2DPMA

Dpnm dna adenine methyltransferase from streptoccocus pneumoniae complexed with s-adenosylmethionine
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
275
structure length
258
Chain Sequence
TLQPFTKWTGGKRQLLPVIRELIPKTYNRYFEPFVGGGALFFDLAPKDAVINDFNAELINCYQQIKDNPQELIEILKVHQEYNSKEYYLDLRSADRDERIDMMSEVQRAARILYMLRVNFNGLYRVNSKNQFNVPYGRYKNPKIVDEELISAISVYINNNQLEIKVGDFEKAIVDVRTGDFVYFDPPYIPLFTSYTHEGFSFADQVRLRDAFKRLSDTGAYVMLSNSSSALVEELYKDFNIHYVEGKISEIIVTNYEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ADENINE-SPECIFIC METHYLTRANSFERASE DPNII 1)
publication title Crystal structure of the DpnM DNA adenine methyltransferase from the DpnII restriction system of streptococcus pneumoniae bound to S-adenosylmethionine.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 89
structure length 258
sequence length 275
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 1998-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 2dpmA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2dpmA01
4ER6A 2YQZA 3GRVA 2Z6AA 2ZBQA 3PB3A 5T67A 3I53A 5CM2Z 5EMKA 1O54A 4C05A 2IH2A 2ERCA 3TM5A 3BGDA 2WK1A 4FZVA 3A26A 4XUEA 1WZNA 5EOVA 5FA5A 4EMSA 4FSXA 1WXWA 1R18A 2CMGA 3GGDA 3IV6A 4R8SA 3D2LA 3BKXA 1JTFA 1SUIA 2DULA 3JWHA 4HGYA 5K03A 2P3LA 3ELWA 3L8DA 4CTJA 3HTXA 5LQRA 3NTVA 3EVCA 2AN5A 3KR1A 1M6YA 4V0QA 3HCCA 2DPMA 5ICEA 2JJQA 1D2HA 1BHJA 2NXCA 1RI3A 1ZG3A 5DSXA 4EK9A 4E31A 1FJXA 5CCBA 1P39A 2BR5A 4OX9Y 4OBWA 5CVDA 3KHKA 5CVUA 5LQKA 1JSXA 3CCFA 4NECA 4YV1A 5BW4A 5C9ZA 2PGXA 3P9CA 3EVZA 3R9XB 2E5WA 3DUWA 3LSTA 3NJRA 1JSZA 3VC1A 5E2AA 1NV8A 1L9KA 3I58A 1V39A 2G8NA 4FT2A 2FYTA 5FQOA 3OU7A 1DCTA 3E7PA 3MTIA 4C03A 3I9FA 4ER7A 5GIOE 3BWBA 3FRHA 4HG2A 3ME5A 3KPJA 2O07A 5DSTA 1N7JA 4EVIA 4YV2A 2AN4A 1FBNA 5EEGA 4CKEA 2B2CA 2PX5A 3PT9A 3EMDA 4IKPA 1TW3A 4MIKA 3DXZA 5G02A 1EJ0A 2FK8A 4FS8A 3KQWA 1EAMA 4KDRA 4OBXA 4DCMA 5LQJA 3B5IA 1SVUA 1YB2A 2ZZKA 3KR2A 3FTDA 4X1OA 5DRTA 5P8WA 3A7EA 5F2NA 3ERCA 1UWVA 1X19A 4PYMA 3HA3A 4BLWA 2ZLBA 3CBGA 1O9HA 4RV9A 1L3CA 3B3FA 3DULA 3GXOA 5E9JA 5K0EA 2GB4A 3K0BA 4RVFA 1VQ1A 3LKDA 5K0CA 4BY9E 1NW3A 2IIPA 5EG5A 3EGEA 3G7UA 5EQJB 3EGIA 3LBYA 1YFLA 4PONA 2ZULA 1X1BA 2I9KA 4P7JA 3KQOA 3MQ2A 3GRUA 1SUSA 2BR4A 5CD1A 4C04A 5EGSA 3SXJA 4POOA 3DMFA 4ISCA 2JH8A 5CCXA 2G70A 1PRYA 3NWBA 3HVIA 3E05A 4PYIA 4ER5A 3HNRA 4L7VA 5DT2A 5EIFA 4OA8A 2AS0A 5FCDA 2AR0A 2YXEA 3THSA 4F84A 4JXJA 2IH4A 4GF5A 3GRZA 5B1SA 2ZTHA 5K09A 5KQRA 1EJ6A 2Y1XA 1YF3A 5C1IA 3HCFA 1N7IA 3P2KA 2BH2A 4WVLA 5KS2A 3CKKA 1HNNA 3OU2A 4U7TB 3GRYA 3KPVA 4O29A 3EEYA 3A4TA 3I5UA 3R6TA 3SSOA 4AZVA 1NT2A 4RTQA 2F8LA 3G5LA 1QAMA 2AOXA 3IEIA 1SQFA 3LECA 1MJFA 2IFTA 3Q87B 2K4MA 3THRA 1FP2A 1TPYA 3G2OA 2FRXA 3HM2A 3OE5A 4Y2HA 4HTFB 4PINA 5FADA 2C7PA 1JR4A 3R3HA 2CMHA 2PV0A 3KPUA 4U7PB 4C08A 4CTKA 3MCZA 2ZFUA 2H00A 1X1CA 3P8ZA 3PVCA 4RVHA 3ELYA 3C3PA 3EPPA 4RTKA 5E9QA 2NYUA 3P9IA 2IBTA 2OB1A 4R6WA 5HIKA 3BGIA 3JWJA 3ER9A 2AOUB 1Z3CA 2IDJA 4MHTA 4AZSA 3FUUA 3NMUF 4K6MA 2I62A 2ZBPA 1VPTA 4BP1A 4RTMA 3B89A 3EVBA 2ONYA 1QAOA 2PX2A 3LBFA 2Y1WA 1ORHA 4PYNA 2UYCA 3MTEA 1QAQA 1L3BA 5K0BA 2A14A 1JQ3A 1RJFA 2AVDA 2VDWA 1WY7A 1IM8A 4PNEA 4PCAA 2PT9A 3KPYA 3AJDA 4DZRA 3O31A 5EMJA 3UA3A 3PLAE 1QYRA 2H1RA 2PKWA 3DMHA 5CVVA 2YTZA 4QPNA 4FP9A 3SR4A 3B3JA 2WA1A 4E2YA 1EQAA 1KHHA 4G56A 5HIIA 4RSRA 3TLJA 3CGGA 4M7RA 4DQ0A 3TQSA 4B17A 4ZTBA 2EFJA 4ATNA 3BZBA 3LX6A 3OZTA 4DM3A 9MHTA 2ADMA 1RI5A 1XJ5A 5E1MA 3BKWA 1NBIA 5M5BA 2ZCJA 2ZW9A 1JG2A 3Q7EA 3KKZA 5FUBA 2VDUE 1VP3A 2ESRA 4KRGA 3T7RA 3GDHA 1VIDA 4GUAA 1UIRA 4YV0A 1G8SA 3HCAA 2GAFA 3VSEA 1I9GA 3SSNA 4BLUA 2UYOA 1D2CA 3TPZA 5LSAA 3ORHA 4KVZA 4MQ4A 4Y30A 4MTLA 2Q41A 3HVJA 4X61A 2OZVA 2QYOA 2ZIGA 3BGVA 1P91A 4PYQA 3HP7A 1VBFA 3OCJA 3CJQA 2QE6A 4V0RA 1ZQ9A 2G71A 5GWXA 7MHTA 5DTMA 2AOTB 2PX4A 5E1OA 5E9WA 3NDIA 1ZGAA 3DOUA 4YUYA 2CL5A 2V74B 1XDZA 4LWOA 2FK7A 3TOSA 3T7SA 3DLIA 2YR0A 2OPBA 2ZZMA 1UFKA 2PVCA 1YUBA 1Y8CA 5ICCA 3MGGA 2OKCA 3I64A 4PYOA 3TFWA 5D1NA 5E8RA 3GO4A 4AZTA 10MHA 5K8VA 3MAGA 5DX8A 1EG2A 3EVDA 4GOOD 1Q0TA 3JWGA 3MHTA 4E30A 5FWAA 5EMMA 5GIPE 2R6ZA 3NDJA 2G72A 5GP1A 1P1CA 3BWYA 3VC2A 3LHDA 3UZUA 1G38A 3OU6A 2OB2A 1NW7A 1M0EA 2ZWAA 3AXTA 3HEMA 4GEKA 2LD4A 5HILA 5U4XA 3T0IA 4MWZA 3S68A 1KIAA 3IYLW 2B9EA 3LDGA 4AZWA 2P1DA 3C6KA 5DXAA 3GWZA 4C4AA 2EJTA 3SVZA 1R8XA 1ZKDA 1T43A 4QVGA 4C06A 4RTNA 1DL5A 2YUIA 4HRAA 5HOQA 3RODA 2HMYB 4AUKA 5F2OA 3PTAA 4OQEA 2BM8A 2VDVE 4PYLA 1YZ3A 2PSSA 3KQSA 3HVHA 5MHTA 4X60A 3UJAA 3EVAA 3O7WA 3PS9A 5K05A 2XVMA 1Q0SA 3P97A 4WXHA 3X0DA 3M6VA 2AOWA 5BW5A 1L3IA 2VZ9A 5KQSA 3SM3A 3UJCA 3M6WA 3DXXA 5DTQA 4GC9A 4CKCA 3SMQA 5T64A 3P9KA 5BP7A 1IXKA 2B3TA 1JQEA 3OZRA 3IHTA 4KDCA 2ZIFA 2P35A 1XCLA 4PWYA 3EVGA 3R0QA 2BR3A 3KU1A 3FTEA 3EVFA 3PFGA 3A25A 4QDJA 4XCXA 2IP2A 2JHPA 2UYQA 4YMGA 5LQCA 1NW6A 1AQJA 1R74A 4HGZA 1MHTA 2NP7A 2HTEA 3M33A 2WA2A 4FR0A 1FP1D 3WSTA 2OO3A 4RTSA 3G8AA 5EMLA 3C0KA 2YVLA 5LQAA 3EEOA 3UJ6A 3M4XA 5DWQA 4XUDA 5K0LA 1KPIA 4X63A 4ER0A 1H1DA 2P41A 4M36A 2YX1A 3PX3A 3G5TA 4EQZA 4YUVA 1RJEA 4HTFA 4RX1A 2JHCA 1KR5A 1G60A 3PFHA 4GBED 1XVAA 4OA5A 3A27A 5GOZA 