BHNA 3GFTA 5IZ4A 2CZCA 1T9GS 3IRVA 1S01A 2IYSA 3KM0A 5TGDA 3M6VA 3ONDA 3KB6A 3OZTA 4XFDA 1UPTA 2AOUB 3II6X 4W82A 1EP9A 3L6RA 1NQ5A 1SVOA 2EFGA 1XR3A 2RKWA 2NV0A 4RGVA 1CJUC 1QP0A 2Z3VA 1CKEA 4S1PA 3UW3A 2ZCVA 3AEQB 1E2UA 5JWHA 1A9XA 1QUFA 3G17A 3S1AA 4M0UA 2UZ0A 4WXEA 4AM8A 1H9CA 3C3XA 4KPYA 3PUJA 1T9GR 1SUPA 3MT7A 5AM4A 4YPOA 3QVGB 1SVNA 4MPDA 4WGGA 2CL6X 2FWBA 3QENA 4ARZA 5HMMA 4BTVA 2D7DA 5JANA 2R65A 3FLEA 3OZIA 4D80A 1MF7A 5EIBC 1NVUQ 2JFQA 2R6HA 1A9YA 1UEJA 3MD9A 4IIJB 4BRZA 4DB4A 1A4XA 3NBKA 1WG8A 3LHDA 5DVZA 4D3SA 4GOMD 5BY2A 3RUAA 5CA1F 3RQSA 4AZVA 5FPQA 2XYGA 1ZVJA 1JNYA 3HVIA 2RKBA 2O5CA 2WPNA 4LZOA 3W1WA 1BA3A 3MUEA 3KU4A 4TT8A 5KTOA 4G9EA 2ZYAA 5DSXA 1Z13A 5DBGA 2XMBA 2C4NA 5DSTA 3TXAA 1FMJA 1TU4A 2JF0A 3A31A 1AZLA 4K28A 4BKUA 2QTNA 1SXIA 4B5KA 3G0HA 3L18A 4FC7A 1GEGA 2AR9A 4TMZA 3KQYA 1NPDA 5IFLA 3W3AA 4H31A 3C8ZA 4JR1A 3OZEA 5H4HA 1K8RA 3ZZ0A 4ZU6X 3P9XA 4MGKR 4RS4A 2E1RA 3IBSA 1S02A 4IYRA 4Q1VA 1JLHA 2QG4A 3EQ2A 3FMFA 4IBOA 4IIXA 3TG2A 1IDN1 4RFVA 2B6HA 3H6HA 3HBNA 2J3MA 1S7CA 1CRZA 2DUJA 1FP7A 4W1PA 1EWKA 4HRVA 2BFOA 2JIOA 2PIDA 3L0BA 2HIAA 2HV8A 4Q9KA 4M0LA 2Z8YM 3DTNA 4RY9A 1IG3A 3GP3A 4UQOA 3QU2A 4PRYA 3FCUB 3IPXA 2GSWA 4R2JA 4B76A 5IKEA 3LWZA 5JISA 2AC4A 3CGWA 3MTGA 5FOWA 5LNK1 2C5LA 4N6GA 3TX2A 2VSOA 1UDWA 1KMHA 4EG5A 3N6VA 5AVXA 2E0IA 4IEIA 4BO8A 2JG3A 1T0JB 3ENZA 2ZIEA 1XMOB 1N0UA 3I05A 3N28A 1KEVA 3D1LA 1KC3A 4V3CA 3WL4A 1VYHA 4E2XA 5AW6A 4WOCA 3EIOA 1RPAA 2HM7A 2R47A 3K6RA 3L9XA 1W73A 4MDFA 4HWSA 4J0CA 4DRXB 1FBNA 3LIPA 4KR6A 4KVFA 4KREA 3UKJA 3GLIA 3AVTA 5DU2A 3OECA 3ADCA 2X19A 3M9WA 3N7TA 1YZFA 5GVSA 3CURA 1NLUA 3TQOA 4LYAA 3ICEA 1Y63A 2Z8XA 2DJIA 1G21B 6Q21A 4MUYA 2VLIA 4PHHA 2F90A 2P5SA 3V34A 1CJCA 3I04M 2ZUEA 3F2VA 3VNVA 4UKDA 2HA5A 1JKJA 3RAGA 2GERA 2P1RA 2PZBA 4Y0AA 3SR4A 3A0UA 2XF8A 4NARA 2HLNA 3DBRB 1LTKA 3K4QA 2ON6A 2GK7A 3AERA 5KYXB 4C6HA 3EULA 4PYNA 5B58C 3MLBA 4U02A 4PRZA 4IHJA 5B6PA 4TYYA 2O5VA 1E63A 2IX9A 5IBQA 3QXSA 3MWJA 3AEZA 4YP1A 5FA5A 3CR3C 1F9AA 5CCXA 4LNUA 3DAOA 1RFGE 3UUFA 1UXJA 1AKTA 5HF9A 3VR1A 4MJXA 2HWYA 3DEYX 3FPHA 4OH7A 4D46A 2X2PA 2UYQA 2QJTA 5EJIA 1ZQ1A 3W8NA 1XL0A 3OX2A 4KWIA 3QVVA 2F1RA 3RWBA 1EFRA 5JAZA 3L6OO 2X9GA 4QDOA 5DLDA 3GCZA 4KXMA 1K6MA 3IMGA 4D9IA 3Q0IA 1G8HA 4F3KA 