1M5RA

Ternary complex of t4 phage bgt with udp and a 13 mer dna duplex
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
351
structure length
351
Chain Sequence
MKIAIINMGNNVINFKTVPSSETIYLFKVISEMGLNVDIISLKNGVYTKSFDEVDVNDYDRLIVVNSSINFFGGKPNLAILSAQKFMAKYKSKIYYLFTDIRLPFSQSWPNVKNRPWAYLYTEEELLIKSPIKVISQGINLDIAKAAHKKVDNVIEFEYFPIEQYKIHMNDFQLSKPTKKTLDVIYGGSFRSGQRESKMVEFLFDTGLNIEFFGNAREKQFKNPKYPWTKAPVFTGKIPMNMVSEKNSQAIAALIIGDKNYNDNFITLRVWETMASDAVMLIDEEFDTKHRIINDARFYVNNRAELIDRVNELKHSDVLRKEMLSIQHDILNKTRAKKAEWQDAFKKAIDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*AP*TP*AP*CP*TP*3DRP*AP*GP*AP*TP*AP*G)-3'
publication title A Base-flipping mechanism for the T4 phage beta-glucosyltransferase and identification of a transition state analog
pubmed doi rcsb
source organism Enterobacteria phage t4
total genus 130
structure length 351
sequence length 351
chains with identical sequence B
ec nomenclature ec 2.4.1.27: DNA beta-glucosyltransferase.
pdb deposition date 2002-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09198 T4-Gluco-transf Bacteriophage T4 beta-glucosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1m5rA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1m5rA02
2BGTA 1WV0A 2QRQA 3GUHA 3IAAA 3PE4A 3Q3HA 2GM9A 3OKPA 2F3UA 3MT9A 4EKYA 1V4VA 3MQFA 3D1JA 3WC4A 3NCHA 4GZ3A 3C4QA 2QRPA 3IA7A 1P4JA 1WV1A 4N3BA 4M60A 3TOVA 3UYLA 3MS4A 4X7MA 2X6RA 4RIHA 2JJMA 1P4HA 3SYMA 1VGVA 1C8LA 1XKXA 2GEJA 1C50A 3CUVA 3G2KA 2IYFA 2QLNA 4NC9A 3T3HA 3WAGA 1Y8ZA 3OY2A 3EBPA 3AMVA 1PNVA 1L6IA 3ZCQA 3CEJA 2IEIA 4GZ6A 3MRVA 1NZFA 1XOIA 1Z62A 2OFFA 1L5VA 2BGUA 2F3QA 2VSYA 2QN1A 3FROA 2PYIA 1UQUA 2QN3A 1Z8DA 1EXVA 5DXFA 4N3AA 4YI5A 3L7AA 4WHMA 4YI3A 6GPBA 3HBMA 3L01A 3G2JA 2WTXA 4WADA 2X6QA 4X7RA 2FF5A 1L5QA 1E1YA 3OTGA 1P2DA 3ZCUA 1QKJA 2IV3A 1P29A 2QRMA 4GYYA 3CUUA 4KQMA 3CUTA 4F97A 1XL1A 2GJ4A 4GPBA 4M83A 1PYGA 3VDMA 4EL0A 3CX4A 2QN7A 4LEIA 1EM6A 2AW3A 2ASVA 1JEJA 3TSAA 2R4TA 2X0EA 2H1HA 3MS2A 2IEGA 1FA9A 5D00A 2XGOA 2PRJA 2JLBA 4BFCA 2QN8A 3RT1A 3D0RA 4BQFA 3VDNB 2F9FA 2QRHA 2R4UA 1BX3A 1JIUA 2KS6A 1H5UA 4HLNA 2SKDA 2JZCA 1YA6A 1JIXA 3Q3EA 5JTTA 3S29A 2AV6A 4N9WA 3BEOA 1WUTA 3G2LA 1FU4A 5GPBA 1P2GA 4MI9A 3UYKA 3RHZA 4F9FA 2G9QA 5ENZA 4REMA 1WW3A 3MT8A 1NVKA 4MHSA 2G9UA 3MTAA 4FZRA 4HWGA 1XC7A 1SXQA 7GPBA 4EKEA 2PYDA 2VG8A 3G2HA 1SXPA 4WACA 3ZCTA 2ACWA 2XMPA 1GFZA 4MHOA 3T3DA 4AY5A 3BD7A 1WUYA 1Z6PA 2GPBA 4QLBA 1XL0A 3MT7A 2VCEA 1NOJA 1HLFA 3CEHA 3PE3A 4EL5A 3S27A 2FETA 4RIIA 5C1DA 3BDAA 2FFRA 5D01A 1RZVA 5HXAA 2IYAA 1RRVA 3CV3A 1FTYA 3MSCA 1FTQA 2H1FA 1KTIA 3OTHA 3H4TA 3HBNA 4PQGA 1GG8A 1GPBA 3T3IA 2IV7A 1GPAA 3OY7A 4CTMA 4L22A 4AMBA 4GZ5A 1Y6FA 3OKAA 1AHPA 1C3JA 2ATIA 1NLMA 5IKOA 1F0KA 3MS7A 4MRAA 2BFWA 3DZCA 3HBJA 4BQEA 2PQ6A 1GZ5A 1JIVA 2R66A 4KQ1A 1P4GA 3OT5A 2QNBA 1L5WA 2C1XA 3DD1A 3NB0A 4RIFA 2GT1A 4AMGA 3ZCRA 1NOIA 1LWOA 3BCSA 3ZCSA 3RSCA 3T3EA 3OKCA 4XI9A 4BQIA 2X0DA 9GPBA 3TAXA 2QN9A 2VSNA 3ZCPA 1IXYA 2XGMA 4W6QA 3RSZA 2XCUA 3L7CA 3T5TA 2G9RA 3Q3IA 2O6LA 3C4VA 3BD6A 4X6LA 1A8IA 8GPBA 1P2BA 4RIEA 3NC4A 4YUAA 1GPYA 3E3LA 1PSWA 2F3SA 5DU2A 2XA9A 4NESA 3BD8A 4G2TA 4RELA 1PN3A 3EBOA 3HBFA 2ECPA 3MTBA 3MTDA 1NZDA 3C48A 3L7DA 2IW1A 4RIGA 4MI6A 3CUYA 3COPA 3VUEA 2YJNA 1K08A 1ABBA 1JG6A 2ACVA 1B4DA 1YGPA 2AMVA 2IUYA 4FKZA 2VCHA 2P6PA 4MICA 4XIFA 3ZCVA 4AY6A 3NP7A 1FC0A 3G2NA 1GGNA 3L79A 4MI3A 1F6DA 2PRIA 1FU8A 4GYWA 2XA2A 2C9ZA 1UQTA 4CTNA 4F96A 1E4OA 3O3CA 1FS4A 2QZSA 2GEKA 3MRXA 3WADA 3BCUA 3NP9A 3S28A 3S2UA 2ZB2A 4X7PA 4CDRA 2HY7A 1L5RA 1K06A 5I45A 3CEMA 3QKWA 1L7XA 2XCIA 3SYRA 4RBNA 2QLLA 3L7BA 4N39A 3NPAA 3CUWA 3DDSA 1LWNA 4KQ2A 1RZUA 2C1ZA 3GPBA 1WW2A 2XA1A 1QM5A 3G2IA 5TMBA 1J39A 3E3NA 1M5RA 5TMDA 2BISA 3BCRA 1NOKA 2X0FA 2C4MA 1O6CA 3E3OA 3QHPA 2Q6VA 4M7PA 1Z6QA 2XGSA 3MBOA 5TVGA 2QN2A 2QLMA 3T7DA 3T3GA 1XV5A 2G9VA 1FTWA 1AXRA 1JG7A 1FU7A 2QRGA 4N3CA 5DLDA 2R68A 3D0QA 3OTIA 4NEQA 3NAZA 2GPNA 1L5SA 3DDWA 4CTOA 2SKEA 1Y6GA 4RENA 4LDPA 5BNWA 5TMEA 4EJ2A 5IKPA 3MRTA 4AN4A 2R60A 2F3PA 2SKCA 2GPAA 1IIRA 1UZUA 3S0JA 5LQDA 2AZDA 5JTUA 3VUFA 4Z5XA 1C8KA 3H4IA
chains in the Genus database with same CATH superfamily
5AVTA 3VU9A 4BMPB 1BJRE 1OWPA 4ZIRB 4ZRDA 3N28A 4F45A 4OHUA 4B7XA 1MNQA 4EA7A 3CLRC 2P6OA 1X86B 1EI9A 1YL5A 2FJUA 2VKQA 4O4LB 5E8JA 3RVKA 2RH8A 1XLTC 5LMUB 4YR7A 4WXPA 1OXVA 2PJRA 4IILA 4TS9A 1AGRA 2ZSUA 1HLDA 1OASA 2QF7A 3ILSA 4EJSA 1HNXB 3AYZB 1NM5C 2WIAA 3RREA 1NW8A 2EW1A 2WA1A 5HKOA 5GIOE 1U7TA 3BSFA 1H22A 4W6ZA 1XTUA 2WHXA 1SG0A 1PGNA 1AUOA 2P8SA 4G63A 4RO0A 3GLTA 4CJXA 1CR2A 2JGMA 2IP1A 2GN0A 3CTPA 2WYVA 4QOHA 5AJUA 1USKA 1G8JA 1FPMA 3KLOA 2E4WA 3NJ8A 1W5SA 4G4SP 4N3BA 4CL2A 2GUWA 1H8HD 3M6FA 1J1UA 2V55B 2O59A 1QH1A 2O5RA 1EZZA 1LNZA 2A4MA 2YIDA 4TZKA 4MQFB 1KY2A 4ZV7A 5LWQA 3O1IC 3OIYA 1W4AA 2I1LA 4H17A 4RF3A 2WZDA 5KOHB 3DCNA 3AWIA 1QIMA 1CXZA 1TM2A 3DZGA 3PVSA 1RACA 1Z9BA 2FX2A 1H2XA 3EXG1 3LV8A 4Q1DA 3V2HA 5DLQC 3Q3VA 4HTFB 2IPNA 4N6OA 2Z6AA 4UVEA 1BO6A 2V5VA 3PYXA 2JK0A 2O8BA 2CCJA 1PJZA 2XYPA 4H59A 4LQCA 3MK31 1Y8ZA 4NE2A 3A28A 4D9MA 5IN4A 5CVJA 3FHJA 3F3KA 3V80A 4W5RA 3T5AA 5C53B 3HCCA 1L6IA 