2ZIEA 5EIWA 2KW5A 3P2EA 3HA7A 4LECA 2PWPA 2BZGA 3LPMA 4QDKA 5DM4A 3ELUA 2UYHA 3R24A 4LG1A 5H02A 4YUZA 1JG3A 1X1DA 1I4WA 1KPHA 2N47A 2GS9A 3BXOA 3UJ9A 5K0JA 3UJ7A 2PLWA 1I1NA 1XDSA 3CVOA 3G88A 4PIPA 2HWKA 3TMAA 5BXYA 4YMHA 2AOUA 5DX0A 3UFBA 2O57A 5IH3A 5FQNA 2FPOA 3ANXA 1XDUA 3KR9A 4FT4A 3SGLA 3DP7A 2XYRA 3RIEA 4P7KA 5E2BA 1G6Q1 4EKGA 4GOMD 1G55A 3LCVB 1RJDA 1VL5A 2OY0A 3OFJA 5EPEA 5FULA 3HCBA 3G2QA 1IY9A 3OPNA 1NE2A 3KQTA 4PIMA 2PBFA 3M70A 2CWWA 2YXLA 3JWIA 2GA9A 4XUCA 2EJUA 3PX2A 4YUWA 3LGAA 2ZWVA 2UZ4A 4R8RA 1AF7A 1XCJA 5DPMA 2OYRA 4M38A 3BWCA 3M6XA 3MB5A 5DM1A 1RI4A 5FHRA 5HIJA 2QRVB 4RTLA 1B42A 3DLCA 3EGVA 3KPWA 2P3OA 5KVAA 3FPGA 1M6EX 3QOWA 5K01A 3ER8A 2P40A 3BUSA 2GLUA 3LDFA 4KIGA 5DM0A 4IV8A 3UJ8A 4CKBA 4DMGA 5K0GA 2HNKA 1JG1A 1BOOA 1AQIA 1BKYA 2OXTA 3P2IA 4PYKA 5DTRA 2BM9A 1YFJA 1X1AA 3P9NA 1R6AA 2IGTA 2CKDA 5C0OE 3GCZA 1JG4A 3FUTA 3OE4A 4F85A 1JTEA 3FZGA 1D2GA 1RJGA 1SG9A 4F86A 2ONZA 4IWNA 1O9GA 2ZZNA 3LCCA 4RVGA 3LDUA 1AV6A 4GOLD 3GJYA 5EZQA 2JHAA 2AOVA 1NBHA 3G89A 4GC5A 2IH5A 3H2BA 3MERA 1BC5A 1VLMA 3KQYA 5FWDA 5HFJA 3UWPA 2I6GA 3RW9A 3VYWA 3UA4A 4H0NA 2B25A 4QVKA 2AOTA 2G1PA 2XYVA 1JQDA 4PGGA 2QM3A 3MCTA 5LQUA 3P71T 3G2MA 4RWZA 4DKJA 2C7OA 5IKMA 2VS1A 4C07A 5GM2A 2VP3A 4RTOA 1N2XA 3KQQA 4R6XA 5EVJA 2PX8A 4X41A 4A6DA 3B3GA 3BT7A 2YXDA 4RYLA 4QQKA 5F2KA 5CIYA 8MHTA 5ERGB 2QY6A 1SQGA 2PXCA 3CJTA 2IPXA 3G2PA 1F38A 1VP9A 2XYQA 1R8YA 3F4KA 3UBTA 2ORED 5CUQA 5FHQA 4KIFA 5JUWA 5DX1A 5EHIA 5KYGA 1QZZA 3U81A 1L1EA 3AY0A 3BWMA 4KWCA 2C7RA 3KQVA 1WS6A 4QQNA 2NXEA 2XVAA 1EIZA 3NW9A 1P1BA 1XTPA 1OR8A 3FPJA 3ELDA 5K0NA 3K6RA 2EX4A 4KW7A 1QANA 2FHPA 4EKIA 3FTFA 2HV9A 5HZMA 5EC8A 3SSMA 4DA4A 3NVKI 4RTJA 4CWAA 4GOND 1G8AA 2FCAA 4OQDA 3FRIA 5E8JA 5ICGA 2Z6UA 3NWEA 3HVKA 2NNWB 3HCDA 5CVEA 3FUWA 2NP6A 5T6BA 2I7CA 3C6MA 3FPEA 3QOXA 1NKVA 5HIMA 5ICFA 2Z6QA 3EVEA 4PYJA 1WG8A 2NXNA 4Z2YA 3ID6C 5DRYA 3HA5A 4IV0A 4E32A 3KQMA 2P7IA 4P58A 2HR1A 3HCEA 2PJDA 2O06A 2XBMA 1ZGJA 2PT6A 2IDKA 4P7FA 4E2ZA 1NW5A 1WXXA 2JG3A 5EKUA 1F3LA 5EEHA 3FYDA 4RTPA 2JH9A 3G8BA 4HSGA 1R00A 3AXSA 3TM4A 3GNLA 5GINE 2AZTA 5LQNA 2O05A 2ZBRA 3C3YA 3DH0A 3KR0A 5EHGA 5HEKA 4UOEA 1SKMA 2IBSA 2PWYA 4HC4A 3EMBA 1FPQA 4HH4A 3TRKA 4FGZA 4E70A 1NW8A 2PXAA 3B7PA 3O4FA 1U2ZA 2P7HA 3FUVA 5DLYA 5GM1A 4BLVA 4PCLA 2ZSUA 3DR5A 1DUSA 1KYWA 2O0LA 2EG5A 4PGHA 3LL7A 5K0FA 1KPGA 3DXYA 4E2WA 1HMYA 3E8SA 4FSDA 3V8VA 3OFKA 2H11A 5E1DA 2V7EA 3DMGA 3TKAA 5FA8A 1RI1A 1INLA 4RTRA 3TR6A 1YZHA 3CC8A 3GIWA 3OZSA 2AVNA 4AX8A 3QV2A 3NVMB 3CJRA 4R05A 3FTCA 3AWIA 4M37A 5D1HA 3T7TA 3UJDA 1KP9A 3FPFA 2GH1A 5FTWA 1XXLA 3KQPA 4ER3A 1ZHFA 4GQBA 1VE3A 1KXZA 1RI2A 2NXJA 4A6EA 5LR6A 4CXMA 2C7QA 5EZSA 5DXJA 3TKYA 1NV9A 2ZVJA 3DTNA 3E23A 2P8JA 5JR3A 4QTUB 5DM2A 3FYCA 1TW2A 2P3QA 4RVDA 4BP3A 4DF3A 3LKZA 1KYZA 3REOA 2PXXA 2B78A 3V97A 3FPHA 2QRVA 5EKXA 3M6UA 3GU3A 5CVJA 3UJBA 4YUXA 4P7GA 4E33A 4E2XA 4LWPA 3GRRA 2GPYA 3FUXA 5E1BA 4QPPA 2R3SA 3A7DA 2PY6A 4QTTB 1PJZA 1ORIA 2OBFA 4DCGA 2AN3A 3LCUA 3SX0A
chains in the Genus database with same CATH superfamily
1PJBA 4BNZA 4LZNA 2Z6AA 3H5TA 5H3LA 1EK1A 3PB3A 4J2HA 5JD5A 3AJ9A 2IYWA 4LF8B 2JGDB 1YTUA 1P5JA 2SCUB 3TQTA 3EF1A 4BGDA 1GSAA 3PWZA 3BA6A 1JTFA 3BKXA 3AB3A 1M2WA 4JVNA 3ZU2A 5IZCA 4CL8A 2YMMA 2BDEA 4QYMA 2VYVA 3NTVA 1JDSA 2NO7A 5FBWB 3W1WA 4MWDA 2PMKA 3F49S 2IVZA 1JN0A 2YOGA 1Z83A 5JNRA 4FX5A 2O2YA 4CBVA 3H5WA 3EIXA 5ESWA 1ZG3A 3RB8A 1FJXA 1MO6A 2EEZA 1L5NA 3T15A 1PGJA 2B35A 1Z8HA 1UMCA 3LXRA 4LZOA 1JQBA 4Z4HA 1UBRS 1Y8RB 2QUZA 3BILA 1G21B 3QVTA 3UG7A 4HDOB 4FINA 2KBEA 2XDAA 4NMHA 2ATXA 4RJLA 4WCDA 4Z0PA 3W8NA 4ENQA 2AA3A 1ZINA 4CM8A 5HDQA 3E9EA 2WD9A 4C1NA 2FF5A 1NX9A 1M6HA 3N7UA 2JFGA 4WCFA 4JT9A 4UZSA 5ENZA 1AMOA 2EFGA 5GIOE 4IJVA 4KPUB 1Y7HA 3O2JA 4EDFA 4OVKA 4NV1A 3UOGA 1KNQA 3OIYA 2G9QA 1QR6A 1T5TA 2J33A 2B2CA 2VJKA 2FWJA 3LI2A 4QEKA 2W6PA 1TW3A 3C1AA 3CLTC 1P31A 4BLPA 4FS8A 3LOQA 5AR1A 1QRRA 2BIFA 4C4XA 1GIAA 2H4XA 3LUPA 4WNAB 4ESOA 4Z3KA 3JR3A 3QFSA 4H9GA 4QECA 4ZC1A 5B1YA 1BJRE 5DRTA 4H08A 2WHRA 1Z7WA 2OM2A 2WSMA 2WY2D 3O1JC 4K9NA 3UGTA 4ZGBA 3NRBA 3Q0IA 4P84A 5E9JA 1ACMA 1R4AA 1X0VA 3P45A 4K1XA 3ZQKA 2I2AA 3HCWA 3WV4A 2NSJA 2WTMA 2QTWB 3LPCA 2JGKA 4RVFA 4QGFA 2WU1A 3ECSA 2IIPA 3FWPA 1K92A 3E9RA 5HJ5A 5I7EA 4L07A 4PZAA 2X0RA 1NL3A 2BW0A 1E2FA 1QPZA 4G1BA 4PONA 5ARBA 4R68A 1J1UA 1KVQA 1LBQA 2F59A 4XWGA 3QUSA 4GX1A 2F1HA 4NOKA 3VR5D 1K7XB 2PGOA 3AI1A 3RC8A 1T9GS 4ZK6A 2C97A 5CD1A 2DMRA 4DC1A 1PG5A 1PO7A 2G70A 1KO1A 3NGMA 3VVCA 5CK5A 4EGSA 3RVMA 4MUJA 3J80A 2HTFA 3O47A 5DT2A 4LKOA 5I9BA 5JCPA 2EFCB 4X6XA 3W04A 2WHYA 4HVAA 4HNHA 3K9QO 5IMSA 1RLIA 4D25A 4F84A 1C0PA 1JL3A 4RABA 4BQPA 3CUEF 3O94A 5TPZD 3VYRB 4LMBA 1ZUWA 3R5SA 3TSZA 2IYAA 4KAFA 1C80A 3DZCA 3D6TB 4FFMA 1UXOA 3KVNA 2GPAA 2CLSA 5HBGA 2ZRMA 4HAUA 3UF0A 1T5LA 1M2OB 3ECCA 3IPLA 1K3TA 2GFHA 2JVKA 1F4PA 3HADA 4WNIA 4FQ8A 3WP1B 4L7QA 5C3MA 1EX6A 3G2OA 1A5BB 4NATA 1I4EB 2IV2X 2OESA 4AYXA 4ZEXA 1NBOA 1T6ZA 4FILA 1NRXA 4MRAA 4QATA 4EVSA 4HDCA 1OFUA 1E5QA 1NBEA 1H4QA 4K9SA 2PVPA 3LUCA 2X40A 3A2KA 4F45A 4QC2A 4YASA 2YNMD 1CTQA 4WESA 2VH2A 1C1YA 4L5IA 1D09A 3ELYA 5GJCA 