3QW4B 5ALDA 2ZTUA 5KYWB 1C1XB 3SBOA 4BKRA 1F4VA 3QEBZ 1B76A 4LBZA 3T4UA 1P7YA 2DYKA 2W48A 3MRXA 4KQGA 4MUNA 2ZTSA 5I9IA 2GHQA 3OEHD 1EWQA 4TOIA 1TFRA 4UNQA 2YXPX 1ADBA 2HH9A 3NH6A 3MLEA 4FE4A 1NZDA 2NVWA 4NG4A 4EARA 4YYZA 2E5WA 2O7QA 3QKRA 4EY5A 4D6YA 1OGIA 1TTHA 2QN8A 3R3YA 5F1YA 4MYHA 3KQNA 4NU6A 4YRTA 1EDOA 3DVSX 3GRVA 4CETA 4GOKA 2B1IA 4FI3C 4H6PA 1O08A 1HUQA 3DZJA 2J7PD 3HA2A 3N75A 4QT4A 4XDHA 1BDMA 1HT1E 1CSEE 1JQAA 3D0KA 4Y0VA 1FSGA 2IOQA 4BEBA 4LE2A 2G08A 2ZSJA 3I76A 2RGBA 3HBJA 3INNA 1WDMA 2ZSIA 1YI0A 2L42A 3KNZA 4ZT3A 2ACKA 1MG0A 1MA3A 3BHIA 1RNLA 3VSEA 4D4MA 5CDTA 4FW9A 2MSKA 1VP9A 4E88A 1UC4B 4DCNA 2L17A 3UMFA 5EJ7A 4DUPA 3RSFA 5FUMA 1RYYA 4NHEA 4LXYA 1QH0A 4CQMD 2FGKA 4LHWA 4PG7A 2PBLA 4AWXA 3HQ4O 1RKBA 1MIOA 3FR8A 4I1IA 3CKMA 4B7XA 1IOLA 1UKYA 1PWYE 1U0JA 4DDMA 1SC3A 5EE0A 4ZHQF 2VRCD 2O7RA 2VQEB 3OZGA 1PNOA 2GAAA 4DBVO 4YRIA 3BD6A 4CEIB 1GCOA 2PX2A 4NYJR 1P1RA 3OFVA 1NNLA 2QAGC 3JD4A 2R7NA 3HY6A 5P8WA 1JBEA 3FGNA 3P52A 1KSGA 3KKQA 4FI3F 1HI9A 3HJCA 4LPKA 4NYIR 3DOHA 3MRVA 4B3FX 4BV8A 2PUCA 3R9WA 4ZOLA 3IP6A 4L57A 4QFCA 3VUEA 4CIWA 5FA8A 121PA 1Z2DA 4DA6A 1WE2A 2Z04A 4PY2A 3L6BA 1LQ2A 2G4VA 1DSSG 3L05A 4RVDA 3I0ZA 4UAUA 1XFAA 4YR7A 1XZNA 3AEKB 5JD4A 4B3BA 1VG8A 1ZJZA 2PBFA 4GP9A 3GI1A 3QV1A 3UMJA 3UWMA 4EW1A 4YV7A 3B38A 1U9CA 4V0LA 4QC2A 2ZRCA 3TNYA 4DARA 1K86A 1HZZC 4Y2XA 1KRWA 3OM0A 2Y77A 1RM3A 1ZH4A 4I36A 5J1SB 1T8YA 2FPRA 2XZPA 1CB0A 2WHXA 4C9BA 2HSDA 1O5TA 2I1QA 2R48A 2CFIA 3HMQA 4RDHA 2M6RA 3EFEA 2HWWA 3K73O 3GMSA 5ARBA 1AN9A 1XTZA 4R2WA 2XCOA 4D3DA 2GCOA 4JJAA 3SF8B 4H1HA 4DL9A 4BS9A 5B64A 3BXPA 4X84A 1BMTA 5HUQA 1WF6A 3WLAA 3KU1A 1ULBA 2C2ZA 1FU8A 1UWLA 3T5AA 4LV5B 4QUKA 2WMOB 4UCFA 5FUWA 1QFXA 3C7DB 4FTWA 5K99A 3NEJA 1LK0A 1L5VA 3HYCA 5KOHA 3HNPA 4UEWA 3PQDA 1GYRA 3VR4H 4YPVA 3EXHA 1H65A 1ZU4A 3JQEA 5K2MA 3F90A 4LY9A 5EVCA 3VNQA 5ICGA 2HQRA 3D8NA 1PGNA 3OZXA 2HBZA 1T8PA 1KPGA 3EWIA 3U37A 4JBYA 1RPNA 1TKBA 5ADWA 3IDOA 4FFLA 4ID3A 5D3KA 4CM4B 3QX8A 4J0DA 4IIUA 4LV6A 3H3XA 1BNCA 2AG0A 3HCAA 3FDZB 3STUA 1OBHA 4LZNA 3X43A 3LMKA 3LKBA 4MVXA 3DAYA 5KHOC 3ESQA 2EIHA 2PKRA 1O9BA 2FA9A 3FF4A 4HFJA 4POAA 3R74A 4YRBA 1ZIYA 1QTQA 1FA9A 3SX2A 2W6IA 2R7MA 1VB3A 5BWBA 5K8UA 2Y0CA 4IXWA 4D3FA 5CJ2A 1BKDR 3R09A 3TJZA 4JS0A 4C6TA 