1XAHA

Crystal structure of staphlyococcus aureus 3-dehydroquinate synthase (dhqs) in complex with zn2+ and nad+
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
352
structure length
323
Chain Sequence
b'MKLQTTYPSNNYPIYVEHGAIKYIGTYLNQFDQSFLLIDEYVNQYFANKFDNVHKVIIPAGEKTKTFEQYQETLEYILSHHVTRNTAIIAVGGGATGDFAGFVAATLLRGVHFIQVPTTILAHDSSVGGKVGINSKQGKNLIGAFYRPTAVIYDLDFLKTLPFKQILSGYAEVYKHALLNGESATQDIEQHFKDREILQSLNGMDKYIAKGIETKLDIVVADEKEQGVRKFLNLGHTFGHAVEYYHKIPHGHAVMVGIIYQFIVANALFDSKHDISHYIQYLIQLGYPLDGVQMVLMRQFGDIVVQHVDQLTLQHACEQLKTY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinate synthase
publication title Comparison of ligand induced conformational changes and domain closure mechanisms, between prokaryotic and eukaryotic dehydroquinate synthases.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Lyase
total genus 124
structure length 323
sequence length 352
chains with identical sequence B
ec nomenclature ec 4.2.3.4: 3-dehydroquinate synthase.
pdb deposition date 2004-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01761 DHQ_synthase 3-dehydroquinate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1090.10 Mainly Alpha Up-down Bundle Dehydroquinate synthase-like, alpha domain Dehydroquinate synthase-like - alpha domain 1xahA02
3.40.50.1970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xahA01
1XAIA 1RRMA 1KQ3A 4MCAA 1NR5A 3JZDA 1XAGA 1JQ5A 4RFLA 1SG6A 3HL0A 3IV7A 3ZOKA 1NVBA 1OJ7A 2GRUA 2D2XA 4QGSA 3OX4A 4RGVA 1NVFA 1VHDA 1O2DA 3QBEA 3RF7A 1NVDA 1VLJA 1NVEA 5EKSA 3BFJA 3ZDRA 3OKFA 1JQAA 4FR2A 1XAHA 3QBDA 3CLHA 4RGQA 1XALA 1JPUA 3CE9A 5FB3A 3UHJA 5HVNA 1NRXA 1TA9A 1XAJA 4P53A 3W5SA 1UJNA 5BR4A 2BI4A 2BL4A 1NUAA 1NVAA 3OWOA 5K8CA 1DQSA
chains in the Genus database with same CATH superfamily
1KYIA 3AONB 2K7FA 4DJTA 4YP9A 3IV7A 5CCXA 3CRMA 2YJZA 1C8LA 4IV8A 1ZNYA 2CFRA 3A6EA 3MD0A 4FUTA 5AKKA 1VLVA 3ZK9A 4KR6A 4LBWA 2AX4A 4IJVA 2AOVA 1YIOA 2P2CA 1NXWA 2ZSEA 3HN6A 2PN1A 4TMVA 2REQA 2M1ZA 4BOYA 2QMQA 4MJ7A 2Y1FA 2N46A 5K7SA 4P82A 3UG7A 1H0SA 3I53A 3WGKA 4UTNA 2GJSA 1DAGA 2H57A 2EC5A 2AF4C 1OYWA 4KXFB 1EK6A 2Z5LA 4K9KA 3IOYA 5BNFA 3HXMA 3HZRA 1QHSA 3S4YA 5K8UA 2WSSD 2X8JA 3GFVA 1G20B 3H13A 4JEMA 4PHCA 1WSAA 3DPSA 3FUWA 4JCCA 1PWZA 1EX7A 1RC0A 4WZAA 3GEIA 1HA3A 4M9SA 4K9MA 5AW9A 1VMKA 4BB5A 3V1TC 1FUYB 2V5AA 2MSDB 2RHMA 3MMSA 1QG6A 3KHUA 4IIJB 3FFAA 2GJKA 4ZODA 1E4EA 5AW8A 4HXYA 3KCNA 16PKA 1ECCA 1V9CA 2DWPA 3FFTA 4HLCA 4KR0A 4BMNA 2RH9B 2B34A 3NRJA 2KWIA 1ZINA 2I62A 2Z8YM 2WTBA 3U80A 1T24A 2QSZA 3U4GA 3ZX5A 4IDNA 2G08A 1QQ7A 1E6UA 1GZVA 2IK8A 3FNIA 4HMOA 4IIUA 5AQEA 1AKMA 3WO0A 1OWLA 2IL1A 2UYQA 5HR5A 5A1TA 2RD2A 4JT2A 1A9YA 3EHEA 4GQIA 3ZKWA 2WIGA 2VSXA 2HDOA 5C37A 3LPDA 1I6WA 3LPCA 3QPCA 3KTAA 2UDPA 3AEYA 1MBZA 4KXQA 3L1VA 5DW0A 5KMGA 2OZKA 4O5OA 1UJCA 4Y6RA 3QJ5A 5DNYB 5CD1A 5CLQA 4WIAA 2WUEA 4HXGA 2WPNA 5I4IA 1ZW6A 2Y1XA 4IP0A 4LBVA 1KMCA 3CNEA 3E7WA 4D9JA 3S2GA 1QRUA 4O4JB 3K1AA 2B1GA 3GMDA 4QGGA 1DDIA 1UFVA 4WV3A 4DV6B 2FQ1A 3V9PA 1BCSB 4FHGA 5DRTA 1UJ4A 5JS1A 2PBRA 2HSJA 3RVSA 1M0SA 3BFPA 1SCNE 1CJKC 2P79A 3BMCB 3OQHA 2FW9A 5E95A 1ATZA 5E4TA 2DQSA 2OBFA 1NTOA 4M0KA 4LY6A 5EE5B 4MWDA 4QLAA 1XLVA 1QO0D 1BHQ1 5DTEA 1ETHA 5IP5A 1MLDA 3TLCA 4HEQA 2OBMA 1HE3A 1ZBDA 1B16A 1UAYA 4NEGA 3UENA 4J4TA 2BM0A 3CF4A 4NDZA 3A06A 5KJ6A 2VDLB 1AQYA 3JQAB 3LA6A 2CFIA 4YGYA 1KR5A 5E3HA 4CHTA 1E9CA 1VBMA 3AM4A 1PZEA 5FWDA 1RWQA 3TKAA 3U1BA 4CT4B 2YWDA 2VN8A 2JIMA 3OAAD 2IODA 5ED0A 4DW8A 4BFCA 1BXKA 1S96A 3BSSA 2C1EA 2IZ7A 5L9AA 4OX9B 2O2IA 4F3TA 3FOEC 2PLFA 4QPDA 2CUKA 5J3JA 4A6PA 4EGJA 3GLIB 5HMMA 1P4RA 1TVEA 4MWCA 3RBVA 5FUBA 3I9JA 3RSHA 4ZDJA 4HRXA 1E66A 3G82C 5KSPA 4G3XA 3FDIA 2ZBQA 3S1AA 3GFBA 3LPMA 4G8BA 4Z9BA 3ANSA 3ASYA 3G0GA 3UAGA 3DEJA 2BI8A 4NCAA 4C6TA 2QUZA 3DVAA 1KZ1A 2HT6A 2I2WA 3NT4A 2WYHA 5FR1A 4ARUA 1JHDA 2PKYX 4XGIA 5KREA 4CLEA 2BEUB 1CPYA 2O8DB 1W4LA 4NV0A 5F64A 3F8TA 4Q1BA 1FTSA 4AF6A 2XYRA 4NVRA 1NGSA 1NVGA 1XJWA 1Z83A 1F8YA 4N40A 3W2HA 4OMCA 3BDVA 2FQWA 5B57C 2B9VA 1IWOA 5F1KA 1PE0A 5TS3A 1P9WA 1GITA 1H23A 1K4MA 1PW5A 1H6DA 1YZVA 2DFNA 2O4UX 2D8MA 4QOGA 1GZSA 5IVHA 1OVMA 3CSUA 5AJUA 2GO1A 2MCFA 1JAHA 2XBLA 1J2EA 1JHOA 2CMFA 3CVWA 4JENA 4AKIA 4J43A 4BFTA 4MYTA 1JBEA 3KFLA 2XT9A 1DKQA 2XVYA 3EZXA 3ZHUA 5EERA 2OBYA 5ECGC 2GCPA 3W3AD 4Z4EA 5J5CA 5ILOA 1E89A 2JGKA 4LISA 1K1EA 4BWGA 5JV5A 2DERA 2REBA 3NAZA 1P8AA 4PFKA 1SKMA 4TKZA 3ERCA 4BXOB 2H5IA 4GS5A 3DD1A 4QDKA 5A06A 2WD7B 1B0UA 3T3GA 5E2IA 2BGGA 3HDQA 1LWOA 4HYYA 2X0RA 3I05A 2E48A 1PR5A 5J2UA 4IGEA 4R41A 3WDMA 1GLNA 2PKRA 2JAOA 1EAYA 5F4ZA 1NRJB 4ALNA 1CRWG 4F72A 2XJ4A 1AC5A 3PLAE 4E88A 4B32A 3P9IA 1UBEA 1RXSA 4ZVSA 2G9QA 2A9OA 3QQ5A 4JC5A 2VRCA 4I9GA 4FFVA 4YJ2F 3K0AB 1ZJ6A 2PIDA 3WIDA 3SJBA 3ZUGA 3UMYA 3BFKA 3CMMA 4BVKA 5IJ0A 4FM9A 1CTQA 2QL5A 3G88A 4LY9A 5FB3A 3G9XA 1DWUA 4HDOB 1T1RA 4PG5A 3KXLA 4D42A 1ZUHA 4EENA 4L50A 2B5VA 4DQXA 2BL4A 4TMKA 3RYFB 1H4VB 1ZN2A 2VAXA 3NS7A 5LQKA 3FWYA 3IV6A 1YVDA 2W8ZA 4ARCA 1ZOOA 4ANFA 3SQLA 5I7WA 1M2FA 1HSOA 2KHZA 5CFZA 1FFAA 1Z4MA 3B1YA 5KOJB 2OQRA 4C4OA 4C22A 2Q2OA 2R4TA 2I6XA 1Z06A 3C4QA 4JJGA 4V0LA 3P2EA 2BFDA 