2DPMA

Dpnm dna adenine methyltransferase from streptoccocus pneumoniae complexed with s-adenosylmethionine
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
275
structure length
258
Chain Sequence
TLQPFTKWTGGKRQLLPVIRELIPKTYNRYFEPFVGGGALFFDLAPKDAVINDFNAELINCYQQIKDNPQELIEILKVHQEYNSKEYYLDLRSADRDERIDMMSEVQRAARILYMLRVNFNGLYRVNSKNQFNVPYGRYKNPKIVDEELISAISVYINNNQLEIKVGDFEKAIVDVRTGDFVYFDPPYIPLFTSYTHEGFSFADQVRLRDAFKRLSDTGAYVMLSNSSSALVEELYKDFNIHYVEGKISEIIVTNYEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the DpnM DNA adenine methyltransferase from the DpnII restriction system of streptococcus pneumoniae bound to S-adenosylmethionine.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
molecule keywords PROTEIN (ADENINE-SPECIFIC METHYLTRANSFERASE DPNII 1)
total genus 89
structure length 258
sequence length 275
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 1998-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 2dpmA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2dpmA01
4QDJA 5CCBA 3P9CA 3O4FA 1G8SA 1O9HA 3FPGA 2AOWA 3SSNA 1P1CA 1JQDA 5HIKA 3LDGA 1JG2A 3DXZA 4KVZA 4BLVA 5DWQA 1PJZA 3KR1A 5F2OA 3NDJA 2PSSA 1D2HA 3MGGA 4A6DA 5CVDA 2OXTA 4PYNA 3HA7A 4XUEA 3FPHA 2F8LA 2B2CA 3M4XA 3KQYA 3OPNA 5E1DA 3LGAA 5EKXA 4DF3A 4MHTA 4QVKA 5DX8A 1NE2A 5ICCA 5FADA 3LDUA 3LBYA 3VC1A 2B9EA 4FSDA 4ER7A 3LBFA 3ORHA 1N7IA 4WXHA 5HZMA 1FPQA 3VC2A 1R8YA 2ZBRA 4RTPA 3HVKA 4CTJA 2ORED 3M6VA 5DTRA 4C4AA 3TM4A 3R24A 1RI5A 4EQZA 1G60A 1XDUA 2ZLBA 2PX2A 1YUBA 4E30A 2I7CA 2P40A 3MTIA 1VIDA 2OBFA 2PGXA 3G2MA 4MQ4A 5CVVA 4LG1A 3HP7A 1KR5A 2H11A 3KQTA 5K0CA 5KQRA 4L7VA 4R6XA 2YUIA 2ZULA 2ZBQA 3FRHA 2FYTA 2PXCA 2HMYB 4V0QA 2NP6A 4ZTBA 3MCZA 3M33A 3HEMA 4X61A 3TQSA 3EGIA 3LCVB 2UZ4A 1M6YA 3GJYA 3CCFA 1QYRA 3KR9A 3LPMA 3BXOA 5DSTA 3P8ZA 3ELWA 4KRGA 5D1NA 2BH2A 5KYGA 2O05A 3EMDA 1QAMA 3SX0A 1RJFA 1QZZA 3PX2A 2AOTA 4EKIA 2PX4A 3OE5A 3CKKA 5EMLA 3DH0A 1O9GA 4EK9A 2XYRA 3MCTA 5MHTA 1RI3A 1L3CA 3O31A 2OYRA 5E8JA 5DT2A 3OU2A 1N2XA 3DMFA 1TW3A 3DULA 3REOA 3NWEA 4CKCA 2P3LA 3UJ9A 3P2EA 1T43A 3M6XA 4ER0A 2C7QA 1HMYA 5E8RA 3HCDA 3DUWA 3V8VA 3I53A 1I1NA 5K09A 5B1SA 2ZIGA 3LKDA 1OR8A 4DQ0A 2YTZA 2UYOA 3TKYA 4AZTA 4ISCA 4E2ZA 4GOOD 4YUXA 4MIKA 5CIYA 2PXXA 5LSAA 3KPWA 1G38A 4HSGA 2EJTA 4YUZA 3A27A 3AXTA 2VDVE 3PFGA 4RTOA 4PYOA 4RVGA 4Y30A 1FBNA 1ORHA 1XTPA 2JHAA 1X1DA 4FT4A 3P9NA 4PIPA 4R8SA 4XUDA 5FQOA 3FTCA 4OBXA 4PYKA 3KHKA 2Z6UA 3JWIA 3TMAA 3EGEA 4KDRA 3DTNA 2GPYA 5T64A 5K0EA 3P2KA 3ER9A 3EVBA 1BHJA 5K0JA 2EFJA 1JTEA 5BW4A 2NXJA 1BC5A 1ORIA 2IIPA 4PCAA 2FK7A 5DXJA 1M6EX 1RI1A 1SQGA 2JHCA 4E33A 2QM3A 2FK8A 2IH5A 1IXKA 3LCUA 3RODA 2NXEA 4OQEA 2O07A 5M5BA 2JG3A 4E2WA 4BP1A 3IYLW 4AX8A 3C0KA 2IFTA 1KIAA 5E1OA 5P8WA 2ZTHA 3LSTA 1JTFA 3RW9A 2QE6A 2ZZKA 2C7OA 1EIZA 3O7WA 3EVDA 1G6Q1 1SQFA 2YR0A 1B42A 4RVDA 1Q0SA 5CM2Z 1EG2A 4KIFA 2XVMA 5CVUA 5FULA 5DLYA 2PBFA 1VLMA 3OU7A 1IM8A 3GIWA 3TFWA 5EZSA 3E23A 2ADMA 1JG4A 1DL5A 3CJTA 3EGVA 3Q7EA 5E2BA 3FUTA 2CKDA 2YVLA 2QRVB 1TPYA 4OA8A 4C04A 5C0OE 4RVFA 4PNEA 4X1OA 5EMKA 1AF7A 3G5LA 5FA8A 3UJCA 3ER8A 1X1BA 2JH9A 2A14A 4KWCA 4UOEA 4WVLA 4DCMA 1UIRA 2CMHA 4RTSA 1L3BA 4RSRA 2VDWA 3EMBA 1WS6A 2NNWB 5DM2A 1AV6A 3JWGA 2H00A 3HCCA 3GRRA 3DXYA 4BLWA 4DCGA 4YV2A 3S68A 2P7HA 3KR0A 5BW5A 1VP9A 9MHTA 2AVNA 3QOWA 3I64A 2OY0A 5E9WA 4X60A 4C07A 2AOUB 2OB2A 3BWYA 4CXMA 2OO3A 3KQWA 2ZFUA 1WXXA 5EZQA 3SR4A 5FA5A 2C7RA 5EEGA 3HTXA 2IH4A 4HH4A 5HIJA 4M7RA 3NVKI 1VE3A 4M38A 3UBTA 1KPGA 2JH8A 4P7KA 3T7RA 2P3QA 3K0BA 2P1DA 1SUIA 2AN5A 3AJDA 4PYLA 3EEYA 4HGZA 5GP1A 2AS0A 2NYUA 1YF3A 4QQKA 2Y1XA 2P8JA 1JSZA 2ZIFA 5FHRA 1Z3CA 3LECA 1XXLA 1AQJA 3G2PA 3I58A 2G72A 2ZBPA 3T7SA 2FPOA 3I9FA 2IDKA 1Y8CA 3WSTA 4CTKA 5CD1A 2YQZA 3KR2A 4RTLA 3R3HA 5BP7A 4GC5A 3AWIA 3BGIA 1QAQA 1FJXA 3NJRA 5LQNA 1UFKA 2AOUA 5K05A 3DOUA 3EEOA 2ZIEA 1U2ZA 1RJGA 2E5WA 4E70A 5K03A 2JHPA 1R6AA 3MQ2A 1XCJA 3TKAA 4YUWA 3FUWA 1X1CA 1VBFA 3A7DA 3LL7A 5LQUA 3EVEA 4PGGA 3C3PA 1EJ0A 4GQBA 2BR3A 3CGGA 3EVGA 4IWNA 3IEIA 5E9JA 5EG5A 3UJ6A 3UA3A 2IH2A 1KP9A 1YB2A 3VYWA 2FHPA 3AY0A 1F3LA 1NBHA 4IV8A 3F4KA 5H02A 4C05A 4DM3A 1XDSA 5FCDA 1R74A 4R6WA 4YUVA 2YX1A 3FUVA 3FYDA 2IBSA 1L1EA 4FR0A 2I9KA 5ICFA 2WA1A 2GLUA 3HA5A 4EKGA 3MTEA 4Y2HA 3B3FA 1NW5A 3NW9A 3UJ8A 3KQVA 4FT2A 2B25A 4HG2A 2PT6A 4OBWA 5E1BA 5EQJB 5EKUA 3THRA 4YV1A 1SKMA 2AOTB 1MHTA 1ZKDA 1P39A 3HCAA 4K6MA 3QV2A 3SGLA 4AZVA 5K0NA 2CWWA 2V7EA 3KPJA 2XBMA 3ELYA 2UYCA 3HCEA 3LX6A 4F85A 4F84A 4PYMA 3GGDA 4XUCA 4GBED 1UWVA 4LECA 2PX8A 3NMUF 2WK1A 2PY6A 1JG3A 5EHIA 5E2AA 1VL5A 5KVAA 3QOXA 4X63A 3OFKA 3IV6A 4DKJA 4RTRA 4CKBA 3R9XB 2ZZNA 1ZG3A 3FPJA 4M36A 5DSXA 4FS8A 1KYWA 4RTMA 3KQPA 4M37A 1NV8A 2PXAA 4GF5A 1FP1D 1JSXA 3B7PA 1R8XA 4GOLD 4RTQA 2AN4A 2N47A 3FPEA 4P58A 3LKZA 4PYQA 3TPZA 1WXWA 3A4TA 5GM1A 8MHTA 2AN3A 2PT9A 2PV0A 3LDFA 4HTFB 3X0DA 4PGHA 3KPYA 4GUAA 3HA3A 4HRAA 2ZWVA 1VQ1A 2ZW9A 1YZHA 5DX1A 5F2NA 5HILA 2HV9A 3G7UA 5CUQA 2Y1WA 5K0BA 3SSMA 2IBTA 2CL5A 3DMHA 1AQIA 5JR3A 3SMQA 2XYVA 5HEKA 4ER3A 2PWPA 3G88A 3OCJA 4QDKA 5EHGA 5LQRA 3BKWA 3DMGA 3KQSA 1G55A 3B5IA 3B89A 3GRVA 3PVCA 4E2YA 2ZVJA 