2IGTA 4Q9LA 5A9RA 1RRVA 1S9DA 3UJ3X 1RPTA 2R8BA 2REBA 2NNLD 2OXFA 3P0FA 5DX0A 3OKPA 4G8BA 2ABWA 1HFKA 2FHPA 4TUYA 5G3ZA 1V4BA 2DUUA 1Q95A 1PWXA 5C1DA 3M6AA 1R8SA 3DPSA 1X86B 1JNXX 1UBGA 1ZRMA 1C1YA 1JHQA 1NN5A 4H3KB 1DWUA 3ANTA 3QPAA 2YZKA 3PDHA 4FR0A 4G01B 3CB4A 2ZLBA 4IVNA 2QRPA 5FI5A 4E3WA 1XEXA 1LVUA 2BSAA 3PQ4A 2NTNA 1BDBA 3U7GA 3V42A 4F71A 1B6GA 4MR9A 4MHSA 1B0PA 3ITDA 1MENA 3I6QA 5C5EA 4GEGA 4HAOA 2FPPB 1XQYA 3GJSA 3SM9A 4R1TA 4YRZA 4OOEA 2CLSA 4LNHA 1WDKA 3U3XA 1RHMA 3OIGA 2GFIA 4IZHA 3UK1A 5FB3A 3LLCA 4X1IA 1VHWA 2BEUB 3F6RA 2REOA 4H6WA 4IQ0A 2PL1A 5ER9A 4QLBA 5HWSA 5JXIA 2QROA 3SBDA 2CHQA 1DXYA 4O4JA 5EL0A 3L8HA 1L5OA 2WF9A 1HDCA 1YGYA 1ZK3A 2GN2A 2YJZA 3C3YA 3TLGA 1LKZA 2IYTA 1ZBDA 3ML1A 1DUVG 1QHNA 4YP5A 3KQPA 2FE1A 2R6DA 5A62A 4UVIA 1LDBA 5J43A 1WTCA 4B6RA 3KHSA 4KE8A 4ZU3A 2BFNA 1RXVA 1EFHA 4XGIA 4YH1A 1FFHA 5HQTA 3R8FA 3I23A 3COSA 3GCGA 2IFTA 1IEWA 1RE0A 1A9RA 3ANSA 3FCAA 4NICA 1UQUA 4KQMA 5FBVB 1DOAA 3I4LA 3U16A 3Q88A 1L7DA 4AVYA 3VOSA 2O9JA 5GINE 3TTVA 2FW1A 3IMEA 4RIEA 2CSUA 3EZ7A 4LYYA 1E5DA 2PUGA 3WLRA 3V8BA 4LJSA 1GQSA 1TCAA 3IKJA 4L9AA 5C3MA 5JASA 2O5EA 4H7KA 3R4VA 3D2BA 2Y4OA 3GPCA 2QMHA 2QM8A 4X7RA 2WF5A 2ATEA 1TD1A 1MX9A 5I7UA 3JY6A 4R1QA 3NHLA 1T3HA 3PUHA 2Z98A 4PTZA 2UVDA 4M38A 4QBIA 2EWWA 2RG1A 2ZVDA 4DQXA 4AXBA 3HA3A 3OCUA 1H3FA 2QX9A 4GX2A 1GVHA 4Q5IA 4YJFB 5HCNA 3T9EA 2QZJA 3FPFA 4M49A 5JSQA 1UMDA 5EXPA 1PV4A 1JI0A 4Z9YA 1XAGA 1L7MA 1VGVA 4MP8A 2OM6A 3WLMA 4A92A 1YIAA 3HDQA 4XARA 1L5GB 3I6MA 3QUAA 3VH3A 4GE3A 4B3DA 5L4LA 3ICCA 2EP5A 2ODTX 3LAWA 5JFGA 4PSVA 4BLRA 5JD5A 3UH1A 3FTCA 1GZDA 3GQVA 2AN1A 3D6JA 6ADHA 1HLFA 2PWAA 1N1GA 1YKGA 4YV0A 3QV2A 5DK4A 1AQJA 4MVJA 3RBAA 4LF4B 4IJWA 4I1YA 3O31A 1XNHA 1Z0IA 3KEFA 1NNEA 4D9FA 3FF1A 2GZ3A 4XYGA 1J5XA 1QHHA 1R5BA 4NK5A 1YVDA 1RADA 4CM3A 1R3DA 1XZIA 2BHTA 2IZ1A 2UXBB 4TXNA 1WHTA 2P78A 1E2IA 1JIUA 2BFDB 3PJFA 2DX7A 1BD3A 4C43A 4GQIA 5BORA 5M34A 1QF6A 4XD2A 2AFHB 5AKGA 1MB3A 1SXJD 1G3UA 3WIDA 3NJ8A 1MXHA 1DTSA 4YMWA 3G0DA 2HK8A 1ZGJA 5CNJA 1JYEA 2ODPA 2PUBA 4QM7A 1SKAA 3RK0A 1VYVA 3AP3A 2N3ZA 2C4KA 3ANXA 2XRYA 3C85A 1ECCA 1K7XB 2B8JA 3GDWA 5KCZA 1TZMA 2WYIA 1VHJA 5IC6A 2PRZA 5FLKA 1E1RD 721PA 3UYKA 4A1FA 3RUHA 3A04A 4DDHA 1E3QA 4H0CA 5CNKA 3TBFA 2VDNB 5AM3A 5K20A 