2DPMA

Dpnm dna adenine methyltransferase from streptoccocus pneumoniae complexed with s-adenosylmethionine
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
275
structure length
258
Chain Sequence
TLQPFTKWTGGKRQLLPVIRELIPKTYNRYFEPFVGGGALFFDLAPKDAVINDFNAELINCYQQIKDNPQELIEILKVHQEYNSKEYYLDLRSADRDERIDMMSEVQRAARILYMLRVNFNGLYRVNSKNQFNVPYGRYKNPKIVDEELISAISVYINNNQLEIKVGDFEKAIVDVRTGDFVYFDPPYIPLFTSYTHEGFSFADQVRLRDAFKRLSDTGAYVMLSNSSSALVEELYKDFNIHYVEGKISEIIVTNYEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ADENINE-SPECIFIC METHYLTRANSFERASE DPNII 1)
publication title Crystal structure of the DpnM DNA adenine methyltransferase from the DpnII restriction system of streptococcus pneumoniae bound to S-adenosylmethionine.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 89
structure length 258
sequence length 275
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 1998-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 2dpmA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2dpmA01
10MHA 4MIKA 2BH2A 3DULA 3FPGA 4KDRA 2V74B 1KR5A 1KYWA 5DX8A 2XYQA 1R00A 3LSTA 4C07A 2BR3A 5GWXA 3ORHA 2ZIEA 4YUXA 1M0EA 3HM2A 3LX6A 4V0RA 3KR2A 3CBGA 3V97A 2ONYA 5EMJA 4YV2A 3PLAE 2NP6A 1L9KA 3NJRA 4DQ0A 4FS8A 5EOVA 5EPEA 3BWYA 2CL5A 2EG5A 5E2BA 3E23A 4R6XA 4PYIA 2AOUA 5HFJA 2I6GA 2AOTB 4YUZA 1SUIA 4M7RA 2ESRA 1NV9A 3K6RA 1ZQ9A 1D2CA 4X63A 1JSZA 4RTSA 2GLUA 3P97A 2P1DA 3UJ7A 3UJBA 4GQBA 3LGAA 5K0EA 2LD4A 1NW3A 3NVKI 3QOWA 4R8SA 3OZTA 5CVDA 2NXNA 3E05A 3X0DA 4P7JA 2ZWVA 2HWKA 5KQSA 1WXXA 2ZBRA 3FUWA 2O05A 1SQFA 2ZIGA 5CM2Z 5DWQA 4CTKA 3OZSA 1TPYA 3NVMB 2C7OA 1R8XA 5KVAA 5ERGB 4LWPA 5F2NA 2QYOA 3HNRA 2GAFA 2JH9A 1FP1D 1IM8A 2OZVA 2PGXA 2UYCA 3NTVA 5CVVA 4ER3A 2IH2A 3EEYA 4F84A 1RJDA 3HCAA 4DA4A 2AVDA 1YZ3A 2AN5A 4LG1A 3HA3A 5K0GA 1JTFA 4C06A 4GUAA 5C0OE 1Y8CA 2ZTHA 4H0NA 2GH1A 2ZSUA 3UZUA 3EVGA 2FK7A 5E1MA 3MTEA 1ZHFA 1NW5A 3UJAA 1ORHA 2OPBA 3A4TA 3OU6A 3C6KA 3BWBA 2IH5A 4QTTB 3UBTA 2JHCA 1BHJA 4OBWA 4DF3A 3G7UA 1HNNA 3P9NA 4RTRA 1VP3A 2VDUE 5K05A 1NW7A 4XUEA 3SX0A 2PVCA 1JQDA 2ZBQA 3OE5A 3SSMA 3Q7EA 5E1BA 2OBFA 3I53A 5CD1A 4R05A 5LQJA 4C05A 2YTZA 2IH4A 2O0LA 1RI2A 2P8JA 3QV2A 1EAMA 3KQYA 3TRKA 4DZRA 5DM0A 5EIFA 5KQRA 2PV0A 1WZNA 1EJ6A 2ZULA 5G02A 3UJ8A 4C4AA 3C6MA 3C0KA 2AN3A 3UJ9A 5FADA 4DM3A 3BZBA 3DMGA 3G5LA 3TFWA 1SG9A 5BW4A 3FPHA 1YB2A 2OB2A 2AOXA 3HVHA 4OBXA 2Z6QA 4E2WA 3DR5A 2BM8A 4PIMA 2GS9A 3B89A 3BWMA 5HIKA 1RI4A 3LECA 2O07A 5EQJB 5DM2A 1XCLA 5GIPE 3FUXA 4EK9A 1X19A 2WA1A 4RVHA 4UOEA 1JQEA 2I9KA 3T0IA 3IHTA 2UYHA 5K0CA 4RTNA 3UJ6A 4E70A 2B25A 5FWDA 4QDJA 3EMDA 3PT9A 3EVCA 5CIYA 1KPIA 2PXCA 4YMHA 1RI1A 4IV0A 3BGDA 3SSOA 1DCTA 3GRYA 3FRHA 5DPMA 2CMGA 1XTPA 4RTMA 3L8DA 1FBNA 2PSSA 3HVIA 3LPMA 1BC5A 4OQDA 5FQOA 4EKGA 1EG2A 1R18A 5ICGA 3FTEA 4JXJA 5P8WA 2C7QA 2PX4A 3SXJA 4WXHA 4A6EA 1FPQA 4BP1A 1F38A 1Z3CA 5DRYA 4IWNA 5F2OA 1JQ3A 2QRVA 3EPPA 4HG2A 3Q87B 3FTDA 4XCXA 2QE6A 1JSXA 1NBHA 2NXCA 4M36A 5K0LA 2IFTA 1F3LA 4QQNA 1MHTA 4P7GA 1O9GA 4HSGA 2FCAA 3LCCA 2ZZKA 3GCZA 4DKJA 2R3SA 3ER8A 3LKDA 3IYLW 3OFJA 5CUQA 4YUYA 2JH8A 2PBFA 3TKYA 2NYUA 2Z6UA 1XCJA 3MHTA 9MHTA 5DXJA 4E30A 1X1BA 3VC2A 5BW5A 2XBMA 1N2XA 2B9EA 3OCJA 4GBED 5DTRA 3RODA 4EKIA 4M37A 3ELYA 2VS1A 3GGDA 4PYNA 5GOZA 3HEMA 3CCFA 5HEKA 3SR4A 2C7PA 1QANA 4AX8A 4NECA 4DCGA 3TOSA 5K01A 5EKXA 2GPYA 3E8SA 4KIFA 4DMGA 3EGEA 1NKVA 5K0JA 3P9KA 3P71T 2EX4A 3T7RA 4AZVA 2PKWA 3G8AA 3MCTA 4WVLA 3MGGA 3NWEA 4KRGA 4POOA 2IBTA 1YUBA 4P58A 1G60A 3I9FA 3HP7A 3GRRA 4MHTA 4C08A 2C7RA 5KYGA 5DRTA 1D2HA 1MJFA 1VL5A 2A14A 2AOUB 2G72A 4FP9A 3DMFA 1I1NA 3GNLA 3SVZA 3TM4A 4YV1A 1AQJA 1X1CA 5DLYA 3C3YA 3AJDA 1DUSA 3DUWA 2UYOA 3TLJA 3K0BA 1RI3A 2YXLA 3KQSA 3DLCA 3V8VA 3A26A 5D1HA 5EVJA 4HTFA 1P91A 3OZRA 4GEKA 5K8VA 4RV9A 4XUCA 3VC1A 3SGLA 5EIWA 3G88A 3JWHA 2GA9A 4BLWA 5DTQA 3EVFA 5LSAA 1ORIA 4HC4A 3REOA 2UYQA 3ID6C 5FCDA 4OX9Y 4DCMA 2ZLBA 4X1OA 4HTFB 5K0NA 5LQKA 1EJ0A 3FUVA 1L3BA 3B5IA 3KQMA 1IY9A 4PCAA 2BR5A 3G8BA 3DXXA 5LQCA 3AWIA 4PYLA 3ME5A 5EMLA 3GWZA 1NW8A 4PINA 4E32A 4ATNA 3HVJA 5CVEA 4PGHA 4BY9E 4GC5A 2UZ4A 1AV6A 2XVAA 3HCBA 3JWJA 4FR0A 5C9ZA 2IPXA 4E33A 4F85A 3ELUA 3IEIA 5LQNA 2FRXA 3HCDA 2FPOA 5EKUA 3BT7A 4O29A 5HIIA 4ISCA 5FA8A 3EGIA 3QOXA 2H1RA 2K4MA 4E2ZA 2G70A 1YZHA 3O4FA 1YFLA 5EMKA 4KWCA 1KPGA 1UWVA 2IBSA 3UA3A 5EG5A 3SMQA 2ZVJA 5FWAA 2CMHA 2WK1A 3LCVB 1ZKDA 2G8NA 4E2YA 2I62A 2ZZMA 4ER5A 1NV8A 3CJRA 3O31A 4U7TB 5GIOE 1AQIA 4KIGA 3AXTA 1QAQA 2I7CA 3M6VA 4MQ4A 2HR1A 4GC9A 1G6Q1 2VDWA 4LWOA 3KPYA 2HTEA 2IIPA 3ER9A 3EVEA 3TKAA 1M6YA 3D2LA 3HVKA 2AVNA 3FUUA 3P2KA 5CVUA 3P9CA 4RTJA 4YUVA 5E9WA 5E1DA 5ICEA 1P1CA 4PYMA 1EQAA 1I9GA 2YXEA 1SVUA 3UJDA 3UJCA 1H1DA 3M6WA 3UA4A 1PJZA 3LBFA 1JG1A 1G38A 3PFHA 5EC8A 1HMYA 5E8RA 2IDKA 2B2CA 1WY7A 5H02A 5IKMA 1NE2A 4QVKA 3GRVA 1JTEA 1SUSA 2VZ9A 2DPMA 2P3QA 4FSDA 5DTMA 3KR9A 2G1PA 4ER0A 3LKZA 3MTIA 1IXKA 3G5TA 2P35A 3MERA 4QDKA 2HNKA 3DTNA 4RTQA 3LL7A 5E8JA 5BXYA 3FTFA 1VE3A 4FZVA 5EGSA 2PX5A 2O06A 5ICFA 4CKCA 2DULA 2FYTA 3BGVA 3PTAA 2BM9A 2XYRA 2B78A 4PGGA 1WG8A 3U81A 3I58A 4Y30A 1XVAA 1ZGJA 4G56A 4RTPA 4GOND 4HGYA 3KPJA 