3UJBA 1I9GA 4QPPA 5DRYA 4X41A 3LHDA 4PYIA 3M6UA 5DTMA 5T6BA 1P1BA 2PWYA 3ID6C 4FGZA 2ZCJA 2EJUA 3ANXA 2G71A 2ONYA 5EMMA 5DM1A 4LWPA 5FWAA 4QPNA 1QAOA 3TLJA 4FP9A 5EIFA 2I62A 3FTDA 3CBGA 4G56A 2Z6QA 3C3YA 3EVCA 1JG1A 1VP3A 3B3GA 3I5UA 5K01A 3EPPA 2HNKA 4IKPA 3A25A 2VS1A 1ZGAA 5E9QA 4QQNA 3FRIA 5ICEA 5DM4A 3AXSA 4B17A 2DPMA 1VPTA 2QY6A 1R00A 3ELDA 4IV0A 2IDJA 2R6ZA 5LQKA 3G89A 2PVCA 3BZBA 3FUUA 4P7JA 5GIPE 3BKXA 4PIMA 3SSOA 3UZUA 3JWHA 3UFBA 3GRYA 5DTQA 3HM2A 3GO4A 3P71T 1BOOA 1X19A 3P2IA 3PLAE 2B3TA 5ERGB 3PFHA 2P35A 3T0IA 2HR1A 2OZVA 2BR5A 1KPHA 3SXJA 2O0LA 2G70A 5EOVA 3B3JA 1EJ6A 4U7TB 3PT9A 3DXXA 3TOSA 2EX4A 3M6WA 5IKMA 5KQSA 4PYJA 4QTTB 3KQQA 3FZGA 4RTKA 4YMGA 1KYZA 1D2GA 3KKZA 3DLIA 3KQMA 3M70A 2HTEA 4QVGA 1M0EA 7MHTA 3ME5A 1ZQ9A 2BM8A 3E7PA 1BKYA 3BT7A 4JXJA 4H0NA 3GU3A 3GDHA 3L8DA 5LQAA 5E1MA 4XCXA 3K6RA 1NW8A 5DRTA 2V74B 3EVFA 3OZRA 3PTAA 1NW3A 1KXZA 1RJEA 3GXOA 3NTVA 3P9IA 4BLUA 3Q87B 3FTEA 1HNNA 1X1AA 1NW7A 1NV9A 1V39A 1L3IA 5EIWA 4ER6A 3E8SA 2P41A 3GCZA 2XVAA 1EAMA 2VP3A 5EPEA 1JQ3A 2AVDA 1IY9A 1JR4A 4CKEA 1L9KA 2ZWAA 4R8RA 2FCAA 4BP3A 3E05A 3FYCA 4DZRA 1JQEA 3NWBA 4DMGA 5FUBA 3OFJA 4P7FA 2GS9A 3UJAA 3G8BA 4PINA 5K0LA 3CC8A 5EMJA 2PLWA 2ZSUA 3DP7A 1DCTA 1RI4A 2LD4A 4C08A 2JJQA 3KU1A 4ATNA 2UYHA 1I4WA 5DXAA 4CWAA 4V0RA 5GM2A 3ERCA 3G2QA 2I6GA 3LCCA 4FZVA 4KDCA 5FQNA 3GRUA 1YZ3A 3A7EA 2G8NA 3UJ7A 3G8AA 3D2LA 3PS9A 4QTUB 2IP2A 3TM5A 2AR0A 1F38A 1YFLA 4R05A 1D2CA 4A6EA 2R3SA 5ICGA 4EVIA 10MHA 2GA9A 1ZGJA 4P7GA 3DLCA 1N7JA 3R0QA 5GOZA 4YMHA 2GH1A 2B78A 4AUKA 2GAFA 4O29A 4E31A 5JUWA 3MHTA 3FUXA 5KS2A 3BGDA 3KQOA 1PRYA 1DUSA 2NXCA 2OB1A 3JWJA 3NDIA 3OZSA 4PCLA 3TRKA 4E2XA 5LR6A 3UA4A 5FWDA 1WZNA 5G02A 4AZWA 5K0FA 4C06A 1KHHA 2ESRA 3BGVA 3HVIA 1RI2A 1NBIA 2H1RA 4FSXA 4RWZA 3UWPA 2Z6AA 5EC8A 3R6TA 2NP7A 1SVUA 2HWKA 4PONA 2AOXA 2BM9A 3NVMB 2OPBA 4DA4A 4RV9A 3T7TA 4OQDA 3U81A 4POOA 4MWZA 4RTNA 4YV0A 2ZZMA 3UJDA 4KIGA 2QYOA 3C6KA 4E32A 1MJFA 4BY9E 2BR4A 3SM3A 3OZTA 2GB4A 3THSA 3GRZA 1WY7A 5DPMA 5HOQA 2DULA 2KW5A 1QANA 1XJ5A 5C1IA 4F86A 3MB5A 5CCXA 1H1DA 3G2OA 3BWBA 5EGSA 5LQCA 5LQJA 5CVEA 3KPVA 4GOND 3BWMA 4YUYA 3OE4A 1NKVA 3RIEA 3KPUA 4KW7A 4AZSA 2WA2A 3EVAA 4MTLA 4OA5A 5K0GA 2CMGA 4RVHA 4RX1A 1XDZA 2K4MA 5D1HA 5HIIA 4ER5A 2P3OA 3PB3A 1YFJA 4C03A 3G5TA 1ZHFA 2NXNA 5DX0A 2IPXA 3H2BA 3FTFA 2Q41A 3EVZA 1WG8A 3CJRA 3IHTA 1Q0TA 2AOVA 2PX5A 3ELUA 5HFJA 2P7IA 5EEHA 3VSEA 4LWOA 3TR6A 4OX9Y 5FTWA 2UYQA 3P9KA 1FP2A 2C7PA 3PX3A 3HCFA 4GC9A 4RTJA 4Z2YA 5F2KA 4HTFA 5EVJA 1XVAA 3BWCA 3CJQA 3C6MA 1P91A 3HCBA 2YXDA 4HC4A 5C9ZA 2O06A 5K8VA 1NT2A 2ONZA 1O54A 5GINE 2YXLA 3HVJA 3CVOA 4GEKA 5GWXA 2ERCA 1NW6A 5FHQA 3MERA 3A26A 1RJDA 2BZGA 1KPIA 2PKWA 2YXEA 3HNRA 4NECA 4U7PB 5DM0A 2QRVA 1SG9A 5IH3A 3SVZA 3MAGA 3OU6A 2VDUE 2AZTA 2FRXA 3P97A 1INLA 2EG5A 2VZ9A 5T67A 2G1PA 2O57A 3GNLA 3FPFA 3HVHA 3BUSA 5HIMA 1G8AA 4RYLA 1TW2A 3V97A 4EMSA 5U4XA 1XCLA 2XYQA 2OKCA 3DR5A 3GWZA 4HGYA 1R18A 4GOMD 5CVJA 5BXYA 4PWYA 5GIOE 2IGTA 1EQAA 1SUSA 2PJDA
chains in the Genus database with same CATH superfamily
1I2CA 1CYEA 1LPBB 1H94A 4JI2B 4I1SA 3KEQA 1JB1A 5LP6C 1SC3A 2JFVA 4FE7A 2A5DA 3FPGA 1RTTA 5CT8A 1CUJA 2OBNA 1B0ZA 3EH2A 2NZWA 4BLVA 5GGYA 2HN9A 3W90A 3JASA 2V5UA 4NK5A 5B3KA 4U39A 1ADBA 2Q3LA 2W2OA 4TTAA 1J24A 1X7HA 2Q0XA 3RS0A 2G77B 5EKXA 2CDBA 4DF3A 1CUBA 3QMWA 3U4AA 4D26A 3EXHC 4IO1A 4C5AA 3GMDA 1RYBA 1ZCFA 4UJ3A 4M8IA 3L0SA 2K2QB 2YNMD 1E5TA 4DMRA 3MGCA 4D3YA 3ML1A 2QORA 4B3TB 2CLLB 1NFRA 2OCPA 1I6WA 4ZOLB 3KG2A 3HPRA 5K4GA 4A1FA 4ZDJA 3V9AA 3CCCA 3H42B 4FJ0A 4D2IA 1PW5A 4C4AA 1IJKA 1ZD5A 1GIAA 4NNJA 5JYBA 1SHZA 1VMDA 3O8OA 4DBLE 5BN3A 2PX2A 1GITA 3NONA 3MZ0A 4UKDA 5JAZA 3EPKA 3U9LA 1C7QA 2ARKA 3AHCA 3E0XA 1IY2A 4RMGA 4Q39A 2PD4A 2NUTA 1GPH1 1O57A 1JEEA 3EFOB 5J63A 2Z2XA 4Z9YA 2YUIA 2VHVA 1E2GA 1YJAA 1CF9A 1P7YA 2PLNA 3KJGA 4DLRA 3D6JA 1II0A 4JT9A 3OX2A 1O89A 3E48A 2A59A 2JASA 3LCVB 3A6ZA 5J5CA 3ZK7A 3ZZTA 4C7OB 5A0TA 4HLNA 2PGLA 4JSTA 4BBPA 3ONNA 4BX0A 4L9RA 2YVQA 2DSNA 4R81A 5JCJD 4KRGA 1DRUA 2Q1XA 4QHTA 3I45A 4BKRA 4BN0A 1ACMA 1UK9A 1AZTA 3FNBA 1CLEA 3PUYA 4LBZA 3DWEX 3GLHB 2A67A 4L2IB 1E9BA 2F3RA 5B30A 1PBNA 2CVOA 4RGQA 5LCXA 4YRIA 3SKVA 1BYIA 3N0WA 1A5ZA 1IXSB 4OVKA 5DHAA 2JGDA 5ISMA 1J5PA 4NBTA 4F6RA 5IKXA 2A9VA 3A9UA 3QE3A 4ZMBA 3FWHA 1LRLA 4BQEA 1MHPA 3MT0A 3EOZA 2C1XA 3JQFC 1E2KA 1YR2A 2JBHA 5B2FA 4RA6A 3QWHA 2Q49A 5EPOA 2ID4A 5B1SA 2ZIGA 2YCLA 4L8VA 2I2XB 3WK9A 4DDWA 2YMQA 2HA4A 4ZWNA 1E64A 1M73E 2IHUA 4FYJA 2DAPA 4EI7A 4NZOA 4TMYA 5TQ0A 3PI7A 4MDYA 1E3QA 2NW6A 5CX1B 1QM5A 3QBDA 2D5IA 4C2AA 4ZJZA 4ZMRA 1I3OA 2ZBGA 4U7DA 5DASA 1ZD9A 3U7HB 1JBKA 3H87A 4R1QA 3CW8X 4CRWB 5IWCA 4KQ1A 3H7IA 4RZXA 2ZJAA 2JKZA 4FYIA 1I4OA 1PSZA 3FYUB 1U1CA 4LBVA 2CNWA 2X8AA 3L84A 1GYQA 4EM6A 5K0JA 3PC8A 4NIMA 3D1VA 3NGLA 1M6EX 3E1SA 2CVQA 4IXTA 4QEZA 3FMVA 4UCQA 1J21A 4KBYA 5CR9A 2WM2A 3E9DA 3VVBA 1PHRA 4OQEA 4CEHB 4NFYA 4B73A 5IT5A 3R3YA 2X9GA 3B1ZA 2JI7A 3IR5A 4BNZA 5AW4A 1GRRA 3NYRA 4U7GA 1Z8FA 3O92A 2GKSA 2ATEA 5IABA 4Q7KA 2XUDA 4GZ5A 4EJMA 1EG2A 1P6XA 4KIFA 3ZQKA 3EUFA 1SZPA 2YHIA 4G8JA 3IVXA 3OU7A 1Q3HA 3EGXA 5H7XA 3L7IA 5BT8A 