3SQDA 3SS7X 5E9WA 4MI3A 5CGZA 4ZTZB 3ZZ1A 4Q93A 2YY5A 4PGHA 2ZANA 5KJ6A 5KZMB 3NTVA 1FVOA 1HE4A 3L8MA 7REQA 1JZTA 1ARZA 4B74A 3LXXA 4F2GA 4NL4H 1QB7A 2E55A 1ZESA 2DLDA 2P9BA 4ER6A 3NWPA 3JSXA 2FJ0A 1DDIA 4QUAA 4R69A 2VEOA 4RFLA 3PF8A 5F2OA 2O3SA 3R9XB 4BAZA 3M5WA 3LG2A 1KC1A 4DLLA 4D81A 4EEKA 4IHJF 5EMJA 3BK2A 2RK4A 4U9HS 1K8XB 5I9LA 3K9GA 3D6VA 4BMZA 5JOQA 2XB9A 3ORHA 4XM2A 3IIJA 1SXJE 2ZM6B 1XMXA 3ZTWA 4Q39A 2A86A 1N5DA 3AIMA 3EA0A 4M7OA 3M6MD 2WJ4A 4TXHA 1XMJA 3UOGA 3ZKAA 1LSJA 2Z09A 4OJMX 5ALXA 1N9GB 5GV8A 4D1YA 4YRGA 3EC7A 1NR5A 1PCXA 3X1KA 2RJNA 4B84A 3KQMA 3NXSA 4LNAA 1R9GA 4OHZA 4PG8A 3KQHA 2LE0A 4RJTA 4B09A 3T54A 2WUDA 2C88A 4QREA 3ZUGA 1F8UA 3R3WA 5GMOA 3OZ7A 4MPRA 1QZ3A 4QPNA 4A3SA 1U3FA 1UF9A 3JWGA 4X8OA 3ZCUA 1VHDA 2GAJA 3BWCA 1FNCA 3IPYA 4KXUA 4QPZA 5L9AA 4BBPA 5AUPB 1M73E 5H81A 5KTTA 4IMPA 1RQ7A 4MR8A 2RGDA 3WWEA 5KVVA 1GPUA 3O8RA 2R00A 3M9XA 2V74B 2QRVB 1M2OB 1KP9A 1NT2A 1WXDA 4CL0A 4MGHA 1EGVB 5LB2A 1CY4A 4LJ9A 5FORA 1MX5A 2ZJ4A 2HLDD 5WRFA 3TTWA 3DE4X 5L51A 1VPDA 1ZU5A 2IK8A 5G02A 1CUIA 1GP2A 1KJIA 1EAMA 4NBVA 1PX2A 4OX9Y 1RP1A 4TMYA 5EZSA 2NZ2A 3F3YA 4TLBA 1WWKA 3IOCA 3N2LA 2I2XB 2GZMA 3MS2A 2J33A 4GM0A 3IUEA 1K7SN 4WLVA 3RRFA 3GP8A 1RI5A 1OX5A 2FB9A 2W2OA 3L43A 1Q91A 1LJ8A 5F64A 4AJPA 1EVQA 5C5CA 5A6SB 3AVXA 3AILA 4UU8A 1P18A 3A06A 1TVCA 2SBTA 1P2TA 3M3HA 2IF0A 1ZFNA 3AXSA 5JMOA 4DSTA 3KUXA 1K9VF 1HO3A 2YVKA 2BTEA 4O8CA 4L28A 4TSKA 3B20A 1BZYA 2OO5A 2FK7A 1E69A 1T2FA 1SCDA 1HDRA 1GFWA 1XVIA 2QT9A 4FFNA 4KGVA 3CE6A 4M99A 3RYFB 4BGIA 1YQTA 1ZRHA 3TW8A 2FN3A 1LBQA 4ZN6A 4D3ZA 4LXXA 1C7FA 4PC6A 2FG5A 1CYEA 3T3GA 2EGUA 3QLEA 4PF1A 2ODBA 4KI7A 4KI0A 5B2ZA 1HDZA 1JRLA 1SKYB 1RQNA 1ZHHA 4TWJA 4DLRA 1DX6A 3TOSA 3K2IA 4KR2A 4CDMA 4F6RA 1BU5A 1UJ2A 5AKIA 3ZTTA 4RKRA 1DDGA 3G49A 2VP3A 4PQRA 3WV4A 1UZMA 4CE6A 4AJ2A 1WKBA 1YAHA 4OM8A 3BA6A 2CJYA 3EXHC 4AMGA 4YUXA 1USGA 4L5JA 1Y8ZA 3R7SA 4PFKA 4ZOLF 2IS2A 3WO0A 1G5RA 1G20B 3MTBA 4ZVTA 4P08A 5IAEA 3MB5A 2FEAA 1ZH0A 4FWBA 1KK3A 1Y3AA 3VGPA 1GTL1 5B2FA 2OGZA 5E0KB 5C7YA 1UJ6A 3BXEA 3IMKA 1OLSB 1QGED 3P7MA 3QWBA 4TRNA 4DLXA 1NI4B 4QGSA 1NP7A 4DUGA 1VE9A 3PFIA 3SYLA 4ZCRA 1IBSA 1ZVKA 4EI2A 5ADVA 2NSYA 4Z4IA 3QXJA 1GGMA 3GNLA 3T7KA 1E2HA 1WSBA 2OB1A 4DCCA 1G8PA 4MLDA 2C59A 2WIFA 3K8QA 