2DPMA

Dpnm dna adenine methyltransferase from streptoccocus pneumoniae complexed with s-adenosylmethionine
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
275
structure length
258
Chain Sequence
TLQPFTKWTGGKRQLLPVIRELIPKTYNRYFEPFVGGGALFFDLAPKDAVINDFNAELINCYQQIKDNPQELIEILKVHQEYNSKEYYLDLRSADRDERIDMMSEVQRAARILYMLRVNFNGLYRVNSKNQFNVPYGRYKNPKIVDEELISAISVYINNNQLEIKVGDFEKAIVDVRTGDFVYFDPPYIPLFTSYTHEGFSFADQVRLRDAFKRLSDTGAYVMLSNSSSALVEELYKDFNIHYVEGKISEIIVTNYEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTEIN (ADENINE-SPECIFIC METHYLTRANSFERASE DPNII 1)
publication title Crystal structure of the DpnM DNA adenine methyltransferase from the DpnII restriction system of streptococcus pneumoniae bound to S-adenosylmethionine.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 89
structure length 258
sequence length 275
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 1998-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 2dpmA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2dpmA01
3PFGA 1O9GA 2AOTA 4PGGA 2PGXA 3LDFA 3DULA 4YUWA 3EVFA 2PWYA 4FS8A 3THRA 5F2KA 2LD4A 2PY6A 2NP7A 5DTMA 3FYDA 2FCAA 2PX8A 2HTEA 1ZGJA 3LKDA 4Y30A 3VSEA 1M0EA 1YFLA 3ER8A 3PS9A 3G5TA 3ORHA 3UJ6A 5HILA 2BZGA 4PYKA 1VIDA 4RWZA 3LGAA 3G5LA 5DSTA 4BLWA 1RJFA 2ZW9A 3P9NA 2K4MA 4QQKA 1L1EA 2E5WA 4RTQA 1X1CA 2UYQA 1WG8A 4FT4A 1ZQ9A 4XUDA 4EQZA 2O06A 2VS1A 3P2KA 1AQIA 5EEGA 4AUKA 2VP3A 5EQJB 1X1AA 5LQJA 4PYMA 1EAMA 1JTEA 4C04A 2HMYB 5KQRA 4QQNA 1ZKDA 3R0QA 5BXYA 1AQJA 4YUZA 3A4TA 5EG5A 4CWAA 3DXXA 1QANA 4X1OA 2JH9A 2OBFA 4XCXA 1VLMA 1RI5A 3FPFA 5GM2A 3FUTA 4GUAA 1QYRA 4RV9A 4IV8A 1WZNA 4GOOD 4G56A 3GCZA 5EIFA 2AZTA 1KPHA 2ORED 4GOMD 2UZ4A 3FPHA 1NW3A 1NV8A 3GRZA 2HNKA 1N7IA 3PX3A 5E8JA 5E8RA 1RJEA 3CC8A 2NYUA 2PLWA 4PONA 3R9XB 2ZTHA 2FPOA 3UFBA 2IDJA 3HCFA 4A6DA 5CUQA 4CTJA 3FZGA 5LQRA 1HNNA 2AN4A 2PX4A 4YV1A 4FZVA 5EC8A 2ZCJA 3KKZA 3DMFA 4B17A 5K03A 3BZBA 2OO3A 3KU1A 4X60A 4C08A 1SQGA 3OU7A 2V7EA 5DX8A 2F8LA 4WXHA 2ZZMA 4GF5A 2YUIA 3NWEA 3DLCA 5EMKA 3P97A 2QRVB 1IY9A 3Q87B 3GRYA 3HCDA 2UYCA 2GPYA 3DUWA 5FA5A 3P71T 5T67A 1OR8A 2G8NA 1EIZA 3HVKA 4L7VA 2EG5A 1YZHA 2ZULA 2AOTB 3NWBA 4HC4A 2GS9A 2AS0A 2PBFA 4PYNA 4QVKA 2Z6UA 5ICFA 3ELDA 5LQUA 2ADMA 2BR3A 1ZGAA 3TM5A 5K0JA 3EGVA 2Y1WA 4V0QA 4POOA 5T6BA 4F84A 3TQSA 4C07A 3NMUF 3KPYA 2IIPA 4OA8A 4BLUA 5DM4A 5DXAA 3G2PA 3WSTA 3BGDA 2P1DA 1WY7A 3EGEA 3ID6C 5EPEA 1VE3A 1KYZA 4GOLD 3UJ8A 3UZUA 1M6EX 3MERA 2DULA 3KHKA 2JHAA 3G2OA 1X1DA 4QDKA 5T64A 3TKYA 4KIFA 1D2GA 3UJDA 2HWKA 4C03A 1TW2A 3LCUA 1NT2A 4LECA 5GM1A 1X19A 3VC1A 4ER7A 5LSAA 1QAMA 3FUXA 3BKWA 4DCMA 3UA4A 3EEOA 3A7DA 5EZSA 1HMYA 5FQOA 3BT7A 3MTIA 2AN3A 1XTPA 3OZTA 5DM1A 3DTNA 4KWCA 3DMHA 5KVAA 1FJXA 1RI3A 2FK8A 3OE4A 4E70A 3C3PA 1WS6A 5K0NA 3CJTA 3M70A 5CIYA 4MWZA 2OKCA 4C05A 3EGIA 3T7TA 2CL5A 1KYWA 2PJDA 4HG2A 1YB2A 5HIMA 5K09A 1AF7A 2ZWVA 3GIWA 1O9HA 2P8JA 1ORIA 2FRXA 3GRRA 1KPGA 4DMGA 3P9IA 4P7KA 5P8WA 3SSOA 4HGZA 3UJCA 3CJQA 5JUWA 1UWVA 3HEMA 3LSTA 1D2CA 3P9KA 2EFJA 3R24A 5DT2A 5FUBA 2AOUA 5K0LA 3X0DA 3EMBA 1BC5A 1NW5A 3THSA 2FYTA 3E7PA 4FGZA 4AZWA 4E33A 2Z6QA 3C6KA 2ZIFA 4RVGA 3HNRA 8MHTA 1PJZA 1INLA 1VP3A 2ZBRA 3DXYA 1NE2A 2AN5A 5FHRA 3GRVA 3P9CA 3SR4A 4AZSA 2NNWB 9MHTA 5K0CA 3P8ZA 1AV6A 3D2LA 2V74B 3LDUA 2PT9A 3B89A 3OU2A 3KPWA 4LWOA 4EKGA 4RTPA 5CM2Z 2B2CA 2BM9A 5K0EA 4ISCA 4DF3A 5KQSA 1BOOA 3TR6A 4R8SA 4GBED 3NVMB 4R6XA 2GB4A 5EHIA 1YFJA 1NBHA 5EEHA 5FWAA 2YQZA 3EVZA 3TOSA 4AZVA 7MHTA 3QV2A 3I9FA 3PVCA 5GIOE 2GH1A 2KW5A 3AY0A 3CJRA 4JXJA 4F86A 3KPUA 2BR5A 5E1MA 3KQVA 1KXZA 2AVDA 1NW7A 3I58A 1IXKA 4PIPA 1JG1A 1QAOA 4Z2YA 1UIRA 3GJYA 5CVUA 1I1NA 2NXNA 4MIKA 5E2AA 1NV9A 3V97A 2UYHA 5K01A 3M6WA 2PXXA 4ER3A 4WVLA 4M37A 3JWHA 4P7GA 3CGGA 3FRHA 3C6MA 2CMHA 2I7CA 3S68A 2HR1A 4CKBA 1XXLA 2YXEA 3HCCA 3GWZA 4PYOA 3KQTA 2UYOA 4RTJA 2A14A 3FUVA 2P35A 1L3CA 3NW9A 4HGYA 3RW9A 2NXCA 1FP1D 3B3GA 3KQOA 5H02A 2YR0A 1R8XA 3SVZA 1NW8A 4QTUB 1FBNA 1PRYA 2OPBA 3G8AA 5BP7A 4XUCA 2C7RA 1EJ0A 4EVIA 3M33A 3VYWA 4MHTA 3PB3A 2YXDA 2IH5A 1Q0TA 1H1DA 1EG2A 4AZTA 2OXTA 2AOUB 5LQAA 3Q7EA 2XYVA 2ZSUA 3MB5A 2OYRA 5HEKA 3SGLA 3MHTA 3G2QA 3I53A 4EK9A 3TFWA 5DX0A 3DOUA 4CKCA 3DR5A 3G8BA 4RTKA 2Y1XA 2Z6AA 2G70A 1R8YA 3PFHA 1DCTA 3HTXA 2ZLBA 3B5IA 4PYQA 1NKVA 4XUEA 4YUXA 3TMAA 2XVMA 2VDUE 5EHGA 4M7RA 4BP3A 4KRGA 4DCGA 2PXAA 3PT9A 3KQMA 4GOND 1RJDA 4DZRA 5E1DA 1M6YA 2I6GA 1KP9A 5DRTA 2JHCA 3B3JA 3LCCA 3OE5A 1TW3A 2QYOA 3LPMA 4GQBA 4OBXA 3MTEA 4PGHA 5GINE 4IKPA 5FADA 4ZTBA 5GIPE 2QY6A 2PVCA 3ELWA 3KQSA 3NDIA 4F85A 4YV0A 2JG3A 3EPPA 2PX2A 5HIKA 3C3YA 3I5UA 1KIAA 2CMGA 3MAGA 1SG9A 2PXCA 3BKXA 5FQNA 1WXXA 5GWXA 3JWIA 3SSMA 3K6RA 3LCVB 2PX5A 2XBMA 1R18A 5FWDA 1Q0SA 5EOVA 5E1BA 2IH2A 1N7JA 3HA3A 5K0GA 2QE6A 3VC2A 4CTKA 3EVBA 3EVGA 3FTCA 3GNLA 1V39A 3UBTA 3G89A 5JR3A 1Z3CA 4PIMA 5EVJA 3A25A 5EMMA 1JG4A 3HA7A 4RSRA 3TLJA 1JQEA 1VQ1A 3UJBA 5DM0A 3LDGA 4E32A 4FT2A 2PWPA 5MHTA 1DL5A 1JTFA 2ZWAA 4MQ4A 4RTRA 5LR6A 4PYIA 1G38A 5ICGA 1I4WA 3FUUA 4HTFA 3F4KA 4OQDA 4PWYA 4ATNA 1JSXA 1P1CA 2EX4A 1U2ZA 3LBYA 5GOZA 3T7SA 2OY0A 4BP1A 1VL5A 3GGDA 3G2MA 5FA8A 