4YRPA 1IY8A 1LNSA 1E5VA 1O03A 4GLJA 2FZLA 4Q3KA 2JFWA 4C01A 3MHTA 2FLWA 2XZOA 1RADA 4HXFB 2BUAA 2Q5LA 1GPJA 1WUKS 1RQ2A 1GARA 1Y1QA 2XCUA 4Y2UA 1IY1A 3WE7A 3INTA 2OUIA 1P62B 4DSAA 3QX3A 2X8LA 2YNMA 3KQWA 5K0FA 5EP4A 1OXBB 1XA4A 1WUTA 3GFFA 4RVHA 4CF6A 2YIDA 4WNAA 4H31A 3Q6NA 5M2QA 1KQGA 3UB3A 1L4GA 1MIHA 1XN1A 2PZKA 1COWD 1D2CA 1MKYA 1BS9A 2J30A 4FZ3A 4ZTBA 1UT8A 1L7OA 1Z2NX 4EAAA 3F6SA 3KKZA 5TE9A 5LYJF 5F3WB 1AM4D 1GKLA 4A2CA 1GL3A 5BV1A 5H8WA 3OQOA 3FMPB 4MS1A 4D7AA 2P5YA 2PGLA 2OM2A 3HC7A 4K05A 1LLFA 4RSGA 4B2IA 1DX4A 3U4QA 1YI0A 1K27A 1SQ6A 1WB6A 4GDFA 5LP1A 1QTQA 2HF7A 4RZQA 5FPTA 3RS2A 4XEHA 1SCQA 1J0CA 1T3TA 1RWXA 3DFFA 1FDWA 3HV2A 2WU1A 4G5XA 2RH8A 3U37A 2XYVA 1RAIA 2JEZA 3B8HA 4BMXA 5TIIA 2GERA 1PP4A 2CFSA 1FCJA 2RFLA 4HJRA 1L8LA 4KLCA 1XXHE 2MOKA 3F6CA 1H8HD 1Z13A 1TU0A 1P7PA 4PFJA 2JBAB 4JX9A 4FMPA 3TVDA 4NPCA 2GK3A 1NVUQ 2C07A 2WF7A 3JALB 3ZI7A 3GRZA 1L5WA 1KJYA 1SVKA 1WLYA 2IHUA 3CKMA 3WKCA 5I7OA 4EGSA 2BSQA 1YZLA 3HP1A 3WYAA 2IYSA 3EAGA 3NI2A 4FR0A 5I4CA 2YIMA 3ETJA 5KNCD 4KVFA 2EJBA 4FLEA 2HR1A 3VHXB 3CRQA 4R2JA 1MNAA 4D9FA 3IA2A 4RS4A 1QF9A 4WECA 2WYWA 5EEHA 4IDBA 4O5AA 2XUHA 3HBJA 1AB5A 1GNSA 3NM6B 4GX5A 3DUWA 5AVOA 1NKTA 5DIZA 4KVAA 2OOKA 3D59A 2XZTA 3U4AA 3P0RA 4D4KA 2N1MA 1ZJZA 3QOXA 1TJPB 4AZVA 3U16A 4PCAA 1GA4A 1RWWA 3G59A 1VI5A 1XZIA 1G8KA 2W6JA 3LWBA 4B4WA 1F2UA 3DSRA 4BVJA 3GR6A 1KBOA 1TF7A 2BFBB 2Q50A 5LZ8A 1JTFA 1WVIA 4TV8F 4EF6A 2IZZA 4WGGA 1Q91A 1SVLA 2HDHA 1KR2A 3IAFA 3TLEA 2BJVA 4A5OA 2P8SA 3KETA 4MTCA 4PVDA 4QWMA 3KQHA 3VZSA 2L2QA 2F59A 4I6JA 3DWFA 2NNWB 3IEIA 5JH7A 5TNXA 4OLAA 1X9IA 2MYPA 3G5LA 1WZNA 1LW6E 2CNOA 4CM4B 5BSHA 2HC9A 1Q6ZA 2BGIA 2J5QA 3WR5A 1THMA 1SIBE 4FPXA 1IEWA 1XRLA 3WTCA 3UXYA 3VQTA 2VHTA 5BO5A 1RLJA 5BYJA 2PKWA 3TRJA 4EYEA 2AQHA 1E1QD 1AUXA 1OUMA 3IEPA 2WA1A 3L0DA 5EMNA 1V25A 2X2EA 4CTNA 3AUFA 2IU4A 4FHZA 5IAKA 3UF0A 3SFTA 1LDGA 4V0MA 2BFCA 4XDGA 3PHBE 5AKZA 5LLDA 2IU3A 3O3MB 3PEEA 2VHYA 5IVKA 5HZMA 1UPBA 1QX4A 2NXEA 1EFRA 1ODFA 2W6CX 3MEQA 1L5VA 2BGKA 1J1ZA 2P9ZA 4KH1A 3SEAA 1WPXA 4KE8A 3U7RA 4KW7A 5A5VA 4MLCA 5C1DA 4GMFA 2G77B 1Z47A 2OL4A 1YZFA 3B48A 4FX2A 3UWOA 4DNXA 3G68A 4J1TC 2BWJA 2HQSA 1JV2B 4RADA 2WF8A 3QENA 1H22A 5IC4A 1Q1NA 1YQUA 1FNCA 2H1RA 3EOBI 3OPYB 1IOVA 4LDQA 4QREA 1HDYA 3FZEA 4OK6A 4DEXA 2XGOA 4OGWA 1EGMB 4GNKA 2GPYA 1MQSA 2Y1EA 4Q47A 4IV5A 1YB4A 1FE8A 1FTWA 5CNMA 1DCKA 4HT3B 1KTVA 3ABQB 4PYIA 2PUAA 5AVJA 2NO9A 3B3FA 3EVAA 3NT2A 4P31A 3BZWA 5IDVA 5FWNA 4DMUB 2O52A 3EFHA 4F2HA 4BLUA 3M4ZA 2A9FA 3FSEA 4YAOA 4CL0A 1N2CA 1Q1ZA 3ABZA 3KQSA 3BWMA 3OCVA 4QAJA 3ZS8A 3ICOA 1E64A 4XWKA 3VNQA 1GRRA 4IDHA 4DLYA 1O96B 1E1CB 1BDJA 1SBNE 1ENOA 5DX1A 4BQQA 5CB4B 3NVMB 1EJBA 4XOUA 1AF4A 3R3YA 1I9CA 2I6UA 2WHPB 3N8DA 3MOGA 3UXEA 1G42A 2VLIA 2PGOA 5BP7A 3ZWYA 2QQFA 4M53A 1QGZA 5C8DA 3O93A 3LY8A 5HBRA 1XTTA 4OM7A 3QW2A 3C16C 2PVPA 4AP5A 1BKDR 1KMMA 1MEJA 3I2KA 3QLUA 3AEUB 4E31A 3NHFA 3B6MA 3H87A 4QUAA 2XT6A 4IG9A 4DRXA 1QB8A 2C2HA 1SO8A 3GEBA 4RAQA 1HNNA 3I34X 1Z5NA 3NEYA 1HKHA 1HDRA 2OZPA 2Y1CA 4MVJE 4NATA 4Q3NA 5LP6F 3LY7A 3C39A 1YRYE 3SC4A 3QM1A 4W5OA 1TT7A 3NALA 3MTDA 2Q0HA 1O97C 4F9TA 1MMFB 2X42A 3K6SB 4GM4A 1EXWA 4R8RA 4CDRA 2IEAA 3V8QA 3WQRA 1IBSA 3E48A 2FPSA 3EGVA 3ZXYA 1JVBA 3QI2A 1L7BA 4LK3A 4U9IS 3L7YA 4BBAA 3ZH2A 2GBCA 3FMVA 2PK3A 2P4HX 5HCNA 4KITB 1IN6A 3STHA 5ALQA 1ZCJA 1FVFA 4KQ9A 4EQZA 2NV2B 3HGMA 4A0RA 4E0BA 3PHIA 3A4LA 1Y1SA 3MAJA 3G2OA 1XSEA 3PT5A 3PUVA 4YS6A 5MFZA 1CYEA 1R0WA 5JEDA 3S0JA 3O03A 4OXKA 4YRNA 2W7TA 2O8CA 4KDFA 1XNGA 4MW2A 3VNUA 2XXAA 1SEVA 4JI4B 4LHWA 3W3ZB 1KPIA 1MFZA 3UFBA 1H5UA 3P0JA 2C54A 4C4XA 5BSMA 4ED9A 3BE5A 2FZEA 1ITZA 4CUJA 1HNWB 4QJ5A 3EDCA 4X9XA 2RGGA 2Z57A 1RXIA 3EFEA 3H0EA 2KMLA 2A3NA 2NUTA 3C45A 3D6JA 3N9IA 5EFZA 1XDWA 3DBLA 2VNHA 2R3SA 3OP1A 3AUKA 4FHCA 4F8YA 2FPOA 3JXEA 2O2JA 3CZ9A 3QVKA 4EPWA 1H2FA 4X63A 3PDHA 3A25A 4OH1A 3WIVA 3R3XA 1Y3FE 2QTTA 2VF7A 2C7QA 2AXPA 2ZSJA 1R6DA 1FS5A 3N0WA 4W5RA 5ER6A 3V9AA 5EXTA 3BXPA 2LKDA 3HDHA 1QH1A 4ZJZA 3C4JA 4EB6A 4B3CA 1JP7A 4Y6PA 3ITDA 1BMTA 3IQEA 5T4BA 4XQ9A 1P4AA 5IYZF 2V0GA 4FK8A 4M1TA 3LS2A 3OZCA 4E4TA 1QIFA 2DCUA 4OYHA 4CQLB 3NHKA 4GGPA 3O21A 4DM3A 5EKTA 2K7ZA 5JAUA 4HAZA 1IBKB 2NXCA 5HQJA 1E1LA 1DARA 2ZRHA 3RYIB 4B0OA 1XQ9A 2ZITA 3KXIA 3AOEC 2E3JA 1KEPA 4KUEA 2DBZA 2HXYA 2NXWA 3HDYA 5TGTA 4ZGGA 3OCWA 1XCPA 1DAIA 1C7IA 3GT4A 4XAQA 2H3HA 1VSQA 5HTKA 1R12A 1JDBC 4DMLA 4N48A 2RHHA 3TW8A 2HXGA 4Y2YA 4DC0A 4C2AA 2M2IA 1HT1E 1QM5A 3OPNA 5J58A 4JLPA 2FRXA 2WM9B 3MD9A 2I3ZA 1Y4AE 3ITNA 3TSAA 4CN9A 5C8YF 9ABPA 1FUEA 5KC9A 1TM5E 3K1ZA 4RHFA 2AC2A 3S5UA 4RULA 1EKXA 1SUEA 3FNHA 2ZJ5A 2QPAA 5T6BA 2CYCA 1BKSB 3IUQA 1PJ8A 3HA5A 2Y9MB 1W30A 3IIIA 4KO1S 4PHGA 1XU4A 1M1ZA 3GGDA 2QN6A 3UH1A 3KQPA 4DVGA 4TLMB 1WMEA 3IB6A 4DMRA 5HQ3A 2NO0A 2IRWA 2DPXA 4X24A 4DYVA 1PGNA 3MFYA 1EFPA 4Q9KA 5EN4A 1TTHA 2Q49A 4AYWA 1AHNA 3F71A 4GM0A 2BKXA 3RS5A 4YCSA 5DNAA 2JHCA 1T1JA 4MGZR 1YRAA 4UOEA 2I1QA 1K97A 1NF9A 1T0JB 2JI9A 2RAVA 2YWEA 3HB0A 1GZ5A 4EJSA 4Q7QA 5A3RA 2XUAA 1KXJA 2FWJA 1QKIA 2FX3A 3F5QA 4PC7A 2FZCA 5BT8A 2WQ7A 1CY8A 3LOUA 4IS3A 5GJWC 3OU6A 1I1NA 8MHTA 1RQRA 1B0ZA 1KEEB 3TEMA 3K9WA 4XGKA 4PX9A 