1USWA 1DBSA 3N0RA 4PYLA 4MVJI 1X74A 3KZOA 4JLPA 3F71A 5KS2A 3BF8A 2FLVA 3A3NA 3TN7A 5F4BA 3GEEA 5BNWA 4INPA 3GLGA 3AF0A 3K9WA 3OURA 5KQRA 1Y3FE 1GNPA 4WECA 3RRJA 4AG5A 3VR5D 5KQGA 3UJDA 3FSJX 1FDIA 3DBHB 4KBYA 1U8XX 1UP4A 4YQEA 2H1OA 3TXYA 3VTFA 2ID7A 4WESB 3G7UA 5A7HA 4P86A 1PBNA 4C4TA 4MQEA 2YDYA 2JLXA 3PR1A 3LUCA 3OJXA 4H0NA 4NE9A 5JXGA 4CEHB 5IN5A 5KQPA 1PR5A 4PLHA 4S24A 3GOHA 3FG9A 3QUBA 1K0FA 3BC1A 3IUNA 3R0JA 4WEOA 4DSUA 2W83A 4LRTB 4M8IA 3GVXA 5G2OA 2ECOA 3K6SB 1UP7A 1EFLA 4NKRA 4XX1A 4OI1A 3S28A 3MIIA 4JI6B 4EYOA 3VNRA 5D2CA 5M7EA 4TX1A 1HDGO 4PHFA 1IN1A 1GPH1 1JW9B 1HDOA 4LJRA 3RRNA 4FU0A 2QB5A 2H85A 1DHTA 2PU7A 1R0RE 3G7NA 1XTVA 4IIBA 2CYBA 5DTEA 3W2TA 4GSYA 1N6HA 4KVZA 1RM5A 1EXVA 2ZRBA 4ZGBA 4RTQA 8MHTA 4IG9A 1B43A 2C2MA 1DTEA 2GQ0A 4U3JB 1FUKA 4C08A 1T8UA 3L41A 1L4FA 1AUQA 3PGXA 5I7AA 3L5OA 4NPHA 1CQJB 2Q5OA 4ZRNA 1JAIA 2C3OA 1ZSVA 3BRWD 4QVGA 2GYVA 3FVWA 2XA2A 5U1PA 3UOWA 5HDQA 1YRLA 4TUYF 1JA0A 3HP4A 1ZLYA 2HMTA 1E5XA 1FDUA 1VC2A 1SG0A 1XROA 2ST1A 2WDZA 4YFVA 3HFRA 1SU6A 3CUKA 2JZOA 1TL7C 2OOSA 2FXVA 2WMDA 4G5XA 4N5LA 1P80A 4TRRA 3V9AA 2KJQA 2VTBA 2BZSA 1LNZA 2YC2C 1F6WA 2W00A 2CC2A 4HMPA 4EAQA 2NTVA 1VCMA 4J4HA 3NT2A 4BNVA 1JHAA 1DBQA 1COZA 1GNQA 4IDNA 3KQUA 2HU8A 1VDMA 1KDOA 1YZHA 2PVSA 3JYHA 3VAAA 4ARVA 4C7KA 1GR0A 3QU5A 1C30B 2JI4A 2WSSD 3UAWA 1R37A 3SC4A 1BH2A 3JD3A 2MSEB 4DQDA 1CR4A 4GXQA 2XE6A 4K46A 1M34E 1N6LA 1IUOA 1NXTA 1W48A 2JJ2D 2R84A 1Q1AA 4IDQA 4M9QA 5CX1A 1T1EA 2ZI6A 3EVEA 4ALLA 1PDWA 2BEKA 2NG1A 5G1NA 1C3VA 1E4OA 3WWPA 1YK0A 3THYA 1Z7GA 5K8TA 9ATCA 1ZCAA 1FIUA 5FR1A 1MPXA 3Q7IA 5EIEA 3DM9B 1P6XA 2NQ2C 3Q98A 3NWBA 4JKOA 1GDDA 3BRQA 2QR5A 3FKSA 4MKHA 5LDHA 4NDZA 4WXHA 1BCSA 1DTWB 2XTAA 3CIFA 3JQAA 3NDBB 3ZOKA 1JEYB 3H2ZA 3RC1A 2HQ1A 3C45A 5DHQA 2Z9BA 5B55A 4QYTA 2YY6A 3N05A 4G6ZA 4F4JA 5JCOA 5JH7B 1XXHE 2A9JA 2ZWMA 1NVAA 2CHFA 1WXXA 4RKWA 2XXBA 1E3LA 4ILEA 4PXAA 5AK0A 4TVSA 1N6RA 1QGUA 2X8AA 4QRIA 4Z53A 1J0CA 2ZIFA 2C78A 2ZR0A 4G9GA 3UOAB 4LF9B 1B23P 1MDBA 5C51B 1BOFA 2AJBA 3AHHA 3SM3A 4TLLB 4RIIA 3S8YA 1LPAB 2B1QA 1FVHA 2P2YA 3GL9A 3PXBA 5JC1A 1NE7A 4PZPA 5HIJA 4CCYA 4EVQA 2JC3A 2XVMA 4CRWB 4OXNA 3T1NA 3RFTA 3WLLA 1TJPB 1YR9A 1BXRB 1UBEA 4PGGA 3VH4A 4MRRA 4DZTA 5I9NA 3DHYA 1QV6A 3O94A 3IT0A 4OBEA 3T9BA 1E8DA 