1L3CA 3LCUA 3M6UA 1EIZA 3R24A 4C03A 2XYVA 2G71A 1NT2A 2H00A 4AZTA 3KHKA 2JHAA 3FTCA 3EGVA 5LQRA 4PYQA 4PWYA 4CWAA 1KPHA 3A25A 2ZWAA 1VBFA 3KQPA 5T67A 1XDSA 3I5UA 4M38A 3PX2A 4FT2A 3JWIA 3GDHA 5FTWA 2E5WA 2ZZNA 1XXLA 3WSTA 2H11A 3FYDA 4P7FA 5EZQA 3TMAA 3KPVA 3BKWA 2PXXA 2Z6AA 3GXOA 1D2GA 1T43A 2QRVB 1VLMA 3E7PA 1VP9A 2PT9A 3MCZA 1JG3A 1O9HA 3O7WA 3DP7A 5E1OA 5GM1A 1QAMA 2PX2A 2ADMA 3PB3A 1QAOA 2AOVA 3ELDA 4CKEA 5DX0A 2PY6A 5HIJA 4PYKA 4ER6A 3F4KA 4XUDA 5EEGA 4BLVA 5EMMA 4GOLD 4FSXA 2YVLA 4HH4A 1N7JA 4QQKA 5FUBA 4OA8A 4RWZA 2WA2A 5IH3A 1KXZA 1L1EA 5C1IA 2OXTA 3LDFA 2HMYB 1WS6A 4CXMA 2NXJA 3A7EA 5GM2A 2V7EA 3KKZA 1UFKA 4FT4A 1O54A 1B42A 4ER7A 5MHTA 4X61A 3MQ2A 4PONA 4IKPA 3HA5A 2OO3A 1M6EX 3M33A 2PWYA 4PIPA 3UFBA 4EMSA 4EVIA 4QPPA 2OB1A 5FHQA 2ZBPA 2PLWA 3BKXA 4E31A 4KDCA 5K0FA 4AZWA 3MAGA 1L3IA 4GF5A 2O57A 3KQTA 2P3LA 3GU3A 3LBYA 2P40A 2AOTA 3M6XA 5HILA 5T64A 4X60A 1VIDA 4RX1A 3HCFA 2AR0A 2EFJA 2CWWA 3CGGA 2GB4A 3G89A 4R6WA 5DX1A 3FYCA 1KIAA 1RI5A 3OU2A 5DM1A 4Z2YA 5ICCA 5K0BA 3BUSA 5K03A 3GJYA 3TQSA 3TPZA 2F8LA 3GRZA 3THRA 1VPTA 1V39A 2YQZA 5F2KA 5LR6A 2ZCJA 3ERCA 3G2QA 3KQVA 3JWGA 1R74A 3KR1A 3KU1A 3UWPA 3T7TA 3EVZA 1INLA 2JJQA 2P7IA 1AF7A 2Y1XA 5E9QA 2NXEA 3EVDA 4QTUB 3FUTA 5DXAA 3EVBA 4EQZA 1N7IA 1KP9A 4B17A 3P2EA 1BKYA 1KYZA 3H2BA 2OYRA 3A27A 1XDZA 2JHPA 3G2OA 2IP2A 2QM3A 3I64A 5HZMA 3DOUA 2ERCA 3LDGA 3B7PA 2VDVE 1ZG3A 1OR8A 3PS9A 2R6ZA 5D1NA 1R8YA 1X1AA 4GOOD 2YUIA 3OE4A 4CTJA 4RYLA 5CCBA 3RW9A 3CC8A 3DXYA 4RVGA 1P39A 3T7SA 1KHHA 1XJ5A 4HRAA 1Q0SA 4QPNA 3SM3A 1WXWA 3KR0A 3THSA 4CKBA 1SKMA 1ZGAA 3DLIA 1Q0TA 3B3GA 5EHGA 3SSNA 2EJUA 5FULA 1NW6A 3HA7A 2XVMA 3MB5A 2IGTA 3AY0A 5M5BA 5CCXA 3DXZA 3DH0A 4E2XA 2OY0A 3FPJA 2NNWB 3ELWA 4MWZA 5LQAA 2YX1A 2IDJA 2P41A 1UIRA 4X41A 1X1DA 1YFJA 2AOWA 1FP2A 1G8SA 1DL5A 3KQOA 3FZGA 3HCEA 4U7PB 5E9JA 4IV8A 2ZIFA 4MTLA 2ORED 3C3PA 5EEHA 1JG4A 1G8AA 8MHTA 2Q41A 2FK8A 2Y1WA 1I4WA 4L7VA 3B3JA 2NP7A 1BOOA 3M70A 3GO4A 3NWBA 3CVOA 3KPWA 3DMHA 5HIMA 4RTLA 5E2AA 4YV0A 3ANXA 3P9IA 4LECA 3EEOA 3KQWA 3R3HA 5B1SA 3HCCA 2FHPA 3LHDA 3NDIA 3R6TA 4FGZA 5EZSA 1U2ZA 1QYRA 4YMGA 3EMBA 5CVJA 3TM5A 5FHRA 3KQQA 1YF3A 2ZW9A 4PYOA 4QVGA 4AZSA 3NMUF 2CKDA 4A6DA 1TW2A 1QZZA 5BP7A 3AXSA 5DSXA 1FJXA 2HV9A 1JR4A 1PRYA 2EJTA 3NDJA 4RTOA 4K6MA 3PFGA 4Y2HA 5DM4A 5KS2A 3FRIA 3NW9A 3RIEA 4YUWA 4GOMD 2OKCA 2PX8A 3R0QA 3P2IA 4RVDA 4ZTBA 3GRUA 5HOQA 2PT6A 2PXAA 4RSRA 4PYJA 1RJFA 5DSTA 4AUKA 1G55A 2PWPA 3TR6A 5T6BA 4HGZA 2P3OA 5DT2A 2YR0A 2PJDA 5GINE 3B3FA 5EHIA 3FPFA 2ZFUA 4RTKA 3OPNA 3OU7A 3P8ZA 4PCLA 4OQEA 1VQ1A 2B3TA 3FPEA 7MHTA 4BLUA 3R9XB 3EVAA 2AZTA 2KW5A 3PVCA 2VP3A 1P1BA 4OA5A 1R6AA 3BWCA 1RJEA 2YXDA 5FQNA 2AN4A 3VSEA 3VYWA 3CKKA 2QY6A 3LDUA 4P7KA 2AS0A 5JUWA 4F86A 5K09A 5LQUA 1XDUA 3G2PA 3S68A 5U4XA 1TW3A 4KW7A 1JG2A 5FA5A 2P7HA 3CJQA 3OFKA 4R8RA 4V0QA 2BR4A 3GIWA 1SQGA 3A7DA 3KPUA 3G2MA 3CJTA 4C04A 2N47A 4BP3A 4KVZA 4RVFA 3BGIA 3BXOA 2ONZA 5JR3A 3M4XA 1RJGA 3PX3A 4PNEA 2BZGA 3HTXA 5GP1A 2JG3A 3IV6A 1NBIA
chains in the Genus database with same CATH superfamily
2YWCA 10MHA 2CHFA 1FQJA 4FFRA 4LOKA 3AC0A 4C07A 5L45A 1VCOA 1Q5PA 2W2OA 3VU9B 4I1PA 1R0RE 3CNQS 2JFYA 4CI9A 4ZHSA 1HFWA 4M55A 4WK6A 4ESHA 1V3UA 2EKQA 1X9IA 3CX6A 2GOYA 3CLRC 4HEA6 3ZTWA 5L3QB 4CLRB 4NU5A 3I01A 4BNZA 2I4OA 5JZVA 1NZDA 3PEUA 2QX7A 5HFJA 2TRSB 3UPDA 3VI4B 1G2PA 3F4BA 3NYRA 4MPJA 4CM5A 2VK4A 4F3NA 1JSZA 3H13A 4UNSA 1P60A 4KXUA 1LBEA 5HF9A 1TJ4A 1A5BB 2E6KA 2FRDA 2IYOA 4G5SA 1DCKA 2RHMA 4D6PA 3LGAA 3UAGA 3GN1A 4U2BA 1EXNA 3NIGB 3QOWA 3N8KA 3PV0A 3JYHA 3X0DA 1KJ8A 3WC4A 1PFGA 1M1YB 2Z9BA 3OKFA 3MJRA 2OUKA 2R00A 5GY7A 1G98A 2HRDA 2O05A 4RPKA 5DYYA 4C0WA 5JEDA 4Y9UA 1G20E 4LMPA 3E61A 4W7HA 5ERGB 5BV7A 2GAFA 2B21A 1FP1D 2WG1A 5JH7A 1IM8A 3E1KA 1X15A 3NTVA 2YVAA 2AYYA 1I01A 2QT1A 2YJ3A 3I2JA 1XYYA 3TPCA 5AVRA 1QV9A 1XU4A 4U7FA 3MJHA 1XVVA 4PZEA 5TX7A 3SOPA 3HZOA 2HT1A 2FUG1 4GE0A 1QQ6A 1LLFA 1XN1A 1YS9A 1D1PA 2R62A 2VK2A 3NRJA 4IGAA 4II3A 4M8NE 4Y6SA 1VIYA 2BFBB 2BHLA 1OGYA 2BKUA 1DT3A 3RLIA 4AP5A 1S2DA 4J03A 1DMSA 4ITUA 3SWWA 5JC8A 1UAGA 2W6JD 1KZ9A 3DKRA 5KU1A 5DGXA 1ZH8A 3I5AA 4HAWA 5JBNA 2ZUDA 3NBZC 3A6KA 1JFFA 1OROA 3AVQA 4WUTA 1T3SA 1ZI6A 2FN8A 4UVEA 3RWMB 3U7HB 2AMVA 1HNNA 1W8IA 4WGFA 4MEJA 1QCYA 2OXFA 2V7WA 3IJEB 4HXEB 2NTVA 3L43A 1KIMA 4ITVA 1LLCA 2NYVA 4RDHA 2V65A 2CYCA 2OBFA 2PTGA 2C31A 2AB0A 2P6OA 3JD1A 3IPAA 4DQKA 1OBCA 2PO5A 4U3JA 4N9QA 3DTVB 3ADOA 4AW9A 4KNYA 5LP6C 1VYHA 3V8NA 3AI2A 2EKLA 2KLBA 4BHTA 1YK1A 2PV0A 3CUSA 4HDRB 1OVGA 3UJ8A 4HVCA 1EFVB 1M3SA 1Z2NX 2IPOA 4KP7A 2HSWA 2A57A 3U48A 2XB4A 4OLHA 1L5SA 2C2OA 2P6MA 1JEYA 1ISGA 1SCDA 4D8UA 5CFRA 3E9CA 1JPVA 3FPHA 4OQNA 1YB2A 5FBRB 1VJDA 4OXXA 4B6JA 4PFSA 4XPIA 1H2BA 1TK9A 3BMXA 3DR5A 4LHZA 1PLJA 1SZCA 2HK9A 1IL0A 3HACA 4IM7A 1V6AA 2Z6VA 4HGQA 3QE3A 3T5PA 1RM3A 1F12A 3QYJA 3CW8X 4AICA 3ABRB 4O25A 1NMSA 1UPXA 1AV7A 3QYPA 1CUAA 1RQGA 2D8MA 4NKRA 1PR0A 1SHKA 2R11A 2QDKA 3T0IA 3KSRA 4LTNA 5K0CA 1K4YA 3F7OA 1N7HA 2JBWA 3E6AA 3FDIA 1D0VA 2DT5A 4TS1A 4EELA 4P81A 4U2KA 3OCCA 1W47A 1KPIA 2UZ1A 1KAGA 2R84A 3G0DA 5K1ZA 3K1TA 4CIDA 2ROQA 1ZX1A 3NC0C 4DBLE 1FDTA 