3ZLUA 4A10A 1U2DC 1REQB 2QD5A 1X7WB 4PHHA 3A0UA 4JLSA 3B1JA 3IQIX 3UC9A 1X7ZB 3IDFA 2RBEA 1A9XB 3I2IA 3MB5A 4J3FA 3O2NA 5COAA 3I04A 3T6KA 3CLKA 4HVAA 3IAM6 3V1NA 3I4LA 1A1VA 1LSOA 2JH9A 2ZAYA 4Z49A 3D81A 2OC4A 5LMNB 3LYHA 1WBDA 1USIA 3CVXA 1FS4A 2ZJ8A 1EESA 1CRZA 5F23A 4WESB 2ZIAA 5D3QA 3FW1A 2XWBF 1OLOA 1JDUA 4N01A 3JQBA 2GFQA 3SEFA 3WNDA 3VTKA 3IAM1 4MPTA 4ZKDA 1USWA 3AP2A 4NG5A 5B3KA 1I6KA 1TIPA 4F3YA 3G5TA 4P7GA 1N6RA 4RV9A 3HDGA 1PR0A 5IJ9A 3EUAA 3M6UA 4LSGA 3L0PA 1Q0RA 3BWCA 4O63O 1M73E 2FMXA 3CNHA 3NW9A 5H4HA 5K3FB 4KREA 4N12A 1IG3A 1QC5A 1OQAA 3QFHA 4PGGA 5FNVB 4M46A 2VWGA 5TXGA 4IWNA 2NPFA 3TUIC 3UYKA 4M0UA 1SIOA 1OC4A 3ZWOA 1EZ1A 5KNDA 4TLCA 2FR0A 1AD2A 1DS6A 1JDPA 1X7GA 4ZEWA 5DN6D 2Z56A 1N6KA 4BB9A 2RAPA 1D6MA 2BTEA 1OFHA 4NOMA 3P9YA 4CEJA 5C5DA 4IG4A 5BWNA 2VC2B 3FF4A 1SD5A 1GR1A 4G1CA 5KNDH 4UZEA 1E20A 3KYCA 3GDFA 4GR9A 4I9HA 1M3SA 3DT9A 2HY7A 4C5CA 4EB8A 5BSEA 5KTRA 4YPOA 4B4KA 1QNLA 4OFXA 4EGAA 2C5LA 5EHGA 3FVQA 5AI9A 5CJ2A 3RHTA 4A6DA 3TLKA 4F0JA 5BYKA 5CEJA 4WK6A 1N33B 1HV8A 5JBQA 1ISIA 3RB8A 3FOBA 2R6GA 4L4RA 1G38A 1JEDA 1U2ZA 4L4XA 4RGQA 1RYYA 2R60A 3SZMA 4B5LA 3EISA 3UH0A 4JITA 4OGFA 2E0IA 2EJVA 5DYWA 4RCVA 4DQ0A 1X1CA 3AGQA 2WT9A 3OE7D 1U3DA 5D84A 3UTDA 3VU1A 5TMEA 3EMBA 3GLHE 3FGNA 4TWJA 1DMSA 4GMHA 2VEOA 3LM8A 4OAOA 2P9JA 1G4HA 2ODEA 4MAMA 3O8OB 3CJQA 3J7AC 3FSGD 4KUHA 5LA6B 3GI1A 1ORRA 5L3QB 3FKQA 4G1FA 1G2IA 1W0JD 2KE5A 2I2CA 2RARA 2VCHA 3L43A 1BXZA 4RJJA 3U0VA 1MEOA 2ZYGA 1MABA 3FN4A 5EE3A 1G5FA 1EE9A 2JCYA 3NWEA 3PXDA 4R51A 1IBLB 5T64A 1W5AA 5CFMA 1HMYA 3GLRA 2WHXA 4MUMA 2IXGA 4CR7A 4IJMA 4CCYA 2ROQA 3ND5A 1V1RB 3TQCA 2ZJOA 1XZQA 4MZDA 4NIMA 4XIJA 4CF7A 3PX2A 3PXUA 3DFZA 3ZHVA 1PT5A 4DUZB 1NA5A 1BU8A 1OBVA 2PV7A 3OPQA 4P8RA 4XIFA 4E2YA 2A5YB 3ABOB 2IPAB 4QTTB 5J1SB 1NSTA 3T0FA 3GZTB 4LXUA 4MLPA 3L8MA 4DS3A 3VAAA 3GEEA 1E58A 1JG3A 1I24A 2F17A 2OZEA 3EEFA 1ESZA 3EDYA 3N86A 3P52A 3G85A 2CF5A 4KPGA 4FS8A 1U0NA 4MVJI 2CLIB 3UAWA 2VPYA 1QMGA 1T9HA 3KJGA 3QUQA 1Z15A 2OK7A 1EK5A 1OSNA 4HN2A 4O0MA 3OPMA 4OGGA 4NFLA 5DT9A 5EMLA 4BV9A 3PQ4A 1FXWF 3ZW9A 4DPMA 1UK7A 5C1PA 1AN9A 2OG1A 4BFSA 4X85A 3AERA 5CRIA 1PQ4A 3LLVA 5WRFA 3VDRA 4E7PA 5KYKA 1PR3A 3A3KA 3EXG2 3IIKA 5HUJA 1KZ6A 2NZVG 4EG4A 4LXGA 3TKLA 4R1TA 1E1RD 1J8MF 1Q7RA 3E3NA 4G9GA 1H05A 1EXDA 4DR6B 3V2IA 3WWZA 1TEZA 3U7JA 2R84A 4BTLA 2V7VA 5K0EA 1IDN1 3RRXA 4E1AA 3L4EA 5DHRA 1K4YA 1T8SA 2INGX 4AS3A 1OLUA 2ODNA 1THTA 4FBLA 3BK1A 3EMVA 5HKAA 3GGOA 4FFDA 5K0JA 2IFTA 4NOJA 3L92A 5B36A 4IIXA 2HSDA 1H1LB 4FNOA 4K9QA 1U7OA 4ZT5A 4G0NA 4MVCA 1OZHA 5FL7A 4B7ZA 5BN1A 4P84A 4LJAA 2YTZA 3AF5A 1GDDA 2WQZA 3OWOA 3PFNA 1BOFA 2NSYA 4LI0A 4WDRA 4ZKEA 4CTKA 3MPOA 3AETA 1EUCB 3B2NA 1BDHA 4LOLA 4XLZA 1DC7A 1R64A 1E2KA 3DPUA 4U2GA 4Q3LA 3LVQE 1L4HA 1CY1A 1YZKA 1Z5VA 1YWGO 2DGDA 2K6GA 1D8AA 2X23A 1TYBE 3GUVA 4N7BA 1ZD5A 1VYUA 3K20A 4NZPA 2TRSB 5FIUA 4Y6GB 5BSKA 5IKMA 1F3LA 2VKQA 1RT9A 2WYIA 5FV4A 1C4OA 2R1TB 3C6XA 1LS1A 1U0JA 3CG0A 3LZDA 4JSYA 5EUMA 5LZ9A 3FR8A 3HH8A 1PAUA 1TKCA 4WCFC 5CJJA 2FWMX 1ODLA 2WFZA 5ALXA 4RQAA 5GIPE 5K6AA 1RYHA 4RVOA 1GTSA 2HBQA 4IV0A 3U61B 1N1GA 5CVEA 1N2SA 3R3JA 4ON9A 2GXSA 1GEEA 2CLDX 4UU8A 721PA 2H48A 1SVMA 3C97A 3Q0IA 1LPSA 1U3TA 5EMMA 1M6VB 4ZC8A 2ZYAA 5I47A 1XA3A 3KOUA 3B1KA 2QTLA 4MUFA 4JA2A 3V2HA 3ZV7A 1S01A 1YULA 3L8DA 1GPMA 2GAAA 2VBCA 1NIJA 2C31A 1ZC4A 2CEKA 2ZKLA 3I23A 3OWXA 4IL5A 3A14A 2R8ZA 3IAEA 4RZIA 4BFZA 4J6FA 4OK3A 5LQUA 2AR0A 3ZCPA 3DMPA 3F4LA 2ZSFA 3CW8X 1V11A 1XLTA 3LTEA 5ALTA 4CVNA 2NSHA 4YT5A 1SC4A 4LZWA 2GK7A 4NNJA 2GZ1A 3C8DA 2O2EA 3VH3A 1NHGA 2NO4A 2G0AA 2XWPA 1JXOA 4D1YA 8ADHA 5HM6A 3S2YA 3SM9A 3OPXA 4BS9A 3EBLA 2GDZA 2QSUA 1ILEA 1BE0A 1X1QA 4DLAA 4JC4A 1SB8A 3VZQA 1E3EA 2IWRA 4C1NA 1NJ5A 1BCRB 1SC1A 3WGVA 4EGQA 4KE7A 2ICAA 2YWJA 5ADVA 2PEYA 1XD2B 5KQRA 3STWA 1JBKA 1RXUA 3R6GA 4NHEA 4P4NA 3M5PA 1G8PA 1L5FA 1RRPA 1QGED 1T0HB 1K4KA 1ECGA 3EDOA 1YBMA 1DKUA 4Z4FA 2FN3A 3L5OA 4ZPXA 5IABA 3L8HA 4FDVA 5CK4A 2Z43A 1ZU5A 1M2OA 4WKCA 5LBTA 2RJOA 5JUWA 1E5QA 2PY6A 3IHLA 5CPBA 1XZCA 2XQKA 4OQ4A 1IUOA 1GP2A 2C5EA 4O2LA 4PTLA 4DCMA 1PLKA 1VRVA 3HYCA 4FLMA 4HTFA 1FSFA 1GGJA 5A4KA 1ZRHA 3S5JA 4BO4A 2AEMA 3PYLA 1L3IA 5DO9A 2AMYA 1CUAA 2O57A 3PJDA 4RKEA 2P9QA 3SZUA 1GV0A 3IQDB 3V1MA 4ZN6A 1ZKMA 1T13A 2N42A 3MT0A 4ZJPA 2B7LA 4K6GA 2R85A 2GMWA 4J1QA 1ES9A 5DGDA 3DMFA 5EKXA 4HDMA 4F06A 3FDZA 4N6GA 1FBNA 1T2FA 4C7OB 3EK2A 4YRDA 2RC5A 2O8EA 3HRHA 5JSZA 1V37A 3FFXA 3GP5A 1MB3A 3SYRA 3PUYA 4WACA 1BEUB 3H11A 3PGXA 1NXOA 3OZTA 4R1NA 5A1JA 2P3LA 5A62A 3D7RA 5YASA 2II6A 1Y5IA 1D7AA 3IUMA 4EEZA 5A9SB 3R6DA 2I87A 4MHOA 1LTKA 1NOIA 2MINB 1DEAA 1LRLA 3C43A 5AQ1A 1WOMA 2W2KA 1TDJA 4QVIA 3HJAA 1KK2A 5DM0A 2AUNA 2IXDA 1PQWA 2ZJ2A 3A11A 1UZAA 4GI7A 1E4OA 3OIUA 3WBJA 3ZJUA 4HPXB 1RWBA 2A88A 2YVAA 2ARKA 3LSTA 3U2QA 5BN4A 4DMMA 5AVSA 1XYGA 5SYAA 1SULA 1BN7A 4YQFA 2HPZA 4BLRA 3KWLA 4WNIA 1ZG3A 3O8NA 2VHEA 4F8JA 3G8YA 2C61A 1G60A 1RWOA 4WZBB 2WNHA 1NONA 1PLJA 5BUZA 3JS5A 5EJ6A 3MCWA 5CA0B 2IIQA 4B75A 2RGNC 4TQGA 5CLGA 4ESHA 3G02A 1RZVA 2EIHA 3VKUA 2FPWA 1FNBA 1EK0A 2G0TA 2W6NA 3G1TA 3PNBA 4F2WA 4XWAA 4ZOLF 1UBJS 5JJKA 3LHIA 1Z07A 4HWTA 4UJ3A 1U1FA 2D74A 2PWZA 