4CJXA 1X1QA 5I7WA 1T2VA 1EB9A 1W47A 3S44A 1RDFA 4CT5A 4DBLE 2QRQA 3SIPA 5BXQC 3EOAI 2XYHA 1WVIA 4OHCA 2ORED 4DJTA 5FD8A 3S2YA 3LRPA 3UANA 5HM8A 3LE8A 4MVJF 2B99A 4NMXB 4OVKA 4DR4B 2DT5A 3MW8A 2D1RA 3B5JA 2P67A 2P6PA 2B61A 2M1XA 3CB2A 3GQBB 5T4BA 3RARA 1DRVA 4HYYA 4I14A 1V8ZA 4RX1A 5AJTA 1H0KA 1H9AA 4YASA 3IL2A 2HGZA 2RC6A 2CF6A 3L0CA 3FHTA 4JB8A 2BGUA 3W0LB 2ZVPX 2BP7A 3DPUA 3I62A 1X1AA 4CIBA 3FMIA 1Z6ZA 2CUTA 2CHVA 4ENWA 1RBYA 4Q1FA 5KDDA 1EFPB 3FZGA 5DW0A 5TXGA 3KG2A 1GZ5A 2D1FA 1OHHA 2DPYA 2WM8A 1H0HA 2GEKA 2AS0A 5CA0A 3DXXA 4L4ZA 4JB0A 4KITB 2GEJA 5JIBA 3RLIA 1FMFA 1U7OA 2VJCA 2QN6A 5JVDB 3T1TA 1TYDE 1KS2A 3B6ZA 3TMAA 4EF5A 1P74A 2QYSA 1AZSC 2NT4A 2QJFA 2NO7A 2R00C 3H9GA 3IHWA 4MW6A 4DC0A 2IH4A 3NIDB 5C31A 1YUBA 3G0OA 4GE0A 4G1EB 2IV2X 3SHOA 2A0WA 2YMLA 3SX0A 2XLCA 2XSZA 3LLSA 4EPYA 5IS2A 1GG5A 2ORYA 2PUVA 3KXKA 3DMDA 1GQFA 3Q0EA 4YX9A 1WW2A 2ZRMA 4C89A 1PYOA 4N0DA 4BTEA 1E1CA 3CRZA 1JHVA 1U8FO 1VCOA 4X3CA 7ADHA 1OA1A 5LP6A 1EESA 1F2UA 1S96A 2SCUA 3TK1A 3FAZA 5LYJA 4A6EA 4TM7A 2GLXA 4N82A 1Q7EA 1IRIA 2YHBA 4HEA1 4I55F 5GPBA 2PJDA 1FPQA 4PLPA 2GAOA 1EJ0A 1COWD 3NU1A 4MRMA 5TMDA 5B7QA 2FF7A 4F3TA 3TJMA 4ZYLA 2IEZA 2IEDA 3GCXA 5JCXA 5BMVB 3DB2A 2ZAMA 3W5CA 2WZDA 1F4PA 3ZDXB 2BMAA 5F5LA 3J81k 2OAEA 3AMVA 4FBLA 2ERXA 3T0GA 3ZJTA 1U8AA 2OO5C 4NMMA 2ZE8A 1EVYA 2BFBA 4WBSA 1YU6A 5KKNB 3DZCA 4D7AA 2P6MA 3SZOA 4Q3CA 1JG6A 1GNRA 4GL2A 4KO2S 3ESRA 2AD5A 3AR7A 3OE7A 1EWRA 1YB7A 3IUJA 4OU5A 3UNXA 1VKZA 1K7EB 1DRJA 2R1VA 4E1BA 3D7MA 1MV8A 3FMGA 3HDGA 1D6NA 1EQ2A 3WLNA 6REQB 3PNYA 3ZQ6A 4LJ7A 3R40A 1FRVA 2G8LA 3DV0B 4EHKA 4RYDA 3PR2B 4CTOA 5INTA 4YJGA 3CWZA 3DYBA 4TXMA 1U7TA 3GLUA 1PWZA 2OXRA 3PGKA 4CG3A 1PQUA 4PPYA 1XTKA 2ZJ2A 3RYHB 2WZCA 3LZ6A 1YS4A 1E2MA 4J2TA 1CWUA 3UT5A 1L3BA 5A4FS 4M9ZA 3CUVA 2V45A 5AIBA 4QQNA 1W52X 4BLUA 3B48A 5BP7A 3WYAA 4NOLA 2XQKA 3ZCVA 1OX4B 5AD1A 5ITVA 5E7QA 4E2WA 3B1VA 4G0OA 4FK8A 3PCTA 4MO9A 1RQXA 3PDIA 2QLMA 4EMBA 2OBFA 4K6KA 4K6FA 5MF6A 3DE5X 1VKHA 5I4BA 2WUVA 4GC5A 5HE8A 3CM0A 2VK4A 4ZA2A 3HCNA 4B5LA 2NZJA 1BEZA 1K4YA 3VPBA 3IAUA 1JDZA 2WNIA 4G5OA 3RO7A 1M1XB 3GLVA 2J31A 3T7CA 4RTPA 1GU7A 5B7NA 1YCGA 1KIAA 4J76A 1KFJB 5BYJA 4QOFA 1CB7A 5C7IO 1OWPA 4WT7A 1LS1A 3WMXA 4HLDA 1CRPA 1Z39A 4I5EA 4QQ8A 4Z0NA 3R44A 1TA0A 