2DPMA

Dpnm dna adenine methyltransferase from streptoccocus pneumoniae complexed with s-adenosylmethionine
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
275
structure length
258
Chain Sequence
b'TLQPFTKWTGGKRQLLPVIRELIPKTYNRYFEPFVGGGALFFDLAPKDAVINDFNAELINCYQQIKDNPQELIEILKVHQEYNSKEYYLDLRSADRDERIDMMSEVQRAARILYMLRVNFNGLYRVNSKNQFNVPYGRYKNPKIVDEELISAISVYINNNQLEIKVGDFEKAIVDVRTGDFVYFDPPYIPLFTSYTHEGFSFADQVRLRDAFKRLSDTGAYVMLSNSSSALVEELYKDFNIHYVEGKISEIIVTNYEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ADENINE-SPECIFIC METHYLTRANSFERASE DPNII 1)
publication title Crystal structure of the DpnM DNA adenine methyltransferase from the DpnII restriction system of streptococcus pneumoniae bound to S-adenosylmethionine.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 89
structure length 258
sequence length 275
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 1998-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 2dpmA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2dpmA01
2YX1A 3K6RA 3M6WA 5P8WA 5LQKA 1VE3A 2PGXA 1O9HA 1WG8A 3K0BA 2B2CA 4C4AA 2IH4A 5FHQA 3IHTA 2ZBRA 3ELWA 3LL7A 1I9GA 3SMQA 4E2WA 3M6VA 4EK9A 3D2LA 1RI4A 2P40A 4GOND 1JQEA 2Z6UA 4RTMA 1IXKA 5E1MA 4IV8A 2G72A 5FHRA 9MHTA 1ZQ9A 4MQ4A 3TRKA 3HCAA 4X61A 3KHKA 3TM5A 1EIZA 3IEIA 3OU6A 5LQRA 3UJ7A 3AXTA 3UA3A 2WK1A 4DF3A 4EVIA 3MAGA 3UBTA 2NP7A 3GCZA 5EVJA 3NJRA 3FUVA 5BXYA 5GM1A 2PX2A 4KIGA 3HVHA 5DSXA 4PWYA 3TR6A 3PFGA 3VC1A 3KPUA 4AZSA 3HCBA 2VS1A 3SSOA 3FUWA 4WVLA 1EQAA 3FYCA 3HM2A 4G56A 2ZVJA 1KPIA 3SGLA 1AV6A 3HCFA 2P3OA 2PXAA 3E7PA 1R74A 2QE6A 4P7KA 1G38A 1I1NA 3C6MA 5DM2A 3X0DA 2BR3A 4OBXA 2KW5A 5EMKA 2IBSA 1OR8A 3HVKA 5CM2Z 5DTQA 2PX4A 4MIKA 4B17A 5LQUA 1AQJA 1B42A 3EVEA 3E05A 4RX1A 4AZWA 5CIYA 3KR2A 4YMGA 3LPMA 4F86A 5M5BA 2OB2A 1O54A 2IIPA 1NW8A 3KR1A 2YTZA 2O0LA 4FSDA 3ANXA 2QY6A 4XUCA 3GO4A 3ERCA 3ORHA 1Z3CA 5EZSA 3PVCA 3T0IA 3B5IA 3G8BA 4FSXA 4P7GA 5EGSA 5EKUA 5EZQA 5GINE 2P7IA 1ORHA 1JQDA 3PFHA 2IP2A 2F8LA 2IH2A 1JSXA 1NW6A 4DCGA 2ZZNA 2JH9A 1N7IA 5EC8A 4QPNA 3NDIA 3UJ8A 2AOTB 4XUEA 3I9FA 4RSRA 4HGYA 4U7TB 5FQOA 2PLWA 3F4KA 3G5LA 1XVAA 4AX8A 4PIMA 3DXXA 5LQJA 3HEMA 2CKDA 3FRHA 5K0LA 2C7QA 5EHGA 4PYIA 4EMSA 3LCCA 3VSEA 2ZIFA 2FCAA 4QPPA 1G60A 3RODA 4Y30A 3KR0A 3BWMA 4Z2YA 3MTEA 1X1BA 4X1OA 4C06A 3TMAA 5DLYA 2BR4A 3EVAA 1RJGA 3C3PA 3EPPA 2YXDA 5E2BA 2PBFA 2QM3A 3PB3A 1KPGA 2WA1A 3HNRA 2PXXA 3RIEA 1P91A 2H1RA 4GBED 2OB1A 3LKZA 2LD4A 3B89A 2ZLBA 1TPYA 3ELYA 3LDUA 3G8AA 3P71T 4U7PB 1BKYA 1FP2A 2QRVA 3DMGA 4M38A 2R6ZA 3REOA 4V0RA 2VDWA 2AN5A 1TW2A 2ZBQA 4QVGA 2GB4A 4PYLA 4E2YA 1G8AA 1X1CA 3BKXA 5HZMA 4YMHA 4PCAA 2BH2A 2YQZA 2YVLA 1D2GA 2ZSUA 3KPWA 4RVHA 4F85A 2R3SA 1JTEA 2Y1WA 2PSSA 4M7RA 4ER5A 4OA5A 1JR4A 1D2HA 3ELDA 4XUDA 3UJ9A 2O05A 3TOSA 4IV0A 2IFTA 3A4TA 4C03A 3C6KA 2E5WA 4ER6A 3A26A 3B3FA 5DTRA 4RTSA 2OXTA 5KQSA 4BP1A 2I7CA 3CJQA 2VDUE 5LQAA 3EGEA 3EVFA 5LQCA 1R8YA 2P7HA 3P9CA 3FZGA 4R6XA 2UZ4A 1NBIA 3RW9A 5BW4A 2ZZMA 2BR5A 2DULA 1G55A 4E30A 5E9WA 4P7FA 1EJ0A 5JUWA 2OPBA 1KXZA 3MCZA 2PX8A 5DT2A 1H1DA 1KHHA 4EKGA 2Z6QA 1KPHA 2ONYA 3CGGA 5GP1A 5K05A 3I5UA 2Y1XA 4MTLA 1L3BA 4ISCA 5CVEA 5DRYA 3GRYA 4GC5A 4NECA 4AUKA 4PYJA 1L1EA 5LQNA 4HTFA 2VP3A 1WS6A 1X1DA 5HIMA 3DH0A 3GGDA 5LR6A 2P35A 4QQNA 2PWYA 4CXMA 1BOOA 3KPYA 2ADMA 4ATNA 1FBNA 5K0FA 2JHCA 2XYQA 3PT9A 3DTNA 1MJFA 3M4XA 3HTXA 2H11A 3O31A 3VYWA 3O7WA 5GIPE 3KQQA 4GC9A 2PJDA 1XCJA 1JTFA 2OKCA 1R8XA 3LX6A 1X1AA 1RJEA 2OZVA 3KQWA 3GNLA 5K0EA 3AWIA 1XXLA 4ER7A 4EQZA 1NW3A 4HG2A 1VP9A 3QOXA 2FPOA 2GAFA 3KKZA 2OY0A 5ERGB 5ICGA 5FUBA 1BHJA 3TM4A 3GJYA 4GOLD 1RI1A 3FPGA 4DZRA 2ZWVA 3PLAE 4YV1A 3T7TA 3CVOA 3M33A 4GOOD 1Q0SA 3KQMA 4KWCA 3FTEA 1JG2A 2EG5A 3OFJA 1JG1A 1MHTA 3V8VA 5CCBA 3KQTA 3I64A 3FPFA 4RTRA 1KYWA 5K8VA 1ZGAA 1INLA 2ORED 2ZIGA 3EVBA 3P9NA 5EHIA 3TPZA 1EG2A 5EMJA 5K03A 5GIOE 2C7PA 2PV0A 3HVIA 1YB2A 3O4FA 3R6TA 3I53A 4IWNA 4DCMA 3BXOA 5DPMA 2HV9A 1NV9A 1P39A 3T7RA 1VPTA 4BLUA 1UFKA 1XDSA 3OE4A 1SQFA 4CTJA 3FPJA 3NWEA 4PYOA 1Q0TA 3JWHA 3KQPA 3EVGA 4C07A 5F2NA 5EEHA 2UYHA 4PYNA 2OYRA 4YUYA 2XYVA 3DP7A 4CWAA 3B3GA 2UYQA 2YUIA 3KR9A 1XDUA 3FUTA 4RTPA 3JWGA 3QV2A 4OQDA 4KRGA 3UZUA 1UWVA 4HGZA 2AOUB 2ESRA 4QVKA 3SM3A 2AS0A 3LDFA 2IDJA 3DXYA 3KPJA 2HWKA 4GEKA 5HIIA 3EMDA 4KDCA 4PGHA 4V0QA 4DM3A 5FULA 3GWZA 3HA3A 3G5TA 2PX5A 1RI5A 2YXLA 4FS8A 5C0OE 1DCTA 1G8SA 3THSA 4BLWA 2ERCA 2Q41A 3MHTA 2VDVE 2ZZKA 4X41A 3PS9A 3E8SA 2K4MA 5FTWA 3DR5A 5DX0A 5EG5A 5GWXA 2PVCA 2H00A 1KR5A 2O07A 4PYQA 2ZFUA 1SKMA 3AY0A 2IPXA 4GUAA 3UJBA 1KP9A 5FADA 3OZTA 3UFBA 3LHDA 3LSTA 2AOVA 1N2XA 3HCDA 1VQ1A 3P2KA 1BC5A 3QOWA 4P7JA 2NXJA 4HTFB 5KS2A 3KQOA 3A27A 5DX1A 4QTTB 4HH4A 3UJAA 5BW5A 2PKWA 1VIDA 3GXOA 2AOWA 3MGGA 5JR3A 4H0NA 3C0KA 4RTKA 4RTLA 2BM8A 2JJQA 4P58A 1NBHA 3CCFA 3ME5A 3M6UA 4E2ZA 5T64A 3SSMA 3AJDA 2G1PA 5EKXA 2DPMA 1KIAA 4POOA 2BZGA 3KU1A 5T67A 5HIKA 2AN4A 1VBFA 4PNEA 2O57A 4E2XA 4QQKA 5E9QA 2EFJA 1NW7A 2ZBPA 3JWIA 3KQVA 5K0BA 5U4XA 2AVDA 3R0QA 1SUIA 3H2BA 8MHTA 3ER9A 2V7EA 4C05A 4RTOA 1NT2A 3UJDA 5E2AA 5C9ZA 7MHTA 1WXWA 4OBWA 3AXSA 1YF3A 2FHPA 3LBYA 5ICCA 3CKKA 