3RTAA 3RTEA 1C41A 1V48A 2AUMA 3O2SB 1AXGA 1CERA 1KA9H 4GQBA 5E7MA 3U39A 4EY3A 1ZEMA 2IXTA 3Q3IA 4PW0A 4AB1A 4V1CA 1DWOA 1P2GA 2P5UA 2YJ4A 2BGWA 3NVKI 4MKHA 5K4GA 1A71A 1LWNA 2AL7A 1T0BA 4KE9A 1LK0A 4LQDA 1US8A 2WG2A 2BMEA 3U7EB 1XCOA 1QHNA 4YLYA 2GWHA 5KIAA 1PNTA 2XOKD 1CVIA 2FSIA 3NIWA 1D4OA 4JD5A 4P3KA 4XIIA 1VIVA 2P91A 2YWFA 1WXHA 1PUJA 3I6YA 4JROA 1GUBA 5DM70 2WRZA 3GUZA 3RTCA 7ADHA 1ZLYA 4J0JA 3AKZA 4OHVA 4CNQA 2FPGB 3ANXA 3D6AA 2H08A 2F3PA 4UVGA 3ZBQA 1SC9A 1LDNA 2DY1A 4EW1A 4MB0A 3NOXA 1KMNA 3BJMA 1BXGB 5KKCA 4MZXA 2IYYA 2YY6A 2PAAA 2BTQA 2G0NA 1G0OA 5D51S 5LVAA 2CXTA 5LQMA 2GVNA 5DNWA 1YC2A 2PNFA 2O1EA 1G8GA 2IYLD 3TDMA 1QOZA 3MN1A 1Z38A 3OJLA 1R16A 2C4KA 3MCZA 3PHJA 3VOAA 4UHHA 1J2RA 1E0DA 1G5RA 4HDNA 3HVIA 1H0KA 4NENB 4WXHA 3WP0A 3ZD8A 2YOFA 1B6TA 3CHYA 2H16A 4IQ8A 4HFRA 4AICA 3W7VA 4EGCB 3WJ1A 1KI3A 5CK5A 4DXDA 4MLDA 4HDKB 4ZZ3A 4DR1B 1FS6A 2EYQA 1XRJA 2PUTA 3PQDA 3JYHA 1WY7A 4F4DA 5CM9C 4OQFA 1U0OC 5ALLA 2FRDC 1J90A 3QLEA 4QX6A 2JW5A 3V80A 4O08A 2E1PA 2PS3A 4K88A 4LTMA 2HRRA 1DZIA 2ZJ1A 5JTUA 4TL7A 2HPHA 2QRVB 5LKRA 1K68A 1K66A 1A5SB 2LIPA 4R54A 4ADSG 3IEMA 3C1AA 3O4HA 4U8GA 3AIIA 3ABIA 2PO5A 4M0LA 2X0FA 5IT5A 5J4LA 1WS6A 4H35A 1UBTS 1U6JA 2GNAA 3DE7X 3AFIA 2JL1A 1N8NA 1QSGA 1PGJA 1DZ3A 3E1KA 3JRNA 3DKKA 1NDUA 1SWVA 4IHKA 1NQVA 3BMQB 2C4UA 4G9BA 1Q6YA 2JGRA 2BF7A 4TSKA 5SY6A 5DSTA 5EVJA 4P38A 5EQDA 5TX7A 2CDNA 4YJ3B 3RO7A 3OQMA 4JUFA 5BQPA 4EVIA 1KI4A 1ZGJA 4WSOA 3I1FA 3RDPA 5F5NA 1IFXA 1Z2DA 5CA1A 3ICCA 4LYYA 1N92A 3BOSA 4XD7A 4KCGA 1VHTA 4GI2A 5BVHB 1O95D 3W5UA 1NU8A 4V0ME 3WSVA 4LF8B 3CZ5A 2XB9A 4U02A 4QASA 1EFKA 4L0DA 2BCJQ 4WBNA 3S2EA 1BA3A 1VIDA 4I19A 4DBLE 4HB0A 2YWXA 4MI6A 4F38A 1WDTA 3W6PA 3DHYA 2PL5A 4E11A 3C3PA 4H18A 3K5PA 1MB9A 4HNAB 2X0JA 4P36A 3SC3A 2XZLA 2EKPA 5KTYA 4Y0VA 1G4UR 1M2EA 1BKYA 5CVUA 1BVRA 1DX9A 2QJFA 4FYHA 4D44A 3GHYA 1KEKA 3QXGA 2OLEA 1VKHA 2X19A 3K9GA 4YRRA 4OVKA 1BS1A 5AHRA 2PSJA 1N0VC 1XAIA 1KJ9A 4M7WA 1MVOA 1FJGB 3B89A 1JHUA 4J0GA 4MKRA 4BGUA 5C4IA 1IPEA 3GJRA 1CWUA 2Q3LA 3PPXA 2VK4A 4WKPA 1UC4B 4ZVVA 3MXTA 3IQGX 1UM9A 2X41A 4PLHA 2VH2A 3IQZA 2PTHA 3OQ1A 1IZ9A 1X70A 3SBEA 3PNQA 1ZGHA 3DE2X 3TAUA 2CXOA 2OLKA 4O2AA 1KZ9A 3QIAA 4CI0B 1TF2A 1U8AA 4RA6A 3E9RA 3T3HA 5FADA 4YAGA 3WLHA 1N5OX 4JI1B 2RHWA 4RVSA 2D7DA 3J7TA 1T4DA 3NHLA 2JK1A 4RPKA 1LZLA 3SR3A 3DD5A 4H77A 4RTQA 2RGDA 4MA5A 5BRNA 3VC2A 3IXQA 3VNAA 3O5AA 4CG2A 2W2VA 5L4LA 1YS4A 3U49A 2I3AA 4NONA 4P6VF 2MYUA 2VCYA 1T5DX 3PL5A 5FUWA 4ARZB 2OK8A 1P1FA 3L0OA 1E0AA 4S24A 3OZIA 3P2OA 3SPXA 2ZI9A 5DYGA 1FMTA 2D5LA 2FGKA 4RYLA 2R8RA 4W1RA 5K09A 1Z68A 3E3LA 4ZT3A 1UAAA 2XYPA 3TB6A 4M3NA 2CHUA 3ZHRA 1LI5A 4GH5A 1ZIOA 4YUZA 2VDWA 3K4HA 4UBMA 3VXKA 4BL5A 2OECA 3GT3A 4WA8A 3BKWA 4D8WA 4N0DA 2BRUC 1ECLA 4FW8A 2NGRA 4V0SA 5L7YA 2PRKA 3N6XA 2PJRA 1G7CA 1ONOA 4D5EA 1QVWA 2C3OA 5F1OA 1JW9B 1IATA 3FMOB 3PNMA 1FB5A 2RMKA 4D26A 2PRZA 4H9GA 4MUNA 5LXTF 3N87A 4UOZA 1U2QA 4YR7A 4OLHA 2FEAA 1ZM9A 4JLMA 3KSUA 4E30A 4QYIB 5BR7A 2VDMB 1E2HA 1OIXA 3PQ2A 3JCZA 1U2TA 2AT1A 1ZOIA 2PGNA 3AR8A 2HAEA 1NMSA 3JWJA 4EG6A 4OA5A 4BP3A 1P0IA 4QEKA 2FHSA 2NPIA 3BD9A 4GWKA 4OB6A 4NWIA 5NULA 1YDHA 3I32A 3I30X 4OATA 1NNLA 4N8SA 3DTVA 3I9FA 4FOLA 4OHFA 5FF9A 1JA0A 1TM7E 1J33A 1QV6A 2V7QA 4FXOA 3CUWA 1F5NA 2Q07A 3KO8A 2BISA 4ZQGA 2AQIA 3AR4A 1N1MA 2I9PA 4EYSA 1L2TA 2EBUA 4Y6QA 4MWSA 1A2QA 1DQNA 4Q7MB 3FCEA 3RVRA 3D3WA 3IP1A 1S2DA 3AY0A 4ZP1A 4CM1A 2VYVD 2XX3A 1PZHA 4YDQA 1RTTA 3BAZA 4CL2A 1Y3IA 2FMKA 5J2TA 1I3OA 2V9CA 2ZIXB 3OIDA 1Q1BA 2SKDA 5EIHA 3LKDA 3X1XA 1RYMA 1X74A 1H3NA 3JZFA 5DP1A 4D0GA 4F2GA 1YS2X 1ZMBA 1RXVA 4S1VA 3K4QA 1K6IA 2QM8A 1JU9A 1Q44A 1GAEO 1K9VF 3KWFA 3RRBA 4XR9A 3ZXXA 3KQOA 5IWCA 1NZDA 3JWPA 4HKTA 4L9WA 1SRRA 3GDGA 4G4SO 1R50A 2BI4A 5TEVA 3K0FB 4FYMA 3OFNA 3Q8MA 4FTWA 3KT6A 2A1TR 1CUDA 4KI0A 3VZDA 5JIBA 4JR1A 2I2DA 1KSGA 5DFAA 5JFGA 1Q1AA 2XLCA 2NOAA 4JCOA 2V1XA 2W4IA 3HADA 5KOIA 2H9IA 1HYQA 5KDOA 4TKLA 5EJEA 2J32A 3HLTA 3OT1A 3EPLA 1JFLA 2Z2KA 2DFKB 3ORYA 4UPVA 2H2IA 1SCUB 5ITWA 1OAOA 1CK4A 2H59A 4OYRA 1NQWA 3R7DA 3D0OA 5KWJA 3B13B 1JXQA 1BC5A 1NULA 2Q0XA 2R25B 1CF2O 1GFZA 1U7WA 3GGJA 3MUNA 4IYRA 4MQ5A 1AZSC 2CNWA 2IW1A 1C2TA 4KUGA 3TZKA 2PMWB 3FM9A 2B99A 3W5CA 2X22A 1R4MB 3DC7A 4OMUA 3EFOB 5J40A 3T4PA 2EWVA 2XNDD 1P3DA 2F8TA 3RWBA 1P5JA 1UBRS 1ZNZA 3GCXA 3P0HA 1C1DB 4W1QA 3OOJA 2UUCB 1CY0A 1VCMA 1L8XA 3CKYA 3EB9A 1J1UA 3KAQA 3TO5A 1T9DA 1EVZA 3PFBA 5H3LA 1RRKA 4J2TA 1DJPA 3GUYA 1KZ7B 2PE5A 5CFPA 4OY3A 1NV9A 2AWNA 2JFVA 2A7XA 4XVQA 1JB9A 4II2A 4KAJA 4O2BB 3WWPA 1KKLA 1SVOA 4BQSA 4YRLA 1QYXA 5IWAB 4RUKA 3WKAA 5L45A 2I4IA 1V8DA 1Q0ZA 3WBFA 5TPWA 3WGTA 2IQIA 1EP1B 1LC3A 3TVTA 3OJ0A 3UA4A 1GG5A 1ULBA 2JVKA 1N0HA 4M1YA 4X66B 5E1DA 4TZTA 4BDTA 3TIVA 4NAUA 1OVGA 3JQFA 3GGSA 1P81A 1XMVA 1A95A 3G5AA 3L07A 4IRUB 4J0FA 2BH2A 2N1BA 2YJ6A 3NYQA 2H1SA 2HL6A 3KAPA 3TNFA 1U5BB 3DLAA 3C0KA 2R11A 4QQNA 5KTSA 1Z25A 3L8GA 2BI7A 1P2VA 2AZMA 2BGLA 2QTNA 4I1IA 4X7RA 3STTA 3QBJA 4K2AA 4KO3S 3KE8A 3GAFA 3VC1A 5ES4B 3QXHA 3RVOA 3F7TA 4LJ6A 3GQVA 3ROTA 1NLYA 2HBZA 4KXUA 5GWXA 3UWDA 4C7MA 2CXNA 1HLDA 4ZCRA 1TAUA 2XTNA 1IUPA 1XNJA 2D0PB 4J4BA 4TTPA 3TTVA 2J85A 4Q16A 1TLTA 4AN1A 