1G9SA 1F20A 4RHFA 5CURA 1E99A 1I5EA 2OHVA 1W8DA 2H4JA 3OBBA 3CPHA 2MSDB 3UWOA 1D09A 1ISJA 5C34B 4CMEC 3GJ5A 4RHEA 3DTVB 3S29A 4GDFA 3TPCA 1Z8FA 4X8MA 4TMXA 1GU1A 1PS0A 4YRRA 2AOUA 1Z9BA 4QGAA 4AT1A 5M29A 4IUBS 1IHPA 3LH5A 1B8UA 2H2FA 2CFRA 1RRGA 5EE1A 5JAHA 3AEQA 4YFYA 4FSXA 4C14A 5BQ5A 4RIGA 3GGJA 1PLKA 3EVBA 3PWSA 1QYIA 3SSAA 3B12A 3K96A 3HLTA 3QVGA 4NCHA 1YA8A 3DV9A 1PU2A 2XZLA 3RYCB 2QI9C 2VL7A 3NVMB 2PM8A 3OHMA 1C29B 1PQWA 4OB6A 4R41A 1PK9A 1QDEA 4X6UA 3WGIA 1IPEA 4IIJA 3SHTA 2C7BA 2EW2A 1NQTA 1V6CA 2ICAA 3U5TA 1FSSA 2I1LA 1IZ0A 1S2GA 1VHLA 4S1TA 1GSAA 1FU7A 5CFNA 1OAOA 2Z0MA 4MW1A 5H16A 5K6RA 5IXJA 4KAAA 3T38A 1MVLA 4DRZA 4JENA 2BJVA 3D6HA 2F1HA 2RAVA 2FUKA 5C53B 5LA6B 1Y3CE 4DC9A 1IB0A 3AGQA 3SZMA 1YC2A 1QRTA 5DTMA 4EB0A 1R88A 4LXQA 2GXUA 5EIBD 1KP3A 1XL1A 2Q4EA 3NUQA 1USIA 5CJPA 2NUTB 2B7LA 2PWZA 2IYYA 2Q0XA 4CZ2A 3ELBA 2R79A 4PLFA 1PW7A 2GN4A 3T7DA 3WLOA 3LZDA 3TQRA 4AKEA 4JLVA 3HDTA 3LVQE 3T9FA 1P1JA 2ZP1A 3GFRA 5DE3A 5CLGA 1D6SA 2B1JA 2JATA 2GARA 2H29A 2MIIA 2DETA 4B3XA 3ZHBA 1DAHA 2B0CA 3ETJA 2A2ZA 1U3DA 2GX6A 2PLAA 2D5IA 2X8JB 4EABA 3WBFA 1AGYA 1ZH2A 4UQPA 5DXFA 1E9VA 2B9VA 2QI9F 3CX3A 4JL5A 1E5TA 1DEOA 1ESCA 3VTAA 3DZIA 2O6HA 4NJMB 1RC8A 2LIVA 2VN8A 3MYRA 1N2CB 2EZ9A 2P9YA 4ZYWA 3DVRX 2Q5CA 2Q6KA 1OF1A 2GJ9A 4H7HA 3LDGA 2CNBA 3IDQA 1NLMA 4IP0A 4NAUA 1Z2EA 3VMFA 3IKLA 5EKDA 1W76A 1Z2PX 3DW3X 4WJZA 4K6HA 4Y9DA 1U8UA 2OAP1 1JLRA 1Y42X 2J0VA 2GN8A 1XD8A 3DF9A 3AV3A 1YZLA 4GAEA 2XUPA 1MJGM 3K9CA 4K9RA 4DRXA 3HJTA 3I8OA 2CVPA 2DQZA 3QNWA 4QRHA 4ITVA 4U2FA 5SY4A 4C4AA 4F1KA 5LLTA 1QNLA 1ZINA 4Y3UA 3GT4A 2YC4C 2C83A 3IBTA 4Q03A 1G2IA 3GNTA 1BS1A 3RE1A 3KKLA 3PFCA 1ODLA 2X3YA 2J3HA 2TMKA 3A6GA 5T8KA 1G21A 3M6FA 3A6KA 4LEIA 1L1RA 2DHRA 2PSFA 2MSNA 4GVLA 1US8B 1KDTA 4NAVA 1GAXA 3DCJA 4TTRA 4OYHA 1FSZA 2R44A 3CUTA 3KB2A 3KV1A 4OI2A 4UM8B 1N7IA 4C6SA 4EENA 4TYWA 5BW8A 3HN2A 3H99A 2XA9A 3R9KA 1UDRA 2W0MA 1ND6A 1WY7A 4JNCA 3PIDA 4Y1RB 4PPGA 3DBRA 3QY0A 5E7IA 3QI7A 5GVRA 1DHRA 1JWAB 2YJGA 1KNXA 1M67A 1QK5A 5KYXA 5AQEA 3O8OB 4ZQHA 4G0PA 3K9BA 4ZO4A 4HGPA 3JVUA 4FFSA 1CUYA 1G7SA 1QR6A 2WF8A 4GPAA 2X2EA 1YQDA 2J0SA 3DEJA 1VCNA 1YJ8A 1U9ZA 4LXUA 3OBIA 2YDXA 5KBYA 1MP0A 3PPWA 4PPNA 2Y4NA 5H80A 1ISRA 3HGMA 5DTJA 4B81A 3AVYA 3WZ2A 1TZCA 4M4SA 