1F8FA 2ZDGA 4BNFA 4E88A 4DG8A 3QWFA 4L22A 1P9OA 4MKGA 1N4DA 4WOKA 2NACA 4MYUA 4K6MA 3LOPA 4PQFA 1FFCA 1KO4A 4IR7A 1P1KA 2AI1A 1VPTA 5THQA 3L7CA 2BONA 4AN4A 4FCVA 3ZCSA 4Z4QA 2D74A 4C0SA 4KMSA 1OFGA 2GEJA 1IOLA 3IP7A 3TUJC 3GR6A 4BWFB 5B7NA 4YI5A 4ZU3A 3RT9A 1K63A 4KQFA 4P4GA 5K0BA 2H0QA 1A9XA 1P44A 1WVIA 1O7JA 2RJ3A 2VDWA 1EE1A 1KI2A 3A0UA 3USCS 1X8KA 5EMJA 3EH1A 4ZCQA 5ALVA 1YUNA 4RK5A 4OSEA 3DMHA 4XR9A 3UHJA 4MOWA 3WZMA 5IT9A 1Y8QA 1RZUA 5IAEA 3WB2A 5K4GA 2ZJAA 3R3XA 4BXOB 1GAXA 4YT8A 4NE2A 3BTUA 2OG2A 4NMMA 4DUGD 1J99A 1W2GA 4XD7A 3IV7A 4ACBA 5BV2P 2GM4A 2C3OA 2ZI6A 4XGNA 2XB8A 1AX9A 1GRCA 2G1AA 2GNAA 5I8PA 4KZPA 5L4SA 4MGKR 1B16A 3H4MA 3ZCUA 3DUFB 1YI0A 4MP6A 1EWRA 3REGA 4AZ3A 1TFRA 4FFBA 1H66A 3NIDB 4A8JB 2R4TA 4KRGA 4G41A 4KUHA 3IHLA 5AVJA 2UXDB 1XVVA 1G8SA 4ADSG 4TTSA 4RE6A 1E99A 2G9UA 2WJGA 4YK7A 1X86B 1D2CA 2WWHA 2PWAA 1UBUS 3A05A 3GMDA 4M7OA 3CPEA 4QYIA 3K4HA 4ZI5A 6Q21A 4LE1A 4QWMA 1FDVA 2ZE5A 2QYOA 1EFVA 1PQYA 3AJAA 3DFFA 4TN5A 5CIQA 2BUCA 4GKAA 4W1RA 3U60B 1HM5A 1YD7A 1EVZA 2XWBF 1SVNA 3AINA 5GWXA 1GITA 4KNVA 4UHEA 2AOTB 3VR2D 4CF4A 5FBQB 2E3JA 2P9YA 3BJRA 3GP8A 2VDQB 3WGUA 1T3LA 3EPLA 3DGEC 4XPIA 1S89A 2ZRFA 4W5RA 5LIRA 5HWSA 4FIZA 1C0LA 4O4HF 5IULC 4PYOA 5E4TA 4EBBA 4HHEA 2XODA 4MHOA 1JE0A 3PDUA 4L6CA 4TMTA 1ZD1A 4GLOA 7YASA 3ZWKA 2VVTA 4E5KA 5K51A 1OBOA 2ONJA 5D6NA 1LJ8A 3DPIA 3NCTA 4L4UA 3ZXIA 3PQ2A 4MW4A 5EMMA 3EIOA 4ZOEA 3D7SA 1E1LA 1HFJA 4XGRA 5GIPE 1YQQA 3KSMA 1BS2A 2J4CA 2WKSA 1T10A 3GLIE 5TS3A 1LBSA 1TRKA 3BRQA 4BN4A 3I1FA 1IY0A 1WLSA 4BO2A 2AJLI 3HBMA 4EY8A 2OK7A 4GKJB 5KTOA 2QR5A 1AKEA 1R5JA 4KVGA 2HF8A 1V35A 4ZZIA 3I9LA 1WIWA 3QTTA 2G6TA 1Q84A 1R8XA 1S9DA 1T43A 4I1SA 5FBVB 4H35A 2FR0A 1WR8A 5EA2A 4X3PA 1X9IA 3H1TA 4PNHA 4TYMA 4RZSA 3K6JA 2PT5A 1LDGA 1B14A 2NTEA 1UPUA 2C4MA 3TKLA 3OCYA 4FHCA 3OIGA 3ZHYA 3ZXSA 1PW7A 2X14A 1Z34A 3KJNA 1KI1A 3BMCA 1KY3A 2RHTA 3A04A 4D6YA 5K3AA 2IODA 1SQSA 4OP2A 5MGNA 2V1UA 1CYEA 3IHTA 1TAHA 2ZJ4A 3CRRA 2EZTA 1CY2A 2WNIA 3KU1A 2IYZA 4CEJB 3AW8A 4HGZA 2IKSA 3ZHOA 2WUDA 5EWJA 5EN4A 3AJRA 1OIXA 3D7RA 4JGBA 3R41A 2JFHA 4L9WA 5LQAA 4DJJA 5CB8A 2ZR0A 3OTQA 4CGZA 1GDDA 3IP8A 4HXFB 1QHHB 3L8MA 2ZVPX 1C4OA 5D5PA 3PGMA 5JY6A 3QV1A 5JBNA 1GY8A 1NUUA 3DF9A 4GECA 1Q7CA 2VI5A 1K8RA 1XVAA 3OPMA 4NU5A 3WB9A 5B7QA 2BPOA 2K2QB 4E12A 2PSJA 1KJ8A 1JBQA 3BH6A 4QE3A 4ZO7A 5ALFA 1GNPA 2GF0A 3BWDD 3JARB 1LPAB 2BKLA 4NZOA 1D8AA 1C1DB 4ONEA 4ESHA 5GTDA 3KUDA 2PLWA 1USWA 2HWXA 1LLFA 5K3FA 3RDPA 5JSZA 1L4BA 1IBRA 4Z7JA 4OQNA 3QW4B 2G83A 3X3HA 1GQOA 4FT4A 4YRSA 3B3AA 1EUYA 4B3BA 2VL7A 4X92A 3A32A 1G55A 1E2BA 1G63A 3DPSA 2B4RO 4I3FA 1VL5A 1XA4A 1Z08A 3OFJA 1JQLB 2Q9AA 4NR0A 1XZIA 2LIPA 3M7IA 3K9CA 5FBHA 8ADHA 5F5XA 2GCIA 3JWIA 4IFEA 4ZWNA 1X42A 3U4CA 4NBLA 4Z8YA 4YUWA 1QUFA 5KOIA 5A3RA 3LQ2A 3QLJA 3H1FA 4R8RA 2DWUA 4BO0A 2OV8A 3MWJA 4P4UA 3H9CA 5LD2C 3WK5A 5AQ1A 1AG9A 2DR0A 2YC4C 2D7CA 1GEEA 3EPHA 1E2QA 2J41A 4W1SA 1CK4A 4QELA 5D00A 4BGUA 4GVLA 4IHKA 1JFSA 2WU0A 1PR6A 3DONA 1K08A 3O8DA 2P9BA 3P2JA 1JDBB 4IV8A 5A0VA 5BR1A 2NV2B 3W3AA 5C1OA 2RHCA 1BOOA 2GCGA 3RAEC 3NKLA 3PPXA 4IXTA 1SVLA 4J0GA 4WH0A 1I10A 1ODCA 2BEUA 2GDJA 2PMFA 2VZ8A 1KAMA 3GCZA 3FUTA 3GEPA 3OF5A 1NAIA 4OJYA 4TT3D 1HT2E 1T8SA 1Z28A 2NX2A 1ZD3A 2ONZA 2VJDA 1EI9A 3LCCA 3PDIA 1I36A 1VM6A 3WBKA 4ECEA 1IUPA 2QE7A 4PHFA 3HK2A 2NUAB 4RKRA 5JMWA 4WWHA 3K0AB 3FOBA 5CD9A 2XV1A 4WT7A 2XT6A 3PFNA 2ID7A 5DEOA 4WZBE 4M9QA 1L4LA 1HYQA 1N57A 5ENDA 3VU9A 4FONA 3AFIA 1IQUA 4GWLA 4H3SA 4P2GA 1V8ZA 3UHAA 1L9XA 3R4VA 1L1FA 3V4PB 2JJ2A 2HHHB 3RU3A 1TT5A 1HKHA 3DTTA 3EVNA 8GPBA 4DKJA 2BJHA 3DMTC 2I7DA 1BFDA 3FDXA 3DFIA 3IVXA 3P1JA 4NOMA 3F5DA 2FUG6 4D0GA 1D9ZA 2XEDA 4EY3A 3MGCA 3IP9A 5IW8A 1UPAA 2EXXA 2FWPA 2C0QA 3NHAA 5DWDA 3B3GA 2CLFB 4P83A 4CG3A 5IVKA 4XIJA 4PZUA 2AD1A 4TLDA 1HLGA 1UBTS 3VHXA 5AW1A 3CCBA 4KBYA 1VP9A 3B5JA 1ZSVA 1WXQA 3UBTA 1MFPA 4FI3C 1P9WA 5FHQA 4BO8A 1HDCA 3PKJA 3X43A 1Z3IX 1PEDA 1RW4A 3W78A 4YRZA 1PCXA 2FPLA 1JEQB 4KFRA 1CRZA 3GLIA 1OAAA 4G89A 3PRHA 1GILA 3NW9A 1VJ0A 1Y63A 3L6OO 1IG3A 1JXQA 4BAZA 3EZLA 3L6BA 3S55A 3NX4A 4O4IB 3FTFA 4GOJA 5FEUA 2MT9A 4Z1MA 3WYFA 2BE9A 2CDAA 1I3CA 3WA6A 3CKMA 2AX4A 4OQDA 5ICGA 3IIMA 4YH1A 3CLKA 2GRJA 3CPJB 3AM1A 1SHTX 1H2RS 1SXJC 1WQ3A 1WCV1 4GR5A 1YDMA 2VXOA 4AJ1A 1S8AA 1Y1QA 2I7CA 2X0FA 3ZN2A 1VHTA 1L2TA 3PD0A 1B15A 1GA1A 1SHZA 4I4LA 4YJFB 1WDMA 2DT5A 2PQ2A 1IEVA 2PU5A 2XNCA 2DUUA 3VR1A 2PUDA 3ZDRA 4QRHA 3V8QA 1EWVA 4D0RA 3I9OA 2ODBA 3ZH2A 3Q0EA 1RLJA 1VOTA 4BWVA 2XRZA 2IDKA 1FRFS 3NT4A 2JGEA 1AK2A 4EO4A 5CDGA 5CNJA 1N3YA 1UXIA 2X8JA 4UFNA 3W2IA 2FNAA 3M5DA 2BFDB 5LIPA 16PKA 4I50B 4TMWA 3UKOA 1B41A 4C3ZA 5I7OA 2IOHA 2O05A 3Q41A 3OQHA 3ZCRA 4HC4A 1A98A 1NT4A 1UBMS 2CVPA 2KPOA 4FFLA 4R1PA 2AR9A 3GRCA 3H8JA 4H60A 3UT5B 2HN9A 3LAWA 4PCLA 5CLJA 1ZGGA 3LHKA 3OQNA 3HS3A 4B48A 3LDAA 3N3AC 5K99A 2EZUA 1J39A 1E3WB 1G3UA 3FM9A 2J3IA 5A9SA 3E9QA 3T9CA 1X39A 1NYQA 1JMKC 1AZLA 2CKMA 5DGIA 4BJ6A 4OYYA 2B94A 2NZVG 2YV3A 3B2QA 3LQ4A 4H27A 1JAHA 1CUVA 1G20E 4JX8A 3SZUA 4CCSA 2YCLA 3GFRA 1SXJE 1LZKA 1NZDA 4KYUA 1Y7IA 3EXHB 4RHTA 4CMIA 3M3HA 4NC9A 2CXHA 5EERA 1B8PA 5DXJA 1T0UA 