1TW3A 1VL5A 1RI3A 1UIRA 2V74B 1YFJA 5K09A 3DMHA 1RJFA 4QDJA 3MB5A 5E9JA 4RWZA 3OU2A 3TKAA 4WXHA 3ELUA 2Z6AA 4M36A 1WY7A 2XYRA 3FTDA 3LBFA 4RVFA 5DXAA 2IGTA 1XJ5A 2GS9A 1VLMA 2IDKA 3MERA 2XVAA 4RTNA 3EMBA 1DUSA 3CJRA 2P3QA 2VZ9A 1V39A 3OE5A 4ZTBA 5T6BA 3R24A 1VP3A 1WZNA 3HP7A 1RI2A 3OCJA 3G88A 4OA8A 1L3IA 5CVUA 3NVKI 2GPYA 5K0JA 5FQNA 3I58A 3MQ2A 5DM4A 2AOTA 3TKYA 3OFKA 4BLVA 4CKEA 3FYDA 3NMUF 5DTMA 4E32A 4AZTA 1G6Q1 3OZSA 4E70A 4HRAA 2ONZA 5B1SA 1FJXA 4GOMD 3G2PA 3DLIA 3LCUA 4C08A 3NTVA 5ICEA 5CCXA 2NXNA 2PT6A 3G2OA 3E23A 4X63A 3OU7A 4R8RA 3SVZA 2B9EA 3A25A 3CBGA 3LGAA 3G89A 1SG9A 3DULA 3P8ZA 1QZZA 4C04A 1SUSA 4XCXA 1IM8A 3GRVA 2G70A 3DLCA 3EEYA 5CVJA 3IYLW 4PYMA 5LSAA 1P1BA 1NKVA 3HVJA 2P8JA 4L7VA 4RVGA 5E8JA 3S68A 3A7DA 4FT2A 1M6EX 2UYOA 5KVAA 2NNWB 4R6WA 4DA4A 2PWPA 2P1DA 5CUQA 3LECA 2AVNA 5D1HA 4YUVA 4E31A 3EVZA 3FTFA 2N47A 2NXCA 1FPQA 2JH8A 2JG3A 5DWQA 3SX0A 3V97A 2PY6A 3BGIA 3M70A 3P2EA 4PYKA 2QRVB 2ZIEA 3DOUA 1HNNA 1D2CA 1YZHA 4GF5A 4YUWA 1ZHFA 2FRXA 4QDKA 5BP7A 1AQIA 1PRYA 3G2QA 3ER8A 3THRA 4A6DA 4OX9Y 1JG3A 2GA9A 5GOZA 2HTEA 3P9IA 1WXXA 3P9KA 4RV9A 3PX3A 2ZCJA 3FUUA 2O06A 3MTIA 5H02A 4CKCA 5HOQA 1YFLA 1ZKDA 5F2KA 4DKJA 5DX8A 2QYOA 1NV8A 1XTPA 2FYTA 1YZ3A 4M37A 5HIJA 2ZW9A 2I6GA 1JG4A 2AOXA 2NP6A 3BWBA 4MHTA 2XBMA 1L9KA 1X19A 4PIPA 5MHTA 1O9GA 3BWYA 5KQRA 2B3TA 3EVCA 4KVZA 5E1DA 3B3JA 3UJ6A 4EKIA 3UJCA 2YR0A 3EEOA 4F84A 4PCLA 3BUSA 5FCDA 1DL5A 1I4WA 1HMYA 1SVUA 3P97A 5D1NA 3GU3A 4RTQA 2B25A 3TLJA 5K01A 2HR1A 2AN3A 2A14A 4FR0A 4GQBA 3PTAA 2WA2A 3GDHA 4RYLA 1NW5A 3LKDA 3UWPA 3VC2A 1R18A 3GRUA 3OPNA 3JWJA 4JXJA 5GM2A 3FRIA 3EVDA 2GH1A 1F38A 1T43A 1PJZA 3G7UA 2EX4A 3FPEA 4PINA 1JQ3A 3BT7A 3U81A 1SQGA 2FK8A 4OQEA 2P41A 3KQSA 4YUZA 4AZVA 4BP3A 1XCLA 2G8NA 3CC8A 4CKBA 5DSTA 3HA5A 3BWCA 1QAMA 4FZVA 4R05A 5DM0A 5E1OA 3SR4A 3WSTA 1QYRA 2NXEA 2AR0A 1EJ6A 3C3YA 3GRZA 1L3CA 3LDGA 3L8DA 3EGIA 1JSZA 1AF7A 3NVMB 2G71A 4KIFA 5E1BA 4ER0A 3NW9A 1QAOA 4KDRA 10MHA 5EEGA 1M6YA 2CMGA 2PXCA 3A7EA 3DMFA 2BM9A 1P1CA 3NWBA 5EOVA 5HFJA 2OBFA 3BGVA 2ZULA 4DMGA 3KPVA 3BKWA 5KYGA 4R8SA 3P2IA 3HCCA 5EQJB 3FPHA 3GIWA 1ORIA 1R6AA 3FUXA 3BZBA 4DQ0A 1ZGJA 5HEKA 3B7PA 3ID6C 2PT9A 4A6EA 3MCTA 2EJTA 5C1IA 4QTUB 1Y8CA 4YV0A 1YUBA 4FT4A 2IH5A 1KYZA 4IKPA 4ER3A 2AZTA 2OO3A 5K0GA 1FP1D 1N7JA 3HA7A 5K0NA 3G2MA 1EAMA 4MWZA 4UOEA 5FWAA 2P3LA 3Q87B 3DUWA 5CVVA 5DXJA 5EPEA 5EMLA 3EGVA 3M6XA 3BGDA 2CL5A 4LG1A 5CVDA 1RJDA 2AOUA 1NE2A 3TQSA 4X60A 1R00A 5ICFA 4CTKA 4HC4A 2I62A 2C7OA 3OZRA 2NYUA 2ZTHA 2JHAA 4FGZA 4HSGA 4LECA 4PONA 5FWDA 2IBTA 1ZG3A 3FTCA 3LCVB 5FA5A 2EJUA 2XVMA 3CJTA 2C7RA 2I9KA 1F3LA 5IH3A 5EMMA 3GRRA 4KW7A 1QANA 3TFWA 3T7SA 5F2OA 4BY9E 2HMYB 3Q7EA 4E33A 3NDJA 1IY9A 5EIFA 2UYCA 4FP9A 2CWWA 5K0CA 4YUXA 1U2ZA 1XDZA 2JHPA 3SSNA 5CD1A 3UA4A 3R3HA 3SXJA 5IKMA 1M0EA 4K6MA 2CMHA 3PX2A 4PGGA 4RVDA 4Y2HA 5G02A 5FA8A 2B78A 3KQYA 3IV6A 5DRTA 4YV2A 2GLUA 3HCEA 4O29A 4LWPA 5DM1A 5HILA 5EIWA 3R9XB 2FK7A 1QAQA 2YXEA 2ZWAA 2HNKA 4RTJA 3DXZA 5E8RA 4LWOA
chains in the Genus database with same CATH superfamily
1UT5A 4TXNA 4ZHQB 1OSNA 1ZR4A 3GFVA 2J6HA 4MMZB 2JCYA 4WNAA 3OD5A 2YVQA 4FONA 1Y63A 2P67A 4GD3Q 4TXLA 4ZZIA 4G65A 4H15A 5JSZB 1WEHA 1O95A 1DVRA 2H0RA 3IHTA 5HBRA 2FG6C 3H5TA 4E4TA 2WHQA 2X77A 3P27A 4YRDA 2JI4A 1NVEA 1XJCA 2HMVA 2ORIA 2UZ1A 2XKAA 4HNQA 4GOND 4BMZA 4JLWA 1ADFA 1QUEA 1RLJA 2ZZNA 2I4NA 1F0PA 1VL8A 1MX3A 1R0LA 4BB5A 1T24A 1Z8DA 3FSJX 2XVXA 5CDYA 3F90A 2GARA 2X14A 1VHJA 3W1WA 1ID8A 4A8TA 4TTAA 4IDOA 2VP5A 3UBTA 2WK1A 2CHQA 4GU5A 1SUBA 1P0CA 2A7QA 3IT0A 3JQFC 4GMDA 5CTJA 4OHZA 2W4MA 4RJKA 1XWWA 5GM1A 1R9MA 2A30A 3PRJA 4TQUS 3WYFA 3U39A 4CLOA 1EQAA 5AVZA 1TU0A 2VRNA 2WSLA 1AUOA 4IDGA 4S1OA 2NUAB 1AV6A 2PE5A 1R74A 5JSUA 4NICA 2VJNA 2BSAA 3N86A 3PNQA 2QUZA 4MKHA 2W43A 3ICQB 2ZU6A 2ERXA 4UUQA 5E6RB 5K3EA 2XHEA 1P2TA 4P4NA 1N1EA 1NGSA 1H1LB 1U7HA 3VR5D 5I3ZA 4QQFA 2EHJA 2QZJA 4LRSB 1EX7A 2Y92A 4ZI2A 1NJ6A 2HF9A 5FNZA 1D8TA 1XU7A 4GIBA 2D2IA 4R40A 4MV6A 4RMIA 2JVIA 4RS4A 3ND6A 5KYUA 4AMZA 2CKMA 5HJ5A 1EFCA 1QGDA 2BGUA 1FFXB 2X9VA 1KFJB 1JEOA 1J49A 1R4MA 2D62A 2EFYA 5GINE 1R0XA 3K9LA 2Q9CA 1MT3A 3LV8A 1JSXA 4ENPA 2IE0A 3BSSA 4OL0A 2QXTA 3EB9A 4GPTA 4II3A 5JPIA 2VXYA 5I7EA 1T5OA 2FFHA 1VE6A 3UUGA 4UFNA 1Y1RA 3COVA 4L72A 3TTYA 1JSRA 2ZSIA 2XUGA 2XB6A 4DAEA 4GG1A 1O4WA 5LQJA 3RYHA 2FUG1 2QK4A 2Q3EA 1AV7A 2FCAA 2IEAA 2X8JB 4G3XA 4WBNF 3EZNA 1SHKA 3D4LA 2H5JA 4YCSA 3DWEX 3H6GA 3JZDA 2JIDA 3DFKA 3O26A 4J2OA 2BGJA 3VOTA 3WP1B 3R5TA 5ADUS 2FR1A 2C2WA 1O58A 4K9DA 2YXDA 2PBFA 4MICA 3HK2A 1EMDA 3NXKA 3BWVA 1USGA 4DWWA 3CSDA 1Z7WA 3K6KA 4B2YA 2IW1A 1A3CA 2QAIA 3I9MA 1VG8A 3BORA 3QE3A 4H4EA 1L5RA 2G4CA 3FCEA 4HEJA 1FP2A 3WBJA 1B23P 4EBFA 4RF4A 2REBA 2R6ZA 4H31A 5KDLA 3QIAA 1U9IA 1ISIA 5EJ6A 2WQ7A 3MC1A 4OI0A 1CLUA 2OECA 3GLGB 4AC9A 4QVGA 4PYLA 2ID8A 1G8AA 5SV2A 2EZ8A 1Z5UA 2FX3A 3FSRA 5BSGA 3BHJA 1NQUA 1RJ9A 2BH2A 4HAXA 3LUPA 2BAGA 2W48A 4RADA 4P3OA 2I4MA 1QIFA 4GL4A 1GA6A 1IDOA 5I7UA 3CWCA 1WW3A 1OAOA 4FYMA 2P6PA 4XUDA 1KY3A 4RJJA 2A1TS 3KB1A 4NWIA 2WIAA 3A4TA 1V3QE 2O7NA 1V4BA 3INYA 3KSRA 5GMOA 4ERXA 4V0MA 1RADA 5LYJB 2REQA 