5M2QA 3Q0EA 5EZSA 1NVGA 4YCMA 4ZZ2A 2J67A 3WKCA 4ZFNA 2H1CA 2YW9A 3B6EA 2P9HA 4DNPA 4EF5A 4O4LF 2H17A 5KCMA 1N3LA 4D0NA 4UM7A 3L7OA 1RU3A 4UOEA 4Y1RA 1GSAA 5K0ZA 1SY7A 2QRMA 1D7AA 3GHHA 4RSRA 5JVDA 3OY7A 5AKJA 3EMBA 1FU8A 1TZ2A 5K3DA 3UAZA 1QGYA 2CVZA 1XZKA 1E4EB 3GRRA 3VZBA 5CGZA 3TK1A 5I9TA 2WV9A 1JKIA 2X0EA 3A1FA 3B53X 4X3PA 1WDTA 3IB3A 1RRKA 4W5TA 2AOUB 4ZT4A 1Q6YA 3KQWA 1A9PA 4LX0A 4UDNA 4YMVA 5FI5A 4IV5A 1OBFO 1RE1A 3QUSA 3OHPA 1D1SA 5AKZA 4DR7B 1YNSA 1IOLA 3PWZA 5TE9A 4CM6A 4MUHA 1YZLA 1K27A 3EZGA 3IKJA 4H08A 1TC2A 4LHXA 1CJUC 4U5XA 1A8QA 1N1GA 1M74A 3R4VA 5JAHA 2J7KA 2OEPA 3I9FA 4QJ3A 3AY6A 2IHVA 1ZK3A 4QRHA 2G67A 3BGIA 5BN4B 4OHZA 3FPAA 5SY6A 4DGSA 2WJIA 5GY7A 1UFKA 4JJAA 1VFNA 2NTVA 2VDKB 3I9LA 1IN5A 1TM3E 3T7EA 3H8JA 4IHJF 2HLHA 3AVQA 4WN9A 5LN1A 1U7ZA 1X1CA 1VBFA 3A7DA 4LDQA 4M0LA 1QV6A 3EVEA 4L9AA 4NJOA 3C3MA 5EMHA 5IDVA 1ABBA 4MW5A 1UOPA 2MYNA 5KYWB 3U13A 1WB9A 5E9JA 4HXFB 1H69A 4CJXA 4BKUA 1L7MA 2ODWA 5JMTA 1YB6A 4FYMA 1G7RA 1MVOA 1Z29A 4CT0A 4Z51A 1R74A 2VP9A 3M5DA 1S96A 2NPFA 2TSYB 2FDCA 2JBAA 4N18A 4FCCA 4RKQA 2DHQA 1NJ8A 3ITEA 1YJCA 4CMEC 3EUEA 2QRKA 3IOEA 4J0IA 5G0VA 4ZIRB 4NCNA 5DYYA 3AEQA 3QHQA 2BLNA 4HRVA 3WL4A 2QN6A 3A0RB 5AJVB 1DARA 2CWWA 2GXUA 2WIBA 3DAGA 5KTSA 3FFWA 4O1IA 4A5SA 1QGOA 3EQ9A 3RJMA 2UYCA 5FORA 3V42A 2YIVX 4I55B 2X7HA 2I7XA 4Q3AA 5IN5A 4IMPA 1CZHA 2XNDD 1W0CA 3T1YB 2ZS7A 3V6LA 4QUAA 2PT7A 4Z9BA 3ZK9A 4CYMA 1RBMA 5ALMA 4Z1OA 4QOEA 1YVUA 1Y5LA 4KLRA 1XZJA 1U9YA 3T34A 3SS8A 2XTMA 5LIPA 3HB0A 2RH4A 2PXAA 4EQ6A 1XFAA 3IL2A 4GOLD 3DVRX 3TPZA 4KLAA 1PT6A 4ZJPA 1DB3A 2QGNA 3WK6A 4J43A 2PV0A 4RHEA 2XJ4A 4FBMA 3DFKA 1T8UA 1MJGA 2ISQA 3M4NA 4KVFA 3IULA 4GAEA 2X1VA 2FPLA 2JIRA 5LP6B 1VI2A 1YU9A 2GSDA 4RO0A 2ZSFA 3T9DA 1NKSA 4N3BA 1EXDA 1IY1A 1G55A 3HY6A 2RJNA 2UAGA 1W5FA 2Q62A 4NE7A 4XSHA 1W4CA 2O52A 3H9JA 3LV8A 1YQEA 2C77A 1MO6A 4LF6B 1DEXA 4E4TA 3UUGA 3H3JA 4UC0A 4I9HA 1CF4A 3KK0A 2VYCA 2IU6A 2EJUA 1J33A 4AJEA 4MRRA 1C4XA 2YJNA 4FFSA 4WVFA 4UU0A 3KAJA 5T4FA 2CB0A 3HMKA 4DRXB 1UDWA 4Y6PA 1P9NA 1GNQA 2JIQA 3CMMA 3RKRA 1OZAA 1R5OA 2BEWB 2OFPA 5EUCA 4M1ZA 2XQJA 3Q8MA 4A27A 1UAAA 2O3QA 5DW0A 1N2IA 2Q1UA 1QBGA 1J7KA 3WG9A 2IZ5A 4JJ4A 3DT6A 3G49A 4UULA 1MAHA 1U7HA 3CNBA 3JQCA 1Y7TA 3GJ5A 4D44A 3K2EA 1AT1A 2GF9A 4WJKB 3OOSA 1V5GA 2HT6A 3DCIA 3PC7A 1X80A 1SOAA 5KYGA 1U2EA 1RLUA 1XJCA 2PVCA 3ECSA 3FM9A 4FK8A 5F3RA 2RAUA 2RIPA 3UFBA 3DOCA 1HTWA 2HYIC 3NAZA 2AR7A 5B2EA 2PUFA 1CUGA 2DQSA 2FNAA 1X74A 3PLAE 2V8OA 2OZVA 2X13A 2PMEA 3WLRA 1KO4A 4GSLA 1V1MA 5SZKB 1J07A 4F1WA 1M2VA 3F9IA 4B6FA 4A3SA 5CT4A 3H5LA 4I6EA 1QRTA 2PKQP 2HJHA 2XTZA 1YT5A 1RWKA 3LOUA 3KQQA 4MS4A 1TUEA 4RZ3A 4QVGA 4JT4A 1PD0A 5DYTA 5LYJF 3PHCA 3Q3CA 5CNKA 3S55A 1ZFNA 4WE3A 5BVGB 1XQWA 4FWTA 3WGGA 3WRXA 3IQFA 4DAEA 1NE7A 3OKCA 3K6RA 4BYGA 3TSCA 3NM6B 1L7AA 4M55A 2VHEA 4FTWA 3RASA 1CY6A 1TYEB 3H9EO 4LF4B 2ZRAA 2WE8A 1H8HD 3CNEA 2OGTA 1NW7A 2KI5A 1J49A 2VDPB 5FLYA 1NXSA 2ZRIA 1SBZA 1YKGA 2X9QA 4AJOA 2EWVA 5KC9A 3EBLA 2FCAA 5IJAA 4YUAA 2MSCB 1TXGA 1ZX1A 2ZPAA 1JLSA 1U2GA 3HJGA 4QNNA 3NHZA 1LNZA 2BTQB 5K3FA 2HY7A 5AQ1A 3EQ8A 4LZLA 3G8BA 5HVNA 3CC8A 4R8KA 2VUTA 4L16A 2DCUA 3RIMA 2WIFA 3SQDA 4EG6A 4TGLA 4AWBA 2JGAA 4YRNA 4C3VA 3W7AA 3C7KA 4I5DA 1PR3A 5DXAA 1A2BA 2IUUA 5KJFA 2X8LA 2YFKA 1EK6A 1YB4A 1KGSA 1NOJA 2ORYA 3ITDA 1YSCA 1WZ2A 2IUTA 3SYLA 3A9WA 1WBBA 3B9BA 4NH4A 5KJ6A 3C6QA 1IEWA 1KOFA 3N2KA 3R76A 4UCFA 2YWFA 3MNFA 3KBBA 1SCUA 1A2OA 3IP7A 5ICGA 2Z56A 1QLWA 3OUTA 1ML4A 4JL8A 2J08A 1CIVA 4FHEA 4YLGA 3ZY5A 4OI0A 2OO7A 3U49A 2PBRA 4N40A 4UJ5A 3DBOB 1P6UA 4EHJA 3M5WA 4JUIA 4U8GA 3MHTA 3FUXA 2P75A 3HHEA 1T0IA 1ECCA 1W35A 2QD1A 1OJLA 4TWRA 3OZSA 4X20B 1UC8A 3JWJA 3Q98A 5EJ8A 1XDDA 1T9GR 5D5QA 4FE3A 4UZEA 4G5QA 2Q0HA 3T9BA 2ZJZA 3BE8A 4N9WA 5K0FA 2WD7A 1LS1A 2XRYA 2GARA 2D2VA 3HZHA 3UWPA 1WCXA 3R6TA 2C4UA 4XYGA 3A6PC 3A05A 3UN1A 2A1TR 1FYWA 5IT4A 5HQ3A 5LBIA 4G97A 2EZ8A 5K8IA 2HWKA 4PNHA 3IDZA 4C0JA 1L5MA 2J4DA 5ADUS 5CDFE 1NWCA 1UWKA 1Y63A 3OZ7A 4HWKA 4M1SA 5EXDA 2JA1A 3N7AA 1D0VA 3FNQA 3VR6D 4AO8A 4ZVOA 2PUTA 3OFSA 3N53A 4KXMA 1XCGB 4NBVA 4TYQA 4OUDB 1YCFA 4RLQA 5TQ2A 4E5VA 1B0PA 3H97A 2E1RA 1USVA 3IDQA 3GJZA 3MMSA 4IWXA 1DZIA 1DBSA 1T4CB 2CCJA 3I9NA 4I4CA 3OETA 3TINA 3UXMA 3DLHA 1K66A 1N5RA 2JLSA 4WZAE 5JATA 4DA6A 4EPXA 1DG1G 1GILA 4X0EA 1R3UA 1AKVA 1C0KA 2I66A 4GSKA 5IUNC 2O5VA 3BTOA 4FGSA 2GPSA 2OV2A 2WTAA 5EJ5A 2R1VA 1E0SA 3OUUA 3P9XA 4BGIA 1I5RA 2FSVC 1LKZA 1XDZA 1EGVB 2XWSA 3DWGA 5D1HA 3SI7A 3VM6A 3WMFA 4Q4JA 4HHEA 4D9MA 1PJ3A 1P62B 2A0YA 4IS3A 2NXNA 1T2CA 3FTFA 3EODA 2Z5LA 3P2JA 4WNIA 1V6SA 3QKWA 4O4LA 4UATA 3IBTA 4GECA 4ITVA 2WY2D 1JR6A 1UDRA 1NURA 1DBIA 2G0AA 4L57A 4Z0PA 4EVSA 4ZC8A 4B5LA 4EL0A 2UYQA 4HNVA 4EKDA 4XD7D 4IZIA 5EQTA 1SUPA 3HCFA 1KP3A 3JRNA 4OB6A 5CFNA 2OPHA 2W2LD 3H65A 2ZT7A 1TT5B 1TMOA 3NHKA 4DQXA 3FLEA 4HQNA 1LSOA 1LY1A 1KYXA 1MOQA 4N49A 4H1VA 4JSRA 3SJCA 1CNFA 2HBYA 4JHLA 3V2GA 3W2TA 4EELA 4B6EA 3GPIA 1NVWQ 2YDYA 2VR1A 3NJ8A 4DILA 4HQ6A 1EVEA 2X4LA 1FDSA 2ZYSA 5TMPA 5AM1A 4E3WA 5EI5A 3P0HA 3SVZA 5LLSA 2Z8YM 4HN4B 3W0LB 4CM7A 2OHHA 4QGSA 2EQBA 3N75A 2BGLA 5B3JA 1FSFA 2MINB 3BHIA 