4JB0A 1Y7HA 1UBOS 2TMKA 4CFZA 2IEIA 4W8HA 2OZLA 4EABA 3OFKA 2NU9B 4NVRA 2BGUA 3P9QA 1OHHD 3D2BA 3L4BC 1MHTA 3N59A 1H5QA 3ZJYA 4KMOA 2G06A 1M0SA 4YAJA 5L3QA 3D6HA 3N39C 4KXFB 1HQCA 1QHHA 3G79A 4MINA 3TN7A 5IK2D 5JASA 4EPVA 4ZHQA 3EMVA 4B81A 4ND1A 3WP1B 3VV2A 3IT0A 3VPBA 2ZAGA 2XXBA 2CXNA 4KQJA 5EZYB 3VU8A 4DW8A 1GEEA 3H2YA 4GD3Q 2FQWA 4REQB 2OD7A 1HK7A 4YIHA 2O3RA 1MJFA 5CW1A 1YVRA 1GKUB 3PQ8A 4YECA 4UOZA 5KU7A 2QGNA 1R5OA 5AHKA 1QORA 1Y6ZA 2AQKA 3FSGD 4YH1A 3UMSA 3X43A 7AT1A 1SFRA 2G1AA 1BX0A 3RV4A 3W9SA 1CS0A 1P2DA 3O90A 1X13A 4LOAA 2F1IA 4FCTA 4GDFA 5EMKA 3QA9A 4JA2A 1ACJA 1BNCA 2E4UA 3L1JA 4RTPA 1M1ZA 3G0HA 4QM6A 3B1JA 4ZT6A 1AIPA 1XJ0A 2UUOA 2ID9A 2ZVQX 3IO5A 4R2LA 2GETA 2QE7D 1X9HA 4M83A 2VQ6A 4BFWA 1EKXA 2NXNA 5JS7A 1G63A 1YOVB 2FDXA 3GEGA 4HRAA 1O96A 5EP1A 1DG1G 1K88A 4TWJA 3GPCA 4MYHA 2XW6A 3SEZA 1GPNA 3NNNA 1JVBA 4IXWA 4LZZA 3IAS6 5AH0A 3KDAA 1XZIA 1CDEA 5ICCA 1E4EA 2UZ0A 3VGJA 1RQNA 4WW0A 1UKCA 4DQDA 4RQUA 1G5RA 5AKZA 1F3OA 4FR5A 3BRSA 2WIDA 2ONKA 3GRPA 1TQ6A 1NC1A 1AT1A 3W5CA 1RU3A 3T95A 1A8QA 2C99A 4KYVA 4B35A 4BFCA 1MJHA 2D0PB 1JR3E 2F62A 1YQTA 4R0MA 1F51E 2QN8A 1XVAA 5MN6A 5ALXA 2G0AA 4PLPA 1CUVA 2X4IA 3HEMA 4YPFA 2VNAA 2X2OA 2O2GA 4HR7A 1XA0A 3TB4A 2HWKA 2ZXEA 4ZCMA 5AW3A 1GZVA 2ATVA 1JXAA 4NBWA 3SHOA 3ZY6A 5JH7A 1JKFA 3NWJA 2XJ9A 3UMJA 3WLSA 3VGPA 16PKA 4IRXA 2GNPA 3LF1A 4H7IA 4Q1BA 1CULC 3FHLA 4KRGA 1TEHA 4HGNA 3P0RA 3OE7A 4LZNA 4WNIA 5E9WA 3RS4A 3RVPA 3O73A 3ZJUA 3KQMA 4MV1A 4L9SA 5DSZA 1CUIA 1FYVA 1EE1A 3KDPA 2FEOA 1QE5A 4BLWA 4XYGA 1TYZA 3S29A 4BE4A 1O95C 2ZWAA 5KWSA 2AR7A 4IWXA 4K9RA 4RFLA 4WLFA 5C0OE 3TGPA 1V4NA 4OL9A 5IXJA 2Q7XA 2XADA 1QIFA 3E82A 3T35A 2VLIA 2OCBA 1EVLA 2XMRA 3EHDA 3TGWA 1L7AA 2IYSA 2IXBA 3ICOA 4XJXA 3UYKA 3VPDA 3CVVA 4LYFA 3DZ8A 1NVAA 3MT8A 2GF0A 2OZVA 3E7PA 3MRSA 5EWMB 5IDVA 4I99A 1N1EA 3PD0A 4JUCA 2LKCA 4JYPA 4LDQA 1N1GA 4TWIA 4EHIA 5B4TA 5KQGA 3NOQA 3MMXA 4DQVA 5KTPA 2GWRA 1XTKA 2VTBA 4Y2JA 4WZAB 1DBRA 1FFDA 3QKUA 3PGMA 1GAWA 3D7LA 3VKGA 1ISFA 4IO1A 3CONA 4UTPA 1EDBA 2IEAA 3H19A 4HK4A 1UR5A 1C9NA 1FX1A 2G5CA 3DZDA 3T3DA 4IL5A 1E5QA 3MC1A 1XCLA 1QG6A 1T3SA 2IS4A 1A5ZA 2VJKA 1B6GA 2Y1LA 1EAYA 3LW8A 1G20A 3W3ZB 3PPYA 3O1LA 1L5FA 2CXHA 2HJSA 2WF6A 1DDOA 2PZKA 4HDNB 4L7VA 1T4CA 5ALEA 5E0OA 1RAFA 3UA4A 1U9JA 3C41J 4ARZA 1NI4B 2EEZA 4IH1A 1SC1A 1FTQA 2IEZA 4IAOA 4ROTA 2GCNA 3E58A 1GA6A 1C0KA 1RXYA 2B82A 4Z7OB 3HDVA 2NV0A 4LHEA 3PZRA 3N87A 4MV0A 5HKLA 2OL4A 3WL4A 1E3LA 5IHPA 4DFDA 2WOOA 4IY1A 4YUZA 3D7KA 1L7VC 1JEYB 5MF6A 2UZ1A 1QYDA 2VBIA 2Z5VA 1NLUA 4AMBA 5DYNA 3CZQA 3DF7A 1JSXA 4QNRA 2XWSA 3HRIA 2F90A 3QYPA 4F3NA 3VBCA 2I6TA 1QE3A 1QRUA 1W0KA 2WUDA 4LXUA 5EEGA 3DPSA 3WIEA 3GLFE 4K40A 1UPAA 2CXQA 3PENA 3TXYA 2X9LA 5A6VA 3EYWA 1HFKA 2H9YA 2BFWA 4XWKA 3PCTA 3C6ZA 5LQSA 4DC1A 5JAQA 2E21A 1U0HC 1A7UA 2AOXA 4GBED 1VDMA 1GYRA 1WBJB 3IP7A 2DUJA 3WOHA 5L7WA 1GPJA 1N5MA 2F3TA 3PKZA 4LXGA 3NVKI 1BVHA 1CHDA 3MW8A 2D59A 3GUUA 4K6MA 4DSAA 1DKLA 5K0FA 3DMTC 1U5AA 2YXLA 2ZBPA 5FUMA 4UHHA 4OQXA 4DZZA 4EWLA 5JPCA 1YR7A 2JCSA 2QNBA 3KJIA 5FTMA 1L5HA 2PLAA 3W5HA 4EKIA 3HZOA 3FHOA 1H6DA 4BNKA 4TQUS 1TJPB 2G8NA 4RE5A 4Y30A 1YQWA 4FE3A 1U99A 1ZUD1 3QVVA 3DT9A 3RIYA 1VQ1A 3VZCA 3R23A 4BFLA 2N1MA 2XE7A 3BFXA 3G1UA 3NM6B 2YN0A 1XVTA 4L73A 1ZI6A 2C84A 4J2TA 2YJZA 4M37A 2HXYA 3I0ZA 2OYCA 5LIPA 4R9UC 3I5YA 3AVXA 1OH7A 1JQ5A 2A88A 4KVFA 2XUKA 3E7DA 5DHAA 3NHZA 4EM6A 3B3JA 4F8JA 2BDTA 1THGA 3WTCA 1OH6A 4IHJF 5EJGA 5BOVA 4G0MA 5BVGB 1KYIA 4UUNA 3ZIDA 2AGVA 1FDVA 4UHBA 4W6QA 5J40A 1WPQA 4PGGA 2VOJA 1O6ZA 4XLZA 4EMTA 3JD1A 1V16B 5GTDA 1Q74A 4NHOA 3X44A 1U65A 1NP3A 1R88A 3W5JA 4IDFA 3TNDA 1Z0ZA 2YOHA 1JR4A 4TS4A 1NXPA 5CVCA 3R2JA 4TOIA 3FNEA 2BM0A 2YXDA 5LZ8A 4HOYA 4IYJA 4LMPA 4GNKA 4WA8A 4BMCA 1Y5MA 1PV4A 3ZE7A 2HM7A 1IUKA 2QL6A 1KVQA 3IE2A 1DCKA 3S99A 4B3FX 3MJ4A 1O4VA 3QVSA 5F7JA 2APJA 3FCXA 5F73A 3C14C 1ID1A 4FFPA 4EF5A 1PKEA 5B7GA 5BV0A 1I4WA 4US0R 1S0UA 2ECPA 4WLUA 4MUYA 2H16A 3ETGA 4BRWA 3EWIA 4CXMA 4MWOA 3ONFA 4PYKA 3A6JA 1ZWLA 4OUDB 3AB8A 2DERA 3COPA 3T12A 1AKTA 1KYTA 1K08A 3B1KA 2HX1A 2I65A 2YC2C 2F55A 1WHSB 2C96A 2QG4A 4TLCA 2C5EA 2YNMC 3DD5A 4FMCB 3ZCVA 3C5CA 1JYEA 2VJNA 5FI0B 4CEJA 4MYDA 1JI3A 1G38A 2VWHA 3EEYA 3FF1A 1NVGA 1KAHA 5AKGA 3MCAA 4MI3A 1V8ZA 4KUEA 4YDSA 1CLEA 5TPWB 2D8AA 4X24A 3GL9A 4Y98A 5L40A 4HBZA 3LBAA 5FLXA 3A4NA 1NFFA 4E6PA 4FI3F 1TKAA 2R2AA 3CF6R 3FDZA 3MJEA 4JNCA 1BJKA 4EFDA 1P5FA 4WDQA 3ZWCA 3VC2A 4O0LA 4MX8A 4LCEA 1RC0A 1A9OA 4QIHA 4CTNA 3M33A 2Y1DA 4KO4S 1CIJA 2FE1A 4K3UA 4ZEXA 2PUGA 2Q4BA 3MA0A 4D79A 1MTZA 3GFQA 1WSWA 3ON5A 1KQGA 2GEKA 4FEGA 4DF3A 1GPLA 3HR4A 2JJ1D 4K28A 4D5EA 3CF4A 3GY0A 4FHZA 4XDZA 5A62A 1YKFA 3EGEA 1JAXA 3HUUA 5AUQA 1CUGA 2KM1A 3TLGA 3QV1A 2QX6A 4XQCA 4X7PA 1PVDA 3B9BA 4NBTA 3NBKA 5DGCA 1I7QB 1A9TA 1QONA 2XB4A 2DHEA 4J0CA 3KT0A 4HNAB 5JCOC 3NM4A 4LS3A 4M1ZA 1F17A 4LRQA 1DAHA 4CF6A 5IVHA 2VRCD 2DTDA 1ECJA 3B9PA 4KLNA 1WCIA 2WRZA 4XYMA 1Y3BE 1KOLA 2AHRA 2M98A 3L6CA 2WHEA 5KJ1A 2EZUA 4CMJA 5SY9A 4WNAB 1R9JA 4YLGA 2W2TA 1S3SA 5DCUA 2XA1A 1NHGA 2IK8A 1XEXB 1ZM9A 4MMXB 2GA9A 4L2IB 1KRXA 5AVZA 1Z35A 2ANCA 2F7SA 2HO5A 3C1AA 3EA5A 3VDNB 3T4XA 1XZAA 4LFAB 