4RH3A 4N01A 5GONF 2WIGA 1QR2A 1C7ZA 4C7OA 4LRQA 1FC0A 1NYLA 2R9VA 1J0BA 2IU3A 2C1EA 1IXSB 3PNBA 3Q3IA 4RVDA 1SAYA 3PNPA 4JL5A 5BRNA 3WKCA 3HDTA 5DYIA 1MC4A 3S2EA 4H1TA 2XOKD 5EKSA 3M6UA 2P75A 5J23A 2YFKA 3FWKA 3C16C 3GEIA 1QH8B 4E33A 2PFKA 4E2XA 1K2WA 2J7PA 4FNAA 4BNIA 1RHRA 2OXIA 3T8YA 2I4LA 4F0JA 3IPAA 5L53A 2ZYDA 1TLFA 3PR3A 5ESDA 2I4MA 4BO3A 2R3SA 1UJ2A 1E89A 3P9ZA 4DIEA 3EIFA 4ENUA 4JLWA 3NH9A 2Q9UA 4CFSA 4DCGA 4DQUA 4LYYA 1VHLA 3RIXA 3SX0A 4EEZA 2AFRA 4EJ6A 2UXBB 2ZR8A 5EE1A 4CODB 4R01A 2LE0A 1AF4A 2QZZA 2WUVA 2RB4A 5JS6A 3C3XA 4XUEA 3G79A 4D5EA 3PBKA 5AVKA 1EHIA 3GGDA 3IV6A 3RK0A 2JF0A 5IYZB 3NYRA 1JJ7A 1U7TA 3RYTC 4CTJA 1QMPA 2Q5EA 1V5EA 1LXCA 1M2HA 3H2HA 4RK4A 3NNDA 2A9RA 2AN5A 3AL3A 2NYAA 5AW2A 1JKFA 4EO7A 3WWPA 4EGAA 1BHJA 2HU2A 2NXCA 2PUHA 4KV7A 1HT3A 1PJSA 4GEGA 4X85A 5DNDA 5DSXA 4TS4A 4E31A 4IIBA 2XTJA 4OBWA 4WLUA 3EN0A 3KHKA 1KDZA 1B6SA 4JVLA 3COVA 5F7XA 3CG4A 5LQKA 1CR4A 4U3JB 1TUEA 3DUWA 1IIBA 1L5RA 5BQFA 5K5EA 1KJWA 4LGVA 2R6CA 4FT2A 3SQNA 1YR7A 5BVHB 3ETCA 5IUNC 3IALA 2Y66A 3JSAA 1NFQA 3ZQ6A 2DGDA 1PG0A 3OFNA 1RWWA 1J0EA 1M2GA 4EA6A 1VMDA 1YZFA 2XTAA 3S99A 4IKPA 5BNWA 5LA6F 1AB5A 1FJGB 1EJ0A 3G85A 3WK9A 3RVPA 2FEMA 3HBLA 1XZAA 2FMKA 2F1OA 2PM8A 1NURA 1MV5A 4KGDA 3TSWA 2XT9A 3K0EA 5HW0A 3LC7O 5CR9A 3Q6MA 4DRXB 5KYKA 4ID9A 5CLQA 2ODAA 1H0KA 4R71A 1L5WA 4QYIB 3K0BA 4O2AB 1EVEA 1TAGA 4XUGB 2G06A 3LKDA 1FS5A 3I9MA 1EUZA 3MOSA 2FMTA 2ZR7A 4JP3A 4MAMA 4GBGA 4OMCA 1FYWA 2Q1XA 3IMCA 2ZULA 3L5OA 4P7JA 4BMXA 4MRVA 3C6XA 2FWAA 3D8TA 3GFQA 3HSSA 4BNWA 1FUEA 5ITZA 2EBWA 5JW6A 3KEMA 5H1YA 1XVLA 4BLOA 4BN5A 4CLOA 4EHIA 5B4UA 1KL7A 2ZSIA 3HN7A 3NM6B 2BDUA 4Q16A 4HADA 4TLMB 2WI8A 2H0RA 3LKBA 4RGVA 3SDZA 4EARA 2DPHA 4MPPA 3WNDA 1A1VA 1S8FA 4PIVA 4JJFA 1GA6A 4KXQA 4L5BA 4MQ5A 1HTTA 2AS0A 3F6SA 3N8KA 3THSA 4P3YA 4F7WA 1VKZA 3BMQA 4GP6A 2ZTHA 2ECPA 1V7QA 2O2XA 3K1YA 4B3HA 1FNMA 4IYJA 4XFJA 2VF8A 1YF3A 4P54A 4JT4A 4ZT7A 2RBKA 4D97A 2AZMA 2WYUA 4PX2A 3ZYZA 1DAHA 4X00A 4LJYA 5JMTA 2WV7A 4MJ7A 1GNSA 2HA0A 1RCFA 4JVOA 3QMPA 1QAMA 4D8YA 5IRCD 1N78A 1I8TA 1L8QA 4OYHA 3QBVA 1ODLA 2JEZA 3I0MA 3N8DA 4JCCA 4YJKA 3W6PA 1XQ9A 2EKDA 1IZZA 2Y6VA 4A91A 3G17A 2JJ1D 5AH0A 5KYYA 2DWQA 4LYFA 4B4UA 3M82A 2RH4A 2O2GA 4C08A 4FWIB 4ZHSA 4DCUA 5CA0F 1S4QA 1N5IA 1P61B 1TJ3A 3AF1A 4Y2RA 1BMTA 2QP3A 5FNZA 3CVUA 2SICE 4RD1A 3K09A 2ZSHA 4COOA 2W2KA 2CV1A 3G9ZA 3Q2IA 5PGMA 1A95A 2DFDA 4RELA 3T9EA 2Q8PA 1SXJA 4B44A 4COKA 3K94A 3C1UA 4C30A 5C5DA 4AZSA 1ZJ6A 5JHGB 2INGX 1O95A 3AHJA 3DMYA 4Q4JA 3BTSA 3AQ4A 3C8ZA 2GKOA 3O4IA 5JNWA 1IBMB 1ST3A 1ZKMA 3G8DA 3OEHA 4K26A 1AVTA 2BKUA 3Q6NA 2HRQA 2CLLB 4PN7A 2IS1A 1DADA 1IM8A 4L8GA 3RH0A 3BC1A 3ROZA 5EJ2A 2PT9A 4Q9AA 3WMFA 3KYCB 2PR7A 3IAS6 4DZRA 1X7DA 5L7TA 4LYAA 2Q99A 1Q3HA 1MX5A 1C29B 1ULSA 2X3UA 5D8DA 3VHQA 5BSTA 2EDCA 3AG5A 1BGVA 5AKYA 2HBQA 1DAGA 2G1KA 2V5VA 3VGJA 2V7UA 3GMSA 3K8ZA 5FV4A 1BE0A 1WJGA 2HKIA 4FGWA 4B17A 5KUTA 3T0GA 3ZHVA 1WZ2A 1PJ2A 1XAJA 3DLPX 3GJ0A 4K8OA 4QUGA 1NDQA 5AO9A 4GPZA 3WGGA 5BYKA 1O6CA 2ZW9A 4IMRA 3BN3A 4RA6A 3IOCA 3QVWA 4LTDA 3R7BA 1TD9A 1ENZA 2VRWA 3KE9A 5AI6A 4E3ZA 3SS8A 3K73O 2BJWA 3OOWA 3WOHA 3OD1A 1NMYA 2RGXA 1VIDA 4YT4A 3UMCA 2J3EA 4BVJA 1Z4OA 5DBEX 1DAPA 1BN6A 2JRCA 4I81A 1E3IA 1PFGA 4M4SA 2Y1OA 4FYYA 2W2TA 4PZ9A 2GBGA 1GZSA 1OW3B 3I2GA 1R9NA 2AI2A 4S2UA 3K9WA 1GZ4A 3VU8A 7ABPA 5KDOA 3FVWA 5HKAA 2TMYA 3X44A 2WVJA 4CM4A 1N2HA 3VPSA 5KQPA 1NC3A 3KV3O 4I99A 4AD8A 3O7MA 1SOMA 1VB3A 2YDYA 1R5OA 4CLRA 3KHTA 3ETHA 1TI7A 3FLBA 3PR2B 3BQ9A 3HL4A 4JB3A 1OFUX 3H42B 4ZT6A 5IKOA 3WMEA 3HJRA 3Q9UA 4OQYA 2FAXA 1Z0FA 4MIYA 3TO5A 2O19A 2TRSB 3J81k 2VDMB 2XI4A 4UEKA 4US0R 4WPGA 1PEYA 1ZXLA 3BFVA 5E8RA 1WZUA 1OPXA 2IVFA 3QJYA 2QL5A 3MAGA 3QPDA 4OUKX 3AZPA 3A3YA 5FBZA 3CTMA 2D1TA 1HDXA 1YRBA 2FEPA 2X3FA 1TK2A 5C4IA 4LV6A 3T94A 4I08A 3P5SA 3ZY4A 1VG9B 2CVZA 2V7VA 1H94A 2TMDA 3HO8A 5GP1A 4PR0A 2FE4A 1MG0A 3K70C 4ND5A 4BJ5A 2EZ4A 3UC5A 2QD1A 4OAPA 5BYBA 1F0YA 2GZ3A 1DEOA 3HI4A 3AXTA 2LD4A 3KB8A 1ADBA 3T5TA 4YWHA 4TRRA 4BJHB 4J1QA 4L4ZA 4HBZA 3G0IA 1KHTA 1CG6A 2G5TA 2E82A 3WGMA 2W8ZA 5CW2A 1W6RA 1F0NA 1VPLA 4QL3A 1MORA 3NOVA 2IXFA 3AVOA 3K7EA 2F2TA 3I09A 2PZAA 4A15A 5CYFA 1CV2A 2JFUA 1R8QA 1NFFA 2PSSA 3ZWAA 5IVIA 2HJRA 5C8YA 1H4SA 4YCAA 4JOBA 4HI0E 3P97A 4PXYA 3WKEA 4NEQA 2C5BA 2VP0A 3V33A 1CRQA 4TSFA 2F3UA 5JTTA 1QB7A 2CDBA 3GT7A 2WZCA 2PZEA 1KK3A 2VH5R 2ORYA 4OHCA 4BFUA 5LP6F 1E1CA 3HV2A 4N4AA 4CIAA 3VA7A 4HNSA 4PWYA 3BIOA 4XH9B 1E1YA 2O8BB 1G41A 3TIXB 1MHTA 5FWYA 1FVOA 3KFVA 4E5VA 1B8VA 2ZJ3A 2WA2A 5AVYA 3QH4A 1F9EA 1HQYE 2VJLA 2YVLA 5KNDA 4RM3A 1VI2A 2PUVA 4C0XA 3ZHTA 1W9MA 1KPIA 1M1NA 1JIVA 5C4GB 5BOSA 4CM9D 4B6JA 1UT5A 2G6BA 2J30A 4BNXA 1CNEA 1BX1A 4G4JA 3WL5A 1GNLA 1I80A 1SBHA 4YQZA 3PFHA 4GBED 4IM7A 5LA6A 1S2OA 1QV6A 1JPVA 3AY6A 5FUXA 5THKA 1N9GA 2NUPA 1V8PA 2NTJA 3ZWXA 1BWRA 3OQ6A 2C9ZA 3IVRA 4UVIA 4WVFA 4BOYA 3WDKA 3EDCA 1P8JA 3TEJA 3VJKA 1ODIA 2N47A 2ZEJA 3AHHA 5J5AA 4ASUD 3UJ7A 1T4MA 4Q6WA 1I1NA 1ULUA 4O5AA 3NOOA 5LBTA 4OQXA 2Z1MA 2AOUA 1QP8A 1I3MA 1YZKA 2HJSA 2J3LA 2WHPB 3HLKA 4TUYB 1IY2A 3RARA 2OZEA 2SECE 3N2LA 3DEHA 3RIEA 2PGAA 3IVAA 4DV0B 1G6Q1 