2FH5B 4RTSA 2GM9A 4H35A 4YQZA 3L8YA 2Z5GA 2B4KA 1M6VA 4K6CA 2VDUE 3S99A 1I32A 2EKBA 1TTPB 4CDRA 1RM4A 3PNOA 3AZPA 4R6XA 4GI3A 3OF5A 5HFAA 1MO6A 2BR5A 4OQYA 4D8UA 1XKQA 1N78A 3U40A 4O2BA 1Z12A 1ZLYA 1K88A 2RH5A 4H6WA 2ES4A 4KN5A 4ZVTA 3HWX1 1BX3A 4X8HA 1RRMA 3QVSA 1H5UA 4DLNA 5C46F 4OHUA 1ZI8A 2F62A 5CIQA 3DOHA 1VIMA 4JYMA 4IH9A 2W93A 1CJVC 1A27A 1HF3A 4WKBA 5KNCH 2W00A 2JBAB 2QVZX 3LPLA 1IN4A 2W7TA 4YAEA 2XYQA 4HZIA 2QMHA 1M2VB 1TM1E 3FM9A 2P9TA 3ROEA 2RK4A 3UC5A 1S2IA 4IXDA 1EUDB 3D31A 3QXSA 1DJOA 2VK2A 4H7EA 1QMGA 4G5QA 3DQZA 2BFFB 2VQSA 1RC1A 1UKEA 4CF4A 1OOEA 4A03A 1U0BB 4G8CA 4CEHA 3ASVA 4FCWA 4JOQA 4OSPA 2X8BA 3A1FA 2FZ5A 4WA8A 2PUEA 1KO4A 1CW2B 5BQ3A 2QIPA 1FJ2A 1LV7A 1RU3A 2IYVA 3L0PA 3DS8A 1UR5A 2RD2A 3L0IB 2UZ3A 3OEHD 4KWCA 4W9NA 4X84A 1TYEB 4NE2A 1NVBA 5EQDA 4ALNA 2I2DA 4ALJA 2E4UA 2WHYA 2GCPA 3ZVMA 4G0UA 3N8HA 5EPUA 1YC2A 4DMKA 2VQFB 4B7CA 2EYQA 1HORA 4J0GA 1OLOA 4PCVA 1PR4A 2OD2A 3T7RA 4W63A 3QKIA 2Q7OE 1GT91 2WOJA 3I32A 2VATA 3FPJA 6AT1A 4IIGA 1J2JA 1BX0A 2IHJA 3KQPA 1T1EA 4YT5A 1ZDMA 4AF8A 1K7CA 2J5BA 1P1RA 2FG7C 2PO5A 5DYTA 3HMKA 2KBEA 3NHZA 1ML3A 2QSJA 4N5HX 4KRGA 4UTVA 1GRQA 2H57A 2ZBDA 2ESRA 2AZXA 1OKKA 2OBXA 1FFSA 1QG6A 4DG9A 1Q84A 1CZLA 2FR8C 4V0QA 5L7TA 3K0EA 4DDWA 4MR7A 5CLJA 4X5OA 1RI5A 3LK6A 3O47A 4L57A 4P8RA 3TX6A 3L7IA 3FZQA 4IQ0A 1IPHA 2VP9A 4PSUA 3BIFA 1E2NA 3ZJ5A 1USWA 2K4MA 4EBBA 1EK0A 1NVVR 3EZFA 4L6IA 4MLZA 4DSOA 2D2EA 3SJUA 4HUTA 3HJFA 4A2QA 4IIJA 4AWXA 4HH3C 3KOYA 4G5XA 5TF0A 3UAGA 2WUEA 4B3MB 4AB1A 3NNSA 2EARA 2JGNA 1Z6YA 3LHDA 5KSOA 2AOVA 2BCJQ 5IRCD 4D4LA 1G5TA 2JHFA 2VSFA 5JW6A 5KS2A 5K99A 3FLBA 3IEMA 1IM5A 1O4VA 4HH4A 1OTXA 4J7UA 4RY2A 2QJFA 4CI0B 1I0IA 1NNLA 3F46A 1SKUA 1V7ZA 2QMUA 4DR7B 2BSQA 3QU4A 3VKFA 4B6GA 4NPAA 1ATIA 3DHVA 2ZJZA 4LKRA 2RIRA 3MJRA 3TGLA 1GLVA 3GGJA 3MJ4A 1QXSA 1GU0A 1BXGA 3FH0A 1E3EA 1PS0A 1C7ZA 2P4QA 3K4QA 1V1MA 3C6ZA 3E58A 1G5PA 1J06A 1UBMS 2R44A 3KU1A 3UAVA 1H2AS 3MOGA 1NW7A 2BRUA 5AK0A 3GJQA 1OWMA 1KJQA 4UKDA 4YUAA 1JXQA 2EZ4A 1CIJA 1N9KA 2XYGA 1DOHA 2DU8A 3PLRA 2WYWA 3RJ9A 4RTOA 4QPZA 1M34E 4NMMA 1M5RA 1IY8A 1JDSA 3RTEA 4PG6A 3L7MA 2VF8A 5ICCA 1NOIA 2EGUA 3OQOA 3ZJTA 2RJNA 4PLFA 4LBWA 1KJIA 3CR8A 2OORA 1KEVA 4OATA 2JEYA 5FEMA 4FYWA 4UUMA 2X0RA 2EKPA 2HA3A 2AI2A 2ZE8A 1BA3A 1NF8A 1I2BA 4FBGA 5LC1A 4GBJA 3ZHQA 4DIBA 5C8DA 1U28C 1AN0A 2CEKA 4CHTA 4H1UA 5LQDA 3GP5A 3UV6A 1XJ5A 1NXQA 2PBZA 3K6SA 2Q4EA 2RGUA 2WD7A 1EM8B 1VLMA 3PJGA 4RK0A 1GAEO 3V2UA 1L5ZA 1ISGA 1SU8A 2RHRA 1D6JA 3E48A 2P3QA 1YCFA 1MU0A 3QA3E 4KJZA 1K7XB 4LOHA 1D9ZA 1K97A 4M0UA 4P08A 4PAOA 4NK5A 2GYVA 3L7KA 5DBIA 4AIRA 2B5WA 1FYDA 4BZZA 1TUBB 1JAYA 3TKYA 4QRDA 1COZA 2VK1A 3NCHA 4CU2A 1YR6A 1YOVB 2AFRA 3ENNA 5CX4A 5C3UA 3FVWA 3L4KA 2EKDA 2OO5C 3KNZA 2FZ4A 3N76A 5FBQB 1G21E 1TM7E 4N5IX 1I0ZA 4PO8A 3UXEA 3ESRA 1W93A 3GRCA 5CFPA 1GQOA 5HBGA 3AB3A 3SJBA 3DLIA 3LCUA 2W2XA 3MTGA 1MEOA 1OV6A 4D26A 3ABZA 2R7AA 1PL6A 2WAYA 4N0EA 4OF4A 2XE7A 4X63A 4WBNB 3LVFO 1IB6A 1QLHA 4D9NA 2ZDGA 3DAYA 3T5DA 3W2GA 2Q2QA 3WWPA 4O8ZA 1UCFA 4BNIA 5AVTA 4HOYA 4L0MA 5KX5F 3IYLW 1KH3A 121PA 5CA0A 1MX5A 2ECQA 2W6QA 3USZA 2P8JA 2QN1A 4RVGA 4URHA 4PX2A 5EA2A 4YP0A 1SIUA 2H9AA 1U0HC 4K2HA 5DASA 1C30A 4BWFB 1FA9A 2PWPA 3MTQA 4YRCA 5LXTF 4BNNA 5D1HA 3JR3A 1AHHA 4XD7A 3LHFA 3CBQA 5FBZA 3WJ2A 1Q7BA 2A0WA 4B3XA 4EYGA 2C5SA 5DWQA 4TLMB 1KY4A 4JI3B 4JJEA 5DBFA 1MKYA 1U0FA 4ETWA 5AUPB 1UADA 1EX1A 1M1NB 2Q49A 1HT2E 4Q4CA 2E1RA 3T5PA 2PMFA 1K92A 2NVBA 4IY1A 4OIMA 3FGZA 2IV2X 4BFXA 2HTEA 1EB8A 4TYWA 1QGOA 1QGUB 4JKIA 4K9SA 5H02A 4UQOA 4B4WA 1PK7A 3PTLA 1YFLA 4ZDKA 5IK2D 5JAQA 1OXTA 1TLLA 1W85A 3O4GA 3NVDA 5DK4A 3TLAA 1YJ5A 3RCBA 2NPIA 1EXVA 2ZT5A 4K6FA 3KXPA 3D8UA 4LJSA 4QEKA 3AR7A 3I04A 4CV1A 2VPXA 4D4GA 4RFLA 3NEAA 4WNCA 4ZQIA 3C6XA 2GWRA 5AJZA 2IXGA 1AVTA 3ZLBA 3WRXA 1G20B 1EBFA 1QHHB 4I4NA 2GJAA 3KAKA 1APBA 4GZ3A 3TLJA 4CT0A 2VWPA 4JR2A 4K9RA 4I1YA 1YR1A 4PZDA 4ASUA 2BM0A 4AW9A 1IJBA 4Y0NA 1BO6A 2ZUSA 4YT4A 1LC0A 4N8DA 1IEWA 3V80A 2BBTA 3FLAA 4KGZA 3QWIA 3R9XA 5EZ5A 3TE7A 1Z9BA 5KWVA 1PDVA 3OM1A 3CUTA 4P3KA 4LE0A 1KKUA 1G41A 3CRNA 2IEYA 1CJUC 5J40A 4LJLA 1Y8QB 1NRXA 1KFEB 2GEUA 1SR8A 5DHSA 1T4CB 2GFQA 1HLDA 4AYTA 1QAMA 4R05A 1CS4C 1VL6A 1C1XB 4FYYA 2PMKA 3FAZA 4GWKA 3WSTA 4I1RA 4WY5A 4C14A 1CUSA 1XN1A 3MCUA 4IZOA 4ZICA 2WVAA 4QKQA 2BFCB 2DB3A 4HGNA 1E2FA 1PL8A 1RC0A 5HP4A 3HCPA 2BFWA 3WP0A 4CIXA 2VK8A 3MGKA 4ARIA 10MHA 1L7AA 5M2QA 1M6YA 2PXCA 4HRVA 5CBKA 2DOKA 4HDSB 4WOKA 5K0SA 4R69A 4JWTA 5HFJA 4RETA 3VR1A 4UVGA 3WRYA 2QLNA 5H82A 2Q6TA 3EBLA 3KUKA 1DV1A 2AUMA 5TY0A 3HCCA 4RVUA 2HF7A 3OLQA 1MQ8B 1C3OA 2E49A 5IDYA 1KBZA 3PDHA 3WLFA 2O8DA 4Y2QA 1N92A 2IU3A 3MCTA 2XADA 3P26A 4FT4A 1XAIA 4NFHA 5FOUA 5JHGB 4HQKA 3G02A 1W30A 5ALZA 4M99A 3VPDA 3TLMA 2C0PA 3L7AA 4HEHA 1WDMA 1JALA 1QORA 4UDNA 1KRWA 2YQ5A 3V6MA 1WV0A 4LF5B 3IS3A 4UTPA 3KQUA 1ZS9A 3KUUA 1XUOA 3VAAA 3RVPA 1TIKA 5IVPA 4D5GA 2GTHA 2O2DA 3N7TA 2QN9A 1ZWKA 4RZSA 4TT3A 2XZOA 3QI2A 3LFUA 1KEWA 1YQWA 1F12A 1IM2A 3FTCA 3TZEA 5JNWA 4DTIA 2B92A 3HDGA 3T9EA 2Z5VA 4XKJA 2QDXA 2C5FA 4R1PA 2X9LA 3OTIA 5KJ6A 2XMZA 3VYUB 1HFEL 1GD1O 2IZ1A 3KM0A 3ZBTA 3GLIB 