1RXCA 4OBXA 1NBAA 5CVDA 3GXOA 4ZKEA 1KBQA 3X2SA 1NOKA 1NURA 3KE8A 3HI4A 5D87A 3CIFA 3AUJB 1FZTA 4KYIB 5CM8B 2Z9CA 3EGDB 3OJOA 1KJJA 3FGZA 1E77A 5BW5A 1FP6A 1DAMA 7REQA 2D2IA 2XMSA 2Q3EA 3B1VA 3EXHA 3T9CA 1QIKA 2LTAA 3AFHA 2FMHA 1Z26A 4OHPA 4L4ZA 2QQ5A 4LPKA 3U3JA 4QEDA 1ZOPA 2QRJA 4MJ7A 3D2AA 2H3HA 3IUNA 1FDIA 1ICIA 3AR4A 1VYHA 2VDWB 2XYGA 3LPLA 5HUHA 2HTEA 1J6UA 2A9RA 2DX7A 3GOHA 1QYCA 4S05A 2OHIA 3L82B 4ENWA 4O5OA 3RO7A 2MSDB 5K3AA 5AKYA 2JF0A 2WJAA 3EFEA 1V8OA 3GUYA 2D7CA 5CH5A 3KYJB 3TOZA 5KWVA 4EHAA 1P3DA 2MYNA 5EXPA 2TMGA 2CFOA 5EE1A 2ID4A 3SLRA 1UBGA 4C4AA 1OB2A 4W8OA 3LMKA 2HHAA 1W9HA 4D0RA 3B1ZA 1T15A 3ABQB 1W87A 3PC6A 4JD5A 1DADA 1Z0IA 2PZMA 5BNWA 1JS1X 1Q1ZA 1H8ED 4B2LA 1J97A 5IC4A 3CZPA 1X7ZA 2I3DA 3N1UA 4XPIB 5HRUA 4RTJA 4UM9D 1JYFA 1DBSA 3IURA 1I0IA 3OCXA 3QLEA 3FVWA 3N7UA 1SWVA 3LLSA 4JJZA 1JQKA 3IELA 5JSZB 1LD3A 5ER6A 2D0IA 1C9KA 2C3UA 2JJYA 3JQAA 3JD3A 4IJVA 3DQZA 4PG8A 4YT8A 5F7XA 2HEIA 3A26A 1JDNA 1SBNE 3NUZA 4RWEA 3DOIA 3AINA 1JFFB 3AF0A 2B7BA 1XALA 3COYA 3K9WA 1NNI1 2BZGA 1TVKB 2PUFA 4JT2A 4EHHA 3HYSA 3Q7RA 5KMGA 3GJRA 3DR3A 5AUPB 5LP6F 3JQGA 1EESA 2I2BA 3HJAA 4CMEC 4AUKA 2ZBDA 3F4LA 3NXSA 5EWLA 1N6PA 3VOSA 2W2MA 3E2MA 3JWEA 1A71A 2DBRA 1DXHA 1TEVA 1WU8A 4M0EA 1MB2A 4MB6A 4B32A 5HIIA 4B82A 5BXYA 1T9HA 1GTG1 3PQ4A 4QREA 4XWYA 4PAMA 3ITKA 4Y1RA 3D54D 2I91A 1ZIDA 3U80A 2YHAA 4ZZ0A 4JS0A 4YLEA 1OC4A 1LVHA 4WRRA 5BWNA 1TZMA 2I99A 1UMDA 1ZGGA 2AWNA 3QW2A 5THQA 4S1TA 2HCTA 2M32A 3OPYI 2BMWA 2HF7A 3FGNA 2MCFA 4HLDA 5KSPA 2DLCX 1PJCA 4QBHA 4BFVA 4L0CA 2XB8A 2GXAA 2X6RA 2IDJA 2EL7A 5CBPA 4JJ6A 2IX3A 2JHCA 1U0RA 5JCJA 1Q5PA 3I9MA 2FSFA 2MR5A 3TIXB 3U48A 3W1VA 4LBWA 5A9RA 2UYCA 4JKIA 1SUEA 1SHJA 3LHDA 3SF0A 5HBRA 4XUDA 2FH5B 2JEYA 3IVAA 3LFUA 1FMLA 3JAKB 2I2WA 2QY9A 1F0PA 4IDBA 1ZD4A 4DMLA 1U4NA 4TZ0A 3E48A 4PSCA 1GTJ1 1TIPA 2QE6A 4P22A 1DAGA 4RTRA 3NQ41 3S2GA 1PE0A 3DHWC 3GPDG 3JAMA 1KIFA 1CZOA 1VLLA 1N6IA 2H1LA 2R97A 2R7LA 4HS9A 3SIWA 1ARZA 2J5RA 1DQSA 1R0RE 2I8AA 4R2HA 4ZALA 5CDTA 5IFKA 3MJDA 3S44A 1RHUA 5FYDA 1R50A 1MW8X 9ATCA 2YWEA 3G0IA 3F3MA 2IP4A 5TX7A 1OR8A 5DBOA 3IEXA 4XSVA 4AIRA 3FROA 2ES4A 1RC8A 2RHCA 1VP9A 2AOUB 5ES4B 2MT9A 4BN0A 2E4YA 3H83A 2A1TR 4RMJA 4J0JA 3E70C 3KSMA 3L18A 5SYNA 5KEIA 3FOZA 5GV7A 4IJKA 4EJMA 1TJNA 4YB8A 4UTVA 5HJ7A 4C06A 1TPYA 5G0TA 1E6LA 1K3TA 3GK3A 4OBBA 3H2BA 2BVNA 2O2ZA 2ZM5A 3VH2A 3PDIA 2OR3A 4AJKA 5REQA 1KEZA 5KTOA 1R37A 4UZSA 1YJBA 3W2TA 2AFIA 3HB5X 1FFGA 1E2JA 3STHA 4NCKA 3DTVD 1QJ4A 3PLAE 1SC4A 2VP5A 4CL3A 5FBQB 3OPMA 1G3IA 2YJTD 3TQHA 4GPEA 4RVOA 1T5BA 2OBXA 4V03A 4CRWB 4F56A 4YCSA 4B84A 1GGMA 3NOXA 2Q1XA 3UY4A 4TKVB 4CCYA 2XE6A 3FCAA 2GRUA 3ZDFA 4OL0A 3O8QB 1NHWA 1QIGA 3GLVA 4JQZA 4Y2RA 5U4QA 1RAHA 3UCEA 1CZHA 2YRWA 2FUCA 3ABZA 4IEFB 2I76A 1TW2A 4KQMA 4NZMA 5CA1A 3I32A 4HEQA 1UFKA 2INGX 4KLCA 1BVRA 2A78A 2PL1A 2R8PA 3NEAA 3L6OO 4D42A 1E6MA 3A2NA 4GX1A 4A8TA 3ENNA 4BUJA 3FYUA 5AD1A 3K53A 3QY0A 4CW7A 2B1GA 3DUFA 2W9XA 1EM8B 4ID9A 2FFHA 1RYMA 3E05A 2Z56A 4DNQA 5C1BA 2UYQA 2YMMA 4C0WA 4BO9A 1DVRA 1Q92A 2XF8A 3GUZA 1W30A 4MAAA 3P2KA 4OSOA 4RA9B 3RR2A 1EUCB 1FLVA 1FMTA 1QGDA 5DHTA 3PUJA 5KYWB 2O8BB 1C0PA 3NH9A 4FHCA 1GRNA 3I2KA 1Z75A 4FYYA 2PPVA 4KPEC 3OM0A 1M73E 3CE6A 1CNMA 4WGFA 4WBXC 5K0ZA 3W79A 5EY5B 4OLFA 1C7RA 1E94E 3JRNA 3STUA 2PHZA 5AVVA 3T94A 4G0ZA 3Q10A 2EL9A 4FTWA 4H60A 1FTNA 4GQAA 4QBFA 2BMJA 5DGIA 4HTAA 4C0QC 2ZBFA 2LWIA 3LP6A 3RV3A 3AOGA 3ZWYA 1VG1A 2XV1A 1MABB 1G8YA 4UUMA 3LY9A 1HI9A 1X80A 3F2VA 5THXA 5A5DA 4KODA 4KE7A 5CG1A 2L19A 1UL1X 2FWBA 4H7FA 4UTRA 3ZQKA 3W6ZA 4PYRA 4W99A 3UK6A 4R7GA 4OHWA 2EKZA 3TBFA 3I5MA 4EUKA 3L8DA 3Q9UA 3HVRA 3C3XA 1T0HB 3CVOA 3DAGA 4LCJA 3GT0A 1US8A 4BGIA 4GPIB 3CS3A 4MW5A 1HZZA 3F96A 3H5VA 4TKZA 4X20A 4CT0A 1K5DA 1CHNA 1PT5A 2HSWA 3EVFA 3HA5A 4Q3AA 4WNCA 4XB1A 3V4FA 2B99A 1B23P 5KYXA 3RHZA 3KOXA 2G9QA 2D3WA 2GXQA 2ZJ1A 1YS6A 4UARA 4L5BA 4X3OA 1KWKA 5CRIA 4DLZA 1KVUA 2CE2X 2P2ZA 2XNDA 3GRVA 4OD0A 4B6PA 3NIFB 1V96A 2AUNA 2IIPA 5GAJA 3WGGA 2UUAB 1D8AA 4C21A 3AVOA 5JSUA 2CJFA 1X87A 1KHHA 5H9VA 4D7AA 2P9TA 5FWDA 1G42A 2A9OA 4OB6A 1Q77A 4RZ3A 4BNDB 1P18A 1KP9A 2YN2A 3JASA 1QVRA 2KW5A 2QENA 2ONZA 1ULUA 2W4MA 1JWBB 4XSGA 1JAZA 2J3EA 4MHOA 4FWIB 1RRFA 4ZMSA 3A4MA 1IBKB 3SP1A 1ISJA 1T1IA 4MUNA 1G41A 4QRDA 3TZEA 2PQ2A 3ZKAA 2V4UA 4ARCA 5FR2A 3FIJA 4B6OA 2AZTA 2X9QA 4L02A 5A9TA 1ZJWA 1I7NA 1VDZA 1YE8A 3TW6A 1RQLA 1DIHA 1B1AA 2VEOA 3FPEA 4DR2B 1Z38A 1G5FA 2DPGA 2KHZA 2P3QA 4Y3UA 1FTYA 3QLJA 1P2TA 5C8YF 1CSEE 2GKGA 1ZA2A 1JDBB 5A7HA 1JHRA 1WZNA 3ZDEA 4BRSA 4F4IA 5IZ4A 1M2OB 1OGIA 1PS9A 2VSFA 4XRRA 4IUDS 1C5KA 2CE7A 5FYQA 1BMTA 4DCSA 5I47A 1KMQA 1SCIA 4KXUA 1Z33A 2I71A 1VSUA 2OBYA 4B3TB 4BAZA 2PR2A 1U3WA 2H4ZA 4PFQA 4QFMA 4ZVQA 3LHIA 4M0KA 3UUWA 3OQOA 3ER8A 4XWAA 4IP0A 3WOVA 4AF7A 3UG6A 3UH0A 4FJ2A 3GLQA 4BS9A 2BJWA 2MSWA 1FIUA 2CL7X 4YFVA 1QRTA 4F6RB 4BLOA 4LGMA 3NCTA 4X60A 5JCXA 1F0KA 1UXIA 3L8YA 2IOFA 5NULA 1T9KA 3BSWA 5EYPB 2UYYA 3NWOA 1COWA 1EDZA 2NO0A 4MV9A 2P67A 3Q87B 4LXHA 2HT1A 5FPPA 4E07A 4WOJA 1V39A 1Z7EA 2J3JA 3BPSA 3L1IA 4IHKA 5GOZA 5IKMA 3OWHA 4WBSA 3V1TC 1A5SB 2OCXA 3GNQA 2FOXA 3P2JA 1ENZA 1O3YA 2QMZA 3A7DA 