5K3DA 4QUIA 2B7CA 4RLFA 3QEMB 4BNUA 1LSOA 2WR8A 1RPJA 2EARA 2VWHA 4MWZA 2BLLA 1M8PA 2WE8A 4NOMA 4HNHA 3B70A 5BOVA 3VNUA 4KGXA 5KYWA 3VR2A 2GF0A 3DFZA 2H5LA 3EGDB 4TN1A 1Q7TA 1C3XA 1W4RA 1C1XA 4MYUA 1P4GA 4LQ4A 5E9AA 3KX2A 1NF9A 2NSDA 1T2EA 3D7LA 3DWIA 3W6UA 2RMKA 1UDAA 1JSLA 3E9NA 3PUXA 4H7FA 2O7NA 3U39A 3V7FA 3S81A 2JW5A 3GR6A 2PSJA 4G1CA 1P6QA 1WKCA 3UEOA 3FPCA 4H1TA 5A4DA 4CU2A 1EX1A 2ORWA 2R5NA 3HP1A 4XJSA 2VBIA 5F7JA 2VYFA 5HFJA 5LCXA 3UVEA 3VPGA 3SJBA 4EQ6B 2Q4OA 2ZRDA 4PIVA 4Y30A 2PD6A 2CV0A 1QJ4A 1DG1G 3VZPA 3N2ZB 4YRDA 3AX6A 3ETGA 3CEMA 4F2PA 5AXAA 3GRAA 4F9FA 3L1IA 3PFBA 4IIDA 2LDXA 4OLFA 1XT6A 3DB1A 2IX3A 2DWCA 2GBFA 2LIPA 5JZSA 1BXZA 1V8BA 4XVQA 3QPBA 1TC1A 2W11A 2UVPB 5EIWA 2MINB 4BFSA 2F4VB 1SUFA 1Z56C 2FDRA 4L8LA 1XQXA 2HMWA 3MUOA 5FF9A 1M6EX 1OI7A 3DKPA 1Z4MA 4LOKA 4UEJA 1QGDA 2I55A 4F5ZA 2AQHA 3IAM6 2BKEA 3ZQKA 3TZKA 3NONA 1NUUA 3TZ6A 2REQB 1JQKA 4W6QA 3KE8A 2ZG6A 4G8JA 5IC4A 1EK2A 2IW3A 5UKDA 1J7KA 4EUNA 3SVZA 1QPBA 4MV3A 2IV3A 2QQGA 3AJDA 3O74A 4L78A 4XVRA 1EX6A 1XCBA 4ZQIA 4EIWA 5IBCA 5FWAA 2GM4A 1N0HA 3QTTA 3WL3A 5EP4A 5D3MB 5I7SA 4L5BA 3L04A 4MRPA 2WY2D 3QEKA 4YRAA 4NBSA 2EP7A 4OFZA 1PJQA 4MS1B 5DYNA 3ZD8A 1O6ZA 1WCWA 5CA0F 1P91A 1OXSC 3HB9A 5EE9A 3JWPA 1TXGA 2C5AA 4PO3X 3WA6A 2C9ZA 4JT4A 2AYZA 3HFSA 3MVEA 5SZJA 2Q5QA 4BO2A 5DGXA 1SIBE 4INZA 4DNFA 3QQPA 3LXRA 3MRTA 3P27A 3QE4A 4NMLA 3AF6A 4YAUA 2J59A 4AMVA 1WXFA 4KXNA 4ALIA 1EXNA 3LWDA 3Q15C 4G4IA 2HI0A 2H2IA 4KIGA 3ERCA 3WK8A 4I1VA 4Q24A 2FQWA 1F4LA 3LVBA 4O59O 4GS5A 2HZBA 4QGHA 2DE0X 1KKLA 1YR1A 4ZO7A 3RD5A 3I32A 4A5OA 4HNVA 4JOBA 2W5UA 2UKDA 3KQVA 4DLVA 4NE2A 1OSNA 1RM0A 5AM0A 3W1VA 4E5SA 3BTOA 1E89A 4S05A 2FR8C 1M83A 2RBGA 4L22A 1NW5A 1M2VB 2ZUCA 2YRWA 3KKMA 3M1AA 3AEKA 1I6LA 1PGJA 3R7NA 1NWHA 3GZNB 4GPBA 4JJ6A 4MUKA 5E2BA 5F3WB 1G5IA 2XV1A 1LVGA 4YO7A 5LYJF 1QAMA 2GKSA 3L4SO 1C7EA 4R1NA 2C57A 4YREA 3U3MA 2F6RA 1UIMA 4J1TA 5IX8A 1WTAA 1WB4A 3OAAA 2JCXA 2BI7A 1XCLA 4L8VA 2W42A 3W8FA 4N3BA 5AKKA 4BLTA 3COYA 2AJDA 2XOKA 5FO1A 3SHFA 3U62A 2WM3A 3WKEA 4ABTA 4XR4A 4LWPA 4D97A 3EVDA 3EC2A 4GBJA 3KEMA 1KQ3A 3L02A 5AXBA 2IDKA 3BE6A 3OZDA 5LBIA 3EASA 1GGJA 3SF8A 4LRYA 2B1RA 3O9VA 3U5ZB 1ML3A 3GRKA 1AU9A 5F78A 1QFJA 5JAUA 5A0TA 4RNCA 3HJFA 1K5DA 2VT6A 5KYUB 2XY4A 1U1CA