1XAHA

Crystal structure of staphlyococcus aureus 3-dehydroquinate synthase (dhqs) in complex with zn2+ and nad+
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
352
structure length
323
Chain Sequence
b'MKLQTTYPSNNYPIYVEHGAIKYIGTYLNQFDQSFLLIDEYVNQYFANKFDNVHKVIIPAGEKTKTFEQYQETLEYILSHHVTRNTAIIAVGGGATGDFAGFVAATLLRGVHFIQVPTTILAHDSSVGGKVGINSKQGKNLIGAFYRPTAVIYDLDFLKTLPFKQILSGYAEVYKHALLNGESATQDIEQHFKDREILQSLNGMDKYIAKGIETKLDIVVADEKEQGVRKFLNLGHTFGHAVEYYHKIPHGHAVMVGIIYQFIVANALFDSKHDISHYIQYLIQLGYPLDGVQMVLMRQFGDIVVQHVDQLTLQHACEQLKTY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinate synthase
publication title Comparison of ligand induced conformational changes and domain closure mechanisms, between prokaryotic and eukaryotic dehydroquinate synthases.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Lyase
total genus 124
structure length 323
sequence length 352
chains with identical sequence B
ec nomenclature ec 4.2.3.4: 3-dehydroquinate synthase.
pdb deposition date 2004-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01761 DHQ_synthase 3-dehydroquinate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1090.10 Mainly Alpha Up-down Bundle Dehydroquinate synthase-like, alpha domain Dehydroquinate synthase-like - alpha domain 1xahA02
3.40.50.1970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xahA01
3CLHA 1NVAA 1XAJA 1NUAA 3OX4A 4RFLA 1XAGA 1OJ7A 1NRXA 4MCAA 2D2XA 1NVEA 1XAIA 1O2DA 1KQ3A 3IV7A 5FB3A 1JQAA 3BFJA 2BL4A 1RRMA 1XALA 4P53A 1NVDA 3QBDA 3ZDRA 3JZDA 5EKSA 1JQ5A 3CE9A 1JPUA 1XAHA 3ZOKA 3HL0A 1NR5A 4RGVA 4FR2A 3OWOA 1DQSA 3UHJA 1SG6A 3QBEA 1VLJA 3OKFA 5BR4A 3RF7A 1UJNA 2BI4A 5HVNA 1VHDA 5K8CA 4QGSA 1NVBA 1TA9A 2GRUA 3W5SA 1NVFA 4RGQA
chains in the Genus database with same CATH superfamily
1P7YA 1J9GA 4PGMA 5U4QA 3R9KA 2GVZC 2WT4A 4RTRA 3JR7A 1PK8A 5F77A 1T36A 1ZXLA 3LHDA 3L7AA 2ZYAA 4QICA 4GNRA 1UFOA 2VCHA 3QMPA 3E5NA 3WIVA 5IH7A 3OE4A 1O0BA 1SBYA 1VTKA 2PHZA 3S5UA 3SQXA 1YFZA 1ZIDA 4R7GA 1R5BA 2NAFA 2NO9A 2Z95A 3WJ2A 3EGOA 3VI4B 2NTJA 4AZ3B 3MERA 5ICGA 4EI7A 3IB6A 5B37A 2XECA 5H70A 2BEKA 3RPEA 1IHXA 1LSOA 1S8NA 2GNPA 5ENZA 5IKEA 3I62A 1USIA 2B4QA 3NDJA 5EE0A 1SCIA 4DMMA 1NPDA 2R7AA 1N6HA 3OSUA 5ALIA 3FSGA 2ZRPA 4BNGA 2WFMA 4KV9A 4CUJA 4DPLA 3QEJA 4Y98A 3ETHA 1QHEA 3SZRA 2LUOA 3CKYA 4K46A 4UTVA 1V16A 3WNBA 5CT6A 3FCYA 5HDQA 3S55A 3HLYA 2NZVG 1TLFA 2FR0A 3JQ7A 1ZM9A 5HBRA 3A9VA 2FPMA 5LJIA 1KPIA 4HQKA 4WXHA 4RH1A 4MIEA 1ZMTA 2HPZA 2DFDA 1X1TA 3GB9A 3BGIA 1PSWA 2L69A 5JVDF 2HHAA 4Q7JB 4OBBA 4FEGA 3P27A 2VTEA 4CDMA 2CVZA 2M1ZA 4LHYA 4QQ8A 1T9DA 3PB3A 3T99A 1QFJA 1WB6A 3OTIA 1WLYA 5EMLA 1KK0A 1YZVA 4M99A 1E3SA 1D7AA 2JJYA 1CQXA 5TMBA 1YQEA 1HDCA 1CLUA 4YYEA 5A4IS 5JHHB 3KAJA 1ULSA 2HF9A 4RACA 2NSJA 5KTMA 3GPIA 4YGXB 2ZIWB 4TWJA 3EQ7A 1JIQA 3LL4A 1HYEA 3ZDYB 1L5WA 4OD0A 1JHAA 2A1UA 4CLHA 4WHMA 4IXDA 1QMPA 4S1PA 2X40A 4EMUA 3FWHA 2PSSA 3LC7O 4GX5A 2XYPA 1JKXA 1NSYA 1TU3A 3MRTA 3G88A 2IS6A 1A8HA 1FRZA 5ENDA 3A2NA 3FW1A 3EDMA 3P0JA 5JFTA 1CQJB 4F5DA 3EWAA 2H92A 1OI3A 2FF7A 4KXYA 3SC4A 4RY8A 5FWXA 1OFHA 3IAEA 4AURA 3OD1A 3QWFA 4FFNA 4J75A 1I4EB 4AJ1A 5FLKA 5IJ0B 4GKAA 2IGBA 4BMDA 1TJPB 3ZVRA 1NZFA 1OLXB 1CUHA 4C0JA 5AI0A 3UAGA 4E2YA 4RA9A 2Z2XA 1Y9AA 2AMVA 2H2IA 2IPXA 3E35A 4MR8A 3SHOA 4EIWA 2PYDA 2QRMA 1PW7A 3EJWA 1J39A 4CCSA 1DC7A 1T9GR 1WDTA 1ZW1A 1HKHA 3RRBA 2AG6A 4JEHA 4EX7A 1KR5A 1NLMA 2VJCA 1I2CA 3FLEA 2R1VB 5K4AA 2WU1A 4EZEA 5TXGA 4RTPA 1WDMA 2PH5A 1AY0A 1XA4A 2QS9A 2YY6A 3FB4A 4IJVA 1IZ9A 1MH9A 2UVPB 3DHYA 3O94A 3VUEA 5EP4A 2GUGA 5UKDA 1U2TA 1HTWA 4YP0A 2BZSA 1V6CA 1YQXA 3TQCA 3CUVA 2QE7D 4LHWA 3TXAA 4DZTA 5T67A 1QPZA 1MZPA 1L7RA 5M7EA 2ODBA 1KBZA 2VK2A 3ZH2A 1OCEA 2PS0A 2YVQA 3N3BC 1A8UA 2Q3CA 3FCEA 2CUNA 3ROXA 4GDFA 3PSAA 3QY9A 3VZCA 1JQEA 1M74A 1QVVA 3DQZA 4JITA 1JH8A 1Y8RA 1VLJA 2JGFA 2W98A 2NT3A 3GYGA 3H97A 4ITUA 2VXOA 3R6DA 1GZUA 2YWDA 3G9UA 5K3OA 1PJ3A 4A2WA 4E70A 2WT9A 2PX4A 2VTDA 1AE1A 3NNDA 2V5UA 4OM7A 3WLQA 1T10A 4MCHA 3S2YA 4KWEA 3FUCA 3I73A 4OU5A 1AKQA 3RIEA 2O48X 1R0SA 5T4BA 1ML3A 1P0FA 2GD2A 1OBFO 2Q27A 2FWPA 3BSSA 3C6QA 3HJHA 3LCRA 3TPFA 2D7DA 4GKJB 2G5PA 4ZYUA 5DHUA 1DUSA 2PO7A 5A4FS 3WLIA 2W22A 4D9MA 3V4SA 1W6UA 3PQ3A 3AVPA 2QTBA 3IKJA 4KQKA 5BYBA 4YCAA 2VDMB 4ALIA 1A72A 3PLRA 3V33A 2JIDA 2WUGA 3RHFA 4AO7A 4J3FA 3DAPA 1X7XA 4LGCA 3ZHQA 2H08A 1V39A 2D5AA 3BRWD 1G17A 4OQLA 4EB8A 2Y1FA 4JQZA 3MD0A 1F9AA 1VG1A 1K5HA 1L5MA 4PBTA 4D9JA 4K6MA 3Q3CA 3GX1A 4MGKR 3T5GA 1U0TA 3O75A 3FM9A 3OSZA 4OXQA 2BZ0A 3V6LA 3J81k 4JD5A 3AETB 4NE7A 2WUWE 5ITZA 3H9EO 1ID1A 2XVMA 3U61B 3QVTA 3C97A 3JWIA 3NLLA 1RU3A 5L8VA 2ZAOA 2W6QA 2WICA 4LRWA 1E2UA 4MDYA 1DRVA 1KPHA 2Q07A 1ECLA 2NW6A 1K27A 2HXGA 2V74B 5AM1A 2EIXA 4EY6A 2IXAA 2YXPX 2QSZA 2Z5FA 2ZWMA 3K1AA 4RVGA 3ZTWA 3IT3A 4B83A 5K8CA 1IEVA 2J3EA 2XSZD 2P9JA 2O2SA 3FETA 3Q6NA 5F1PA 4CCAA 2REBA 1HT0A 1XQ9A 2RK6A 5SYNA 4BATA 3VNUA 1JTFA 3DXYA 1VCNA 2TMYA 2VAXA 5DJ5A 5E0OA 4DQUA 4CCYA 2ZJ5A 2CE7A 5LU9A 1IK4A 1YUMA 3IGFA 4KI0A 3OZFA 4YJGA 4BNIA 2CLCX 4LS3A 3GJ8A 2JCXA 1S9DA 1U1EA 3B8EA 1A9RA 5AHOA 1N5RA 4HDCA 1SURA 4RQTA 4Y0VA 3L07A 1HT3A 2QW0X 4RHEA 2DPMA 4AMVA 