4M6WA 2P90A 3HN6A 5HMMA 5TGDA 3SGLA 3WRXC 4CKWB 1VLVA 4C4ZA 1QFZA 4HADA 4TMTA 5AHWA 1QFMA 2GBLA 3OT1A 4IRUB 4FX2A 4M7WA 4F4HA 2B1JA 3PNBA 4JHXA 4X66B 3ZHUA 2NWQA 1L5WA 3DMRA 4KFSA 1S4MA 5E1DA 3WYFA 4IXTA 1RCTE 2DBQA 2HV9A 1WPRA 4YRKA 1DTWA 2B0CA 2CJYA 4TTRA 1L7NA 3DHNA 3L6UA 3LOQA 3HB9A 3PC3A 4JB2A 3TDMA 5CYGA 4RZUA 4TL7A 2ZRQA 4GGMX 3EVEA 3W2HA 1BDIA 4K1LA 1YB2A 3L3BA 1MLDA 4MA4A 5T4HA 1NUAA 5IANA 3OKFA 3QOXA 4QTYA 3ZYZA 4RVUA 3QPBA 5A5GA 4U2GA 5HCNA 3M4JA 2D6FA 1NBIA 1NBMD 3UMGA 2BJHA 1NDUA 2BGKA 2W6JD 1TMKA 2OC4A 2RK6A 2YW9A 4KWCA 1EFTA 5TT1A 1JNYA 2W48A 3U3OA 2TS1A 5SV2A 3GLFB 2O3QA 3GIWA 1F06A 1KK1A 1W1UA 3K9NA 3D64A 3I9JA 2OK8A 1UPCA 2P5TB 3FLBA 2VWQA 3MAJA 5DHSA 2Q3DA 3PFBA 4UNIA 3B7GA 5KDOA 1DT5A 1SRQA 1VBNA 3VR4D 4K9DA 5DHRA 3U4MA 4PYOA 3DE7X 3LT4A 4AJJA 4Q3CA 4WKBA 4YV0A 4O4LA 4JI5B 3UPTA 3LP8A 1QR2A 2R1VB 2GDJA 4QT0A 4IQFA 5AM1A 3KEMA 1WIWA 3ZD8A 2Y1EA 3MAGA 4BQNA 5H70A 1JTVA 4Q16A 4WKCA 4R1UA 4ZJYA 1EMDA 2G28A 1XIVA 3MINB 2I3ZA 1D7AA 1CNFA 1KI1A 1RJGA 1P75A 1X19A 2BTQB 2DKOA 1VMEA 1N3BA 2B4TO 2D54A 3LYAA 5B58T 1RYHA 2NU8A 1HTBA 2ZE7A 3I04M 3F8TA 3C5WP 4G0OA 4NOLA 4B44A 2Q3JA 1RJFA 3BD8A 3TZQA 2OZKA 3KTFA 1PJQA 3GP8A 2B30A 3Q2KA 3IVGA 2WU1A 3QPAA 4JI1B 5SZJA 4RK5A 4A03A 2IXDA 5BYJA 5U9CA 3N2ZB 3WNZA 4IOMA 2HA0A 4F2PA 4LQLA 1N6RA 5JEDA 1GIAA 5KOHA 5FR1A 2FLWA 4DC9A 3VR5H 4HNVA 1JG6A 2WM3A 4LNHA 3AIMA 1H1DA 4JJFA 4BDSA 1CQIA 2V7EA 2IUYA 3RF6A 4A8JC 4G1UC 2WKQA 1B8VA 1OOEA 1NQTA 3V1YA 4MYRA 4PW0A 1NBHA 1NXWA 1YJCA 5EIAA 3MCUA 3GMTA 1JIIA 1ATIA 1F6DA 3IBGA 4YXWD 1IN5A 1XNJA 5F5XA 1UT6A 2EJVA 1EGHA 2QVCA 5E1BA 4JB8A 3STVA 3AM3A 4R8LA 3RSSA 3UPDA 4DIEA 3QBJA 3QXGA 2ZYIA 1Q1BA 2D4AA 1N5IA 3UB3A 2FXIA 2D2XA 1GUAA 3RUCA 2X7HA 4J4TA 4Y2SA 3B89A 1BHQ1 4B80A 4JXXA 2Q5CA 5GMOA 3HSKA 4U63A 1P0PA 3RBXA 4J6EA 3VR2A 2ST1A 4E31A 3UWPA 3MQ2A 3M6VA 5DKFA 3C3BA 2IYQA 4XLLA 4Z0HO 4D46A 1J0XO 4MJ3A 4N8DA 3RU2A 2G7ZA 5C3MA 8ABPA 3S2UA 1YC2A 3A4VA 3TFWA 5LB4A 4I5EA 3O1HB 4HX5A 4M38A 1Z18A 5EZYA 2HY7A 1DC8A 2BFFA 3ZI4A 1SEVA 1CIPA 1DOAA 2PEYA 1R0ZA 2ZIUB 3FPBA 4H1VA 1M2FA 3ZGXA 1BJTA 2HMYB 1YZQA 3CBGA 1CVRA 1PLLA 1NUHA 1SUCA 1CY0A 1LSOA 1QSGA 2Y1XA 4M1TA 5EMHA 5HE8A 4D6YA 3USES 3FNQA 3ECCA 3TQOA 3OX4A 2GVDC 1HURA 1Z6ZA 4CM9A 1S1CA 3WY9A 1FXSA 3DBVO 1RXSA 2Y05A 2ZROA 3LXUX 3Q15C 1G18A 5HG0A 4BFUA 2EZTA 2OO5A 5TMBA 1J39A 1ZN9A 1GUFA 2YX1A 1GJRA 1W19A 2C2KA 4JBLA 1WB5A 3JV7A 5HK8A 3U7EB 1UOOA 1X39A 4E12A 4ZHSA 3T52A 4OJNA 3GMDA 1QQ6A 1LI7A 5HGJA 3VZDA 3PUYA 4I55A 4AQDA 5B57C 1DJPA 2QG9A 1HDRA 2P4EA 3HXKA 2DJ5A 5DHPA 2PH5A 1PJBA 4ZPXA 4ACBA 5EJ8A 2AVNA 2CDRA 2C95A 3BKWA 4BUCA 1NMZA 2BE9A 2IYOA 2P6NA 3WMGA 3MLBA 5DIFA 4JIMA 2FF7A 1RWKA 2WWYA 3ZVLA 2HRDA 5HFJA 2PUBA 4PWYA 1G5IA 4W1QA 4E33A 2YV1A 2FPKA 2BSAA 2O8VA 4JL8A 3UAXA 3LUPA 1CQWA 3K16A 3QWHA 3VHXA 4BC1A 2XXJA 3CU5A 3K09C 4CVNA 1P9WA 3L0BA 3WB1A 5JAZA 2R86A 2P1DA 1EVIA 1P0CA 3OIFA 4E1AA 2D7DA 1VL8A 4FFDA 3WP0A 1B3RA 1RWVA 1BQ4A 3DS8A 1DXQA 1G2PA 3ERCA 3K9HA 2R6HA 3UTCA 2IDMA 2XJ4A 5FLKA 3ZI0A 1EQ2A 1E2UA 4YAIA 2NUPA 3H5NA 3V2UA 4CMCA 1QF9A 4DNPA 3L4BA 4OHMA 4BX8A 2I55A 2PKYX 3JARB 2MSCB 1YRQA 1B76A 4X6XA 2FWRA 3MB8A 4UUPA 3FSJX 1L8OA 4LDPA 3ICPA 5TEVA 4F5WA 3L41A 3GGCA 3B2EA 4YP5A 1OREA 4MW7A 4YGXB 3IERA 5IKPA 3OQNA 2I7TA 1IBMB 1RD4A 4H9GA 2WE7A 2Y77A 4XM1A 1P7YA 1RXEA 4NWIA 3VR6A 4E2ZA 4YHHB 2C59A 1D6NA 3FSRA 3KUXA 3QNUA 2FVYA 4F7WA 1LJ8A 4W5JA 2ZJ8A 3E7FA 3LVBA 5CJ2A 2W8ZA 4YUXA 2ZRJA 4LZJA 3M6LA 2PX8A 4V0QA 3DMFA 3QNMA 1YZFA 2JLCA 4JP1A 5J59A 3VAAA 1VSQA 5HTKA 3R6DA 4EPXA 4AZVA 3CLUD 3NRJA 4X1IB 3DFZA 1KJWA 2P2CA 2B36A 2B2CA 4GSLA 3C3MA 4TLBA 3QELB 3LO5A 4J1TC 3UXYA 1LBSA 2WU3A 3EEOA 4WZAA 4MUBA 1FDWA 2X3YA 4RDIA 4GLBA 3DBOB 4C9BA 1E3EA 1P39A 3QX7A 4O2RA 3QUTA 4O3MA 1C1XA 4ZGWA 1O6GA 3KAQA 1C3OB 2IPAB 5EPEA 3U17A 1W96A 1N7GA 2FLKA 4GPAA 5T4BA 3HBLA 1F6BA 4ALIA 3GO4A 2C5HA 2Q6LA 1PHRA 1ULSA 2J85A 2Y71A 3HCRA 3WMEA 1RWOA 5JARA 1AA6A 1F2VA 3NPMA 1BU8A 3P27A 5BY2A 3EY9A 1SCDA 3CUEF 1LDMA 2DBZA 4FGKA 3RSOA 3IIMA 2EGHA 1NI4A 2W2QA 1CRZA 4H7EA 4U7TB 2AF3C 4X7MA 2WSIA 3FMFA 4LV8B 4OA8A 2NP7A 2C2OA 1NPYA 4EGJA 4Y2GA 1P4HA 2EWVA 1YFZA 2KYRA 5JDCC 2PE5A 3QIAA 4G0XA 1UFQA 3LY5A 1KXZA 4JP3A 2CLKB 3CZAA 4BNJA 4DM3A 4UCXA 2O1SA 2WI8A 4PYMA 1YCFA 5AOBA 2QRVB 4RTKA 5BW6B 1FXUA 1CZLA 5SZIA 1U6JA 5IVDA 4QGAA 4MS4B 3AHHA 2OHVA 2OM6A 4HDOB 3RFFA 721PA 5D3ZA 2WWHA 3LYLA 5LYJF 1ZCBA 5C5EA 5H0IA 4G0VA 3KX2A 3FM9A 1SWWA 2G25A 3ANTA 4K0RA 2GXSA 2QDXA 3GOQA 4JFAA 1W88B 3SN6A 3VXKA 1XTSA 1RLJA 3O6VA 3K6KA 1NXXA 3PNOA 1KSFX 3M6WA 4D8XA 4DTIA 1LV8A 3LRTA 1OCEA 1JFTA 2O5VA 3A3NA 4QUKA 3FFWA 2JLXA 2WQ6A 4DKJA 2ZIEA 2CF6A 2XHEA 5FLYA 2G0NA 4LDNA 2CV2A 1NVVQ 4LGCA 2OLKA 1CF2O 1T4GA 3LZ6A 5K3FB 2V59A 2O5CA 4RABA 1BMFA 1RI2A 2RH5A 1XHEA 4A0FA 5ESXA 1SVIA 3TZLA 1TTPB 2Q8PA 3AJ8A 3GPLA 3ICCA 3L6DA 5FQOA 5IZCC 4DB2A 2AEMA 4TUYA 3DEKA 3THOA 4ATNA 1GY8A 1T91A 5DMHA 2DYKA 5HRAA 5JZBA 3EXG2 2DUNA 3UGQA 3KQVA 3HXTA 5IDWA 4QFCA 3S2EA 2JIDA 4Q6WA 4R0VA 1HE1C 2A9PA 4CHTA 3H1EA 1ZVVA 3HRHA 3EVTA 4FZJA 1NTRA 1SHZA 4G84A 2I33A 1XDWA 3BUSA 3B78A 4Z7QB 2X5OA 4KAFA 2Q0XA 4RNCA 3H9CA 1JR2A 2GD1O 1IWBB 2V45A 1XWIA 2A5JA 