1M5RA

Ternary complex of t4 phage bgt with udp and a 13 mer dna duplex
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
351
structure length
351
Chain Sequence
MKIAIINMGNNVINFKTVPSSETIYLFKVISEMGLNVDIISLKNGVYTKSFDEVDVNDYDRLIVVNSSINFFGGKPNLAILSAQKFMAKYKSKIYYLFTDIRLPFSQSWPNVKNRPWAYLYTEEELLIKSPIKVISQGINLDIAKAAHKKVDNVIEFEYFPIEQYKIHMNDFQLSKPTKKTLDVIYGGSFRSGQRESKMVEFLFDTGLNIEFFGNAREKQFKNPKYPWTKAPVFTGKIPMNMVSEKNSQAIAALIIGDKNYNDNFITLRVWETMASDAVMLIDEEFDTKHRIINDARFYVNNRAELIDRVNELKHSDVLRKEMLSIQHDILNKTRAKKAEWQDAFKKAIDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Base-flipping mechanism for the T4 phage beta-glucosyltransferase and identification of a transition state analog
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*AP*TP*AP*CP*TP*3DRP*AP*GP*AP*TP*AP*G)-3'
total genus 130
structure length 351
sequence length 351
chains with identical sequence B
ec nomenclature ec 2.4.1.27: DNA beta-glucosyltransferase.
pdb deposition date 2002-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09198 T4-Gluco-transf Bacteriophage T4 beta-glucosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1m5rA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1m5rA02
8GPBA 3IA7A 2GT1A 4MI6A 3BDAA 1NZFA 4BFCA 3FROA 3S2UA 2FFRA 3RSCA 3BCUA 2X0FA 4EJ2A 1FU8A 2QRQA 2VSNA 1YA6A 4KQ1A 2ATIA 5GPBA 2F3QA 1AHPA 1Y6FA 3ZCRA 2AV6A 1EM6A 1NOIA 2F9FA 2PYIA 1Z62A 3CUWA 4EKYA 2GPBA 5DLDA 3RSZA 4NEQA 2O6LA 1FU7A 2XCIA 4X7PA 4KQ2A 3T3IA 1PSWA 4CTOA 1L5SA 1UQTA 5D01A 1Y8ZA 2G9RA 1JIUA 2C9ZA 4BQFA 3MS2A 3IAAA 3MTDA 3Q3EA 4MICA 3WAGA 3CEHA 3HBMA 1KTIA 3MSCA 4LDPA 3L7CA 4NC9A 3VUFA 3CEMA 2X0EA 3ZCPA 3TAXA 2F3SA 3Q3IA 3D1JA 2QN3A 3G2NA 1L5WA 1SXQA 1Z6PA 1QM5A 5IKOA 1P2BA 3NP7A 4EKEA 3OTHA 3HBNA 3QKWA 4CTMA 1FTQA 3T3GA 3MRXA 2R4UA 1XKXA 1WUYA 3WC4A 4AY5A 5HXAA 1V4VA 1C8LA 3S27A 2GEJA 2IV3A 1J39A 4GYWA 1JG6A 5D00A 4RBNA 4XI9A 1IIRA 2H1FA 1P2DA 1UQUA 1EXVA 1C3JA 3GUHA 2VSYA 