1IHDA 4GOMD 3VDXA 2GETA 1JXMA 4LZLA 5E7JA 1Z75A 3OF3A 4IV5A 3M4NA 5G0SA 3WGOA 1IY9A 2QM0A 3MBIA 4G0XA 1PUJA 1ZM9A 5ILQA 4JB2A 2G4CA 4AN1A 4C43A 4DLTA 4MYSA 5JANA 2Z83A 3FKSD 1W4BA 3LYLA 1GL9B 3VZBA 4EX6A 1U2GC 4UCXA 3WRVA 4B8ZA 4DDMA 5DPMA 3CSSA 5D84A 4RDIA 3OWOA 2DG2A 5C7LO 1EM6A 4RTLA 3ANMA 4E5PA 4BE7B 3AV0B 2PA0A 5A4IS 1WHSB 4QGGA 1KVRA 2VAXA 3A10A 2ZBGA 4HX2A 4CTMA 1BEUB 1RJ9A 3MXOA 2X4IA 2VKQA 3NEYA 1TCCA 2XD9A 1Z7BA 1AQIA 2W22A 1Z0ZA 2XKAA 4JD5A 1DP4A 4DA7A 5DTRA 5LXTB 1B1AA 4PY2A 1JHRA 3Q2OA 2CKDA 1Y5IA 1V2GA 2RGDA 4CI9A 3FN4A 4DCVA 2ZS7A 1YRHA 2OZLA 3IR6A 4G8DA 1I7QB 1IBLB 1FDUA 1OI3A 2I76A 1A2OA 1C3VA 1SGWA 5CT6A 4A6PA 1U8EA 2RKBA 4MEAA 4ZMSA 4RVGA 1N7GA 4XYMA 1AV6A 4G4SP 2V65A 2ZVQX 5IJAA 2Q5IA 3FBTA 4HJRA 1P2UA 1WZIA 2J32A 1GCAA 4FQ7A 4KQEA 4OL9A 1VLMA 3R9KA 4EI2A 2IYTA 2HD4A 5A1JA 2R1VB 4EG1A 2XCLA 3HCRA 3E81A 4X6UA 3PDJA 5KB3A 3CLVA 5CA0A 2H1HA 3L7YA 4B09A 1WHTB 3GRKA 2W00A 4YRDA 1W5EA 2P4EA 1QIKA 2GXUA 1G1AA 1QFMA 2YIMA 4NV3A 5JT1A 1GUZA 5I7HA 1WPRA 3QTBA 1I4OA 2P6PA 3KEGA 5CDSA 2IRWA 2EFYA 3B13B 2WWWA 1AKQA 1ENPA 1II8A 5EIXA 1PZHA 2MYUA 1ZRMA 2Q6VA 3D8NA 2O52A 2C8KA 1KFKB 3NYWA 4HAVA 4LOIA 3W6ZA 2IPXA 3Q6IA 4NFYA 3IT1A 3LK7A 2HWWA 2C04A 2H5LA 4QUKA 1DXOA 3VI3B 1S7GA 1Z4QA 1HYGA 3LYUA 1B6RA 4N54A 3UWSA 6YASA 1G4AE 1TJYA 1ZVMA 3DM5A 1KQ3A 4BMNA 1PV4A 5FV7A 4CU2A 3H5OA 3ZZTA 4M98A 2D0DA 3PENA 4PTLA 5SY6A 3DZJA 2NXEA 2Z08A 3P9RA 4GQAA 5ALOA 2PE5A 3CRVA 1N2CB 3S2IA 4BX3A 5CA1A 3DB2A 2HHLA 3FPJA 3I39X 3QELA 4BEBA 2H63A 4F46A 5I3CA 1J06A 1ML4A 3DCYA 3FG9A 4KW7A 4MVCA 5AHKA 1KDOA 4HFNA 2WIAA 3K8YA 1LW6E 3FMGA 3IHWA 4WX2B 3TE6A 5EP3A 4JJ4A 3TW6A 3I8OA 1OVMA 4QUJA 2FCAA 4I0WB 2JGJA 1IG0A 3DAOA 3H6KA 4GWGA 2ZITA 4EUNA 4ZCRA 1JHXA 2J6IA 3PFFA 3FUWA 2CXTA 5LKRA 2NP6A 1QS0B 1HPLA 1VJ1A 4P4SA 1N8NA 4P35A 3EVEA 2NSLA 5EJMA 3I9KA 1OB5A 5AKZA 3TE7A 1KO7A 3GLRA 3EEIA 2FEWB 4WA8A 2GCPA 2VHTA 2I80A 1CR2A 4WHMA 3FSGA 3ZCXA 4WBNB 2QT9A 3JAMA 5F9HA 1UMBA 4ALIA 2IZZA 1U3TA 1ZGJA 3FDZB 1LPNA 4KXVA 4X5OA 3SKXA 4RHXA 4CNBA 4EQ6A 1XMIA 1YR9A 4PLCA 4LISA 1G9XA 1RM3A 2WDPA 1O8BA 1L7VC 1CY6A 3R9IA 4UAGA 3E4CA 3QKSA 3N7TA 3ZWDA 2CVQA 4R4JA 2MMGA 2ZRDA 5CFZA 3PNMA 4QRIA 4GU5A 1NI3A 121PA 1PL7A 1PWZA 1QFSA 2PXAA 4ZRNA 3Q12A 1EX9A 2QJTA 5J40A 3RVKA 3LUFA 3NRJA 3GLGE 3DE4X 3DE5X 2I6XA 4XARA 1NNEA 3TTWA 2B2XA 5KCMA 2HGZA 4DY6A 4ZVLA 5BQ5A 1AHIA 4DABA 5KOHA 4BPRA 1WE2A 3N0TA 4MKRA 1X7ZA 4QOJA 1HT0A 2BBTA 1Y3DE 3DB1A 4EABA 1INLA 2IYVA 1K3UB 1MO4A 1KQOA 3AFMA 3R6GA 4J1NA 2FPGB 2OHVA 3ZBUA 4KO1S 1Y1SA 5BQXA 2HCBA 3OAAD 3O4HA 1V5WA 4KGZA 1RHKA 2MOKA 2ORWA 1MT0A 4UBMA 3BAFA 3IP6A 2H4JA 5BQOA 4FFPA 4P2BA 4XQCA 1IZYA 5JH7A 4FR5A 4OQPA 5EWLB 2C7QA 2XCQA 4OHKA 1C50A 2PU7A 1EWQA 1XT6A 1FNSA 4HWPA 2QN9A 1XNJA 5TIIA 4BP3A 1S02A 5B1EA 4XA8A 3IQHX 3LFUA 2QLTA 4OXIA 2NG1A 2BD0A 1M1UA 5EKXA 2G36A 5T4EA 3V3KA 4B3XA 1M5TA 1H69A 3O21A 4P7GA 1M2VA 1WL8A 2JEYA 2JIRA 1IZ8A 3AY3A 4JFRA 3RHSA 4F8JA 2IPMA 5JWOA 5LP6A 3OP4A 1V3UA 2FJUA 4KACA 1QE3A 1E2DA 3QKRA 3WLFA 2QVXX 1P7CA 3E61A 2JARA 3GOHA 2HEGA 3L4BC 4N0PA 1XMOB 1NPDA 1ZM7A 4KYTA 4ER6A 3R5TA 1QKJA 4RUKA 5EJAA 2IH2A 2XADA 2PSHA 2C5GA 1EH5A 5DM70 5FA5A 5AW7A 3IE1A 1CRLA 5CFPA 2NNLD 4R8SA 1W0JD 3ES9A 5I7VA 1EZZA 1J8FA 2P3LA 5IARA 4NBNA 2I7VA 4Z99A 4M1ZA 1C9MA 1XEAA 2OWDA 4QRDA 1DIOB 2FPIB 3TOZA 1GGNA 4ZAYA 4UDXX 3H2YA 4EVRA 3H87A 3WSWA 2HLDD 3KDPA 3HJTA 1G21E 1ZCBA 4UAUA 4EK9A 1GRNA 5CFOA 4ZVUA 3W4KA 3QEBZ 2VSYA 4DSOA 2XQIA 2AFVA 3CCFA 3EZ2A 3FGPA 3ISVA 3C7KA 4QX6A 1GFIA 4URXR 2DQYA 2C2YA 4MAAA 4KN8A 1E9EA 1OWPA 3FCSB 3W5CA 1I7NA 4C0KA 3HWX1 3K3PA 4MW0A 5GV7A 3WXBA 3MTIA 4X3OA 5JALA 4BASA 1HBJA 3ME5A 1FQJA 3TZ6A 2O07A 1H8ED 4YV2A 4HRVA 1GXSA 1YO6A 2C9CA 3A1EA 1DELA 1S6YA 2KLBA 1D4FA 3DR3A 1FJHA 3WISA 4AKEA 1NASA 4PPQA 5FI0B 1GG9A 1GZDA 1O87A 3V46A 5FO0A 4DCMA 2XUIA 2FP4A 1JFFA 4FEEA 4XM1A 4NFSA 1L4KA 3LNTA 4PSCA 5EWMB 2CD7A 1R7RA 3BGWA 3OG9A 1Z7YA 5LQDA 3LJKA 2E9SA 3QOYA 3JR7A 2LPMA 3CBGA 1O9HA 1Q0ZA 3GJTA 4HH1A 4J90A 5LDGA 1V7CA 1DRUA 2GB4A 2L19A 1GYRA 2I55A 1O3YA 1WABA 3T12A 2RMKA 5BW6B 2EATA 2OFPA 3BD7A 4IPTA 4O2BB 3OLVA 2HLNA 2MINA 3WIUA 1EDDA 4NYMQ 4ZQGA 2OECA 3IAM1 1ISIA 4MB0A 3OCWA 5F73A 3KQOA 4UTRA 1QU3A 4XIIA 2AFHB 3ZQUA 5A4DA 2B5VA 2J48A 4TYWA 2IEIA 2DSNA 2V3WA 3K1JA 2GSWA 4GXQA 4DCSA 1MO3A 3ZWYA 2PRSA 3U40A 5LUAA 4KMOA 2WWGA 2EP8A 5EUQB 1HE4A 4XYLA 3G0DA 4ER5A 3PNKA 2MSLA 2J45A 1SCBA 4L7VA 3QKIA 4Y6QA 3MA0A 3A6KA 3WY9A 4CVNA 4RKYA 2GK6A 4O0MA 5DASA 5G1PA 4ZT4A 1O94A 3ESDA 4EFLA 4YYEA 1VIAA 4H2DA 2XHZA 4JXJA 3TAXA 5K09A 5MGBA 2D3TA 3BE5A 4C5AA 3LT5A 2YVQA 2NIPA 1FMCA 3PNSA 3IUSA 4M54A 4F21A 1B3RA 1UPBA 2F67A 3AHIA 3G8CA 3M4YA 1ONSA 1QQTA 3OU2A 4QU9A 3JQFC 4C5BA 3F74A 1B6TA 2YWBA 3A8TA 1NXVA 1YTLA 3IEIA 2FPPB 3QUAA 1H0SA 1ESCA 2ZM5A 5JXGA 4F2WA 4L5AA 4FGSA 4ZRMA 4EMUA 4NYMR 3IA7A 5FTKA 5MN5A 2QMZA 3KZXA 1JR4A 1OREA 2KHZA 3QXXA 3IUNA 1T9CA 1ZH6A 3G1TA 3GDGA 4A4DA 2WT4A 1TAQA 3QSYA 2EERA 3TNYA 2R6AA 1P4AA 2X6QA 3PVCA 4YDSA 3LHSA 4KNYA 4R8VA 2CNLA 3I5AA 1ZRHA 3C3PA 1LB1B 3KLNA 4RIFA 3KQUA 2I66A 1R0WA 1H2ZA 2V7WA 5NLLA 4BXOA 5AK4A 4UU8A 1E2JA 3ASUA 3TD2A 1Z3CA 4X71A 1NVTA 