5C1IA 4A6EA 4AX8A 4IV0A 2OB2A 5U4XA 1RI2A 5DRYA 5HIIA 3BUSA 3BWYA 1L3IA 4UOEA 3HP7A 5E9JA 1L3BA 1Y8CA 2QM3A 3TM4A 3LL7A 1G8SA 3OU6A 4GEKA 4OA5A 5DX1A 1N2XA 4PCLA 4PINA 1VPTA 3HVHA 4P58A 5DPMA 4DKJA 2GAFA 2NXEA 3A26A 3T7RA 4YV2A 2IBTA 4RVFA 3MCZA 2WA1A 3KQQA 4KDRA 5KS2A 4R8RA 3EVAA 1BKYA 3BWMA 2JHPA 1P91A 3CVOA 3HCBA 2ZFUA 4X63A 4K6MA 4QDJA 3QOXA 5DLYA 3DP7A 5EKUA 5HZMA 2AOXA 4NECA 4HH4A 2P3LA 3EVDA 1O54A 5M5BA 2BH2A 1YUBA 1JR4A 2YXLA 2H1RA 3LECA 5E9WA 2IFTA 2CWWA 5GP1A 4BY9E 1WXWA 4YMGA 3A7EA 4P7FA 1UFKA 3E05A 4PNEA 3CBGA 3E8SA 3REOA 1XJ5A 4DM3A 3HVJA 3GO4A 2P40A 3BXOA 2EJTA 2XVAA 3AWIA 4R6WA 4E2XA 4O29A 2ZZNA 2ESRA 1BHJA 3MGGA 2O57A 3O7WA 1ZHFA 4QVGA 2P7IA 2IDKA 3PTAA 1G55A 10MHA 5C0OE 5D1HA 2O07A 2EJUA 3MQ2A 3B3FA 1SKMA 5DWQA 2G1PA 3FPJA 2OB1A 3DH0A 3DXZA 4CKEA 1G8AA 2XYRA 4E2YA 3QOWA 3R6TA 3P2EA 4CXMA 4YUYA 1X1BA 2IP2A 1XDZA 3KQYA 2ZIGA 3HA5A 3OZRA 5E1OA 2H00A 3TKAA 5B1SA 2P3QA 2PSSA 3AJDA 5LQNA 2I62A 2O05A 3JWGA 5BW5A 1XVAA 5DXJA 4HTFB 4E2WA 4KW7A 3GDHA 3FTEA 3KQWA 1MHTA 3JWJA 4LG1A 3NDJA 3M6UA 2FK7A 3OFKA 3AXTA 1FP2A 2P7HA 3H2BA 2C7OA 4PCAA 3PLAE 3GRUA 3UJ7A 2VZ9A 4RTMA 5ICEA 2Q41A 2AR0A 5CVDA 2B3TA 3G7UA 4OBWA 5EKXA 1QAQA 5KYGA 2N47A 3LBFA 5HOQA 3KPJA 3EEYA 2OZVA 3UJ9A 4V0RA 1DUSA 3RODA 1YZ3A 2JJQA 4MTLA 5CVVA 2WA2A 4FP9A 3ANXA 1P1BA 3UA3A 2GA9A 5DM2A 5HFJA 4FR0A 3DMGA 5CVEA 3TPZA 1IM8A 4EKIA 4ER0A 5IKMA 4KVZA 5K05A 4RTNA 3IV6A 1T43A 2ZVJA 3HCAA 3O4FA 3KR0A 4QPNA 4RX1A 4KDCA 1B42A 5FHQA 3LKZA 5F2OA 3L8DA 1TPYA 1R74A 3NVKI 1EQAA 3MCTA 1MJFA 5EMJA 3UWPA 2C7QA 3ELYA 3FRIA 3OZSA 5E9QA 1NBIA 3O31A 3ME5A 4RTLA 1JSZA 2G71A 2ZBPA 5HIJA 2BR4A 3BWBA 4H0NA 1XCJA 2YTZA 1VP9A 2DPMA 2XYQA 3BGVA 3KPVA 3BWCA 5CVJA 3IHTA 4ER6A 2AOVA 3KQPA 4FSXA 5EGSA 4X41A 3M4XA 2HV9A 3KR2A 2VDWA 1XDUA 4R05A 1R00A 5EZQA 2ZBQA 3U81A 4RVHA 2O0LA 4E30A 3IEIA 3IYLW 1ORHA 4C4AA 4DQ0A 1JG2A 1XDSA 4GC9A 3SMQA 1RI1A 2CKDA 4E31A 1QZZA 4KIGA 2ZZKA 3M6VA 1SQFA 5EMLA 1RJGA 5K8VA 5EIWA 5BW4A 5ICCA 2BM8A 3E23A 4U7TB 3NJRA 2ONZA 3LHDA 1SUSA 2AVNA 1JQDA 3SX0A 3FUWA 5FULA 1FPQA 1KR5A 4RTSA 4RTOA 3P2IA 3C0KA 1I9GA 1XCLA 2NP6A 1L9KA 2C7PA 3FTDA 4E2ZA 5CD1A 3CKKA 1YF3A 1JQ3A 3GU3A 3OPNA 4IWNA 4QPPA 2G72A 4X61A 4M38A 5LQKA 3FTFA 3KR1A 1P39A 3HCEA 5ERGB 3RIEA 4PYJA 3ER9A 3PX2A 2I9KA 2PT6A 5C9ZA 5K0FA 3HVIA 2P3OA 3K0BA 4GC5A 3EVEA 3TRKA 1R6AA 2R3SA 3I64A 5D1NA 5FCDA 5LQCA 3T0IA 3FPEA 4FSDA 2FHPA 3AXSA 2IPXA 3EVCA 4RVDA 2ONYA 3HM2A 5DSXA 2ZIEA 2B9EA 4HSGA 3GXOA 1KHHA 2NXJA 4RYLA 3FYCA 4QTTB 5G02A 4YUVA 4C06A 4OX9Y 1G6Q1 3ELUA 5DTRA 1SUIA 1RI4A 3SSNA 2ERCA 3KR9A 3B7PA 5F2NA 5CCXA 2YVLA 1D2HA 4YMHA 3R3HA 4P7JA 2IGTA 3UJAA 5DTQA 5K0BA 3OFJA 3EMDA 4OQEA 4U7PB 5IH3A 3V8VA 4ER5A 3BGIA 2H11A 3DLIA 3G88A 2JH8A 1EJ6A 2R6ZA 2IH4A 1F3LA 3FPGA 3OCJA 4Y2HA 2IBSA 2P41A 5CCBA 1VBFA 2PKWA 3A27A 2PV0A 4PYLA 1F38A 4DA4A 1G60A 2WK1A 2YX1A 1NW6A 3SM3A 2QRVA 2VDVE 4BLVA 1JG3A 2AOWA 3SXJA 1SVUA 4M36A 3M6XA 4HRAA 4EMSA 3ERCA 2B25A 2B78A 3CCFA 1KPIA 5E2BA 5FTWA 4LWPA 3NTVA 3LX6A 1ZG3A 2GLUA
chains in the Genus database with same CATH superfamily
1AHHA 3HLTA 3KIPA 4R0NA 1UQUA 1N5DA 2FJUA 3R3UA 2P2SA 4G1VA 3PRJA 4KXFB 4PZZA 2C2YA 1GD1O 2PWYA 4JT4A 1XBTA 4OBBA 4U5QA 1MD9A 1Q7RA 2FE4A 2NZVG 3Q5EA 4U9HS 1T0HB 2HTEA 1NVUQ 4IRXA 3Q9NA 1E66A 3OP1A 3ROKA 1VLLA 5DM60 4L28A 3EPRA 4D9NA 2F8MA 1GV0A 3OM9A 4O3FA 4L0QA 2E49A 1G8MA 5DSTA 5F12A 4G8CA 3VDMA 5BSHA 5LD2C 1DEHA 4G5OA 3H6HA 3W5DA 1I13A 3PFWO 1NZDA 3C5WP 3LXUX 3QXXA 4UMDA 1WG8A 3AZPA 2O06A 5T4HA 1X1AA 1YQQA 2I6QA 4G97A 4B6RA 1H4SA 3GUZA 5BSKA 5JDIA 3Q2IA 2OCYC 3TQFA 4BJ3A 4EZEA 2FMUA 3A4TA 2X8WA 1UKCA 3IO3A 5AUQA 2GAJA 1S01A 3K96A 1VLMA 1T2FA 3EQ2A 4IGEA 3WNBA 5IT5A 4J2TA 2VT7A 3FUTA 4RV9A 3A0RB 3P4XA 4Y0NA 1QJCA 2TMGA 1WPRA 1YDMA 2FUNB 4MUYA 1C30B 2A59A 1EDDA 3QE2A 4LRSB 3K9HA 3TSOA 4GOMD 3VAYA 4C6TB 4C4XA 3FPHA 2UZ4A 3BBPA 4Z9BA 3B9RA 4KLCA 4Q1DA 4EFLA 1T8YA 2I8AA 3IUEA 4QXQA 2DM6A 3DM5A 1ZD1A 4GQIA 4FFSA 3AI3A 4A6DA 3W4JA 3L18A 5EC8A 3JTMA 4RVUA 2UAGA 3TTWA 3VPXA 4QTZA 1D6NA 1OIVA 4HRYA 1ZNZA 2RFLA 2QN8A 2ZZMA 4QLBA 4LVCA 1TZKA 3RBAA 3EOBI 1RQ2A 2CXSA 3ABQB 3I6QA 3TLYA 2E3JA 4RGBA 3VU9B 3I5YA 1PQYA 1PWHA 5F1PA 3BMQB 3JZMA 4DR5B 5T67A 2YRXA 1E63A 1HETA 2XRFA 4TM7A 4RBNA 1CJMA 1OLOA 1DBRA 5F2EA 1JPNA 1PN3A 4Y2UA 3RT7A 4R2JA 2QX4A 4QVKA 5ENVA 4WBNF 2IZOA 3AKDA 3L4SO 3QE0A 2W0MA 1NLFA 2HRBA 4MR8A 4V02A 1RNLA 2IOFK 4IJWA 5F3WB 2Y1WA 1MLDA 1QBGA 2X9NA 4C6RA 4FGLA 5T6BA 2HLDA 2HNBA 1OFVA 4XWYA 5BNFA 1W30A 1CIJA 2FDXA 2I67A 2OV8A 2CSUA 4YCJA 5JS2A 1GPDG 1EGMB 3G3EA 4Y1GA 3KS9A 4N5LA 1W85B 3EGEA 1G8FA 1W93A 3IAS6 3TR0A 1Z6XA 4NE9A 4RHCA 3L0SA 2Y2VA 1Z6AA 3UJDA 4KIFA 2Q5HA 4E14A 1NR7A 1YA4A 5FL7D 1AGRA 4PC3A 3QEOA 4JYMA 1WPGA 4FVTA 5BSWA 4L8WB 1F7UA 4YJGA 1A9OA 1MQ8B 4FEGA 3LZDA 4K9RA 5FNVF 2JFVA 3S7TA 3DKVA 1ZCJA 4INJA 2PSHA 1U7PA 4M99A 3MM4A 4AWBA 2WB2A 1L1FA 1J49A 1W29A 3OFSA 4FZJA 4BX9A 1O0SA 2GYYA 1L4LA 4NARA 1OAOA 3GA0A 5BR8B 2A94A 3U4QA 1ZUHA 1CQJA 4YMWA 3OE7A 1C7EA 1CIVA 4HGZA 1UXHA 4RW0A 1JXMA 1EFPA 1WSWA 2I22A 2VK2A 3B20A 3EZ9A 3IKLA 3QPUA 3OKAA 3AW8A 3R24A 1L4EA 1OE0A 3CZ9A 3EMBA 3GGPA 3K2EA 4WXYB 3N5KA 5HX7A 