1ADBA 1DE0A 2JFYA 5IARA 4E33A 5ALOA 2CZQA 1JKJA 1PFVA 2QGZA 4FP9A 4RKYA 1U2PA 1G5QA 2RHWA 2NOAA 2DH6A 3G85A 2GZHA 3SSNA 3UGKA 3W6PA 5G3YA 3AJ9A 3UA4A 1IZ8A 5IBRA 1UWKA 2GBPA 2ZPTX 1HTBA 3RNLA 1K75A 5DGCA 2P9FA 1U4SA 1OIVA 1LI5A 3AF4A 3AKCA 4ZAGA 2IEIA 2I33A 4ZMBA 4O1IA 4YT8A 3O8QB 1O94D 4LWOA 1TRKA 4D8WA 1ST3A 1CNMA 1VE3A 2F17A 3D02A 1HZZC 1R27A 5AKGA 4QJBA 1JKFA 1DQPA 2P2GA 3OLXA 4YJ2F 1EU1A 5K6AC 2QPTA 4V1CI 2P11A 2GT1A 1DAKA 1I9GA 4NSNA 4HYQA 4PSAA 3IBSA 3KTDA 4WVFA 3COJA 1H6DA 3C7TA 4HUQB 2E55A 3CX6A 4D42A 3QEBZ 1MTZA 1FX0A 2RGRA 2MYTA 5LP1A 3QLEA 2O3JA 1XTBA 4NBKA 3RTAA 3UOWA 5BN3B 3H11A 1ML4A 3N58A 3IMKA 4RGVA 2Y1FA 4V0SA 5GAJA 2NV2B 4YA6A 2BEWB 3WGVA 4QTYA 3NJRA 5D3KA 3Q41A 3ZQJA 4BXOA 3OQNA 2F9MA 2MYPA 4I4TA 1X7YB 1YVEI 3EZ9A 4B3HA 5KNLA 2ONJA 4G56A 3VTZA 2PMWB 3Q12A 5EE0A 2X9GA 4QGHA 4J0HA 3VH1A 1OWNA 3CNNA 4F8JA 2HLNA 1TYBE 3Q5EA 3BFPA 4M1WA 1I2ZA 1EK6A 4MINA 4EPTA 5JS6A 3ZZMA 3V33A 4HS4A 4R5HA 3SXUA 1P2GA 1V6AA 2F3SA 2DHQA 3CLUD 3LG2A 3I61A 2V7QA 1KP2A 3R76A 1QJCA 1NDUA 1M66A 2ZRNA 1ADJA 3E2IA 4AN1A 4F4UA 5KO2A 4EHIA 4MW7A 3OE7A 3CT6A 3JYNA 4P7GA 3SHQA 3PGKA 2WTXA 4HZUB 3AJRA 3PFHA 2VHUA 3GN1A 1OFUX 3ONVA 3EG9B 2WWFA 1KZ6A 5E6SA 4EEZA 3E9CA 3IOEA 3VTKA 3DL7A 2Y67A 4WZBB 2WUGA 2VT6A 3DQQA 1CYDA 4EHNA 2CK3D 3AEKA 2C82A 1UEIA 4AN0A 1G1MA 1KVTA 1M0SA 3C16C 3MN1A 3SIWA 4CMEC 1N32B 2O2ZA 4EB6A 1KEEB 3ZVLA 2C77A 1QH1A 2H1WA 4WESB 3WGOA 1A1VA 3ZR4B 1U2RA 3MRVA 1G60A 1EGHA 1CRLA 2AQKA 4NENB 5HE9A 1K9SA 4AJEA 4QFCA 4BIMA 1Y1SA 2VT2A 4FWIB 1X1BA 2P1ZA 1NONA 2XQIA 4MGZR 5MGBA 3L8HA 1IZ9A 1SBIA 4G0XA 5GONF 1T91A 2QM3A 2VUTA 3ASZA 3RIEA 2JRCA 3L6RA 4RVOA 1W5EA 2W2MA 3MWDB 4ZWNA 4GVLA 1ULSA 2EJBA 3LDUA 5KBYA 2QTWB 3HKCB 3SLRA 2R6AA 2QRVA 3FDZB 2WIDA 3U7QB 3ZW8A 3H2KA 1G6KA 1SBCA 3H1GA 2FFAA 4L8YA 5J5AA 5HZMA 1P2VA 1X1CA 3BKXA 4JODA 4EJSA 4YMHA 3V8QA 1PGPA 3HY4A 4LMRA 3L0YA 3WISA 1FDSA 4WQMA 2HSGA 4QPDA 3QA9A 4AG6A 2JJYA 2CJYA 5AKLA 1VFPA 4MWDA 4YO8A 2A5LA 5SYNA 5I8ZA 2Q6LA 1JR4A 2ZXEA 3C3AA 3ES9A 1QX3A 1GL9B 3ZIDA 2C9CA 3AINA 4P9NA 1VJ1A 4JIGA 4L0CA 1Z62A 3SEZA 3X1JA 1U9CA 2H4FA 5HKAA 5G40A 2ZQZA 4L8FA 4I36A 2CHEA 1PHPA 3DKVA 4PPNA 5CK4A 1WXGA 1H6AA 5F4ZA 2P7HA 3FZGA 1YBMA 5JY6A 3DBRB 1PQUA 1GU7A 2A1UB 5KYYB 4I14A 2PTHA 1E6CA 3GEBA 3QYJA 4G2TA 4ZVNA 3QVTA 5CDGA 2UUPA 4Q1VA 1SCQA 2OZKA 1CC1S 1CIVA 4M1MA 3ZHUA 5E4YA 2E21A 2FV8A 3UVEA 3OPYI 3C1AA 3IQEA 4JXZA 4WW0A 5LQNA 4B7XA 4Q4AB 1P1KA 4QXOA 1FY2A 1RRGA 4R9UC 4WNIA 2PWYA 3UB3A 2G1JA 2I4LA 1B41A 4G0QA 4M7PA 2XQKA 2BIFA 3VNQA 1UAAA 2GXUA 2G9ZA 2YVKA 3USES 3W6NA 5JVDF 4MVJA 1QNLA 1KOLA 1SA0A 4MWCA 1QZTA 2J08A 2PJDA 3SBXA 1MHPA 1Z36A 4AWBA 2PUGA 2QM7A 1G2OA 2VDLB 4DCCA 1WQ1R 3QU7A 2LDBA 2AR9A 2OKCA 3OZGA 4IVRA 4R68A 4RDIA 3SOZA 5FBVB 2HN9A 5LZ8A 4RLFA 2LWIA 3DDSA 4YFVA 1V2HE 4E14A 3CW9A 2NAPA 4LY6A 5DNYB 3FPGA 3ICOA 3TINA 1W35A 4TZTA 4HK4A 2ZQYA 3IBCA 4H3VA 1X6VA 2GFIA 5ABPA 3I64A 5EY5B 3QVXA 1UDBA 4C4RA 5HFNA 4BRUA 2C4VA 2C94A 2PGIA 2WVHA 4NHOA 1GGHA 1T3GA 3OEYA 1CUZA 1DC7A 1L7XA 3NKFA 4UREA 5EMJA 1ODCA 1GTMA 4U8HA 2YYYA 2M6RA 4XFJA 1O89A 3LKBA 2AJCA 3P9PA 1GAQA 4P2GA 1LI4A 3GEPA 2DJ5A 2GFHA 1BKDR 2V8OA 4LUCA 1P39A 2XKJE 3KSUA 4MRVA 5IP5A 2CV2A 1V7QA 2X1LA 3OUUA 4RDHA 2PVSA 4O25A 4IV5A 1LW7A 1HBJA 5DEOA 2D1SA 3U3KA 3KR9A 3Q9NA 3WNCA 2IYTA 3EPJA 3A9TA 4YDQA 1OW3B 4AD8A 1Z38A 3UHFA 2GZ3A 2IUYA 3CTMA 4V0LA 5DNAA 2JFXA 1NBWB 1V43A 5FKJA 1X1TA 1OC4A 4KI0A 5TGZA 4QVKA 1GTZA 1NUUA 1Z73A 3F3KA 3KYCA 5A7HA 4EY8A 2XCLA 3SBEA 5B30A 2H2AA 3IDZA 3L0BA 1PKEA 1YDFA 4HEQA 4K9OA 4YCDA 4UM9B 2PX5A 2XTJA 3A4YA 4XCVA 1VCHA 4N0MA 4D25A 1KBQA 1S2MA 4INAA 5HM6A 1R5OA 4ZAXA 5I48A 1U3DA 4MQFA 1S8AA 2C58A 4OM8A 4EUNA 1OU4A 1SVIA 5DX0A 2F55A 3DFMA 3OOJA 4KH0A 3DMTC 1J24A 1Y6QA 2BMEA 3F3MA 1OPRA 1JKMA 1NQVA 1QFJA 1V16A 1WDKA 3F97A 1FFGA 4LZNA 4U9IS 1XXHE 4Q4LA 3RVLA 3K20A 5U9CA 5CDFA 2X2OA 4QLAA 4PGFA 3JVDA 4FKBA 5BSWA 1KP9A 3EQ9A 4RHCA 1TLFA 3HCDA 3ORYA 4W99A 3O9ZA 3K5WA 1GTJ1 3G8CA 3UT0A 1GCAA 3H5OA 4MKIA 1EFVA 1KYYA 4UTOA 4ZMSA 2VTBB 4QTTB 1NOKA 1UC9A 2IITA 1F6BA 3FAKA 3MGGA 3SJ7A 2Y3IA 4L4SA 4FGSA 4KU4A 4QJIA 4RHTA 4YJ2B 4TVOA 2BSXA 1UUFA 4IOJA 1G8FA 4GMFA 4YCLA 3I4LA 2WKRA 4LBZA 2OSBA 3DT6A 4TSKA 5JXJA 1LF0A 4AJOA 4YHBA 3PZBA 3W8NA 2YWFA 2W0MA 2YHBA 1C2YA 1G4UR 2BGRA 4L27A 2QTVA 1N0HA 2BTQA 3M49A 4KREA 5T67A 3VNBA 5D3MB 2UVQA 1N6OA 4A3SA 1TEZA 2O8CB 2ZBPA 1DCKA 3UG6A 4AYXA 1JDJA 4EFDA 4K6GA 3PNBA 4N7RA 1DRUA 1ZSNA 5KQLA 1SUIA 4ZCMA 1YQXA 1J8MF 3NFYA 3VPAA 1KVUA 2UXDB 4CM4B 2IHZA 4PZPA 1WXWA 2EL9A 1USIA 3U3JA 3GLIA 2Z8YM 2XDQB 4WMLA 1VGRA 3ZUGA 3KZOA 2XNCA 5G41A 5JDCA 5JQWA 2F1JA 3F7MA 2FW7A 1LX7A 5LNK1 5THQA 2PJRA 2C9OA 2IZ0A 1BQEA 5LZ7A 2F8MA 3UCXA 3HXOA 4ZU1X 3BD7A 2JJ1D 1Z2AA 4R1NA 4WXHA 2PGJA 3W5IA 1XKTA 3DZHA 3IEVA 1ZD4A 1K8XB 1OI7A 3TZKA 1RKUA 1HGXA 4QUBA 1SOVA 2IDKA 4MUFA 3MERA 5E7IA 5FOWA 3RIHA 4UQLA 2F3PA 3L84A 1O6FA 2FWJA 3K7EA 4KE6A 4UCXA 1ZVKA 2Q4RA 4TV9A 4DIEA 4FU0A 5HIAA 4C78A 4RKFA 3UWKA 3RAPR 1B3RA 4BQQA 2YYSA 4BO0A 3JVVA 4U2DA 5JWHA 1XLTA 4JQCA 4MDHA 4GLBA 3RJZA 3UMRA 4Z2AA 3O4VA 2C3PA 4MI9A 4YRLA 1TADA 1JQLB 1QLWA 5LLDA 3S55A 3DVLA 2TSYB 3I9LA 