4OHXA 4MHTA 1GPDG 2C82A 1JR3D 3ZZ0A 2W93A 3WWDA 1FFBA 2DTXA 4US2R 4TSKA 2OP1A 2QD2A 1T9ZA 4TMXA 1R8SA 2A86A 3CWQA 5ICSA 4YAUA 4HAYA 4NOLA 3R5FA 3IQZA 4UM9D 1PGOA 2I3BA 2BFCB 3D0KA 1M0SA 4FYPA 2BGLA 1CZLA 1I5EA 3I72A 3O31A 5IDYA 5J4YA 1YA8A 2QGZA 4LBWA 2ZRCA 5KWSA 4LI3X 2JD2A 2XWPA 2FDCA 2HDHA 2QXTA 1OI4A 1Y7TA 3ED5A 4XVQA 1JZTA 2PNFA 2NADA 2YHAA 3MAAC 4YO7A 2A8YA 4ZOBA 4EA7A 1P4SA 1RWVA 4OF4A 3ZBPA 4U02A 1TUGA 3ZHSA 4ZT2A 4DLLA 2JGDA 3HYCA 2BCJQ 4BTLA 1DV2A 4BFYA 5IXJA 1IFXA 2SCUA 4XJSA 3TLGB 3BKWA 2EW2A 1DKOA 3W8FA 1SOUA 3RG8A 4HS9A 5AKEA 3F2VA 4H6XA 5FUBA 4ILEA 3U80A 4DR6B 1AC5A 1XDBA 1PDOA 1GFSA 3HZRA 4LCBA 1TPZA 2ZRIA 4MP8A 4Z9YA 5KPDA 1PZEA 3F6YA 1XI2A 4BQEA 1FSFA 4H31A 1B7GO 3FBWA 3NP7A 4Y30A 1ZITA 2NU6B 5J47A 2ZK7A 1U2QA 3KNZA 1QV9A 1Y8RA 3GUYA 4H4DA 3RUEA 1G21A 2WM3A 3BGVA 1WCYA 3BTVA 2RGUA 4OMFG 5DP2A 4LOHA 2RKOA 5HZHA 5EJ5A 1NQWA 2XUJA 2QE6A 1MJGM 2VXYA 5HKKA 4KZKA 5DTMA 5TJHA 5E1OA 1IJKA 4ZPJA 1H2BA 1ORTA 3ETEA 3OJWA 4DHWA 5DVZA 5TEVA 3RABA 3F5SA 4KPUA 4MVXA 2D2XA 5B3AA 1T9HA 2M32A 4LUCA 3DLIA 5EPOA 1YB4A 1YFKA 1P7PA 2B8TA 2OPBA 3C7DB 5JS2A 1KJNA 2OKCA 2E21A 4BZZA 4ARAA 1EK2A 4HQLA 2B6HA 2V97A 2P9FA 3IJ5A 5K8VA 3MMPA 4WNAA 2OBNA 1C2TA 4S1NA 5AW9A 4E30A 1QIJA 3TTSA 1CJMA 2VPXA 3GCGA 2BBSA 2ZRGA 3ZZMA 4RHCA 3NDJA 2B8NA 3D0OA 2QZSA 3ESQA 4PQRA 5EE9A 3NHSA 1NMQA 2QMYA 3NHJA 3L4BA 4N5HX 5D85A 3DEKA 1PZFA 1MVLA 1QTIA 2CVFA 1SXQA 1BXGB 1ADGA 2BMAA 3D6VA 1SVKA 4BO9A 2P1DA 1QVZA 1HDOA 2JASA 3JAWB 1XQWA 3C4JA 3LZDA 4L76A 2CCGA 4W9MC 2B0JA 4MRSA 2DWCA 3QU2A 5ECDA 2Y92A 3O4JA 5KYWB 3N87A 3N5KA 1O57A 5KTSA 1RKVA 4IDAA 4W5OA 2R65A 2PXHA 1W5FA 2Y8EA 3NBYC 4YAOA 1LK5A 4DPMA 4RZXA 3CVVA 3RE1A 1O6FA 3QQPA 3QEMA 1OXBB 1GFWA 2WJZB 1ZCFA 2RAUA 3D5TA 3ROPA 1LNSA 2D0IA 4HGOA 3SJ7A 5CK4A 4ZK2A 1VGVA 2FOIA 4L95C 4EUKA 4RPCA 1TB4A 3F3MA 2DCMA 2PYZA 4KWTA 4WKOA 5BT9A 4E21A 2X6RA 1XCLA 3OT1A 2YHUA 1JDBC 3EVGA 5JISA 2A1IA 2NZUG 3REFA 3GJ5A 4Y0AA 1VLLA 4I8IA 2GFQA 1OYWA 3V9AA 1UEXC 5SZHB 4JBIA 1E96A 2PKCA 3NAQA 3LM8A 2B30A 1DNPA 2R8YA 1P18A 3C0KA 3GBSA 5BUQA 1KYYA 1MA3A 5JJIA 3Q5DA 3LOUA 5WRFA 2A0UA 4X66B 1K97A 4WOBA 1TM4E 1D03A 4JS0A 4RQUA 3V8BA 1XE3A 1ZCZA 3MRXA 4EOGA 2R68A 4N5IX 2YS6A 2TSYB 3LUJA 1UBEA 3BMXA 2D1FA 4K7JA 2W9XA 4FW8A 2PN1A 3PC2A 4R8KA 3SJUA 3SEZA 4CM3A 5BNFA 1UT6A 1FSZA 3C5WP 1CIPA 4LG1A 4MUGA 4ZZ2A 2D13A 3VSAA 3UJ9A 4A26A 2DFKB 5C2JB 1UDRA 3RHZA 4H1UA 3C6YA 5EXXA 1RBQA 4DEYA 5KOJB 3AL2A 4RE5A 3UFBA 2IZ1A 3WMRA 2ILVA 1S9HA 4HXYA 1C1XB 4BLQA 3IXLA 3PQCA 3DP7A 4DNQA 1BG6A 1V8FA 3A4VA 2YWEA 3QG5A 1TOAA 1DQZA 1YDFA 2NYRA 1KIFA 3R5HA 5EPEA 2REQB 2JJYA 3EXAA 4LXXA 5BQ3A 2BEKA 4JX9A 1EP3B 2FZLA 2GEVA 1NQOA 1A2BA 2O3JA 2QTVB 1BU8A 3WQRA 4AMYA 4JI8B 2XGOA 4PCUA 2XW6A 1MDBA 2XAUA 4HLUA 4WGGA 4HXEB 3SR0A 3W34A 5AUOB 2QRLA 4B6EA 1BWQA 3UWMA 3OZAA 4BKRA 4B5KA 2QU7A 3FR7A 4EYQA 3A4IA 3M6XA 2PG3A 4CLXA 1RI4A 1RIIA 3ADCA 3TRJA 2Z0MA 4P1ZA 5NULA 5HCNA 1AKNA 3IP3A 1USVA 1VKHA 3CLSD 3T3GA 1H0RA 1DKLA 1ZD9A 5K0GA 1Y8ZA 3PDCA 4IWYA 3RK1A 3DUFA 5DF1A 2R6GA 5DGHA 2OXTA 4H7DA 4IXNA 3RFXA 4BJ3A 3ZE7A 5EXDA 1QF7A 3R74A 2J9YB 3VZQA 1J8YF 2CEAA 4A8JA 4IGKA 4F4HA 3OP1A 4G37A 3K16A 2O5VA 4IIFA 4IBOA 3T7KA 4J2OA 2QUBA 3N2ZB 1NVXQ 1LRJA 4IHQA 1VJDA 3ABRB 2ENWA 4I6GA 3G23A 1P45A 1XMJA 2AC7A 4I1UA 4Q4HB 1T0HB 1DJOA 2JHAA 3RC9A 5CEJA 2O8EB 2P6OA 2X15A 4MKXA 3D3WB 3WWYA 1UDWA 2H08A 2V59A 4Y2YA 3VYWA 1D4AA 2YV5A 1VRVA 2P79A 4D9KA 4NK5A 4I50F 4MPJA 5KWIA 2AOTA 3NKFA 2XYVA 4OTZA 4ZJUA 3VPAA 2F17A 3S28A 4YS6A 4XKJA 5I4CA 1DOHA 2QM3A 1DDOA 2OV1A 4PFSA 1HE3A 2J3DA 3L01A 1J09A 1CS4C 3WRXC 4BHTA 1OBCA 1KSHA 5CDYA 2I91A 5SYMA 2Z09A 3ZU3A 2RKWA 4HRXA 4QYSA 1XN4A 4X90A 1KY5A 1C0KA 1RE1A 2P8SA 4LOLA 2PJRA 2MIIA 4QT0A 4KFCA 3BT7A 4X7BA 3HBJA 1EESA 3JYPA 3NAZA 2OZKA 3AF0A 3PRKE 3ONDA 1EQ2A 3SHWA 4AM8A 3EGXB 4GXRA 3CURA 2J09A 3BHNA 3PLRA 2XECA 1K0UA 2AUMA 2G08A 4KIFA 2XMBA 2GYVA 2WWXA 3ZVLA 4NNOA 2FI1A 4GYJA 4WASA 4BNMA 3S1LA 2A35A 4F9GA 1CBUA 1JPJA 4QLOA 3GK3A 1RAEA 1UADA 1OC4A 5CVCA 1VG1A 1XTPA 1NW9B 1L5MA 1P1BA 4M1WA 3Q8LA 1CZKA 4JLSA 3AKEA 2MMCA 1M83A 1WPGA 4FYIA 1PS0A 2MHCA 5DKFA 1JQKA 3K5HA 5CHEA 1OWNA 4UQPA 1RQRA 3EXHC 3FMPB 1GVNB 2G7MC 4M1SA 1O0BA 3W7AA 4L8VA 2P78A 4L0MA 1DAIA 2ON6A 1EK0A 1XNGA 3FTNA 2WJPA 3S8EA 2IE0A 3UCXA 2YKGA 3GN2A 4HQOA 1G9SA 4LDNA 2DBVO 3I05A 2PKQO 2WUWE 3HABA 5JNVA 5JJLA 1DMRA 5IKEA 3AU9A 4JJZA 4RANA 5AVQA 5JNLA 5JZOA 2HR1A 1Y1TA 4TZ6A 1YJCA 1UP4A 3BDIA 2EKZA 4KCGA 2I9PA 3ZVRA 2XBMA 4R16A 2GK7A 5JYEA 3RREA 4BIMA 2REXB 3WGHA 1C7EA 1WXXA 2B4AA 2BFFB 3NDPA 4ROSA 3ROXA 5L7WA 4CEJA 1FNNA 1BDBA 4ABYA 3O8LA 3EGDB 2XJ4A 4G65A 3AKCA 5TGDA 3CGWA 5AOVA 4Q4DA 3S2ZA 2QK4A 5LQNA 1SBQA 3DH0A 3E8MA 3G68A 3KVOA 1SKMA 1E1NA 1QHHA 5E4FA 4JENA 2VAVA 3A4NA 5IYZF 3IUBA 3DCIA 1CVRA 1YQDA 3NHFA 3U26A 3AI2A 4MIOA 4RL4A 4E2FA 4I5FA 1UFRA 2VDRB 2CUNA 4UVGA 4ZV7A 1RYMA 1OWLA 1RRMA 4J2TA 3JQ9C 4XSGA 5TQ2B 2QMQA 1P0MA 1IEWA 4DR3B 2M1ZA 1DUSA 2A9OA 1KZ9A 2O5EA 1V7PC 3GMTA 3GGGA 2BGMA 3JALA 3JARA 4M0PA 4JNKA 4ARSA 4FSDA 2JGIA 4DJAA 4UVEA 3ADKA 4JV5B 2BMWA 4TXMA 1C1DA 2MDTA 1XHLA 4ZVKA 3FLMA 4G2NA 2VT3A 5KHAA 3CC8A 3GBPA 4RNCA 3ZHUA 