5E4FA 3ZDDA 2MIIA 4FYKA 1T0UA 2EV9A 1XU9A 1T36A 2SICE 5BSEA 4YPFA 2X4IA 3V97A 2DEUA 2H8KA 2ENUA 3L02A 4C30A 1C0IA 3BVPA 4PQFA 1EFCA 1WMFA 1U1FA 2VK1A 4MUMA 2IF2A 4DR6B 1AXEA 3FD8A 4PLVA 3SBXA 2HU7A 5CCBA 3B5EA 3EASA 3H75A 3PNQA 1Q11A 5LMNB 3COVA 3QPUA 2CT8A 5KC8A 3OWHA 3GJ3A 4LYYA 4O4HA 3VKFA 3NH6A 4JEUA 1ZY2A 3I9OA 4U7JA 4CCWA 1NLZA 1ATIA 5LNK6 2ZKIA 4A6DA 3W5DA 3M4XA 4S2EA 1GG5A 4I4IA 2VAPA 1ZIYA 4HDKA 2HBRA 2ORWA 2V59A 2Z98A 4ZU1X 2B1JA 3ROEA 3S2IA 2F4NA 3LBYA 2GAJA 1BWPA 1E2UA 4N3NA 4PLWA 3Q3VA 1J2JA 1U5BB 1U98A 1W85B 1XDWA 1QORA 1WUYA 1Y82A 2CDAA 1DIAA 1Q0RA 4H6VA 4KIWA 4LQDA 3M83A 4M9UA 5D51S 3RUHA 3QTTA 4TUYA 4D9HA 5HUHA 4M7WA 2PQ6A 4ZP1A 1D2RA 4B3XA 3HGMA 4DBLC 4D5GA 4EX7A 4R98A 1JECA 1TK2A 1IHOA 2BHRA 3JASB 4JNCA 1UJ4A 4RD0A 1WPGA 2N0SA 3MIIA 4D74A 2QX8A 5EN4A 3Q7TA 2OFWA 4IXMA 2GTIA 1Z13A 1R10A 1YJ5A 2YWHA 3DZDA 3ITKA 4RS3A 4BNWA 2NV0A 3BICA 4HDCA 5FEUA 3RAFC 1G8JA 5IYZF 4C5BA 3ZU5A 5AI4A 5C8XA 3ZDAA 4JV5B 1V3TA 1K9VF 1OH7A 4RLHA 4ON9A 2UYYA 4Q6WA 1QFXA 3DD1A 3T41A 1DG3A 3WDSA 4FWBA 4ZOAA 4AL4A 4QJIA 4FKBA 1NQTA 1F6DA 3V7UA 4A6XA 2FWPA 1GVNB 2AMLA 2IYZA 2K6GA 4TKVB 3L4BA 1ZCZA 6GPBA 2EX1A 1UJ6A 2PPVA 1RJFA 3KUXA 4NG5A 3LNCA 4BV3A 1FLDA 2VZLA 1PV2A 3QJ5A 3D8UA 3FMOB 3DUFB 4J49A 1KY4A 1ZNWA 3GAZA 2PZKA 2B92A 4PN7A 1KOJA 3TXAA 4EF4A 2FEAA 3DMFA 5JFGA 4KO2S 1YRQA 5A04A 4Z4QA 1NUPA 3LK7A 3GLRA 1I3CA 3FF1A 1F60A 3H18A 3RS3A 1WWKA 3WMEA 2OXEA 2JIBA 2Z09A 4MQMA 5FV4A 2JGEA 3KQKA 3LA6A 4DJJA 1E6UA 3ZXIA 1KI4A 4QZVA 5DNVA 3TF5A 1ENOA 1E66A 3Q0TA 2VRNA 4R0VA 1QLHA 1O77A 1QV9A 4LQLA 4ZAVA 4E2ZA 1IQRA 2RC6A 3BGSA 4NV3A 4L2IA 1G5FA 4C6TB 1VIVA 5SY9A 1IHDA 2GN1A 2XVXA 4QOIA 3ZHUA 2JW5A 3Q12A 4IAOA 4MINA 1RR6A 4AFNA 4AMGA 2JDIA 1XD8A 4MOWA 4CFSA 4HDSB 4Y30A 1W5BA 4R8SA 1Q0HA 1OZGA 3IO3A 4MLDA 1P7WA 4YXFA 4YI3A 1H65A 2RHHA 5F1YA 5L45A 3FNFA 4H4CA 2Z6UA 7ADHA 4P4TA 4B6RA 3GVCA 2JFPA 1VPVA 2PGAA 3JRXA 2DFKB 2JJMA 3OTQA 1PJBA 4JLNA 3UUEA 5BNIA 4LJLA 5JXIA 2WU1A 3ZDYB 4D99A 3ETJA 3H5RA 4L9SA 1SQGA 4HH3C 4D96A 4JWTA 3NP7A 3AESA 2ZB7A 3AI7A 1AUPA 1KRHA 5M5BA 3N7TA 3Q8WA 3JX9A 3QPVA 5C1BA 1IG3A 1ORVA 3WWOA 4DUGA 4DNQA 1UIMA 4P4UA 2XQGA 2VJQA 2F48A 2YR0A 4NJEB 1F17A 4EKNB 3GRFA 2XVMA 4LJ7A 5K8UA 5DLYA 4YJGA 1EGMB 4AULA 2VNIA 1R0XA 3ZVRA 3WIBA 5EFZA 4DSUA 4GR9A 2H4JA 3HUEA 2ANCA 2YHUA 3QVXA 4M9CA 5EYPA 1F8XA 3A6HA 4XVHA 5BR7A 1H66A 1HNZB 4CIXA 1SOWA 1FX0B 1D03A 3BXFA 4II7A 4KUGA 4Q9NA 5EMKA 1GV0A 4ZAXA 4WQMA 4F3NA 3ADDA 3B9QA 3N2LA 2VWQA 3IQZA 3CLRC 4HDMB 5K1ZA 3RD5A 1EQUA 2FZKA 5FTKA 4YB8A 5IW8A 3I4LA 2EATA 2HIMA 2YH2A 3JWGA 1M2WA 4UBOA 3ZCSA 3DXYA 1I24A 3I28A 4XOUA 3R7FA 3S1SA 4LF9B 2O1XA 5J2UF 2HREA 5C46F 4LEIA 4RV4A 5AVOA 3V1NA 4KMMA 2D06A 5BSVA 1GJRA 2ZFUA 4G6ZA 3GC6A 2E1PA 3V5NA 1PL7A 1NMSA 1U28C 4HH4A 2ASVA 3K92A 4M38A 2J3EA 2OM2A 3E3OA 1HYEA 5DW3A 3C14C 3HDVA 3T7RA 4BLRA 2HRDA 4C6RA 1M66A 1LRJA 9ATCA 3WJ1A 1TJPB 2M2IA 5ELXA 2Y1XA 4DCTA 4V3BA 5D3QA 4ZVVA 3OQMA 3M82A 3QW4B 2O2HA 3HUFA 2CW5A 3L04A 4UM9D 1G2IA 4NHEA 4C87A 2Z8ZA 3CVXA 4QDOA 4E2FA 4XFJA 1ZXBA 2VHUA 2NUTB 1CFJA 2RGEA 5FBRB 5FL7D 3M2PA 4XWTA 4QC2A 3E2MA 2ID8A 3BH6A 4L0DA 1NPTO 3AVPA 1MABB 3CVJA 4U6SA 5FNVA 3L4JA 3TKAA 3SKXA 3FBGA 5DM60 2JNWA 2O20A 2XXBA 2OLJA 3AFNA 3OJLA 1EEHA 3QG1A 3ROPA 4PGGA 2UXBB 1YO6A 4YI5A 5H82A 1K88A 1GR0A 2IRWA 2PU7A 3LHFA 3U1VA 3TQIA 3X1KA 1BWQA 3H2IA 4J16A 2A94A 3HCWA 4UUMA 4LRTB 4UU1A 2CFTA 3K1ZA 2OHXA 4ASUD 3VKHA 4TKUA 5LUBA 1BQEA 2IEBA 1OGJA 2G06A 3PV0A 1OLXA 4PZPA 1CQZA 3DAFA 4UDOA 1XMSA 2ZU6A 4UEWA 4ZQCB 2IU0A 1MEJA 4B8WA 1DQSA 2CE7A 6PFKA 4PLFA 3E1KA 4IEFB 1MTZA 3RIYA 4YMTA 5EJEA 1DKOA 1Z4MA 2P27A 3HFGA 1CUYA 1NW9B 2ZYRA 1BS2A 1GZUA 2QDKA 3NHUA 2B5VA 4ZQGA 2OYCA 1EFKA 1VSBA 2ZGVA 4BJ3A 4XA8A 4C5CA 2GPNA 4FOSA 1P0FA 2ATXA 2W7TA 1G0NA 3TCKA 4R54A 4MWBA 3UMRA 3D54D 3ELYA 3MOGA 3VNSA 2W98A 4LYHA 4B47A 1M2HA 2GXQA 3G0DA 1KEPA 3HKBA 1PNRA 2PX8A 2R7MA 2P2DA 3IILA 2PK3A 1FS4A 5THKA 5KVAA 1YDEA 1Y7IA 2FW1A 2DP4E 2DUMA 3ETEA 3QOXA 4AWAA 2O8FA 3D81A 3ZHTA 2R8YA 1U0LA 1GDTA 1R8QA 4RTRA 3ADPA 4UE3S 1QIHA 4CKBA 4B4WA 2WZCA 3W4JA 5FAKA 3EPHA 4GI2A 2J7PD 2ZUCA 3RC3A 3TZCA 2VPZA 4XCVA 3DYIA 1L6IA 1T8TA 4TLBA 3S1AB 2ZJ4A 4D1YA 4E6PA 4YPVA 3ZCXA 5G4KB 3SZMA 2P2SA 2CEKA 2H2AA 2QP3A 3X0DA 3ZCTA 2OQVA 3TTWA 5IH7A 5LYYA 1KC1A 2P90A 3K0AA 2GUGA 2P4HX 1LRKA 3KOUA 3QXJA 4Z8XA 3U17A 4Y2GA 5HKAA 1ZH4A 2WFLB 2CL5A 4FC6A 4J0FA 4PPNA 5I4IA 3SC3A 1JRLA 2JAPA 3NO4A 3NYQA 1HO3A 3VDMA 5A5GA 4MYSA 4G0UA 3G6KA 3USES 1I7LA 3G88A 1UFVA 2ON6A 4AZ0B 2ZRFA 1CIJA 4D25A 1SBHA 3C15C 3BBPA 3ESYA 4GIBA 3A28A 4PC3A 5ER9A 2B7LA 2XGGA 3BTUA 4BDTA 4DOMA 2DGDA 1N1DA 1C3EA 4B6GA 1JZTA 3NATA 4RACA 2VQDA 2OHFA 3M6UA 2FW9A 3TUJC 2FP4A 4WNYA 4Q9AA 2ZETA 2ZYAA 3FHJA 4B9AA 1WVMA 2BFMA 4U2CA 3GRAA 4YQFA 4BIMA 2V9ZA 1B3BA 1O6FA 1L7DA 5BWBA 1EWKA 1A8SA 1T4MA 2GM9A 2HPVA 1VL0A 3B3GA 3CUKA 1H5UA 1N2GA 4M76B 3K0CC 3OP4A 5DNUA 2CXTA 3FRIA 2WOJA 5T4BA 4B17A 4O6VA 1J2UA 3EZ7A 4M46A 2IIVA 3F3MA 2VZ0A 5CU7A 2OGSA 3C6ZA 5EZYA 4BVHA 5LMCA 5AVKA 2P9BA 1II8B 1HLDA 4J3JA 3I05A 4GX0A 3GO4A 1XMVA 1KI8A 1M0WA 3BL5A 4IX1A 4IIJA 4JVNA 7GPBA 3SQNA 1E3MA 1VJTA 3E22B 1WL8A 1HRKA 