3L8EA 3PPIA 1Z7EA 1X7XA 2NVOA 1G6HA 2IYOA 5DLQC 5ESXA 3WLKX 3JQAB 5CCXA 3JQ8A 3K09A 3PUKA 3UUFA 3RVDA 1E9FA 4JEIA 5DCYA 3LGAA 1UJNA 1U80A 1PQPA 2YOFA 2FPSA 3G89A 4MPPA 4AX4A 4ZDWA 3FOCA 3WY9A 2H8GA 3ODGA 5GONB 3MJDA 1MH9A 5CVJA 1CNFA 3K70D 1KDRA 2OXCA 1Z8NA 1P1BA 2O48X 2HKIA 2W98A 1YK1A 2GPBA 2VPWA 2P2DA 1VJRA 4RL4A 4K2AA 3W4JA 1N77A 3N8NA 3GUHA 4F12A 4W7HA 3ST7A 1I13A 2HU7A 2C4NA 5CG1A 4LDPA 3TR0A 2PIAA 4ZO7A 3FTFA 4YGXB 2DPXA 5CRIA 3RIMA 3V97A 1NL3A 2PY6A 2HZ7A 3BTVA 4WK0B 1XU9A 2OTCA 4F3TA 1CDEA 1U4NA 2HLDD 1X74A 2YMLA 1AN9A 3EJWA 4QDKA 1BDMA 5B53A 5F4BA 3ETCA 2AE2A 1WZUA 3DE2X 4HRYA 4EUKA 1S02A 1UPXA 1Z3IX 2MIIA 3PPXA 1KQFA 5EJFA 2BYTA 3TLCA 2GRJA 3GMDA 3LQ1A 5L8VA 2Q3JA 2X86A 4Y0VA 1T2AA 3RVNA 3FYUA 5BUCA 1VJGA 2KHZA 3KWLA 1UK8A 4G0OA 4Q16A 1ND6A 1RYBA 1W0CA 1CRQA 1EHCA 2JD2A 2HHLA 3FKJA 4JYCA 1L7RA 5GJBA 2C54A 4KACA 4XJSA 2YBEA 2YBDA 4LHYA 4JLVA 5CJJA 1C80A 3TZHA 4L2IA 3R9WA 2BEVA 3ENWA 1I2DA 3QBTA 2QY9A 4WXPA 3A37A 1BWRA 1O9GA 4AJJA 5KQRA 1OFHA 2ZRKA 3ILVA 4RULA 3FD8A 2F7SA 5HJ7A 1BE1A 5CEJA 4GM1A 1HRDA 4GRAA 1B2LA 3EXHA 5U4QA 3KT3A 4UPDA 3DE4X 3IO5A 5CJ2A 5LU8A 1QHNA 3SC2B 2CFCA 3KSBC 1QG0A 5ED4A 4CV2A 1OFVA 2ZUVA 3C5VA 2I8AA 1ONNA 5EN4A 4S0XA 2YQ4A 4QG7A 1BIFA 1BVRA 4U4AA 4DILA 3EFOB 1CX9B 3A3KA 3OPNA 4RM2A 2NO1A 5JVDB 3M4JA 4R8KA 2G7ZA 4MZXA 5LVAA 1EWYA 1F38A 1Z5GA 2FP4B 5KNDA 4FS3A 4WXEA 1JQ3A 5IJAA 2QP3A 1CD5A 1YNSA 3LWZA 4I5EA 4LSGA 5DNWA 4ASUD 4DBVO 1Z7YA 1KTIA 1JECA 2HSZA 4C29A 2W2OA 3ISVA 3ORFA 4LZZA 1KMCA 1VJTA 2X23A 1QO7A 3W9BA 3ZHXA 4X7BA 3PD1A 4IJUA 4NRDA 1ACLA 1RQPA 1V2GA 3L4BA 4B44A 4YRJA 1U0LA 2GILA 4J4HA 4HTAA 2QOEA 3HN6A 4KDRA 3GJ5A 5CK5A 3U49A 3UAOA 5CDSA 5D00A 4KK4A 3HABA 4UMFA 3DAHA 4XX1A 4B80A 2DUUA 5CVCA 4K3VA 1BWSA 4IDEA 2OBBA 4NV3A 2AEJA 5IKOA 3WBBA 1I6LA 2AI1A 2OGUA 3FA2A 5LNK6 3GP3A 4WN3A 4DOMA 1U5BA 2JBHA 3GFOA 4FDLA 2ZULA 3IPAA 2AQ8A 2P30A 2W11A 1TL7C 2ZRBA 4BFSA 5A3RA 4PXSA 4CCWA 3MT9A 4H27A 4MRNA 2NQ2C 1EVLA 2VDMB 1JIUA 3C4VA 2CDBA 4XOUA 1L7OA 4JJZA 4I9GA 1Y9DA 3ANSA 2OO3A 2RHTA 3O4IA 4ZVVA 5AKZA 3T3MB 5KNCD 3NJ8A 2BEUA 1OZ0A 4LOAA 5AFSA 3BRWD 1PJ4A 1NWCA 2R1TB 1D4FA 2O2IA 2JIOA 3HWWA 3IESA 4LNHA 4TX1A 1J99A 3PL5A 3EXG2 3ZZUA 1UMCB 3SYLA 4HB3A 2WILA 4GYJA 2BE7A 3K15A 1UAGA 2EFDB 1L4FA 2ZETA 2PKXA 4GECA 2CHGA 2O14A 4M1TA 4QASA 2RDMA 4YLYA 3H4MA 2IXEA 3PEFA 2NUBA 2TMGA 4HSEA 4GYKA 4PF1A 3T7DA 4Z54A 5LJLA 4JT4A 1WWKA 1YCGA 3RUDA 1X1SA 1QANA 4C4OA 4F9GA 4J0QA 4E13A 4KWHA 3VO2A 4HQRA 3B1VA 1QIMA 1VJ5A 3NQ41 3PXUA 4FCTA 4TWZA 3WFZA 3W5BA 4BY9E 4WKGA 2IOHA 1DJNA 4PS0A 3X1ZA 3NTLA 2FY8A 2A1TR 4LYFA 3DTVA 1PT8A 2XVYA 4RHYA 1H69A 2HNAA 4B8ZA 3U61B 4BFCA 3HCEA 3SS9X 5HQ3B 1GADO 5JISA 2GKSA 1XKXA 4TKLA 4MUXA 4B87A 3I6ZA 1OGIA 4L4UA 3Q2OA 4MYCA 1A8IA 1AG9A 5LMUB 1NAIA 5CFRA 1BJTA 2ID9A 3GZJA 4OUKX 1PP4A 2WVGA 2XUOA 4HBGA 4MS3A 4ZGBA 4KXMA 1P0PA 3WOVA 3IAXA 2V7UA 1N1GA 1T9BA 4QOSA 4B3FX 2R87A 4PPFA 3WNBA 3O73A 1HDXA 2HMTA 1ODSA 4YCMA 1BVHA 4IV8A 3JW8A 4KQCA 2HA6A 4FLMA 4MQ4A 5CLIA 2NUTB 2P90A 3GVXA 5AK3A 1IMJA 5J5CA 3MWEA 3UA3A 2I71A 3RK4A 2HWYA 3VR0A 5ITZB 4ETMA 5IT4A 4KHPB 4Z7JA 5IJ9A 2XE8A 5BXYA 2XWJI 4KIGA 5DSXA 1Y3CE 3BWEA 5JD3A 2GSWA 4AJ4A 1S4QA 1GP2A 1SMKA 4L8VA 3HM2A 2G67A 3COWA 3L46A 1XT6A 1HETA 1QFYA 2PZGA 3CNLA 5UKDA 3AKEA 4Q3AA 4UQPA 4LF4B 1WJGA 1N9GA 3IDFA 2ID4A 5EESA 2CV1A 2B61A 2BUBA 2KW5A 1A76A 2WSYB 4MO9A 5J23A 3HP4A 4JP3A 2CLDX 3DDOA 1I1HA 1SCNE 4UDXX 1H3NA 1SELA 4Y2PA 3VR2A 4DCPA 1LS6A 3VU3A 4NH0A 2LP4Y 3DOCA 4HGRA 3F49S 1DKPA 3JTEA 4NC9A 4ZT3A 3UGJA 1XPRA 2VP2A 5HSGA 1VPWA 3K0AA 3IOCA 2JK0A 3QJGA 2AG8A 1UBJS 4ZOAA 1RBZA 5C34B 4XYLA 1Y8RB 5EZQA 3IUMA 3H8SA 4LC9A 3DJFA 4AZ0B 2YXPX 2C4WA 1J07A 5DBEX 4A26A 4D9BA 2RAPA 1FRNA 2HFKA 2V65A 1GNPA 2LR0A 4YMWA 5TMEA 4AIIA 1NYLA 4D0GA 1D2NA 4AU1A 3PF8A 2GUGA 4Y1FA 1X94A 3EH2A 4C0LA 2GRUA 4A2PA 3JRWA 1FX1A 1V1RA 2VH1A 3FNFA 4AP5A 1NRWA 2PZJA 1R4NB 4QJ5A 1RQRA 5T41A 1HX7A 4PEVA 3B51X 3A6KA 3QPWA 2PFKA 3VR4A 2FOLA 1JSCA 4WZAE 3X1XA 4N6NA 4U1RA 3AUKA 4B5LA 3BWMA 3TQTA 1CJSA 4I7EA 4LNUB 4TMVA 4BZXA 1A9XB 3GFTA 4D8XA 2CLLB 3EPPA 2F43B 2PFSA 3CRZA 1BE0A 3DL0A 4LVNA 1KU0A 1KQNA 5KHLB 5B6PA 5MN6A 1K08A 5H8WA 4GBED 3LKZA 4UMDA 5DO9A 4AXBA 3K9CA 1FDRA 4JELA 3IHLA 3G8AA 1T6YA 3AHDA 3ZE9A 1L8XA 1EDOA 4Z4CA 4MCAA 3ZBUA 1B73A 1AQNA 1G16A 1IHOA 4JAVC 4IGIA 4MVJH 1QIJA 3UY4A 1VLQA 5BUSA 4J8PA 1N2BA 4N3AA 4QHTA 5AUOB 4WPGA 2VP6A 4EMUA 1G5FA 4TVBA 1WL8A 2QLFA 4LA4A 4NE7A 4BKQA 5G0SA 2YVLA 2ZSUA 4P3YA 2EDAA 2B4YA 1ZJYA 3ET5A 1JTEA 2ASEA 2ADFA 1SVLA 4MR9B 3AHGA 1L5HB 4H3SA 3HSKA 4FFNA 1I9CA 1GPYA 1IZZA 3IKVA 1Q1QA 2O05A 3UJ9A 3B1KA 2Z95A 3GLHA 3NBFA 4ER6A 1MQSA 3B3FA 2R8BA 1BXZA 3CUKA 4U0KA 2OAEA 2G1KA 4CQMA 2C2BA 3OZFA 5C37A 1HNWB 3ESYA 4I50A 3RV4A 4QTXA 2FWIA 3JQ9C 2H9YA 4PPYA 4RO0A 1WABA 1NW4A 2A58A 4E30A 4JB2A 5JDIC 1J5PA 3T12A 1Q92A 1FMCA 5FH9A 2FA9A 2IOQA 2Y0PA 3QF7A 2J3KA 1KI6B 2OHVA 2X1HA 4L6AA 1UJ6A 1G4HA 2JIBA 2VEDA 4HLUC 3VAYA 4EGFA 4NFSA 1P29A 2BDUA 1JXAA 3T95A 4ARSA 5AVWA 4QDOA 1AKYA 4KKXB 1U3VA 4ODIA 1AK9A 5CLHA 2I5PO 1N4AA 1N5JA 2BMVA 3KFVA 4CQLB 4C4SA 2JHCA 1RRVA 3FIUA 2Y9PB 3PT9A 4P93A 3HTXA 4RA9A 4GDMA 2GBLC 