1L3CA 4LJSA 4TN5A 4DRZA 1VZ2A 3SVZA 1SOAA 5HYVA 1E6KA 2YL2A 1MENA 2A9KA 1FLAA 1DXYA 3ITDA 3L0YA 3VDMA 1HX7A 4ZZ1A 4YMSA 3AXSA 1JECA 5E38A 5BVGA 3U7GA 3D2CA 5FBLB 1EM6A 1UAGA 2NVWA 4F85A 4ZN6A 5H3HA 2ZLBA 2J31A 1N3IA 5EXXA 3WGJA 1Q3TA 4PC6A 1NUUA 1W75A 1MAHA 4NHEA 4XJTA 3W6PA 5SYMA 5F1PA 2V8BA 2VAVA 4AWXA 1LDGA 1UXGA 1KF0A 1NE2A 5CUQA 1GVHA 1XE3A 4WAUA 2QM7A 2Z04A 3GA5A 4B6EA 4AI6A 4FW8A 4Y8VA 1W6UA 4ED9A 1TRHA 1E3WB 1GITA 4TL9A 3SM9A 3X2FA 1O94D 4FHFA 3TR5A 4TXNA 1FL9A 4B75A 2PXAA 5I4IA 1TUEA 4HNQA 4JBWA 4FZ3A 1LQUA 3BB3A 3BB4A 4GI7A 2NZXA 1EX7A 1P19A 2QUZA 4TTJA 3PHIA 3RUHA 2C88A 2J5BA 3WV5A 3WL8A 5AVYA 2DRIA 1RYNA 2Q9UA 2JFUA 3FTQA 3IPXA 1T5LA 1T2FA 5CNMA 5EN4A 3MXTA 4MNTA 4OUDA 5AJXA 4XWOA 1ISIA 1K8XB 3QVLA 4PX9A 4BOYA 2QI9F 2H08A 2R8RA 4LRYA 2F59A 3BCHA 3UFBA 3M6IA 4N9WA 3LHSA 3JY6A 3PA8A 5E8RA 1JJ7A 1BGVA 2IYUA 2XKBA 5FORA 1YTUA 1UBUS 1K7EB 1NGSA 1UBEA 2ZE6A 4B7UA 3PDJA 4J29A 4YP1A 2WMYA 1L0BA 2Z57A 1GNLA 1I1HA 1OBFO 2PZ8A 2JFQA 2QLFA 3HYRA 4G8JA 3PUHA 3PXXA 1R0CA 3AF3A 3VZPA 4JDUA 1BXKA 4D8VA 1HY3A 4KOEC 4HN9A 4K9NA 2M9MA 4DQKA 3V42A 2GHRA 4KDCA 1IZ7A 3Q7TA 5F9MA 4IFTA 2E4AA 4WCFB 1SXQA 4L8WB 5M34A 3BAZA 3RRJA 4M8NE 2GJ8A 4FHEA 3I8SA 2ZUDA 2BE7A 4B34A 2XQIA 1QHNA 2ZT8A 2XTJA 1WCYA 3JQFC 5K0LA 5BSRA 2ACWA 4MCHA 4QYXA 4C6HA 5BOSB 3CTMA 3HVIA 3G1WA 1M54A 3HMQA 1WUYA 2AKYA 1YONA 2PSJA 5DRTA 3IKLA 1J2JA 3E9DA 2ZRCA 3BGWA 2X1HA 3QUCA 3MJRA 5TS3A 3VJMA 3ZV4A 4O2AB 3A1DA 4BO4A 4XVUA 3PZBA 3ZU3A 3S8MA 1P5HA 3MD0A 4PCLA 3TJMA 2FHPA 3OQBA 4H7KA 3DL4A 4MRMB 1DPFA 5KC9A 1ZRHA 1TNDA 2UDPA 1IY8A 4RY9A 4U00A 2ZATA 1PG5A 1I01A 1LSJA 2OGZA 4QELA 4LZWA 3AL0C 3PTZA 3G9UA 2VTKA 4AJEA 3T9FA 1O58A 1XEXA 4YC7A 2YMQA 3M4YA 2DY0A 1KSGA 1F1JA 3TKLA 3UHPA 4CLHA 2IH2A 3J7TA 3AVVA 2D5IA 2O2SA 1J0BA 1KY3A 4YK7A 2EHDA 3B53X 5HS6A 1J8DA 1BWSA 4C6TB 4L51A 1CQJB 5C7YA 4YCDA 3MJTA 3RC7A 1QHYA 2OXIA 3YASA 1RVV1 3ENKA 4OB7A 5TXGA 3EGDA 4R16A 2O2YA 5T8KA 3K0HA 1NU8A 4DSOA 4FOSA 3ZY4A 2JI4A 2ZR7A 3WAKA 1DMSA 1VIAA 5LMZA 2NPIA 4YMWA 2B3DA 2GYYA 2J9YB 2W2LD 4ISCA 2DP4E 1H9CA 3HBJA 4ZEOA 4RQAA 3RVNA 3DO5A 1FRFS 4IQ8A 4YRCA 2PY6A 1N32B 1G6Q1 2IE8A 1M3SA 1V8DA 4M0DA 5JOQA 5D7NA 1ZIYA 1RCUA 4KO2S 2X9GA 1MC4A 1PEKE 3NIGB 4TLDA 5FKJA 4CR6A 1XJWA 3RM3A 5MFZA 2WHPA 3VNBA 2C5SA 4WH0A 3ZQ6A 1GQQA 2QWXA 2QW0X 4UE6A 4IIEA 2GXUA 2IUUA 4AYTA 1TC2A 3GJTA 3QJGA 2JFOA 3NHRA 5F52A 4D96A 1JQAA 2HF2A 4BB5A 2IRWA 3AI7A 2IOQA 3LA8A 3I5AA 4F8YA 3AKCA 1OX6A 2BI8A 2FR1A 4YJGA 3LQRA 1GRCA 1OZ0A 3I92A 1N2JA 4FYKA 1NPTO 2H7CA 3GEDA 4FCVA 2X1LA 5EP3A 5NLLA 3T41A 4A73A 5JMTA 4J90A 3KQKA 4FDMA 2HA6A 4FU0A 4OJTA 3W6UA 3WWEA 1CUAA 1PK9A 4XI9A 1QU3A 1TZ2A 4LKOA 1C1DB 4KBFA 1S4QA 2W6IA 4OQYA 4LF5B 3CX7A 3MJHA 4L4UA 1AF4A 5JSZA 4HDSA 4MVYA 1DZIA 1YZLA 4NXNB 1WD5A 4CGYA 3ESZA 2O23A 1D04A 3NONA 5IM5A 1F1BA 3U4CA 4E14A 1IXYA 1PYOA 5ICMA 3TTTA 1T0IA 4KE8A 1NV9A 4L78A 3ABRB 4GOLD 1EHYA 5FV7A 4NKRA 4W4TA 3F9IA 2ZP1A 3VO8A 2HHCA 4M21A 1XF1A 4OHVA 5F2EA 4IHQA 3AOEA 1E0SA 1CRPA 4QJ3A 1NAIA 1VMDA 3FF4A 1IB0A 3O4RA 4FR2A 1QJCA 5DTJA 4J16A 4MO9A 5TIIA 4B3RB 4BVBA 1I3CA 1RKBA 5GONB 1GZ4A 1PK7A 1HE3A 4P4GA 4PCAA 5DN6A 5J5CA 1YS9A 3FOBA 5HIJA 4TMXA 3VU0A 4CTKA 1C29B 3WJ2A 1OFGA 2DTXA 2X41A 2ZRIA 3BTUA 1N3YA 5CFRA 1L3IA 2QPTA 2R87A 4NBLA 5F2OA 1UK7A 3I4LA 5H4HA 1BU5A 1MC5A 4IZOA 3WGLA 5IU6A 4L5JA 4URZR 1FSZA 2VDPB 3LGAA 2CGEA 3AGPA 4HQ6A 4S24A 1HKUA 4II7A 4B6SA 5BNTA 1H2BA 2HCFA 2J7PD 3K2QA 3LX8A 3FNRA 1PEDA 2H1WA 1CUEA 3EZXA 3LUDA 4OQZA 4DMGA 3C7DB 3IT1A 3H2GA 2XAAA 2A9FA 1GQSA 3HLKA 3WRYA 1T1SA 4KKXB 1MEJA 1ABBA 2VPXA 4GP6A 2R8ZA 1RLTA 3JAKA 5C5CA 2ZI4A 5IEJA 5JZMA 3UK7A 2VYND 1XDGA 4BBJA 5T4FA 2SBTA 2HV8A 1G3UA 3VH4A 1IBRA 2CC2A 3B6JA 4B6JA 3EODA 4M1YA 1N2BA 1MO3A 2PSDA 4L76A 1JHMA 1ZZEA 3GEBA 3PHHA 2WSMA 3BK7A 4JELA 1W8IA 5DBHX 2XTAA 4TX1A 2QLBA 1KPIA 1ULZA 1DWQA 2IHJA 4MW4A 5A4KA 3Q88A 2OKCA 1TLTA 4R71A 4IDGA 2CHFA 1IVSA 5LZ4A 2YVLA 2W00A 3P4UA 5IT5A 1FRQA 2C4UA 3QVOA 1BE8A 3IAM1 4BFYA 2QZSA 2J67A 1N9GA 1HT1E 3DULA 3FDFA 1RT9A 1U8UA 5CEJA 5CITA 1Y9DA 4MQEA 5DYYA 9LDBA 2I3AA 2Q2NA 4IJWA 3EZ9A 4JLKA 2RK3A 4LZOA 4M88A 1Y3DE 4Y6GB 2C61A 4EA6A 3IAS1 4FJ0A 3I4FA 2VL7A 3FD8A 4HBGA 4J1NA 4YRPA 5FX2A 1Z6XA 1NRIA 3CM0A 1E5XA 3TD6A 2Z98A 5I01A 3GHHA 3N2LA 2XCIA 4E13A 1TK2A 3E2IA 2ZWPA 4DT1A 4EG0A 1QK4A 1EUQA 2NXJA 1KK3A 4GXNA 3H17A 3SHWA 3BJRA 1E18A 2I9PA 2IEBA 3LYHA 3NH6A 2N3ZA 1I3OA 3SIXA 1O9GA 1OZAA 3RUEA 1KI7A 3RUPA 2O4CA 3OFJA 1CR0A 2IDZA 1YZ3A 4MLDA 4EY6A 6REQA 4WFIA 2C0CA 2J30A 1KO5A 3TNJA 1IJKA 4MP6A 4F3KA 4CU2A 4DDTA 2ZQ5A 1QZTA 1P7VA 3WDSA 2BISA 5FF9A 3EF1A 4WN9A 5CB4B 2A30A 4IG9A 4G97A 4R8MA 2ZTHA 4I1RA 4BLTA 5FXMA 3AUFA 4KSCA 4BVGA 3BXFA 1MO6A 4LE0A 3WWYA 5K0TA 2G9ZA 4XKJA 1RE0A 2AA3A 4LECA 4OXXA 4RDXA 1EM8A 4JX8A 5D1NA 2B5VA 4YDHB 5DISB 1Z6QA 3SK0A 4LDJA 2J1LA 1FX0B 3WA6A 1WS6A 2BKXA 3RU7A 4Q01A 2YV5A 3HACA 4FCWA 5TVGA 3DF9A 3UAYA 5CX1B 3P20A 3THRA 3IE0A 4LJAA 4P4LA 5KYWA 5KREA 3X1WA 1RM0A 3ADPA 3Q5EA 3UK0A 5DM60 4DV5B 5FQNA 2C7PA 4WBNA 1YBHA 4YONB 2H85A 3TECE 121PA 4WOBA 3MD9A 2ZM6B 5EG5A 1Q19A 4YJ2F 5AJHA 1AF7A 2NTNA 4G9BA 4GEKA 1Z15A 5ELLA 3E9ZA 1FMCA 3K2BA 5IEBA 1DI0A 5E9JA 2FZVA 