1W1IA 2F1IA 1AHHA 3MILA 3WJ1A 4HJRA 3NKFA 5HIIA 2PLAA 3LUGA 4Q7KA 2O8FA 4HQNA 4N4AA 3UN1A 1U1GA 1ZM4A 2ZR0A 3PA6A 1OE0A 3SM9A 5JAZA 2H00A 3N2KB 1E2NA 2VHTA 5JS1A 1TUBB 1Z47A 1KVUA 3R5FA 5DOVA 3G5MA 5EXXA 3RK4A 1ZU5A 2I3DA 4JH0A 4MVYA 3I28A 5IAGA 5FYQA 4GZLA 1DV1A 1FCJA 3JQGB 3QJYA 1BHQ1 2W6PA 3UMGA 2X42A 3WO1A 4C0KA 4D8WA 2Q3MA 5KVSA 3STYA 1V3TA 3UUGA 3IHWA 4FONA 4FT4A 3QWBA 3STTA 4BMVA 2FZCA 4HQ0A 1A8PA 4KYUA 4K2AA 1DC8A 4HOYA 2GHTA 4RABA 4PR3A 4Z5XA 3HVIA 4HGNA 1EK5A 4R40A 4CF6A 3RLIA 3ELYA 3RASA 3IAAA 2ZSJA 2PZEA 1JDVA 1RJWA 3C8HA 3BBPA 4K0KB 5B53A 1W1WA 4JJEA 4JSRA 4S1VA 2KX7A 4Z1MA 1GTVA 1KL7A 2ZUSA 3OTWA 1MC1A 3OKFA 1MP0A 2V7XA 1MUUA 3PKIA 5CX1A 4C4AA 1U0NA 1VBNA 1PJ8A 5ECYA 4JBIA 1KJNA 4MI9A 3SY8A 4WERA 1DMSA 3FHCB 1MA3A 2Q5HA 3Q7RA 4XWAA 4DR1B 4XFDA 1M2EA 1J99A 4WNYA 4MSUA 2MOKA 1IPEA 1QCZA 3MRXA 4LA4A 2RMKA 2ZVDA 5H59A 2QNBA 5EWMB 4NMHA 5LZ5A 4CMAA 1DIGA 1N3BA 3AYZB 1AF4A 1JSXA 1ZI9A 2GPYA 4ZHQA 1IQUA 3PJGA 1RPNA 3VAYA 3BUSA 1PDWA 2VZEA 3GEEA 3RSFA 1PAUA 2ZBFA 1FQJA 1AGPA 2H9YA 1QHXA 2FXVA 4JBXA 4EEKA 3LHSA 3FLMA 5HUQA 4AO8A 2W6CX 2FI1A 2CXQA 2PM8A 2YXEA 1RQ2A 5AMXA 3G17A 5I9BA 5CFOA 2CNLA 2HRQA 4H7HA 1U2PA 2OBXA 3L8DA 2CWDA 1JG3A 1W9HA 5GZ1A 3SAJA 2P11A 3W6OA 1ISJA 1QSGA 3CG0A 5DX1A 4ZU6X 5IN4A 5JYCA 1U6KA 5ALWA 1SKUA 2ZRMA 2RAPA 3CPHA 3OPNA 3O83A 1LDYA 2VZ0A 4RVCA 3H9JA 5JFOA 3LX4A 1G66A 4JGBA 3V1LA 2P2NA 5DSTA 1I1QB 1ISSA 4XGIA 2GJSA 2XQGA 4RHXA 2YL2A 4MV6A 4JA0A 4PSDA 3T3DA 1Q20A 2XOXA 1R4NA 3ABSB 4L3WA 3ROZA 4B09A 4Y1RA 3H84A 1MPXA 3DPSA 1CY0A 3JZAA 1NYQA 2G9NA 5AYVA 1V4NA 3HGTA 4YYZA 2PH1A 3HZRA 3FZGA 2N75A 4DSUA 1TEVA 3RYTC 2HRDA 4M1ZA 2Z08A 4YBRA 1MQ8B 2ACVA 3HB5X 4MQMA 3SG0A 1UBUS 4F71A 5FBVB 4L7VA 2JJ2A 2QLLA 4DCCA 4Q01A 4TM8A 4I6JA 3VR5A 3FWYA 2PJRA 1UEIA 1GSHA 3H0KA 3M83A 2OT3B 2C59A 3QP9A 3E03A 5MN6A 3B53X 3T8YA 2G72A 2I2BA 3EOAI 5MFZA 2J3MA 5GJWC 1UM9B 3RTGA 2KYRA 3CH5A 1QCCA 1DIAA 2R97A 2GJKA 4IGIA 4XX1A 1Z6AA 2C9YA 1DZIA 1VRVA 2LW7A 1YZHA 3UH1A 3VZBA 1JG7A 2A1IA 4AQ7A 1GL6A 2OFXA 4BEVA 5BWLA 2AK3A 3CR3C 1CY2A 2OXRA 2V0NA 1TA4A 2VJAA 2LE0A 1F2DA 4QASA 1DOHA 5PGMA 3OIVA 1W0KD 1D3AA 2HPHA 3OX3A 2QMQA 4RK0A 1RNLA 4NLLA 4ND8A 3WNVA 4ZJZA 2PR2A 2JGKA 4LX0A 4RK7A 3ZZ1A 2QYTA 1C41A 1G6OA 2D4HA 1A97A 1SIWA 4A3SA 3IMCA 4CMHA 1THGA 1XMOB 1Y6JA 2AH5A 1WIWA 1HNZB 1RJFA 2R00A 3W7AA 4BOYA 4RJTA 5I3CA 2AV6A 2DUMA 1S96A 1E6LA 1QIIA 3KT0A 3L6CA 4FHFA 4KR3A 2PKRA 3ITNA 4MVJM 4XM2A 5CYPA 2FF5A 2W6OA 5JU6A 1G8AA 4JAVC 2C5GA 4GZ6A 4P3PA 4BAZA 5J4VA 3TTXA 1V3QE 5CM2Z 4EATA 3NHWA 1T2DA 4ITVA 2BFCA 4RADA 2PLNA 2XR1A 4PGFA 5HA5A 5E95A 4L16A 1SXJE 3QEOA 4HVTA 4RH3A 1SVWA 3GO4A 1Q6ZA 2ZE7A 4V0MA 4R1QA 1ETHA 1QTIA 2Q5QA 3RT1A 4KSYA 1CZUA 4MRSA 4JLPA 3SZGA 1QGAA 2KPOA 4LC0A 3ZY2A 1DAEA 4ZDKA 1B76A 1SH7A 3ZCRA 3BT7A 1H1LA 1NF8A 1SD2A 2Y2UA 3RHTA 4DJFC 3AESB 3ECCA 3B3GA 2QRJA 3O8BA 3WKDA 5JY1A 2VYVA 3CINA 1E77A 2EOAA 1GA4A 2W90A 4K9KA 3T9AA 1E3MA 4JROA 4R71A 2UYGA 4P53A 2H3EA 4XQ0A 1A8IA 2GAOA 1LSUA 4BNTA 3RC7A 3SXUA 1DL5A 1YO6A 3WBBA 1JDTA 3LWDA 3W06A 1YR3A 1IBSA 2CSXA 2I1WA 3A4MA 5JJBA 3GLHA 3IIJA 4MGYR 4RA6B 1UKAA 2Q2VA 1NNLA 1HE4A 2QTRA 4NNJA 3RYFB 3R0ZA 5HQTA 1V5GA 3EGXA 4HWRA 3U13A 4XR9A 1TMKA 1KU0A 2BJVA 4IWNA 1P62B 4Z4FA 4LEIA 3PUVA 3MB5A 4I3FA 1GADO 1CRQA 1XRPA 3HCDA 4G67A 5DYIA 5CG2A 4IPTA 3OMXA 4RJ2A 4CLOA 1TEHA 3UAWA 2HA2A 4RANA 4KGVA 2BKLA 2PT5A 2H65A 1MBZA 2QYSA 1ND5A 2I33A 3L8CA 2VJMB 2VYND 5L3ZA 2QHXA 3TI9A 2JG3A 3THYB 1ACJA 1VBFA 1C9MA 3KQLA 5C3UA 1N7GA 1RIIA 2G5TA 4N5HX 5J23A 2I2FA 2BGMA 4NZYA 1PR9A 1ISGA 2FOIA 2HK9A 3CZQA 3N59A 4KAAA 1KSHA 1TYDE 2BEWA 3DTYA 1JDJA 4OFXA 2GPWA 4UEKA 3W2GA 3GFRA 4D96A 1Q84A 3P2IA 3L1IA 3BA1A 3GEBA 2D2FA 4U5XA 4FE4A 4CKCA 2E6KA 3QV2A 4KN5A 5TQVA 9LDBA 2ERYA 1WZIA 2XIJA 4BIMA 3GIDA 3C85A 3ROGA 1XJ5A 5EZYA 1HLDA 4W9MC 5H3HA 1J0XO 1VG9B 3MVEA 1BHJA 1PHPA 1LC3A 3MBIA 1YASA 4GOMD 4EUFA 1B7GO 3EPLA 2VSNA 1HSOA 2QRZA 2AMJA 4BQQA 5B5SA 1QYCA 4J94A 2H4JA 2BI8A 1GEGA 2PKQP 1GRNA 1URPA 3OLZA 3OQBA 3R0JA 2VAPA 4OGLA 3DKPA 3ZI7A 4IH1A 2Q4TA 1LVUA 1EEXB 1C3EA 1IB6A 1ZEJA 3AERA 4I1VA 2CLHB 4MH0R 3OU7A 3Q2IA 3TNDA 3HJFA 4LHEA 3AM5A 2BTQA 1F6WA 4EM6A 3TNJA 4HLDA 4I4LA 4FDAA 1BA2A 4O2AA 1OZ0A 1TF2A 3NTQA 3L7BA 2SBTA 4JBYA 4QEKA 4DUGA 5KDOA 5DULA 1IYZA 3U9SA 3BK1A 4F3YA 4PLCA 5AT1A 4ZAZA 5AD1A 2DCUA 1YFKA 3EPKA 2BHSA 1OWOA 2NU6A 3X43A 1EFTA 5A3RA 1VHJA 3V5NA 3AFIA 3PGJA 2O06A 5J5AA 3A32A 4E5NA 3D6JA 5HRUA 2QEQA 5J2TB 2A1TS 4ALNA 1Q0PA 2XE7A 1J2TA 1JDPA 4Q1AA 1L9KA 3LRXA 4DR4B 1WSWA 4WK4B 1IEQA 3AF3A 1Y98A 3D5QA 4RJLA 2JLUA 2PZJA 4B2PA 4BO2A 3M9XA 4CV1A 1FMFA 1AF7A 1JHRA 1OI4A 2R44A 2NLOA 4OAOA 1EE1A 3A4NA 5HS4A 1O89A 1K6IA 4C07A 4YCCA 2HQOA 2IOFK 4MR7B 4AJLA 3B6EA 1SBHA 3N70A 4IV5A 3UC9A 2XD4A 3EUAA 4BE9A 2IYVA 3N8DA 2B8JA 4LYYA 5AXCA 5H3LA 5ALNA 4O33A 5IJWA 1XUOA 3D4LA 4WZBB 2OCIA 4BYGA 2A88A 2IHBA 2M32A 3EC2A 1M1NB 4LV5B 4Q12A 2NPFA 3R0XA 5FLXA 3TSCA 2FMUA 1LRKA 3WZ2A 2PSDA 4QPPA 1U0EA 3MEQA 3P8ZA 4JSYA 4OB6A 3UGKA 3P26A 1Z2EA 3MOIA 3NV7A 3M33A 2V55B 3IDFA 3LGXA 3T4PA 4NH4A 4K86A 1DAIA 3AU8A 5H0IA 4JQCA 5J4YA 6PFKA 4RESA 3WVNA 2BKEA 2CMGA 1AKVA 4YB8A 1FEZA 2FR8C 3FSGD 2PL5A 1FVOA 3FFTA 3E5RA 