1GFZA 3MRVA 2XA2A 1NVKA 2QN7A 4XIFA 2PRIA 3D0QA 3EBOA 1H5UA 4M83A 2QRMA 1GPAA 3OKCA 4F97A 3VDMA 3G2IA 4X7MA 1L5VA 1ABBA 2AMVA 3G2JA 2VCEA 4RIEA 2QLNA 3DD1A 2PYDA 2QRGA 4REMA 3Q3HA 2QZSA 2C4MA 1P2GA 3PE3A 2BGTA 3CX4A 4EL5A 4MHOA 3OKAA 3S28A 3QHPA 4MI3A 2QNBA 2IW1A 4WHMA 3OKPA 4M7PA 5IKPA 1LWOA 2F3PA 4GZ3A 2X6RA 4X7RA 1LWNA 3L7AA 2ASVA 3HBFA 3MQFA 3CEJA 2QN1A 3L79A 1L6IA 3S29A 1A8IA 4MRAA 4F9FA 2IYAA 2XMPA 2H1HA 1NOKA 1P29A 1XL1A 3BD7A 5LQDA 2FETA 2C1ZA 3OTGA 5DU2A 3MTAA 4WACA 4AN4A 3E3NA 1QKJA 5TVGA 1RRVA 2JJMA 3MS4A 1PYGA 3WADA 3PE4A 3EBPA 4MI9A 2IYFA 3NP9A 1P4HA 3L7DA 4LEIA 1FTWA 3L7BA 1F6DA 1P4JA 2IEGA 3COPA 1XOIA 3D0RA 7GPBA 2FF5A 1WUTA 3CUTA 2X6QA 2AZDA 4RELA 3L01A 2OFFA 3NB0A 4KQMA 4M60A 3VDNB 1PNVA 1Z8DA 2G9UA 3SYMA 4AMBA 2VG8A 1GZ5A 1NOJA 4G2TA 2X0DA 1C50A 3MTBA 3H4TA 3DZCA 3ZCUA 1JIVA 2G9QA 1JIXA 5C1DA 1XV5A 1WW3A 3T3EA 4AMGA 1XL0A 3HBJA 2QLMA 4WADA 1RZVA 3T7DA 3MS7A 3AMVA 2XCUA 4CDRA 3GPBA 1WV1A 2XGMA 1C8KA 1UZUA 2GEKA 2JZCA 1BX3A 2BISA 2VCHA 2XA1A 2PQ6A 1RZUA 2R4TA 4BQIA 1HLFA 3E3OA 3CV3A 2XGOA 4N3CA 2ZB2A 4N3BA 2HY7A 4AY6A 2QRPA 2QN9A 3TSAA 3MT8A 5TMDA 4GYYA 3T3DA 3ZCVA 1SXPA 2ECPA 4RIIA 1FC0A 1Y6GA 3DDWA 4BQEA 3TOVA 4QLBA 3BD6A 4Z5XA 1NZDA 5TMEA 2XA9A 3MT9A 3BEOA 3ZCSA 2SKCA 9GPBA 5DXFA 3NAZA 1L7XA 2JLBA 3ZCTA 4RIFA 3CUUA 2SKDA 3DDSA 3G2HA 3O3CA 4N39A 2F3UA 4RENA 3BCRA 6GPBA 1WW2A 2KS6A 1FA9A 3CUVA 4YI5A 1IXYA 2GPNA 1GG8A 2WTXA 1JG7A 3OY2A 1M5RA 3MT7A 4RIHA 3T5TA 2R66A 2QLLA 2G9VA 2QN8A 4GZ6A 2YJNA 1L5RA 2BGUA 1JEJA 2GM9A 3UYLA 3E3LA 2PRJA 4L22A 4YI3A 3UYKA 2GPAA 3MRTA 5I45A 4YUAA 3S0JA 3OTIA 4CTNA 3RT1A 1E4OA 1YGPA 5ENZA 3BCSA 5JTTA 1FTYA 1VGVA 5JTUA 2XGSA 2BFWA 4FKZA 2R60A 4MHSA 3C4VA 2AW3A 5BNWA 3G2LA 2SKEA 1B4DA 1FS4A 1XC7A 1F0KA 1GPBA 1PN3A 2GJ4A 2Q6VA 1O6CA 4F96A 3MBOA 4GZ5A 2IEIA 5TMBA 3G2KA 3CUYA 3OY7A 2ACWA 3RHZA 3NCHA 1NLMA 2QRHA 4PQGA 1AXRA 4FZRA 2IUYA 1L5QA 4HWGA 4NESA 3NPAA 3NC4A 2ACVA 1K08A 4RIGA 4HLNA 2C1XA 3ZCQA 1GGNA 1WV0A 4X6LA 2R68A 3BD8A 1GPYA 3C48A 3C4QA 4W6QA 2P6PA 4N3AA 1K06A 4EL0A 3VUEA 1Z6QA 1P4GA 2IV7A 3SYRA 1FU4A 3OT5A 4N9WA 1E1YA 3H4IA 2QN2A 4GPBA 3T3HA