1DWUA 2R62A 3HZHA 4IVQA 4LHWA 1HETA 1M73E 2IPLA 4JEIA 5EJFA 3LVQE 3FROA 1YL5A 1P73A 1SR8A 3V48A 4MV9A 4FMDF 4HB2A 1RQ2A 1IL0A 4K9QA 4BUZA 2WWFA 1ZH0A 4YJDA 2PUTA 3JQCA 5LR6A 3E15A 5H7XA 1Y1LA 1V6SA 4LYEA 1W0KD 2A0YA 1NV9A 2ZVJA 3AI7A 3DTNA 3H83A 1U7ZA 4KFUA 4L5CA 2QJOA 4HV4A 4AKGA 4ZO6A 5FPYA 1TW2A 3IJEB 5A03A 5J4LA 1P9RA 1N9ZA 1QBKC 1GAJA 3FNFA 1RXCA 1G8HA 4C6RA 4C76A 2V6BA 3LX4A 4P5DA 4ZI3A 5EJIA 2FH5B 4F2GA 3U56A 1VE9A 2VP6A 3TLYA 3LQ1A 3PC3A 1THZA 4O2AF 2W70A 4OHRA 1QO7A 4U4AA 1DDIA 4QTTB 4JUFA 1X8LA 2ZB2A 4KO3S 4Z8XA 2JLVA 4BBAA 4UEWA 3EUAA 2CLOB 3MF4A 1IXZA 1DAMA 1XYYA 5F12A 3GRVA 1YE5A 1SURA 4L0CA 4RU1A 4G26A 3GW8A 1TTTA 3H9BA 2ERCA 3LW7A 2C58A 2VQDA 3P4XA 4EMSA 1PNRA 1TTQB 2XGSA 4MKZA 2HF9A 4FHEA 5G3ZA 3CEPB 4H6VA 1NN3A 4JMLA 4EH1A 3L7IA 3K0AA 4D80A 5CHYA 4DDTA 1OLOA 3OTOB 4KDFA 1OXVA 2P2CA 2Y9PB 3AKZA 3ZGVA 3MIIA 2Q3CA 1EA5A 4ZMBA 1RT9A 3HXOA 4HWSA 4V0QA 1EVQA 4HNQA 2ETVA 4WK6A 5AKLA 3VDMA 2A58A 4DV3B 4J0QA 2AKYA 3L9WA 3SHVA 3VZCA 1XD2B 2A9FA 3LIIA 4QG3A 5L4LA 2F9FA 1ZD8A 1Z0IA 3UK2A 5JEEA 1TMKA 4FFSA 3ITNA 2ZSDA 3QBJA 2QJRA 3DEJA 1ONOA 2HI0A 1QOPB 4DQDA 2WB4A 1QDUA 1DJMA 2G0TA 3I9FA 1UJBA 1J2RA 1JEAA 1Q92A 2TS1A 3KDSE 5ARDA 3WRYA 5FL3A 4Y6SA 4WJLA 4D3SA 1IE3A 1Q1GA 1DXYA 1E64A 1THTA 1JEQA 5AFSA 1B26A 1I33A 2Z8XA 4KVFA 2PYIA 2ZBFA 3O0TA 4K3VA 2PS9A 4B3DA 1E58A 3KR2A 1BVHA 2P5YA 4X1OA 1P75A 3M9XA 3VSBA 1E79D 3E9ZA 1RAHA 1SHJA 1C3JA 1W1IA 3IBTA 3CKYA 2CYCA 4Q05A 5I3ZA 3RLFA 1RZ3A 2H7XA 2H4WA 1PE0A 2GILA 2KI5A 4MVJH 3DULA 3H16A 5AUQA 4FYWA 5IBPA 4EBFA 3A4YA 1Q1QA 4NQZA 1QP0A 1CU1A 2WSSD 4G67A 4MROA 2SNIE 4QXAA 3MYRA 1RBZA 1ZK0A 4QKQA 7GPBA 1A4IA 1TEVA 3EGEA 3NONA 1GM5A 3KTDA 3VHLB 3KSAC 4PHTA 1QRAA 4D99A 4C4OA 3PHJA 1YULA 3BHMA 4ND6A 4RK1A 4YJFA 3F8SA 1DG1G 4M0CA 1T9GR 1K75A 3WV5A 1O58A 1MC5A 3ETGA 3I6QA 3MNFA 3ZWOA 1BCSB 2G17A 1SC9A 3OX1A 4H1VA 5KDDA 1T8TA 4JI3B 3EZ6A 3JQBC 4TRJA 2E4UA 2ACWA 3BJIC 1X74A 2FXIA 1NM5A 3EUEA 3EZ9A 2GBFA 4EPRA 1MIHA 3SKYA 2BF4A 3QX8A 1V2HE 3QP9A 2BFDA 5BQPA 3QA9A 4I50A 4R84A 2Q62A 3ZD9A 4OI2A 4DJEC 4EGJA 4EUEA 4F12A 5JXJA 2VSFA 4UTOA 4G86A 1V3TA 3HKBB 3SI7A 1Y9ZA 3DT6A 4R9VA 1RXUA 2P11A 2XXJA 3V1KA 3VH1A 5C1IA 4Y98A 3L1JA 3SN6A 4S05A 5JFOA 1XLVA 4BLWA 3M49A 3H9EO 4HDSB 3CKKA 2JLCA 3RHTA 2XUOA 3UT5A 3A4TA 3G5LA 3IQEA 2AOXA 2GN8A 6REQB 2QBYB 5LZ2A 3Q87B 4LWQA 3BZWA 1E3WA 1T1GA 3LQFA 1FVXA 3DQQA 3W1VA 4FGUA 3DKIA 1Z0SA 2VK8A 4IX1A 2QZPA 1QP4A 1S2MA 1Y7LA 2PSFA 2EP5A 5DIFA 4JGIA 1JJVA 4YMUA 1MQAA 5COAA 4NE7A 4RTKA 1MGOA 2RHRA 3EZXA 5AK5A 3ND6A 4LGCA 1WEHA 1PVDA 3EXHA 1HFKA 1SA0B 1JDNA 2Z4SA 4GZ5A 1S3GA 3ROQA 3ER9A 5EJ6A 4M9XA 1TJ5A 2X9VA 3WLJA 2H9IA 4DWVA 2QW0X 4D45A 2I62A 4G0UA 3GUVA 4BP1A 2ZJZA 4JLOA 3UMVA 1OD6A 2C1ZA 3IVGA 3L18A 2NU8B 4WBNA 3KHSA 5MFPA 5KJEA 3QX7A 4IEIA 3BRWD 2J4DA 3CKLA 1JKIA 2A84A 4HFMA 4GMXA 2VHVA 1QH8A 2JLZA 4RMHA 2IXTA 1IHXA 1NQXA 1QOZA 1T2DA 1NONA 1H6AA 3DMRA 3TZHA 3UENA 3EDYA 4F71A 2ZIVB 4FP9A 2AK2A 4N3GA 4WERA 3W79A 1RPTA 4KE7A 2AEJA 4MGEA 4MR9B 5F7OA 5K8LA 5IVDA 2VDKB 4GSYA 1Y6ZA 2YJ3A 1VCOA 3URKA 2PUEA 1C8LA 1PTKA 4M7RA 2HIHA 3MWYW 2I3ZA 1KK0A 1FUUA 3IDQA 1T5HX 3I52A 3TD9A 4Q19A 4ATNA 1FZTA 5GV8A 3CY6A 4K9KA 3T9DA 4EJFA 3UAGA 1RI5A 9MHTA 4FE3A 1IB0A 5IYZA 2ZCJA 3IQWA 4UJ3A 4URWR 2ZQZA 1IHUA 3P0HA 1SUEA 5GVRA 2ESRA 1M5UA 1LS6A 2PYDA 4GUDA 3VR5A 2B1QA 4BVHA 1UIRA 3HYSA 3NC4A 4ZCIA 4M0FA 3IOYA 1BMQA 3SXUB 1K5GA 3V7NA 5BSWA 2UYOA 1A4XA 1EBUA 1HTWA 4HGRA 4TL6A 5JU6A 2AHRA 5L3ZA 4TTIA 2ZAYA 1QYXA 1ZD5A 3KZVA 4U3JA 1L5KA 4O1MA 4BQOA 2WKRA 2FKAA 1OFHA 3N6RA 3U7IA 5BVHA 4HYTA 1DSSG 2ASEA 3W6OA 2DHCA 2V8BA 2CL5A 2FN8A 1JNYA 3VR6H 4G1CA 4G9EA 3R3YA 2EFHB 3PIDA 2IK8A 3CW9A 2ZZMA 2B37A 2FZ5A 3OWHA 3TFWA 4AZTA 2ZJ7A 5GQSA 1KAOA 3C70A 3SYNA 5K45A 3K9LA 1GCIA 2B69A 5A5EA 2BDTA 3WBJA 4AS2A 3GT4A 2WJVA 1P1CA 5AKJA 1J1ZA 3LHDA 3UZUA 2WD8A 4DRXA 3E2MA 2C84A 1L8AA 3JAKB 4TUYF 5JSUA 2ATIA 2SKDA 2YNMA 3OJLA 4O2AA 2P6NA 1I3OA 1POXA 1R4ZA 3I1YA 3C45A 2PX3A 4MWZA 4ZKDA 2PQ0A 4FZJA 2APJA 4DNOA 3Q7TA 2HXGA 2GO7A 3FCUB 2DR3A 1MC8A 1OA0A 2XNJA 4HFJA 4UHFA 3E7XA 1ZRNA 2QLNA 2EJTA 3CRNA 4JLPA 2OM6A 2BGIA 2V6JA 1DT5A 1QHGA 1Y5LA 3N75A 4RTNA 3PF9A 2E4ZA 3JZIA 4CQMB 1N0IA 2BEVB 2DTDA 2JEOA 4K87A 1KZHA 1I6MA 3W3ZB 1Z8DA 3IVMA 3T06B 4HDKB 2BM8A 5KWJA 3EY4A 1FLNA 1U8YA 2YJTD 2QROA 4CM6A 1FXWA 3N8NA 2LCQA 5MHTA 3UJAA 3KT6A 4YDRA 4OQLA 3BD9A 5ESXA 1I51A 4HEA6 4M21A 4MMXB 1TC1A 4GMGA 1MAWA 1NXOA 1BJKA 1Q14A 1GV0A 3DD1A 1PGNA 1QLJA 3EJ6A 3P9KA 4J6EA 3GJ6A 1D2MA 4JUCA 3TTUA 4D3XA 2HA2A 2VYVD 2Z04A 4I55F 3FNIA 3SIRA 3ZD8A 5EI5A 2OOKA 3TNFA 4G5YA 2V9PA 3O5AA 1GL6A 1DGQA 2XF8A 2JI7A 3RTEA 1AHNA 5DCLA 1C30B 1HWYA 2P9EA 3HP4A 3HXKA 2RE8A 2DB3A 1NOIA 2V54A 3MJFA 1W46A 3WSTA 4AULA 1UF9A 1JLLB 2VNKA 2ZAGA 4PLYA 3O83A 4DLPA 2QTHA 3NTQA 3R0JA 5EJEA 3DLAA 3I6MA 1BFUA 4F97A 3NPMA 4B3FX 3V55A 3GAFA 3PFCA 1PJAA 4FNMA 5LOVB 1PJQA 3LPLA 3VC3A 4U6QA 1XP5A 4NG4A 3E5MA 3QVLA 4PANA 3KUXA 1SG0A 1T4CB 1GFZA 2KW5A 3DFKA 3T52A 2WZDA 4QDKA 2CUKA 2VHQA 1FIUA 1ZUHA 4BNVA 1TKBA 1LNQA 1UP7A 3EQ6A 3T38A 1Z2EA 4FYXA 4JN6B 2A9VA 6PFKA 5TMEA 1J5PA 1X7WB 2X9QA 1KU0A 2OLJA 1Q3TA 3V4OA 3MLEA 4D44A 