1HEUA 3RFUA 1U0JA 4R1OA 3GEMA 1MABA 2R00C 3OIVA 2WV9A 1XKLA 3KFLA 3NHFA 3AEUA 1PG0A 1Q95A 3LD9A 1P6XA 3WBJA 1RXWA 2FRVA 3SF8B 3O4HA 1IM2A 5DBEX 4N03A 5B64A 2IEDA 4IHAA 1GL9B 1W4BA 2BEUA 4EMSA 3DFKA 1DHRA 3A1WA 4XRGA 1IIRA 2WT9A 3F7MA 3P9NA 1AV7A 1VIMA 2RJNA 2RIRA 2VH5R 3G0OA 4OQNA 3WYBA 2ODPA 4F46A 1G4UR 4V24A 1OMOA 1V11B 1WDKA 4PSKA 5DX1A 1D2NA 4MR8B 5LBUA 2X0JA 5K4GA 2I78A 3C3CA 4E1VA 2RB5A 2BRUA 2BY4A 3V3KA 4EZBA 1YQ9A 3RD5A 3O95A 3OP1A 2IQ5A 3T7TA 2W7TA 4GVLA 2BBOA 5JBIA 1ORVA 1AKVA 5KSWB 2DR3A 5AKEA 2NYRA 3QLTA 5AKXA 2BCGY 1XZCA 3L49A 2GBGA 3EBLA 1EG2A 4E15A 5I3CA 4YBZA 1SU4A 3NKFA 5EJ2A 1ND6A 2AOWA 2Z58A 3D81A 2Q7OE 4RKQA 1JR3A 4DAEA 4AECA 1EK0A 3OZAA 1XYVA 4UHKA 4BY9E 2OAQ1 4LXIA 1XJQA 3LTNC 4UE2A 4R2KA 1AVTA 1ZN2A 1KEVA 2XCQA 3I04A 2JZOA 3O0TA 3R0JA 3U1VA 1IZYA 3H5RA 4HT3B 4B6QA 2FMIA 1U2PA 3CUKA 3N0WA 3BICA 3WWOA 3V1KA 1DEAA 1P60A 3CKMA 1J0AA 1MB4A 3DB1A 3ET4A 4R98A 5EHIA 5C35A 5KIAA 5MN4A 2AJ8A 1Z5WA 1X1SA 1EHCA 2JJMA 2O06A 2COKA 2FPUA 4P7JA 2AT1A 1M2OA 4B8ZA 1WBDA 3NBQA 2H5IA 2X3FA 1SUAA 5GINE 4N5LA 2ODEA 3WGIA 1Y8AA 3K1TA 1WHTB 3LGXA 4RH1A 3BE6A 3LLVA 1I6MA 1UH5A 2PWAA 2WPNA 1M7HA 1JKMA 6LDHA 1C3LA 2ZIXB 1X8KA 4X62B 2D1FA 1ZDMA 2QVYX 4MW9A 1Z8NA 3H1FA 4RD3A 4TMYA 1RVDA 2HZBA 4MYCA 2PSSA 3V4SA 1ZXXA 5JSKA 4L5IA 3WAGA 2ZSAA 1GGHA 4UTZA 4BUZA 2IL1A 4HPXB 4KNYA 4F6LA 3R44A 5DNWA 2I03A 4MRVA 5K8TA 4F6RA 4NCJA 1T8TA 1YH3A 2AK3A 2FGJA 3CEJA 1DTSA 4BVHA 2QJFA 3IDOA 2GZMA 4QGSA 4DMMA 3K6JA 4H4CA 4GZ6A 4P54A 3MWJA 3W5UA 1X77A 4RHXA 4GBGA 4O4IF 4UPEA 5I4CA 2EC5A 1DAPA 3LNCA 4GICA 4TMVA 5DBGA 3CVJA 2GUGA 3LECA 4DIFA 2OUKA 3VOAA 2A5DA 1UQUA 3FZGA 3GD7A 2ZJFA 4YAEA 3UXHA 3I6BA 4F84A 5J3JA 1EXVA 2ILVA 2RAPA 3U7QB 1FFYA 3SM3A 3E3MA 3WGHA 4JR2A 3K71B 3ZXUB 4J0FA 1AK2A 1JBKA 2ZJBA 3HM9A 3IMCA 4YI3A 3WLEA 5TT0A 3N53A 3ORYA 3QF4B 4CKWA 5HM6A 4HZUB 1PCXA 2CXUA 4N4AA 3W5VA 4S1PA 1GN8A 3KPVA 2VZLA 2HMWA 2Q5JA 3LAWA 4OXRA 1E2QA 2H6EA 1M7BA 1JLRA 2QRNA 3IV9A 3G3EA 4R1LA 3V33A 4LHVA 2VP0A 3F6YA 4G4JA 4KN6A 1OI2A 2PGAA 2YZMA 5AR1A 5HOQA 1QFYA 3WJAA 2JFPA 1NUTA 3C15C 2QTWB 4YEDA 1QVWA 5JD6A 1NN0A 4YQYA 4OY3A 4U5XA 4RFSA 4MS3B 3ELYA 4QTZA 2IBMA 1L4YA 3KB2A 3WZLA 1XVLA 2R6GA 2GM5A 2VRWA 3R3ZA 2NPOA 5DYIA 1ABEA 1K7FB 4KAAA 3V6LA 3VYRB 4JYMA 3WLRA 3GLFA 2NP6A 4YCCA 4H1WA 5GQSA 1CB0A 1SC9A 1VE3A 3FB1A 1CF9A 1Q7EA 1AHNA 3ZBTA 1QF7A 4BJ3A 1XROA 2FMKA 2R6JA 1S3GA 3SBEA 1NQOA 4JI2B 1EDDA 4GL2A 2IUSA 3ZJVA 3DONA 1PGJA 2JLAA 3GZNB 5IWAB 3IIEA 2BKLA 4QPZA 1XELA 1Z2DA 2HC9A 3AR8A 4W7IA 2D7JA 1R00A 2VI5A 4OP2A 2FN3A 3UT5A 1F9AA 1ZW1A 2J9RA 1NRWA 3MXOA 3STWA 5EQJB 3Q0EA 4YAUA 3F5FA 2ATXA 1LPPA 2F1OA 3MINA 3O2SB 1UPUA 2BTQA 2C92A 3AY7A 5CDYA 5LQJA 2I4LA 3CWZA 2EBUA 1ECLA 3MVEA 3N2NA 3OQVA 4EZEA 5ECYA 4M76B 3KYBA 1E3TA 2GVZC 2ZRDA 3WK9A 1BMQA 3IT3A 4JVMA 5AKKA 5EKUA 3ZK7A 3D0OA 1NT2A 1QQBA 4LA4A 3CNOA 4OK6A 2HWXA 4ZI7F 1JIXA 2EJTA 1UC8A 2J0UB 3E2PA 5DTMA 1NNEA 1A97A 2PFKA 3D4BA 2GILA 3LCVB 4O4HB 3NHSA 1P0MA 4UZFA 1ISMA 3LQ1A 2DFKB 5AM0A 3C1TA 4EHJA 1GQFA 1NF2A 4WJLA 2DWQA 2NO9A 1N7IA 3LRXA 3ZY3A 1LPNA 3KB6A 1AZSC 3RVBA 2QP9X 4BZZA 4CM8B 5IBQA 1DBPA 4G8CA 5K0NA 3I61A 4A5SA 1BD3A 1KEUA 1P73A 1C9YA 4FP9A 2ZRGA 1J21A 1E9AA 3NGXA 1Z7WA 3SR3A 1ZAKA 1SBZA 4OU4A 4LI3X 2QD1A 3OAAD 4I6EA 4REMA 2Y1WA 5CD9A 3PR1A 1NVKA 3MWLA 3WZ2A 1NRXA 4Q82A 3M9XA 4IXDA 3ZLVA 4C6RA 5KX5B 5L4NA 4RY2A 2J3HA 3KSDO 2QUIA 4OSEA 4EI8A 2IYVA 1PVOA 5TPZA 3G89A 1R2QA 1YZNA 1JAHA 1R64A 2BUCA 1ULTA 2W6ZA 2B4YA 3ICWA 3M3PA 3UB4A 3DMYA 3F6BX 4AUMA 3QHQA 4C5AA 3R77A 4K9SA 1H9BA 1XA3A 3BORA 4MCIA 1EUYA 3TLZA 3OM1A 1NX9A 1Y3AA 3BD7A 3LDGA 2EARA 4R1MA 3ZHXA 1R1DA 4AJNA 3DAHA 1U0FA 5FNVB 2RHDA 3VNVA 4DYDA 2FW1A 5C5IA 1AQYA 3Q8LA 2QUAA 2O7SA 1G1AA 1WP4A 3GX1A 3HJRA 4TV9F 4QDOA 3ORRA 1MOSA 1WCXA 5HXAA 1H4QA 2ONCA 5BWMA 1GR1A 3ZNQA 4RLFA 3FZEA 4LY3A 4PVCA 1W85A 1DV1A 2H1FA 1TYBE 3RS5A 2G1PA 2JHPA 3IJEB 5AVUA 3CISA 5ALHA 4ITUA 3RADC 5AM2A 3WMRA 1SJ9A 2W6PA 5JYCA 5AMXA 5EIEA 1RIIA 4KSYA 4Q15A 1NMEA 3ANSA 3HBNA 4D9HA 2IF2A 3SJCA 4NV0A 4NR0A 3DCIA 4JT4A 4FQ8A 4Z8YA 5EXDA 3UC9A 4DJDC 2PN1A 2ROQA 1XZLA 3K92A 4AJ1A 3CPHA 5KTTA 3H04A 1E1KA 2XYHA 4AMYA 1VHTA 1WVMA 3IX7A 4KWIA 1B0UA 3GEHA 2PZJA 1I2AA 3AIOA 3HDGA 5EXSA 4HYTA 5BQOA 1O0BA 4I4TB 4JC5A 1ECFA 2PKCA 4ZT7A 5KAPA 3GJ5A 4X97A 5JD4A 5G53C 2RGNA 3ROZA 3F1KA 1K27A 5IKOA 3AILA 4L27A 1ZN8A 2IS1A 1BW9B 4NJMB 2PGJA 3ULKA 2XZTA 4MRNA 5JVDF 4BXOB 1XFAA 3H99A 2RGXA 2WQ7A 3IHTA 5E2BA 1CQZA 3GGPA 1OPRA 3LQKA 3TVDA 5ALOA 3PQCA 3BL6A 4A8JA 1M6YA 4F9EA 2GQ0A 4ZZ3A 1QRRA 2RD2A 1ZR2A 3NBAA 2XKAA 4WECA 3DLBA 1SG9A 1XEWY 4TLMB 5DSXA 3DBHB 3ESRA 1O0SA 3QY9A 4RKRA 1MO2A 1RHJA 1IHYA 2B0JA 4ZO6A 1F2TB 5EKDA 2HRCA 3TL6A 1QRDA 3QENA 1N3LA 1WQ4A 3K7EA 4HGOA 4AZ3A 2ETXA 3ANMA 2O8NA 5JIBA 3EMDA 3ND7A 4BO0A 5BQFA 3HFGA 4ARBA 3LT2A 1GNRA 2O1XA 3JALA 2AZ4A 3I37X 3JQCA 4TS3A 4FWBA 4KIWA 3G5TA 4I66A 3S1SA 1PGOA 4QBIA 5CCDA 5DFAA 1QHIA 5TDHA 1IEXA 1IIBA 3JARA 3JD0A 2C1XA 3M5PA 3Q41A 4AX4A 4Z4HA 1W4LA 3FPJA 3LP5A 4YGYA 4RIFA 2IZ0A 2JEZA 3B82A 3E9MA 5FL7A 2PKWA 3ZK8A 4PTYA 1JA0A 4PZ0A 1KR2A 4IQGA 3DL2A 1D2EA 2H4JA 4RTNA 2VZEA 1C0EA 3CB2A 2CSUA 3R8FA 1JKJB 1BCRB 1ZBQA 