3TF5A 2NP6A 2VZLA 3ZG6A 2WTEA 4GHWA 4BVFA 3GC6A 1SG6A 3PUIA 3QUTA 1CR0A 2OFXA 5CDYA 5ICMA 2ZRCA 1MG0A 4J7CA 1D4ZA 1V39A 3AL3A 3L1HA 3JD3A 1M76A 4G36A 3DXZA 4DBZA 1U2EA 1OBCA 1S2LA 3RVBA 5JS6A 4IZ6A 1XLUA 4UDNA 1TU4A 1K7EB 3BPSA 2NPOA 2FWBA 4KTTE 4OFBA 4V03A 4ZHQF 2H4YA 2JJ1D 4LZLA 3TAXA 1SUCA 5IM4F 2V58A 4DDTA 3IE1A 3GZ4A 3LT4A 1QS0B 2I76A 1QZUA 2QLBA 4XJVA 3SLGA 2QF7A 4EW3A 1P91A 4RHTA 2ZT5A 3TW0A 2EKZA 2WP0A 2ISSD 5AW2A 2PQ2A 4MGIR 5H7XA 3C3YA 1PHPA 1OY1A 4L3OA 4K9LA 4R2XA 1BU5A 4N1AA 1D6SA 5A3SA 2Z1NA 2PJUA 4OB8A 5JMTA 4AG3A 1N2BA 2QM0A 4XFJA 4NPHA 2JAPA 1RS0A 2G76A 1DQRA 1MHTA 4BB6A 4Y1FA 1SELA 1N8SA 2FMIA 1U1CA 4LG1A 3OEED 4IIJA 1PJBA 2FLKA 2JLRA 5KVSA 1FTQA 2IXAA 3T3OA 3HDTA 4PZZA 4EJMA 1U0RA 3TE7A 2VCEA 4EABA 1B3BA 2QTVB 1GZ3A 1JHMA 3IXMA 4U39A 1PBTA 2ODBA 4LC1A 1OROA 4YJFB 4JJIA 1Y6JA 1C29B 4PO8A 5GMOA 3ZE8A 2X0DA 2G7ZA 3EY9A 1MW8X 5JXJA 3E3OA 2C2YA 4PBSA 3MQFA 2C4VA 1A5BB 3O0TA 1E8DA 1C50A 1T10A 1W5FA 3A6HA 3CRNA 5D3ZA 1Q1EA 2ATXA 3DTYA 3QNMA 3U09A 4LFBB 1PL0A 4UUQA 1UWLA 2DT5A 2IP4A 3TEJA 1DAPA 4MKXA 4XZ3A 2Q5QA 2GEDA 3RM3A 4PLTA 4XX1A 4KKXB 5KTMA 9ATCA 3KLBA 3ZCVA 1IZYA 3SWWA 3R9XB 1NVVR 3EDQA 1M6YA 2W2PA 2ZU0C 1OWNA 2H5LA 3OIWA 4DDHA 4O4IB 3I52A 1KE1A 4Y7DA 1QQAA 4NMXB 2JZNA 4W7HA 2CFTA 4H0CA 3T3PB 4DCNA 3TG8A 4J9VA 4IDOA 1PYGA 3Q0EA 2L82A 2OV1A 4QUBA 2DZDA 2HTEA 4R01A 1BCSA 1MRNA 1NUPA 2HRCA 3M34A 4M1EA 5MN4A 2UXDB 1A98A 1S02A 2C88A 3BMCA 1GQSA 1UEIA 2QSJA 3FAKA 3RS0A 3TRDA 3IIMA 4GZ5A 2PKCA 4MI9A 2ZJ6A 1OLSB 5FJIA 5KHAA 1CY2A 1B2LA 1YE8A 1IXYA 4I3FA 4HLUA 4Z4CA 3QFSA 4YDRA 2GX6A 2PRSA 1MJGM 2F6RA 4DIBA 2HYIC 2V6JA 3FUXA 3PC8C 4LVUA 3CRZA 2VHJA 2XITA 5JCJA 3F7MA 3EF0A 4OQZA 3GIDA 4NABA 5JE8A 1C4KA 1C3EA 1I13A 2A9QA 2W90A 1Q2XA 3O0DA 1JQBA 3T7CA 4Z6KA 5FTLA 4DSTA 1ZCAA 2ZBDA 3VX3A 5C46F 4ND6A 3VO1A 2JGAA 1CB0A 4JC8A 2QZPA 3RD5A 5B3LA 5K0ZA 5FTJA 3FNEA 2HBYA 5LLTA 3I6QA 3V33A 5DPMA 2HU7A 5IPFA 3DKVA 3G2MA 1QOQB 5J47A 1L4NA 4IXTA 3QW4B 4RZ3A 5AOCA 3K6KA 5AVTA 5HRUA 1O6FA 2NTNA 2C2XA 3AVYA 2P1ZA 3P9RA 4RJ2A 4TM8A 1LSSA 2Y3IA 3DMYA 3GQBB 3PRYA 2XMDA 4H6PA 3TAHA 1HORA 4G2TA 3L40A 1WF3A 2Y4OA 2JFXA 1WHTB 1TCAA 1WG8A 3MMNA 1Q5PA 3MRSA 1FDOA 1P3JA 3WRYA 1ZMTA 1PR9A 2YBDA 1CUVA 4DLZA 2A4MA 2M6KA 3INNA 4ZU6X 1W88B 3DMTC 3JWGA 2OA0A 2QT1A 4DDWA 2O8DA 4FVTA 4O3MA 4E12A 3NBZC 1EEHA 1RKUA 2VI5A 3CNBA 3HU1A 4ZU3A 1YDMA 1RJGA 4FMDB 5CGZA 1OWPA 1E7MA 4CKEB 1Q84A 3UJAA 2HQRA 4JKYA 2J9FB 3K9BA 1FVHA 2WLTA 2WICA 2DKOA 2YVLA 2BMVA 3L8EA 3UJ8A 5LC1A 1A8HA 3DXFA 3FBWA 5EHNA 3O9ZA 1C4WA 4KR2A 4R9NA 2BBWA 3OBIA 821PA 3OY7A 1VHJA 1E1NA 1SKBA 3ZWQA 1OX4B 3LW7A 2I5PO 4DHWA 4YR9A 2B4KA 4UDYX 2R0QC 1U4NA 3DDWA 3I73A 3P4YA 3LXUX 5AOVA 2VUHB 3CTMA 2VBFA 2J3HA 2A0YA 2FPIB 4IAOA 2DFTA 3QFFA 4NEHB 1T4CA 3L77A 2CJPA 2GN2A 4RY8A 4KMOA 2FK8A 2JJ2D 2FV8A 1ZICA 3IAAA 3JQGB 3R2JA 4G8CA 2TSYB 1N7HA 1IZ8A 4QEZA 4BXOA 1FRFS 3HDVA 1TGYA 4IJWA 3WWOA 4D9CA 2WD7A 3IEXA 3FHTA 1IPHA 1LX7A 1K6EA 1GZ4A 2HF8A 4PZDA 1GU7A 3PDIB 4GBED 4UTRA 5ICGA 4MR8A 3AUTA 1B1CA 1YH3A 1OZGA 3EUFA 4MB6A 3ZZ0A 2Z6AA 3H18A 2CMKA 2R7KA 4L85A 1YU6A 1XVVA 1YJ8A 2O7VA 3MK31 3K0AA 3QVLA 4OSPA 4OJYA 4U5XA 3RVQA 4BRZA 2XE7A 1XVUA 1GPUA 3TKYA 3CEAA 5IW8A 2NVBA 3FRIA 2QUKA 5LBUA 2WF5A 2AA3A 1TYDE 1CDOA 2HV9A 1JG4A 4NECA 3VHQA 4CPDA 4CR6A 5CCBA 1K7XB 2C0CA 1NVAA 3H5IA 3ZTYA 5I7UA 1GKYA 1BMDA 2WG1A 4HGPA 3RYFA 5J59A 5I51A 3WWEA 4DV3B 2E5LB 2HU8A 4D45A 2IHBA 3RF6A 1W5TA 4Z0PA 4IMRA 1NVBA 3W77A 3Q8KA 3Q87B 4JIGA 4AUNA 5SZIA 4DGSA 1DCFA 3TZ6A 3UJ7A 2J0SA 4JUDX 2G9ZA 1FFHA 3NEJA 1N2OA 3X43A 3PF8A 3JYLA 3W8RA 3LFHA 3SIRA 1JJVA 1N2IA 2LKCA 3OJWA 3QFCA 3MCTA 2GF2A 4KTVE 5T8KA 1G16A 3QKRA 3R8CA 1X1SA 5LZ7A 3ZQ6A 1GYRA 1ONPA 1UBMS 1W2GA 3NP9A 4BHTA 3I5MA 2ZUEA 4EKEA 5TRTA 1WW2A 2OXFA 2RJNA 3DEIA 3N3AC 2QZSA 2JJ8A 4RMNA 4RM2A 3I1JA 2JDID 3W4KA 4HFJA 1X94A 1C9MA 2ZRIA 3B60A 4XCVA 4IIBA 3H9CA 4IIEA 4QXPA 3CF0A 2GD2A 3TVYA 1E62A 3I6MA 5FBVB 2CT8A 2AMVA 3NHMA 4PHFA 1U7UA 3H04A 3K70B 1EG7A 1TE2A 2YJ3A 4QOEA 3RC8A 3UVEA 4RVFA 2WTUA 2E9SA 2WIKA 1EP9A 1Z22A 1QVZA 1J07A 3G13A 4JGIA 2FVXA 1QUFA 4G0ZA 2G36A 1Z0UA 4NE7A 3K9FC 4IFIA 4EYQA 1EINA 4N8EA 1Z0ZA 1QQ5A 1QIDA 2CYBA 1FP6A 2NZYA 3GFTA 3H2IA 3SF8A 4BVBA 5BW4A 2ZSUA 3DLCA 4I50F 3LQKA 5K45A 2JGFA 3LD9A 3CT4A 3COPA 5IVIA 3TDKA 6LDHA 1T8PA 4ZAYA 4UAGA 3SIXA 3GY0A 1SH7A 3CM0A 4JOCA 4QFBA 1FX1A 1Z75A 4ER5A 1ISFA 3DE5X 3MRTA 2WHYA 3CEHA 3MAAC 4ZAXA 5GJBA 5CVTA 4ZO6A 2PX6A 5ED4A 4JNCA 4C05A 8AT1A 3B5JA 3MT9A 3C24A 2IPMA 1QBKC 1HTBA 4NJMA 4Q4AA 5KCZA 1NXTA 1ZDMA 1ZP6A 2GESA 2HJRA 1SR8A 2O1WA 2V7XA 3C3KA 3VHXA 2BR3A 4I8XA 1E9FA 2QS9A 2H4FA 2Y1OA 1L5OA 3N6RA 3WOHA 3QHQA 2AE1A 2YZ2A 2DTDA 5E8RA 3H16A 4AJHA 1UINA 4PLYA 5T67A 1NI4A 3AB8A 2GZ2A 1I30A 1WTCA 3BGDA 3CZCA 3TNLA 1SUBA 3P9KA 4ZYVA 4J29A 3ZHTA 2RHGB 4EARA 2PUCA 3GXBA 5JQGB 3FTEA 4TKUB 2R4UA 3VV2A 2GYYA 1E3WA 3EPPA 3K73O 4FD3A 2GI4A 1SUWA 3S55A 1T91A 5EXSA 3MWLA 3V1YA 8ABPA 4LX8A 3EVZA 4CLRB 1BRTA 2ADOA 1GFSA 1MQ9A 2BKLA 2B20A 1RACA 3ZZNA 3JQQA 3LUJA 5L51A 4ES6A 1TMKA 1YB5A 1MX3A 2A35A 3HXLA 5DBHX 2QG9A 4TQ9A 1B8NA 2C9BA 3OOEA 3D6VA 2O50A 1UODA 3FZYA 4BX3A 1T2AA 3L7CA 1UR5A 3ZHQA 4W9NA 3W8FA 2RHRA 1AQLA 1OTXA 