chains in the Genus database with same CATH superfamily
1KJ9A 3A6DA 5CLJA 3KKPA 1RHUA 3GLIB 3B1FA 3QVGA 3CVYA 4JFAA 2JJQA 4RKEA 5JMOA 1OU0A 3P9RA 1UEJA 2FOXA 4BNDB 3ZWCA 1G5TA 2BKXA 4KE7A 4U63A 5KYWA 3Q11A 2EWMA 2DHEA 4I7EA 4KTTE 3FNEA 1LPSA 5G41A 4EJ2A 3COSA 1RXEA 1LK5A 2CXUA 3HEMA 3OQPA 4GP6A 3AEXA 3L0DA 1A8QA 5IH3A 4GPAA 4UATA 2R8OA 4BJ1A 2OLEA 5KU1A 2WHPB 3EOAI 2CK3D 1QZXA 3BS4A 3ZCRA 2PZ8A 2X9QA 3EZ6A 4HQ0A 1M1YB 4OMUA 5JATA 4WCVA 4DVJA 1ZITA 2RBEA 3QPCA 4BNIA 1MGPA 4E5PA 5LU8A 3WLIA 3CUWA 5EEHA 4EY8A 1GSHA 1XMQB 3MJTA 1X9IA 5J47A 1M1YE 4V38A 1SHZA 3B89A 3OMWA 4MV1A 4DL9A 1XAHA 3VOAA 3V8NA 1IN5A 1SR8A 1Z2OX 2Q2NA 2RG1A 2VSOA 1Q1ZA 3PBKA 3EZNA 4TWAA 4J16A 3BMQA 4XX0A 5DBEX 5DCWA 2CFCA 4DKJA 1AKNA 3OU6A 2I91A 4CUKA 5DNCA 2CD7A 1M7BA 1BWSA 1NQVA 1OLSB 3GMSA 4CIDA 1LPOA 4Y9TA 3CCCA 4G0ZA 3RTGA 2YV2A 3KSDO 3N5CA 1BWQA 3AM5A 1PJTA 3PUVA 4GR5A 3IQIX 2C9ZA 4B17A 4CHTA 1XD8A 4QD3A 4OB7A 4BKMA 4U7HA 5DMHA 5IN5A 1MBZA 3N7AA 4UHJA 4QEZA 4UUOA 4E5YA 4OY3A 5CFRA 1ZAYA 1RLTA 2IIBA 3R23A 3DLBA 4FQ8A 1KTIA 1T36A 3QTBA 1ID1A 3GJTA 3WOHA 1KWKA 4ZK2A 1OBCA 3CT4A 4DDWA 3UFBA 4WK0B 2ZCJA 3QKIA 1NWCA 4K9NA 3DLCA 4NULA 1KVQA 1E2KA 4DM7A 2R6FA 4UOEA 4WKGA 2JAWA 5ALFA 1VPTA 4NYJR 1I7NA 2QR5A 3BWBA 5HQTA 1UWKA 4LXUA 1XO1A 3IIEA 3KKNA 4ZGWA 2WMOB 4BO0A 1F5SA 2YCLA 1HG0A 2TMDA 4ZRDA 1NI3A 1DG9A 4MWCA 2R1ZA 4YMTA 3QM1A 3PS9A 4CLOB 1QM5A 3W0LB 1FZQA 1YJAA 2VTEA 4IDEA 5F3RA 5FQOA 2NAFA 3DC2A 3REOA 4BFZA 4ZCRA 4IDFA 1R5NA 4OEHA 4D9KA 1FXWA 4OAPA 4XYMA 1QHXA 4U02A 3FVVA 1U7PA 3IDQA 1YU9A 4FFDA 3NFYA 4IYJA 2EQ5A 5BWOA 1XKXA 1PL7A 2TYSB 1CJBA 1H65A 3KR2A 4J94A 1EFPA 2OCIA 3GUVA 3RVJA 5FBHA 3C6KA 1QZUA 1ZCBA 3DULA 1TM4E 3G0CA 4UHFA 1S1CA 4RESA 4E88A 2E7ZA 2QTZA 2AQ8A 3LGSA 4HMPA 4PAQA 3GP5A 1AKWA 2JARA 4BNZA 4PSVA 