5FFNA 3PDIA 4LVUA 4MLDA 4WNCA 3K53A 1OWPA 1S2LA 1OJ7A 3ENQA 5CR9A 1JEQB 4G5XA 1DXYA 4XLLA 3AF5A 1TLTA 3R7LA 1MIOA 4RPCA 1JBKA 3FVVA 4G8CA 5AVYA 4E5VA 1J6UA 2EFDB 1VJ0A 4DXDA 1D6JA 4MLZA 2R4UA 5CDHA 3L4KA 1NZDA 2B8TA 5J2TF 5FTJA 4CLXA 5I7FA 1CZOA 3BD8A 2H9IA 4YT5A 1MHPA 1JSLA 5FBKA 5JNWA 2PFKA 1ZD4A 2ZIEA 3FPCA 2ACEA 1NF3A 4MKXA 4NI5A 2R5WA 1ULBA 5D7BA 1TM4E 3EIQA 4OQEA 1TA9A 4P08A 3VR2A 1G5IA 1OBOA 3FAKA 2VCEA 1PJCA 3OFND 2WVJA 3SS8A 2HQRA 3GY0A 2DQYA 4F72A 2W5UA 1XTIA 1YWGO 4MKFA 4ND2A 4WL0A 4TROA 4P2BA 4YH1A 1YJCA 3F1LA 4UZFA 4WLUA 3RG8A 1AMOA 5ELMA 3OBBA 3RAPR 2AJTA 4BJ6A 2YICA 3MGBA 4GMFA 4WBNA 2G70A 3SEFA 3AHHA 5F5LA 3UWKA 3OQMA 2DWCA 4ZJPA 2ZJOA 1H6AA 2XUDA 4Q9JA 5KJEA 4MMYB 4C9BA 2JIRA 5G4LA 4J2OA 3E7FA 1H6CA 1JAXA 1S3FA 4Q7MB 3KYCA 1E3QA 3IJPA 4MMXB 4QFBA 3T1TA 1THZA 1WSDA 1ZH6A 3OMWA 3AI2A 3OF5A 2P68A 4EI9A 4FQ8A 3WLOA 2QMUA 4EFKA 2CVPA 3K2IA 3G02A 4QVGA 3L8GA 3O84A 4B73A 5KQGA 1Q0TA 4B40A 2J09A 1WHSA 1U2GC 4HN9A 2J4FA 4JBWA 2HQBA 2ZSIA 1V4BA 4MW2A 4UOEA 4EDFA 2BFWA 1FX0A 2P3LA 3VOSA 2ZWAA 1FE8A 4MW7A 3IEMA 1Z3IX 5LUAA 4P34A 3VU0A 1Z22A 2AZXA 2FPOA 4QJBA 5KKCA 2RGCA 3V8BA 1VMKA 1ZOIA 2NYRA 1RADA 4JEMA 3KZOA 1IAVA 5LZ8A 4BMSA 1Z2OX 4G24A 3C70A 1KYXA 4A1OA 4LV8B 4DDVA 3UUWA 1ONNA 4RTLA 1N5LA 1TIPA 1ZU4A 4NOKA 4B4KA 2J0UA 4TZ0A 3L0ZA 3MS4A 4BNWA 2ZSBA 4DC9A 4S3MA 3JSAA 2ODWA 1CJVC 1A7AA 2AEEA 4KQ1A 4Q7QA 4DFDA 2X0NA 3BK7A 1YL5A 4BWYA 3PQ7A 3K70B 5C8DA 5HNKA 1QIEA 1VGRA 2RFLA 4JI2B 3UJNA 4M1KA 4CI0B 3DOFA 1XN4A 1I33A 1C7FA 3NIFB 3EG5A 4WY5A 2X8JB 3U5ZB 2O0HA 4BU1A 2UU9B 2JZCA 5DM0A 2V58A 5JSKA 1IN4A 4YCNA 1G21E 1Y4AE 4BQOA 3IV9A 3RYHB 2VAVA 1Z07A 3GQBB 5EKUA 1UAGA 1ZJ4A 4PTYA 2B0JA 4L27A 4OHUA 2P3QA 5EJ9A 4PZYA 3OETA 5KYXB 4W6QA 1J97A 1GV0A 1KZ4A 4C0AC 2H07A 2JIMA 2RGEA 3LLUA 4DZRA 4HYYA 2JL1A 4R9RA 3D3WB 3SPXA 3T34A 3HM9A 4PPNA 1TX4B 5SY4A 4UVIA 2CXXA 3MLEA 2OBMA 5AI8A 4ER5A 1NBMA 3EAGA 2WSBA 2V97A 2Y1XA 3H1FA 4LI3X 1U4SA 4BLWA 1RXIA 1NJFA 1OX6A 1QM5A 2GBFA 2Q1UA 2PUHA 3VKVA 4ZEMA 3WA7A 3HL4A 2BF4A 2ATCA 2J3DA 1V41E 1WXIA 2QLMA 4OJNA 4EJFA 3AIOA 3WLLA 3DT8A 1NU8A 3WYBA 1XZCA 1Y7IA 4QDXA 3ZV4A 5A5VA 3WIUA 1JZTA 3F9IA 2HA6A 2WTXA 1XKQA 1AZTA 1LPMA 3NBKA 1ULZA 1CUSA 5JT1A 1PDOA 1U2DC 2HJRA 4HMQA 3A28A 5JS2A 3UGQA 4L6IA 4IFBA 3W5AA 2EKQA 2UZ1B 1K86A 4BX2A 3WIOA 3CUYA 3TL6A 4YMUA 2WV9A 3MWDB 2DOKA 2YINC 4M36A 4RPJA 2AFIA 1XCOA 2PRIA 3HBMA 4J1QA 1JF8A 2FP4A 3LFTA 5THKA 1WM1A 2QP4A 3EVAA 2NMVA 1GZ4A 3UK7A 3PTZA 5K3CA 1L7QA 2HMTA 3D2CA 3O47A 3VU9A 1TUIA 1F3LA 3G8DA 3RFTA 3BSWA 4HFRA 3PPIA 3PWSA 4M1WA 3ITDA 2EAUA 4PLVA 3PC8C 4UTPA 1OH7A 4DC1A 2QSYA 1D0SA 1PEAA 3CY6A 4F3TA 4N0MA 1SHJA 5GJCA 1F1BA 2CE2X 3AKEA 3KPYA 3NT5A 5AKYA 2VP2A 4YP6A 3BAZA 4Y2TA 1G63A 3STHA 3DJYA 3RFCA 3IJEB 3OIFA 3GHYA 3ZJTA 2G4CA 2XZDA 4RCYA 3PS9A 2FUNB 1CXZA 5EKXA 2IV7A 4AULA 2JDIA 4CW7A 2HU2A 3G2JA 5J40A 3C5VA 1P2DA 2IY9A 3WL4A 3FPFA 4LYDA 4YJHB 1V35A 1EP3B 4PC6A 3BMCA 2FN7A 3IE0A 4MUHA 1GR0A 4ZGBA 4RF5A 4S35A 3LO8A 1VOTA 2C9OA 2LXNA 1WHTB 2OHGA 2YASA 3MMPA 2H06A 4MWCA 3KQHA 3GK3A 5ERGB 4EJ2A 4CTNA 1GTJ1 1JZSA 2WPNA 1F0YA 2I76A 2DFTA 2ZDGA 2ES4A 3FZYA 1TK2A 4GPIB 4I9UA 4G81A 4X1OA 5E9JA 3E4DA 4DLPA 1B26A 2FE1A 4IVPA 2IKQA 5C46F 3SHVA 1QHYA 4MHTA 3BXEA 2HHCA 4PE5B 4RMHA 4RX1A 4ZYVA 3VVCA 4DA9A 1RCUA 2VK8A 2Z4RA 1NKSA 1O95D 3R5HA 2QU8A 3QX8A 2ZTUA 2HRRA 2C9DA 3KAPA 2GERA 2Z1NA 3R4VA 4TRJA 5C51B 5HGJA 3IKTA 2C3PA 3PHJA 4YRGA 1PQ4A 4EYKA 3GEHA 2FSPA 5L7YA 3T7DA 4LBWA 1Y3CE 1G21B 3JZIA 4LN1A 2HRBA 2JFXA 4HH0A 1NPYA 1P7PA 2FEMA 5ITVA 4ZVTA 1UPUA 4YDSA 3NOVA 2NP7A 1I24A 2C99A 1UBRS 3BDVA 3GELA 3NAMA 4S1NA 1LK7A 1U5CA 2O0JA 4JDPA 3UMCA 3K6SB 2JAPA 4XW2A 4WZAA 5B1HA 1UDWA 4M1OA 4K6FA 3IQZA 3HB1A 1P4SA 3QEAZ 2IZOA 3ZDEA 2BLNA 3LQFA 2K6GA 5FUMA 5TJ9A 2ZXUA 3UHPA 7GPBA 3MS2A 5D3KA 1OYOA 2OO7A 2WFAA 2WFZA 2QD1A 3LX6A 2R11A 3DLAA 3IBYA 1YU6A 4PYOA 3AZPA 3W3AD 3BKWA 4HAOA 4K9NA 4U7GA 5AKXA 4EY4A 1W76A 5IJ0A 2JLXA 3F3MA 3AJAA 5E2BA 1BGVA 2PKEA 1TKRA 2RBKA 1O77A 1JQDA 3X1WA 1XU4A 4L2IB 3PYMA 3UT6A 4DQVA 1N8SA 2YZKA 3PL1A 4A82A 3M3PA 5HM8A 4OFBA 4BKRA 1VFNA 3H65A 2P4UA 3OKCA 4C6HA 4EGFA 3BL8A 5HMLA 1KPGA 2BGTA 1MG0A 3ED5A 3EEBA 5JQWA 2YHIB 4ZVNA 3QYFA 3N2YA 3KTDA 5I8ZA 3ROQA 1E1CA 2GEFA 4PV7A 5CDSA 3I6MA 4GD3Q 5IFLA 5A9TA 3LK7A 5F2EA 4P92A 3R7WB 5J2UA 5ED4A 5AM0A 2XCTB 3I2FA 4UZEA 3ZQ4A 1U3VA 4XM1A 4GQAA 4DQDA 1NA5A 1H94A 1TE2A 1PK7A 3GEIA 1N4AA 1T6ZA 2BMDA 3A2MA 4QUEA 1NI4B 4JBGA 2JI7A 1RRFA 4M98A 3SU8A 4RJIA 4OI4A 5H9WA 4XWTA 2ISSD 1CQPA 3PE3A 4R1TA 3W5IA 4DLNA 4EKIA 5CLFA 5KX5A 2ZSEA 1RRGA 1JIUA 1HFEL 1I36A 4FGJA 4JMPA 4UM9D 5K0GA 4RDIA 3E9NA 3FFXA 3M6UA 1DBVO 1G7SA 1SQSA 2F48A 1V11B 1Q14A 2JJ2D 2Z2ZA 3ZWVA 4B84A 4TV9B 2D54A 3VR5D 4EFMA 3I5XA 4OSEA 3FPJA 2Q62A 2BFEA 1DARA 1LBEA 2XCRB 4BMXA 4PRYA 1FJGB 1OMOA 1XZGA 2C77A 4Y2VA 1N77A 2GBPA 5IVKA 1PL6A 4DXHA 1I5RA 1YIAA 1GXSB 2IVFA 4CG2A 3B12A 3S81A 3ZIDA 1KC1A 1XAIA 3KWJA 2XEXA 2LGJA 1OA1A 1VYUA 2UKDA 4XVRA 7ADHA 1SAYA 1E7SA 2XYHA 5IKXA 4W9NC 5IARA 1US8B 2C7PA 1HR0B 1VECA 1DNPA 2B2XA 2XF2A 3HBFA 3NGXA 1SPXA 5SZJA 4HX9A 1F12A 2OUKA 1HURA 2Z3VA 3JATB 4IMJB 1TZMA 4URUR 2CYCA 5EESA 4MUAA 1Y4UA 3FKSA 4WLNA 1BXRB 4PO1A 4YPVA 