3OUZA 1YUNA 4DMFA 3OIYA 1KYYA 4UE2A 4HX5A 3RK0A 1KEWA 1NVFA 3JYPA 1J97A 3MOSA 3IJPA 3QNMA 4FFVA 4P34A 3WBFA 1UMKA 2NVUA 5FUMA 2C8LA 4JJ6A 5KQSA 4OD0A 3W05A 3GH1A 1AK9A 4PYJA 2WUVA 5A4IS 4H18A 4TUYF 3HO6A 3WO0A 1YC5A 3RTGA 1TADA 3ECCA 3FNGA 4IQ8A 2VJNA 2C2OA 1QWOA 2FX5A 4JU9A 3UT5A 2IYLD 4OMDA 4DPMA 3TPCA 1CQXA 4QYIB 4P86A 1UDCA 5JLJA 3ZN2A 3DF7A 2HJVA 2H4YA 1ECFA 3EQ2A 1Y8ZA 1NRJB 3TX2A 4M9RA 3RYCB 1BHSA 4ER6A 4XVRA 3EBPA 3IMFA 1HR0B 3L7NA 1LPPA 1WQ3A 2OFXA 2Q9CA 1V5EA 3QZUA 2QRZA 4LVUA 4MSUA 1K7XB 5TMEA 4BP3A 3VDNB 4Q1EA 3ZV4A 2GUWA 3FYCA 1FP7A 1VMEA 3NWBA 3PUKA 3FYHA 1FL9A 2VDMB 1NP3A 5FR2A 4HT3B 3FFAA 1ZIOA 3QXXA 4UBKA 5CT6A 4OEHA 2Z2IA 2J5XA 5BSFA 2GKOA 4C0KA 1WUTA 1EDDA 5LUAA 1GCAA 3GAAA 2GILA 5E6SB 2NZJA 2A5GA 4JB0A 4GGMX 3JU3A 4Q03A 4C88A 1YDWA 4QEKA 4Q9DA 4B3DA 3H84A 4FZVA 4GICA 4NBUA 4ZT5A 1P9LA 3QENA 1E3WA 1TA4A 4Z0NA 3ZPXA 1ZGBA 3LHSA 4IXDA 2XOKD 1RRFA 2FPXA 1GKLA 4UVIA 1FXWF 1VLLA 4RDHA 2QUAA 5H3CA 4TMZA 4N39A 3BXXA 1KZ9A 5GOZA 3WADA 3RO7A 4YMHA 4YMUA 3VKWA 4AJJA 3BQ9A 4FLMA 4O29A 2AJCA 1R37A 1NDQA 2PJRA 2UYGA 3FGOA 3NDIA 1ZK4A 1YIDA 2XQIA 3DVQX 2PA0A 3IBFA 3LT1A 5DNAA 1CBUA 5FWDA 3P32A 1KJNA 1GP2A 1KFEB 2WYIA 4D0RA 1FFSA 3OECA 4JVMA 4U2GA 2GYYA 1NF9A 2ISSD 3SC6A 4XFDA 3BCRA 5DGCA 1VSQA 2CJXA 2Z95A 3UV6A 1JXAA 4EIWA 5B7QA 5CB8A 5DT9A 4GI5A 3ENQA 4MO2A 4XWKA 3VBCA 3PC6A 2OA0A 1E1RD 2ZT8A 4IXWA 3B1WA 4IL5A 5IARA 2YYZA 2VDOB 3K4PA 2ZANA 4X6XA 2JI6A 3CF0A 4RUKA 3VZDA 3PQ7A 2O48X 4X20A 2WTMA 1G7TA 3I73A 5KYUA 2R7LA 3OZTA 4EX6A 4A0GA 5HM6A 3TZ6A 3FLMA 3MUEA 3RSCA 3LKBA 4JBYA 1T29A 4JJZA 4ANFA 3L6CA 3G2OA 2DRIA 1O5IA 1UBEA 4L9WA 3T3MB 2WB2A 4UVEA 3ZVNA 4IFEA 3R2JA 3ZY6A 4DIDA 1AB6A 1Z4IA 2LNDA 4B7CA 4BZQA 1B2LA 2HO5A 3IP8A 4M3NA 4X24A 1QGDA 2AWOA 3DMRA 1V16B 4WHMA 3MQ4A 1GAQA 1V7QA 2QQ5A 3EWIA 3IEVA 2OVFA 3TZHA 4RL6A 1Q21A 2JI9A 1E9RA 1TVKA 2C3YA 3A10A 4ZOLF 3G8CA 2JZCA 2VXYA 3H2BA 4MR9B 1DQPA 4JROA 4OREX 1VKRA 4Z4EA 4ENTA 1WG8A 1VJRA 1T4CA 3AKDA 2PSDA 2F4VB 2QENA 1T2VA 3ZG6A 1CS0A 2P7IA 1LPMA 1KMHB 2GGSA 2G36A 2XEXA 3ICWA 3UAWA 2YWEA 1RAHA 3HYSA 3K73O 5TR9A 1BS9A 1M2OB 2P2GA 2Q3HA 3GJ8A 5E3IA 3ZLUA 5F2KA 4GRDA 4HTFA 3LW7A 2JIPA 3KRTA 3PPYA 4WOJA 2B21A 1P91A 3CM0A 4RZ2A 1PWZA 1QVZA 3DWFA 4R8MA 3QX9A 2BBTA 5F12A 1P3JA 3Q3GE 4LISA 1CKEA 1DQRA 5JS6A 3L43A 2O2XA 4OLJA 3P9RA 1B7GO 4YJ2F 4PNZA 3AF4A 3QX3A 3E61A 4BEVA 1NXPA 2XUJA 3LDAA 4RANA 3NQ41 2VNSA 1Z0UA 2PKWA 4KXNA 1M6HA 1A3CA 4YYEA 1ZR4A 1SVMA 3HWX1 1INLA 2BISA 2RBGA 3KS9A 2O57A 4NL4H 3T94A 4AYTA 1XNJA 2C2GA 3BUSA 4MVJG 2DBQA 3E7XA 3CS3A 4RH1A 4NTZA 4M87A 2ROQA 5BQXA 3H4TA 3L79A 4WT7A 4UE6A 4TT8A 2B30A 5AWFC 1I5EA 4ZD6A 1RZRA 3EG9B 1MJHA 1MOZA 2J45A 4ZICA 1UKCA 3BH7A 4P80A 4BMXA 4OLFA 1GFWA 4JKYA 2P1ZA 4MVWA 4QDJA 3SHVA 5J2UB 2WICA 4BKQA 3SSNA 1DJOA 2AX4A 2SKCA 2A58A 2RG1A 3HDTA 1XROA 4LIPD 1FMLA 1XMIA 2XWBF 2EVWX 1QH1A 2VUHB 3QEOA 2OV4A 2B69A 2PFGA 2JCSA 4G4SO 4HGRA 5ALSA 3NC1C 4DMKA 1GKUB 4Y2UA 3TRFA 4UW9A 4MVJP 3BX1A 5IEBA 2ZWPA 1DT3A 5C37A 1NVBA 3MPOA 4JP5A 3HA7A 3U4IA 1CFZA 2NUAB 2B2CA 2JK1A 2OHOA 3NFRA 3QPAA 4YJKA 1HDGO 1AUOA 1EXWA 1SRQA 1WZCA 2B4RO 1WMDA 4UMEA 3RVKA 1W44A 1QFJA 1ZI8A 1YQUA 3OEEA 4ER7A 1PT8A 3GJ4A 1N7IA 4YO7A 1DAEA 5AKIA 1GPLA 2Q29A 4F92B 2WEKA 5J4KA 3F71A 4AP5A 1GRQA 1XVLA 1YVDA 4A8HA 4AWXA 4PLGA 2PLRA 3K72B 4K03A 3F49S 1M0TA 4KXLA 5EINA 3CLVA 1NA5A 1TFUA 2R7KA 3AEKA 1I2MA 4NJMA 1IK6A 1GQFA 4HRXA 3QJGA 4BB0A 5I7RA 3QITA 4ENPA 4G4JA 3IB6A 4EQ6B 1IZ9A 2C92A 5CXUA 4RWEA 2CHUA 2I67A 5EXSA 1CZUA 3A4NA 3OOEA 2CK3A 4BE9A 2VWHA 3O21A 3C4QA 2OZLA 4XSGA 2NAPA 3ROQA 3OIFA 3DTVA 4ZCQA 1C3VA 1CUDA 3F6RA 3CZMA 3IHLA 1L9XA 3M33A 4HO1X 4ND8A 2WHXA 1W7AA 1P7VA 5AO9A 3GVHA 1PT7A 3R0IA 1PSDA 5EIHA 1MP0A 1YE3A 2A9QA 3IX7A 1Z6QA 3I9JA 3TLCA 3PR2B 4AP6A 3RVRA 4FLEA 2P8SA 1FBTA 1QZZA 3ACDA 3RBXA 4TRMA 5CLIA 5IEJA 4WY2A 5T4EA 1O9GA 2HBZA 4B81A 3DE0X 3OIVA 3KXIA 1TKAA 5LKAA 1R5BA 2WSSD 5MHTA 2YXPX 3KTDA 3JQBC 2OAP1 1SZCA 1KDPA 3UKDA 3OH8A 1NBEA 2RHCA 3K16A 2Y92A 1TCAA 4M7OA 1Y1PA 2ECFA 3TMYA 3R6DA 4QBHA 2DLNA 2Q5OA 4ZAFA 1SG6A 3D8BA 1J8FA 1UKBA 3U3JA 4YGYA 1QF6A 2EGHA 2VNKA 3PX7A 3I5AA 4F5DA 4AB1A 1BS1A 1XZ8A 1ONOA 3BTSA 1GHTA 3LCJA 2QL5A 3PUIA 3VR6A 1XPRA 1NG9A 3GIDA 1MB0A 4GYKA 3W5BA 1I36A 2RHMA 2GZ1A 2EFHB 2GVNA 2REOA 3EH1A 3CPEA 3KPWA 1TIKA 2OFOA 2VJLA 3QXSA 3ODPA 3RNOA 4KREA 2GA8A 3DOHA 1HSOA 3OPYB 3PQ3A 4MUJA 3VYSB 4UXIA 3HBAA 2JHAA 1QHIA 3A4VA 4LY6A 4PIPA 4JI3B 4RM3A 1LW6E 3RFUA 5DM70 4PPGA 1RYEA 3ZWMA 3RRYA 1ZH2A 1EJ2A 1QVAA 1WV0A 1XRRA 2GN8A 5T64A 1GD1O 1ISRA 4D8TA 1KFKB 3AHHA 3NC4A 4MGKR 4EYSA 4KCGA 1H8EA 4MP8A 4JFRA 2JHCA 5TQ0B 3VUEA 1YIOA 2J4CA 4XJXA 3IQHX 4QYXA 1HDOA 5K3AA 2DF8A 5JU6A 3C87A 3N8NA 1NZDA 1U28A 3ROMA 1KIAA 3SBDA 1V5WA 2Z57A 3M9WA 1L7XA 2IITA 3P4YA 4G37A 2Q45A 2DPYA 4PC1A 4WUTA 5IBQA 3ZTYA 1TQ2A 2QZZA 1SQFA 2WILA 3DE5X 1B42A 3GEIA 1Q0SA 4QODA 3TB4A 3DYVA 3DQPA 4DWJA 4NCBA 3T3GA 3GIWA 4IQGA 5IVKA 4DY4A 4FHFA 4AC9A 1RWXA 3IFSA 3PHHA 1P4AA 3KHTA 3SEQA 1SKBA 2QRVB 4TPKA 2V6JA 4MWCA 3T3DA 4B3BA 1PZFA 4B44A 2DKFA 5KSYA 5IN4A 1RYFA 1TKBA 1GZ5A 2VRBA 5EWMA 4A1OA 4JJFA 4FILA 2CV1A 1R6DA 4KXVA 3PYMA 2UZ0A 4HPWA 