3VR6D 1TTPB 2BKVA 4EGCB 5E9AA 4YLYA 3PC8A 1MB3A 4PLVA 1O1YA 2RGGA 4F5YA 1OZHA 1L8AA 1I6LA 4TRRA 4CV0A 4G5QA 4WXEA 3ODPA 4RBNA 3RLFA 1PZFA 4N12A 1FUYB 2O5VA 4DADA 1EUZA 1L7NA 2J3EA 2ZU0C 3FZEA 3HNRA 4LDJA 4XXHA 1GLNA 1IEWA 3WGNA 5BRAA 5C3MA 3GBVA 3H9UA 4TTIA 2NV0A 3ED5A 4B6FA 1G5HA 1M6WA 4KPUA 1YE5A 4FBGA 3NVDA 4MYUA 4RMIA 1E8DA 2HO4A 2RDMA 4Z7JA 3LQ2A 2HOQA 3X1XA 3DZBA 4KC0A 1YVPA 2NOAA 5TNXA 2VDKB 1ZMTA 3GJZA 4XIFA 5C7YA 3D0QA 5F35A 5DNYB 3PGKA 3BIOA 1JHPA 2N0SA 1GPAA 1ZK4A 1S2LA 2GZHA 3PSHA 4BZQA 4BFLA 4DAOA 3NPMA 2PE5A 5E4TA 1SCKA 3O4HA 4LZLA 4C20A 5JD6A 2VP3A 2H5IA 2JA1A 4RGYA 5AJZA 4G0MA 4L5IA 1PJ3A 3NGXA 4J4BA 3RJZA 5C81A 3HM9A 2BUBA 3KT0A 2RHHA 1EGQA 2OILA 4A6DA 4BXOB 1JT2A 2H51A 3G2JA 4PX5A 1OLXA 1CE8B 2GRUA 5TR9A 2CMHA 3TDNA 3UHOA 3NASA 3ZHZA 4UZSA 4FOSA 2QBYA 3ABRB 1G6Q1 3SS9X 4K05A 4EW3A 1XZCA 1XTPA 3NANA 1S89A 4DT1B 3T5GA 2OO5A 4LHSA 4EUHA 5CYPA 1ZW1A 1CEQA 2GJSA 1AXGA 3LY9A 2HRCA 4WZBB 2VHVA 1PR6A 4AX4A 3F6PA 5A4JA 3FD8A 5J59A 3NVKI 1UC9A 3SU8A 3EIXA 1BXRB 3ES9A 3FCAA 3OQBA 1TMKA 2SNIE 2QMOA 5DHAA 4MI3A 4CLHA 1U7DA 3UPUA 3FTEA 3D6VA 1LF5A 2H52A 2Q7OE 3TTSA 1KBZA 1W1WA 5IDYA 4Q3LA 3ZHOA 2IY8A 4BUCA 5GZ3A 1FIUA 2E6UX 4AJ2A 2IT1A 5A1JA 3WKCA 3HZZA 1I6KA 4PZ0A 4W9NC 4HNTA 5T3YA 4J07A 3OFND 5DN6D 2WTAA 4XFKA 4JMPA 3L8CA 4WNAA 3VYTB 4AJKA 4ZDIA 1U3WA 1OB5A 2IE0A 1I8TA 3RRYA 3AT1A 3WK7A 1ND6A 4TV9B 3GT0A 1HSZA 2ZQYA 5I9TA 1F6WA 3WLMA 1W4CA 5KYGA 1ZCJA 1U2QA 4RE6A 4KRFA 3VU1A 4CQMB 4GR9A 1MC8A 1RMTA 1C0PA 1QVRA 1ZJZA 2IF2A 3N9IA 1UWVA 3QVVA 5CH5A 4P7FA 5ANRB 4CTJA 4HVCA 1OILA 1A8IA 2WLTA 5JI3E 3MWEB 1I2CA 1JQDA 3KX2A 3KYDB 3ZZ0A 3HO6A 2NU9A 1F2VA 1KPIA 1UBLS 1YL7A 4MUKA 1T8RA 5EINA 4JASB 4AJ4A 1QF9A 3ME5A 1EFCA 3KLPX 3N86A 3Q3VA 3HXTA 1OXSC 2SHKA 4LUCA 1I4TD 4EY7A 4YO8A 4WACA 1P8AA 5B1HA 4YPFA 1X6VA 3ZW7A 2C42A 4F56A 1K27A 4F5WA 1AKTA 4MKXA 1WEHA 1JVNA 2GBLC 1PUJA 2NG1A 3AF1A 1ZVVA 1BWRA 1R6VA 1JDUA 5F78A 3HB4X 3UC5A 2IYFA 4FB4A 2VHYA 