1S0UA 4GSLA 3DLPX 4P7KA 2RB5A 1YS7A 3AEKA 4FGSA 5EINA 4QSHA 4FE7A 5K7SA 1HUQA 2NOAA 2JIOA 3K0EA 2XJ4A 4WADA 1JFTA 2OQIA 1KAEA 3AB8A 1ZRNA 5AJHA 1N6KA 3LXMA 3WL6A 3DV2A 4LJ6A 2VJNA 4O4LB 2GFIA 1ZA1A 5IAEA 1T4GA 3R75A 1DKQA 1YE5A 2HNBA 3AFHA 4LDJA 1RDFA 4YRBA 1O54A 2WNHA 4Y7CA 5JHGB 1MX1A 5FCDA 3E9DA 4IIEA 3DBHA 3C43A 4DW8A 1II8B 2QDKA 4LJ9A 4W63A 1RYNA 3GT0A 3QTTA 2ZSUA 1KE2A 4TV9F 4V0QA 3S2EA 3DZJA 1YA8A 1MQ9A 3M4ZA 2B98A 2QUKA 4LZNA 2ZOSA 3SIXA 2B1RA 3T3PB 5FJIA 3CNQS 2WF5A 1BXGA 2IZ7A 4INZA 2C4TA 3IOBA 3K92A 3L7DA 4L28A 1CIPA 1CVIA 4PAQA 2PKWA 2CYAA 1POXA 2VPTA 1TT5A 3ZNNA 4L8LA 1K7SN 4MV3A 1R0ZA 1BQ4A 4LUCA 3GT7A 5CDFA 4YUXA 3KWLA 1J1UA 1JJ7A 2HSZA 1N0UA 1VCMA 3IJRA 4HBGA 2X14A 4ZC8A 3PENA 3SBEA 3SXJA 2PMWB 4EY3A 4CLEA 3LUCA 1NP3A 2GM5A 4X6LA 2FPSA 1Y7HA 4YR7A 2C83A 4BB5A 2NXEA 3VSCA 1KDPA 3H5OA 4KBYA 1GCAA 2KBEA 3ME5A 2PYZA 5I5EA 3PGXA 3BMXA 5DWQA 1XLVA 1U1IA 1QR2A 5P21A 4GMXA 5BRAA 3N7TA 2FKNA 1A98A 3TLJA 1ZIPA 3TCXB 4OQMA 4F0JA 3V7UA 5B2ZA 1I0ZA 3AEQB 2WIKA 3PQ5A 1TYZA 3DEZA 5REQA 3S1AB 3RCBA 5LYYA 4EGSA 4O4LF 1JFRA 3LL7A 4RCVA 2G7ZA 4ARIA 5CP8A 5E9AA 1WXEA 4YK7A 4YAGA 1RXCA 3DP9A 3NMUF 1GQQA 2QTFA 2C8VA 1E9AA 3VSDA 4P5DA 1MEOA 4ESOA 5B6PA 3GJQA 2O3JA 3IX7A 4P22A 1DSSG 2QJWA 1N5IA 3U81A 4JSTA 4MDFA 1XNHA 1I4LD 4AZ0A 1AZLA 4MWGA 3KB8A 5T6BA 2WDPA 4JC8A 2Z58A 1BN7A 3GA5A 5HTKA 3H7IA 2ZRCA 3AOEC 4Z0TA 2AUMA 3EA0A 1HTTA 4WY2A 3WKEA 1GG2A 3ACDA 3FR7A 3JQBA 3H5IA 1UKBA 3DFFA 3IPYA 4OBXA 3ZE8A 3F47A 3U4QA 1NDHA 5A3SA 1E0AA 5AKLA 3AT1A 1FL9A 1AKMA 4XVCA 3SIPA 3LUFA 2P6MA 4MRAA 2DPGA 1QAMA 4QYWA 3ROMA 1YGYA 1M2VB 4KFSA 2YMLA 1KO5A 4C3VA 1WMEA 3COSA 4ZCSA 3ST7A 1O96B 4REMA 3KQNA 1DCTA 3ETJA 3GR6A 2CVQA 2AXQA 4TLEA 3RK1A 3NM5A 3PJRA 2GJ8A 2QD4A 2Q4RA 3A1WA 1BDBA 1M2OA 4KGXA 1Q0SA 1Z5WA 5KYUA 1U5AA 2OEPA 4BVLA 4QPDA 4RTKA 1RRCA 4OX9B 3SX2A 1IL0A 1VJDA 1V8OA 4CKZA 4L8WB 2QJOA 2C57A 2TMDA 3UATA 5JARA 1T2FA 2PG3A 4HH1A 4LNUA 5CFRA 4B82A 3C1TA 3T5DA 1XDBA 1VRWA 2P6PA 2ZS7A 4RMIA 2Q8PA 1MJHA 3A4VA 1D2RA 1D4ZA 2QZJA 4MVJD 1KO8A 4CEIA 3EW7A 4CXMA 4H7PA 3RH0A 1WY5A 2Y92A 4EQZA 1JLMA 2XAUA 4CM3A 2D4AA 2I6TA 3R3HA 3UMYA 1JVSA 1PN3A 3ND9A 4WN3A 2OVFA 4AYWA 3NP9A 3OE5A 2CXTA 1GPBA 3VPAA 4ZTZB 4V0SA 1XFAA 2P8JA 5GOZA 1L5LA 1V45E 3F9RA 4LMPA 3R9XB 5HKKA 1NATA 3NT4A 4OFWA 2XQJA 5I01A 3TJZA 3CT4A 1X14A 3I53A 1KDYA 3K5WA 3OESA 2LKDA 2VF7A 3EYWA 5KBYA 5IF3A 1Z26A 3IMKA 4YAKA 5IJ9A 3T7AA 3DE5X 1YHYA 1RM5A 1SM4A 3HKCB 1MABB 5CIWA 4Y2QA 1VLZA 5K8UA 1DADA 5DISB 1TYCA 1U5BB 2AK2A 5TNXA 3DNFA 3RV4A 5ADWA 1SA0A 2WYIA 2WIGA 4DQLA 5CVTA 1U8EA 3LQ4A 4OPMA 1MAWA 1MJGM 1Z18A 2GCEA 3VHQA 4BKOA 1IOLA 2IYAA 3ZHTA 4BGUA 3DDNA 5DGDA 1X9GA 1CIJA 3D0QA 4G9EA 3U49A 3BTVA 4NY1A 3V8QA 4JB3A 4WUVA 2IEBA 4X6UA 4BBJA 2K7ZA 4WINA 3A10A 2LIPA 2Z0MA 2AN5A 3HC7A 4LXIA 1FPQA 3JX9A 2HA7A 2VF5X 1REQA 3B2NA 4H7KA 5ADVA 4HYEA 2UXDB 3H2ZA 1C8BA 2B9VA 3AHFA 4TT8A 3N2GB 5K6AC 2FCRA 4OHVA 3CPSA 1E2HA 1RPJA 3BZWA 4FHGA 1P0MA 4FGLA 5A4DA 1AO0A 4OA8A 4LOAA 1ONSA 5TPWB 1Y3AA 4FTWA 1DQZA 2P5SA 2Q1WA 4LDZA 2SKCA 4O59O 3RFFA 3F2IA 4UCWA 1P1FA 5K8IA 3FN4A 2Q4BA 4YHHB 1RWNA 2X5KO 3A1TA 2H1CA 5CUQA 3DW3X 4AP5A 4FYXA 1EE2A 1GQSA 2BCGY 4GP6A 1E3EA 5TB5A 3ZX4A 5IRCD 4LZJA 1EM8B 1XLTA 3H6KA 1LY1A 3LY9A 3NC4A 2ZRAA 1OX5A 4IS2A 3PPVA 3GPBA 3DDSA 1OASA 3IO3A 4PC7A 1B2LA 3N07A 5EIXA 3PNSA 2PJUA 4O4IA 2NUAA 4BGVA 2XT6A 1J0DA 2VBCA 4QL3A 1MTZA 2PL9A 1I4DD 2I1VB 3VU3A 1ICEA 4ZK6A 5KOIA 1RAHA 1TO2E 3H8VA 2QN6A 3MTEA 4NU5A 1OFVA 4BVBA 2V1UA 4MI6A 1WL8A 1ACLA 3L2OB 4PHFA 5DM4A 3QNUA 5FOXA 1OFIA 1JMKC 2PLWA 4E12A 3T5TA 4B3BA 3TIIA 4HI0E 1SKAA 1XR3A 2B1JA 4OM8A 1P7VA 5D8DA 4HDMB 2YOFA 3C1AA 5D2CA 1CUXA 4Z49A 4Q1BA 5J59A 1AMNA 1CW2B 3ASZA 3SQLA 5JAMA 3ZLUA 2PR7A 3LDFA 3PLAE 7MHTA 1JR6A 3AVQA 5IM4A 4WLVA 3RYCA 4ABTA 2Q6VA 1E4OA 3LY8A 2BEVB 3WK8A 3LC0A 1ORIA 1QORA 2TMGA 1D2HA 2QPOA 3IURA 2XHZA 4LTNA 5DTEA 3EVZA 5BWNA 1U98A 1E2FA 2WSLA 4NDZA 2HXYA 5CM9C 1M34A 3B38A 3ZKWB 2R9VA 4EB6B 5I4KA 2NZUG 4MDEA 4ZU3A 5TS2A 4E07A 4N3GA 1C0LA 1K4MA 1P7WA 1GUYA 1SMKA 2BT4A 3OUTA 1D2CA 3HSKA 4F6RA 4GS5A 3GJRA 3NX4A 2BTEA 1X0VA 3C0KA 4KPGA 4ZCLA 1J2UA 3NOOA 1W5AA 1A50B 2WM2A 1N1DA 1HI9A 3CLUD 4GLLA 1F38A 1C1YA 1YVDA 4IG9A 1SCUB 1EFKA 1Z8HA 4PQEA 3Q2KA 4AG3A 4DJDC 2EP7A 4UBJA 2C3OA 4JI7B 2CNDA 4IZ6A 3INGA 3IBGA 2WKSA 4PZZA 3K4PA 1KMMA 2W0MA 3ADBA 1SQ5A 4H4EA 1FQWA 4P7JA 1RQNA 2ZYGA 1T3ZA 2GCNA 1R6VA 4EGAA 1BG6A 1JB1A 1M7HA 3WP0A 3K0CC 4ZCIA 2AE2A 3CX6A 2AHRA 5FI0B 3V2GA 4PZ0A 3I4LA 3O2QB 4JHLA 4B81A 2BH2A 1XP8A 2B9EA 4ZYXA 3Q72A 1VMIA 3KUCA 3V8RA 3CKLA 3ADCA 3TAHA 4KO8A 2JA1A 4FINA 1Y1SA 2AR0A 4OO3A 1IZ8A 4DANA 4NH0A 5I7AA 3AJ9A 1WAMA 4F06A 5F2KA 2WWTA 4FJ1A 3JAWA 1L4EA 3QXSA 4M21A 4P4TA 1A7UA 1ZGJA 2JS7A 3HO6A 4GPEA 1XTRA 2G6TA 3BMOB 2W6JA 3OJ0A 4R8LA 1NBMD 1QKKA 2Q9BA 4K6OA 5FP0A 3ZQKA 5AW5A 1KQPA 3RLFA 2OXFA 3A1DA 5FNVB 5IBRA 3M3HA 4CG3A 3FGOA 4R16A 4UC0A 3NYIA 5K3EA 5TC4A 4E6EA 5LOVA 3NDIA 2ZUEA 4AWAA 4KIFA 1DO2A 2SKEA 1SVSA 3KHTA 1I1OA 4G5QA 4OYLA 3BBLA 5LZ2A 5AQEA 1JPVA 3UA3A 1P5ZB 2RHTA 2WTBA 4MUBA 2WJJA 4NRDA 4ZI7A 5A2QA 1IN5A 1U7WA 2C2HA 4X61A 2QN8A 1QVAA 3K0FB 4XTCS 3OFKA 4LOLA 2VEDA 3OM9A 1DX9A 2YJGA 1NXPA 4RGYA 1ZP6A 