4BN4A 5KYXA 5ADHA 1YJ8A 3D4IA 4A3SA 2OG1A 3TE6A 4BMYA 3QEMA 4R1MA 5LIRA 1W25A 5B1IA 1RXWA 3L1IA 1SN7A 3ZK9A 2ZUSA 4MEAA 5AW5A 2NNWB 5AVOA 4XAQA 3OOSA 2ZJ7A 4C21A 5IJ9A 4GLJA 4OHXA 1JIXA 3KPWA 3GNSA 3QXCA 3QELB 2ZS9A 3LBHA 2CLKB 5K0EA 1WF3A 3H1TA 1I3MA 4G8DA 5JMTA 5JG7A 3ISJA 2PD6A 1V6SA 3QF4A 4S12A 3L7YA 2VQSA 2X5XA 2A5LA 1MBZA 1T5IA 3TOSA 1TLTA 1YJ5A 3RRXA 1PKEA 3AY0A 3DHEA 4U3JA 3GLHA 3ZD8A 4F56A 2VF8A 1EU1A 2IY9A 3NVDA 4P84A 3CXRA 3EGXA 4ZJPA 1E61A 3X2EA 3TIXB 4DJJA 1T36A 1IXKA 1CZUA 4XVRA 5K3CA 1L5SA 5JAMA 4X7MA 2X3FA 3CX7A 3O75A 4YI3A 2FA9A 2EF1A 2Q21A 2RGUA 2ZPTX 4TV8B 3SIPA 3D6VA 2ZU0C 1ZOSA 3L7LA 1TFUA 1WQ4A 3MPUA 1LRJA 2AFIA 1YZKA 4K1XA 2JLXA 4WHMA 1K0FA 1U0FA 1PNQA 3JYOA 4KXNA 3VKVA 4BASA 4I8XA 5CGQB 3O2JA 1ZH2A 3QTBA 3T5PA 6ABPA 4RJKA 2H7VA 3NDRA 1QFXA 2ZI5A 1FX0B 5FPKA 3KQOA 3ZHZA 1TRKA 3HFRA 4D4KA 5ALOA 3BILA 3M6IA 3IT3A 3PF9A 3CVJA 2JFQA 2AUNA 2R1ZA 3BE6A 3HL4A 3LT5A 3IHLA 1DTWB 3LVBA 2CB9A 3NFYA 4Q4JA 5BP7A 1QU2A 5CGZA 3F90A 4E15A 1OH8A 1B8NA 1HTWA 2O1SA 3FZEA 3OQVA 1GKYA 5FOUA 3TX6A 4G0MA 3LTNC 2IH5A 2BTQB 4KRYA 2DQZA 4IPTA 2AOUB 6Q21A 1PDOA 1CULC 4N3BA 1W88B 2R8XA 4FYPA 4HNRA 1H6CA 2FAXA 1JXAA 4B74A 1YDEA 3HDTA 1D1PA 1EPUA 2W8BB 4BLTA 5KSYA 2HY7A 4YRSA 1FSGA 1XD9A 2Q49A 4IJ6A 3U37A 2G0TA 1Z47A 2B83A 3IVGA 3MS4A 2VSYA 3TMAA 3LXMA 1BU5A 4IMRA 1YIAA 3PK0A 5EE3A 3GCGA 5EHGA 1YJAA 4XWKA 4K2AA 4JYCA 1ZI9A 2ACEA 1AY0A 2F8TA 1QBKC 3CX4A 1UJCA 4DZRA 2OAQ1 2X7XA 3J81A 3I12A 2W58A 3MT8A 2XHZA 4D46A 5TQ2B 5K6AA 2ACVA 4X65B 3LCCA 4UTRA 2AQKA 2XTNA 1LTHR 3BF8A 3K71B 2GWRA 3CRZA 4GG1A 1Q20A 2AHOA 1EUCB 4PGHA 3L84A 1DRVA 2MT9A 3QMVA 4KI0A 5DN6A 5REQB 4IKPA 4F2HA 1NRJB 2BKVA 2PVCA 4D26A 2AYYA 2HLPA 2WSSA 3IIEA 3QNUA 4TLBA 2G9NA 4KGXA 1V95A 1G0OA 1LPMA 3UB3A 3WIOA 4X3CA 1QQ7A 4M1MA 3GVPA 5C46F 3H6GA 2C0PA 2ZM5A 4RKRA 1CR2A 4KJXA 4GYKA 1N7JA 1RM0A 4KSBA 4QOIA 3CU5A 1A2BA 4BO1A 4F4UA 1WB6A 1GPLA 2EP8A 4NEGA 3CNQS 3WGZA 5IBCA 3ZK7A 1Z3CA 5JSHA 1VSBA 4XPIB 3W1WA 2J9GA 2V5AA 2ZBVA 2FMFA 3KTDA 3OMWA 2YBEA 4GKJB 3ZLJA 1HUQA 3VUEA 2Z04A 4FEAA 1OZFA 3OIDA 4BP9A 1D2NA 2O2XA 2ATXA 3JYPA 1Y5RA 5LR6A 1W49A 3KC2A 3RRJA 2NZJA 1KYQA 2P8SA 3HRKA 5LZ7A 2EX4A 4MJ7A 4MUEA 1JDBC 1UP4A 3DO6A 1Q16A 5C1IA 5IKPA 1M1YA 3AKYA 4NV0A 2ECFA 1KXJA 1WULS 3BXPA 4A4DA 1N0IA 2XCUA 3C6QA 2YJTD 2G07A 3RIMA 2YZ2A 2EHJA 2JCVA 3K05A 1GUZA 3L4BA 5FBLB 4FZRA 4F92B 5CFLA 1NFFA 1Z06A 1R5JA 3SLKA 4S1WA 1IZZA 1HDOA 5BXQC 3FCAA 1IEVA 4RD1A 5KYNA 4P58A 3QEBZ 2LKDA 5AD1A 1XMJA 5A4IS 1QO0A 5K3DA 4CDNA 2IBTA 2JIPA 5J2TF 1QHHA 2FKNA 2QD3A 3W8DA 3MMXA 3ZZNA 5HKOA 5JJ5A 1T5OA 3CXUA 5IJ0A 1Z0KA 1I80A 3F96A 2XA1A 1E64A 3RFFA 4G36A 3HKCB 3ZV4A 1X0XA 5LXTB 4PX5A 2VZEA 3MTJA 3ZQJA 3H5LA 2YN0A 4XM1A 1CBUA 4COKA 5PNTA 3TB6A 3ZGVA 1O97D 2CWWA 2QMHA 4AJKA 1DKMA 1N2SA 4BO2A 5J2TA 4RNCA 1MOQA 4YMGA 4E4RA 4BXOB 1XZCA 4LYHA 2ECPA 4MS4B 4Y8VA 3H5OA 2XDYA 3V4RA 2P40A 1QG6A 2HI0A 2JLVA 4I1RA 3EHDA 2ZZNA 2H4FA 1TT7A 1U3FA 2B8TA 1AD2A 2XGMA 3AV3A 4OV6B 3ECSA 1ZHFA 2VBIA 3UK2A 4V39A 1GDHA 2PSEA 4ESHA 4XQ0A 2YHAA 5ALQA 4QHTA 3R7LA 1FFXA 2CXNA 3PC8A 5JAPA 2CCKA 2FQQA 3V34A 4L4SA 4KE9A 4C4PA 1HZJA 3DXZA 2V6MA 2JK1A 4BWFB 3L07A 3PGVA 2RAFA 4QYIA 1PWYE 4OI4A 3CE9A 3E9CA 3NNSA 5AW8A 4LRWA 3ZWNA 1W46A 1U8UA 3W2GA 4A10A 1KIFA 3EWSA 2NAPA 2LZ0A 2VP6A 4YYEA 1SG0A 5DCWA 2QX6A 2Y2UA 1F9AA 3K5IA 3RVPA 4BRSA 5BW5A 1NXPA 5LBTA 1POXA 1SKYE 2NSHA 4IY1A 2B61A 4D2IA 3CH5A 5C8YF 5CDGA 1TM4E 4LEIA 3TTSA 4DG8A 1E7RA 3RUIA 2JI6A 3P52A 2AKYA 4LG1A 4LXUA 4HRXA 3EWIA 2XQKA 3AXTA 3E9MA 3EBLA 4LE2A 4CL2A 2E48A 2PGLA 1G2IA 2Z4TA 1FK8A 2A1UA 3NCTA 4DAOA 3PLAE 1EUDA 3EUEA 2IOHA 3LKVA 1QYDA 3I6IA 4RQBA 3RHZA 3A6JA 1A8HA 2UZAA 2MYNA 1JMKC 3KAJA 5K8IA 3TRDA 3ZVNA 5C8YA 4OKNA 4R7TA 4DLAA 1TJNA 1BW9A 3ZTTA 3V7FA 3TVDA 5JW6A 5AESA 3PEVA 3LF1A 1U8ZA 3KJNA 4MLPA 1T9ZA 1J33A 3HJNA 1ORRA 4AUMA 1FDSA 1USKA 2AF3C 2QNRA 3AEKB 3HYNA 3IBGA 4BNKA 3SC3A 4RK7A 4QJ5A 4X1IB 3AR7A 2XMBA 3K70B 3LUAA 3OTHA 3DPUA 3EEQA 3OSUA 5IUKC 2D8AA 4NF2A 4KR3A 3B1JA 3O8NA 3EXHA 4WERA 1ZJYA 5FNZA 3DBVO 3K09A 2GT1A 3O3OB 2Q3CA 3LW8A 4BY9E 1U3CA 3IQXA 3R3WA 3AO0B 3JD0A 5BWNA 1P9OA 3OZBA 4JBWA 4M6WB 3FRJA 4QOSA 2L82A 2VJAA 2GYWA 3T7EA 2REQA 4TGLA 1WXEA 3SZRA 3CZ4A 3H0CA 2EJWA 3RK4A 1MOPA 5JCOA 3LT2A 5T4EA 4LX0A 4UVHA 1I7DA 1N5KA 4MAMA 4EUSA 3CLTD 5DCYA 2WIDA 3H5NA 1YA6A 1QHXA 2PLRA 5TE9A 5EMLA 2IEIA 1V11B 5GZ6A 1M2WA 1L5KA 4S1NA 4U7WA 4R1NA 5AVVA 1UEJA 5EHNA 1SUSA 2FWPA 1Z4KA 2HC9A 5AOCA 1KR5A 1X7GA 2HEGA 2A92A 1BH2A 2QTMA 2VRWA 3R3YA 4MVWA 1TRHA 2Q1XA 3IDQA 1MJ5A 3NASA 2G82A 3KLOA 3T06B 2G72A 3TCNA 3RLIA 1R0SA 4WFIA 1LVGA 1SVIA 4WV3A 4QIHA 2EX0A 2OP1A 4EP1A 2WJHA 2C2ZA 5EFZA 3CCCA 2P0YA 3OETA 2QBYB 4MO2A 2N46A 1CHNA 3NT5A 4IDQA 2ZIEA 1J1IA 1D2MA 3HN7A 5I9BA 1GA6A 3UWMA 4ESOA 1YZNA 4JODA 3DOCA 2BGTA 4AO7A 2QLLA 4OK6A 3HO1A 1FW6A 4BQPA 2I9PA 1NATA 5C1OA 3KV1A 3HVUA 2QM7A 3DBHA 4N4AA 4Q03A 5F76A 1AH2A 3WA7A 5CCXA 3F97A 1S9DA 4R5HA 3ZY5A 4ERNA 2XDQA 3S55A 3W9UA 2XZLA 4WI1A 2XMRA 4GZLA 3RS7A 5I4KA 4QRHA 2E4VA 2BGUA 4I50F 3F47A 1KFKB 1DAFA 2OXEA 3FPGA 1HNZB 1VBMA 1GP2A 3RSQA 3ZJUA 2VQDA 4PYLA 1Q95A 3JPWA 4NK5A 4FHFA 1T9AA 1BEEA 