2W2MA 2Q1SA 4JLDA 4PZCA 5BUQA 2QN8A 3H3XA 3KT3A 1DJNA 2Q4TA 4DEYA 5KTMA 2C3UA 1W46A 2QYTA 1GU7A 3BORA 4NJEA 1USIA 2HYDA 2F3TA 4C07A 2DH6A 5EHQA 5KYXB 3RC2A 4YP6A 2Y1EA 4RKEA 3QE2A 5TGZA 3SR4A 4EI9A 3RS8A 2IA5A 1YGPA 3C5CA 4W8HA 5K5EA 1GUDA 3CW9A 2I4OA 2NLOA 4O4JA 3B9RA 3RDPA 4H16A 1U5BA 5T8KA 1MNAA 1Z39A 3UCFA 4ZV4A 1KPGA 1NJ1A 3R8FA 1N33B 1SUIA 5GP1A 1A7UA 2EP5A 4YCCA 3KOXA 2NSDA 6LDHA 3U4GA 1GTVA 3I58A 2J0UB 2IPAB 3ZHBA 3R40A 3CRZA 1BE1A 1JG6A 4K3VA 1BGVA 2B20A 4Y8VA 1PEYA 5L3SA 5A3RA 1UT5A 1FJXA 1QK3A 1QAQA 2RGDA 1M1ZA 5F76A 3B5JA 5IM4A 1NVVR 2GK3A 5I7VA 1OXTA 3EEOA 2JFBA 4GGOA 5CK5A 1NUHA 1B0UA 1LLCA 2DR0A 1TMGE 1W34A 1THZA 1QDUA 3D5EA 3MJSA 4MKHA 3RIHA 4NV0A 1CZNA 1P4RA 3BM5A 1C0EA 4FDTA 4HSEA 2W2NA 3CYFA 3JARB 3MINB 1XRLA 1N0WA 2DBVO 2EW2A 1Z0SA 1OAKA 2VT7A 2X7JA 4HFNA 4ODIA 5EG5A 5JMOA 3QVWA 1F3LA 2FWIA 1KJ8A 3DKPA 3HXTA 4KAAA 4AD8A 4N48A 1L1EA 5JBIA 2I9KA 2HMVA 4M4SA 4P22A 1Z0JA 3DFUA 3LF1A 3NIFB 2WINI 3KWLA 1XTKA 5HP4A 2BGWA 4DB2A 3FOCA 2EARA 4MS1B 2IWHA 1I14A 4LY9A 4HG2A 5AOAA 4QL3A 5EQJB 1OPRA 4Y2PA 3AVVA 3UB2A 1L4UA 2TMYA 1UBLS 1XPJA 4ZPJA 4IMJB 4L74A 2C2BA 2R6CA 1CUXA 1E1QD 3BEDA 3MJEA 2HXSA 3WLLA 3JQ9A 5FBVB 4HB0A 2FQ1A 1DEOA 1F6WA 2R85A 4G0OA 3VR2D 3LOQA 3WYEA 4F6RB 3TQTA 3S2UA 2P9QA 3KJFA 4NCIA 5C80A 3IV6A 5MDHA 3EGDA 1YE8A 5KI6A 2H63A 3WV5A 3UWKA 1KH2A 4YJFA 4BUCA 5EIXA 4LGMA 1STOA 5EJGA 3MWYW 3G17A 1MDBA 1SB8A 1G5IA 1NV8A 1T8WA 1YNOA 1JU3A 2GLTA 2BEVA 3S2FA 5AESA 4A6PA 1MXFA 5LPNA 3TYXA 3RR2A 1A96A 3P2YA 2FMTA 4F72A 1TLFA 1QFYA 2GBGA 3D7NA 2GYUA 4RKRA 5GTDA 3BERA 3L0ZA 3MXOA 3UO8B 2BTEA 1PU2A 3QUBA 5AI6A 1OX6A 5CUQA 1FYEA 3KXPA 4DWVA 3V6MA 1UMDB 2GEJA 1ZESA 3EWSA 3SMQA 2V7PA 1KI1A 3X43A 2PWPA 2WIJA 3F78A 2G1UA 1RAAA 4XIYA 1VIYA 4XM2A 1YMVA 1Z7GA 2OC9A 2OBYA 3GRVA 3IESA 4KGZA 5TB5A 5AKGA 4LGCA 2FKAA 5ALNA 5A02A 5KWJA 2XSZA 4ZGBA 1PGJA 2I4MA 3HYNA 1LQUA 2WAYA 3WMRA 3MJHA 2ZJ0A 3R5FA 1L4EA 4RIHA 4HS9A 4OMFG 3K8ZA 2CUZA 1NAIA 5EMMA 5EZYF 1SULA 3K0AB 4HCJA 3DV9A 2R6HA 3VV2A 2I0FA 4AN0A 4CEHA 2W71A 3CGWA 3VNQA 1RQXA 4GZLA 4TL9A 4BO1A 4Z7NB 4EA6A 2H1OA 1U8XX 3F6SA 221PA 5IAGA 4J0JA 1Z4KA 3STXA 3NAQA 2FPRA 3ZWOA 4HGNA 1CJCA 1P3Y1 5KAMA 4CDGA 2AFHA 3VR2A 4DR3B 2HIHA 2WPDD 3WB0A 2G9RA 1N78A 3ZJ4A 1DEHA 4DUGD 5B4UA 1V7ZA 1IHUA 2ZI9A 3RSSA 1U2TA 2BHSA 1W88A 3EJWA 1USUA 4JP2A 4XYMA 1IHPA 2R6ZA 3D5QA 4HMOA 4B8ZA 1ZEJA 3TW0A 5KMGB 1N8TA 4U00A 3BKXA 3B3AA 3Q9UA 3WK7A 4EB0A 4OLBA 1Z6YA 3R8CA 2F1RA 2VG8A 3L18A 3ESAA 3WP0A 3P71T 4EEKA 1PJAA 2GD2A 2J1LA 3L7BA 2IOQA 4P35A 3DOEA 2B2XA 4R68A 1LV8A 4Y1RB 4RGVA 3X1XA 1G6KA 3ZQUA 1UEJA 3D1JA 4Q37A 3PPWA 2BR5A 2PUVA 3HB1A 4JEMA 4IRMA 4WXRA 1AU9A 3NHFA 3KXDA 3M1AA 4B80A 3I4FA 1DPFA 1EUDA 3N2YA 5WRFA 3D6NB 4ERNA 4NS4A 5I4CA 3LF2A 3T5BA 1DO0A 5DH9A 5IKMA 3L0DA 3OP1A 3VMFA 3ONWA 3R74A 1M5UA 2CXHA 4JITA 5CYFA 4MGEA 4W63A 3WYAA 2QTBA 1L7QA 2CBGA 2PIDA 2YQ4A 3CWQA 4BVEA 2D7JA 2LWIA 3I3SR 4OHPA 4ZOCA 5LQAA 2H8GA 3FCAA 1TO2E 4N8EA 4AG6A 2VH1A 4HQOA 3ZNOA 2C9MA 5I47A 3OWOA 3RUFA 1N1EA 1T8RA 3P27A 5IRCD 4GBJA 1YS9A 1YK0A 3KT6A 1ECBA 1TF7A 1Z9BA 2INGX 1JJAA 2BEUB 3Q5GA 5G53C 2IXTA 1MX1A 3MSXA 4XIGS 2KS6A 4C4RA 4OKIA 3UB3A 4MDEA 2WSMA 4OHRA 2LV8A 5AJTA 1NBMD 1IL0A 3PDWA 2X86A 4H7JA 4HDNA 3H2YA 4TQGA 4BKPA 3GAMA 1Z82A 2B37A 5JLAA 4KP7A 5K0LA 4OXYA 4LZAA 3PNKA 2ZSUA 4BQIA 4PBTA 2C5GA 1W2HA 2B5WA 2WABA 4NDNE 2VPQA 4R1LA 4JXKA 3N2IA 4ATNA 5J1TB 4AICA 4AF8A 4HNRA 4B2PA 4DJDC 3BFXA 3PE3A 2QVBA 2W8BB 4XPZA 4ZOEA 3FIJA 3UGJA 4AY4A 1G98A 1E60A 2XMQA 1XZPA 3D2LA 3ZJ5A 1P5ZB 2AR0A 2OCIA 2QN3A 2Y27A 2I4NA 3N0RA 4UNIA 4ZODA 1K98A 1Y7HA 3A2LA 3AF3A 4MIOA 2D4AA 2IP1A 5DOVA 3PZBA 3V1KA 4E5SA 3THYA 4E0BA 2GH1A 1V9LA 2B78A 4G4GA 5FTLA 2GAFA 4E31A 3EAFA 3O73A 3GVPA 3HGQA 4HZUA 3C8DA 4YCAA 1XTUA 4QFBA 3WYFA 1O4VA 2GZAA 4G36A 4BYMA 1KHHA 3L6BA 5LMZA 1VL8A 2WAAA 4JXXA 3C1TA 3IP3A 4FSXA 2B4YA 4LJ5A 3L0BA 2GETA 2PRKA 1F0NA 4GKBA 4RNCA 4HADA 1OI3A 4ND2A 4R1TA 5K6RA 2EBFX 2AI3A 2A5FA 3TOZA 3UHAA 2OPBA 4IH4A 1E3IA 5AW5A 4OQDA 4I4LA 1QZTA 3QLVA 3DDWA 4KUEA 3GFRA 1YL7A 4S35A 5ENVA 4Z0TA 2GRUA 1CNEA 5HF6A 1PJ8A 3IA2A 1U5AA 5ALKA 4I5GA 1EVKA 4LXTA 3JQAD 4IYJA 1C1YA 2R47A 2BDUA 1ZICA 3OQNA 3A2KA 2GZRA 1ETHA 1TYDE 3UAYA 4EO9A 2X6QA 3KKPA 4FDMA 4KZPA 4K26A 1Z0DA 4MX8A 2AXEA 2JCXA 1V8PA 1HZZC 4BECA 5AKLA 4CL3A 4WLNA 2H1WA 3IIEA 4F86A 3G0HA 1RLMA 2QRGA 4MYRA 1KK0A 2C7BA 1Q1GA 4XJTA 2BAGA 5H1YA 1AN9A 3SF8A 4BQOA 6REQB 1EI9A 1C1XA 2HMAA 3O3NB 2APJA 5BSTA 1NKVA 3SLRA 5AM3A 3QNUA 3WBKA 2DH5A 3T7JA 2WA2A 1E62A 1NXQA 5ERXA 2JLYA 3K5PA 4R8LA 4ER5A 3MAAC 3I6ZA 4PV7A 1RT9A 3GBSA 4NCJA 1NNI1 4X6YA 4IDCA 2QBYA 3JVVA 4ZAYA 3OE7D 5FOTA 3WGTA 1J99A 2COKA 2WZDA 3G5AA 4JP1A 4RAQA 2F90A 1IFXA 2PX5A 5H80A 4KSYA 4CEIB 3IT2A 5I7SA 3WDMA 5IDYA 5DE3A 3HUUA 1SBCA 4CGYA 3AIOA 2J46A 2QV7A 4MLPA 2EBUA 5LWQA 1TOAA 2OAQ1 3OJXA 1O3YA 3SICE 2UUPA 1HV8A 1GAWA 4I5IA 5DCWA 3NBYC 3FCXA 5DKFA 1XHFA 2FQWA 1EM8A 1E59A 2OK7A 1JJFA 2C1EA 2PGNA 2AUNA 2PO7A 2YXDA 2HIAA 1RWNA 2O06A 2I80A 1T3SA 3OPYI 2FPKA 5C4IA 2BFDB 1I94B 1HX7A 4PTYA 2P69A 5CDSA 1P2SA 3AF0A 3G02A 1GOTA 2C99A 2D5BA 4JD5A 3KHUA 1Z2NX 3ZWQA 3AM5A 4BDSA 4EPVA 3THOA 