3TSWA 2HW8A 3C6MA 3EX7C 3E23A 1C4XA 2VZ8A 5KMGB 3G0BA 1V1RA 4MUFA 1QHIA 3F5SA 3LVRE 1IVYA 1I3MA 1WS6A 4OHFA 2E1PA 3JQAA 1O0CA 3B6KA 4FFBA 2XA2A 5ES3A 1L5VA 3ISJA 1GITA 1U0HC 1KNQA 1DWQA 1RIFA 2FEPA 3DMGA 4OQYA 4URHA 4UULA 2UXCB 4KXWA 5DN6A 2FSSA 3O8NA 1R5JA 1W47A 5JALA 1N6OA 2ZE6A 1IIBA 3JU3A 3O1JC 5K4GA 4GI2A 5LM3A 1U2EA 1W88A 2OV8A 1Q1BA 5AK6A 2GK3A 4K9LA 4BLQA 3BGDA 3D8HA 4XUCA 4DIMA 2K7FA 1GR1A 3HJUA 2PUVA 4MVWA 1JLSA 2V3CC 5K20A 2OWDA 2JDID 1Z0JA 2YC2C 5FNVF 2B20A 5TVKA 4B6RA 1EAYA 4MVJP 4EDHA 2XKKA 4PXYA 4EY5A 5D7NA 1UAYA 3A9TA 3PFKA 4IFEA 1Z7BA 4FWIB 1AD2A 1JEOA 4ZVSA 4YRZA 1VC2A 3IIIA 1VZ3A 1YHNA 3BXGA 3KPWA 3L82B 2FR1A 1Q1EA 1RMTA 5BPHA 5AHKA 1Y48E 4QOJA 4K03A 3EXHB 3JQ9A 4P3NA 1N2CA 1WCWA 3FPSA 1ZITA 2DX7A 3QBEA 3CCCA 3ZDAA 1QS0B 2Q3DA 4LZAA 2HBRA 2IHVA 2HXSA 3ZDDA 4NXNB 2AFHA 1WR8A 1ZAKA 2IVZA 4MWSA 4W5QA 4WCVA 5BY2A 1Z25A 5AI4A 3P9RA 4EYOA 3QPDA 1Z4PX 4MWDA 5BNIA 1ZS9A 3B2EA 2R86A 3JQFC 4BO1A 1TZJA 4OAPA 3JALB 4HNAA 3EXEA 4WPGA 5A6VA 1KAQA 4BV9A 5E7MA 3ZZ0A 4HVLA 4U7HA 4COOA 1HEUA 3A37A 3HXTA 1PG0A 2GTHA 3R09A 4DLXA 1U0FA 3EMDA 5IUKC 1UKYA 1GGFA 3A7EA 4LVNA 5CG1A 2EKBA 1CRLA 2WZDA 2YJTD 4IHJB 1FS6A 1AQUA 4RFSA 5DNEA 4NEHB 1Q0UA 5CDUA 1DC3A 1ADCA 4L3VA 4M8LA 1E4EA 5F51A 2B78A 1ITZA 3KSUA 2H1VA 2BAGA 2PFGA 2Q49A 5DCUA 3CKKA 4BFXA 2JBAB 3TFWA 2QA5A 3A1UA 4P0PB 3B20A 4HB3A 1S89A 4DS3A 2D1FA 3DHNA 4PC1A 1N2EA 3TR0A 1XLUA 1PSZA 3RT7A 1SXJC 2ZATA 2BSAA 4WLFA 2AN4A 4MHSA 3ZDBA 4MMZB 2H1WA 3COYA 1EQUA 1M6WA 1QLHA 2C20A 2PYIA 4I14A 4MQEA 4V0OA 3LUKA 4EY8A 4MV9A 1MDFA 1O97D 3HYSA 4HRVA 4KG7A 3AUKA 3JAKA 4BV8A 2MINA 3LBAA 2IYZA 5JCZA 1EBUA 3KL4A 3SCZA 4COKA 4H3HB 1XEWY 2ZZNA 5DHSA 5HJ7A 4A91A 1XPUA 1H3NA 1I80A 2JD0A 2AOWA 2I2AA 1RE0A 2IGTA 1XJ0A 2ISCA 2XUGA 4FC7A 4G0MA 4BVGA 1NJ1A 3UK1A 1Z38A 3RF7A 2JASA 2OMKA 3HUTA 4RJKA 1L7PA 4J91A 3SC3A 5L45A 4AY2A 3KXPA 3MWKA 3FNGA 4JUIA 1HT2E 3Q0TA 2ZUCA 3NR2A 4EJMA 5EQTA 1JMYA 4YDRA 1W1UA 3KS9A 5DEOA 1R74A 4NCAA 3SHQA 4AO6A 1E58A 3EUEA 2PKYX 1V9CA 3ZJ5A 1OAOA 1RHRA 2L17A 2OXEA 1HXHA 1R6DA 3MT7A 2OV6A 4P6VF 1N6RA 4CUZA 2F67A 3KUUA 1EZ4A 2NVUA 2VDPB 4GICA 2PMKA 3U48A 5FL3A 1NVXQ 3DEIA 4WCDA 2HPVA 2ODQA 4D8TA 1QH9A 1EFUA 2CL0X 2FU5C 3KD3A 3X1MA 4BBAA 1PYDA 2AOVA 5AH0A 3UB3A 1NQAO 4UM8B 3D0RA 5ER9A 4F4DA 4FT2A 5BV0A 2Q2WA 3W9UA 4BRZA 5JS6A 3RYHA 4RZXA 4EJ0A 1FSGA 3OZCA 4C0SA 2O2GA 4M49A 3O4VA 4RZIA 2FY8A 4Y6OA 4JLKA 4C4YA 1EG2A 5JD3A 4ROSA 3IDSA 4DXAA 1I6WA 4JX8A 5CA0B 1LBSA 4QYIB 3FOFC 3IOMA 4ZGWA 1P9WA 4RJJA 3W04A 1K7EB 3KEGA 4R8KA 3V4LA 4BFYA 3BMQA 4RY0A 1ZKMA 3FWZA 3TXYA 4C05A 3BL5A 1R0LA 3FPAA 4FFLA 1UBNA 2FWMX 1UDCA 2V7QA 4KDFA 3ZJVA 2WUFA 2C0CA 5F76A 1XT6A 3SQMA 3KFVA 1NUSA 4LFBB 2WM9B 3RTBA 1HQCA 2PY6A 1EESA 1OZHA 3K9WA 3R41A 4DN6A 4E21A 4YCSA 3FKSD 3CH6A 3UANA 3D6UA 1UPTA 2JLSA 4PPGA 4XQCA 2JHCA 3CPEA 5EE1A 2AUTA 3STVA 4DDUA 5IHXA 2YCBA 3TI7A 4J0DA 1E2MA 2VF4X 3PC6A 3WLKX 4CKXA 1D2MA 1A9XA 3C2QA 1A71A 5CEEA 1LNZA 1P1CA 3AHGA 1ESDA 1IG0A 2VUSA 1OSNA 5LP6B 2VJBA 2R8OA 3IUMA 3KG2A 4A6XA 1CUIA 1DTEA 1SIBE 3OAAD 1JXQA 4JX9A 2FMTA 1BFKA 5KWVA 3FTPA 4HTFA 4JIMA 3QEKA 2X3FA 4UBLA 5BMVB 621PA 3FTEA 4H4CA 4OVKA 4QEZA 3DC7A 2C04A 3N9IA 4X54A 1XVUA 2HT1A 3O4FA 3JQCA 1T5BA 5JEEA 1E2BA 4ND3A 1U2QA 5K3AA 4QM6A 2QZ4A 1W59A 1N7JA 2R1TA 5F1OA 2F7SA 2L82A 4D9NA 3W1WA 5F9HA 4CZ2A 2RHBA 3NC1C 2Z8XA 1ZONA 4M60A 5CA0F 1JWBB 3FDZA 1KYYA 4EG4A 1J1ZA 2X22A 2WHRA 4OJMX 3DMHA 1J00A 1KI6A 1SO8A 4DA4A 2IEGA 1OXTA 4R1OA 1K7XB 5JPDA 1JTEA 1SUPA 1YBFA 2RGAA 4KO3S 2QVZX 2FSGA 2X9LA 2PRYA 2CLFB 3EVNA 4P4UA 3LBYA 4YP9A 3HVHA 4WN9A 3PPYA 1AG9A 5J1TB 1AS3A 5F52A 3KQUA 4PTZA 1JQ5A 3D64A 2J9RA 1F3OA 4HB0A 1ZIXA 1XZIA 4IVQA 3OZTA 1TQ4A 2J9XB 1T5IA 2ID9A 3AR6A 4OIMA 3G89A 2F8MA 1M6NA 4Q4JA 2QRQA 3HN2A 1ZK1A 2Q9UA 1SD1A 3LW7A 1DB3A 1UFVA 3F6EX 4N0EA 2PQ2A 2RJOA 2Y77A 4V2UA 1UIRA 3WGYA 1Z39A 2HD4A 3W5SA 1Z5VA 2ASVA 4KH1A 4WA8A 3V1YA 3HWSA 4HPXB 1W36D 2CMHA 4ZT2A 2B5VA 4NMWA 5L3QA 3KR9A 4XB2A 5LP6F 5E4TA 2F1HA 2PKXA 1DAMA 1NW8A 4F5EA 3TD2A 4DEVA 2VJPA 4E5MA 2R6JA 2ZJ8A 5BMVF 1U2GA 2GT1A 3ZWKA 5J5CA 5CDGA 3JYHA 2A5DA 2OORC 3I1YA 1SRQA 3W6PA 2P2DA 3UCFA 5I7HA 3AHJA 3AR5A 4AC9A 4BZXA 1ZIOA 3P96A 1S2DA 1ZQ9A 3JWGA 4DMLA 3DFUA 1ULTA 1IHOA 1ZJYA 3QPAA 4ALJA 1A82A 1F4PA 2IXFA 2REQA 3KKPA 1T8UA 3FLBA 3MJVA 2CJPA 4KLZA 5ALTA 4FB4A 1ZOLA 2CUZA 3MJHA 4XE5A 1V3VA 2ZETA 1S3IA 1ZJ5A 1KU6A 1EK0A 3MTDA 4IZIA 3T3NA 5E6UA 5EP1A 5L3SA 4XWYA 1XDUA 2YV1A 1AN9A 2GS9A 2NU9A 1YR9A 1OH5A 4Z4GA 3A14A 2TMKA 4FOPA 3RVSA 5JSUA 1FB5A 2GBLC 3I37X 1K2VN 4WZZA 4P83A 4WVLA 4KNWA 1YB4A 2P30A 3FR8A 2JIBA 3QW4B 4PYMA 5JNTA 2V3WA 3PWKA 3QLEA 1X1BA 3BHNA 1B4DA 3BXOA 2FQXA 1JG1A 1JZQA 1M2HA 1P1IA 1YRHA 3DOEA 4F21A 5KU1A 1B1AA 1JXOA 4JJ8A 2R7LA 4E5DA 3NOQA 2W2NA 4L3OA 5HDBB 2FDCA 1GARA 1OXVA 1YOVB 3CUWA 4J49A 3TOVA 1FSPA 2HA3A 5NLLA 1M73E 3E9QA 4BU0A 1PJBA 1QH8A 2I66A 3GVCA 4KN9S 3ZWQA 4XCXA 2D2XA 2WKQA 5B3AA 1B3RA 3AQIA 3U6KA 4K3UA 3MHPA 3QMVA 4WD3A 1K6XA 1SCNE 1N36B 3JQRA 1CUYA 3BERA 4NWIA 2UYQA 2W2OA 3AIIA 2WYUA 3QYAA 4ZKEA 2J3JA 4E3ZA 2B7BA 4DLBA 3CBQA 3WY9A 4NENA 2J3KA 3HYLA 4GR4A 2KM1A 5DNDA 4AY6A 1CY1A 3BREA 3LZ6A 4AMGA 2FQ1A 1RI2A 3GPCA 1KTIA 2E87A 