1KQ3A 2B6HA 2WK1A 2X8JA 3CN7A 1X94A 2UUOA 4RE5A 3SQLA 2DUMA 3M3HA 2IDMA 4DAEA 3BA1A 4X6YA 2XMSA 1JG6A 3EGWA 1E9FA 4UUOA 1T2DA 1KPIA 1HF3A 5KWEA 3ZDAA 2H31A 4M3NA 1QRSA 2PSJA 1O9GA 3C48A 5JNWA 4BB5A 3BORA 821PA 1APBA 1ORTA 2PGXA 4L76A 1J23A 4AW9A 1N2IA 1H4VB 4IEFB 4G23A 2EF0A 3LOQA 1E1YA 4MR8B 3HI6A 2H1OA 5I7HA 1YRLA 5ESRA 4RMGA 3ZIUA 2F43A 3HSYA 4OD0A 2P9JA 1QKKA 5A2GA 1PGQA 3RAEC 1QO7A 4NXNB 3IMEA 5L40A 1OD6A 1OLXA 2WHXA 4FE4A 3AVQA 1ZMXA 5EXTA 1RJFA 1RXYA 3LYUA 4H1TA 2C4MA 4DG5A 4KOAA 3JXEA 3K4QA 4CZ2A 2ZSFA 4E5KA 3IQFA 4EGJA 4EQZA 4D74A 1N32B 1T8RA 4NCXA 2MIIA 1OFUX 5EQJB 1WL8A 4DGQA 4TVKA 4C04A 2JLAA 3X1DA 4YJGB 1N3YA 3R77A 1ZKDA 2JDIA 3D4OA 4YRDA 3QH4A 1DZ3A 1EK2A 4HAUA 4MQ5A 3L9WA 1VPLA 1ZUD1 3DXXA 1R64A 3GEPA 3O3NB 1XZAA 1DMSA 1H0KA 1I4TD 5IM4F 1PNRA 1L7RA 1WZNA 2VHZA 3QUQA 4QJBA 2QAGA 2I76A 5AHWA 4MW9A 2IZ0A 1E99A 4OI1A 3ZVKA 1XHFA 1C81A 3ETNA 4NR0A 4GWKA 5A0TA 1IJEA 4HQOA 4BWGA 1EFPB 4ZN6A 2VTDA 1XFAA 5FNVB 1E94E 3N74A 5ALWA 4CTJA 5LBIA 5TMDA 2XCOA 2VP0A 1Q5PA 5KYXB 2EAUA 5IM4A 4EYOA 3STXA 1T3HA 2JIZD 3LUGA 1EG7A 5KC9A 1WKBA 3WB0A 5BV7A 3HBLA 4WXHA 2YW9A 4QXOA 1KDVA 4Y6QA 4FNGA 3VYRB 1RADA 4F6RA 2QUAA 3D3WB 4G3XA 5IJ9B 1B0UA 4P32A 3CRW1 1GWNA 2GFQA 4ND2A 4PPQA 4E1AA 3GEDA 3UXEA 3T3GA 2AJCA 2QXUA 2ARKA 2ZIXA 5UKDA 3KTAA 1XTZA 5FV4A 1UOEA 2WYIA 1HG1A 2ZI3A 1F8YA 2VEDA 2XBUA 2ZTLA 3B1VA 3NXKA 4IIDA 3LWBA 3ZWWA 4EFDA 1KJZA 3G9QA 2D4HA 3ELDA 1SUFA 3D0OA 4J7XA 1ZGAA 1O4WA 1TVKA 2D1QA 4TWIA 3VNSA 3U80A 4FPXA 2P2CA 1JXQA 4KE7A 2XNJA 3IBSA 4YA6A 3TQSA 3ZDEA 2XUZA 1S9HA 3T6KA 3EGXB 4JDPA 4Q3AA 721PA 1TM1E 2VJBA 2GZMA 5EPEA 1A96A 1NM5A 3TNDA 4GM1A 2HK8A 1DC7A 1M6EX 1QIMA 1Y9DA 2OD2A 3EW9A 2FWJA 3EXIA 3KLMX 1XDDA 3F6BX 4PO3X 3M49A 2CZQA 1BXZA 3OCUA 1M3SA 4LECA 4B3IA 5WRFA 5AIAA 2ZYUX 3VR6H 4R1PA 2C5FA 3RTCA 4DCMA 3BB4A 4D3YA 1PS9A 3M6LA 4EJSC 3SHTA 2ZETA 3LQRA 2VYQA 5EJ6A 2G3YA 3LFUA 4PRKA 3MUOA 4F0JA 3OE4A 2WAOA 2JK0A 3WZ2A 1XCPA 3L7IA 3L7CA 3K0KA 2JEYA 2RBKA 3T7TA 4BU0A 3INTA 4HG2A 5HIMA 4F7WA 2DLCX 4FCWA 2R4TA 3ABZA 3OFND 4GBJA 4B71A 5L7TA 1Y8ZA 1FXWA 3UT5A 1L5RA 4BKQA 3QVJA 3MMZA 4N82A 3THXA 3ZOZA 1DKPA 1CE8B 4TSRA 3UJCA 2REXB 1BX3A 1FUUA 2NZXA 3OZEA 4PWZA 2EFJA 2YOFA 3M5PA 1V8FA 2EWVA 3K94A 3WZLA 3C4JA 4QGHA 1ECGA 3A1CA 3EGDB 4GBMA 2W6JA 4IDDA 1EXDA 2GSWA 1PJZA 3K9GA 1FFSA 1VP3A 4X8MA 5ES4B 5CFNA 4C2UA 4A36A 1V5FA 3HCRA 2QZPA 5EUMA 4E5NA 2JI4A 4PHTA 4A8JC 1QGUB 1W5SA 1OZAA 1T91A 1TECE 4DPLA 5KC8A 1RE0A 3DO5A 5IMSA 1B6TA 1P17A 1G59A 1C3XA 1XXHB 3MN1A 4GU5A 1TAUA 4NPCA 2X5KO 1L7VC 3ZEAA 4DF3A 1UEIA 2ACWA 2QRGA 3WLFA 1RQRA 4B8ZA 2GD1O 3DVAA 2HSGA 1FSSA 2JKYA 4I5IA 4RMJA 2QA5A 2ZROA 4R3NA 2NUBA 4HNAA 4BGUA 1CB7A 1J42A 4XVUA 4D6YA 3GYGA 4RIFA 1NP6A 2D2FA 2NMVA 1ZFNA 5CLIA 3TK1A 4F6CA 4NI5A 3KOXA 1QHSA 4MO9A 4NENB 1E9SA 3C6BA 3RFCA 1C0IA 2G04A 2HJ9A 1Q1EA 1SO8A 2W4MA 4UEOA 4CF3A 3FCYA 2WNHA 1O77A 1CDDA 1RYEA 3P4YA 1KH3A 4MIKA 4RAOA 2CK3A 4BKOA 1PLKA 1G21E 3CF0A 3CS3A 3KT6A 4W9MC 1ZW1A 4I55F 5I5GA 1LLUA 5KX5F 2PL3A 4B73A 5KB3A 1U7WA 1DEAA 2WJYA 3FYSA 1XAIA 4P7GA 3CFYA 1UDAA 3E22A 1RQNA 5CA1F 3ADCA 3HR7A 2I7CA 2OV1A 1E89A 1W96A 1Z9BA 4FX2A 4N03A 4R8MA 4CKBA 4S24A 1LJ8A 5BMVA 5F23A 1QV9A 3KQTA 4L3VA 5LJIA 4PFQA 1IWPB 3FUVA 5E3HA 3AINA 4V0MA 2A78A 2VRCA 3K1YA 3K2IA 2WWXA 3PPIA 5ALDA 3GP8A 1DELA 1YL5A 4POAA 4N1AA 2FN3A 3H86A 3DZBA 1TEVA 4KK4A 4CDMA 2ALJA 4JASB 5HF6A 4DDUA 3C8MA 2AG1A 2ODEA 4K88A 4EX7A 3EPKA 3JVIA 2I7XA 4BX8A 3RSGA 3GT0A 5E7MA 1KH2A 2E37A 5TT1A 2NU8A 5A1JA 3UWOA 3D43A 1QH1B 1TGYA 3DZIA 4Z54A 5HQJA 1DFHA 1AB5A 3FOBA 2B8WA 3NALA 2OGTA 3V9PA 1WBJB 3OEED 2IU0A 2VQ6A 5IXYA 3U61B 4NEQA 2PZGA 2P2ZA 4CL8A 2QV0A 1DWUA 4YLEA 3BCSA 4IO1A 1Z17A 3L7JA 4R68A 2J0EA 4IVPA 1KRHA 2FRDA 3GMDA 4BL5A 5C5IA 2J1LA 2UUCB 3VMFA 1RDFA 3LO5A 1R4MA 3K8OE 1TUEA 2AE1A 4KGVA 5CYGA 4QGGA 5DRTA 4Y6OA 2V6FA 4DBVO 3WGJA 2Y9MB 5KOJB 4GQBA 5K3AA 3IB6A 1RRGA 3CRMA 4Y2SA 5SV2A 4AIIA 4E5SA 1OJ7A 1XD8A 3HDHA 3MINB 4G41A 2FXIA 2Q6IA 1BS1A 5F5XA 5J2TB 1JHVA 5LD2B 1T0JB 3ZHCA 3I5UA 1U3GA 2CMGA 2REOA 3OQPA 1TQ4A 5I7AA 1ZC3A 4HL6A 2AJDA 1W36D 4E5VA 4TLAA 2D1FA 4M87A 1RE1A 3HXKA 4QREA 1BNCA 3JD2A 3RJZA 2ZPUA 1IHPA 5K0GA 4Q9JA 1PLJA 3GRCA 4N54A 5FPSA 4PIMA 3WIEA 4G1MB 3Q85A 4QT0A 1XXHE 1V1JA 3KWFA 1P5JA 1Y7HA 2JASA 3CCBA 1SVWA 1DG9A 4DUZB 3LWDA 4UASA 4YRCA 1JIQA 3HJTA 1NQUA 3CG0A 3RKUA 2PAAA 4MWCA 4DHEA 5FOWA 3RADC 3ESZA 4ZQHA 4QOEA 4AY6A 2ZWAA 1RXCA 3O8QB 1LF5A 1PZMA 1XVVA 5IUJC 2YC2C 3E35A 4G0NA 2GR9A 1G8YA 4R40A 2J3HA 3T7SA 3H99A 3NM4A 1Z18A 4LKOA 4CI9A 3AR5A 1GGJA 4GPBA 1O6ZA 5DTIA 2JLZA 1RI2A 1E79A 4V2UA 1AO3A 3GVHA 1VG1A 3RF6A 5ADVA 2JPDA 3PP8A 5BOSA 2G09A 3GLUA 1EUDB 4S0XA 4OJKA 1IAVA 3WHPA 4G0VA 5KO2A 2OXRA 1UC9A 5DPMA 1PW7A 2JBAB 2PZAA 1XEFA 4JNCA 1NJ8A 4MW2A 1ZZGA 4R3WA 1M1UA 4JL5A 4CMIA 4YV2A 5C8YB 2GYUA 1OA0A 3N9IA 1FZTA 1FDRA 2VNHA 1BW9B 3M1LA 3IR6A 1BOFA 1M5RA 2O4CA 3KALA 1EKXA 2PH5A 1J90A 5DF1A 1CRWG 1RAAA 2DUJA 4M53A 2RC6A 4TUYA 3UMMA 5CIWA 5DLYA 1V7PC 3G8CA 5GOTA 2AOXA 3KLPX 5IAAA 2O8BA 2EQ5A 2O3QA 4R71A 4B0PA 1Y3BE 3NLLA 1HDEA 1R8QA 1LU9A 1KSGA 1PWEA 4I8IA 3IUYA 4LMPA 1QZUA 3VC3A 1A1SA 3IHKA 1QWOA 1RZRA 