1PHPA 4PG4A 2QMUA 1VLJA 1KMCA 4LK2A 4MUAA 5BSKA 2BHLA 2H59A 3X1XA 2HRZA 1CETA 1BZYA 5TC4A 4YASA 2IBTA 3HL4A 5IXYA 1KZ6A 2VSNA 1RJEA 3L46A 3U9TA 2PVPA 1I7SB 5ADUS 3QVGB 4EY4A 5JQWA 4UUQA 1XZHA 1YFKA 4D9JA 4FWTA 1YOBA 4LFBB 1M67A 4DLYA 1A9RA 3QELA 3T5BA 1WY7A 3DLIA 2ZYAA 3GAMA 5K8UA 1QVAA 5LYJB 2GSWA 5ISMA 2YBEA 4DCTA 5KNCA 3F73A 2YHUA 3B12A 4JOSA 3BH6A 4GUDA 3X1ZA 3K4PA 1Y7IA 3PNKA 1U0NA 2NO7A 3COWA 4E94A 1ECGA 1LW7A 2VJLA 1OF1A 5KDDA 1C3OA 1FYXA 3AR9A 5CH3A 1OLXA 3U26A 4E5VA 5DLYA 5J47A 5GGXA 1U1GA 1HETA 1M2JA 3OD5A 1N34B 1JDPA 4X8MA 4N1AA 5IJ9A 2FN7A 2IXFA 3HYLA 4MVJH 4JBGA 2B98A 1YBFA 2DOKA 5EFZA 3C97A 1W48A 2Q21A 2YV3A 3C48A 3K09A 2VF5X 4Q3BA 3FB4A 5BWOA 1X3LA 3AESB 4OXQA 3UW3A 4BJ5A 2OECA 2Y6UA 1VE5A 4YIKA 4RXTA 3PJRA 1LTQA 3EJ6A 1GNTA 2RK4A 2JLRA 3F4BA 1I4LD 2WJVA 3OE7D 5AHRA 4B85A 1OLUA 4KPGA 1KC3A 5BWLA 2RGWA 4TM8A 4MULA 1E3MA 2JAPA 5EQDA 2EATA 1Z4OA 2ZS9A 1NBOA 4B6FA 3S2SA 1IEWA 3QPWA 1QAQA 1C3EA 1E4VA 4NE9A 4CBVA 5B30A 3MMNA 4WASA 2SNIE 2G5TA 4GI1A 2KE5A 3FUUA 4KH0A 1J8FA 2W6NA 3EVDA 4LXYA 2WJZB 4MS4A 1E8NA 2VXBA 1M83A 2G5GX 3GT4A 1SG6A 4GYWA 2C5FA 2YHIA 4LOLA 4BV8A 3F3YA 1JJIA 3K2IA 4I6JA 4EJ6A 3F90A 1TM5E 4I3HA 3UMBA 1UQTA 1W88A 1NQWA 4QDXA 5F5NA 4Y1EA 4DWJA 2QTFA 3H1TA 1YFLA 4HC4A 4J49A 4JR1A 3ROXA 1FJGB 4PGFA 1TVMA 4QUGA 5HIMA 4LJ7A 1ONBA 5KUTA 4K9QA 3QKIA 3IPRA 3M3DA 1OIVA 2O2IA 2Y1KA 1I51A 1G7RA 1JRLA 1CQXA 2IHBA 2R8EA 3E22B 3TRHA 2QMYA 1BX1A 3T5PA 4A0SA 5A5EA 5K3FA 3RJ5A 4OX9Y 1Q0SA 4K1XA 3BCUA 1F20A 3WGTA 4BU1A 3HJHA 3QITA 3CH5A 1RLMA 1ZISA 2IE0A 3DOJA 1PT6A 2HA7A 1CJBA 2ZSFA 1JBEA 2IYEA 2FP4B 4N7BA 2YOFA 4JHLA 5HUJA 5I7UA 1BXGA 1NKVA 1L8LA 3H8SA 4FYPA 1MRZA 3IR7A 4QVGA 3UXEA 1WPXA 2PDAA 2WNHA 5TY0A 1UKVY 4HXEB 1QYIA 4L9WA 3KALA 4MCAA 4J07A 3ADBA 1MV5A 3NHWA 1FDSA 3AHGA 5ABPA 5J4LA 3T1TA 3KPYA 1DBVO 1SR8A 3P9KA 1WOMA 3PIDA 1F9EA 4HAOA 1P5RA 1I7PA 2EBFX 2HREA 3C0KA 3G2IA 4MPDA 4NK4A 3TLXA 5HSGA 2CV0A 1F38A 5JH7F 3CBQA 2D00A 3TSWA 1P8AA 3O3MB 1IJBA 3EWAA 3HXOA 2Y0EA 3LXRA 2FPLA 3AT1A 5AI9A 3E03A 3WLKX 1P1KA 1DQYA 1IXKA 1JHVA 1FE8A 3UJPA 4FOPA 1QLHA 4ZTUB 1ADFA 3NHUA 3FAZA 3BZBA 4YRZA 2VTDA 3N3AC 4MDFA 2HHJA 4G5SA 4D3XA 4NCAA 1E1RA 2C5GA 2ANBA 4RE6A 1S3IA 3ZWOA 3BK1A 3CSDA 4OLBA 3KRTA 1W0KD 2QMQA 3O4GA 2JNWA 1CS4C 3JVEA 4R83A 3WFZA 2PLFA 5D7BA 1SVUA 3N2GB 2HCBA 4P8RA 4DDKA 1FK8A 4GR4A 4K8RB 3ZJTA 3OJCA 1VBFA 3V7YA 5CFQA 4MMZB 5A4AA 1JDBC 3KLMX 1C1YA 3LQQA 3RS7A 4DLWA 2VP2A 2KB0A 2VK4A 3GUVA 4EB0A 1E3WA 3NTOA 4NEQA 1FDTA 4L15A 2IZZA 1L5SA 5AI6A 2WFLA 2DWUA 2RHLA 3T9BA 1O0CA 2SKEA 1K6EA 2ZSJA 2GWHA 1A50B 3BFVA 2MINB 4RENA 3BWXA 1PR3A 3FETA 2HBYA 4BKPA 1DEHA 4IIFA 5I9BA 4CL0A 4DIOA 3M89A 3RPEA 4DEVA 5I51A 4EUHA 3DG9A 2Q5EA 3H8JA 3QUBA 4H3KB 4PPYA 1X3SA 4E5MA 1W34A 3Q3GE 3R75A 5SY4A 4DIUA 4ETWA 1OWLA 3BA1A 4ENUA 3Q8KA 1K97A 5BV8A 3QOFA 3AY3A 1VA4A 4JKYA 4H3SA 2DPMA 4O02B 3GVPA 3I45A 2DR0A 3CRNA 2DETA 3A6EA 1RXVA 4ESHA 4B76A 2JCBA 1PFVA 2ZANA 5BV1A 2OFPA 3N0XA 2FK7A 1KRWA 2GAOA 2E6KA 2G1KA 5GGYA 4IGEA 4CF4A 2A7XA 2Z2KA 3RIXA 1CCWA 5EESA 5KCZA 3D31A 1V5GA 2SHKA 4KZPA 4QZVA 3RDPA 4C30A 4WCFA 5CA0A 3L0DA 1A1SA 1HE2A 1MT3A 1U2ZA 3I73A 3B36A 1Z5OA 4L5AA 4NCIA 4P9NA 5EL0A 1MRNA 4DWVA 3IIIA 5ICFA 4L50A 4IMRA 3U44B 1LRKA 3R20A 1FRZA 3UWSA 5BOSA 3ROEA 3S40A 3VR0A 2WWWA 4RZIA 4UXHA 1Z4LA 2AMYA 2JB9A 2Q4EA 2XD4A 5AOCA 2MWMA 3F5MA 2F9MA 2QRPA 3VTZA 4EVIA 4O2AA 4NF2A 1KTVA 1IVNA 4EG6A 1PQ4A 2HFKA 4QHYA 1NVUQ 1XAGA 3UMFA 3ROMA 4MRMA 1DEXA 1MZVA 2OB1A 1NMSA 3TLCA 1QRAA 1S2GA 1XK7A 1KBZA 2RBKA 3N0RA 1ZK3A 2VN8A 3EZ6A 2N47A 1O89A 4GOOD 4I1IA 4LGVA 4HUQB 1Z0SA 4WLVA 4GYJA 2LXNA 5L3RA 4WI1A 1DO2A 3OESA 4WVFA 4EGQA 1VGVA 2XMBA 3R3SA 2NSYA 2NUBA 4IGKA 4XFDA 3ASYA 5AOVA 4HF7A 1LB1B 3EDQA 3WJ7A 4F4CA 5JRDS 3RGWS 4ZMRA 2QTHA 4U8GA 1Y1QA 2CEAA 4PG5A 5F7ZA 5DIZA 3TW0A 1XTBA 4MGHA 3HUEA 5FTKA 1FXWA 2JFNA 2F43B 3KUKA 4F4FA 2PL3A 2H1RA 2H1OA 1MX1A 1COZA 1YS2X 3DNPA 1TD9A 1Y89A 5AWFC 5K8VA 2WTUA 4JP5A 5EC8A 2PK3A 1MDBA 2P1RA 4A2QA 2FCRA 3ZV6A 2BFBA 2RMKA 1NZFA 2H4XA 2X42A 2FFBA 1L5VA 1KEEB 2F3QA 4PU0A 1GGEA 2FW9A 1SULA 1GZUA 2Z2XA 5AXDA 2IH4A 3QLUA 2R8YA 3SZRA 1VJTA 3FKQA 5DF1A 4DTCA 1AXGA 2R96A 3CVWA 3K0FB 4BP3A 4Q5IA 1T43A 4HAVA 2BMEA 3ZHYA 3HE3A 4QYWA 4YWJA 5AW1A 4LNUB 1M6HA 2Y2VA 3K8YA 4AXBA 3SC2A 3B6MA 4U2FA 3RB8A 3ESYA 1DRWA 2OV4A 4YI5A 4AWAA 2G6BA 4DCMA 4V1CA 4EW2A 1LRJA 3OJLA 2JD2A 3QU7A 2DFVA 1P1RA 4H16A 2GJAA 3IL2A 1A2OA 4R3NA 1MB9A 4J0KA 4BHTA 1TEZA 4RJKA 3L01A 3TQTA 3BHJA 2HSDA 3KL4A 4NU5A 3D8RA 4NV3A 1C30B 4NV1A 3CCCA 3WLFA 3HZRA 5DRYA 1I4OA 5AQ1A 3LBYA 3JU3A 1GU0A 1SIUA 1ZSNA 3PG5A 3TJRA 1XDDA 2H54A 1KA9H 2OXFA 1TYCA 2IY9A 3L8CA 3B3QA 2AEEA 3QEMA 2XXAB 2OQIA 2EQBA 3G5AA 2O07A 2OE2A 4NEHB 3FCUB 1Q16A 5D3MB 3ZZ0A 4QYIB 4KLZA 5AKLA 4JROA 1JGTA 2E5WA 2XUHA 3G0DA 4JJGA 5HQJA 3DXYA 4QA9A 1CUSA 2BBWA 1AHHA 4DCGA 1OQAA 4BX2A 5EJ5A 2MR6A 1OLOA 2QN7A 4K6KA 2ON6A 1BH2A 4Z6KA 1AGXA 2PU7A 1LK0A 3IXQA 1UODA 3W4IA 3E1KA 2O3SA 3PICA 4NAUA 5KOJB 3EQ6A 3RNOA 5C34B 3TSAA 3C8HA 1OWMA 1RI3A 4MYUA 2WG1A 2C7RA 2H1HA 3EFOB 2XVMA 1OIXA 2A4KA 3OU7A 4Z0NA 5GONA 1U0TA 1FP7A 4ITRC 2VSXA 4UU0A 4D9KA 1EFAA 2VXYA 2JIPA 4JI6B 3HWSA 1FA9A 3L1UA 