1H6BA 3KKMA 4GOJA 4A10A 2DF8A 3LWBA 4PQGA 4TXNA 1GTZA 1UM9B 1II0A 2DWOA 2J3LA 3BICA 3L02A 1Z5UA 5HCNA 5AW1A 4ZQIA 1KARA 3A4VA 1JDVA 1D5CA 2EFCB 2F9FA 2VTBA 5FLKA 4U9IS 3O84A 4KLZA 1CHDA 3UNXA 3GQBA 1F6DA 1LRKA 3PFKA 4JN6B 1G66A 3RRFA 4N0MA 1F2TB 2WFMA 5KAMA 3SS9X 2WTUA 3M3PA 4U8GA 1L4FA 4EATA 2R85A 1TLLA 3ZIUA 4N0EA 4ZO7A 2CUNA 2FFJA 1IG3A 2ZRIA 2JFPA 2PBFA 2YMMA 4TRNA 3FCCA 3RK0A 2GRJA 3D6UA 1R0WA 2IYWA 2Z6UA 1JPJA 4MQLA 5TQJA 3RTCA 3VC2A 5BW5A 1JDJA 1NRJB 4Q9JA 5EKTA 1E2GA 1K7YA 3GYBA 3TNYA 2VNHA 4EG6A 3SSAA 3JD3A 1ENPA 1NP6A 2PKRA 4LAFA 4OJTA 4RPHA 3LUKA 3ELYA 3ML1A 5AUPB 1OBHA 1M1XB 1WQ1R 1JZTA 3SR4A 4EW2A 4PRLA 2D5LA 2X15A 3IQIX 4MI9A 3WNBA 1XNQB 4UU0A 1OW3B 3K8QA 1IDOA 1W30A 3GUHA 4LY3A 3ZQ6A 2AC2A 4DMGA 5K01A 3V1KA 1XEFA 4CT4B 5G1PA 1E3LA 5DKFA 5AW6A 5JRZA 4QOEA 3NT5A 2RI6A 1BS9A 1ZL2A 1KK3A 3PQ8A 3I9FA 5BN1A 1JIIA 1L7OA 1RDFA 4DBLC 1OI3A 2QBYB 1XOIA 2XQVA 4QDUA 2VUHB 1R0BA 3C6YA 2QTHA 4MDHA 2Q6TA 2X1LA 2QXTA 1KC1A 1XLUA 3AJDA 4JP5A 2R751 3FFAA 1W46A 4TLBA 4UVGA 1Q12A 5F5XA 3UJPA 3C3AA 3HJBA 1X9GA 5D1HA 3ZGOA 1V1MB 3ZCSA 1HC7A 2R6DA 4XVHA 4EY6A 4RV9A 2RJ3A 3SZGA 2D54A 3G88A 2LDXA 5AKHA 1Z62A 2CFIA 4F3CA 5I7AA 2ZBUA 2DZDA 1EH5A 1ZISA 4UPDA 1CK4A 2II6A 3DHVA 4DABA 3EEQA 1TMKA 4XZ3A 2IODA 1ZM2A 2D3WA 3DXXA 3KDPA 1QUEA 2Z56A 4G3XA 1HO3A 5EMLA 1CKEA 3RVKA 5JHGB 1S4QA 5EYPB 2AQKA 1GA1A 1HYQA 1PS0A 1Y37A 2NSDA 1EMDA 4N8SA 4O2BA 1GRVA 4AURA 4DLUA 1MFZA 4REQB 4YJ2B 4QREA 3IPYA 5ALMA 2IYEA 4P33A 4P8RA 4X3PA 4AWBA 5FAXA 2CVZA 2QN8A 1Z5PA 3G1UA 4FUTA 4JUDX 4PG8A 2GEDA 4Q24A 4E11A 1GUYA 2QM7A 2QTCA 3QHPA 3AOEA 2K4MA 4FKZA 5EFOA 3ZV4A 1VCHA 4DGQA 1FRZA 2AFRA 2QTAA 4BUZA 1V4VA 2G6BA 1ODIA 1XZLA 2ZVJA 1E1MA 3QPUA 4KAFA 5FWAA 3RRJA 4AF6A 5K9ZA 2ZZMA 3CJRA 2R8RA 3VTZA 1ZCZA 4JQYA 3ZI4A 3JQAB 3RUIA 1AXRA 2I7CA 3W77A 2RIPA 4GQAA 3VQTA 4GC9A 4YX9A 2Y92A 2Z95A 1E6EA 3QWBA 1EBBA 1VG0B 2G36A 4JJFA 5TMBA 4P31A 4NYMR 2O8VA 4OB8A 5ALNA 3NCHA 4FINA 4IZHA 4EYEA 1YIAA 3KNZA 3T5DA 4CW7A 5H82A 1QIJA 3D0OA 3GMIA 1AZTA 2BV3A 4Z3OA 1I5OA 1PGNA 3EOAI 1NVGA 1XTJA 3WRXA 4EHFA 3SQWA 2QRQA 2CVPA 4LGMA 3EEBA 4ZMSA 4GYYA 2MYNA 2YJ6A 2V3WA 2FMXA 1QPBA 4E08A 3R4VA 4I5EA 3F4LA 4P4NA 3EG9A 4Q82A 1AVTA 2HWXA 4EI8A 1X3LA 1EIWA 4H08A 3SZMA 4GDFA 3ISJA 4BMOB 1H6AA 3ZZ0A 4F97A 4Q37A 3EXHC 1JJFA 3H99A 2OCPA 5ICFA 4D7AA 4LNHA 3D0RA 3NNDA 1NQTA 2FTKE 4DJFC 2X8AA 1FDRA 3KKNA 2BCGY 3BL8A 4UFPA 4QGGA 2ZIUB 1IXSB 1BDIA 4OQ4A 1N57A 3PE4A 1L3CA 3HGMA 4MKZA 1GXSA 5ALTA 2GHQA 4B40A 1KH1A 5AP9A 4RK5A 2JGRA 4OFWA 3KZMA 1RRPA 5K8JB 1THZA 3CZ5A 3PI7A 2I8LA 2NSHA 3PJDA 4RPCA 1YRAA 3I8OA 4TLCA 4X90A 3E4CA 4AJ1A 3TIFA 3R9XA 1G19A 1FDSA 1UAYA 3OZIA 2P6PA 1V71A 2PXXA 2HMSA 2F90A 3GXOA 1D2GA 3T3MB 3WMEA 1PNVA 2R2AA 3IPLA 2O8DB 2ZTUA 5GJBA 1CUWA 2HRQA 1NSYA 4QWWA 3TJMA 1FZTA 2GETA 5DX0A 1KI1A 2O20A 4TMYA 2DR3A 5FIUA 3ZTTA 3O38A 1K8ZB 2I67A 2WDZA 5EEGA 3ORSA 3E4DA 2XUDA 1Q1AA 2ZEJA 4EP1A 3HHEA 5FOTA 3ZCPA 2VF7A 2Q4DA 3ILXA 1BE6A 3E3MA 2HMYB 4LMRA 1ZH0A 2ZR9A 5AOCA 3SLRA 4OXIA 2AQ8A 4YC7A 4OJMX 5A0TA 5JS2A 1UFKA 5D5HA 3T7CA 2JB9A 2Z2JA 3GJ6A 1K6IA 2PHZA 3ISTA 2ZUSA 3KUDA 2IHJA 4KQ1A 1R6BX 4V0KA 1R3UA 3L7LA 5AI4A 1E4EA 1ONPA 3EA5A 4ENUA 1HNXB 2IIQA 1PL6A 2A59A 1Y3HA 2WUFA 2ZBPA 4YVFA 2ZKIA 4B1FA 3C5CA 4WESB 3K09C 4MQEA 1M8JA 5D7BA 3TUJC 3WLTA 2WJIA 3V5NA 1ZMTA 3OLWA 4C9BA 3CX7A 2W22A 1TF2A 1XZNA 3PGVA 3AR8A 4XM0A 4NBKA 2Q07A 3SFTA 3WK4A 2XZLA 2J7KA 3ITKA 2BFDB 4BLTA 2QLNA 5ALRA 2H1WA 2ZVDA 2FPKA 3C8DA 3UJDA 3ZZTA 4CFSA 4Z2YA 3EY4A 2XWSA 1UQTA 1E1YA 2FLVA 3OX4A 1YL6A 4S1TA 2BP7A 3AYXB 1XDDA 2NUTA 1R9GA 1QLHA 3TPZA 1DRUA 5BPHA 4D41A 3ETCA 3A0UA 3NDPA 2XUFA 3V4OA 3DZFA 4B46A 4LZLA 3OPYI 2O0KA 2PH5A 1M7BA 3HV0A 2ZIAA 4TXHA 2JC3A 1R9NA 2Y1XA 5E9QA 5AW7A 4LY0A 1E2IA 3UYKA 3VNRA 4C5CA 1PZGA 1ABBA 1G8GA 2RI0A 2XITA 1IBCA 4C5AA 5KOIA 1Y1SA 5K3BA 1RPAA 3AR4A 3UKJA 2XVXA 4JBLA 4C21A 1PQYA 3NAGA 4ROSA 1Q22A 1ST2A 3I64A 3PENA 4HWRA 4JBWA 1I33A 4R2JA 4QBGB 1WHSB 3S2GA 3V6MA 4EZIA 5JFTA 1EFRD 1UPTA 3QE0A 1OR8A 5CA1B 3UJNA 1K6EA 1KGSA 5CW2A 1T1RA 2O8CB 3DXYA 2PGDA 2YC4C 4LDPA 2JFVA 2PRZA 4ZP1A 1TAQA 4XLTA 4ENTA 1D6MA 1VMAA 1J9ZA 1IY0A 4IUDS 4YDRA 5EHGA 3SOZA 4A4DA 3E9NA 2JFZA 4RK6A 3RU7A 4C4XA 1UBEA 1KYQA 3T5AA 3KSBC 3PCRB 5KIAA 5I7RA 5EFZA 4KKVA 4N4AA 3OQBA 5M5BA 2H63A 3DH0A 4HQRA 2OY0A 1Z6YA 5GZ3A 1UKVY 3F0TA 2I34A 1MQ8B 3CWQA 5LQAA 3AQ4A 1P5RA 2REBA 3DLBA 1QPGA 2G82A 2X76A 1ZRMA 5DCWA 2I8CA 1BGXT 3TEMA 4TQUS 3ROQA 3WKAA 3RFFA 1NR7A 1QB8A 5FWYB 3VYVA 5A03A 3SXUB 2Q49A 4RQBA 1EVZA 3FSJX 5FYQA 1EGVB 4O4JB 3TG2A 2Q41A 4EPVA 2IYNA 3WL7A 1GPBA 3GW8A 4AZ3A 4QYIB 3KJGA 4JLJA 2VJAA 4KJXA 5IZ4A 4P84A 3ZY2A 1TYZA 5B7NA 2CMFA 3F73A 4ADSG 2IXBA 5E2AA 1NBWB 1KU6A 5TVKA 1VL8A 1PNRA 4Y7CA 5SY9A 3UWKA 1WKCA 1L1RA 1SOMA 3MMXA 4Y1RA 1QYRA 2WJ3A 3AILA 3ZE7A 3S8EA 5DLYA 2FE4A 5FO0A 1J8QA 1GCOA 1QO0D 2WPDD 1FJXA 2QD4A 4HDSB 4IIJB 2VCEA 3PYLA 1G4UR 3MCWA 3VR5D 3WXBA 2WMNB 1VSVA 3GN2A 2A5JA 1C7FA 3PHJA 4PG5A 5DYNA 2BI8A 3ZI0A 1PGJA 2AT1A 4ZTBA 4BFTA 4DJAA 2PXAA 2ERYA 1J42A 4IGIA 5DSTA 2RB4A 3L7NA 4JIGA 2IU0A 1LPMA 4RAOA 1JEEA 3NTUA 3VTFA 3S5JA 4C2AA 1NUTA 4ZEMA 4QU8A 5K7SA 4FMBB 4ZPXA 