3BL5A 4PC6A 3WE7A 1PDWA 2COKA 1RD4A 3N5CA 3TF5A 2UUBB 2VP0A 3GJ4A 4OXRA 1TEHA 1F0YA 4YPFA 1A8PA 5K8LA 2FWRA 4YCCA 1XXLA 2FGKA 4MPTA 1VP9A 3T9FA 4C5AA 4KWTA 4MKXA 5ICGA 4DIMA 4IZHA 3HJRA 1DC8A 4KNYA 3TM4A 1SXJA 2ZYWX 2D1RA 4HWKA 5FTKA 2VKQA 2YCBA 1T35A 1T36B 4ZA2A 1OX6A 4LMPA 2V4MA 3CN9A 3HJCA 4FEYA 1XD2B 3IR7A 4LRUA 4REQB 1JXMA 4FFSA 1YI0A 3E03A 4IDCA 2HX1A 4CIVA 2IDMA 5K03A 1D6NA 2QN6A 3MMXA 4B7AA 3O83A 3TL3A 1SUEA 3D6NB 1N5KA 4BLPA 3PC6A 1P5HA 3DLBA 5A6VA 3PFWO 4X3PA 1VPTA 1N75A 3QELA 4TSRA 5B64A 1AMNA 4EO4A 1DQYA 2JVKA 2Q0HA 5I4BA 2RBGA 4BLSA 1Z4NA 4INJA 4RL6A 3DP9A 3HJUA 3WQSB 3ZKAA 3B3GA 5BV0A 3PFBA 4N7MA 5GTDA 1VYHA 2A9OA 1O6ZA 3JWGA 3KYDB 4OQDA 4DV6B 2FEOA 3R2JA 1H9CA 2GM4A 3G2KA 1N2CE 5AK4A 2FPRA 4K0RA 5HZGA 2JGDB 5ELMA 5HIIA 1YJBA 1PS8A 2C5BA 1W36D 3OG9A 3V4PB 4JB3A 1P4HA 3GWZA 1X77A 4QUIA 1RABA 4DYDA 1ULTA 1EWKA 2YXLA 5ALQA 4M2LA 5A0TA 2OV8A 1FRZA 1G17A 3BQ9A 4JC8A 1GO2A 2I87A 1E94E 2PUJA 5FTWA 1QJ4A 1GG2A 1SZPA 2EEZA 3K71B 5A2QA 2BMJA 5JOQA 2AK2A 4KAFA 3SQLA 1JSLA 2J09A 5JCOC 2RKBA 1QRSA 5JIBA 1XNHA 2H4ZA 3L7CA 2QAJA 4M53A 4ZT2A 4NEQA 5T4FA 2QW1A 3CM0A 4F1KA 4QRHA 2XIJA 3IQZA 1GZHB 1VTKA 1W47A 4XB2A 3UFBA 2X2FA 3KDSE 4MUYA 1UZUA 5CIWA 4RPLA 4KG7A 5F3RA 3E18A 4HTFB 3VZBA 4CKXA 3KQOA 1TAUA 4K81B 4RD1A 3AM3A 4EPYA 4JWKA 1VIDA 1DT5A 3R5FA 2PL3A 4I1UA 1JLLB 1F06A 5AICA 1FFBA 1SD2A 4R1UA 5JAMA 3X1DA 2HSWA 1YR7A 2BUCA 2JLSA 3PGVA 1RYEA 4JCOA 3WLSA 2FEMA 2IF0A 3M6UA 2HADA 5JY1A 1IZ0A 2P9JA 4Z1MA 3HO6A 5IXJA 4RLSA 5IFKA 3LP6A 4R9RA 1FEZA 4RF5A 1SZDA 5BOVA 1RRPA 4EG1A 1MBZA 1XFAA 2FEWB 4MA0A 4OQLA 3HY6A 4CL3A 2A5YB 1E7MA 1THTA 3GNSA 3N8DA 3U5ZB 4R9VA 1JEJA 2BHTA 3VX4A 2F6RA 4JIMA 3Q3EA 1JZSA 2WJGA 5EHZA 3GLFB 3KQVA 1DFGA 4NBUA 1XZAA 2R11A 3CLSC 1I3CA 4POAA 4B84A 1JKIA 2BTOA 3GEGA 3KXLA 3LQQA 4I9UA 5AOAA 4OOEA 1RJWA 1G8KA 4C05A 5K8JB 3DB2A 1TYAE 3OLCX 3U1VA 3AUFA 3PUXA 1V6SA 2JF0A 4FEAA 4LJ9A 1P77A 2PBRA 3MHPA 5MN4A 3CKKA 3KXKA 3LWNA 3WQBA 1B2RA 2X58A 4GKAA 3C5CA 4EI7A 4CIDA 3KWMA 1QE0A 1H6BA 2V74B 2XRZA 2QMEA 1GUZA 4FLFA 2OYCA 3DZDA 1FRQA 1FC0A 1QBGA 2JZOA 1T9AA 2O5CA 4WEOA 1WY7A 4HDKB 1XAJA 4LF9B 2DBRA 4OX9B 2FFQA 2QPOA 3QNWA 3NVAA 1G7TA 3F6RA 1L4HA 1V39A 4HPJB 1RI2A 2HF2A 3JRXA 4WRRA 2EBUA 4P0PB 1JYSA 2ACVA 3MINA 5DP2A 4UBIA 3WNQA 3CRW1 3Q3GE 5FQNA 4DJEC 3EY9A 3U62A 1UBRS 1OB5A 5F78A 4FYXA 5DTMA 4R4JA 1IQPA 2ODPA 1KMHB 1ZK0A 3S2ZA 1EFKA 4CN9A 2VF5X 1J2EA 3GA7A 1M54A 1TVKB 4WK4B 4BDTA 1GL3A 1N5LA 3G2PA 4MGYR 4Z9XA 4HNVA 2P75A 4JX9A 3LCJA 3QBDA 5FL3A 4IJ5A 4LY3A 4Q7LA 4A92A 4XVCA 1VIYA 4ZDIA 4YHHB 1VJDA 3JU3A 4YIHA 2RGCA 4YI3A 2R85A 4TUYB 3V4VB 4BGDA 3KXDA 1OVGA 4D6YA 1OIWA 2R6R1 1P17A 2NU6B 4RGYA 3NKLA 3RWOA 3B9PA 4LVOA 3HVJA 4KAAA 1Q7RA 3FIJA 3MJEA 1MOSA 5LA6F 1N2JA 2PZBA 4MKFA 4O5OA 2FKNA 5FF9A 5I7HA 2EKQA 2NXCA 3JQEA 3AOEC 3RFVA 3SIRA 2O54A 4HLQB 4PLWA 3KVNA 1YZHA 5REQB 1TM3E 4YLEA 4XQCA 3WXMA 4YUWA 1DLIA 4OI4A 2VDWB 3QG5A 1AQIA 5A5DA 4YJFB 2F3RA 1OJ7A 2CLMB 4C4YA 3OEEA 5DIFA 2ODTX 3DA8A 3I9NA 3VPFA 4KLAA 3B7GA 2YVUA 3JD4A 1FTYA 4XUGB 4CM9A 3ZHZA 4GYWA 1UBFA 2XPCA 3H99A 3PK0A 4FN4A 1SRRA 3GJ0A 3I92A 1Q3KA 3UJNA 1N3YA 4DPKA 3BJZA 1WCV1 5EXXA 2O0MA 1Z33A 5GY7A 3M5PA 5T4HA 5DB4A 2DTXA 3UNXA 1KI8A 2PBLA 1FTQA 4Q1FA 2K2WA 2VYNA 1K4MA 3L7OA 2GN2A 5NULA 1S9DA 4Z9FA 2LIPA 2IUSA 3LUCA 3LGXA 3NBQA 3PXXA 4J2HA 3CO0S 4HXEB 4ZPXA 1BGXT 1ZM9A 3KLNA 2QBYB 1PG0A 2ODQA 3LTEA 4PCLA 3WK9A 5FCDA 2O7SA 4NNOA 3AEQB 2AYYA 4XDZA 1TZKA 5I4KA 3OFNA 1T10A 3L41A 3H1TA 1XCGB 3TH5A 4EG7A 1DGQA 1EFRD 4PX9A 1PNOA 4GQBA 2AYXA 1QH8A 2YIJA 3UT6A 4DJDC 3CISA 1LQ2A 3L92A 2H2WA 2X3UA 3RTCA 5KJCA 1Y8ZA 1XTTA 3VC2A 3WLRA 2O8BB 1U8YA 5HGXA 4Y9SA 2QT1A 2ZAIA 3JQBC 3J81A 5CJPA 4FFRA 1EXWA 4JUCA 6ABPA 1XNRB 1F51E 1AMUA 3HL4A 4L15A 5KU1A 1SCUA 2Z83A 2IYNA 4Z4EA 1IDN1 1Y6JA 2OLKA 3MFYA 1E5XA 2YJZA 4P6VF 4BP3A 1VB3A 2VLBA 4CFYA 4FE3A 4OMCA 3DTYA 4F6LA 4ZYVA 2ANCA 4IXMA 1FLAA 1GPWB 3GD5A 1EBBA 3PXDA 1J1UA 3HDHA 1JSZA 2HRBA 3CH6A 2BGLA 1QPGA 2D5CA 3ROMA 4ZZ3A 2IX3A 5B36A 4U7DA 3GA5A 2ZUEA 2ADOA 2GF2A 5K3FB 2R0QC 1DJMA 2R4TA 1CRPA 2YV2A 3PQEA 4KB5A 1OKKD 1OX4A 2O2GA 4RW0A 4DUGA 4JJ6A 2GCOA 3DV0B 4E1BA 2OBFA 4V39A 1UDWA 4P4GA 5I9TA 5JCXA 3KPVA 3O8OB 4BX2A 5EXSA 3AHFA 1JVBA 2YUTA 4URFA 1XP5A 3NHFA 5L3SA 5KKCA 5EJ5A 2A86A 1NSYA 1YRAA 3M3HA 2Q6IA 5C1IA 1TB4A 1Y8CA 1UK7A 1YUBA 3C1OA 1I51A 1OXKB 3LY8A 4JP8A 5BORA 2MMGA 2JJ2A 3OQIB 1QBKC 1EZ1A 3QRWA 2XZTA 4PZUA 2WY2D 3DAOA 4QNRA 4DEYA 4O63O 3EGVA 3M6XA 4AKHA 2TMYA 2ZSBA 3IELA 3LNCA 3Q72A 3QFSA 2VNSA 5K1ZA 3C3EA 1T0HB 3C41J 2B2XA 3OQMA 1YCDA 4UM7A 2RAUA 2YDYA 4ZOLF 3T5MA 3FMIA 1FDWA 1B8OA 4BFYA 4JI7B 4YRSA 1VI2A 4LWQA 1CJTC 1JIIA 1I14A 4C7MA 3ZV3A 4CMHA 2I9KA 1VSUA 4WOCA 4P36A 4R2XA 1RYYA 4TWRA 1PJSA 1XZQA 1WMDA 1JN0A 1L7VC 1ZC4A 3B1JA 3OPMA 4NG4A 5J2TA 2I6SA 1JDNA 1YJAA 2EZTA 2YW2A 1GZ3A 3WLQA 1QTNA 2V45A 2I22A 2ISCA 3E3NA 3PJRA 4B1FA 1X1EA 4NCKA 4K6MA 4K9NA 2AEMA 2V7TA 2AW3A 5DNVA 3K9FC 721PA 4C0WA 1WXQA 1Z29A 1U04A 1G1AA 1NR7A 3ZY6A 4HDMB 5CDFE 1N5IA 3GGOA 3ENQA 3D3WB 2FR8A 4KR2A 4O1HA 3QLUC 1RM5A 2W6JA 2UVPA 4Y6PA 4F7DA 1RQ2A 2CLEB 4MR8B 4OFXA 3R3YA 3OIWA 4B4UA 1YU9A 2FPPB 2XR1A 