4UHKA 3DAGA 4LY9A 4WV3A 4ZDJA 3U6KA 4TYWA 1VIMA 2Y1KA 5ALXA 4BN4A 4D3YA 3FOEC 2ZTHA 2C0PA 4HQKA 5LNK1 2PX6A 2JDID 2P11A 4LWZA 2XUDA 4AYXA 5HZGA 1VIVA 3WFIA 3A3KA 2AR9A 4EFKA 5HA5A 3CX3A 1MJHA 1CETA 3O2JA 3ZR4B 2AZDA 2L18A 4YJFA 1KIAA 2CGEA 1Y1LA 1EWKA 4E5VA 5F7OA 2GTIA 2HT6A 5FFMA 2VAVA 2HWKA 5UKDA 5CB8A 1G17A 1T3HA 2G25A 3F5FA 4Y1GA 4QT4A 2V7EA 1I4OA 3OHMA 1W36C 2I76A 3Q7RA 3KUKA 4BLWA 1LPNA 1NNSA 2EJBA 2BTOA 3EIUA 3KO8A 4OP3A 1YD7A 4MR8B 4ND1A 2AFRA 1AH2A 1P9NA 4HPXB 4I2VA 3LPDA 1JFVA 4RM3A 1B1AA 1JR3D 1N1EA 1Z06A 1NW9B 2HC9A 4X91A 3SHFA 4BATA 4E5DA 2UYCA 3LC2O 5AOCA 2C5GA 1CEEA 1YKFA 4IEEA 1EPUA 3HUEA 3AQIA 4E3ZA 4EHDA 3FWZA 3KP1A 1MVOA 1X8JA 2QLTA 3PA6A 1MTOA 3EFHA 1VJ0A 5ALYA 2REQA 2NP7A 3PUIA 3Q5DA 3R3XA 1LU9A 2O05A 1ZIYA 2BAGA 5KTPA 3PUJA 1F8FA 1C7IA 4J1SA 4KWTA 1T0JB 1U90A 4U8GA 4F2GA 4LVNA 4UBLA 3L4JA 3LUGA 3TXAA 2MINB 5HIIA 4KRGA 1UZUA 3NVMB 4ZAFA 4IVQA 1TKBA 2GEKA 1NXOA 3EXHA 2QRNA 4WI1A 1ZMBA 5LL6P 3EA5A 1NR5A 2A3NA 4N0PA 1AV6A 3FBGA 3VU0A 5A5DA 2IYEA 5C31A 3WYEA 3UJ7A 4DHEA 1QV9A 2V3WA 3E3OA 4EI8A 5BSTA 5FI0B 4FDUA 1USKA 1Y5RA 2F00A 2IUTA 4RF2A 4U0JA 3RVMA 5FOSA 1JR4A 2Q5FA 4QYXA 2QN9A 3A4NA 3ANMA 3GVIA 3MHPA 3X2FA 1YQXA 2OUIA 4U4AA 1A5AB 1QAMA 1YC5A 4DLNA 4LF9B 1V26A 2AN4A 3LNCA 4KAAA 3JD1A 4GGMX 4D5GA 1T9BA 3LUJA 3OEEA 4LY3A 5AM1A 1NLZA 4PLYA 3DKIA 3FWNA 2B4KA 5JQGA 4BB5A 4HEHA 3EODA 3V7WA 5LYJB 3QX8A 1BN6A 5BW6B 3Q6NA 1NKVA 2YNMA 2K87A 4HZUB 1KPGA 2AR0A 2YDYA 3AEUA 1CQIB 1QOPB 3CNQS 2O3QA 2V7PA 4CR8A 1LTQA 1KU0A 5D1NA 4GMHA 4V1CB 1EH5A 1XZFA 4Y67A 1XQYA 3CZ5A 3GRPA 3J81k 4DT1A 4QTYA 1D0IA 4MRMB 2O19A 1U1DA 4G0XA 1T4MA 3ZVRA 2GA8A 1H8HA 2TS1A 1JFLA 1R6AA 4B8WA 4LJ5A 4XJXA 5E7QA 4EX6A 1Z8HA 3A4LA 3EZFA 3WGIA 5JHHB 2ZYGA 1QVZA 4C2BA 3GPCA 4PBTA 4U7TB 4F2PA 2JI6A 1W8IA 1GADO 2XX3A 1QIHA 1TA4A 4J0GA 4ENVA 5LQKA 2OSVA 2I03A 4DYDA 5CFPA 3ZWNA 2ZS7A 1RRPA 1IL0A 2MSLA 3KD2A 3L82B 1ACMA 2Q5HA 4QFMA 5LBTA 2J33A 2PGAA 1M5RA 4ZP1A 5FV7A 