4KE9A 5G41A 5IZCC 3ADKA 1A5SB 4XJSA 4HOYA 4E6PA 1Q0LA 4I1YA 4OAOA 4XX0B 4EEXA 3U61B 1BU8A 3ZU6A 4OA5A 1IN4A 1CIPA 1G5QA 1GARA 2ZRDA 3AB7A 5JAQA 1H3FA 3U19A 4F2PA 1CUUA 1E32A 3ILYA 4L5BA 1XP5A 1RWMA 2EFHB 4JJGA 1V6CA 4CG3A 5KQGA 1PI3A 2X8JA 4CGYA 5C51B 1SB9A 1GILA 2A1UB 1XDUA 1FLAA 3K72B 4UEQA 5ITZB 1LQTA 1M2OB 1Z5WA 5FA5A 3OFKA 4LOHA 1BHQ1 4NV1A 1ID1A 3OZ7A 1CZHA 2FPMA 3A7DA 4EHIA 3KPUA 3CJTA 3HUUA 1CZOA 4BJHB 3DT9A 4RVFA 3BGIA 1UPBA 4HQNA 4B7AA 4DA7A 1CE8A 5HM8A 1U1IA 4Y6LA 3U0BA 4EJ6A 3PX3A 4IDCA 2YN2A 3IESA 3R1IA 3ZVNA 4HDCA 1Q15A 2CY0A 5P21A 1KR2A 1DEAA 4BZPA 3UGTA 5KYTA 2BJWA 3HM2A 4HBZA 3IUBA 4WZBE 3ZE2B 3TZKA 1NVEA 2YHIB 2R44A 3B85A 3BWVA 4KDRA 4W6QA 3QU7A 4RETA 2XXBA 2BR3A 2HJWA 3OAAD 3X1YA 3QFTA 2XTAA 4TLDA 3B6JA 1YAHA 4TZTA 1Q7GA 4X92A 3GLGB 5GJWC 2H8KA 1KDTA 3FVRA 4TMKA 5EHNA 4ZHQB 4MUNA 1V3QE 3C3EA 3ITDA 2AF3C 2CL5A 2EG5A 5I7FA 2YZ2A 3GRKA 4PX9A 5KYKA 3QKUA 1I8TA 4F3RA 4M7RA 4EGAA 3OQPA 2ACWA 4JJIA 5TQ0B 1B93A 2VYCA 4RTSA 4DUYB 1SBCA 3FXAA 4CL2A 2D62A 3SFZA 3LF1A 3PEEA 3IBSA 4IILA 3SIRA 2ZGVA 3CT4A 1J24A 1G42A 2C1ZA 2FW9A 2QQ5A 2WAMA 2EATA 3HCOA 3I37X 1A9YA 2GXAA 2V9PA 3EDOA 3MCAA 4Z54A 4H4DA 4ROTA 2P9GA 1OFVA 1S2OA 1TFUA 5F9HA 1FDUA 4P6VF 2OOSA 4PX2A 5ALZA 2MSWA 1DAOA 2JCGA 5DTEA 4TKVA 1GNPA 2FPIB 3DUFB 1L4BA 3U4CA 3D4IA 3SY8A 7AT1A 4JDUA 4JI0B 1IJEA 4P3NA 4U6SA 4OI0A 2FZKA 4N3GA 2LR0A 4GGOA 2X22A 1U8YA 3VH1A 5G1NA 4M3NA 4NSNA 3BWEA 1FYXA 1Z36A 4L3OA 2YFYA 4AIRA 3F7TA 4K8RB 2P30A 2P27A 1TJ5A 1TU3A 1W52X 2WILA 1DBIA 4WOJA 6GPBA 5ESXA 1XJCA 4LRWA 2JW5A 4YP5A 3BMQA 3LIPA 4OUDA 1QJ4A 5BWCA 4RPJA 3LUJA 1A76A 3ZD7A 2BHTA 2QP4A 3QJ5A 4LGYA 1JE0A 5HBGA 5TS3A 4BLSA 4ZYTA 4LXQA 1PV4A 1JDNA 4N65A 1QNLA 4M1TA 2FP4B 3AZQA 3RVRA 3WGMA 1UKCA 2DHRA 5KUTA 5COAA 5J2TB 5EXXA 3IKJA 3SSMA 3R9KA 4YALA 2GUWA 4P32A 3RYCB 4KR9A 3NBMA 2YYYA 2KQUA 1NTRA 2C4KA 3GLKA 3GOQA 1XN4A 3QVGA 5FI3A 3WB1A 2EBHX 2P6RA 5A6VA 1L7XA 2ONKA 3HKCA 4LCEA 3M7IA 1TIBA 1JEOA 3EQZA 2J7PA 4FOPA 5C32A 2K7ZA 4YDHB 1AUVA 2FV8A 1GKYA 2CZCA 2XNKA 3H5OA 5HQTA 2I6QA 5L4NA 1CF9A 1NKTA 2DWQA 1T4CA 3WNZA 2VRCD 1OI2A 3N58A 4B6RA 4JC4A 1CBUA 4HUJA 3PHCA 2F1OA 1A7JA 1PLLA 1RTKA 3W78A 4F5EA 1VKJA 2G77B 1JEDA 4BC1A 4XJTA 1DXOA 3HEAA 3PNKA 4US0R 1TF7A 1EM6A 2X1VA 5GONA 3ZBQA 3N2ZB 1XROA 1ZMRA 3M4ZA 9ABPA 4WBNA 1VRWA 4QYTA 3P9QA 5IM5A 3PT9A 5JCJD 1V1RA 1WM1A 2PCJA 2YWJA 3G9ZA 1J5EB 4MZDA 5CB6A 3RVNA 3AP3A 3S1SA 4JI1B 3L93A 1ZK0A 3OQIB 1IEVA 1MXHA 2IYSA 5EJGA 4NH4A 1UFRA 1ZLXA 1G5RA 2Q21A 5ICGA 1TYBE 2BFFA 1EE9A 1G0OA 1J5PA 3KO8A 4NCJA 4MI6A 3GJRA 3QELB 4N5MA 4FS3A 4JXJA 1UMCB 4TLEA 4XR4A 1ML3A 2HDNB 3GH1A 3ZHSA 4BP1A 3V80A 1F38A 1T6NA 3PXXA 3QVMA 1ZBDA 4QOJA 1WHTA 3G0OA 4WTOA 5A4FS 2E5FA 4RCVA 2O8BB 2AR9A 5A0VA 1NF9A 2B2XA 3S1LA 2EEZA 3V8BA 2ZJ5A 3OZVA 1JYEA 4ZYUA 2VLBA 3EXG1 1W0KD 1XRNA 4ZPJA 1DSSG 1ZXLA 3V9AA 4M0FA 4BS9A 4YUYA 3GFVA 2VT3A 3OZEA 1J9EA 1ULHA 2OCBA 4GNKA 2XNCA 2C5AA 4MWBA 2CNKA 1NVBA 4G1BA 3VISA 1C1XB 1AS3A 5L51A 5H9VA 3RODA 2Q5LA 3RKRA 2Q2WA 1QRRA 2JJ1D 3HEMA 3KUKA 2XUAA 1BW9B 4DCGA 2ASEA 1A9OA 3CUEF 2FQWA 2XA2A 3Q12A 1WSBA 4LUCA 5HRCA 3IKMB 5DHSA 1FJHA 1G41A 2VHZA 4KYIB 3G8AA 3R7AA 4UDNA 1B43A 4OK3A 2LXNA 5H70A 5JNLA 5HUQA 5IAKA 1N0UA 2EFYA 3HBNA 2NO5A 3FIUA 3VKUA 4L50A 1VL5A 3SP1A 1KQNA 3OIUA 3RUAA 1AQJA 1SXJA 2HA4A 1EE2A 1ISMA 2CJXA 4R1OA 1J1ZA 4Q3CA 2ZSDA 4KODA 1N2GA 1NVVQ 2EYUA 4WE3A 1HEIA 3BQMB 4MWCA 4FC6A 1A71A 1I0LA 3IHLA 5DTIA 2DOKA 3PQDA 5K6TA 4HTFA 1I13A 2SKEA 2YBEA 3F96A 5FA6A 3TKLA 2H9YA 2XW6A 5AKYA 3SYTA 4D45A 1JB1A 5L6MB 2QV0A 5DTQA 2D8AA 4CLDA 4ZGBA 1MO2A 1NJ6A 2X9GA 1JLMA 3LW7A 5A1TA 4OJNA 5EJEA 3VZQA 5GVRA 5LP6B 3L0YA 1IY9A 1KMNA 2REXB 4M1QA 1XXHA 2RMKA 4B76A 3M9LA 3PGLA 4Q3OA 5LQCA 1G3UA 4UAGA 3PJFA 4E32A 3G82C 3I8XA 2VBFA 3FWYA 3PHLA 3QRWA 1KF0A 3HVJA 1PSDA 1W6RA 2QNBA 3QNMA 1RKQA 4JOQA 4RHUA 4FR0A 4JITA 4TTQA 3GOHA 4ZOCA 3ZK7A 1FDVA 1G20B 2YOHA 2CFTA 3RVOA 3V3TA 1F9EA 1A8UA 4J0JA 1GDTA 3OFNA 1AX9A 4QULA 2KJQA 4WBSA 3L4BA 4TUYB 3F8WA 3H4MA 1GQRA 1Z4MA 2H1CA 1YZHA 3GH3A 3A2KA 4ZDKA 5ELXA 4IIBA 1I5EA 1LFDB 1WCIB 3DNMA 2XKBA 4QGHA 2FWBA 4MUKA 3BD8A 2C2KA 2YV3A 4NCKA 3SJUA 5AKXA 3U4HA 4YI5A 3ZY4A 3AUYA 2BDUA 2BFOA 3KAQA 4Z9BA 3G1WA 1F1JA 2D1RA 3SJBA 4DWOA 3V2IA 3WWYA 3D2LA 1CZRA 1USKA 4AJ2A 5A7HA 2ARKA 2OO5A 1Y7PA 2IRWA 1ZWLA 2PV7A 2DJIA 2WBLC 3P0RA 3PC8C 1T5TA 1FEZA 3EYAA 2VDWB 3AT1A 3K4PA 4BIIA 1QORA 4LXXA 4Q9NA 1I32A 1I4OA 1E1QD 3M6WA 1PJZA 3ND7A 1PX0A 4MW2A 5FORA 2I78A 1TT5A 3JARB 2W6JA 2WMOB 4KUEA 3RYHA 1QHIA 4YV7A 3E0QA 4DBZA 5BPFA 3IAS1 3Q1KA 5EWJB 1II8A 3EA4A 2XUHA 3LX4A 3NTXA 2P2CA 1QGYA 4IIGA 1PVDA 2IOFK 4KFSA 2OXRA 4RGVA 4RLHA 3VJKA 2LV8A 4DT1A 1RAFA 4AN0A 1POWA 2BKEA 4PAQA 3TQOA 1HYGA 5MGNA 2NPIA 1O6GA 3U4DA 4JI8B 4FZVA 2X40A 1PTJC 1TO6A 3IH5A 5E3IA 3Q8KA 2ZUEA 1YWGO 1QHHA 2HBQA 3AW9A 3DEAA 4JJAA 3IVXA 4XW2A 3S2ZA 3SN6A 2P3SA 2B4KA 2JKYA 4JVNA 4TWZA 1WMBA 3M6UA 1KEKA 5AUNB 2OWEA 5D3MA 3VMFA 3OZFA 2JHAA 3ST7A 4UHJA 3WJAA 1C81A 4MMZB 3EC2A 2NVWA 3L4KA 1PUJA 1Y5LA 4QG7A 3G2NA 5AICA 5JS8A 1Z73A 1F9AA 4WH0A 5BURA 3M6AA 1DAHA 3GEEA 1Y8AA 5ALKA 1U0EA 1VLMA 3I52A 4C4PA 4CLOA 4LZZA 1O9HA 1Z4IA 4CM9D 