2IHYA 4JQZA 3CX6A 3U7QA 2HCTA 1RYYA 3WDKA 2R7NA 4Q48A 1ODSA 1KI9A 3OO0A 4QVGA 2IDKA 2QSJA 2ZYRA 5AJVB 1UKVY 3PT5A 3MQ2A 4RFSA 5DHFA 3SX2A 1RLOA 4NESA 3O8RA 2BUBA 2G6BA 3GJ7A 4UTOA 2OQIA 1JLLA 4QICA 2B5OA 2PH1A 4OATA 1Z62A 5DLDA 1T3ZA 5KVQA 5CYPA 4E2YA 3LFTA 3N2GA 1EEHA 3DEIA 5ARBA 2D6FA 4HLQB 3SC2A 1ABFA 5DGXA 1IVNA 1DP4A 2Y0PA 3M5CA 4HXEB 4YFVA 5H4HA 5E4FA 5IW8A 1X15A 3LX8A 4EW1A 4UMEA 3QYPA 2A8YA 3ND8A 1M2GA 4MKHA 4RZ2A 521PA 3UB2A 1CNFA 5IEJA 1D5WA 5KVVA 5DXJA 1VTKA 1I7NA 3D2CA 2ZIWB 3BK2A 4RADA 4CF7A 3OZAA 1YVPA 4KW7A 4XIJA 5CDSA 3LQ4A 3NDJA 5HBGA 1UMBB 1GTG1 3LP6A 1FP2A 4MPPA 1XWIA 3NP9A 1EBFA 3IOEA 3CUUA 1QCYA 1QFJA 2J0VA 2AR0A 1R0LA 1NNLA 2FLWA 3MSCA 3A05A 5I5EA 4NATA 3EJ6A 4MGKR 1G5FA 4X6LA 2VJQA 4OLHA 1VKOA 1TYAE 2AV6A 1JQLB 4S05A 2LXNA 1R27A 4QAQA 5ALPA 4YPFA 1ULSA 5CVVA 4NQRA 4OREX 3ANXA 1RSZA 3BHNA 3AUJB 3KHSA 1KAQA 5CDFE 3AVWA 3IE2A 1D4AA 4DIBA 4N41A 3MIZA 3MJSA 3DBHB 1DUVG 2RB4A 3NTOA 3TAHA 3TPZA 5IKMA 3RVNA 3QZUA 3HCAA 4WLUA 2YKGA 4TZKA 3D6UA 3U40A 1E2MA 3D4PA 3H42B 4Z8YA 3S1SA 1QQBA 4LRTB 4Z3KA 3PUJA 2O8DA 1GZUA 1Y7LA 1E3WB 2NYVA 5ICMA 3C7TA 1CUWA 4MIOA 2AMFA 4EWLA 3T3PB 2CYBA 3OM8A 5IG2A 4LX8A 3QJYA 1KC1A 5SY9A 4ZYVA 5H8WA 4IW3B 6CHYA 4L6CA 2FR1A 1BN7A 1B2LA 4IH9A 3D7KA 2R00A 3W5HA 4CM9D 4RCZA 2CL0X 4EAQA 1Z13A 4TXMA 3S70A 3LT1A 2IYFA 4QQ8A 4I50B 5IN4A 2OV3A 1WCXA 3M0EA 2QTHA 1OREA 3Q1LA 5CVTA 1FIUA 4HGOA 3INGA 5CG2A 1SOUA 1RWQA 4TYQA 5EKTA 4ZVTA 5ESXA 1K7YA 1CUBA 2DFPA 2XD4A 4G63A 2XCLA 4RHFA 4ED9A 3RUDA 2Q0QA 3QVWA 2QTZA 3C6ZA 5EIWA 5BW4A 1KTVA 2I6TA 1WCIA 1R15A 2ZI9A 1Z2NX 2H18A 3I5MA 3OKPA 2OV2A 4FUTA 3ZHVA 1O94C 1NHGA 1PFKA 2WE7A 3PHHA 5YASA 3ZI0A 5HJ7A 1B41A 1WUHS 3U4IA 1C50A 1N2OA 3N8HA 4DDHA 3TD9A 2WHPB 3WYFA 3GRKA 5LMUB 2BFCB 3MT7A 1DEOA 3CW8X 4RKYA 5LQKA 1XWFA 2HQSA 4GW3A 4RWEA 1P39A 3HCEA 3OLWA 5ERGB 1W47A 2O8NA 1ONNA 2GF0A 3KVOA 3LAWA 1RLJA 1T3GA 1LBEA 4ZCSA 4ADSG 4W5NA 1G1AA 3H19A 1DNPA 4ZQBA 2WAYA 1XSEA 3FPEA 3JTEA 4O4HF 3RU7A 5A02A 3RU3A 3U2QA 5FOTA 3WWEA 4JQCA 4AT1A 1N2CB 4JHLA 4M1WA 5DULA 4RYLA 1R0CA 2Q5CA 5ALZA 1ILEA 4V0KA 1L5ZA 3EJWA 2ATEA 4JCOA 3O91A 2WV7A 3PNLA 3OQHA 3KWMA 3PYLA 4PBTA 1GZHB 4OHPA 4TT3A 2YWRA 3OI7A 4ZI2A 3COVA 5CR9A 2C2BA 5IXSA 1NVMB 3EGOA 3EMDA 3ZIAD 4O4HA 1DDOA 1N6PA 2VWGA 3AEUB 1EJ6A 1QO9A 3DE7X 4HZUB 3WAKA 4MMYB 2QE7A 4Z4EA 3RM3A 5EE0A 4OHUA 2O0HA 1SPBS 2IPOA 1CJVC 2IBSA 1FS6A 3BAZA 2IHKA 1XZHA 3UGJA 5F1YA 3GG2A 1LSJA 2IPMA 5HRAA 3GROA 4W1RA 3ZGXA 4AQYB 3QBTA 4L8GA 2YYYA 3WG9A 2HDNB 2VDVE 1ST3A 2AOWA 4FEEA 2XCRB 3BRSA 3BB1A 4F6RB 2F1RA 4OUKX 5E2BA 5JS7A 3KEQA 3NDBB 3GJ3A 4JLOA 4Y6LA 4DS3A 4UCQA 3DL0A 2RGRA 2D1SA 3PFKA 4DYVA 2UVDA 2ZIXB 3KTAB 4WKPA 4JXXA 3V8RA 4QLAA 2GZ3A 3SFZA 2VPIA 4BB0A 4GPAA 1K7XB 3ODGA 4QQFA 4DCTA 1DHTA 1V1MA 2Q5FA 2WYHA 3HN6A 3I9MA 3NR2A 4AN1A 5KPJA 4A23A 1J20A 2AGVA 1II8B 2OVFA 3PDJA 3U56A 3F3KA 4TLEA 3TI9A 1JDBB 3ISVA 1UFQA 3QBDA 3LE8A 4IWXA 3WRXC 4AL4A 1XP8A 2OC9A 3F9IA 4RMNA 3QLUC 4K0RA 4PYKA 3WL7A 3CNEA 4G4IA 4HH0A 2DG2A 2YVKA 3H8JA 2QMYA 4RSGA 3QY9A 1TMOA 1V41E 4Z7NB 4CEIB 4BVGA 3LC1O 5HVNA 3C7AA 3F4BA 3FLEA 3VH1A 3R20A 1CUSA 4Q02A 1NVDA 4ND1A 2C0CA 1XEWX 3ZXXA 2PL5A 2XOKA 4C3VA 2C7BA 1U3WA 4YHBA 4Z53A 1N25A 3EXAA 1KO7A 1QANA 1Y8AA 2AG0A 4TKLA 1DJNA 3TQQA 2O0JA 4OFZA 3K1AB 4D3FA 4UNSA 4EHLA 1W4CA 1WDWB 1ZS9A 3ACCA 3FOAA 1BX0A 2YVUA 3RUAA 2VPZA 4YRRA 2DR3A 3SNHA 2ATVA 2H59A 5AO9A 9ATCA 3HBNA 5AVJA 1KPHA 1G5IA 4DJFC 4R2IA 1NW3A 1J2JA 3THXB 1ZJ5A 2O8EA 4EQ6A 1OGYA 2FLVA 3GB9A 5AM5A 1Z0DA 3TXYA 1SXJC 3OO1A 3N7UA 1USUA 4I7EA 3R6GA 5FPQA 4XGQA 4BB9A 3UFBA 1PR5A 1CR1A 1Z38A 2CUZA 2RH5A 3TOCA 4JI5B 3LBAA 4IHQA 3MGKA 2AWNA 2P9EA 2UU9B 1IOLA 1WXHA 2F9MA 3K9BA 3RIGA 8ADHA 3BN3A 3X44A 4S2EA 4KNYA 4HNUA 4ZI7A 3RIXA 3STHA 4JLDA 1E2UA 1COZA 1ZH0A 3ZXYA 1G5QA 4LNUA 2HHCA 1GL3A 3FHTA 1XAJA 1CUYA 2RONA 1V43A 1KFEB 3GFTA 4MVJA 5JAUA 1D4FA 2IQIA 2G8NA 4MDHA 2ZULA 4EEZA 2UUPA 3NWBA 4DV2B 2VF5X 3HJAA 3HB4X 3FM9A 1ZD4A 2VWQA 3DVAB 3KB6A 3L1VA 1F2DA 4HWRA 2IYUA 4NAVA 3IE1A 3PQ7A 1L7EA 4BEVA 4TYWA 2EFGA 1H69A 2BR3A 4AG5A 3GJZA 4I1VA 1YZLA 1ZSYA 2C2HA 4L2IA 3ST7A 2C9CA 3P9ZA 1XRPA 5TS2A 5IC4A 2JGKA 2CHGA 1ONSA 2C8LA 3EULA 4OA8A 5AICA 1ENZA 1QV6A 1XEAA 4DB2A 1PNVA 2SKCA 3WSTA 4ZPJA 4UFNA 1VE3A 2PPVA 2DQKA 4GOLD 3G2HA 3UJ8A 4YAOA 1TUGA 2MINA 1B8PA 2GPNA 4QDKA 1RXIA 2VA8A 2GUWA 2P62A 3ORQA 1HKUA 4RK5A 4PZ0A 1CP2A 3VC1A 2FXVA 4ER7A 1PFVA 4O1HA 5THQA 3UXHA 1K75A 3RTBA 1BD3A 4RKQA 1OU4A 2PBLA 3E22B 1YFKA 2D2VA 3ET4A 1LLQA 3R3SA 2XODA 1DFIA 1WVMA 3SF0A 4ZVSA 4CKBB 1DWPA 2ZQYA 4KSCA 4NDNE 3OZTA 3IL2A 1PTJA 2IYLD 3GUUA 3R4VA 4YR7A 5KVAA 1F2TA 1GFIA 2VJDA 4MYSA 3PL5A 5BUQA 5ADWA 5HM8A 3UN1A 1H8HD 1MF7A 2YW2A 4IF4A 5IZCC 4L3OA 1SCAA 2NVOA 4CIBA 4I55B 5KX5B 3N59A 5F64A 2BHRA 5CA1B 2FUEA 2ASEA 1VHDA 3ZJTA 1VZ3A 4QLOA 4RDCA 1W4LA 3LP8A 2CXRA 5KDLA 2VPWA 2HQOA 2ZXFA 3IAS1 5JC8A 2NU8B 5TPWB 4RA9A 3ZWPA 2PMFA 3ZNNA 3NYIA 1WDTA 5A5FA 3P32A 1INLA 2AF4C 3I6YA 2VJMB 4BOYA 1LI5A 1MAWA 2JFHA 2Y99A 1GPH1 1AV6A 3VU1A 2RK3A 3D2LA 1L5WA 1Q1AA 1CUJA 2IRWA 4Y2JA 2M6SA 1QTIA 1VG9B 5JC1A 2I2AA 3IT1A 2FWAA 3MZ0A 4QFCA 2B2CA 2SNIE 1FNDA 4ISCA 5AI6A 1E1RA 