6AT1A 5A7HA 4D6PA 4ETMA 4DUYB 1VC2A 1ONSA 4I1UA 4XD7A 1I7QB 5FBLB 4ZT3A 4I1PA 2VDUE 3RS9A 3L4BC 1WF6A 2VZ9A 3ORFA 2QAIA 4Y6GB 5ES3A 4B3GA 1H8HA 3CEMA 3ABOB 1TX4B 2AXQA 3CNNA 1MEOA 5LLTA 4N5IX 2RAPA 1P9OA 2H3HA 4EMSA 3F74A 1S3SA 3RWOA 4DCVA 5DI3A 3HLTA 1C2YA 4DRZA 4GNRA 4BU1A 3FB1A 4LI0A 4MLCA 1ODIA 4EG7A 3C2QA 1HQCA 4HAXA 4X71A 4GI7A 2XYPA 1XAIA 3ZR4B 3AL3A 2D0PB 1ISHA 1GU0A 1R4MA 1SXGA 1T0BA 4LJSA 2I6TA 3JZFA 4DV7B 1KVTA 1WMBA 3EEIA 4MQLA 4ZVKA 3AUXA 5COQA 2JAOA 3FB4A 4KHZA 1YZKA 5CVDA 2HCTA 5L6MB 3D3EA 1UCFA 5F9FA 1SXJA 3G0OA 4TXHA 2IYSA 1RVDA 4PN3A 1M54A 5HIAA 1YRHA 2Z6VA 2R2GA 3GFFA 3VU9A 3SHOA 4A82A 1QP7A 1HDXA 4FSDA 1FK8A 1JR3E 2PCLA 4ZAWA 5HZMA 2XDQA 1RYDA 2QN2A 4UAVA 2BTQA 3K15A 3TUIC 4WCDA 5K0TA 1KQFA 3R24A 4ZYUA 1CEEA 1QH1B 3B9PA 2A0KA 4H7PA 4MEAA 3AUSA 3U9SA 4DT1A 2DOKA 4GLLA 4EKEA 3LXXA 5TF4A 1SIOA 4GOXA 4B32A 1AN0A 5FFFA 3TI7A 2A9RA 4HN2A 4XR9A 2WKRA 4HYTA 5T6MA 2BFAA 4AJ1A 4LUCA 1L4NA 1RLOA 2NWQA 2HEGA 4FFMA 1RHUA 3OFNA 3UCEA 1GVHA 5LDHA 2OXCA 3USCS 5EQFA 3TPFA 4QXOA 5CMLA 5IDWA 1BXKA 3PR1A 1MENA 2XI4A 1T6YA 5H9WA 1DIOB 4X61A 2Z1NA 5E0KB 4PG8A 2VPPA 2C0PA 4N7MA 4QAQA 3KLMX 1T8YA 3BRWA 1FTGA 2FMHA 2GR9A 2PH3A 3QMPA 2B7BA 4FHDA 1V5IA 1XVIA 1GCOA 4H35A 1P18A 2AT1A 4Y6OA 3OZUA 5FOVA 5AXDA 4EK9A 5FJIA 4MWSA 4XW2A 4XYBA 2VSNA 4URXR 1RFLA 1L3CA 1SC9A 2Q4OA 2Y2VA 4QLOA 4GX2A 5ALQA 3LHIA 2RJOA 1E5VA 4Q7EA 4DCSA 4ZRNA 4A0HA 4JLVA 2FFHA 3OEED 4PYRA 2QG4A 4R01A 2WVHA 1SHTX 3ADKA 1AKWA 3R3UA 4BEJA 3VTZA 1B1AA 3ZWPA 5JH7F 1Z7EA 2BMAA 2C31A 3H5WA 3W7BA 1LH0A 4BNIA 5LU8A 2IGBA 5CVTA 1JHVA 2KSQA 4ISCA 1XFDA 3GLVA 5IPFA 5CIYA 4YTEA 1XZHA 1BHQ1 2HQSA 2O9JA 2PIAA 2BEJA 3E9YA 1I10A 2CXNA 3G3EA 4DC0A 2HF8A 2OV3A 3SS7X 1C29B 1YI0A 2LRHA 3O93A 4LZPA 5F9HA 2JLWA 2V9CA 3PFGA 5J1SB 2Y6UA 3FYUC 1RM4A 2EGUA 3B7GA 1P1FA 3RTAA 2R1VB 4RJLA 4MR7B 3D64A 3KB8A 2MOKA 2HMWA 4H1HA 4DWWA 1GR1A 1W87A 2PRIA 1GL7A 1T9KA 1XX6A 2J30A 3L0IB 4FEEA 4Y0VA 3WFIA 1HOTA 1PR2A 1V9CA 3B1VA 2NXJA 2GVDC 4HS4A 4LYJA 4MS4B 4O4LB 1D2NA 4RDCA 1LI5A 1RI1A 2Y71A 4L07A 2JGIA 4YJHA 2FK8A 4NPHA 4Z3DA 2H85A 4KR0A 1Y5IA 1PWHA 2Z3ZA 4M0EA 4XD2A 4NQRA 5ESDA 4BP1A 2EC5A 2MMGA 3TSOA 2FPSA 3LYUA 3PNYA 4KMSA 5ALOA 2VPWA 1DHTA 3H1GA 2VUSA 1XU4A 2ZG6A 3MMXA 4B4VA 3X2EA 1U7UA 1TLTA 4WFKA 5FULA 1VHWA 1XR3A 4XFKA 1RJWA 2DECA 1HE8B 1S5PA 3KOMA 4G9BA 3TFWA 4US2R 3DAPA 1WX1A 1GEGA 2V98A 4N5NA 5KPJA 1CRLA 1CY1A 1SR8A 2ZJ7A 3Q6IA 3QKTA 1EXNA 2Y1CA 1N25A 1CDEA 2AG8A 2BFCA 1VHJA 3W6NA 2PZAA 6Q21A 3VV3A 1OIWA 4IHJA 2I7VA 2RGNA 1JAHA 1T24A 4NMHA 2VDWA 1KYTA 4JI8B 4KPFC 2O7VA 4WY5A 5DM2A 1YCHA 2O2JA 2Z2JA 3BB3A 5C81A 1IN4A 5E95A 4AM8A 3SKYA 1EFUA 2RI0A 4A16A 3CMCO 2Q46A 3IELA 2QLJA 4FFBA 4R5HA 5AICA 5AOCA 5JI3E 4QBTA 1PZGA 4YAGA 4K87A 4M22A 2OB2A 1K5DA 5G0UA 1ZO8A 2EW8A 3IVAA 1P61B 3CKLA 5FA5A 1KEUA 1M83A 3PIRA 3GFGA 2EFDB 1P31A 3IRUA 1QHXA 3QFTA 4RHYA 4MRPA 3U6BA 1WDMA 4UDYX 1CERA 2FEWB 3EEYA 4HGZA 1KSHA 2AS0A 1SWWA 2R8XA 4RU1A 2J0QA 1E61A 4CHTA 1WD7A 2C2WA 3DGFC 2X9VA 1ZIPA 1ZMOA 4QGAA 4I1RA 1FRNA 1FSGA 5KREA 1CZKA 4RTLA 4XM0A 3P0IA 4V0OA 2NU7A 4Q1VA 2FV8A 3DEIA 1VBNA 2FUCA 4A03A 1CSEE 3LQ2A 2GRJA 3WL8A 3GVIA 3B1KA 3UIEA 2R8EA 1A8UA 2BZ0A 1YU6A 5KCZA 4AT1A 1E4OA 2EEPA 3FUWA 3LL7A 1ZNQO 4Y2VA 4ALNA 2GTPA 1D04A 1P1JA 3I30X 3C3PA 3ZIUA 2W9XA 3KJIA 4YT2A 1GZ3A 4JX9A 3SWWA 3AVYA 2ZATA 1V8ZA 2EIXA 3CG4A 5TQ2B 3U80A 4DABA 1OMOA 1FSPA 1O97C 2R5WA 3AFOA 1X2EA 4K9KA 3FPLA 4QO8A 1PX2A 4NU6A 4A26A 2NT3A 2ZSHA 3QFCA 4OQXA 5BWMA 1SIBE 1MH1A 3I6IA 1KRXA 4KFTA 5BY2A 1N36B 2IYTA 3VR3D 5CXQA 2IY9A 2QW1A 2VJOA 3MELA 5KSZA 1V11A 1LDEA 1KEVA 1VRWA 2XDWA 2BFWA 1L1RA 2QPOA 4DQDA 2WTUA 4P5EA 1HEIA 1P39A 2JJ1D 2WHPB 4KLZA 3ST7A 3AUKA 4HVAA 4WIAA 4W1RA 4F84A 2J9FB 1UFRA 2GTHA 4U2DA 2RDMA 3DUFA 4XJVA 5AI0A 1QKKA 5LZ8A 5JO0A 2ZUTA 3W5IA 4JYPA 4REQB 4PHGA 1M1NB 3NR2A 1W52X 5A5EA 2LPMA 1W73A 2FWNA 2JJ2A 1DE0A 4TS3A 4EHAA 3THXA 3DVAA 3KQPA 3L1KA 4NRDA 2GHIA 5LBUA 3TNDA 5JMWA 4P58A 1H85A 3IDAA 4E94A 4XB1A 4R2IA 5CB4A 2EDAA 1HXHA 1DXHA 4MVXA 1LSUA 3UWSA 2ZW9A 2WYUA 1GY8A 1YZHA 2WF8A 3ADOA 4KO1S 3VU3A 1PK7A 3D6FA 3GRCA 4KI7A 3V1MA 2OOKA 1T5SA 1ZZGA 4LX8A 4DC1A 2JFHA 3PVSA 1X1SA 1DQNA 2P77A 3OY2A 3D4NA 2OE2A 1TI7A 4DIEA 2P9CA 2C42A 3D8TA 3U4QB 4MV0A 2O6HA 4WOKA 3B89A 1QGUB 4E5YA 1D9ZA 2VF8A 3W9SA 3BIOA 2VSFA 2ZBFA 1E2PA 4RF3A 2H1LA 2VHJA 5I7FA 1ETUA 3WL3A 4HI0E 1U9JA 2FPMA 1N9GB 1ZA2A 3EDYA 1Y3CE 2C07A 2XCUA 4LWPA 4Q3LA 3ETCA 4UTNA 3MK31 3WI7A 4ARZB 5EIFA 3T54A 3RTEA 4OSEA 2I65A 2BUCA 5BN1A 1XTIA 1I4EB 4HL6A 3TIFA 4J1QA 2HGZA 1RWQA 3B51X 3TECE 1ECJA 5AKXA 2W42A 4DV3B 2HMSA 2L17A 2Y2UA 4I4TF 2Q3DA 5E7IA 5FBKA 4PF1A 2EAUA 1UJ5A 521PA 4RETA 1VGQA 3N6VA 5DM4A 5KO2A 3D6MA 2NNLD 3A11A 3HH8A 4RVOA 2E4XA 1N5LA 2WSIA 4XKJA 3VC7A 3ZH9B 2IDJA 2JJ2D 1KFBB 1UKZA 2PS3A 3JQRA 3AGPA 5DO9A 3F5MA 3FI9A 3UH1A 2YJ4A 2SBTA 5AHRA 3M4JA 1NQXA 3PJGA 1EXVA 1LI7A 4J7CA 1V7PC 3PQCA 2ZRGA 3K20A 2G1KA 3CH6A 1E2JA 1HUQA 1G3IA 4MKXA 5FBWB 1TLLA 2P35A 2RKOA 3G7SA 3QEMB 1XWWA 3IQEA 4OIMA 3SJBA 4EG4A 4G8DA 5J4YA 2G70A 3PA8A 2BE9A 5IZCA 4L4UA 3WFJA 4DV6B 1AS3A 5AHXA 1HORA 1XJQA 3HYRA 3NDRA 4O2AA 3EA4A 5J4VA 1K6IA 4B4DA 