3IBTA 4B34A 4D46A 1FXWF 4Q9HA 1G21E 3ELDA 4L72A 3M8KA 1M2NA 1O4VA 3ZWYA 3CIFA 4XOIA 1BS2A 4LDQA 4DN6A 3UPUA 3GLHE 1U1EA 3MLEA 1PJ2A 3RFTA 1ZUNA 4X85A 1BCSB 1EVYA 2GN2A 2ET6A 1MW8X 5IH3A 1KXZA 4RA9A 3VR3D 1JZSA 3IB3A 4Q66C 4ZOBA 4HH3C 2IC5A 2DY1A 1P5JA 4GBMA 4HB3A 3UWMA 4CFYA 4KLCA 1EFKA 3CPJB 1ZAKA 1OA0A 2R86A 4H17A 2WZCA 1MBZA 2OO3A 2ZXFA 4CMBA 1CQJA 3GZNA 3T1YB 1QH1A 2A0UA 4FYKA 3BFJA 3NRBA 4X1KB 5TQ2B 3YASA 4QG3A 2GILA 2ZSEA 3I4LA 4RU1A 1A9SA 5H83A 2QJWA 1C7RA 2SBTA 4I4IA 4UUOA 4WLOA 1JEQA 2V9CA 3VPHA 1PEDA 3ZUGA 1DWPA 2EZTA 2H6EA 4FOOA 4KL8S 3K35A 5T64A 1ZMXA 2FUNB 2QTGA 4FD2A 5F76A 1CQIA 1CHNA 4MR9A 4TT3A 3PC7A 5JBIA 1BD4A 4R54A 1Z5NA 3C4JA 1FP4A 5DM1A 3SEAA 5CEFA 4DR3B 1PHRA 1VGRA 5ENDA 3BERA 1NSFA 3AEKB 3QKRA 3RSFA 2C2WA 2IHUA 3TQFA 5EQTA 4IBOA 2YQZA 5F2KA 6YASA 1IZ0A 5CEEA 3DDCA 2WABA 1F20A 1VCMA 3AVPA 1WJGA 3B1JA 2OGUA 1Q44A 2VYVD 5LA6A 4W5QA 4JCOA 1UJ5A 2NTNA 5AIBA 2PSDA 4ZCPA 4AP9A 3FR7A 4HPWA 3AU8A 3D2BA 1T0JB 4GKKB 4EB8A 2H08A 2OESA 1RHJA 2AKAB 4JL5A 3DQZA 2OTCA 3A27A 3G2OA 4HVTA 4XGQA 4HWTA 2BTOA 3WA7A 1JDPA 4GI5A 3TRIA 1V7QA 1TYCA 3E81A 4DYVA 1ZM9A 2QRGA 3F71A 3KC2A 1MA0A 4TMXA 4TS9A 4QXQA 4OEHA 4O4LF 5J5VA 4GOOD 4RA6B 1XZIA 3WGQA 2WU8A 2Z30A 4IDBA 3U9LA 4IXWA 4YJKA 3OKAA 1Q0SA 4M46A 2DH5A 3IUJA 2Q50A 4TV8F 3LDHA 4MAFA 5D5PA 2QVBA 1JBKA 4KQKA 2ZYAA 3MB5A 4MS4B 1GPWB 4MV7A 3N8DA 1ODKA 3EXHB 1AKEA 5AHWA 4A3SA 4F46A 3DCIA 5J2UF 1KXJA 2Q3HA 5DGCA 4JY7A 3SX2A 5KWJA 5DYTA 2MINA 1VSQA 2W0SA 2PANA 3KQOA 2H48A 2IDMA 2F43B 3OLYA 5E6SA 4LNAA 1L8OA 5KJFA 1PSWA 4PCUA 1PZEA 2JFOA 4L75A 1II9A 1RLOA 2PYZA 3NGLA 2C8LA 3HU3A 1O2DA 4BNNA 1KDVA 4IDDA 5MN6A 4C01A 2V3VA 4M54A 1FYWA 4J7AA 2EW1A 1I80A 2C1XA 2RHBA 3MOSA 2O9JA 4Y0NA 3I1FA 5EI5A 3EEOA 1LDYA 2PR2A 3HLKA 2QW0X 2CLHB 3KQWA 4NBTA 4FI3F 3D5QA 3QE2A 3RFVA 3T7JA 2QR3A 4ND5A 4P2GA 4BQFA 3JATA 5CHEA 4PLFA 3LBHA 2P2DA 2QVCA 1OC4A 2W8BA 1G2IA 1QQ7A 3I4FA 3EFHA 3N6XA 5K6AC 1UMDB 1VPDA 4OJKA 2RIRA 3VAYA 3AHCA 2XCQA 6AT1A 1ZN8A 3SBXA 2YV2A 1QZZA 3TO5A 1SZDA 1YO6A 2V5AA 3HJGA 1CCWA 1GAWA 1P4JA 2EXXA 2BFEB 1S2NA 2HLHA 4LXHA 4W9MC 5DM4A 1YQDA 4LIPD 1QH0A 4YUWA 2CF6A 3DVAA 3HGTA 4KGVA 4GMKA 1BJRE 3GRUA 3FKJA 2RHGB 4JP1A 2MIIA 5C1PA 1Q1EA 3AJAA 2A7XA 2I6XA 5CITA 3ZXXA 4DLXA 5T6BA 4HGZA 1H2AS 2YR0A 4ZQCB 1ZFNA 4TMFA 2DHEA 4MWGA 3PU6A 1T1IA 4TYMA 3LQRA 4QHYA 5BRAA 3L77A 5J9FA 2VBGA 4HN9A 3EZ6A 4JXXA 1CT9A 5JCOA 1GQ2A 2W4QA 4GOXA 3D7LA 1GTMA 2EU8A 1CB7A 3HYCA 2PEZA 5IKEA 1DELA 3GMSA 3X3HA 1ZA2A 4H7JA 3LQYA 2QI9C 4B7XA 4ETWA 3VNUA 5TPWA 3OZGA 2P2ZA 4LF7B 4UHCA 4KBFA 2XV1A 2WFAA 3KUXA 4AMYA 1MVNA 3V42A 3IBGA 5ERXA 4B8ZA 1YVUA 3M3HA 1W36D 1ZCJA 1KAEA 3L40A 3DV9A 1YS7A 2FPPA 2IOHA 3BXOA 4E4TA 3T8YA 4K2HA 4R8MA 3VYSB 4YJFA 1V95A 4BNVA 5CFMA 5AJYA 4XM2A 5EMHA 3GFPA 2PUBA 3Q85A 2V7BA 2AJTA 1CUZA 1A8HA 1R0CA 4D3ZA 4ENPA 5LOVA 3OMLA 4D9GA 1QU2A 4RKEA 2QTNA 3UN1A 1KMCA 3ENWA 5AUOB 2GBLA 2XNHA 3DULA 2XE7A 1JJIA 1KYWA 1AKVA 2DH6A 2XYQA 4IOKA 3HWRA 4QFDA 5K2MA 2IVZA 4LZJA 4G0YA 4R7ZA 1FXSA 3H05A 2FX5A 3KR2A 2PE5A 1Y82A 1VPVA 5EPEA 5FOVA 2JGLA 1Z7YA 5FF9A 2HNBA 1W7AA 3FLEA 3CE9A 2AXQA 3K6RA 4OO3A 1ZQ9A 5K45A 2WAXA 5CDSA 4HN2A 1HORA 3CE6A 3Q11A 1X92A 3CXRA 4FMDF 2OD7A 3DEYX 3CF4A 3JQ6A 3Q98A 3R8FA 4I50F 4UTVA 4IYRA 5AJXA 3MGKA 2WKQA 2IZ7A 5C7IO 2NXNA 2P0AA 4ZAVA 4P7JA 3RUDA 4BRUA 2HWKA 2LIPA 3BF8A 3CVJA 1XA4A 4J1TA 2GYVA 2O0MA 4UBKA 3CY6A 2OAP1 5DWQA 3J7AC 1N5KA 1GN8A 2PZBA 5JARA 1R8XA 5C35A 4RVSA 1T5HX 2J30A 1XDWA 2RGDA 3HNRA 5EE5B 3W9SA 1XD9A 5LZ8A 3W1EA 2OV8A 3K9FC 4OQFA 3I05A 4C7OA 2AZXA 2OZVA 2PUTA 2O2IA 2UYCA 3WB9A 3MYRA 4CM3A 1OXTA 4UUBA 1IHXA 5KAPA 4U7DA 3DV0B 2PL3A 3W5CA 1ZJYA 2P2YA 3H7IA 5H68A 2NUAB 3LYAA 1U4NA 2HK6A 2WJGA 3A14A 3FVWA 3ROMA 4BO2A 3HWWA 3AI1A 2X0RA 2W58A 3GEDA 3LY5A 4FDTA 2AJLI 2QPTA 4GZ5A 2JFUA 1Y8CA 4RLQA 1L1FA 3FAKA 3W5HA 4YS6A 5E1MA 3QKSA 5H3CA 3DOIA 4QDOA 1LI5A 4V0NA 2F1JA 5AFSA 3OU6A 3ZCVA 3MWDA 3OLVA 4IZIA 1S8FA 1G64A 1J0EA 4ZTZB 1GCAA 5KHLB 1U28A 1K98A 1BEZA 5D2CA 3B3QA 2C98A 3ASYA 3EZ7A 1TUBA 2Y0DA 3KT0A 3QFSA 4L0DA 5DE3A 3SX0A 5FUQA 3MGAA 1KI7A 3EDRA 1D4OA 3TLGA 5E0KB 4ZTUB 4TN5A 1I3LA 2RHTA 1ZRSA 1P6UA 1GCGA 4GLFA 3T9AA 4IO1A 4D6XA 3E3OA 4D8TA 4HNVA 2WWVD 4OAPA 1ATIA 2LKDA 4QUEA 3VDRA 2BMFA 1RZRD 2AN3A 4DM3A 1ACJA 5JSFA 2NO0A 4BKOA 2XPCA 4TVKA 3ZGVA 2A3RA 3OG9A 1JR6A 1CR6A 3OQNA 3RS5A 1L6RA 2GS9A 2VL7A 3BWMA 4WFQA 4ZARA 3T9DA 1Q1NA 1EUDB 4W1QA 4EK9A 1E3MA 5IAAA 4B3TB 3STHA 1XEXA 3I32A 4YCSA 3WHKA 4A23A 3NAQA 1B0PA 1AS2A 2Q3FA 1YBVA 3KS9A 1NWHA 4IOMA 1Y8RA 4LDNA 4QATA 1CZLA 1NUQA 5JDCA 1D2NA 3FWKA 4E70A 3A9SA 2GHRA 1JHXA 2H18A 2C92A 2J9GA 3EMDA 3ESQA 1AGXA 3AERA 3ENVA 3EVCA 3IS3A 3JR3A 3L4EA 3NHSA 4XIYA 2HCFA 3ZE0B 4DRZA 5IX8A 5HRUA 3PT5A 3LF2A 2FN3A 2ZR0A 4ZEXA 4BPBA 3K0CA 5FXMA 3MPOA 3C41J 3LD9A 2WWHA 1XL1A 2WP0A 4JU9A 3A1NA 3AESA 2E6UX 3E18A 3NU1A 2OENG 3RBVA 5K8IA 5TB5A 3FTEA 2JAQA 4KIWA 3L04A 1K75A 1N0VC 3FYUA 2IBMA 5BVGB 4MYCA 4EYKA 3QVOA 2QRVA 2QUBA 2L18A 1FNDA 3GGSA 1JU4A 1A82A 1QO0A 3KEOA 1DVRA 2F2TA 1GPJA 3OJ0A 5K0LA 3SCZA 3W5VA 3QPCA 1ZOPA 3CO0S 1N78A 5IC4A 5L3SB 4KO4S 3VR5A 2FEWB 2JGMA 1RR6A 2G0AA 4CG1A 2QR2A 2HMVA 