1GSAA 2BGLA 1ZH0A 1T2VA 1K8XB 4HNTA 1VI6A 4FW8A 5HOEA 4GSKA 2FSIA 5HKKD 2O6LA 1JDNA 1H4TA 4N3CA 4NZOA 4OK3A 4PBRA 4QDZA 4FCTA 3VZSA 1ABBA 5JIBA 2C7OA 2ZWVA 1U2DA 4NYMR 1NN1A 3PHBE 1JQKA 5ALDA 1XAJA 3QX3A 1ELOA 1NQOA 3I6IA 1OU0A 3QMMA 2YS7A 2VPIA 3F96A 3FGNA 1M8PA 3RW9A 4Y2HA 1BVYF 4ENSA 1AQYA 3EJ6A 1UC8A 2P3SA 3DFZA 4GBJA 5C35A 4MUMA 1RD4A 3C98A 3I72A 4OGFA 5FO1A 2Q3JA 4ZCQA 1LK0A 2HNKA 2Q2QA 3C74A 3E7DA 1Z16A 4BQSA 4ZZ1A 2A5FA 1RI1A 4A8JB 3ZW7A 3AUYA 4RLQA 5LQKA 3H5RA 2AX3A 4K2HA 3JVUA 3OE7A 3OQHA 2H2DA 4BMNA 3UJ7A 1YRQA 3DEHA 2PVCA 1E8MA 4GI5A 2ZTHA 2YHSA 4CIVA 3SJ7A 3BIJA 4KX5A 1WB5A 3NHSA 1DJOA 3HVJA 1ABFA 4HLUC 2OYCA 4DF3A 4ACAA 1T4CB 4EW3A 4AJ9A 1SWWA 3RBZA 3PP8A 1NXSA 3HABA 4B3JA 3ACBA 7ABPA 5C1BA 3BTSA 3O73A 3CIOA 3DFKA 4YJDA 4Z9BA 3EBLA 4BNVA 2RGGA 2DULA 2PGXA 1YZGA 3KJNA 4L02A 3WLRA 1T36B 4F56A 3M5PA 4BNDA 4U2FA 4CQMA 4LZPA 4MPTA 2XCQA 3S2FA 4J0EA 1NV8A 1V5FA 2PUBA 3P9PA 4QYXA 5FO0A 1PW5A 1SQFA 4LDRA 5K3DA 2Y0CA 1DMRA 2YWRA 4BBPA 3IMEA 4JXKA 5EA2A 4RENA 3KQYA 4GX2A 4KP7A 4MDHA 2WSIA 2VDQB 3I9KA 4Z9FA 5C9ZA 1ST2A 3N28A 4HYTA 1GNQA 3C3MA 1OR8A 3JQQA 4C04A 2GYVA 4P4GA 5ANRB 5T4EA 1IJBA 2GBGA 2DWPA 3OTGA 3Q41A 2BOVA 3H16A 1ZVKA 1BEUB 2XQFA 4GRAA 4TV8A 1UODA 1PO7A 2FUG1 1PR6A 2C9CA 1X1DA 2DTXA 2EC5A 4MLCA 1C3OA 4EITA 2BGIA 1N8NA 3DVAA 4QODA 1P60A 4GBED 5DYWA 2EIHA 4OH7A 1Z2DA 1KBOA 1KETA 4D3SA 2D8MA 1V16B 1GFIA 3GZTB 4HDOB 1D8TA 1T3TA 3EZYA 3UICA 2ZANA 1G55A 4PM4A 4ASUA 1A9PA 4DCVA 1QP0A 3BD6A 3JQ7B 4ZD6A 4BFWA 1DAGA 2P4QA 4WIAA 4BP8A 3DUWA 3OQ6A 4EYQA 1BS2A 1MORA 2CBGA 3NPAA 1EHCA 4B0OA 4IOJA 4EPRA 1UJ5A 4GMDA 1Y9ZA 3LKVA 4M7OA 3TR5A 3U3JA 5KYWA 2CXRA 1QGDA 3A6HA 4NCJA 4MQLA 1P61B 3GFBA 3WXMA 4PAMA 2OENG 1W581 3GMIA 4YFVA 3F73A 2FPIA 2OSBA 3L8FA 3PQ8A 4PLYA 2LPMA 4AY3A 1ZAYA 2JJQA 3K32A 2ECFA 3KSAC 2G4LA 3NCHA 4B74A 4M55A 2AC2A 2W4IA 4QXOA 4PG8A 1AQNA 4PYKA 2WSSA 1I3OA 4X90A 1TDJA 1AURA 4JU9A 1UADA 1PT9A 1WXQA 3OY7A 4QDOA 2ZJYA 3JQPA 1KO1A 2EWWA 2HIGA 4AKGA 2A1UB 3AFGA 1NQVA 2H1HA 2W6ID 1CUGA 3GRPA 4ZQFA 4A26A 4Y30A 1BFUA 3DBIA 2ZU0C 3HFRA 1FYVA 4WKGA 2LIVA 1YZKA 3RIXA 1TTQB 4B85A 4ZZIA 4NIMA 1FIUA 3L49A 3R5KA 1QHFA 2O3UA 3W4KA 5HRAA 5ESWA 4Y9TA 1G7TA 1LNSA 1EBFA 1AU9A 1BA3A 4GM1A 4KHPB 4W5OA 4MV0A 1WX1A 3GFSA 5JWOA 4U0KA 3BF8A 4UBIA 5FWXB 4C5CA 3MPUA 4NTZA 4H4DA 2XWJI 3IQHX 1LQ2A 5C8XA 2O2XA 4Q1DA 1F8YA 1TM5E 2P0EA 2RG7A 3MRVA 4RA9B 2OKCA 3CZ5A 3NBMA 1WKVA 4MR8B 1MVOA 1KAHA 1N7HA 1D04A 4EHBA 2A9VA 1IU9A 2EDCA 3DB1A 4UCQA 1QV6A 4D6XA 1G3UA 1JHPA 1SUSA 5C7OO 3KJZA 1L8LA 2PIDA 2YIJA 1K8ZB 4ZANA 3NVMB 4G2TA 1A95A 1B00A 1LLDA 1LLUA 3ZXUB 2ZIZA 4QAQA 5BMOA 4JLVA 2PLFA 3E84A 4MVJG 4KQWA 2RH8A 4JZKA 5C8YA 1YR2A 1JW9B 1VYTA 2VH5R 4UEQA 4G0OA 4XX0A 1SBIA 3UF0A 2HWWA 4TQAA 5AI6A 5JWRA 1K5GA 4OLBA 1KORA 4AP9A 2PS3A 1Z34A 1JR4A 3DV9A 4X00A 4HAVA 5E9QA 2R8EA 2WYVA 3H2HA 1Z6GA 3P5SA 3QVWA 4U2GA 2IV2X 3VOAA 2BUBA 4E2WA 1SXQA 3KJXA 4YECA 3G0OA 4NE9A 1SRRA 2B83A 4E11A 3ETCA 3LGAA 4W7HA 2H2HA 1UPCA 3IIEA 1UJ2A 3PHLA 4XI9A 4LQ4A 2F9FA 1X77A 2WU8A 4Y2YA 2XXBA 5BSTA 1Y8RB 1HZZA 2JCSA 2UZ0A 4WI1A 5AHXA 4CM4A 3EVGA 4NBVA 1SB8A 4ND1A 3IIKA 4YRLA 4GXQA 1Y8QA 3JQAD 1QRSA 3B13B 1BMFD 1QNFA 3SS9X 1UKCA 2A9QA 2UUBB 1UINA 5HS6A 2CFSA 5CIYA 3A11A 4BP1A 3TH5A 3OEEA 4AF6A 3ZQJA 5F78A 3WL5A 5DN6D 3HL0A 4DWWA 3FVQA 2EYUA 4FK8A 1KK2A 3L1VA 1H0KA 4MV7A 4R5MA 4FB5A 1HMYA 2NZ8A 2HADA 2SHKA 5BUQA 3QXGA 5HSGA 3O3NB 2XRYA 4H6VA 2LDXA 3JRWA 2FUEA 4OMDA 1J0CA 5ILGA 4BQPA 3G2QA 5HCIA 3GJXC 5JSQA 2XOKA 2B8WA 1L5FA 4Q93A 1N3YA 4FNOA 1X7XB 1TQ2A 1NT2A 4GOKA 1C7JA 2O5VA 1FBNA 3H5VA 2GXSA 4C3ZA 2YVLA 5H02A 1TVMA 2UUCB 1O3YA 2Y6VA 2C88A 3CC8A 3CLSC 4MRMA 2AJCA 2BV3A 2BJWA 3BWCA 2PMCA 4CUKA 4KKVA 3TQSA 1C9EA 1T8WA 1R27A 5FL7A 5B4UA 5LSAA 3W9YA 3KZVA 2ZRGA 4KO1S 1NAHA 1R6UA 5ITZB 2AKEA 3AB7A 2UVPA 2QYOA 4F2WA 2X2EA 2JLQA 2ZJ2A 2ZROA 2WP0A 1Q0ZA 2XNHA 3SF8A 1LRJA 1M1UA 2GZ3A 1DBIA 4U1RA 3RJ5A 2O20A 5FOVA 3MELA 4MA0A 1J33A 3GGPA 4B3MB 1QU3A 2EZUA 5AVOA 5JYDA 1OUMA 2L0XA 1J7KA 3JR3A 4K7JA 4M0EA 3SSMA 3K1AB 1GP2A 4JCCA 4R1LA 4EH1A 3NHZA 2CBXA 3WKAA 1LNQA 5IJXA 3SMQA 4CGYA 2XAAA 3AHDA 1JAYA 1RKQA 3HO8A 1Z0FA 5I4CA 5JW6A 5LL6P 3K72B 3P4YA 3LXUX 4JFAA 2GDJA 3WWZA 4M0FA 9GPBA 4CCYB 3U26A 1UPFA 1TI7A 4YJGB 4J43A 3ZW8A 4XSHA 1LEHA 1B3BA 1LVGA 1YBMA 3IP5A 2COKA 3RRXA 4ADSG 4BNYA 4DGQA 1PEYA 2FDXA 5IK2A 2PL3A 2VDJA 3U7FB 3E05A 3LUAA 1UWKA 3ZWOA 2MYUA 2O8FB 1IXZA 2EATA 1CKEA 4GYJA 3I2HA 3IUNA 3LWNA 4NAHA 3WB0A 4JKIA 2O54A 1ISPA 3QSGA 5EXEA 3TQHA 421PA 4YV7A 4UAVA 4L51A 1PWEA 1VKJA 4ATNA 1R50A 2D06A 1JDZA 4DQKA 1J9EA 3HXOA 3QE9Y 1HNWB 4NK5A 1NGSA 4MYUA 2FFBA 2Q0QA 2FLWA 2V0CA 1S7GA 1XZDA 3QITA 5L7TA 1Y8ZA 3U3DA 3D1LA 3ZXSA 4IIUA 5IP5A 5BSKA 3C7DB 1KZ9A 3HO1A 3DKRA 2I7TA 4OHWA 4RU1A 3F6BX 1OXXK 3TZBA 1HDEA 3KZKA 2OD2A 2YVUA 4KKXB 5B3JA 1PFYA 2B99A 3GAAA 3NGMA 3QUBA 3W8FA 2VHYA 4WNAA 4W1PA 5B55A 1ADFA 4RTQA 5DIZA 3R5SA 4DLAA 4DRYA 1T9HA 1RJEA 3E53A 2REOA 5KSZA 4YCMA 1L7MA 3P2YA 2ZJ7A 1U3WA 3M1AA 2EHJA 5CX1B 4A7PA 1XZLA 2A0WA 3M4NA 5F3RA 3HACA 4I50A 1TYAE 4M2LA 4V0ME 1UXKA 2DU8A 1M72A 1PQWA 2QW1A 3FSEA 2XLCA 2NPOA 3UFXA 2FJPA 1NUPA 2C1XA 2MYPA 2YHBA 1BE1A 1MKYA 3N53A 4QD3A 2JIZA 5A0TA 