2P6RA 2GR9A 1WKBA 4LRTB 4EYEA 4BVGA 3KT8A 2QPAA 3UMSA 1V8BA 5E38A 3PEWA 1FMFA 1XDUA 1EXMA 1E1RD 3M9WA 1ZEJA 3LL4A 3QE0A 4D81A 3TG8A 1NI4B 1WDLA 5HE9A 4U5QA 1FTGA 3L84A 2NT4A 4DE5A 1F2UB 3GT3A 1MB0A 2D54A 1Q7GA 4AJHA 2EF1A 3T9AA 4I1YA 3ZE1B 1R88A 1P72A 3KYCA 2HPZA 1NKTA 4HLQB 4LE2A 4RPLA 2GM5A 2XZTA 3USES 4R2HA 1K2VN 3HFJA 3MELA 3UXEA 2FPWA 2AF3C 1X2BA 3AR5A 4Y6PA 3TZCA 1JJIA 2R7KA 2IIBA 1AQUA 2GPWA 4B1FA 1RPAA 1GPWB 1ZI6A 3TL3A 4ZHQB 1E2KA 2GHQA 1DKNA 1RQXA 2OC9A 3TCNA 3RAFC 1XVTA 1N9KA 2FPRA 4CEHB 1TQ8A 1ZVVA 1NRWA 3AP1A 3I3SR 3SS7X 1O03A 1UR5A 1X1AA 1ZIPA 4LDQA 2C2KA 5HOQA 1K8ZB 3AI3A 3EW9A 4TYPA 5JD3A 3P94A 2CEKA 3QVVA 2RHBA 4DCTA 3WJ7A 5KAPA 3ZY2A 1HSZA 5H9VA 4BU0A 4UQLA 3PQ3A 3HJCA 5E0KB 1ECLA 2AC2A 2X1LA 3PQDA 1T35A 3CX8A 3OBIA 4LJ4A 1MENA 3DWGA 2IH5A 1EVIA 5LWHA 2N42A 3L49A 3QI7A 2V55B 4RAQA 4HGNA 3U3OA 3RW9A 4J29A 3DE3X 1EBBA 2ZUEA 1HDIA 4R40A 2RARA 3MJDA 4QJ4A 4EFNA 1DQRA 1XTIA 4JI4B 3PWTA 5C1DA 1KQNA 1YRAA 3VAYA 3N2KB 3R0ZA 1FYVA 3A4MA 4IL5A 1MVNA 2ID4A 4LRWA 1SUAA 3P71T 1XZQA 5A7HA 2H1IA 3O3MB 1P5ZB 3RUCA 4F4JA 1ODSA 1X7YB 1FRVA 4IO1A 3PXEA 4IOKA 2O5RA 3RUAA 1NSYA 3T3DA 4ZCTA 4NXMB 1ANKA 4X1YB 3O4VA 4FJ2A 4GKVA 5B3JC 3LXMA 1YBFA 4GW3A 2QY6A 1AN0A 1FDSA 1LTKA 4GM1A 3VFDA 4YV7A 3AH8A 3KT3A 1F38A 1YS9A 1FDOA 2PR2A 4AJEA 3U31A 3T5PA 1J00A 1FZQA 2YBEA 3QPCA 5FBKA 2FLWA 3AY0A 2WP8J 1N2CE 1M2NA 5FL7A 3KQVA 1DKRA 2XB9A 2AMLA 3WNCA 2YFYA 5AW6A 1DEXA 5IHXA 3BVPA 4GE0A 4QGSA 3HM9A 1K4YA 2VRNA 4QBTA 1Y1KE 2ZJ6A 3O03A 2I3DA 1RBMA 4KMMA 3V7UA 5JI2E 3S1AB 1EJ2A 3Q7IA 4MRMB 1WY5A 5ALJA 5EHNA 2WE8A 4RXMA 4FS3A 3V2HA 2I8AA 4XD7D 3HVUA 3KCQA 5CVEA 2XSZA 1EGVB 5ICFA 2GNPA 4R1NA 2QTLA 1ELOA 3G49A 2VDLB 4HB4A 1GQYA 2FDXA 2ZSBA 1XCOA 4LS3A 4P38A 2WF9A 4M6WB 4R83A 3WGLA 1C9DB 4AKTA 3UN1A 3HGQA 4DF3A 5AI5A 5ULLA 1TVMA 2Z57A 1RAIA 4KJXA 3GFTA 3AERB 1U7OA 3K0CA 2C4WA 4M8SA 1Y6RA 1OTHA 3LVFO 3QFRA 1RWBA 1JHUA 4MGYR 2O8BA 2BGRA 3A36A 1Q3KA 1MZPA 2VSNA 3E4DA 3G8BA 1V11B 3H97A 3ANLA 1R00A 4DM4A 1ZN8A 1WSDA 3GNLA 4CEIB 2AZTA 2JGMA 2CD9A 1E4VA 2CLKB 2RGAA 1R0RE 1Q20A 1FPQA 5IDQA 1RSZA 4E70A 1XRQA 5LYJF 2RH9B 3FUVA 3RQSA 3OIWA 4UPVA 1MN6A 4AY6A 1GG2A 3MC1A 3R5KA 1E9CA 2P2ZA 1HSOA 2ZSEA 5JD4A 4NWIA 2VJMB 3EAFA 1MJGA 3K4QA 3C7TA 1Z18A 2RGBA 1IATA 1KPGA 3DXYA 1T8UA 4ERXA 1FP6A 2A9PA 2EBHX 5FI3A 2DQKA 4IZHA 1KO5A 5FH9A 2ATVA 3I12A 1S8OA 2XMPA 1ISHA 1TZMA 1VCMA 5HKLA 3V6MA 4TUYA 1Y48E 2WHPA 3UH0A 3O8BA 4PGMA 3RIMA 5E3HA 1GUDA 5D1HA 4JELA 3TLBA 3UJDA 3VR4D 1YL6A 2XTZA 1I13A 1WMBA 1XTQA 4PR3A 3KC2A 1XXLA 1Z0DA 1T2EA 1DOAA 1P0IA 3CX3A 3T1YB 1QO0A 4TS3A 2EQ5A 3UUFA 1EE2A 3IUMA 4EG6A 1C9KA 3SFZA 5L8VA 2E7ZA 4F04A 2GJAA 5C5IA 1JLMA 2X9GA 4ZVQA 1PQ4A 2CDRA 1SVWA 2EHDA 3I76A 2VAPA 2JCSA 1ULHA 1K8YB 2J6BA 3GL9A 3P0JA 4N8SA 4X44A 2ZBVA 1WHSA 3VU1A 4GS5A 4E03A 4Z49A 4K2AA 2OO5A 3ODPA 4UD6A 3FNEA 4H4CA 5ADVA 2W6ZA 3TW4A 1Y8AA 4O2BF 1YZTA 4DCCA 2NVBA 2EX1A 1F0PA 5ALIA 3WK8A 1XDDA 3AUXA 3HPQA 1NXTA 1I32A 4QNMA 4KPFC 1VA4A 2YZ7A 5A4KA 2Q9BA 3RFTA 3DWFA 2OHGA 1YC2A 2ECFA 4FK8A 4KRXA 4UPDA 4J9UE 3M6MD 4IDDA 1CVLA 2R48A 5LB2A 3ZE2B 1NXWA 4LXIA 4H3VA 1HZJA 3FLEA 2EWWA 1U3DA 3RC3A 2AKEA 3EVCA 2O1XA 3HJHA 1CR6A 4MI3A 3CLTD 3OESA 4D96A 4X62B 1M8FA 4DLNA 3V4FA 5ILOA 1NSFA 1RI3A 5HSGA 4WLEA 3AV3A 5CCBA 1JP7A 4TS9A 4MUFA 3ZCQA 1F6WA 2QPTA 2VH1A 5FLYA 5CVUA 2I4NA 3MOIA 5C9ZA 4DB2A 3FWYA 3FOCA 5DTJA 3BD8A 4YXWA 2R5WA 2EYUA 2VR1A 4QG7A 5HJ2A 1UXKA 4N6OA 1U4NA 3OZEA 2W37A 3M6IA 4YLYA 1K0FA 4QDOA 3TB4A 4C03A 5BSVA 4L1KA 2ZXFA 3F73A 5J5CA 9GPBA 3DO6A 1AQLA 4DV1B 5A9TA 3OE1A 3RVRA 4JZKA 2VK1A 1OKKA 2D0OB 2NTVA 3CUYA 4WADA 5G02A 4XGKA 1ISJA 1YMVA 4H1HA 1G5FA 1YZYA 1U81A 2H1FA 5JZMA 3TGPA 5KQGA 2ZZKA 1E2IA 3AUSA 3LRXA 4MKIA 4P0PB 5F2NA 2OCLA 3DBOB 2I3GA 3DTYA 4KIJA 3GAZA 4KK3A 1X1QA 5L95A 4N9WA 1TLLA 2C8LA 2RBGA 2Y2VA 5F1YA 4CIVA 5H4GA 1EA7A 4F8EA 1JEOA 5KSOA 1X7GA 1OIWA 3DHYA 4FYKA 1P60A 5I48A 4YCNA 4ARZB 1RMYA 2GAAA 1NW3A 2FN3A 1QS0A 2I4OA 2V6MA 4L3VA 4O4LB 4V0OA 2JIDA 5AKIA 2AFHE 1YFLA 3PWKA 4WDRA 3HXPA 1CUYA 4IW3B 1SN7A 1TTHA 3ZEAA 4DMHA 3GYBA 1RM5A 1DJLA 2GESA 2QSYA 3V2IA 1SRQA 5LBUA 2AXQA 3WVNA 5FOVA 1UC9A 2Q5FA 3FDZA 3NNSA 3OM8A 2HOQA 4L3WA 3W5DA 2QAJA 1RYYA 3GQBB 4AQDA 1G3RA 1JBKA 3UEOA 4BCDA 5A4JA 1XUOA 1XL0A 2QE7D 2VOEA 4MCJA 4ZJZA 4CKCB 1EDOA 1W4AA 4HO1X 1II0A 5CH5A 4XX0B 3UJHA 1JT2A 2C5SA 3BQMB 1QH0A 4FWTA 3TUZC 3QI2A 3TQIA 1GNQA 2A1TR 2GZ2A 3O2QB 4C78A 2QMHA 4UPEA 2E89A 3ADOA 3DVLA 4OMDA 2BH2A 4CMHA 1YK0A 3GLHB 4DQVA 1K7CA 4IFBA 4JB0A 3KPVA 4QFMA 4FCCA 2XZPA 1W8IA 5IPFA 1ZL0A 4DSZA 2QY9A 2GUGA 3FCYA 2EX0A 2FRVA 2XVYA 3HM2A 2I2WA 3OE5A 3TQFA 4FXOA 3SYKA 2AJDA 4X6YA 5BV7A 1L7RA 1PP4A 2BZSA 2IU4A 4RF4A 3UAOA 2FPGA 2ZJFA 2Q1SA 2OGZA 2PLRA 5K3DA 1FP7A 2W58A 2PH3A 1OSNA 2AGVA 2JZNA 3P8ZA 4GI7A 5H82A 2BTEA 2JFZA 5I9SA 3L1VA 2FQQA 1V37A 1ZGCA 4ZAGA 1SKBA 3LVBA 1YDEA 2CNBA 2GAOA 4E14A 3LWDA 4C0JA 3ZLJA 4OGGA 3FFXA 1W75A 3LUGA 2QDXA 2CXPA 1NLUA 1NF9A 3LD9A 4L75A 4Z1MD 3Q98A 5BR7A 1HORA 1G18A 4G1EB 4IYRA 1PHRA 1N8TA 5D7BA 1ND6A 3MTEA 3PPWA 5H68A 5BY2A 2FSIA 4PHHA 2PMDA 4D5GA 1TMYA 4ZYZA 1TAUA 2NXWA 1PKEA 1SWVA 3U4IA 2JZCA 3AJDA 3IURA 4R2JA