1J39A 5JQGB 3A1UA 3LWNA 4CIWA 3B13B 1ZZEA 3H6GA 4A0SA 3DBHB 2Z2XA 3KQLA 1W44A 2BZ0A 3ND5A 4KXYA 2CT8A 3TVYA 1LNZA 1PQPA 2P78A 2C84A 4YCDA 3S3TA 4A26A 4B4OA 4BB5A 4M37A 4UM9B 9LDTA 1T9BA 2VS1A 5F9MA 3K0HA 1Y9JA 4QSMA 4CR7A 2WF6A 4HT3B 3C3BA 2J0EA 3K53A 3CLSD 4L9SA 1KYTA 4NYIR 4RD6A 4FSHA 3KWMA 5EKXA 2WKPA 1J07A 1Q2XA 3GUCA 3P9KA 3GLFE 1LPSA 4CMIA 5EZ5A 4E12A 4CPDA 1Z56C 2ZJ6A 3LT4A 2C8JA 1PTKA 4MAAA 5EZYF 4F06A 2JAWA 4PSKA 1JFVA 4PLHA 4FN4A 1JAYA 1MJNA 4WZBB 3ZW9A 3NALA 2QTRA 3EHEA 1C9DB 3MPUA 2XUKA 1O4WA 3FVTA 1KERA 3LG2A 4LKRA 3O8QB 1NMZA 1ULTA 2DFKB 2V54A 2CVQA 4BXOB 2DBZA 1AF4A 1YVEI 2XZPA 2GO1A 3ROEA 3REFA 1P91A 3WWEA 2AZDA 3PXAA 4EY8A 2RKOA 2C54A 4QUIA 5CYGA 1W75A 2QN1A 5DLEA 3MLAA 1WUKS 1U0FA 2VWPA 3ENZA 4Z9XA 4WK0B 1Y6QA 2BRUA 2GWRA 3HN7A 3MUFA 2H1IA 2IOYA 3UICA 1Z0KA 2LBPA 3N2GA 1SA0A 3R0VA 5FBKA 4BPRA 4EAAA 3V2HA 5J3JA 3AKZA 1QQAA 2X7JA 2OK7A 3LOUA 3WIBA 1UJNA 1VJ5A 3TAHA 4BNMA 1H1LB 2P6UA 3GLIE 4HGOA 4K9KA 1Y6ZA 2F1KA 4FMPA 1VECA 4P5PA 3HCBA 5JXGA 5D87A 3ZDDA 2NSJA 1E2UA 4DB4A 3CPEA 2H0QA 3ELUA 3ZE8A 4F56A 5LQNA 3CUVA 4FEAA 2Y0CA 2AI2A 2NZJA 2VPIA 2YCBA 3EGIA 2O0HA 1KSFX 4D9EA 4YRQA 5JD5A 1LDMA 5HQ3B 5J43A 3GJ4A 1ID8A 2IWHA 1YNOA 5M3BA 4DG9A 1PYOA 1ZU4A 2JJ2D 5EG5A 3TI9A 1KJNA 4GR9A 1WNTA 1Y5RA 1YH3A 1J0DA 2H0RA 2P79A 5EIOA 1KY4A 2WIFA 4PBRA 521PA 1VA4A 4BJ5A 2HBYA 5AI8A 4E5UA 1S89A 3T35A 2V7TA 3KPYA 3MXTA 4INJA 2HTEA 1E9FA 1Y9EA 2DFTA 4KJZA 4PSUA 2MCFA 4CM4A 4YUAA 5ITSA 1YVDA 4MAMA 1M6YA 1YB7A 3OCZA 4IZOA 4PQRA 5EWMB 3SE0A 3LOQA 2GX6A 2R8BA 3OF3A 1E7MA 2PL9A 2DR0A 2HM7A 3ZHZA 2BH9A 1E1DA 1UT6A 5J4YA 2Q3EA 1XTIA 2LP4Y 3HDGA 1DC7A 2QIOA 2VYFA 1R5JA 4P92A 5AVWA 5AW0A 3HB1A 5HGJA 1YZGA 3RU2A 1HMYA 5DNUA 1WU8A 5C8VA 3CVVA 5H02A 5IKMA 4X3OA 1F0NA 4BZWA 3PRJA 1QS0A 2P3QA 1QH8B 4JYCA 4AWAA 2AXPA 1T35A 5B58T 4B73A 1HUQA 2HNKA 1I7DA 1C8VB 1P29A 2JBHA 5EGSA 4IVRA 4TM7A 4CKCA 1LFAA 4WN3A 3SE7A 3QEBZ 5CGZA 1JKFA 3S8YA 4IAOA 1NRIA 5AW5A 3SLKA 4O2AB 4CDRA 5HPYB 1XNGA 1DQRA 5LQDA 2BFWA 4RTPA 1ECPA 2ZI7A 3LXRA 1NUHA 4ZIRA 1QYWA 3GZTB 2W2XA 3H0CA 4JB3A 3MT0A 4V1CB 1U6KA 4AZTA 1W93A 1Z9BA 5CLFA 5MF6A 2JBAA 3JV7A 4PYQA 4PWYA 3G0GA 1EBUA 1GPUA 3FNEA 1ARZA 3WMGA 4F3YA 2TSYB 3NUGA 5DK4A 2YJZA 2H11A 3FYDA 3STVA 1KGDA 4UXJA 3W2HA 4Y2RA 2V7PA 3T6KA 1N4DA 3TRHA 4DNXA 1RPNA 1RYFA 1WW8A 3GFGA 5LLDA 1YQEA 5E1OA 1QAMA 1LTHR 3L0DA 1X14A 3PRHA 4Q4DA 2JFWA 2EWVA 2OFFA 5T5QA 2H1FA 4E5NA 3SZRA 1FJ2A 1LSJA 4MLPA 3UF0A 3IURA 2JIDA 3DZJA 1KEVA 2YZ7A 3OEWA 4L4ZA 2AYXA 2J5KA 2CJWA 3OF2A 1J0AA 1A4IA 5KNLA 2FI1A 4NP6A 4ZZ0A 1ABFA 1EHYA 4FDLA 4GI2A 4WINA 1P44A 5ALIA 1GTG1 4V0MA 1WCV1 2R7AA 5JCXA 2ZRJA 1JDBB 2HIAA 2W2TA 1XC7A 4XVQA 3T7DA 1U3CA 4QPPA 5D00A 2OFPA 2CB0A 1D6JA 5LBUA 1QWOA 1OAOC 3SC2B 4E31A 3EDCA 3EHDA 4L3WA 4O6VA 2P5YA 3IELA 2HIGA 4I4TF 1JFTA 3ROPA 1K08A 4JNCA 1C3JA 3FMPB 5JC1A 1E6MA 1U8ZA 3ZQUA 4EO7A 1JECA 3L8EA 1GZ4A 3L7OA 1W0JA 3PWKA 4RF5A 4UE3S 1M6VA 3GFSA 1XWIA 2O3UA 1RI5A 2JVKA 4CLEA 4L16A 5JYEA 4WXRA 1A96A 4Y2JA 2JGAA 1P5HA 2GD2A 4UNNA 3CBQA 3GJYA 5CDFE 2XGJA 3B52X 3P0HA 3PGJA 3W79A 2JCBA 1L0BA 4BV2A 4TYWA 1X39A 1IHDA 4FDAA 4R7GA 3VR0A 1W8DA 1NQUA 4UW9A 4EKDA 3ZHCA 3OC0A 4MRMB 4R16A 2ZRLA 3P52A 4RD2A 4C5BA 1LPOA 1OYYA 4BQQA 4FILA 4BTLA 5MFZA 3D2AA 5IYZB 3ZVKA 2ODAA 4TVOA 1UOOA 1QO7A 5AOBA 3TTWA 4KE7A 1QV7A 3KWJA 1LX6A 1GHTA 4H0CA 4BX3A 1TZBA 1F5NA 2K2QB 1P6XA 4FYXA 4OG2A 3SJAA 3HI6A 4AJIA 1CEEA 1VHQA 2IJGX 3DOUA 1F0YA 4FX2A 4UAVA 4NEGA 2DBYA 1P17A 2OORC 5ESDA 4EJ2A 3JZDA 3WHLA 3IBFA 1Z18A 1L4HA 1SGWA 3DVSX 3S27A 3FCOA 1VFNA 2HJ9A 4KPGA 4RF3A 1Z3IX 3KR0A 1KYVA 4CIBA 2JAXA 3IO5A 1GA6A 2ACKA 3EEFA 3RKSA 2XI4A 5K3EA 1JU9A 5FR2A 4L95C 5JJ5A 2UXBB 4QOFA 2NNWB 3KZNA 3AVTA 1Y98A 4IF6A 1IOVA 5I7UA 1KO4A 1DLJA 1P1JA 1A8SA 4D9CA 3GUZA 4ARZB 1DL5A 1PR9A 4UM5A 3VBEA 4G67A 2FXVA 4JJKA 5FTMA 4GX1A 3T4UA 1U2EA 3K3PA 4LXGA 1B1AA 1XPJA 5EJFA 5BORA 2QB5A 2SCUB 1D9XA 2WF7A 1B16A 2CFOA 1W88A 4DDTA 1C4OA 2C00A 1GZ7A 1VMEA 3GIDA 2D7JA 3PIRA 3DKKA 1KMMA 4M1MA 1XZ8A 2SNIE 1GLNA 4P4SA 4E7OA 5BY2A 1IPHA 2FMTA 1QFJA 1NE7A 2BONA 2NVOA 4KZPA 4MV3A 4PYRA 3L7MA 3D6MA 2JLSA 3BA6A 4JEMA 5AI5A 1AURA 3R6TA 1P7CA 3W4IA 3G13A 2C4MA 5LN1A 4HNSA 4Y9DA 1BNCA 2QENA 1XMIA 3EIXA 3GY0A 4TLAA 2JATA 4UFNA 3V3KA 1XEWX 3DE1X 3KKQA 3KQQA 4PYOA 1W5BA 6NULA 2BGTA 5KYYB 1E3JA 1N2JA 2M98A 4A6DA 2Q0SA 2GKGA 3A9RA 2DPHA 1FCJA 2PJUA 2W00A 3DNFA 3PVSA 1PRYA 3AY3A 1JHMA 4QDTA 1K3FA 4TXMA 2JIQA 3IUSA 3GA0A 2OP0A 3OECA 2R1VB 4FWBA 4Y2HA 1IUKA 5A3SA 4BNLA 2OKCA 3ZH2A 2PUCA 1XCOA 2J4CA 4WNAA 3ZNPA 1SIBE 3ZLVA 2ZRQA 1DC6A 1L5WA 3DAOA 4ZAZA 4F6RA 1TZCA 1G3IA 4GS5A 5DWVA 4BKUA 3ZH9B 2VNIA 1LTKA 2GR9A 2P9ZA 3EFOB 3OY2A 4Z0HO 2ZSIA 2I2WA 3Q15C 2YNMD 4ZZ3A 3OU7A 1KZ4A 1QRAA 3SF8A 4Q05A 3HDHA 1U2PA 2FZLA 2OV2A 5DV9A 4BX0A 4DV1B 2VHXA 4CCYB 3TLBA 3R44A 1MJGM 1GKIA 1RC1A 4C20A 5DP2A 2OSVA 3B5EA 5A5DA 1CXZA 1LK5A 3DFMA 1YZFA 1R6AA 2GPAA 3D81A 3I4CA 4P38A 5ADUS 5KQLA 4BP9A 2ADFA 2AN4A 4ZYYA 2D74A 1NKSA 1LI7A 1CU1A 3K5WA 3UHJA 1V8OA 5EESA 4N39A 4KMOA 1SURA 1L7BA 2FMIA 4JKOA 2HX1A 2G25A 4M0UA 1BHO1 5A2QA 3X2EA 4IOJA 1R0KA 4C04A 5BN4A 3T3NA 3M6MD 3VPSA 2DUWA 2OV1A 2Z8ZA 