3TNDA 4IHJB 4A26A 1UJ6A 4BVLA 3BIOA 4GYKA 4DF3A 1QRDA 1OGIA 1I1HA 1QIGA 2RH4A 2I55A 3PDWA 4LE2A 1DUSA 3E2IA 1ZS9A 1T1GA 1ULAA 1O4WA 5KNBD 1UZMA 3EIOA 3RQSA 4AD8A 4LYDA 5J4HA 1M1YB 1NXVA 1WTAA 1FLNA 2C99A 3WYGA 2X7JA 4JI5B 3VR2D 2H9YA 3Q9LA 2G72A 3ZW7A 3GWGA 1KKMA 4URWR 2IA5A 4OI2A 2A5FA 2CE2X 4GZ3A 4LCJA 7MDHA 2OV6A 3L4BC 1ODIA 3RWOA 1J22A 1FFSA 1UWVA 4HH0A 4PZYA 1AKYA 5AVVA 2QORA 2GBFA 2WUGA 3OBBA 2H5EA 4J6EA 1H2WA 3TQTA 1ZD9A 2I71A 3LDUA 3QX7A 4IJUA 3QE4A 2Y9PB 1DXOA 3VHRA 4UMFA 4FDUA 1U81A 5BMOA 2EJCA 3Q10A 1JWLA 2XTMA 4NF2A 1YBVA 4P58A 4CCSA 3QXXA 1TQ8A 4MJLA 2YYAA 3GVXA 1DWPA 5A02A 2GEKA 4JI3B 4JVSB 1Y8ZA 1JJAA 1X9HA 3H3XA 3ISTA 3WZMA 5CUQA 2A67A 5FHRA 1R4AA 4DV4B 4UHCA 3BWBA 4BNDB 1MN6A 4ENQA 2UAGA 2O1XA 2C4MA 2AXEA 4NJEB 3RAPR 4D2IA 1F9EA 1P5HA 5BWCA 3GZNA 4DB2A 2ZWIA 3K0BA 4OV6B 5LM3A 1FC0A 1WXDA 1FTNA 3R7WB 4UQLA 4YJGB 4ZRMA 3UWPA 2I03A 3V32A 3LL4A 1MH9A 1M1UA 4TROA 3T94A 5JADA 3T1HB 2E49A 1Z6TA 1O96A 4OJMX 1E1CA 5E4FA 3VMMA 1LBQA 4B8YA 1BQEA 2XQJA 5CB4A 2YIVX 1A8UA 3FWNA 3JW8A 3LC2O 1PJ4A 3FPGA 4NCKA 4A3SA 4BKQA 1E3TA 4IVRA 2B1IA 3KP1A 4NYIQ 4R7ZA 3PQFA 3HRKA 1UKBA 1QK3A 1XF9A 4Q12A 4Q4JA 2A0FA 3RE1A 4FGWA 4ZCMA 2QT9A 1V47A 3ENWA 1PYOA 2FFQA 4ZQCB 4UTVA 1QIJA 1ISHA 3WGNA 1X13A 2ZZMA 5L3RA 4IIDA 3AEUA 3IO3A 1NLZA 1T8RA 3IUSA 3SIWA 2O19A 3NKVA 3GP3A 1TLLA 2H85A 2HNAA 5J4KA 1EP3B 1N4DA 3EMDA 3SSMA 2B0CA 4ERXA 3QEMB 5JY1A 3DBRA 1HL7A 2ATCA 2GF0A 2JI4A 1JG2A 1TVKA 1DBQA 1UJBA 3NBMA 4CL8A 2EG5A 2VDJA 4LYEA 1Y8QA 3SD7A 4EVSA 4B8ZA 3T3NA 1DC5A 5CT8A 5LMUB 2QN1A 5BN5B 4R9SA 4OHZA 2WKQA 1LI7A 3P9CA 1KI2A 1UBGA 1JX6A 1JFFB 4L5CA 1EA7A 5IULC 3PX3A 4K6KA 4DOMA 3FCSB 4AO6A 1VHDA 3LXXA 3T35A 1NVDA 4XPIB 3ESXA 1ZD3A 1JZTA 3FHCB 4G4SP 4JMPA 4OSEA 1NX6A 4Y9RA 2C7VA 3PFKA 5AI6A 1B6RA 3KDAA 3WMEA 2C78A 1PT8A 2C5SA 3I9OA 1CETA 2NU8B 1YA6A 1P1BA 1DKRA 1MJNA 2F4NA 1TIBA 5IVDA 3THSA 1KEWA 1DIRA 4TUYB 4GRAA 1MR3F 2OVFA 2A58A 4G0WA 2JD0A 1NC3A 3AR2A 4C30A 3L0SA 2I7DA 4Q01A 4U7PB 2XJ9A 3CU5A 4M7PA 3TLYA 3QI7A 1KVSA 1SZJG 3PD7A 1MAWA 2WJ3A 5JD3A 2OO5A 4TWIA 5GY7A 4M0PA 1YACA 2CC2A 2CV0A 1MXHA 5AKLA 2YJ5A 4WQMA 4YA6A 4ISBA 4EEXA 2GJ8A 5BQXA 1BJKA 7AT1A 3T06B 3B7GA 4MJXA 3GLGA 1XXHB 1Z7BA 2P77A 4IHQA 2ISCA 4Q0MA 1PFKA 1HL3A 3EGEA 3A3OA 3G0BA 3LNTA 1W73A 1Z73A 1QGUB 1CJTC 5J4VA 5DLPA 1P9RA 2Q4RA 1PEAA 5LIRA 4Q4LA 5K6TA 1XX6A 3BILA 3O1LA 3SZGA 3U6KA 2OYSA 1WMDA 3EXFA 1MRSA 3KOOA 5ITSA 2DLCX 3ULKA 2OYRA 3HCDA 1MO4A 1ZD2P 3ZU4A 4NRDA 1CUFA 3MUFA 4GYYA 4B7AA 7GPBA 2FR8A 5HFAA 5DHUA 4KZKA 2HF9A 3Q9UA 4LY0A 2W9XA 5ALGA 3CZRA 2ERYA 1IXZA 4CMHA 2Z3ZA 1K9SA 4CQLA 1A27A 2K2WA 3LQ4A 2IZ5A 4YJ2B 4YMLA 5F2KA 3ZWKA 2FDRA 4R2MA 5EJFA 1J8VA 2R8PA 1Y6FA 2GK6A 4J7XA 1C7RA 1B4DA 1U6KA 2W2XA 1PK8A 1Y3AA 1F0YA 2IOQA 4U9UA 1GV1A 4Q24A 5IBPA 4RDXA 1YD7A 2XH8A 4L5AA 1MVLA 4BCCA 1DG9A 2V7UA 3D3KA 1W87A 5A6VA 2IYOA 1CEYA 1E5TA 1LV8A 4XQCA 2HPAA 1G8HA 3CH4B 5G1NA 5C9ZA 1JYSA 4KZPA 5HKKD 3KOWA 1FP7A 2V7PA 2XNJA 3MW8A 3EC2A 5AKGA 4TL8A 2IITA 5DYIA 2QWXA 3HR7A 4W5WA 5IX8A 3HY6A 5EA2A 4HDSA 3D7MA 3UJPA 3DL4A 3RIHA 4E2XA 3UGTA 5CLJA 3ML1A 2IEYA 1EGAA 2Q9UA 1JAIA 1KK1A 3ED5A 1L6RA 3FVWA 3KU1A 3PGMA 3QK7A 2P9FA 4J0DA 3R3ZA 2YH2A 2NO6A 4IDFA 3Q85A 5EESA 3ZQKA 4C6RA 6REQB 3ID6C 3ENZA 3O1HB 5EIFA 1E9BA 4A0FA 3W4IA 5JAPA 3WZ2A 5IF9A 2YN0A 4V1CI 1QIEA 5BR8B 4BO6A 4EHHA 3OTHA 4I4NA 1F06A 2VNKA 4GOXA 2CXHA 1I10A 2JFYA 3KKPA 1ANKA 4IX9A 4A8JB 2C7PA 2TMDA 3RC2A 1P1HA 1V6AA 1VM6A 1SXJE 3NTVA 1L7VC 2UUAB 5IG2A 4FE4A 1TEVA 2IV2X 4HFNA 4RXMA 2YXEA 1AKNA 2E37A 3AHHA 3M6IA 2QUIA 5A4MS 1Z26A 3I64A 1U11A 2H1CA 4R9UC 4WKBA 2EARA 4MI1A 1CUBA 1IY0A 1REQA 2OUKA 1KAHA 3W2TA 2C7RA 3ZPXA 2PUFA 4XVHA 2VRCD 1OGJA 1QJCA 3Q7PA 2FRDA 4XYGA 2CVHA 5LOVA 3VA7A 2VT6A 1U28A 5ELLA 3PGKA 1A9XA 5DCUA 3DAGA 3MJSA 2GHTA 4UM5A 1ZD4A 4X3CA 1XZPA 5IH3A 3OTOB 3DV2A 4N0MA 1PT6A 1S2OA 3CE9A 5KYYB 4Q3DA 3SJZA 3WYDA 2OKGA 4DAOA 3DULA 2EW8A 5KC8A 1TEXA 2J9GA 1ODKA 2XGSA 1ULSA 4OAPA 4S12A 4OKNA 3ZKAA 4EEKA 3PEWA 3OA0A 3X44A 3SHWA 1OX6A 1LSUA 4KN9S 4HVLA 1L4FA 1Y7LA 5TQ0B 1M66A 2CVFA 3AUAA 2HHLA 2XIJA 2PZJA 1PD0A 1OXUA 3G9QA 3G6WA 3HJTA 3LVRE 3PUZA 5EZYF 5C18A 4OG2A 1CDZA 1O5TA 2DULA 1H2BA 4QZVA 3TECE 1W47A 3B82A 2OCYC 4QNMA 2BP7B 2G67A 3C41J 3IX7A 2CJWB 1PCXA 2GEBA 4IJKA 2EZUA 4LDAA 4X95A 5FNVA 1IY2A 5E0OA 1QYDA 4F1JA 5JDIA 2C9ZA 1Y37A 1USGA 5DCYA 4RH1A 2QX4A 2YNMD 3H9JA 3M89A 3ZTWA 5A2GA 3I0NA 4BX8A 1JEEA 2RONA 4JLAA 1G0NA 1I01A 3B1WA 4BVEA 5TQVA 4D4JA 1G55A 1P39A 2IUFA 4I4TB 4UHJA 3VR6H 2PZAA 3KQMA 5BOSB 1I5OA 2GILA 2OFPA 5LJLA 4B47A 2XPCA 4XCXA 4TV8B 1JQKA 1P61B 2CMGA 3QVTA 1EBFA 3VO8A 4N5IX 5JOQA 3IP6A 2GLTA 2PUJA 4C4SA 2WR8A 2BJHA 3VAYA 2GOYA 4S35A 4KK4A 3GW8A 4E2ZA 3HZHA 3N0XA 4QDOA 3TLAA 1X6VA 4B4DA 4Z7OB 4JXJA 3DCYA 1JQAA 2XDYA 5A7HA 1RKVA 4YGXB 4ROSA 4D8TA 1FLVA 4AKEA 3O31A 3VVLA 2OHXA 3TTTA 4OXNA 1M2GA 1L7DA 3SOPA 3T0GA 3W78A 3AF0A 4FOOA 4DA0A 3UHFA 5HJEA 2Q4OA 4J75A 2YWCA 3DTTA 3LW8A 2X1MA 1SIUA 2RGUA 1CLEA 4FFBB 5JJLA 4KGXA 1NW8A 2NYUA 4P80A 2VOJA 5FO0A 1WKBA 3ONNA 3QWFA 1HT2E 3OFKA 1ZRSA 3IMCA 2ERCA 4I81A 4D8YA 4EMUA 5C8VA 4KKVA 4S04A 1RAGA 2RGRA 2ZYUX 1YIDA 3LDHA 2C8KA 1UOEA 5AH0A 4JQZA 5FOXA 4AZ0B 2OGUA 1T6YA 