1NIPA 5CCEA 2V7GA 3TZHA 1XTRA 4GM4A 2EKBA 1HE8B 4TPKA 3IBYA 1CFJA 2J0SA 4LYHA 2DT5A 4CIBA 1Z7GA 4MUFA 3D0RA 5DM4A 2WTBA 5EMLA 2M6LA 4I5IA 2X8LA 4FFSA 2GOYA 4A8PA 4GP9A 1XZEA 1NFRA 2FB9A 4EHLA 4F5YA 1NMXA 3K0KA 4HXFB 1VL6A 5CXSA 2O8DB 2O8CA 5KCMA 4QAQA 4BJ1A 4ZYUA 2QX7A 2IY8A 5KPDA 1R3DA 2D1TA 1U2SA 2YQ4A 3I1FA 5JG7A 4NS1A 5TQVA 1CY1A 1K4YA 1ECBA 2QXTA 2FCAA 4YUYA 1Q6ZA 4ZAZA 2HQ1A 2HIGA 2A0YA 4MJLA 3HZHA 1SIOA 2NW6A 3FYCA 3R5SA 3DEJA 4P3XA 3LBNA 1T2VA 3R40A 2QJOA 1F2UA 2XDQB 1GN9A 1DDGA 5EA2A 1Y1SA 1TJYA 1Z7YA 2HQBA 2ZXFA 3ZIUA 2HI0A 4CMKA 1C0LA 5FOSA 3JYPA 3SYTA 3I30X 4OQDA 5ESRA 1UBSB 2Z5LA 4PQEA 1Y48E 3UA3A 4QXQA 2GBFA 1ZCAA 3JQAD 5BSEA 5C31A 1LVUA 3DDUA 1PR5A 4MHSA 1YUMA 5FOXA 3U7HB 3H9QA 3RJMA 1KPGA 3DP7A 4DA6A 1A69A 4FZRA 1ZA1A 3CKKA 3GDWA 1A2QA 2CMGA 3M3HA 3REQB 3UN1A 3SS7X 3ZWPA 3I9V1 4URWR 1FLNA 1EGVB 1VTKA 4I9NA 1Y5RA 3AKEA 1IK6A 2QL5A 3LT0A 1TVCA 4J0HA 2XMPA 2Q4TA 3VO1A 2BI7A 2DLNA 5EEHA 4IQ4A 4PRKA 1YZKA 3PDUA 1RZRA 1A76A 2ODAA 3IAHA 2C8JA 3LX6A 4PCUA 4U4AA 2OPBA 1B8OA 1K0FA 3UAOA 2J46A 3AFGA 1V7CA 1QKKA 4GOJA 1ESCA 4L4YA 3SFZA 3TQCA 1V6SA 2W2PA 1A2KC 1OV4A 2QGZA 2YHSA 3CEPB 3NLLA 4OHRA 5CYOA 1L1RA 3DEAA 3E15A 3GVIA 3TD2A 4ETIA 4BKMA 1NJGA 1CUZA 1M6VB 1NRJB 2XUGA 1U90A 3QEBZ 3BH0A 3LC0A 3RYTC 1F48A 1V35A 1G6OA 2D5LA 1SKUA 1EX9A 2WKWA 3FJ1A 4J4HA 3DO6A 3COJA 1XHLA 1QC5A 3Q2IA 2X5XA 2ODNA 1RIFA 2N42A 4HGPA 2WJPA 1QNFA 2H18A 4HAYA 5JCJD 4QQFA 3U4HA 1D03A 1M0TA 3GP3A 3NEYA 3EXIA 1L7DA 1P91A 1B8PA 3IGFA 1VKNA 5TQ0A 4HPJB 1J1IA 2OXEA 8MHTA 1U9CA 2LGJA 3N75A 4KBYA 4ZVRA 1XG5A 3L93A 3UTDA 2Y0CA 5CW2A 3QX8A 2QR5A 2Q99A 1RMTA 3IKMB 5A71A 3ZHCA 1K8YB 1UKZA 1J2YA 4KQKA 4L28A 4GRDA 1Y7PA 4RK6A 2W2XA 1GWNA 1M8FA 2UZAA 1EJ0A 3H75A 3RABA 1VI6A 3B2QA 2Y27A 3R7LA 3T7IA 3LKVA 3PD1A 4QULA 2GERA 5CX1A 2IHYA 1GQYA 3AEZA 4XH9B 4XEUA 5IBPA 4KH1A 2VQSA 1WTAA 2P2YA 4I1SA 4NY1A 3P7MA 1GU1A 1DKNA 1A95A 2J3MA 2YV2A 4I08A 4RPJA 3ZV3A 5BR8B 1DBQA 2O9JA 2YWFA 2ATEA 3ITNA 5EERA 4DXHA 5J58A 4OGWA 1GPMA 1SCKA 2JLSA 5LLDA 1JJVA 1QNLA 4KQGA 1V2GA 3ZWVA 5A4DA 4LJRA 3KWJA 1XN1A 3ZC3A 5ECGC 1GADO 4JH0A 1N2IA 5J2TB 4M8LA 3GWZA 4AD8A 1Y33E 2CJWB 1M74A 4R5MA 3L4EA 3NB0A 3W5SA 5BUCA 3EULA 3JQQA 3BM5A 4P2BA 1J0EA 3M2TA 4N9QA 3ZCRA 2ZRKA 1VL1A 3ZWKA 4LBZA 1YZUA 4E21A 2AMFA 3AUUA 2RG1A 4BQIA 3RSLA 3SF8A 2XCTB 5A04A 1Z63A 3T7JA 2GMWA 4Q7MB 2W8BA 3IVXA 3RASA 1P74A 5DVZA 1Q44A 1IZ0A 3KYDB 4WLEA 4ZO8A 1PZGA 2AJDA 5C8XA 1TAUA 1CDOA 3BD9A 2QPAA 3M1LA 4HAWA 1SQGA 2KPOA 1PSDA 4IH4A 3TW4A 4FZVA 2X0KA 1JG2A 5HHTA 3UM9A 4BWFB 3KJXA 3CEAA 3I39X 1L4FA 4AWBA 3GMIA 1MGOA 5IJWA 1NE7A 2CYAA 4HNRA 4OIMA 1PL0A 1E9EA 1JDVA 3EGXB 1JLLB 3I76A 3OF5A 2HGSA 3OOSA 3WBBA 1FLDA 2WAYA 2VDKB 2WF9A 4JXJA 1L2TA 3ND5A 4LZLA 1J5XA 4D4HA 2BGIA 1DAOA 2JATA 3MELA 3IVRA 3E0QA 2AN3A 5AW8A 4BZPA 1SXJE 5CXXA 5DNEA 3CN9A 1H2AS 1GKIA 3PQEA 2VIIA 3KPWA 4W63A 1Y6RA 5DXJA 1Z0FA 4Z7NB 1UXJA 2GO7A 2JIOA 3KTOA 1ADCA 2FR8A 1REQB 1SGWA 1J8YF 3UWKA 4U02A 3ZU2A 2QTMA 3F47A 3G88A 2QSZA 4WESB 1T9AA 1T4BA 3RUAA 5C7IO 4N01A 3Q85A 2QORA 2NQTA 5HUQA 3TG8A 5FLEX 2QSUA 5J43A 4BECA 4GS5A 1ISPA 3EWNA 3GBSA 3DCJA 3TSOA 1YB6A 4FFNA 3TRDA 3LE8A 4AN0A 1GHTA 1L5KA 4H35A 1P3Y1 2ZIXA 2X23A 1FB5A 4AUNA 1AHIA 2AQ8A 2VCHA 4GQBA 3RYFA 5IS2A 5LZ5A 2Z5FA 4FFLA 3TM5A 1VPWA 2Z1MA 4FI3C 3D3EA 3G2NA 1MVLA 3OLCX 2OHXA 2PRIA 4QDUA 1CKEA 4L9RA 1Z0JA 3BBLA 3WKAA 3V8NA 4H77A 4L6CA 2FOIA 3L7KA 4N0PA 2WJ4A 4D2IA 4IWYA 4YQEA 3FZYA 3EY4A 1SKYE 2XA2A 2C9ZA 3ZNOA 1N77A 1XI2A 1T8SA 5E6RB 3FWYA 5CA1F 1QOQB 2OCPA 3D02A 4ZCRA 1YS7A 1TX4B 1SD5A 1Z3CA 4KQHA 2OB2A 3T1VA 3T5DA 2PQMA 2UYGA 2XNDD 3KT8A 3LNTA 3Q6MA 3P2EA 5FI3A 3GN2A 5TV2A 3QBVA 3WFIA 3R7WB 1KMNA 2EJCA 4EH1A 2VCYA 2JFYA 4KWEA 3OHPA 3IOBA 1DSSG 4BVLA 2NNWB 4BLPA 1EAMA 2GYVA 4FOLA 2AOTB 2EG5A 4BNXA 1ENOA 2WG2A 4TV8A 2G4CA 1TM3E 2Q5FA 3C3KA 3LDUA 4GH5A 1U2GC 5G1NA 1ETUA 4FC6A 4G0QA 4XR4A 3PXGA 1B6SA 1T9GS 5G4KB 4ESEA 1ZNXA 2CKMA 1R4NB 2XD9A 3H4MA 2C83A 3KZVA 2H48A 3CUWA 1Y8RB 5DP2A 5TQ2B 4Y0AA 5HK9A 4BO6A 1KQNA 5I7EA 1VPDA 2FQ1A 2XOEA 3A9UA 1FY2A 4RV5A 1V1RB 2QUBA 3CRZA 4CM7A 2QW8A 2EDCA 3IBSA 5HJ2A 4G36A 1KI6B 3OU2A 3UAVA 2PLWA 1DG3A 2DBVO 3W2IA 2WAOA 1Y1RA 2J3KA 2OBLA 4XUCA 5F4BA 4YMVA 3R3WA 1F8XA 1GNVA 2ZKIA 4MUMA 3IXMA 1OBVA 4NCHA 4WY8A 2QD5A 4DQ0A 2HPVA 1UC5B 4YR9A 3U4QB 4JLSA 4OMUA 1XN4A 1X1CA 2NTEA 2A0FA 4I5FA 5KC8A 2B78A 1QCCA 2NUAB 4BL5A 2V7XA 4IR7A 2B92A 3K6SB 4GT1A 2BC9A 4F3TA 4NOMA 3I2FA 2K7FA 4DA0A 2OGSA 3FUWA 4IDAA 1JNXX 3BAFA 1NZJA 2N75A 5FI5A 5B7QA 2CNNA 3WGNA 1TU4A 3LY7A 1UOEA 1E79A 2QIOA 4M49A 1EE9A 1Y98A 1DTEA 4B2YA 2GS9A 1WSBA 4UJ3A 1SCBA 2Q2OA 3N07A 4INJA 4LDRA 4L8GA 4WE3A 2ZAOA 3IOEA 4YBRA 5LD2B 2JFVA 3GZNA 1M6NA 5G3YA 5LQNA 2B2NA 4GC9A 4RPLA 4WJZA 4LHZA 3D8UA 3TEMA 3D0QA 2QLJA 5JU6A 4ZCLA 1ZMOA 3RF7A 3R0XA 4DR1B 3BJIC 1CR1A 1QGYA 1RPTA 4RA6A 2V7TA 4ZC8A 1B2LA 2KBEA 3L6BA 4F5ZA 3QF7A 4UBIA 2W98A 5IKEA 5L9AA 2IF0A 1TUGA 3AHFA 3HA2A 3NVMB 2IZOA 3UICA 3U4AA 5A9SB 4YCMA 1EIWA 4KB5A 1L4LA 2ZI9A 5T6MA 3S2ZA 1FSPA 2R2GA 4Z0PA 4TN1A 4FGUA 4O4HA 1QO7A 1B41A 3AVYA 5B4UA 2ACEA 1QHFA 1WDTA 4C2BA 2C9BA 5EJIA 2Q0QA 1AURA 4P7KA 4BX9A 2IHVA 3ZD6A 1VB5A 1RYDA 1NDHA 1YQXA