4Q4HA 5AW8A 3BWXA 4PAGA 4YA6A 2BZGA 4E4RA 4TL7A 3OUTA 1G21B 1SHZA 4WNCA 2WYUA 2X5XA 4WFKA 3HZZA 4JX8A 1QX3A 4EY3A 5CBPB 3QMVA 3MJDA 3SBEA 3KWFA 3IMKA 2CXNA 4NNPA 5BSWA 4X62B 3FPGA 2JD0A 1CJTC 4NEHB 5SZHB 1ENOA 5HW0A 4YHHB 3U4QB 1O0SA 2FJPA 1LI4A 1QV6A 1XRMA 2EYQA 3JYNA 2V8BA 2G76A 1V26A 3CBGA 3LPLA 4OP3A 3TBKA 3ZV5A 4AJKA 4IJVA 3A28A 4MV1A 4Q4JB 1PAUA 3CLUD 4K8OA 2UXDB 3T4XA 1G7CA 2B99A 2HU8A 3GX1A 2QDXA 3RAFC 1GG5A 2FPSA 3ZQ4A 3HB0A 4DWWA 3PUVA 3DDOA 4BV9A 1CR4A 1GV0A 1K5PA 3KFXA 3LP5A 4RKWA 1GU1A 2GN6A 1U7XA 3PQ2A 5JROA 3C1UA 3N9IA 4OHOA 2WOJA 5LBTA 2BOVA 2JFHA 3HC7A 2ZB2A 3ESCA 5KSPA 3CNLA 4B35A 1DKMA 1PK9A 2AHOA 1NW3A 1RLUA 2NLOA 3OWOA 4J7XA 4OHRA 1EXWA 3E7WA 1YL7A 5CVDA 4FXPA 1GO2A 3E05A 1Q11A 5AI6A 2R79A 1T5IA 5REQA 3JPYA 4ZT2A 2EQ5A 3F2IA 1SQFA 2QL9A 3FM9A 2C61A 5EKSA 2C7OA 1Y9ZA 2A9KA 4HDMB 4M9QA 3X2SA 3K70D 1B0AA 4MV0A 3ABZA 4MCAA 2YDYA 1ZXBA 3TZEA 4AFNA 4X24A 5FBQB 1GZSA 3EIOA 2AHRA 3MM4A 3OZAA 3UHPA 1PNOA 5LXTA 4RKFA 3Q1LA 4D9MA 2X3YA 3B6MA 5H1YA 4CQJA 1E7SA 4IIYA 4KACA 5KKAA 3QITA 4AROA 3DE4X 3ED1A 5LZ4A 1ECJA 3WFJA 4C06A 3TTXA 3HJTA 2RE8A 4E5SA 1XP8A 1I6MA 1HQCA 1PWXA 4TV9B 3B2NA 4O2LA 3V9PA 1T26A 2CHUA 3E7XA 1ZHFA 4TL8A 2GVNA 4M8IA 4ZI7A 1JLKA 1COZA 1ORHA 3OC6A 2G07A 3K9QO 4BE4A 5K0TA 3G9QA 3SEFA 1W4ZA 4WKNA 3TNJA 1MP0A 1UK9A 3KTDA 1JMKC 4B3BA 1XQXA 3HVRA 3M6LA 2HHAA 2B8TA 5FOWA 2G17A 4DJ5X 1Z47A 2NSLA 2FQ1A 1AZLA 3GWGA 4KNWA 1CUSA 1CQWA 3P9NA 1OZGA 2OCLA 2TMGA 2B1IA 4I6GA 4MRAA 5KEIA 4B74A 1OLUA 4AY6A 3OE5A 5CT6A 2B7CA 1ADGA 1PD0A 3DCYA 2CGEA 2OD2A 3FY4A 3IQDB 4G9GA 4M9SA 4QU5A 3FOAA 1T6YA 4LRYA 2IZ5A 5DCUA 4ETIA 2O0LA 2OM6A 1MAAA 3B1KA 1Q7RA 2Q6VA 2ZREA 3IOEA 1R27A 3PUJA 1ZC4A 3E2IA 4L8LA 1CWUA 2PDAA 1EJ6A 3C45A 1HPLA 4Z0TA 1E79A 1JQKA 4QDZA 4ZU3A 5JYDA 5FADA 3BZBA 1QKJA 4DXAA 4KB5A 1WMEA 1KOFA 1P61B 4ZALA 3Q7QA 1YIDA 1NYLA 2NU6B 3FB4A 3NEJA 4V0LA 1DTSA 1SXGA 4PXSA 5JAMA 2O2EA 3ZV7A 4O4HA 5H3HA 2VH5R 1JU3A 3NJ4A 3WQQA 1PSZA 1X19A 2NQ2C 3L1HA 3RG8A 3TTUA 5FFFA 4Q6BA 5HUHA 2XMQA 1MH9A 2I4TA 3UO8B 3QU2A 5BSUA 2JIPA 2XMGA 3Q4GA 3QX7A 4XCVA 1G59A 4NBLA 3TB6A 1D09A 1LU9A 4RGYA 4I55F 3ZCUA 2AG8A 3NAMA 1EQUA 3LLSA 1FUUA 2WHEA 5DGTA 3RC2A 4GSKA 3UOGA 3BM5A 1T9GR 1PWYE 4D0GA 3JS5A 3R3JA 4LFCB 4PC6A 3EUWA 4G2NA 4GI3A 3GRYA 3C5EA 1LC3A 2ZBEA 3EWIA 4WKGA 4P54A 3AUAA 4CEHA 3UGKA 4IHJA 4F7DA 1CLEA 2L42A 2R8XA 3GFRA 4W8OA 4M9CA 1FX0B 2P65A 3HV2A 4RFSA 1GRNA 3FDJA 3RD5A 4EG4A 4RJTA 2PX4A 4QT0A 1XVUA 4B32A 5C53B 1CIJA 4HP8A 5DN6D 1P80A 5KWSA 1GQFA 1LVGA 2I4LA 2JKZA 1V48A 3OEHA 1HI9A 1I6LA 1X87A 3GRAA 1P9NA 3AJEA 3K5PA 1NBHA 1E63A 1QFZA 3SJCA 2VPQA 5KVCA 2WKSA 3TX2A 3UUFA 2YWXA 5EXEA 3M5CA 4EJSB 5L7WA 1WUYA 3S40A 5JV5A 1Y1QA 2QGFA 4TS4A 3U3KA 4GR5A 3E7FA 3MS4A 2Q7XA 3SZOA 3IAXA 3LKDA 3ER8A 1JIUA 1NNUA 3U0VA 3ZKAA 1UBCA 2HLDD 4FLMA 2B5VA 4G5GA 4R1NA 2C7BA 4RVNA 3R7FA 1MTZA 2L0XA 3ZWXA 4RY8A 4ALIA 1CUBA 2YUTA 3IDAA 3U3RA 4ZCTA 1N7GA 4EKIA 2AW3A 2NU9A 1IBSA 4HYYA 3GGDA 2CNOA 1XAGA 5C7OO 5HEKA 4G0QA 1A4UA 4KBGA 3AL0C 2VF4X 5JS7A 4TMVA 1P2UA 3QOYA 1U9YA 2AE2A 3L0ZA 3T5TA 4WA8A 4N5DA 3V6LA 4LVNA 1KVQA 5IK2D 2WRZA 4XWGA 1Z5OA 4YCAA 3HYNA 4GX0A 3MQ4A 1MQAA 1LJLA 2VHTA 4W7IA 1OFIA 2B61A 4BX8A 5LD2C 1PVOA 4XM1A 2MSKA 2OFXA 4FFWA 4Q03A 4YACA 3O4HA 3SIXA 4E5PA 5AM2A 1OLXB 1PUXA 5KYGA 1C2TA 4DIDA 3GNLA 3LFHA 1V41E 1W2WB 1G8KA 1KMIY 2FUEA 1MW9X 1XJQA 2YMLA 3DUWA 3ZDBA 4LTMA 1GDDA 3TH5A 1XMOB 3MWFA 2GD1O 4BO8A 2R6HA 1FTNA 2QBYA 5LYJB 1PE0A 3I2KA 1T4BA 2QLFA 1QHFA 2LVBA 4YJ2F 3T5MA 3JWHA 3L6RA 2H59A 2PYIA 5LSAA 2VSNA 4LGCA 2EC5A 4Q00A 4XWYA 1G4AE 4JAVC 5EIBD 2IF2A 1YC2A 3ID6C 2O8EA 1IY2A 5INTA 1W29A 3UK6A 2ZWPA 2XBLA 4JOBA 2POCA 2PMWB 5JT1A 2G1AA 2ZT5A 3QEKA 3NC4A 4XQ9A 2VF2A 1EJ2A 1U2GA 3KX2A 1CJSA 4FB5A 3SG0A 3P19A 4BBAA 2R4QA 4I3HA 4IUYA 1E60A 4GR4A 3MS2A 5FA8A 1E9VA 2P9JA 4QNMA 4IVPA 4N82A 2PWAA 3D8HA 2L19A 2CFSA 4BZXA 5C31A 5EMKA 1TA4A 2A94A 4PRKA 4L5IA 1K66A 4B83A 2GM3A 1HURA 3F8TA 3GZ4A 1NOIA 2WK1A 3IAUA 1CDZA 2J5BA 1RTTA 3AHJA 1NV8A 2XD9A 1KDZA 4D8WA 2JLVA 1HT2E 2XE8A 4H35A 5LNK6 4X65B 3O26A 3PWTA 1TVKB 1W5AA 1WXFA 2JAOA 4DPLA 1QIFA 3RASA 4B85A 4B81A 2PL1A 3CNHA 3EQ6A 3ASVA 3LUPA 5IWCA 2Y9PB 3ABOB 4GM0A 1GKLA 1NU8A 1CS0A 4JODA 1LPNA 1J8MF 2DCUA 2R2GA 1RP7A 1A9PA 1YR6A 4HMOA 3RS9A 1ZD9A 2O4CA 3H18A 4HVAA 2G1UA 5ICEA 2FUKA 5CDYA 6LDHA 2C59A 3EIEA 3N0XA 1SVUA 3W8NA 2HWWA 2OHOA 5IHXA 2N42A 4JOSA 4AMUA 2PZJA 1VGVA 3FMOB 2AR7A 4NC9A 4R1SA 1T2EA 2AUMA 2QQGA 3WVNA 3CEMA 4LC0A 2QTBA 1P77A 4U7JA 3LVBA 1E69A 3O95A 4E03A 1WAMA 1SUSA 5DTMA 4QEZA 1K9SA 1JJAA 2ON6A 5IARA 1WVMA 2G1PA 1O87A 1TZKA 1E20A 2FZ4A 1IXKA 2XXJA 3JQDA 4N1AA 1NI4B 5CJ2A 1P45A 3AOEC 3NONA 4J7UA 3HSKA 1U7WA 5E8JA 3DOEA 4HYTA 2ONJA 2J3DA 4UC0A 2MTBA 3FPLA 4A8JB 4DWVA 3VA7A 2QMZA 4OP2A 3GT3A 3GGOA 4D4MA 1IOWA 2OXCA 4WXPA 5HJ2A 5BQFA 3F6PA 4B3GA 3BB4A 2FG5A 4CCWA 5JAPA 5A3JA 3N5CA 5F7ZA 5IH7A 3JQ8A 4BO4A 3U09A 2NGRA 1C3OA 1MDFA 1SOUA 1Y9DA 1LGYA 1RZRA 1NYRA 2WYHA 4GECA 4C03A 1PZNA 1JTVA 4F92B 2R5NA 2BISA 3DZDA 3OIGA 1AGNA 3LJKA 4XDGA 5JHHB 4HSEA 4MQFA 4MW1A 1E6CA 4JP2A 4LJRA 5FTWA 4MVJI 5J63A 4EITA 2IU4A 1MOSA 3WRXC 1IY1A 3BKWA 1ODTC 1TYDE 