1FTNA 1O8CA 1UC5B 2ID9A 3FWYA 1LWOA 2NSLA 2Y9PB 1L7PA 1UJ2A 2QUKA 4J1TC 1PK7A 4PPFA 4WY8A 4B75A 4BRUA 4DQUA 3RWMB 3HHEA 1YL6A 3FZNA 2QRLA 3L0BA 4NFSA 4KREA 3D6NB 1C1YA 1RPTA 2CXOA 3I9OA 4EO9A 3GA5A 5F3DA 4KFUA 4BLSA 3L5OA 3I58A 1KYTA 3S1AB 4NOKA 4IMJB 1UIRA 4ZYUA 5JAHA 2ZOSA 3L43A 3H05A 3IUSA 4MINA 1CS4C 5IYZF 1SAYA 3TSAA 2LP4Y 4HDMA 3PA6A 4DV3B 1Z6ZA 2C77A 1UBHS 4NFYA 2XR1A 3GLIB 4QYSA 4MH0R 5D2CA 3BC1A 1GCOA 4QTXA 3IKJA 4ASUA 3KETA 4ITUA 2ZYHA 5CLGA 1GADO 1SMKA 1J5PA 1FA9A 5IC5A 1YCDA 2OK8A 1ZAYA 3VPDA 2C78A 3IILA 1I7QB 4GS5A 4MIEA 3FZQA 4BKUA 1XMOB 3RVOA 5FFNA 2ID7A 1O96A 1YE3A 1RQLA 4FFRA 3ZWOA 1M75A 1QLJA 2OECA 3R9IA 1KQGA 3OM1A 1XA0A 2AMVA 1RKXA 4QJ3A 1T6YA 1Y0BA 3ZDYB 4Y18A 2ZM6B 3ZU5A 7AT1A 4U2EA 4AF6A 4TWRA 3SBOA 1GQSA 2ZSUA 4PAOA 5A3QA 3ANTA 1F8UA 1FU7A 2R11A 3QVXA 1NXSA 2XXBA 1YQUA 2EKDA 3K9WA 2DVMA 1S02A 1T34A 2HRZA 1GSIA 3EEBA 2HQRA 3NAGA 4L4UA 2Z6AA 3FNIA 1I5EA 2IVZA 1I4EB 4I5GA 3SKYA 2D74A 5FEMA 4JUFA 4YRGA 3IMCA 1DCTA 3EGCA 2OPHA 3PFIA 1QGAA 1Z4MA 1XROA 3EWNA 4ZOBA 3TJZA 2PGDA 1ANKA 3EIWA 3CZ5A 4BNIA 3I9LA 1NQWA 2F3SA 1L7MA 1CJTC 1Z4NA 3A31A 1T8PA 5LCXA 5CAEB 2JL1A 2XLBA 3DUFA 4ZKEA 2CNOA 2I6GA 4Y1FA 1IOZA 1KP9A 1NW9B 2A2ZA 3ETGA 2YYSA 2ZSJA 4MUNA 5HK8A 4LXXA 3UPDA 3OD1A 3DKKA 1F0NA 1Z3IX 2BKUA 1T1GA 2DF8A 2YIMA 1B93A 5FWYA 4TKUB 1BN6A 2AD1A 4WLFA 2VXBA 2K5UA 3OWXA 3BRWD 1EWRA 4HX5A 1KIAA 1X9HA 5GJWC 5FQNA 1Q12A 2PXCA 4KN6A 3AUXA 5GWXA 3DT8A 3K9FC 4RQAA 2VI5A 3MC1A 4OB7A 5FWDA 1X7XB 5E1BA 2IH2A 4TYYA 1XTRA 1V45E 2J59A 1RCUA 3EDMA 3EVBA 4A0FA 1OHHA 3SX4A 1GCAA 2RI6A 1R3UA 2IWHA 1M5UA 4N7BA 1IHYA 1OXBB 3ZHYA 3OOYA 3Q15C 3P5SA 4YFYA 3K0CC 1TT5B 3N2GB 4TROA 4GICA 4ZAGA 2A57A 1YAHA 3LY5A 4E32A 3M4ZA 4FT2A 3AUAA 3RHFA 5DTJA 1NN5A 3UXMA 4RETA 1KEEA 1E59A 3KXDA 4Z7OB 3TTXA 5C8ZA 3QLVA 4I2NA 2WSMA 3K4HA 1M1XB 4HTFA 2HF7A 1GAQA 1Z34A 1N5OX 4L3WA 5FPTA 4D0NA 1YJBA 2OY0A 1C8BA 3A2LA 2VFAA 2D3WA 2CBGA 5H0IA 1P1IA 1TKAA 2DSNA 3Q88A 2OTCA 5JIBA 4UHKA 3TRIA 1T0IA 4L75A 4EMTA 5ER6A 3B38A 2AZMA 2PRIA 1AGNA 3PPVA 1AXGA 3HP7A 2P90A 1PZHA 2DHCA 3OPYB 2JGNA 1WB9A 4GEKA 5JQWA 3C7KA 4W5QA 5I7OA 1VPTA 1Z29A 2RGCA 4UPDA 3GLIE 4K9NA 3V4OA 4NCHA 2RG1A 3VXKA 1UMCB 1JU3A 5A4FS 2EARA 1H0RA 1CUFA 5F51A 3AUUA 1KDZA 2NQ2C 2RHMA 3PUVA 2R7MA 4ITVA 3W7VA 2O5VA 5JVDF 3CEMA 5IVPA 1TIPA 4Y9SA 2A6PA 1G6KA 1MX1A 1OT5A 2F00A 1RT9A 3USES 4C3UA 4D4IA 4EG3A 1GQYA 2XA9A 4QUJA 3K70D 2O8DB 4MQ6A 1DGQA 4BKMA 3OWHA 1E1KA 3A9RA 3VOAA 1GRNA 2Q7DA 1M2HA 2IE0A 3AIMA 5DGIA 3H1PA 4LVUA 4BDTA 4YRKA 2QU8A 2V7XA 1XWWA 2XRYA 3G13A 3H3JA 1EHCA 4K9MA 3BXOA 1Z73A 1QK4A 3OUTA 3PYMA 1SWVA 3VPSA 2BRUA 3WKCA 2ZJZA 1T2VA 2ETVA 2CCJA 3AWIA 3DEJA 1B15A 4IIYA 4LI3X 4QPJC 3ULKA 2CLMB 3O7WA 4X1KA 2POQX 4W6QA 1G55A 2FWRA 4EJSB 2EJUA 2PSFA 3NRCA 2QWXA 2E5FA 4NS1A 4S3MA 3PSAA 3NUGA 3NETA 2HO5A 3HDJA 1CG6A 3L0DA 2OB1A 3D3EA 2L19A 4RF3A 2WQ7A 4KZKA 2XYRA 1JVNA 3HJCA 4M0EA 3F5QA 5FFMA 3GH3A 4MRVA 1WMDA 4JKIA 1QK5A 2H00A 1EGHA 3SOPA 3KWLA 2VJPA 2P3QA 3C15C 3FPCA 3WTCA 3A1DA 3WLRA 3ABIA 3WYGA 4PHGA 1SXJA 2BONA 4Q4HA 5MN6A 1UBKS 4JLNA 5FR1A 4XWGA 1X8JA 2HKIA 4IOKA 2HHAA 1TD9A 4P0QB 3HV2A 4ZFNA 3ZVMA 4UULA 3TLXA 3HHPA 2MOKA 5ALSA 5F4BA 3WGIA 5DHTA 4Y2XA 4BC1A 1CYDA 1UBGA 4IH1A 3IVCA 4UUBA 1C7IA 3HP1A 3OEHA 2CMFA 2HRQA 2LIPA 5E6SB 2OILA 3N0XA 4A8JB 1O08A 5J59A 5CBPA 5KPDA 2HXYA 2C0QA 2W2KA 3K16A 3O6VA 2GCIA 2OHVA 1D7AA 1NA5A 1ULHA 2WKPA 4D4MA 2AJTA 1L8QA 2DUNA 4PLVA 1SUDA 1SGWA 1VDZA 3ANSA 1AQUA 3R5HA 3ZK8A 1QF6A 1WM1A 2C4HA 3FMVA 3SEQA 4OGWA 3NBKA 2HWXA 1UBCA 2LV8A 3DHWC 4JR0A 4LBWA 1NW4A 1IM8A 4MS1B 2FQ1A 1UBJS 1G3IA 4EKIA 4J0CA 2JZCA 1T43A 2O2CA 3J7AC 1K8RA 5F78A 3SP1A 1NOJA 1TPYA 3GCWA 3MTAA 4HBZA 4O4HB 4PS0A 4RPIA 1PDWA 3QKWA 5G3YA 5KNDH 3MCTA 4CM3A 4J0JA 2X22A 2HYIC 3BMNA 3KG2A 2VATA 4NZPA 3QE3A 5G0SA 3HGQA 2Z0MA 3LUPA 5CCEA 1OV4A 1Z15A 2CB0A 2OZKA 5J4VA 3TW8A 2BGWA 3Q7TA 4IXNA 1RWBA 1VCMA 3B51X 3MJFA 4UM5A 2PT5A 2ZAOA 3GEHA 4JP5A 1UPBA 1FTWA 1JX6A 2C97A 1GTMA 3IHTA 5CP8A 5AOBA 2HV9A 2ZQZA 1CUDA 1GA4A 5E7IA 3MXTA 1EFUA 2YY6A 1YB7A 1AK1A 2ZBQA 3QF7A 4LVOA 2BI8A 4JITA 3PFNA 4CV3A 3HBMA 5CH5A 1V7ZA 4DFDA 4MYTA 4B0OA 3ZU3A 1PO7A 3D1JA 3MRXA 3MT9A 1KMHB 1XDBA 3LY8A 2P9ZA 4KR2A 2PLNA 3DZJA 4GC9A 4QSHA 2W0SA 5A9TA 3U17A 1NNUA 4WKNA 1LDYA 2BL4A 4LSZA 4NHEA 1WHSA 2H2FA 1X74A 2Y71A 2ZE5A 3QRWA 3BEOA 3MWEA 2HLDD 2A30A 3T5MA 1RCFA 3X3HA 3FUWA 3ZKAA 4AMUA 4B7XA 1YR7A 3G2IA 1XCLA 1YBVA 4DEYA 1PLLA 2C7PA 3KOZA 3Q2OA 3UQZA 1ADGA 3HJHA 2R8YA 2JGAA 3BIWA 3NOVA 4RVOA 4UEWA 3Q40A 3ECAA 4MVJM 3KOUA 2RIRA 1P1RA 3QU2A 4OXRA 4PYJA 5MN5A 4KQ2A 2CNWA 2Q8NA 1GU1A 2XGGA 3AW9A 3RRYA 1JHOA 2WLTA 1HX7A 4DW8A 1BGXT 4DSZA 1Y6GA 1T26A 2PUVA 1VE9A 4EKDA 1G8HA 1M2KA 2DJ5A 4X6UA 3RUFA 4Q1AA 5JS1A 1CY2A 5HK9A 2GBLA 4KX3A 3F7MA 3ORFA 3H65A 3QVVA 1P5FA 3GQVA 2RGBA 1WMEA 3LU1A 2Y1LA 3SSNA 1CVIA 4ILKA 2CXUA 2ODTX 4J1TA 3R1IA 3TZQA 3M5DA 4OLFA 2DYKA 4GM0A 3V4PB 2IEYA 3DQQA 4HEJA 5J40A 4B6SA 4CF4A 4EQ6B 3E3NA 2C29D 4NCIA 3V8VA 1I3KA 2JGIA 1OASA 2AUTA 2XOEA 3DXFA 4YP5A 1CR0A 2GQ0A 1A9YA 4JP8A 5L53A 2E82A 4B43A 3SF8A 4O4LA 3TN7A 2GBGA 4RJLA 5D7BA 1PSDA 2FP4A 3H8WA 4ZOEA 1JNYA 2P6RA 1TYCA 