3OSZA 4NLLA 3DCYA 1DCFA 1NFRA 2PU7A 2XQGA 2ZRMA 2DR3A 5LPNA 1WXHA 2JLWA 3SC4A 4PE5B 1EG7A 4BZWA 3UWSA 1CF4A 2JGIA 4C0JA 3F6CA 2NVUB 2KLBA 3R7WB 4DCOA 1SQ5A 1I80A 4ND2A 1PS9A 1XTZA 1L9XA 1ZQ9A 4K46A 3EUAA 2VDQB 1JFFA 4JU9A 1N57A 4KX5A 4EH1A 1ORTA 4KRFA 2VBIA 5FUQA 4L8WB 3AFGA 1DXOA 3D7LA 3FUVA 1ZD2P 1PQ4A 4FNMA 4O0MA 3PXEA 3G2LA 4BFTA 1P74A 4D92A 2QI9F 1TM4E 2GVZC 1C8VB 1EWQA 1ZPDA 4TWBA 3UEOA 3O94A 2Z1DA 4HO1X 3V1MA 4MB0A 3N2KA 1OBFO 3ZWKA 4A36A 4YY3B 1C81A 1P2UA 2HHCA 5E0OA 2JAPA 2IBSA 3HVKA 5CM2Z 2RC6A 1RLMA 2YRFA 1R16A 3A1UA 1T0JB 2ATEA 1U3CA 2GESA 2VAVA 3N6VA 3PZRA 2JIZA 3WYCA 4PLPA 3ZXYA 3E22A 3UMMA 3OEWA 5ECYA 4WDQA 4AQYB 1JW9B 4PRYA 4TXMA 3SY8A 2Q5CA 3B13B 4RU1A 3KX2A 2QX8A 1RPNA 1L5WA 4LDAA 5FAKA 1SY7A 4O4HF 2CNDA 1WBJB 3G8BA 1FMTA 5EGSA 3RIXA 2IP2A 2F8LA 2VCHA 4Y9RA 4D44A 2GF9A 2VRCD 3QW4B 1MB0A 2R9VA 3ITDA 3MNFA 1N7IA 4JYZA 5KKAA 3OICA 2WQZA 3FFBA 3G9UA 1MAUA 3FSGD 3I9FA 4WUTA 3SQOA 2Z9BA 1P5ZB 1DQNA 3DSRA 4U2BA 2MJLA 2NW6A 4IP0A 4B6RA 2YJ3A 4YJHB 1CZRA 3WB0A 5AWFC 1U28A 5FPYA 3CMMA 5JYBA 3LW8A 1GNTA 1PGQA 1PUXA 3LCCA 2PSDA 4ZT6A 1VI6A 2VQEB 2Z6VA 2FSPA 3QKWA 3CNOA 3ZNNA 3OX4A 3RSQA 5DLYA 1E1NA 2IV7A 5BYJA 4QJ3A 3WYNA 3R7NA 5LA6B 5KYWA 1U1EA 5E4FA 1XEAA 2H1RA 1GUBA 2E3JA 1MRZA 3RLIA 1L8AA 3VYSB 4G5GA 4KFRA 1G8HA 1QSGA 2GZ1A 2Z9DA 2YWHA 4QGSA 4V1CB 3EXEA 2OO5A 1JPJA 3QVGA 1C7RA 4N0DA 1EFTA 2HDHA 2ZAGA 3OT1A 2NZVG 2XUDA 4MRMA 2V59A 3TCNA 4E2YA 2AC7A 2Q5EA 2R97A 4ED9A 3WYBA 4KMSA 1OI3A 5EIBD 1GNLA 2FSVC 3UMYA 5IC6A 1GJRA 3RS2A 2Z0MA 3MPUA 1ZW1A 5JXIA 1ZAYA 1H5NA 1MX1A 2PSSA 1EP9A 4FGUA 5FR1A 5KTOA 4FGWA 3D4BA 2XHZA 1GA4A 1YS1X 3I0ZA 1NW9B 1RCTE 4KN9S 3A70A 2JGLA 1ZM2A 3U7HB 1XQXA 4ICIA 1V8PA 2HY7A 3EG5A 3QEJA 4XE5A 4EYEA 4XD2A 3AU8A 1TK3A 1QTRA 3PUHA 3A6EA 3CJQA 2PXHA 1T3TA 1ZESA 4QEZA 3GRAA 2ACKA 1M72A 1NBAA 2BONA 1XF9A 1NXVA 4BX3A 1D3AA 1DEKA 2HBRA 3LUAA 2ZRPA 1NQWA 5E9WA 3ROFA 4BNKA 2GJ8A 2VDKB 4Y2TA 2WJYA 5AJWA 6ADHA 3U7GA 4FZ3A 4Q3LA 1Z4KA 4E15A 1MENA 2ONYA 1MJ5A 3R5KA 5HHTA 1V95A 3DW1X 2OFFA 1QB8A 1RYDA 3GRYA 4IWYA 4AUKA 5CB4F 3RTGA 1IBRA 1KSJA 2FTKE 1SVNA 3KOXA 3OM8A 4BMOB 4K6OA 1O0BA 1BVUA 3U4IA 4A15A 5BVGB 3MS4A 1HE1C 4ATNA 5LMZA 1FBNA 1SIWA 3GY0A 4BO5A 1G8GA 1M2OB 1P0MA 1PN3A 2WU8A 4L5BA 1O0CA 4FSHA 4P4SA 3KTAA 3PEWA 1II0A 1JUDA 1XYVA 3BMNB 3H3FA 3QFHA 2PA3A 4N49A 2XTZA 3OJCA 2PSJA 1D4AA 1NPYA 1XCJA 2LXNA 4LMBA 1GLNA 4YV7A 3Q8MA 4AJNA 2XXAA 1TJ3A 4RZ2A 1F6WA 4LZPA 4YJGA 4OHXA 5JSFA 1WKCA 5EMHA 1AS2A 1ZH2A 3MS2A 1O6CA 1T6BY 4TLDA 5JARA 3IPCA 3PENA 1FLNA 1G2PA 3QBJA 3Q85A 2J5XA 1OE0A 3AERA 3ASYA 4RJ2A 1YUMA 2QN7A 2MINA 2ZP1A 3OO1A 1RZ3A 3QM1A 3QUAA 4G63A 4HX2A 4RHXA 4CTMA 1FUYB 5I6DA 5JWRA 2VJMA 4CKYA 4DDHA 4LYHA 1IBMB 1VPDA 1F2TB 5T3UA 1PX0A 1E8DA 3WRVA 1MHTA 3F71A 5AW9A 1Q91A 5KMGA 4IMRA 1YOBA 2WI8A 1WE2A 4JQYA 1KE1A 3ABSB 1LQUA 2GI4A 4AVYA 2D4HA 4WN9A 2E4WA 4ZXFA 1QYDA 4M1SA 1P60A 1X92A 4II2A 2GR9A 2RGDA 5L7YA 5JI3E 3F67A 3RU9A 2A0XA 4IWNA 3L8MA 1P1HA 1FU7A 2WM9B 3BXOA 1BU5A 4M46A 3K1AA 3ZS9A 5CBPA 1DAPA 2FEXA 2NO4A 3ORQA 4N5LA 1Q11A 1Y3IA 4PYOA 4TSFA 4CM8A 1I2MA 1YRLA 1RFGE 3FCCA 3R6LA 4XW2A 4W5WA 4DA7A 2QM8A 1E8NA 2B36A 3MMPA 1GCOA 3TFOA 3LY9A 4ZOLB 1EGQA 3LYUA 5F1OA 4GGOA 2XF8A 4NBNA 3D5TA 3VDRA 5HUQA 3LQYA 3HXKA 2LKCA 3KEGA 3EF3A 3WSWA 2X1MA 2Z9CA 4B3CA 5B7GA 1ZIPA 1AOXA 4BGEA 4K05A 1KGDA 1E3LA 2IQ5A 2EIXA 1D8AA 1DCTA 1KDOA 4BLWA 2VHTA 3UMGA 5FYDA 3PDIA 1RWBA 3WKEA 3DJYA 4OFWA 3ZCUA 1I7PA 3I4FA 4P34A 5FJIA 5H4HA 4BO4A 4K0KB 2G0NA 1GTG1 2R2AA 4Q37A 2QL6A 4LISA 4CLDA 5CDUA 1YHZA 4P3XA 4F1JA 3VR6A 4ZCTA 4RM3A 1XQ6A 2SICE 3UJBA 3LMKA 3Q4GA 1QVRA 3P19A 5AIBA 1XNGA 2V97A 3ZJUA 1ZJZA 4FBLA 3FMOB 3S44A 4LZWA 1IXZA 2OAGA 2NXJA 2QUHA 1XZJA 2IXTA 2JGAA 3SICE 2IBMA 1Z5PA 4F0JA 2F59A 3MBOA 1QS0A 3QPCA 4RTKA 3KEQA 1X7HA 3UGQA 1YQEA 4R8VA 1X7ZB 2YZMA 2XV1A 2FMIA 1GQYA 2HRDA 3TLYA 1OXXK 4KMRA 2EWMA 4E2ZA 2N3ZA 3SSMA 1Z4IA 3ITKA 1XEFA 3WJ1A 1GL6A 3HA2A 3TW8B 1ZIYA 3QBEA 4H6PA 3UANA 5IKXA 2NT4A 1CKEA 2AFHE 2V7QD 4X64B 2R1VA 1DO2A 4AJ2A 2XCTB 3FVVA 4KL8S 1MEJA 1Z2PX 4OH7A 1TM2A 4XOIA 3KD2A 2NPFA 4UU0A 2GK3A 4R1QA 3WICA 3WK4A 1KHTA 1UM9A 3E0QA 4N0QA 4MS4A 5I7AA 3S1LA 4YI5A 3WYGA 4Q0MA 1EWTA 5C9ZA 7MHTA 3DE0X 1X86B 2R66A 1IEQA 1YF3A 1M6HA 1PEKE 4EGCB 4CVNA 1U4OA 4GR5A 3UHAA 4CKWB 4LTDA 4XM0A 5FI3A 1R8QA 1RI3A 2GRAA 3TQQA 1HZZA 3THYA 4Z8XA 2ZJ0A 5KB3A 3VJLA 4LHWA 3AJAA 1Y34E 4ZI7F 1V4VA 2ZDHA 1RPZA 1YMQA 1KZHA 1PR6A 1GLGA 1K5GA 3AFOA 4MX8A 4OCZA 2W9XA 1Y89A 1C9NA 2PJZA 3IH5A 3D4NA 4L3VA 2SHKA 4CR7A 3LYLA 5A4KA 4K28A 1SG0A 2CCGA 3DC7A 4PXYA 1TTHA 2QNRA 2AB0A 1VL0A 2VNIA 4O4HB 4TL8A 4JROA 1JLHA 1JR3D 1K06A 3FWKA 3OT4A 4PZYA 3T4EA 2VXOA 3ZDEA 1ARZA 3D7RA 2AFVA 1DWPA 1SO8A 2PUHA 3LE8A 4GP6A 4M49A 4OFZA 3CH7A 3TDKA 1P9NA 1A9OA 2E48A 2AOTA 2IU6A 1M1YA 1KC3A 2H4WA 2WMDA 3DDCA 3TRJA 2Q0XA 4KIJA 821PA 3NBZC 1CG6A 1LLFA 2YRXA 3GC6A 4GO1A 3RSSA 3WQRA 3W8FA 1XR3A 4E70A 3N05A 4TS4A 3FPLA 2YJTD 2Y1OA 5JXGA 2ETXA 3L43A 1NBMA 1PK9A 2RI0A 4B48A 3F6BX 1NASA 1SK8A 1FPMA 3ZV7A 4AL4A 3WAJA 4Z4HA 3VHXB 5ARCA 2OAP1 2V4ZA 1Z45A 3G5UA 3OA0A 4O6VA 1SG9A 1NXPA 1ST2A 4BVBA 5KJFA 1YB6A 2DPLA 4RIFA 4C04A 1FUUA 