2PX5A 1R37A 2X0JA 4D6PA 3MJ4A 3KJQA 3W3AA 4QJ4A 4E7PA 2OBBA 2FW8A 5AXBA 5CAEB 3NNSA 3KFXA 1FS5A 1UEXC 2RGNA 1DXQA 3BMQB 4UXIA 3VQTA 2CXOA 3WLNA 1RHKA 4A8TA 1TTTA 4W5NA 1H0HA 3CN7A 4PC6A 2FH5B 4ZZ1A 3UTDA 3E3LA 4V0ME 3QW2A 2HO5A 3WICA 4GKJB 4TV8B 2HUNA 3ROGA 1ZK0A 3I5YA 1Q0QA 2IEZA 5ESDA 2VUSA 4L2IA 4O4HA 5AW1A 3F46A 1O95D 1XZJA 2FCAA 2CD9A 1RD4A 2F43B 4YDQA 2PZLA 1XZKA 4XQ0A 1XWIA 1FX1A 2VP9A 3AUTA 2CCGA 1RKQA 2CWWA 4BNTA 2WAYA 4JQCA 1MXFA 4YMLA 1N9ZA 4LQLA 4MWBA 5LOVF 4U2FA 1A9TA 3LLVA 1VSTA 1ZD1A 3ND9A 4M0CA 5A0FA 4F12A 1VGVA 3A26A 2BYTA 1JDTA 2B1QA 1KEUA 4LC1A 1BNCA 3TLGB 4BNDA 4CEJB 1RJGA 1J22A 2FEPA 2OCDA 5MN6A 3PNMA 2WSLA 3A31A 4L4UA 1KY3A 2BFWA 1AZTA 4GH5A 2ZRJA 3QOYA 4TTJA 1OJ7A 1XLWA 4YFYA 2YHAA 5CDSA 1Y9DA 4O0LA 1ZGAA 4D42A 4DIKA 3L6OO 1H9BA 1PDOA 2I6TA 1Y3BE 1AQJA 2UVPB 3Q0IA 3NHYA 2JIMA 2YWGA 2DHCA 3TNDA 4DOMA 1U80A 4BO8A 1W7AA 2PL5A 1AC5A 1JHUA 2JRCA 2PUGA 4L0DA 3KUCA 2O5EA 1YQ9A 3CEAA 3SDSA 1OXXK 3AJ8A 4LXYA 4Y8VA 4MVCA 4C7VA 3ASZA 3UJ3X 3DUFB 3UK6A 2JFWA 1N6NA 3EXG1 1H2BA 1X1TA 4WNAB 5J43A 5CEFA 2YY5A 1I1OA 2I4NA 5FWXB 5ELXA 1GNSA 1NNI1 1TM3E 4JSYA 4PHCA 1CQJA 3E7PA 2I34A 2AK2A 2Q0SA 2Q3EA 4L08A 1GD1O 3BWXA 2UVPA 4Q0MA 3W1WA 3K5WA 1DCTA 1LPBB 2RH5A 4NZPA 3TD9A 3G0HA 2JK0A 4G85A 3UA4A 1P80A 1V35A 4JBNA 2CB9A 3SVZA 1LXCA 1OBHA 2OVBA 5DM70 4JLOA 3FYTA 2QSYA 1BQ4A 3IMCA 2ZIXA 4R2WA 5BN3A 3OWXA 1WPXA 4RLSA 1XQVA 4DABA 3RD5A 3EXG2 2P90A 5K3FB 1MB0A 2UVDA 3ZDQA 4N8DA 4YYEA 3UM9A 5IDVA 7ABPA 3R6WA 2PFGA 2QM3A 2Q9UA 4DB4A 1O7JA 1MX3A 3PVZA 5HRCA 1V1RA 4L9AA 4JIGA 5AHOA 1XSEA 5EL0A 3RV3A 3AUJB 5BV8A 1FRNA 1F4PA 2AW5A 1IRXA 3M81A 5IJAA 2XVYA 2JFBA 5CXXA 1LNZA 1XFDA 1C1YA 1ZC3A 5BV7A 3WTBA 3UUWA 4UPVA 4RZSA 4GKAA 1C1XA 3FNIA 4PYRA 1A72A 3M8KA 5BT9A 2VT6A 3FSGD 3OT5A 4HYQA 5J2UA 4AZWA 5LZ9A 3LXUX 1G5QA 5I7FA 3CIOA 2EJCA 4S3MA 1IN1A 4KX5A 4G89A 4N48A 3AP1A 5F1PA 1VL2A 3R8XA 1O96B 1JIIA 3JZAA 1OKKA 3D0OA 6PFKA 3CX6A 3F47A 4URWR 5J63A 