2F8MA 1ZUWA 2XGOA 3E15A 3BT7A 1EA7A 2HO4A 4ZO8A 1UMCB 3NVKI 3BYZA 4RJJA 1AVTA 4D46A 2YN2A 1RJEA 3GV0A 3GXOA 3P9IA 4CFYA 2XT9A 3IVRA 4X8OA 2NYVA 3SXPA 3UW1A 3FAKA 2NPOA 3KJQA 4C1BA 4NCXA 2OMKA 4CKEA 3L8GA 3ZY4A 3IMEA 1J0DA 4BLTA 2Q9UA 1ISSA 3GLSA 2QI9C 1A9TA 1NDHA 2IV3A 5JJCA 5AXAA 4CIWA 1E2MA 3VZRA 1JDBB 2R68A 5FOQA 2H08A 2Y67A 2ONCA 2C29D 2ZUSA 3ZGXA 4AKGA 1VMKA 4KN8A 2CJYA 1BQ3A 2BT4A 2DFNA 3C3EA 3EZFA 3T99A 2JCBA 1OU4A 3VZCA 3C5EA 3NHWA 2R751 5BR8B 2I6GA 1SBQA 4KV7A 3OKAA 4KDCA 5FPYA 4ASUA 4F97A 2J0SA 1A9RA 3FLAA 4A5OA 4I55F 4HWGA 2FVYA 3A7EA 3WB2A 3GLFB 1J5EB 3BB4A 4L3VA 1N77A 2OT3B 4F91B 1HF3A 3OFVA 1F38A 4R05A 2GZDA 3KOOA 3STTA 4MVJE 2R3SA 5IF3A 2D1FA 3WK8A 1MF7A 4L0QA 3DBVO 4G5GA 1X3LA 4TWZA 4BUZA 1PUXA 2XMGA 4A10A 4PLTA 4UEQA 3W4KA 2UZ4A 1E6MA 2GAIA 3RF6A 2WP0A 3IAAA 2J41A 3T7AA 3UFXB 1HLGA 1FRFS 1XF9A 5I3ZA 3B38A 1RRGA 3B6JA 1TYAE 1E99A 4WADA 1MXHA 1J9GA 4NK4A 2V9PA 2E82A 4XWWA 1DC7A 3HO1A 3P0JA 4QPZA 1LVUA 2WC1A 5AI5A 3O8CA 2F3PA 1SVUA 5I7HA 3OO0A 1YV9A 4BFYA 4PONA 4O3MA 2JBWA 3P96A 5AVXA 2PS9A 2C2HA 1GAEO 5C1OA 3GROA 4EGAA 3N8HA 3NXKA 4JT8A 1BCSA 3IJEB 3I83A 3MTAA 1UBUS 4PNPA 3SNKA 3WYCA 4GX1A 1X0XA 4EUEA 2DULA 5B1YA 2R44A 1YZGA 1M3SA 1QANA 1FMJA 1PR5A 3BK2A 1FRQA 3FNHA 3KOZA 4LHVA 2WJJA 2P2ZA 2JAHA 3DEAA 3QVVA 3ZZ0A 1G1AA 2ZRPA 3G8DA 1Q17A 3EVTA 5HGXA 1M8GA 4GLJA 4AMVA 5KTRA 4FM9A 2O2EA 4UXJA 4YIHA 4Z9XA 2JGJA 3PQ2A 2HKIA 4MTLA 2AFIA 2OD2A 2XT0A 3EXFB 4PRLA 2XPCA 4BAUA 5JJIA 3CURA 1TAHA 4BPRA 4E03A 1NI3A 1ZBDA 4K6OA 4KBFA 4N9QA 4PEVA 4WXMA 5JD6A 2WE7A 3L6RA 3HUTA 5JYCA 1EGQA 3S8YA 2W2QA 2A7QA 1GU1A 1DKLA 4Q01A 3WLSA 1EA5A 2XSZD 4YRRA 1N5MA 3EVZA 1E5DA 4OJMX 1XG5A 2W6QA 3AI2A 1Y9EA 1Z45A 2QY9A 3HYLA 3AG5A 1OAOA 5HFJA 3OTWA 3DO6A 3IIMA 2YWRA 4K3UA 3ROXA 1K5HA 3RYFB 3TEFA 2W0MA 5C18A 1CY7A 3I0ZA 3Q1KA 4DG8A 4S1NA 2VK8A 4ESEA 3UOGA 4TMXA 3GFSA 3OX3A 1O96A 2CDRA 4FFRA 2YFYA 3E18A 3AW9A 4BNLA 3AI3A 4RFSA 2XV1A 5B7PA 4XX0A 3IIJA 3LRPA 5D01A 1N8SA 1Q57A 3WLKX 3LUCA 5IP5A 3WB9A 5C51B 1CUEA 1Y7LA 2R7AA 2KHZA 2CHEA 4JLJA 3HFJA 3NV7A 2WU8A 4QUBA 1OE0A 1KPIA 2YXEA 1NHGA 1QFSA 3LY5A 4FMBB 2ES4A 2V45A 1QVWA 4GOKA 4UNPA 4BO5A 4HGOA 1P2UA 2J6IA 3NNSA 1JKJA 2H31A 5FPTA 1B6GA 1V3UA 2V0CA 5AT1A 1TEHA 4AG5A 721PA 1NC1A 4ZVTA 3ZYCA 2FQQA 4JMLA 5IAAA 2D7CA 4FEYA 1JFRA 4DR2B 4EY7A 2I5PO 1HYBA 4Q24A 4HXEB 3DDHA 4BQPA 1BMDA 2V54A 3I5XA 2V3WA 4DCPA 2PJDA 2YV5A 3DT9A 2PSHA 4C0HA 5L3QB 1BU5A 1G8SA 5BYBA 5JY1A 3PWSA 1Q0QA 4NQZA 1XALA 3V32A 5HMLA 2YZ7A 4MRSA 2K7FA 1E6CA 4KVZA 3N59A 2FG6C 1NOKA 1D2HA 4FFPA 3NUZA 2PFSA 3WIOA 3LLCA 3IODA 2CDCA 1FJHA 3FPHA 4II2A 1KR2A 1QB8A 3K0FB 4MHTA 5KQLA 1ZRHA 3HBNA 3JTMA 1Q7TA 4JC4A 1HDEA 3COSA 3LDUA 3AL0C 4KQIA 1BYUA 1WHSB 1WSDA 3PQ4A 4WXHA 5IKOA 2CNKA 3EISA 2RK4A 1ZXLA 3GZNA 2GNPA 1JHYA 1L5HB 4IILA 4RHUA 2R62A 4BRWA 2ZT5A 1Y89A 5FIUA 3TI9A 5I4BA 4OUKX 1LBIA 2ZLBA 1J0EA 3OA2A 4E07A 1PL0A 1H93A 5BPHA 5F51A 3TD6A 5I51A 1XKXA 3O9MA 2HI0A 3Q6NA 5CVVA 2XNSA 1S6YA 4FZJA 4ID3A 2RBKA 1QR6A 2WJ4A 4P53A 2HMYB 3IHKA 3HK2A 3ONEA 3TQSA 7AT1A 4BJ6A 2P5UA 2BKXA 5HQJA 1V47A 3F6CA 1LQ2A 2JLRA 1ZW1A 2X1LA 3KKNA 3KR9A 3R3JA 4C7JA 2GO7A 4L95C 1M76A 3EGCA 5D1NA 2PGJA 4E4YA 1FRZA 1P19A 3I6MA 4AW9A 5GZ1A 4D5EA 2HJRA 2GXSA 2D74A 5JTTA 3FCUB 4KRYA 3VR4A 1WW8A 2DR3A 1W0JA 2OZLB 2ZR8A 4EVQA 3RBZA 3BMOA 5HNKA 1DBRA 5HYVA 4MAAA 5M7EA 1TW3A 2QG6A 4QTXA 5HMMA 5CPFA 3V8EA 2O8DB 2B6NA 2BI8A 3NWEA 3QXGA 4LA4A 4LHEA 4IDAA 4JUBA 3WGQA 2C7QA 2GN9A 1DKRA 1MU0A 1IBKB 4R3UC 3AY7A 4ZZ1A 1YR3A 4OX9B 2IIQA 4J6EA 2C59A 2ZK7A 2UVDA 3HFSA 4HEQA 1Y5RA 1XL0A 4XWGA 1ONNA 4JI6B 4ENQA 4PO3X 1T34A 2I78A 1ZVMA 2FMFA 1C7JA 1O0SA 2CFOA 3T5PA 3IEMA 3EMVA 2ZVQX 1BN7A 3WYBA 1Y6RA 1QIEA 3EN0A 3N39C 3U4CA 3RTCA 4WUVA 4WJLA 1SM4A 1PVOA 3SNHA 3ZS9A 5KSPA 4FMDF 4WKPA 1QP0A 1MLDA 3RB8A 2ZYUX 1ADJA 1XEFA 1KJYA 4MWGA 4FIZA 2OORA 2ACVA 1OXKB 2BKEA 2B98A 2D13A 3KHKA 5BWCA 3TL6A 2FY8A 4DMMA 5FFMA 2GBPA 2WKSA 4N65A 1XGKA 4XE5A 1NBME 4TM7A 2MHCA 3VXKA 3ZCRA 3P9SA 4CUJA 2IIPA 2HQBA 4RK7A 4K6FA 2WYOA 3ENWA 1J39A 2WIAA 2YW2A 3LCUA 1BNCA 5I9MA 1T6NA 3LLVA 2CHFA 4NS1A 2N75A 2Z4RA 3E9MA 4E2WA 2W4IA 3NH9A 4KOEC 1Z7BA 3H2KA 3R0ZA 5MN4A 3N9IA 2ZPTX 1HZZA 5DSZA 2JARA 5EHNA 1G6Q1 2E4ZA 1SUFA 4GX5A 3UPDA 4YO8A 5DHUA 1DRVA 2QJWA 3C3XA 3AG6A 1HDCA 2C7GA 3CRNA 3OEWA 4BRSA 3PU6A 4H3SA 5JXHA 1OHHA 4MKZA 5JJKA 3BMQA 3EB9A 1RM0A 4NPAA 4WCFC 4KR7A 3FNIA 2OESA 3CJTA 2PR7A 1T4DA 3E70C 3HDGA 4EYOA 4UEJA 1TPYA 1GNVA 4G67A 3R77A 2RCNA 1E3SA 1CY0A 4X1OA 5CYOA 1RE0A 4CTMA 1J42A 2PUJA 3UJCA 3UBMA 4ARIA 3NB0A 2DLCX 2A14A 2AKAB 2I2BA 3O8DA 1UIRA 1M67A 2N1BA 3P7MA 1T36B 4CLDA 4PG5A 4AK9A 2NNWB 3I04A 4R3NA 2BN4A 1U80A 4PX2A 4FR5A 3B20A 3I72A 1QCYA 1ZC4A 4MROA 4MW4A 4UEOA 1DX6A 3NOOA 3LLMA 5AHOA 1YTUA 1YZQA 1K0FA 2R6AA 1I7SB 4CXMA 1UPXA 5HS4A 2RI1A 1KK2A 3P1JA 1MNQA 1LFDB 2CJFA 2F43A 1K92A 1M2NA 2IVZA 1UINA 1KDZA 1N4AA 3NKFA 3VJKA 4EB6B 3LUGA 1VE3A 1VPLA 1OASA 2YS7A 4HB3A 5BNZA 1I6KA 4FNGA 4Y9TA 1XVUA 5JRDS 1V71A 4RD2A 4RA9B 4WZAA 5DK4A 3PC4A 2D5CA 1P7PA 4F96A 2R86A 5GAJA 2XUAA 1IPFA 1V5FA 2HF9A 5HJEA 3T1QA 3RHSA 2FSFA 4GO1A 4RM2A 3T7CA 4CU2A 3WTCA 3R3HA 5BNWA 4OQ4A