3JARA 4QRIA 5SZKB 1TJNA 2I34A 3EEYA 5DN6A 5FUXA 1I7DA 3AESA 1MVNA 2H7XA 2PEZA 3AOGA 1WZEA 2O3UA 4R8LA 3RSOA 4ZJZA 5LZ2A 1T2VA 1MA0A 3A6PC 4JZKA 1LJLA 2SCUB 3JD2A 1KNQA 4OJYA 4O2AF 4TROA 1DTSA 1HWYA 3DZCA 3NCTA 3L6EA 1Q3TA 3C24A 3EMKA 3MILA 5TPWA 4BO7A 3KOMA 2FRXA 4AMUA 1PT5A 4ZO6A 4IQGA 3ZWQA 3G2QA 2W70A 4CMEA 5AW1A 4F71A 1N8KA 1HR0B 1DXYA 3K0CC 2R7MA 4EKEA 3B2QA 4Y7DA 2RI6A 1Z0JA 3WGKA 3O0DA 3PX3A 4OI2A 4NONA 3T3EA 1VOTA 3PCRB 2C2GA 2CJXA 3MTIA 2HMSA 2QQEA 4KLZA 2DSTA 1A77A 4M8IA 4PBSA 2IUFA 4X8LA 1AQUA 2XA1A 1RAAA 3D8NA 3H3XA 5FTJA 1QP0A 4QODA 4MVJD 2WNIA 3GPCA 5D5QA 4EF5A 5C1OA 5JYEA 4ZVKA 3HB7A 2HRRA 2QPLA 1I7NA 2JLQA 4NV1A 2Z57A 4PS1A 2O7RA 3EULA 4J1QA 2ZCUA 2CE7A 2JDIA 1NULA 3O1IC 2ANBA 2ATIA 1C8KA 1X9IA 4JVOA 4QXAA 5DN9A 5IW8A 5LL6P 1UINA 3HR8A 3HR7A 1V9CA 3UB4A 4YMIA 4J0JA 1A7JA 2WV7A 2VYCA 1CR6A 3JQPA 3OJXA 4CMBA 1DL5A 4OLAA 2MHCA 1ENOA 2Y66A 5CB4B 2B25A 2OCGA 1PT7A 2GJ4A 2RB4A 3U3DA 3PBKA 4U3JB 5CGQB 4L22A 3T4XA 1O5TA 4CJXA 2W8ZA 3CY6A 4YH1A 4ALMA 4RD2A 4EF6A 3U13A 5A9SB 4JXJA 2W8BB 4FI3C 2YOHA 3BULA 1R3DA 1TX4B 4ES6A 3EVTA 4F45A 3EMVA 2KQUA 1T43A 1V0JA 2D3WA 2EX4A 2R5NA 5JSZA 4IHQA 5EJEA 5IAOA 3R7BA 4AZVA 1BHQ1 2XSZA 4KTVE 3T3NA 1E4EB 3RS0A 1JHYA 2WABA 2ZS7A 3JQ7A 1M2HA 4U7WA 3UG7A 4FJ0A 3UPDA 1KQPA 2C95A 1DBVO 1HQCA 5KSZA 3W0LB 2F48A 1ABBA 3Q1KA 3TSCA 1I3KA 3QOFA 2J1LA 3W4IA 4UJ5A 5FNVA 1FNNA 3DBHB 2X40A 2PZLA 5LP6C 1IULA 4J7AA 3KV1A 4PG4A 3JQGB 5E2IA 1WPQA 4G0WA 1Z82A 2XNDA 2O6HA 1X9HA 4B4KA 3NM5A 5JWOA 2ORYA 4JBGA 1T1IA 5M04A 4B09A 2NPOA 5CP8A 3DAGA 4MWEA 4J4TA 2C31A 3PR3A 2BLNA 4HWGA 2FKAA 4PLGA 1XEWY 3ZY2A 2GA8A 2XUAA 5ELXA 2LDXA 3O84A 1X1RA 4YV0A 1WSBA 1H1LA 3EDRA 1N5OX 1Y3BE 4IKPA 4N6GA 1YDEA 3M6IA 4ZQEA 2LPMA 2DQKA 2NM0A 1VMAA 3Q87B 1WB5A 1SVSA 3CS3A 1CETA 1PJ3A 3F4LA 3R20A 4TMYA 2NV0A 2OVFA 4ILKA 1CK4A 3HKBB 4BNDA 1MC1A 3MF4A 2PS0A 1KNXA 3OO0A 4HAIA 1QYVA 3NT4A 3GEEA 1LLUA 2IBTA 4OJMX 1K4YA 1Z4PX 1HI9A 4GW3A 1Z18A 3S7ZA 2XF2A 5JQGF 5TQ0B 3QUBA 4FM9A 1V3VA 2WTEA 1YJXA 3B1XA 2CCKA 3HDQA 4MVWA 1WUKS 2D3TA 2OCPA 2HMYB 1QO0D 2G9RA 2P9CA 1DV2A 1IOZA 4QXRA 5FPSA 1U7PA 1V37A 5DSZA 3WWDA 4D02A 2EU8A 1NMQA 2X8JA 1TO1E 1JU4A 3R8CA 4Z4IA 1VRWA 1W2GA 3GJXC 2Z4RA 4CL0A 3HDVA 2GETA 4A0RA 1KA9H 2E0IA 2FLWA 3R5JA 5FA8A 3IVGA 1LTQA 1MPXA 4GLOA 2NACA 4H16A 4Q4JA 4YRQA 3SXPA 4YV2A 1LXCA 3I9JA 1QAQA 1NUSA 2ZWAA 3DXZA 4KGDA 3ULKA 1AJEA 5E7MA 3VKVA 5KVSA 4XYEA 1HDEA 4PVDA 1T8WA 1XQ9A 2OV4A 2PGXA 3TLKA 3ZCPA 3O93A 3RASA 4JLAA 4C9BA 3TB6A 5FLYA 3NM4A 4IX9A 2YFYA 3GLGA 3OJFA 4PIVA 2KLHA 2NUPB 1EGAA 3EX7C 3J81k 5TDHA 3WGIA 3GMSA 3NJ4A 1TMOA 4LXHA 3ZY5A 4AKTA 5C5DA 3BCSA 1FNBA 1ZNWA 1IRXA 5F73A 3MJFA 3QX7A 1UXOA 9MHTA 4G24A 3IRVA 2JIQA 3TRKA 2PZMA 5FOQA 5EVCA 5KDOA 3NYQA 2AXNA 4LQ4A 2Y68A 4JV5B 3M82A 1T2CA 4DG8A 2J7PD 1DTEA 1KY5A 3ECCA 3ND8A 2VH5R 4HADA 3HFSA 2CXQA 1OH6A 5GPBA 2JKZA 4LJYA 2G8LA 1MX9A 5ECGC 3GZTB 1J2TA 1NT4A 3AYZB 3EC2A 3E9EA 3HJHA 3I6BA 4GSYA 3FYCA 4LKOA 4WVLA 1U02A 2ZVJA 4ZI7B 2QJRA 3WLNA 4FR5A 4RS3A 1KDVA 1J0AA 3LDAA 3BSFA 5AD1A 1HXHA 1KVRA 4ARCA 2FZKA 2VCEA 3RAJA 1P8JA 2DWCA 5DM60 3HXQA 5ALXA 3EPKA 1WLYA 2I2WA 1TTTA 1SQSA 2OCBA 2PX4A 2WG0A 2VK4A 2XUFA 1WHTA 4RX1A 3ZHVA 4F38A 2GK7A 1U8TA 3S0JA 4WY2A 1WUTA 1DINA 3P9XA 4JMLA 3SPXA 3RANA 5B2FA 1DDIA 2D2XA 1U98A 2HUPA 2IYYA 1OZGA 5JNSA 1VFNA 2JBAA 2QMYA 3A04A 2QG4A 2H9IA 3NB0A 4JA0A 4GFDA 1HURA 3CCBA 3F0TA 3U2QA 4AJPA 4FSXA 3TTSA 3FWPA 5K9ZA 4HY3A 4TMTA 1PZMA 1XTRA 2QTLA 1BH2A 1SAYA 4PZEA 5TVGA 4EA7A 5CFNA 1PCXA 1P5RA 2W6IA 3GBSA 2YJ6A 4HJXA 2IV3A 2HGSA 1GG8A 3QFCA 4JR1A 4U7TB 3O2NA 4OB8A 2Q7DA 2YMQA 2HEIA 1ANKA 2NTJA 3FB1A 1JJBA 4R84A 4AX8A 3G6WA 2KPOA 1VGVA 2B6NA 2BHRA 2P2LA 2J3HA 3HEMA 2R2GA 3FRHA 3QOYA 5DHPA 3RKSA 3SNKA 3UMVA 3BMOA 4XVUA 1U2QA 4N18A 4C7BA 3IMEA 5TLSA 2BI4A 3K32A 1ADYA 4IYJA 2C5LA 2ZRDA 1S3IA 1RJGA 1X8JA 1T4BA 3KJIA 5G0WA 4AKSA 3N7AA 4F56A 4M0FA 4E5PA 4A2WA 5BRJA 4X6UA 1JFRA 2WZQA 3H87A 4C6HA 2ZGVA 3CNEA 5C8XA 3IAEA 2ZBEA 3ICPA 3LPNA 4A91A 1LB1B 1TPYA 4BECA 2PUAA 4MQ6A 4QT4A 2DF8A 3RRJA 3QLVA 3I83A 5TB5A 2X9NA 4DDKA 2XB4A 1Z2NX 5C52B 3WO0A 4H7PA 4II7A 4C1NA 3O8RA 4BNXA 2NV6A 4CTOA 4DSAA 5IVKA 5JO9A 2AQHA 3AR6A 1J6UA 1RWOA 4I8IA 1MRSA 2DWUA 1ZI9A 3HU2A 3IC5A 4IG9A 4UW9A 3ZBQA 3U7IA 4UM8B 4D8TA 3UYLA 3M1AA 3W04A 1VDZA 1PJRA 3EUFA 1QRDA 2FE1A 1L8LA 1USVA 3RHFA 1G3QA 1NG1A 3PKJA 5FO0A 3AY6A 4J1SA 4HGQA 1FVOA 1HT3A 3ML1A 1MJHA 1Y5LA 2WHXA 1KMMA 1KI1A 3OUTA 2Q6VA 3JD1A 4P3NA 4C03A 4Z0PA 3RJ5A 5KNBA 2VBFA 3EEFA 3BFKA 1D0VA 1PK8A 1D4OA 2KM1A 3O5AA 5DTRA 4EI9A 4R2MA 2P6UA 2ZBFA 1F3OA 5AM4A 2OOSA 5FPPA 3D81A 3EGEA 4FJ1A 4UEQA 5DMHA 1ZH6A 2RGEA 4LV5B 3DVAA 4M1KA 2FJ0A 3QKSA 1K7EB 4UARA 3PYLA 4UNNA 1EJ0A 2J4DA 3PNVA 4UFOA 2GKGA 2Y71A 5G0VA 1XVVA 3VX3A 3R7LA 1XALA 5AUQA 5CCDA 1R0RE 4ISCA 2J7KA 3E1KA 3MCVA 1AY0A 2EW1A 4Y2UA 3FE2A 2J5QA 2VP3A 4PZZA 1GG5A 3KZCA 1EFDN 3ECSA 4C4ZA 4AUEA 1UFRA 5HJ2A 4NBVA 3QUTA 3D6FA 1TF2A 2BGIA 1WW8A 1U81A 4IMPA 1XTKA 1JJIA 3R41A 4FFVA 4GP7A 4A0HA 1Y6FA 1U7UA 2A9PA 2JD0A 4AJHA 5KSYA 3BWDD 4MEAA 3SZRA 4DIKA 4WOPA 4B85A 1LWNA 3VBEA 5PNTA 4WKOA 4YT2A 1FFYA 3OPXA 3W5CA 1RC8A 3GNLA 3AWIA 3SHWA