5IYZA 1T24A 3DEZA 4OMFG 1DAEA 4HGZA 5EJMA 4H1WA 1QLHA 3QGMA 1PZXA 3UJDA 3DV2A 2JLXA 4G0PA 2Y4OA 4RETA 2IH2A 4QJIA 2B30A 3W06A 1QYWA 3AHDA 2AN3A 3JQDA 5H4HA 4W7IA 4QM6A 4JWKA 3RYFA 2PS3A 5JCJA 3Q7EA 3VX4A 3DVQX 2GUWA 1QQ7A 2OAQ1 4CPDA 2RGBA 5GVRA 2BKLA 4RZXA 3QU2A 4EMSA 2HHAA 1NVDA 3B51X 2HPVA 3LT2A 3P97A 2P68A 5JDCA 4BOYA 1ZN8A 1HQYE 5HSGA 4BKQA 3RHFA 1B14A 3NFRA 4Y3UA 3S2FA 1KSJA 4CFZA 2BEWB 4B79A 2GZRA 5D2CA 2C83A 5FI1B 4EKYA 3SR4A 4X00A 4D92A 1BE6A 4ZQHA 4D9GA 3HY6A 1VLZA 1TUIA 1ZK3A 2ZYAA 1U2DC 4G09A 4JUDX 4PS1A 4REQA 4XUCA 2DH6A 2WG0A 4M9QA 3TE6A 2AJTA 2JHPA 3SEZA 1VFPA 1NVWQ 2AJ8A 3CEPB 1UKAA 1MB4A 4M8KA 1RXUA 3WAJA 1JLMA 1XCGB 2BIFA 4X92A 5F1KA 4X65B 3SZLA 2ZITA 5CM2Z 2Z3ZA 1R6UA 4RCYA 5D3KA 4KGXA 3FPLA 2G9RA 5CEJA 1XEXB 2GAIA 3MOSA 3WO1A 2AS0A 4UUMA 4U7DA 4JJIA 4RMJA 3RUAA 1USGA 3W78A 3FCYA 1NBIA 1G18A 1DE0A 1X3SA 2ZWIA 4U7PB 3FFXA 4M54A 5BT8A 3MTDA 2JJ1D 4Y98A 4WN9B 1LZLA 4B2YA 3RSSA 5EZQA 2GLXA 1VHJA 3EVTA 3ECAA 3COJA 5MFZA 1USVA 2FX5A 4CLXA 5B1SA 4UFNA 1D0SA 1F8YA 1QJ4A 4JZKA 4RLQA 1P0FA 2YQZA 3ETNA 1LI4A 1YIAA 4DNOA 4F86A 5DJ5A 1VIYA 1U0BB 2R2GA 3KALA 2O0MA 3Q3IA 2B20A 2FUNB 5F2NA 3LE8A 1ZNQO 1MJFA 2COUA 3G2NA 4BO5A 2ERXA 4DIEA 2P78A 2QOEA 1XNGA 4Q7EA 4RWZA 3EGXA 3KLBA 1H69A 4LTDA 2DY0A 4DMGA 3VPBA 4ARCA 1P2BA 3W5HA 1TGVA 3L6CA 5HS4A 2DBYA 1MN6A 2WTNA 1GLVA 4M46A 3P2KA 2AXPA 4GVXA 4ZJPA 4ZTUB 3ZIAA 2VYVA 3R5TA 3D4BA 1BWPA 3THRA 4FONA 5JO9A 1SXJA 2GBIA 2VEDA 2XQKA 3E2IA 5IAJA 3DB2A 4BFVA 1AUOA 1BCSB 4M0FA 5THKA 2BJVA 1NW5A 1S9DA 3B1YA 1A7UA 3HZRA 3RPEA 3ZHCA 1ZUIA 4L15A 2BHTA 2QR3A 3LCJA 4I1VA 4QDXA 1J1UA 3N74A 2A5GA 4RKYA 4ARAA 2ZJ7A 3TVYA 2IV3A 1R8QA 2QD2A 2O8FB 4KLRA 4U7FA 4QNMA 1I4DD 5ERXA 4IIJF 4MVJF 3KQVA 3TLZA 4BTLA 5AFSA 2N47A 4I9HA 1IIRA 1J9EA 3ONDA 2HPAA 4I55A 4G9GA 1NXWA 4MJLA 2Z5FA 4FGJA 4GFDA 3FOBA 3EEOA 3G0IA 1J24A 2EGGA 4KNWA 2I65A 3BK7A 2QXUA 5JAHA 3GLIA 3BTOA 1NVKA 1E8NA 5DP2A 2NMVA 1MQAA 1UK8A 3L1KA 1XRLA 3LUKA 