2C1ZA 3JY6A 1UKEA 1EB9A 2YX1A 2UZ0A 4KLZA 4M9UA 2JFUA 1WMSA 1L7DA 4DQKA 2ZSAA 4OQZA 4XWAA 4M36A 1RC0A 5DLPA 5KQPA 4OVKA 4KK3A 2IOQA 4GSYA 3CZPA 4EG6A 1YHZA 4IDAA 4AKSA 1X92A 3DE3X 2GLUA 3U3XA 1WB5A 5BSTA 3BL6A 2ZYSA 4HAOA 1Z0IA 1J8VA 3EX7C 3AEQA 3K72B 3SS8A 1QOPB 3PLNA 2OYCA 4AULA 1MABA 1U98A 2O20A 1GNRA 1NVVQ 2PY6A 4FYWA 4R2LA 5DTMA 1C4OA 1OWLA 3HBAA 1YQWA 3KQKA 1LLFA 1XK7A 2DBYA 5TT0A 4D0GA 4UU7A 4WH0A 3AUSA 2A9FA 1E2BA 2QTAA 1VMAA 4JP1A 2BEKA 4F71A 2VYVD 3H97A 4ZGWA 1IY8A 5L6LB 1VKHA 2UZ3A 4P7BA 3TXXA 1SU4A 3DC2A 3GLTA 4DV0B 3ZHSA 4KVGA 3ZCVA 2QRNA 2ZW9A 1AUVA 1FDUA 2OCGA 1L1EA 1V1RA 4AJIA 1MJNA 3D5QA 3MCUA 5BQFA 4PZEA 4MP8A 5EPUA 3MA0A 4JJZA 3FOWA 3FBGA 4CQJA 3A04A 2KYRA 3MCVA 3P7MA 4IXDA 3O7MA 2WUGA 1YR8A 5GV8A 4KUHA 1BVUA 2KJQA 4INOA 5KQRA 3V33A 3KSUA 4OPMA 5EJGA 3H2SA 4IUDS 1TA4A 4B2IA 4UM8B 4Z9FA 5F9HA 1EGQA 5A6VA 4GDMA 1QYRA 2J9FA 1N9ZA 4MYUA 4NOMA 2I8CA 2VLIA 4BV8A 1U99A 2AZTA 4ZAXA 4YJ2A 1WEKA 1WUKS 3TPFA 3GRZA 1HDIA 5DHAA 5BQ5A 1A76A 4D7AA 4YHHB 4NE2A 4FW8A 2NYUA 1DRWA 1C1DA 1LPAB 1DZIA 3DPSA 3LVQE 3AI7A 1N92A 3L8CA 1P4HA 2PWZA 3ROTA 1EWKA 3A1NA 4KFCA 4NCBA 3DCYA 2GJ9A 4KN9S 3ZS8A 3WNCA 5A3JA 4LXIA 4RA9B 1WA5A 4EO7A 2A88A 4GOKA 2EIHA 4RY0A 4ARVA 5K5EA 2PWBA 1KMQA 4QUEA 2QI9C 4MI3A 4D57A 3PXAA 4DYDA 4FR5A 4RZQA 2HSJA 4GE0A 1EFVA 2H1SA 3AI1A 3GRYA 3BICA 1N6KA 2DY1A 3HCDA 1HT0A 3KDSE 5EA2A 1BS9A 1WMFA 4DWVA 3K9CA 1N57A 1U4OA 3K0CA 4PO8A 3D0QA 5G3ZA 5IDXA 5DNYB 3FDZB 3RSZA 2AOTB 1XRRA 3EDOA 3A10A 3CR7A 4QU9A 1N3IA 5K6TA 5HG0A 1CRZA 1V9LA 4IL5A 1Q0QA 4JA0A 3RS2A 4AIRA 1Q44A 3EGVA 4UC0A 3W3AH 4I36A 1A82A 4JBHA 3VZDA 2C31A 4TSKA 3OJLA 4I5EA 1IONA 3PF8A 5DN6D 4CCYA 3TFOA 2AG6A 3IPXA 4KTVE 2WSSD 1N4AA 4EHBA 3ONWA 1W8DA 5JPCA 2KI5A 2QPAA 2NVBA 2GCPA 2IDZA 4BYGA 1P0PA 2DHEA 3EG9A 3SU8A 2J8ZA 4E4TA 2XUQA 2IXTA 1WQ1R 3AVPA 1CY7A 1VKNA 3T9FA 1U2GA 3DD5A 2HK9A 4BVLA 1NT2A 2KWIA 4RVCA 2PUDA 3PCRB 2IYAA 2N75A 1T3SA 3MCAA 3OFVA 4HFRA 4LK2A 1DDIA 4M60A 3SYNA 3TH5A 3WV5A 3A7DA 4FDMA 1CCWA 1B00A 2PV7A 2WMYA 4PLGA 4MP3A 2XT6A 4HUQB 4QU5A 1VE1A 1LC3A 1BGWA 3H1FA 3T34A 4BS9A 5B3JC 1ESEA 3EGIA 4M1KA 1E9AA 5IYZB 3A70A 1NRXA 2HNAA 3FHLA 1ML3A 3V2IA 3GPBA 4LW8A 2X4IA 3LH5A 4QUIA 3GRRA 4AJEA 2Y0EA 3BWXA 3SSOA 5GY7A 2FOLA 2CE7A 3QVLA 5D5PA 5SZKB 3DNPA 2H48A 2VT2A 1H2AS 1TEZA 1M0WA 3OQNA 3T3NA 2WBLC 3C6KA 5BPFA 4RVGA 4FEYA 3FETA 2BKAA 5L45A 4DJTA 1E2PA 2ROQA 1SZJG 2ZBRA 3B12A 4M9XA 4UD6A 4TTAA 5TPZA 3W9YA 4AZSA 3DDCA 3BFJA 3I0NA 5DHSA 1ZK4A 2O2GA 3IEUA 3R0XA 1YVUA 1A04A 4TM8A 4TTPA 2J5KA 5ILQA 4HMQA 4JLMA 2JJ2A 3K9NA 4IIJF 3W7AA 2D4AA 1KAHA 1MH9A 1IZ7A 2A5DA 3QU7A 3UAZA 1E9BA 3K6SA 3MPOA 4FUQA 1JQBA 1Q1ZA 4BLRA 3EXEA 1XZFA 4NBKA 5A0FA 4B33A 2HAEA 5CT4A 4C4TA 1KC3A 2SKEA 4JSYA 3O4VA 3EZYA 1DU4A 1CXZA 3ZY4A 4GMHA 3C4QA 4GMGA 5FWYB 4S1OA 2BGKA 3LG2A 3N07A 4IIJA 1H9BA 1UCFA 2OFWA 3CLUC 3DBRA 1GVNB 3IR5A 5AW3A 2V97A 2J3LA 2N0SA 1A9XA 4GDFA 2DT8A 5F7XA 5JO9A 5LA6A 2GN8A 2OM6A 3RV3A 5EJ5A 3MOSA 1I0ZA 3WK7A 1JV2B 4GOXA 3UOAB 1G20E 2ZEJA 1DT3A 2C07A 1JKJB 5EP4A 2QM0A 1ZOIA 2FZ4A 1F14A 421PA 1IM5A 1C9KA 1J0AA 4Z9XA 4DUPA 1PEKE 4BNDB 4EKYA 2VO1A 2IXGA 4WZ6A 1JHZA 1ULZA 3GWZA 3GUVA 3Q11A 1KGDA 3JZAA 3E82A 2RG7A 3N0WA 4FFNA 2YL2A 3IX7A 1A2QA 3N8IA 2N42A 2ERXA 2NXCA 2XKJE 1RFGE 2VJLA 2YR0A 4CCWA 1A9RA 2C98A 3G8AA 3GVIA 3OQIA 1UBNA 3IJRA 4D9MA 1GPNA 3N2EA 4RMIA 2ZRMA 4EVIA 1W52X 3P19A 1LPNA 5H3CA 3IUQA 3GDWA 4M9CA 1WBDA 4DABA 2P1RA 3QWHA 2VA9A 3P20A 5E4JA 2OXTA 3UKDA 1W9HA 1NUUA 1FDTA 1Q7EA 5TMBA 3SGLA 3OX3A 2B92A 1CHDA 3TFWA 4EK9A 5AXDA 5CCDA 5DX0A 3P9YA 1YZFA 5TDHA 4BBAA 4QBFA 1MXFA 1EWQA 4Z49A 3TLEA 1PT6A 2ZG6A 4G81A 4G8JA 3SY8A 4PYQA 5BWCA 1ICIA 2XSZA 4XUEA 2I80A 1XDGA 1FUKA 2TMKA 3EZFA 1XHLA 5DP1A 2I66A 2LDBA 1K5GA 2JGDA 5K7SA 4O02B 3N2YA 4D6PA 2I4NA 4GR9A 4U0KA 3Q9LA 3OTIA 5JZBA 3PPYA 4Y3UA 5ETJA 3UHFA 4KFRA 3OE5A 1XOIA 2QYOA 3L1KA 3T1HB 3LPMA 5JT1A 3HKDB 5DNEA 4REQA 1KOJA 1MHPA 1NU8A 2DGDA 5C8XA 2JVJA 3AR6A 4QBTA 3EPPA 4A8PA 2YRWA 3AFIA 4NVRA 1WY5A 1SG9A 3IALA 5LU8A 1GLNA 2XUHA 4KAJA 5JVDB 4HPJB 4J3NA 3ZW9A 4QWMA 1HT2E 1VHWA 4PLPA 5B5SA 1ID1A 2QVXX 4QHYA 3FFAA 3N7AA 4IJQA 1MTZA 2PGJA 2L42A 2X0FA 3S2EA 1FYVA 3G89A 5JMOA 3DCNA 5IJXA 2PHZA 2JAHA 1TL7C 1H22A 4C01A 5H3HA 5M29A 3MGCA 5ALGA 5B1YA 2GAIA 2IEBA 3SR3A 4DDWA 2RKWA 1O7JA 1XR3A 2CJYA 2QD1A 4CGYA 5ARDA 1XPOA 2UVPB 2AMYA 5C81A 4QYMA 1KJWA 2BEUB 1U7OA 3FUUA 4Q9AA 2R2GA 3U4DA 1SXJB 3N7TA 2O48X 3W90A 4OLAA 4IZHA 4RIIA 2PZFA 3ES9A 4A6EA 2QDXA 1SA0B 5F7ZA 3NT4A 5SZIA 4P3KA 2IEDA 4J07A 2QT1A 4QM6A 4UTZA 1KQOA 5DDIP 4CV1A 1KL7A 3V48A 5JSZB 2VUTA 3DDSA 4MS3B 3TM4A 1WD5A 2Q5LA 3LL7A 3FOFC 4MGZR 4PQFA 4KSYA 1DO8A 1NUQA 2AR9A 3R76A 1SU8A 2W2KB 1Z0SA 2NOAA 4GH5A 3MGBA 4REMA 1GNQA 2C2GA 1VKRA 1P6QA 4F2GA 1ZMTA 1XLWA 5H3LA 1E1LA 1NI4A 4URFA 3GP3A 1VRWA 1GTVA 2TMYA 1J0EA 1QMPA 1TQHA 3GRAA 3GT7A 5AKXA 1POWA 4XVCA 1RRKA 1WMAA 3HDYA 4LQ4A 4YWJA 2YWJA 1LCIA 1M6WA 1RS0A 2YZKA 2BFPA 2NUTA 1T4DA 5JU6A 4KQFA 1BTOA 5JSYA 1SXIA 3WIUA 1I9CA 1ZEMA 2R5NA 3WYBA 5GP1A 3BMNB 3PQ2A 4TSFA 1V37A 3TKLA 2CVPA 5IH7A 2IS6A 1P2DA 3ZLVA 5J4YA 4YDQA 2EQBA 3HVJA 1T4MA 1HR0B 1XPRA 1L9XA 1GIAA 1C0LA 3O3MB 