2GJ9A 5C34B 1GPKA 4BP9A 1KERA 2BGUA 4OMUA 5BSWA 2WTNA 4IDHA 4DR2B 2X5OA 1OXSC 1RWVA 2P9QA 4F12A 4ZHQB 3Q3EA 4O25A 2DUNA 2HHLA 4KC0A 3QOXA 4PO8A 3E3AA 4UM5A 4EBFA 4I8XA 1FX1A 1H2EA 3FOBA 3SR0A 3ISVA 5BR4A 2F62A 5FI1B 2WD9A 4YAUA 2I5PO 4OLJA 4RK6A 4Z7QB 3DL4A 2QR3A 3AEYA 3X2EA 1R0KA 3NS7A 2BKUA 4OMCA 4XVHA 3EZ9A 4BGEA 2KI5A 1P1HA 1PWZA 1SULA 1W73A 3M34A 3WMGA 4MV4A 2AI2A 4DL9A 1RQXA 5BOSA 3GLHE 3QPUA 1QRDA 4R1UA 3V1NA 2BWJA 3SC2A 1E4VA 4WKPA 3URMA 3CLRC 2AT1A 4G0YA 3L41A 4RMNA 2V7QD 1WCYA 2XMCA 3D0KA 2QORA 3IUSA 1NC1A 3AKYA 4FYVA 5THQA 5IVPA 2N1MA 1SFRA 1XVVA 3LPAA 3B52X 1R4NB 3K96A 3ENZA 2A0KA 3I2YX 4Y1RB 2IEDA 1XVIA 1K9VF 3E18A 3OTQA 4I99A 2G28A 4O4JA 4RIFA 2HF2A 5HFAA 4QIHA 4UTXA 3QKIA 1W44A 3ETEA 3OA0A 4HAXA 5CT8A 4UM9B 4B3SB 2AC7A 3HUFA 4JCOA 3TDNA 1D1PA 4JI6B 5BV1A 1G6Q1 4NF2A 4CIBA 1VHQA 2OK7A 2AQKA 2D2VA 1EFRA 1C0IA 1WF3A 1EX9A 1PR4A 4R54A 3PDUA 4YRTA 1GIAA 4Z7OB 3INTA 1ZL0A 3AQ4A 2EJBA 3REOA 1I3KA 1Q7EA 2VJQA 1P4AA 4WSOA 5DCLA 1KAOA 1PTJA 3PF8A 1ZNZA 5IC6A 3S68A 5K6AA 1TRKA 4OOEA 5L3RA 5GQSA 5AP9A 1H22A 4ZHQF 1V4VA 1HRKA 4PN7A 4H1HA 1YBVA 3GUYA 5C31A 5JXGA 4LGYA 3WNZA 3B3JA 1C2TA 1V8ZA 4H15A 3ZK7A 3LC1O 3NBQA 3Q2OA 1ZW6A 4UDOA 4C0QC 1UK6A 2H8GA 4KIJA 5DBHX 4DCNA 2XDYA 4CM6A 2AB0A 3JQEA 3TKYA 3QVMA 4U2KA 3AF1A 3PUJA 3VC7A 2P9YA 4NS1A 3N0RA 5FHRA 2QRGA 2EV9A 5IABA 1YZYA 1ZXBA 3HKBA 3ROFA 1GGKA 3GVXA 3HK2A 3I64A 1Q77A 2ZE5A 1I5EA 4V39A 3AY3A 3U3ZA 1GZ5A 3BSFA 4IJ5A 1DIHA 4RWEA 1EPUA 5CH5A 1CEYA 4PSKA 3F7NA 4UE6A 1FNMA 1LBQA 3B1JA 3SQDA 1O9GA 2P75A 1GYRA 3P1JA 1NR7A 2J5XA 4R68A 2BF7A 2B4RO 2Q4OA 1AGRA 4UBMA 5H5JA 3CEJA 1E1MA 1NTRA 2Y99A 4KLCA 2M98A 3EHDA 3URKA 4AJHA 2XWQA 2Q29A 4M76B 2X19A 2BFCB 2XNJA 4X62B 1L4KA 5EJAA 5FEMA 2H16A 2CXSA 2IEZA 2O1XA 4Q39A 5LP1A 2I55A 2VRCD 3VDQA 3QHAA 1AT1A 4PGHA 1CNMA 2VHEA 5EZSA 4XWGA 3CNHA 1G3QA 1H1LB 2NN3C 3NYRA 4BQIA 2B4AA 4UEJA 5G0WA 3KNZA 2ACWA 4IG4A 4D6PA 1Z4LA 4R8VA 1KVSA 3BE5A 1KEUA 2ZGVA 3OZAA 1DI0A 2WLTA 3DCNA 4G56A 4IMPA 1XPJA 1PFKA 2O6HA 3H9UA 1TAHA 2BELA 4FBLA 3KKEA 1J06A 2G88A 4FZJA 1EJ6A 1QTRA 5AOAA 1HETA 2QT9A 1P29A 3OLQA 4ZEXA 3SXUB 5C1IA 1E2LA 2IUEA 4B2IA 3ZGZA 4J8PA 4CV2A 4QRDA 5FUWA 4RGQA 1ZGGA 3B1ZA 3GLHB 5IVDA 1HGXA 1VE9A 3DMTC 4IIGA 3DPUA 4JB8A 1GL9B 1A2QA 4PG6A 1ZNQO 3EGXB 1EINA 3HDTA 1RFLA 2JGMA 3LQRA 3LF2A 4LCEA 4NK4A 5AJYA 3U40A 1CJKC 4JYCA 4PNEA 1T0BA 5I6DA 2IXDA 3GAMA 2P9GA 3LUPA 3Q8MA 4RSMA 2ZVQX 3DMDA 3K0CA 4JUAA 3B8HA 1P3Y1 2B0CA 3IXQA 2J7PD 4CLOB 3LSTA 3C3DA 4E32A 1I2ZA 1U9IA 2IU4A 2O9JA 1V0JA 3P52A 4QUIA 2F4VB 3I05A 5HP4A 1KAGA 1QK3A 5IKPA 3QGMA 1N2OA 1QYDA 2KLBA 3EA5A 4KBFA 2OQVA 1G18A 3FJOA 3VJKA 4YMTA 1FSZA 5JATA 3AI7A 2IOYA 3H1GA 1N2ZA 4Z9XA 4MKHA 1XD2A 3LK6A 3V48A 2X2PA 1QZUA 1W25A 5BYKA 3IPCA 3PG5A 3ECSA 4ML3A 5AIAA 2BEWB 2XNCA 1S8OA 1CR1A 1N9ZA 3KFLA 3LDGA 3N2EA 3FROA 4EVRA 2QMOA 4RK4A 2QUIA 4GC5A 3JRXA 4CKCB 1EKXA 4MWTA 1UDRA 1C14A 3QKRB 2LCQA 5TSDA 2EHDA 2ORVA 1BQ3A 2O05A 5GP1A 1NRIA 3E7XA 4OU4A 4BE7B 4D9HA 3EFOA 5EZYB 5K0BA 2BGRA 1H6DA 1A2KC 1KIFA 3I01A 4U9IS 4W8GA 4B47A 3QYPA 5ARCA 2R66A 3EXFA 5T4FA 3VX4A 3M5WA 2P67A 2RBGA 3AVOA 1G8GA 1N8TA 4P5PA 3A3YA 1SD5A 1T1SA 1ENPA 3VPDA 4U7FA 1T3HA 3MTJA 2GR9A 3O93A 3P4UA 5HW0A 3MGKA 1GTZA 3GV0A 4YP1A 5C53B 1A77A 3AERB 2H7VA 3IVXA 4KE6A 3ZNQA 2YY5A 1UKZA 2PGJA 2Q3LA 2B6HA 2BTQB 3BGWA 3D02A 3MB8A 4LXHA 5I51A 1U7UA 4IMIB 1K9SA 4RZQA 2C7RA 3OOEA 4TGLA 2O0KA 3QFCA 4TXLA 1JVNA 3CZMA 1LX6A 1X7WA 5EL0A 4LISA 4BJ1A 1C2YA 1NG9A 4GXTA 2V3VA 4D43A 3OE7D 3NW9A 1YMVA 2NU6B 1NDQA 3RBVA 4RYLA 5D84A 3D7RA 3A9UA 1E20A 2H4FA 4PX3A 3SYRA 2OQ2A 4DILA 1IHPA 4URXR 2B36A 1Z4MA 1JLRA 4ZCTA 5HKBA 1XEAA 4Z4HA 1G4UR 1D6SA 3QVSA 4MQ5A 4QUKA 3GF4A 4IHAA 1GAWA 3UJ8A 4B3DA 1Y82A 2XB6A 2H3HA 3OLVA 4ZVVA 1ETUA 2C3YA 4F4FA 4B0PA 3TSZA 5EPUA 2UYOA 4J1TC 4AJJA 5K99A 1VDZA 1ZM2A 2WKPA 3BFXA 3HRHA 4CQMD 3H2GA 1A8SA 1I4WA 1C81A 2WOOA 4NMXB 2PRSA 5EZYF 2FW0A 3M89A 5P8WA 5DHRA 4B7XA 4BS9A 1USGA 3L0OA 4II2A 3H42B 1PLJA 3O03A 5BOVA 1I1HA 2DM6A 2QD3A 5MDHA 1VG8A 4DPKA 3EEOA 1DWUA 5CH3A 3W5BA 4C4RA 2P78A 1BC5A 4ZTUB 2H2AA 1AKYA 3E22A 3EMVA 2FW9A 2P9TA 3EB9A 3G7NA 3TW0A 4CN9A 1Z17A 2IYEA 1AUVA 2WQ6A 1ZUD1 2WMYA 3E4CA 2XMRA 1J8YF 1WW3A 2FQWA 2GN6A 2Y1WA 3GLTA 3SE0A 3PDIB 4I1OA 3U37A 2HFJA 3CEAA 2PNJA 1KYVA 1R8XA 4M4SA 1E7RA 4FJ0A 4UMVA 5DX0A 5B64A 4E5PA 4WBXC 4AL4A 1SK8A 3LO5A 3ZVKA 3ANLA 1E1RA 2IDZA 1PR2A 5CA1A 2WOJA 4D0NA 3TZQA 1KSGA 3SIWA 1MIOB 1P45A 2AX4A 1Y4ZA 4A4DA 3BC1A 2QX4A 3OD5A 1NJSA 4PCAA 1U0SY 1F5NA 2IZ6A 3OJOA 3Q3GE 3BXZA 3V4PB 2O5RA 4TMFA 1J5EB 2CN1A 3QU7A 3E70C 1ZN7A 2IX9A 3ZWXA 1A1SA 1J4AA 1MB4A 3NTUA 2WJ4A 3TZCA 1GNTA 2YYSA 1JHYA 4RFLA 2G7MC 2ZB2A 3CB2A 2X41A 2FZVA 5EJ6A 1KSFX 1JHMA 1G20A 5DHTA 2C2WA 5GPBA 3WAKA 2JVKA 3OHMA 4GM4A 4KRFA 1SXJA 4US2R 4TKUA 3D6HA 3DLIA 2YNMC 4G0XA 5LBTA 4OQPA 3AF6A 3WGHA 4OJYA 1CULC 2BMVA 2VNIA 2ZIVB 1U1FA 2BEUA 4JVNA 2WSSD 4CODB 1W85A 2H1LA 4M3NA 2A8YA 4WBNB 2ZI3A 3OM1A 4FKMA 2C29D 2BY4A 2F1OA 2GEDA 2JCBA 3HCPA 2I7CA 4TMYA 3MTBA 1E3DA 1J24A 1X19A 3OOSA 3K0KA 4CEJA 3EF3A 1E1YA 2Z04A 3ZG6A 4E2XA 4OP1A 1AZSC 1S2IA 1VE3A 4LXYA 3I9NA 4EY7A 2GESA 2A3NA 4C6SA 2QZSA 2ZBUA 3U31A 3I9V1 1YQ9A 1WOYA 2WSMA 