3U44B 5U4QA 4E14A 4ZDKA 2ETVA 2X0KA 3CISA 1B14A 5K6RA 1N8KA 3KJFA 3TD6A 5CYOA 4TTSA 1G5TA 2DQYA 4HAWA 2DFDA 4J90A 1V1RA 1DIGA 4MITA 3QE2A 4MP6A 3TYXA 4WK2B 4YMVA 1GNPA 2FN7A 4MQ6A 1QHYA 4MR9B 4Y9TA 4ZI7F 1G5IA 1M34A 4TLAA 2CDBA 2QVCA 3LYAA 3HO6A 1CT9A 3DR3A 4RF4A 4RS3A 4PAMA 3A4VA 4UXIA 5AW1A 2Q4DA 1U0EA 2JARA 3NWJA 2IU6A 1YR7A 1YVUA 3GFSA 2H54A 3BGVA 5GZ6A 5BMVF 4XB2A 4I4CA 1L5HB 4XTCS 3OKAA 4C87A 4DLXA 2Y0PA 4N76A 1VSBA 3G0HA 1D03A 3DEYX 2J0EA 2Z4TA 1TM1E 1XQXA 1IJEA 1OI4A 2EOAA 3AF2A 5LQCA 4ZALA 5KNLA 2ID9A 4C04A 4PNEA 1EXVA 1N5DA 4EOGA 3BXGA 4OBWA 2C82A 2W83A 3W05A 4RJTA 5CLFA 3R9IA 4ZI2A 2O3SA 2ZCVA 3L8YA 4FYXA 2PUDA 4XI9A 1ZZGA 3QMVA 5A4IS 2YOGA 3M5DA 3U7HB 4H16A 1J56A 3NEPX 3VR3A 4WKGA 4AP9A 3C6MA 4LWPA 3DAFA 4QPZA 2ZUVA 1KGDA 3HVHA 4ZO4A 3HUEA 4KIWA 2I6FA 3ZZUA 4K46A 1AO0A 3GK3A 1VLJA 1WIWA 1XBTA 4PE5B 1C7QA 3BC1A 3OICA 4J16C 3NORA 4I9NA 3N05A 1HZZA 4CNBA 5HXAA 3QBDA 2BR5A 5BSWA 1PZMA 1EFRD 1LVHA 1UMDB 2Z30A 3B6ZA 4L2IB 4LJSA 2A0KA 3ZJ5A 5CYFA 4LZJA 1H1LA 1GT91 2HHCA 1XUOA 4PPYA 5DE3A 2IPLA 4D9EA 4BNJA 3QLJA 4LJ4A 1RI5A 4KV9A 1YBHA 3UOGA 1ZU4A 3KUDA 2HPVA 4OM8A 4JUBA 4MGHA 1ZAYA 3NTUA 4R98A 1EUCA 2AVDA 2WIJA 3PICA 4DJFC 1MTZA 3VPCA 3TQFA 1A76A 5HE9A 4B6JA 2BE7A 4Z2AA 3OX4A 3H1BA 1H85A 2Q7DA 4FB5A 3IVAA 2QM3A 4KYUA 3QYAA 2GSWA 2X6QA 1JJFA 3NAQA 1NBAA 2R7MA 5H9WA 1K5PA 1QCZA 5KX5B 1ZK2A 3RUIA 1VHWA 5B1YA 2JHFA 1PX0A 2XB6A 1U3GA 5LN1A 5AJHA 1T36B 4R2KA 4S0XA 4E51A 3SYLA 1JIVA 1V7CA 1EUDB 1LDBA 4KQWA 1TI7A 4W99A 3CLRD 5B2ZA 5KVQA 1JBQA 1CUXA 3C8ZA 1F0KA 1KJ8A 4NH4A 2UUOA 1MB4A 2JLZA 2EW2A 4Q3BA 2CL0X 2IOHA 1C30B 2JKVA 3K8ZA 3QVXA 3S6JA 3TN7A 3ZGLA 2FFHA 2ZJZA 4CU5A 4YQZA 1KYVA 2CB0A 4B3GA 3HCWA 1OCEA 2FPRA 4RFSB 5FUMA 2RGAA 3AFGA 2W4QA 2GKOA 3B1ZA 3ILYA 1C8VB 3BXZA 5ECWA 3QYPA 9LDBA 3ROKA 2V55B 1GIAA 4YECA 1JPNA 4F4HA 1HX7A 3WSWA 3TR5A 1Z4OA 2XKJE 4BNYA 3Q1LA 2Y77A 2H06A 2GHRA 2I6SA 2HGSA 2AC7A 3LXMA 4NMHA 4LDJA 3NV9A 4MRMA 3NANA 3AVUA 5G40A 2JKYA 1JWBB 2NO1A 4GWLA 4YP0A 5HVNA 5K0BA 3Q2KA 3QJYA 1ZIXA 4R1LA 4KIGA 4CIXA 1XD2A 2QP3A 1A4XA 3PC2A 5IAEA 3Q7QA 4PYRA 1OC2A 3DZJA 3GRCA 3HLKA 3VI3B 3CVUA 3CWZA 1UPXA 1BNCA 1EWVA 2VZ9A 3O4VA 4BU0A 4E4RA 5IYZB 2OCPA 3NPAA 4B9AA 1LVGA 1TZJA 1W9MA 3Q4GA 4NBLA 1Y3BE 3QKSB 1ZN7A 4RVDA 4BWVA 4DUPA 3NHYA 5BV2P 1O5IA 4QXOA 1KAMA 4P4SB 1YCFA 1L8OA 2PNJA 3ACBA 4R3UC 3C6YA 3B9BA 4JYPA 2YICA 3ZUPA 1XB2A 3CN9A 1WXXA 1PWHA 4O4LA 1KDRA 1E4VA 4MRPA 2Y71A 1VJ1A 4XW2A 4FZ5A 3LCRA 5HKOA 5AVQA 1BVYF 1Z0SA 3W2EA 3RK0A 3HKBB 1T35A 3H65A 3H2BA 2P7IA 3S2SA 1S0UA 1V1MB 2EEZA 3PC7A 4MVYA 4WERA 1ULTA 3GU3A 1IM5A 1FK8A 2D2FA 4KN8A 4JVLA 5DSXA 5LUAA 3MCAA 1C0IA 4C7OA 2Z08A 1YUNA 4HBZA 4D4GA 1MJFA 3DBIA 4G5RA 2YVUA 3FCUB 4B43A 3QNUA 4D43A 4YFVA 4Q9AA 2CF6A 1R74A 3AFMA 5A9SA 2P7HA 2C97A 2Q0SA 3HNRA 1TAHA 3GLHB 3HJCA 4EBBA 3Q6IA 4XJXA 2ZR9A 1MV8A 4MCHA 5A0FA 1HRKA 2G9VA 4HH4A 4N82A 4OHKA 5FA6A 2V6GA 1FOEB 5JAOA 3KPWA 1JIKA 2BT4A 4BNGA 3EA4A 4D97A 4L5BA 2JFZA 3O26A 2GA9A 4U7HA 4TS4A 4YCMA 2PX2A 3RSQA 1GNQA 2AOTA 1AY0A 5DHSA 3SBXA 4CZ2A 2FZ4A 3FTNA 3PKJA 4DSUA 4CTOA 1GQOA 1AHPA 1RRFA 3LRTA 5ADUS 1RLIA 3G8CA 4WZBA 2CNBA 2J09A 2JCSA 4TV9F 4Y3UA 3RVNA 4IY1A 4EX6A 5AXCA 1E4EB 1K08A 1E60A 3E2MA 5GV7A 4UQPA 5CA0A 4PC6A 1KRXA 2GKSA 1DUIA 4ZEXA 5AVUA 2HREA 3M5CA 1SU4A 1O77A 2HTFA 2LRHA 2FF7A 3U6BA 4S05A 3MOIA 1WBBA 3BB4A 3GB9A 1EZ4A 3IR5A 5LPNA 1IHPA 2DOKA 2EKBA 4OO3A 4PO9A 3WHKA 1BJTA 2RJ3A 3H1FA 2RAUA 3L0CA 3CONA 3NHPA 3RYCA 1D0IA 1MXFA 1JI0A 4MULA 1EQ2A 4IKEA 5CXSA 5K0LA 3WLFA 3SIPA 5MN5A 2ZYVX 3ICPA 3WZLA 1YVEI 2XGJA 3T5AA 4HAYA 1AA6A 4YYEA 1IM8A 1KDYA 1QLJA 2VT7A 1K3TA 4KSBA 3W5HA 3UJNA 1JL3A 1E2IA 2QLFA 3AFHA 4QT0A 5KMGB 1ACMA 5G0WA 5C3MA 1PEYA 4ILEA 1S2NA 4F12A 3PV0A 4AZSA 2ZRJA 5B3JA 4BJ1A 2HSEA 3K09A 4Y2RA 1QAMA 3VR0A 2GTHA 3HA2A 4C3OB 4WOJA 1YC5A 5HS4A 4IGIA 4YBRA 2JI8A 4Z7JA 2V7BA 3LT0A 2K5UA 1O1YA 4Y1GA 1O5OA 4R2WA 2AR7A 3WB9A 2FPGA 5DXJA 2CVQA 3L06A 4MPDA 5AW5A 4CKWA 3OZVA 4YAFA 5LQAA 2P9CA 3KLMX 4FFRA 1Z5GA 4NDNE 2WSLA 2YZMA 4KQFA 3DZCA 4MUIA 4HDRB 4BNWA 4GPIB 3D2CA 5JPIA 4RK5A 1Y81A 1N6PA 1YUMA 1J23A 2CZGA 3SQMA 4UE2A 5CDTA 2BPOA 3PIDA 4NENA 3GAZA 4LMAA 4NOLA 2PSFA 2YV5A 1TO2E 1U4SA 2JCGA 5I3CA 2PVSA 3RT7A 3VKGA 3KV1A 3C3JA 3RAEC 3QYJA 2B8EA 3BCSA 2Q5IA 2WC1A 1N9GA 2ZYDA 4HDKA 1E3DA 1OXTA 3AW8A 3EYWA 1N5IA 4RY2A 4ZVNA 1GU1A 1GCAA 1K5DA 1RJDA 3NDBB 4CGZA 3SEQA 2YW9A 3T9FA 3HR4A 2PR2A 3BE6A 1KDOA 2HXSA 2WD8A 5ILQA 2E18A 3RH0A 3UFXA 1Z4KA 2QRVA 3INRA 3L0IB 3RNLA 2AEEA 1D2GA 4JZKA 1N2HA 3G9TA 4Q9NA 5KDDA 5AXBA 1R6UA 3TCKA 3MBKA 1WPRA 3ROPA 4RPGA 3W2FA 2IBMA 3N7AA 2L18A 2RB4A 1QP8A 5HJ2A 3VR4A 4C6TB 2AN1A 1UL1X 1RI2A 3CR8A 3FNFA 1TUIA 3GZJA 2IV3A 2R47A 3LECA 3VYUB 1V7PC 1X9GA 4BTEA 2GJ9A 3ONWA 3EXAA 5ESXA 2I29A 2ZRKA 5AD1A 3NETA 4OXQA 5EUBA 3AYZB 3KZKA 5AJYA 2W70A 5EPUA 2C7GA 1T34A 4CODB 1WZEA 4Z9XA 1VE5A 5KNDD 3AIMA 4HADA 2VHQA 5FI1B 5G1OA 5B4TA 4YDHB 3HGTA 4EHNA 3QOFA 4KH0A 1UJNA 2NU7B 1KDZA 3PUWA 1U0TA 3K2BA 2HJHA 1WF6A 2AHOA 3DMNA 1CD5A 3A6GA 3M1LA 1XKLA 4Y2PA 1NP3A 5CR9A 3PFGA 1G3UA 1GQ2A 1TXGA 4Z1OA 1ZUIA 3G8AA 4GE0A 1NF8A 2I2FA 3PQ3A 4P5DA 5GP1A 2BSXA 2CYAA 1K8ZB 1UOOA 2MYNA 3RR2A 2I1VB 4GX0A 3N2ZB 