4LI0A 5KVCA 1KZYC 5FT9A 4BEWA 5KWJA 1ULTA 4RSHA 1U3VA 2CNBA 2P0AA 2QN1A 2YJZA 4ZAYA 4DDKA 3QEJA 1ZRSA 1NG1A 1WNFA 2R60A 5AK4A 5JS8A 5K8TA 5KTOA 2D13A 2NACA 3IAAA 2IF0A 3HP4A 1PX0A 3OJEA 4J0EA 3KOWA 5HGJA 2ZBEA 3M3DA 1P7ZA 4YCBA 4BTLA 2QZJA 2XVYA 4PVCA 3IEXA 1SCNE 4GO1A 5BYAA 5MF6A 4XWWA 5I8PA 2XXAA 1X1BA 2C94A 4C78A 4DL9A 3E2IA 1SXQA 1DEKA 4XLLA 4R51A 3V4FA 1ULUA 3WFIA 2QI9F 5B1SA 4DV6B 5TVGA 5C4IA 5F5NA 3E70C 4BQRA 1JSLA 1M8JA 2B1JA 5C7YA 5IC6A 3T1NA 4B79A 5LDDC 1HZZC 4FDLA 3ZVRA 1ZUNB 2COEA 3AUTA 2OE2A 3RROA 1KZ9A 2HRDA 1SXGA 4AYWA 1K7SN 2P7HA 1J5XA 1XNJA 2VHUA 3BE5A 3KV3O 4LHSA 4AJLA 1Z4JA 4FN5A 4ARSA 4CQLA 3HWRA 4EPTA 4Q37A 1F8FA 4GHWA 4MV6A 3TPCA 4O5OA 2QTRA 3X1YA 1HYQA 3ZVLA 4CQMA 4BQFA 3KQUA 1JQJC 4GAEA 2YASA 3TMYA 3OQMA 5HOQA 2R65A 4QUKA 2JDID 2VDJA 3UJ9A 4YT4A 1GOTA 1UMDA 1SNYA 1Z83A 1G7TA 1G9XA 2O2ZA 3F6PA 2I1VB 3GJ8A 2CC2A 3ADDA 4GEGA 4HJXA 4LZNA 1VFNA 3P0FA 4PLTA 3FJOA 3DMGA 1R12A 2B99A 3OD5A 4ER0A 2Z2IA 2WVAA 3K1TA 2PJUA 4L27A 3IV6A 2F17A 4MYHA 4X00A 1DX6A 5E3JA 4OHBA 3GRFA 5IJWA 3EFBA 1H1TA 1PT5A 4TKMA 1N2BA 1E1NA 1KORA 5HMLA 3U0BA 1QH0A 4B3HA 1MJFA 4F2PA 5KWVA 2QYHA 4Q16A 2JCGA 4YMSA 4ZZ3A 3SF8B 1IC6A 2HJWA 4OYHA 2CJWA 2VJCA 3RTAA 121PA 2RJNA 2V8OA 1LZLA 4DCJA 3D8HA 1M2FA 4Z5XA 2O1XA 5EGSA 4FCVA 2C5SA 4Q05A 4D79A 3ZCTA 4MAAA 2HA5A 4RVHA 3R74A 3T5GA 1I4LD 1XIVA 3T41A 5B3JA 3WYNA 3C3CA 2HPAA 2D5CA 4P0PB 1QZZA 4ID9A 3M8KA 5FP0A 3N1UA 3V4ZA 1RJGA 4ND8B 5DYNA 3U4GA 4JQOA 3PHJA 2VYNA 1SZPA 4TN1A 5JLAA 3IXLA 1D9XA 2O2DA 1OFGA 1VA4A 2H7YA 1I9GA 4JB0A 1ZIPA 2BGNA 1IBSA 1BCRA 2FZGA 1LK7A 1KKMA 1YVEI 2BZ0A 2MWMA 2VC2B 2TMDA 3LHIA 3CKKA 4UZEA 4D4GA 4OQMA 5HSGA 3AHEA 1R37A 2JA1A 4WZBB 2CN1A 4DNXA 5B6IA 3K31A 1I33A 5FYDA 2JVIA 3DTTA 3HSKA 2PT6A 1V1RB 3RLFA 3CSSA 3KQHA 4FWTA 1KYVA 3V42A 2CVQA 4RK4A 2P68A 1NXVA 4ZYXA 5CDUA 4FSDA 4EPXA 3BXGA 2M1XA 1XMSA 3LV8A 2QTWB 1ZK3A 2BGLA 4KTTE 5AI9A 2Y0DA 5JJKA 3OVMA 1XJCA 3K1JA 3TEMA 4KQXA 4P31A 1N7HA 3AKCA 5AM2A 2RHJA 5G02A 1GXSA 5FPPA 4ZO9A 3A4MA 4WJLA 4F4CA 3ELUA 1SUIA 2J9FB 3KR9A 5IP5A 4RZXA 1PL0A 1MFZA 3W78A 5HQ3A 5I4CA 1P5HA 5L3RA 4ZRMA 2G36A 5LP1A 1AKUA 1N7GA 3FD8A 4ZXPA 5IH3A 2BDUA 4BNXA 2A86A 1RXVA 2JH8A 3WHKA 4XUGB 3A6GA 1JDSA 5K9ZA 4OGGA 3K0FB 6ADHA 1FYFA 2FPMA 3P2MA 5LFAA 5CCBA 2W6JD 4M9ZA 1M8FA 5A3SA 3I8OA 1L0BA 3BE8A 1V5GA 3KSDO 3O38A 3VI4B 1TB4A 4B47A 2JAQA 4DQVA 1JTVA 3QYAA 3X1XA 4HQ6A 3KHUA 2NZYA 1TO2E 3OIWA 1SZDA 1X1QA 1X87A 2JRCA 2ZR0A 2WFZA 4MVJI 2KLBA 3Q6IA 4N6NA 4PSAA 4GPIB 3ERCA 1EFVB 3TNFA 5A9SA 2FWBA 3AKZA 3F7NA 4KI7A 4ZARA 3D4NA 1QGDA 1KDRA 2I2XB 3DBOB 3FXAA 3VR6A 3SD7A 5IX8A 3LDFA 4P2GA 1LSUA 1OX5A 2MMGA 4KBYA 3ABSB 4RLFA 2BSQA 3JQRA 4LJ4A 1A5ZA 3OEWA 3MGAA 2KLHA 3A8TA 4HWSA 4WXMA 4ZDIA 3N75A 1K3TA 3R0JA 2FCAA 3LKDA 4JGBA 4AZ3B 2OP0A 2LE0A 4KXYA 2ZP1A 4RY2A 2HM7A 4TXHA 2W2NA 1O5IA 2QQEA 3QXSA 4CCYB 4UAGA 1UADA 2CFRA 3M83A 5HILA 5C34B 3QBVA 2CVZA 4FBGA 3VAAA 2DUWA 4KN5A 4F3NA 3GLHE 4U4AA 2O23A 1VKJA 3KCNA 3LCJA 3R3XA 3OZDA 4IIHA 3ONNA 1U0GA 2CK3D 3H9CA 1IN8A 4RHYA 3K8QA 2OCDA 4IVRA 5FUVA 1ABBA 5EEGA 2DFNA 3KXLA 4PYMA 4FB5A 2XE8A 3ILVA 3AVXA 5FTNA 1X7YB 4QQNA 3WXMA 4E5YA 1G0NA 5F1KA 3IKMB 4YB8A 5TQVA 4QGSA 3LNCA 5C32A 2XNDD 3AONB 4MJ3A 1JLKA 4AMGA 1GKIA 3WISA 4OH7A 1HTTA 1GU7A 1HRKA 4N39A 2XBLA 4DRXA 4BPBA 3MBOA 4AUEA 4HHEA 4F5EA 4B83A 3JASA 4A7PA 2DKOA 3IJPA 1FZQA 4Y2RA 4GLFA 5IULC 3PZRA 3RVRA 1QRDA 1XJWA 4X91A 3CC8A 3RGGA 1VCNA 2NNLD 3NGMA 1BRTA 1RHQA 2ZTHA 1OY1A 3QPCA 2CT8A 3UMGA 5CUQA 5DGHA 4KE6A 3RC3A 5JZSA 1MR3F 3AL0C 1B7GO 3FLBA 3HU1A 3L0IB 4UBIA 4XQGA 1A1VA 3T5BA 5E9AA 1KFBB 3MOIA 2DPYA 3OHSX 1E2IA 3CR8A 3V6LA 3WMGA 3OT1A 3KEOA 4GD3Q 1XEXA 5C7LO 2H2WA 5CK4A 3R3ZA 4NBUA 3TNLA 5JISA 1M6VA 2D2EA 1WKVA 2QRJA 3EIFA 5KOHB 1JEYB 3NUQA 2GPYA 3KZOA 1RRVA 3VGJA 4X64B 2FPKA 1YHYA 4P5PA 4TOIA 5K3FB 1RXEA 2H63A 4EH1A 4JLBA 3SZOA 1EFTA 4YALA 3KZVA 3TSYA 4IDOA 5NULA 3UC5A 4DLPA 4ENWA 3K6SB 3E3OA 3DE5X 3I2FA 3CKYA 1I24A 3FMIA 5G0UA 1NHWA 4QT4A 1T15A 3OICA 1X7HA 1ZH8A 4OQLA 2GEFA 3U3OA 4NCAA 2QW1A 1LPOA 4C29A 2Q62A 3K9QO 2IIPA 2BFMA 2B2NA 2Y1OA 3VR5H 3G2PA 4IIJB 2NU9B 2F1IA 4PG6A 4ETIA 1Y1KE 3B6EA 3JVDA 3U9SA 4D99A 1K7FB 1PR3A 3DSRA 4E3ZA 1R8JA 4KPEC 2DULA 2PZJA 3KHKA 2JHAA 3PNSA 2AL7A 3EF3A 1T5SA 4L9SA 5FL7A 3GLGB 2QJOA 3SHVA 2BF4A 1NP3A 2V7VA 4JX8A 1DAHA 1YCGA 1HOTA 4BE9A 4RSMA 3RT1A 1PD0A 2OHXA 3B9PA 3FG9A 4E70A 4I1YA 4NCJA 3C3PA 5KTSA 1EVLA 1P2SA 4DHWA 3PXCX 3I52A 1OJLA 4A8TA 1G6HA 2W6OA 4BNUA 1UK7A 3ILHA 4KWHA 4RD3A 2VNKA 4ABTA 2SKDA 2XB4A 1G5RA 4Q1EA 1KAOA 4O0LA 4NYJQ 2JLQA 1R88A 3P9KA 3SQNA 4CUZA 3DMYA 1P2UA 1U0LA 5J5AA 4ROSA 3VX4A 2CXPA 2FYTA 2G06A 1USGA 1RQ7A 4RULA 4WZAE 1GRRA 1Q77A 4I46A 1U0RA 3KKPA 2ZBGA 2PUTA 2GHRA 3F7TA 5D8DA 2CL6X 4B40A 1ENOA 3L7MA 1N2JA 1TM2A 1JQ5A 2XNCA 1ZGBA 4MQUA 5K0SA 1BFDA 4EM6A 3QMPA 2I3BA 2CHUA 5BN5B 4YJHB 2BM9A 2JGDB 3KWJA 2G6TA 5JTTA 4ETNA 3FUCA 2O8FA 4B4DA 4R8SA 1EHYA 4JB2A 3KZNA 1GU0A 3GD5A 4JL6A 3VR1A 2XVZA 1HGXA 2A67A 3IV9A 4JOQA 1NBHA 3CRNA 1NSFA 1DRUA 4YAWA 2D7DA 3V80A 4O2BA 4REQB 3OOHA 4DIMA 3UYLA 2WJGA 3QFCA 4MUMA 1AF4A 4OK3A 1NW7A 3RD5A 3VVCA 2H16A 3Q7RA 1FUEA 4AAYA 3HCNA 1PZEA