2QJTA 3ANYB 4IWXA 4QOSA 1VIAA 3PGKA 3PJDA 4NDNE 4Y8VA 1Z29A 3WLHA 1E9BA 1M0SA 1MR3F 2VRNA 1CUUA 1WHSB 4Y2RA 4WASA 4LC9A 3OJLA 1CY7A 3N6XA 1E3LA 3I0MA 4NHOA 5EIBC 5IUJC 5HUJA 1YDHA 1RMQA 4XYBA 4DIUA 1FX0B 4IJKA 1DOZA 4BMCA 4RO0A 1FTYA 3R6GA 4L74A 3G5LA 2P2LA 1QGUA 1VL2A 4RY2A 1RAFA 3TRJA 3SQWA 2CKDA 1D2AA 1L4HA 2QVGA 2O2ZA 3DMFA 3EDCA 3PCRB 2WMDA 1NIJA 5E7IA 5T41A 3T3IA 5JYBA 1OH6A 3SVLA 4CMEC 1KJWA 2QRKA 3ZHSA 4DV6B 1L6IA 4XRGA 2A58A 1NQXA 2OLEA 1M7GA 2J0UB 3QWHA 4ETWA 1WP4A 3S0JA 4GKVA 1KH3A 3G2LA 4D81A 4AMYA 4X84A 1YR6A 2NSYA 1GKYA 1LI7A 4DJ5X 4YQEA 4F92B 3ZD7A 5AM3A 3T7SA 2C4HA 3GW8A 4WBNF 1OIWA 4HATA 5CVDA 3S2SA 1WXHA 3A1VA 4B87A 3ZPXA 1E9RA 2ZRQA 2HTEA 3R2JA 4P84A 3RWBA 2G1UA 2H1RA 5CB8A 1HE1C 3PYLA 5K0JA 1XWFA 3F0TA 2P9EA 4EW2A 4NICA 1IFXA 4GBGA 3LRPA 4M1SA 1WXGA 3S5JA 3VJLA 3JVVA 2E55A 4TM7A 3TIVA 5DK6A 4DY6A 1KH2A 5LQNA 2PO5A 4G0QA 3UHOA 4RTOA 2PUCA 1DAKA 1L1QA 1RHJA 5DCYA 3PUIA 2GBCA 4WAUA 1NV9A 2A3RA 3M0EA 1SN7A 3M6LA 1QYRA 1DFGA 3OEED 4A1FA 1EK1A 2A9KA 4IZHA 3TZHA 2QTAA 1M2FA 1YBAA 2Z5VA 2HIHA 3EWNA 3R76A 3PDWA 5BT8A 3FH0A 3RUCA 3CG4A 1T0IA 4G5GA 2GSDA 2HBQA 3L7CA 4ZAYA 4PQRA 2AN1A 3RWMB 4TTPA 4ER3A 2W2MA 3OA2A 1K68A 2VWQA 3OEHA 1RZ3A 4B45A 1ZHOA 2XOKD 1N0VC 4IS3A 3CA8A 2JC3A 1CBUA 3N6RA 4NMMA 5AKEA 5ALEA 1Z33A 4XGKA 5HF9A 3EISA 4RIGA 3PCXA 3W5HA 1RQGA 3AR4A 3L43A 4F8YA 1W2GA 3Q7TA 1BCSA 4D98A 2J3IA 2AFIB 3TLGA 1AGNA 2X4DA 4CDNA 4HV4A 4NCBA 2FP4B 1E5VA 1SBNE 3A1CA 1L5YA 1U3GA 1ONOA 2FETA 4X24A 5FL7D 4U00A 3WYCA 1NFQA 2WD7A 3WNDA 1Z6PA 2ZYSA 3U4MA 3P0FA 1RCTE 3CRNA 3NWPA 4G8JA 2AJBA 5DMHA 2NTVA 1Q7TA 1SJ9A 3MZ0A 3VU9B 4U39A 5L6MB 4JXZA 5EQDA 3NTRA 2JEOA 5HZKA 1E4YA 3BZUA 3KWMA 4US1R 2ONCA 3A3NA 2AOTA 2XYQA 1WQ4A 3V42A 2E5WA 2HRZA 1IQRA 4ALLA 1TADA 1SUIA 1Q6YA 2HGSA 1HOTA 3IAFA 5C3MA 4YAOA 2QM7A 2DB3A 1XWIA 3KHKA 4GH5A 5EJIA 5JZ9A 4P98A 4RIEA 1APBA 1O6GA 1ZN8A 2NYAA 3A9SA 2EU8A 3OI7A 4RKEA 4CIAA 1SWVA 4TMVA 4V3BA 3AFOA 1GNPA 1W4ZA 4C0WA 4QUBA 3COVA 4JHXA 2LCIA 3GDWA 5FA6A 4F5ZA 2OBBA 3IDOA 3QLJA 5A9SA 5ISMA 3R44A 4FR2A 3M2PA 5IK2D 1XNJA 5CCEA 1T5HX 3BMCB 1O5IA 2OORA 1KKMA 1XZFA 2N0SA 3PPWA 5GIOE 2WYWA 3TS1A 2WIJA 2QU7A 1P9NA 3MJTA 5ALRA 1A04A 5DO9A 5H80A 1L7BA 2PD3A 3UO8B 4REQA 3RJ9A 4BO6A 4QJ3A 1YA4A 2UXBB 3ANMA 3AO0B 1H8HA 4QGFA 2PXHA 3VR1A 1NY6A 1NBAA 1NP6A 1VB3A 2HHJA 4LX8A 3VYTB 1I13A 2O4UX 3LWBA 3PUHA 2CV0A 1ZVQA 3SEAA 4H7DA 3CKMA 3RVOA 4YV0A 1IONA 3WRWA 2GAFA 1KARA 2B5WA 2Q1SA 1U3UA 1I2BA 2AWNA 3JQDA 2AYXA 1DHTA 1KY4A 5GV7A 2TRSB 1DEKA 2AEJA 4R0MA 1GKLA 2C7BA 3GJSA 4E94A 1DAFA 5AW1A 1NY5A 1H42A 1L7OA 2BE7A 3AH8A 3G9TA 3VPBA 1W4BA 1IM8A 5KPDA 1EX7A 4O08A 3W5CA 3EN0A 3MJEA 5A02A 1WVIA 1JUDA 2WW8A 2XDQA 1GLVA 4BLPA 4DMKA 4MIOA 5DBFA 3CX7A 3VR6D 4MPPA 4WZAB 1PGOA 2V4ZA 2HUPA 3FFAA 4DMGA 5KHLB 3COJA 2SICE 2R6AA 2VTBA 4V0RA 3ECAA 1GVNB 4FYYA 3BN3A 1ESCA 3NFYA 4YP7A 1ENOA 5FBWB 1NSFA 5CD1A 2CB9A 3W5UA 5FPHA 2JIZD 3NPMA 4G26A 3HVUA 3QE4A 1CRWG 3NWBA 2EGGA 2BPOA 1V9LA 3BK2A 2YV5A 1T9BA 4IDAA 2WINI 2XKJE 4K0RA 4KGDA 4IFTA 4TQGA 3D4PA 4M8IA 5D1HA 5L40A 2EYQA 1S2MA 2OO5C 4MULA 3T5BA 1NQ5A 1TZCA 4FEEA 4ZOBA 4ZQGA 2CD7A 3ZHCA 4D4MA 2OV3A 1UR5A 3OIYA 4P33A 2GTIA 2G9UA 1LC0A 3L6OO 1JG6A 4D9FA 3W7BA 2M6SA 4Z1OA 1WHTA 2GBIA 4NFSA 2UVQA 1Z35A 4XCQA 1M2NA 1E1CB 1JLHA 3HBAA 1ZZEA 5HPYB 1ATIA 2I7DA 3OZUA 2JGRA 3WMXA 5HIAA 4L4RA 3CVXA 1RRMA 2C61A 2CJYA 5J2UB 1NTOA 1IM2A 4HKTA 3IT1A 1CY6A 2O3RA 4NOLA 4P81A 1P2BA 4YMSA 2IBTA 3C41J 1QQ7A 3GFVA 4PYLA 4HEHA 4Z4EA 1LKZA 1QANA 1JDSA 1J42A 5KX5B 4UVHA 2Z43A 1L5OA 1J20A 2F2TA 1WPRA 3ZE1B 1N2SA 3A6FA 1P81A 3F4BA 4RPGA 1CF2O 4G25A 1GTG1 2D0OB 1E9SA 1XCJA 2GK7A 3FNHA 5K0LA 4G86A 1X13A 1G21A 2R6DA 4LRSB 4WOBA 4D4LA 3W3AH 1RI5A 1K0UA 1TTPB 1W2HA 4KCGA 4BWFB 4YPOA 4UJ3A 2BFEB 1VJGA 1U6JA 3G85A 1E2IA 1FYEA 2GEVA 2PT9A 2XYVA 2JHGA 3E3NA 5B12A 2RAVA 1UMCA 5AKJA 3K6SA 2A92A 4FIZA 2HQSA 4WLOA 4DLYA 4O8ZA 3HTXA 4X8MA 1NBWB 4UKDA 1SU4A 1G5RA 1R0CA 2GNAA 2Z3WA 1B74A 3GUCA 1GNLA 4FMCB 1UP4A 5EG5A 5DASA 2XMGA 1JI0A 3KKKA 2EW2A 2LKCA 2VBGA 3NM4A 4WFIA 4WGGA 5CGQB 2D00A 2Y76A 3PNOA 2F8SA 1P4JA 2R8YA 5JNSA 1E9EA 5F73A 4E1BA 3D4BA 1V7QA 4OOFA 1CETA 4BGIA 4V1CA 1T3LA 4KSCA 5EQJB 3AEKB 3NETA 3WKBA 5G0VA 4QQKA 2MDTA 4Z51A 1UC5B 2GZ2A 1D5WA 3R7FA 1G1MA 1DTWA 3IA2A 4HQLA 4H08A 5JI3E 1UK8A 4DNQA 4B1FA 1R0YA 2VHJA 5L53A 4F8JA 2WI8A 4CM9A 1EQAA 1E64A 3GLVA 3MAGA 3LQYA 1N4DA 4PZCA 2FJ0A 2VBFA 3BCHA 5A5DA 5KX5F 2E2WA 4N9WA 2FPKA 3ZJ4A 2H6EA 1NNEA 4LGVA 4HX5A 1RC8A 2DERA 2ZRNA 4PWYA 2AQIA 3GJZA 1GFWA 1VE6A 2WJIA 3IVGA 3LWZA 4HGQA 4J3NA 3TX6A 3ZIAA 3DBHB 1KFKB 2V9PA 1U9ZA 4MRVA 4UE3S 2O52A 3T4EA 3WWYA 2RAUA 3OQIA 3BVPA 4FDMA 3DEJA 4RKRA 4RD1A 4UUOA 2A0FA 4MV1A 4RVDA 5D87A 1Y6QA 3OPYA 3PDCA 1BXGB 4BB9A 4DDWA 4J0JA 3P2MA 1VMDA 3NAGA 1P0IA 3VI3B 3L04A 1ZQ1A 2GO1A 3BE8A 3G1WA 1FP6A 1TT5B 4LYHA 3S8YA 1XDWA 4FS3A 4P38A 5EUQB 2C94A 2PZ8A 5HE9A 4FMCF 4HEA6 4W7IA 2UZ3A 4BECA 4S2UA 4QARA 3U9LA 3T7EA 1WU8A 3ZKAA 3GIWA 1H4QA 2X13A 3NUZA 2VXBA 1HF3A 3IPRA 3IL2A 1PZHA 5JZVA 4FNMA 3IAS1 3K5PA 4UJ5A 2CY0A 1RAIA 1WVMA 2WFLB 3LYLA 4ZFNA 4UZSA 3LGSA 3AVVA 3AVWA 3LLMA 4H7IA 2NM0A 1PFWA 1GA6A 4E2FA 4KIWA 3LUDA 5ALSA 3M5DA 2EGHA 2Y1OA 3MWGA