4B40A 3EIFA 3WGMA 4CQNA 4QXRA 3TTUA 3HFRA 1JAYA 3K6JA 4HNAA 4FGLA 5H68A 4Z4QA 4OBEA 4AW9A 1JHAA 1DE0A 4NLLA 4GEGA 4NXNB 1L7EA 5DYNA 3JPWA 3W9SA 1JYEA 1R6AA 2F43A 4MUBA 5ELMA 2VJCA 2ZE8A 4B5KA 3JRWA 1VSTA 2N0SA 2IYUA 4EO4A 5EP1A 1SKAA 1Z35A 2AWOA 5CU7A 1EX1A 2OG2A 3U4DA 4RC9A 3BIFA 4QJ4A 4Z5XA 3OFJA 3RVDA 2RCYA 3OFVA 4GUDA 4J0CA 1NBOA 3GPBA 3OT5A 3R0IA 3BSFA 1S6YA 3LBHA 4G0OA 2XXJA 1ADGA 2CLFB 4UASA 3FWKA 1Z0DA 1BDBA 4QYWA 2XCOA 1WD5A 3UK2A 4CKXA 1EVYA 1Z2AA 1FYWA 2YFHA 4B3DA 5IJ0B 1PGOA 3LH5A 3MAGA 1C3OB 2AOUA 2EP7A 3B9RA 2Q41A 3GBPA 3B3QA 2XMQA 3MBOA 4GLFA 3SGLA 1XMQB 1WEHA 3STVA 4Z8XA 1UJ2A 2ZYTX 5E7JA 1JIXA 4D3XA 3QU2A 2FSGA 3PPWA 1MO5A 4L9SA 1ZC3A 3IJRA 3KV3O 3ZBPA 3H9GA 5FULA 1W35A 4Q21A 1Z8DA 5CPFA 1FQKA 2YN4A 3DO5A 4JLJA 1ZN8A 5SV2A 3H9UA 3E3MA 3K2QA 4UNRA 1B0AA 3EZGA 3R76A 4ARZA 3HCCA 4RSHA 3L46A 3T61A 2O3JA 3PI6A 4FGSA 5E9AA 2QEQA 3RGWS 1D2AA 1NF3A 1JT9A 2BFDB 3CFYA 1I5EA 1C0EA 1Q77A 3ISJA 4FWIB 4NNOA 5ETJA 5G02A 3R75A 1OPXA 1BDMA 4B48A 1Z4QA 3C15C 3BRQA 2QNBA 4JLOA 4H08A 3FTQA 2R8YA 2ZYWX 1UPCA 2B21A 3ORQA 3MTAA 4FC6A 4NS1A 4ZVOA 2WW8A 4AUEA 5ALPA 2O2HA 5DX8A 1MNQA 3HACA 4KBFA 3TLJA 4WCVA 4FMCF 4DWOA 5AP9A 4JGGA 1AU9A 3UEOA 4JBHA 2QGZA 4QRHA 2RCNA 4RDHA 3AKEA 3RGGA 1B42A 1ZM3A 3IGFA 1IZ0A 4EZIA 4PLZA 2QTBA 1IHOA 3CF4G 5L4NA 3PVSA 1NU6A 1A50B 3ANTA 3UN1A 4B3IA 5IZCA 4IQ0A 1MD9A 4W63A 1F4PA 1XZBA 2NLOA 4NV1A 3DE6X 2R1ZA 3H86A 3S8MA 4J8PA 3V7YA 3MOSA 8LDHA 4FSHA 4N5HX 3U4QB 3RIYA 2F48A 3GCGA 5E38A 3U1TA 1GG2A 4K81B 3DZHA 5DW3A 3TJMA 4LDRA 3LHSA 1HG1A 3E7FA 3V3KA 5DYYA 1B6GA 1Y7PA 3D31A 2PA3A 5DGTA 3E81A 3DLPX 2HN9A 3BXXA 3IRUA 3MTBA 4EK9A 4UM9B 4GMKA 4CEHA 4AMVA 2XIQA 2B92A 2WT8A 3B1VA 4Q18A 4DJAA 3GLGE 1MOSA 1WHSA 4IH4A 3RVMA 2C2GA 2KX7A 2ZOSA 2BEJA 3UJDA 4DPKA 4WN9A 5IRCD 3EQ7A 3KR1A 3T4EA 5KQSA 3WG9A 3O4JA 1BGVA 1GPBA 1HQDA 2QTRA 5JAQA 1PK7A 4YIKA 2B69A 1Z34A 1H0RA 5IN5A 2ILTA 2VVTA 1RYBA 5F51A 3M9WA 2GYWA 2GVDC 1TMGE 1G3RA 1YB7A 1ZI9A 4CLHA 4DNQA 2RC6A 5CVDA 5I01A 4WKNA 2W22A 2IE0A 1JA9A 3FUVA 4EGFA 3F3KA 2F3TA 4DC1A 4TWBA 2J3KA 3K1JA 3MB8A 4IGAA 4TLLB 1OB2A 2QP4A 1SUPA 1ETUA 4J2OA 3KT0A 4D6YA 2GXUA 5BW5A 1U8EA 3VV3A 3UM9A 1P4SA 3MGGA 2NZXA 2A7QA 5JCZA 1E7QA 5AOBA 2GRAA 2P67A 3GNTA 1E2NA 3SYTA 2F3UA 2R9VA 3GEGA 2PWYA 3K0FA 3WB2A 3GRVA 3L4JA 4OMDA 4B6OA 4OHCA 2KW5A 4CV0A 4MDEA 4DREA 5JXIA 1E3LA 3DJFA 5F5XA 4PLPA 3T34A 3HVKA 5A5EA 4ND8A 2AOXA 4MWBA 2MSNA 4PU0A 3GROA 3PEVA 3ELWA 4KIUA 2LIVA 3H2ZA 4LJ9A 3WMFA 1DPFA 3NV7A 1RI3A 1IIRA 3R9KA 4F8EA 5D6OA 5EKSA 4MPPA 2C96A 1CG6A 2CUTA 5DV9A 2NU9B 3JAMA 2ECOA 3EHDA 4YAIA 2E82A 2F1KA 2PMDA 1XKXA 2PUVA 4BNUA 5EJ7A 3K0CC 5AYVA 1CXZA 4PSVA 4YAUA 4ENVA 4N5DA 1VLQA 5ALUA 1MDFA 4MGEA 1R4MA 2SCUA 3MWYW 1NJ1A 4QFCA 4B3SB 5BQOA 4UEJA 3ICEA 1C1DA 1X1BA 2WPDA 3LIIA 4MV0A 3MS2A 4XSVA 1HSZA 3WL3A 5ADWA 1TNDA 3FTFA 1IJFA 3KUCA 1ACJA 3BH6A 4M55A 2YVKA 2JLXA 3KX2A 4P7FA 5GJVC 2QBYB 1M8GA 1TYCA 1VJRA 4DQUA 1QGDA 2J5BA 5L3ZA 1VDZA 1VSUA 3ACCA 4PCLA 4ZC1A 3E9ZA 3TBHA 3VH2A 3RAJA 3OKFA 1AGNA 4OD0A 4D46A 2QYHA 1C1YA 3M1AA 4O2BA 2D06A 3C5HA 4AULA 4E5VA 1EFDN 3VDMA 5L3VA 3EYAA 4EL5A 4LOJA 3HBLA 4FFMA 3PU6A 3GLFE 5IUJC 4F6RB 5F9MA 2DU8A 3VO9A 3VPFA 2HK8A 3RBXA 1X77A 5TARA 1L0BA 4DZZA 4WRRA 4FIDA 3HGQA 4Z51A 1WCV1 1LBEA 1PR4A 5KAMA 1EXMA 3NBYC 1RYNA 2FMUA 2OPBA 3ILXA 4JKIA 4DMFA 6GPBA 3HYLA 4LF7B 4KE6A 2FOLA 1JSXA 1KGSA 3FKJA 5IMBA 3IBCA 3FAZA 1CUJA 4NCXA 2X8WA 3LTNC 4RGYA 1S7CA 4C06A 2GARA 4EVRA 5I3ZA 1CRLA 1DJOA 1KBZA 4RELA 4B4VA 1LBHA 2EU8A 5JMPA 4FNMA 2VEDA 1R27A 5BNIA 3GNQA 5DYTA 5EE0A 4NAHA 1TEHA 3QOYA 5AOAA 1Q83A 5ENDA 3FNRA 4CQMB 3N8IA 3V7WA 2R00A 3E70C 4UCQA 1R0SA 2YASA 2YXLA 5FEMA 2WSIA 1UPTA 4YK7A 1KQ3A 4NCBA 4GOND 1N32B 2GLXA 2HZ7A 1R0LA 3TFQA 3OCCA 4GSKA 2E85A 1PG5A 2B1RA 4RA9A 4JS0A 4QGSA 2P4QA 2ZRDA 2C00A 3O91A 3OECA 4UUBA 4GKBA 3P2YA 3EZ6A 4MA4A 1P7YA 2BF4A 2GN9A 4J91A 1A8SA 5KQPA 3AB7A 2E1RA 3AUJB 4AJ1A 3OA2A 4QPNA 3PX7A 5HA5A 4AY3A 2XVAA 4DRXB 4B3MB 3JQ7A 2FJUA 2BFFB 2VQDA 3U3XA 3NONA 1NR1A 1RIIA 1YTLA 3HSSA 4L3WA 3UKOA 3ZDQA 1QS0A 5K8VA 3AFNA 4FYKA 3Q5DA 1FVXA 2QRUA 2WDPA 3KJIA 1RM5A 3L9WA 4O4HA 1B7GO 5CXUA 3K94A 1XDBA 4DTCA 2B4QA 2FFBA 1ESEA 3WQQA 3HK2A 3VU9A 4CL3A 3R7FA 1IHYA 2O2GA 3EVEA 3I12A 1RAFA 4AIIA 2PCJA 1RRGA 4MGYR 4RW0A 5EINA 4ENRA 4G0VA 3WHPA 4XM1A 1WKCA 3CCCA 1M6WA 4TMFA 4NCNA 4BJ5A 3FPCA 4LVOA 3D3JA 3ZW8A 2X58A 1E0SA 3BFXA 3M4NA 4WLNA 3TSYA 4A36A 4C07A 2ZBRA 3T7DA 1M67A 2AG5A 2FPPB 3CLUD 1W581 2GJ4A 4CFZA 4CM9A 2FNAA 2CGEA 3WI7A 3KZOA 1CIJA 1SD2A 4K8OA 1YK1A 1N1EA 2O8CB 1JIUA 1FDVA 4YJFA 1IN5A 5K3DA 5TT0A 5ITZA 5KWVA 2PRYA 5CT5A 3TTWA 2LXNA 5DTJA 2J6HA 3HUDA 1M74A 3MINB 1KNXA 5FFMA 1CIVA 1LDYA 3HYRA 4QIHA 2GBLC 3OF3A 4XR4A 1O94A 2RGYA 1QP7A 1XFDA 3L01A 1WXIA 2AZTA 4O59O 3KALA 2NUTB 1R0XA 4N65A 1SU8A 1IHUA 4KR3A 2G4VA 5LMZA 3QJGA 1WMAA 3C4VA 1C9YA 4PXYA 2X6RA 4PZ9A 4BQPA 3TLMA 3ED1A 2QUAA 3R9XA 1M34E 3QVOA 3JZIA 4O4IA 1XDZA 3EULA 5KYTA 3CT6A 1QO9A 2W6QA 1V9LA 2RE8A 1XTQA 1DAOA 4ID3A 1RHJA 2QL6A 4QTXA 4C7BA 3DKRA 1VSVA 2UZ3A 4NYJQ 4UHBA 3C7DB 4MQLA 2O5RA 1PTJA 4NH0A 1DKMA 4BX0A 2X3UA 3AVXA 1UZUA 4DLVA 2BBSA 3R0VA 5K8CA 4MYSA 4REMA 2QE6A 2BHSA 1SCKA 3IAUA 1XV5A 1OLSA