3C5VA 3FPCA 1RC0A 3MMNA 4RQTA 5IEBA 1PZHA 2XWPA 3O1IC 3V1MA 4AMGA 2PJRA 1GR1A 2XT9A 3B1VA 2PT9A 3I61A 1ES9A 5F98A 1R4AA 1UKAA 5BV0A 2RGYA 3PB3A 2AOVA 1JFRA 2FEOA 3CSSA 1WB4A 3BXZA 1GFSA 1L7NA 1DQZA 1P4SA 3V4LA 4BN5A 2FGKA 2YV1A 4ZXPA 1XNHA 3HY6A 4JCCA 1AUOA 1GAEO 3EE6A 1MLDA 1PL8A 2FHSA 3HFRA 2P9EA 2ASVA 3UQZA 3O82A 4LJ9A 4RZHA 3NPAA 4EMSA 3AR7A 1GGKA 2GAJA 1SAYA 3K9HA 3QF4A 4BVBA 4KUHA 1PCXA 3MIIA 2GMWA 4H7EA 4EZBA 1UDCA 2OHIA 2JEOA 2VRWA 4BB0A 1NA5A 5JMTA 5KC8A 3GU3A 2FZEA 4XD7D 3MAJA 1DWUA 2GKSA 2DUUA 3KEFA 4G8BA 2N1BA 2BL4A 5TVGA 3K16A 3M6XA 3VM6A 5B12A 4WDQA 1K6JA 1IG0A 1UM8A 3C1OA 3PR1A 3BORA 3JTEA 2GB4A 3G89A 1M75A 1OPXA 1KIAA 3CH5A 1LF0A 4Q3DA 3EXAA 4BMCA 4XJXA 1XYVA 3IUPA 2VNKA 3OSUA 1Q16A 5CA1F 3A1DA 1LC0A 1LV7A 4H2DA 1Z37A 4N6OA 1BH2A 3T61A 3G2QA 1T15A 2E49A 3ILVA 2XB2A 3EVZA 2W2LD 3GVCA 2C82A 4QARA 4ZCLA 3IKLA 4FCVA 2I2AA 2VQ6A 4CUZA 1GZ3A 3EZ2A 1HDYA 3QA3E 5BUZA 3QLJA 1P4GA 1R0YA 4R5MA 3R7WA 3R7NA 4OFXA 5DXAA 3SYLA 4Z4HA 3DTVD 3CB2A 2QK4A 4MRVA 1IEQA 3NBUA 2GFHA 5K99A 3NBKA 4EI7A 3ER6A 3MB8A 4ND6A 1KI9A 1OOEA 2P9TA 5HZMA 5I48A 1XRQA 3RC3A 1HDRA 3BIJA 1GNVA 4EHBA 2W98A 2CDNA 4GPTA 5LZ5A 1JI3A 2VDQB 5J5AA 3VSDA 4BMNA 4CTJA 1DTWB 1EUCB 1P5FA 3LL4A 2L17A 2W6PA 3TOZA 4HUQB 3MIZA 3MJSA 1A4XA 3O7MA 3R7SA 4EJMA 1Z25A 2XF2A 3FSGA 2PL5A 1W34A 4XFDA 4ZV7A 4F5YA 1DC3A 4OREX 5FULA 1T2UA 3DZHA 2PBLA 2V7QD 2W6CX 3RSZA 1K92A 2IUFA 2A9RA 3KDAA 2ZJZA 3GJ7A 4L0MA 3L05A 4JI6B 1MOPA 1NULA 5AKZA 4UQOA 3GLIB 3DDZX 3ELWA 2EGGA 2C58A 3IIKA 2HU7A 2YX1A 3E8XA 4KIUA 3QUTA 1N3IA 2V4ZA 3N86A 4OGKA 4X94A 3TW6A 4BGEA 4D79A 1OSNA 3M89A 4J2HA 4CIAA 2JCXA 3M2TA 4FBLA 3K6SA 1EUQA 1BE8A 1NF8A 3D6VA 5E9JA 1BH6A 1QKIA 3HCEA 2XYHA 3K96A 4LE2A 1DAGA 4R9RA 1Z06A 4L2IA 2ORED 1WKVA 2CVFA 2P69A 4EYQA 1GNQA 3ZWOA 4WJLA 3FHCB 5EJAA 4IIJF 3ZW7A 3QXJA 3AL2A 1EVJA 5J2UA 4JEUA 4EHDA 2H4JA 3V1NA 3DMHA 1VLZA 5HOEA 3KM0A 4L5CA 3IC5A 1O08A 4C4ZA 4YV0A 3CRNA 3G7NA 5BN3A 5J4KA 3BXFA 5SZIA 5T4HA 1A8QA 3WX0A 2O8FA 2A0FA 3HCCA 3F7NA 4NATA 3LFTA 4AIIA 1NR1A 1OAKA 3FMVA 2H9AA 4H15A 5F73A 4BFUA 4AX4A 4WOKA 1AKQA 4AM8A 1SKAA 5IUJC 1CZNA 5JY6A 3D6FA 3RFCA 2GDJA 2PWZA 4PPGA 1GPNA 2XVYA 3AXSA 3HDVA 2RAFA 3HRHA 3IVCA 4ALLA 1CLUA 2EJTA 1UZNA 5B30A 3RC8A 1W73A 3K5IA 2O23A 3X1MA 2ZSKA 3JRNA 4MRSA 4CODB 1BG6A 2OHJA 4HQ0A 3L1UA 2FWJA 2PT6A 4E7PA 1Z63A 4YRCA 3WYDA 1JSCA 2C5FA 1ISIA 1TK2A 1NFFA 4EA8A 3NXKA 1WWKA 4A91A 1SC4A 2XDWA 3Q8XB 2MHCA 1QK4A 4HNRA 4FTWA 1C4KA 4AQDA 2O14A 3VR6D 2XDQA 1BSVA 1VQ1A 5IAEA 2WHPB 4FONA 2YFQA 4A16A 3FIJA 4Q6WA 5JJCA 2JLQA 1YFKA 2DAPA 2KW5A 2XHZA 1ZJ6A 1ZAYA 4HF7A 2D0PB 3ZZMA 4BNWA 5D3ZA 1MEJA 4IVNA 1UZMA 1BQ3A 3THOA 3VSEA 4DNOA 4MR8A 3ZBUA 4K6HA 2AS0A 1Y80A 2PH3A 3GP5A 4I9FA 5K8CA 3EZFA 3HDTA 1PJ8A 1Y4AE 1P9LA 2CJPA 1TKBA 4NYJQ 1L5GB 1E9BA 4X20B 4ZHQF 4J0IA 5HF8A 4CMEA 3G1TA 3LP6A 3OICA 1I3KA 3OI7A 4OFZA 4JGBA 2WSYB 5FPQA 1G8HA 1QB7A 3BH6A 3TBFA 3IOCA 3M4XA 3EGDA 5CYPA 3NOOA 4B33A 2A5GA 3P9RA 2PX3A 5GP1A 1N8TA 1I3MA 2J41A 4LYHA 2E82A 3FNBA 2BI7A 1U7DA 3ISVA 1KZ6A 3QVUA 4ZCQA 3U7JA 5BOSB 4Z7OB 3O3NB 4B82A 1M1NB 3BCUA 1NLZA 4WHMA 1G63A 1GGHA 1N2BA 1OF1A 1SUWA 5KTYA 3LX6A 1NL3A 2UU9B 4YAFA 4TS3A 3MXOA 1FYFA 1UXOA 5C7LO 3PNMA 4FS8A 2B34A 2IY7A 1W94A 4PYIA 4R6XA 3S0JA 3F8SA 4DMCA 1HTWA 2VKTA 4ISBA 4RPIA 1Z7WA 1LKZA 5T6MA 3HNPA 1J2TA 5F5LA 2IYRA 4CZ2A 1VMDA 2ZUWA 2HHCA 1FFHA 2QRUA 3T54A 3OURA 3B51X 2MYUA 4FLEA 1I1OA 5K0SA 1A9TA 2OVBA 2EIHA 3OKCA 1VDMA 4NCXA 3P4UA 4GE3A 3DPIA 2RARA 5KQSA 1X94A 3JQAD 2NUPA 1PJTA 4BNJA 5T3YA 5BWNA 3NVMB 4PHGA 3N53A 1US8B 4TWBA 1R16A 5KVAA 4D4IA 3A2NA 3OT5A 3E5MA 4QGAA 2RHDA 4YK7A 4NG4A 5TC4A 3EFBA 3PEVA 2E89A 4QWMA 2ZUBA 1OX4A 4DCCA 1CJBA 2FW6A 5HK9A 5KNBH 2B30A 2M6KA 5EXDA 5J2TF 1UANA 1Y34E 4QTZA 3EW7A 5DLPA 1NQAO 2E4XA 4KFCA 1GCIA 3OZXA 3MOGA 1GPYA 1CUIA 2VI5A 4GUAA 3Q3EA 4DGSA 1SKQA 3PG5A 1HLDA 3PQCA 1WPRA 3ADPA 4MITA 1QFYA 1T9GS 3LXXA 2D0IA 2IYUA 2K2WA 3A4TA 1E9AA 2CXTA 1K7XB 2AC4A 3DAPA 4MK4A 3JVVA 4DLAA 3U60B 1AQ6A 4NAVA 1X13A 4XWKA 4XJVA 2CW5A 3B60A 2FZVA 3RSSA 4BFLA 4FFBB 2CV0A 2VR1A 4HNUA 1MHPA 4ARVA 1YFZA 1OLSB 3LBAA 5TR9A 5B1YA 1Z6TA 2PVCA 4O4IF 3O94A 4DJTA 2XX3A 4FFMA 2H7VA 3BXHA 5IFLA 3IVRA 3CVYA 2DLCX 4LSGA 1DEHA 3ZDAA 1ZHHA 3E2PA 3IOYA 4R05A 3TZHA 1KI3A 1CY7A 4L5JA 4DZRA 2ZRBA 3PQEA 4F2GA 2PQ2A 3L8FA 4IX1A 4U00A 1KWGA 4CR8A 1H65A 1PBNA 3G8CA 3IXQA 1UKYA 2ZSAA 5CGQB 4DXDA 4JJEA 1QVAA 4PHCA 1E7RA 4PVCA 1GZVA 2PUVA 5TF0A 3V4VB 3W1VA 5BW4A 3I9JA 3G79A 2H4HA 3FW1A 2W2PA 4R68A 1EYZA 3FYSA 3BOSA 4LJ8A 5EP4A 2ERXA 1BMFD 2VHWA 1XCLA 3B20A 3T9CA 2NU7A 1I4EB 2XRMA 2Z2KA 4RL4A 2WG0A 4E5YA 1EWYA 3N5KA 5CLIA 3UKDA 2HSZA 1GYRA 5A04A 2E4AA 4YMTA 1MJGA 2V6GA 4RTNA 4XQCA 1GTRA 3A9CA 1WZEA 1KOLA 3KYDA 5KTSA 3QXHA 4R2LA 4KWEA 1FYDA 4B6FA 3V1LA 1K7FB 2JH3A 3OJXA 4FD3A 4B9AA 5ALVA 4IEEA 5CFQA 1NVVR 3O83A 4H6WA 4Z4IA 5AM0A 2CLMB 3DOCA 3C24A 5ALGA 4BNKA 1U0HC 3TDKA 4EKGA 4KIJA 4C2UA 3SZ3A 1Z7GA 1DG9A 4G24A 2HSGA 4I55A 2ISQA 2WVHA 3MUNA 2KHZA 1UINA 4F71A 1QE5A 1V3VA 4KAXA 3K09A 2EV9A 4FBMA 5F2OA 4H0FA 3FNHA 1XYGA 1ICIA 3EK2A 3QBEA 3S28A 3ZYZA 4F9FA 1WUIS 4HTAA 2BE7A 1U4SA 3X2FA 4BTEA 1XZJA 2XOEA