4DCSA 5LP1A 2BL4A 2VC2B 5SYMA 4OQ4A 3QUAA 4IILA 1H5UA 4WASA 1MAAA 3OD5A 8LDHA 4KXLA 2O3RA 3ITNA 4UEJA 3ITKA 1YR7A 3KE8A 3KJHA 5LP6A 4ZCMA 2O8BB 4LRWA 1XRJA 4NARA 4M1YA 1SKUA 3AG5A 5A9TA 2HCRA 1H6CA 2IU4A 1XZBA 4LVUA 4M1KA 4TSFA 5FOWA 4ENQA 1ML3A 4WT7A 1YJBA 4NOKA 4URZR 2QZJA 1AK9A 1QRRA 3FHOA 3C6BA 5BW4A 2IHUA 3PJFA 2I6SA 1G0OA 1QYDA 3JYQA 4G4IA 3DBLB 2EHDA 3Q3HA 1YA4A 2Q4EA 1U0EA 3UOWA 1EE1A 2RHOA 3KSZO 1ZJ5A 1NNLA 1N4AA 4RZHA 1EB8A 4BN0A 1OI2A 4UTRA 4ZI7F 2HK7A 1C4OA 3I9V1 1KFCB 1C4KA 3OPYI 1G5RA 4KACA 5HIMA 4UE2A 4P4TA 1FX0B 2RH9B 5CFMA 3WP0A 1QH8A 1Z29A 1GG2A 3LDHA 4LI0A 4DV2B 1JFFA 1NVVR 3CGGA 3B5JA 2GWRA 1PG5A 3AJDA 3DUFA 3IBGA 4NYJQ 4O5AA 1J23A 4RQUA 5D5PA 5BNFA 5K2MA 4GPTA 4CM6A 3ZKWB 4D9HA 3F7OA 1VKNA 2PDAA 4GBGA 4KWCA 1KNQA 3ZJVA 3EXHC 2H6EA 2HLDA 5D5QA 3NR2A 4RK5A 1U3TA 3TX2A 3KRTA 5I9LA 2GLTA 3H9BA 3VZBA 1UMCA 1LF0A 2AOTB 3IPAA 3HVUA 4IS3A 3IP7A 3EEBA 3VO9A 4EUSA 3D6NB 1NPTO 1VOTA 1SBHA 5IU6A 1Z0FA 2P3OA 3EVZA 3K1TA 4Y2HA 2ZIXB 3HGQA 1L1FA 4GM4A 4EI7A 4JGGA 2ONKA 4E0BA 2QB5A 2XMZA 3U5ZB 4HUQA 4U3JB 3TSCA 2C61A 1OXVA 3IP8A 4FC6A 4JLAA 4QHSA 4ZVUA 2IWHA 1RW4A 1TK9A 4Q7JB 2L42A 1WXQA 2D1SA 2Q50A 2DWUA 3AVPA 3PFBA 1C7FA 5JADA 1FMLA 5CPFA 2YRFA 2J9ZB 4RE5A 4F45A 5CFOA 5FDFA 1BQEA 1A2KC 3FZNA 1I7LA 3KVRA 3VZDA 3QTTA 1P7YA 5LKAA 3OF5A 2JA2A 5A9SA 3CH6A 3ZXXA 4B3FX 2V7BA 4BLUA 3EGWA 3QNWA 4KK3A 1JWAB 2JANA 3A1CA 3GMTA 9LDTA 2OHGA 3DOOA 2WUWE 3LUPA 3UMMA 4TPKA 4JYAB 4RVHA 1FDIA 3EW9A 4Q4HA 4BUJA 2C4HA 1RJ9A 3AFMA 2VBGA 3L7BA 2LKCA 2DY1A 1P4JA 1NW3A 3COPA 3DEYX 5JSFA 1MB2A 1W34A 3OQNA 3VVBA 2ZIFA 3ZBQA 3VR2A 1DO8A 2C2GA 3GEPA 3M89A 3WHPA 4H6XA 4HAYA 1R8XA 3DAPA 3HI6A 1V1JA 4G0OA 2FSPA 2CJYA 2OV4A 2WJWA 3FGNA 3HJHA 4JEIA 4LVCA 4TXJA 1FS6A 5FQNA 5TC4A 5K8JB 1EXDA 4JLMA 2X8WA 4DYVA 4GXTA 2BF7A 2FSSA 1DC4A 4L74A 1UK9A 3H0EA 1HT3A 1UPUA 3HJNA 3KZVA 4J1TC 4CCYB 1LLUA 1LBIA 3HKBA 1QAOA 1D8TA 2ODTX 2VWPA 3G23A 3IBFA 3OCYA 2HK6A 4N40A 5F73A 2W58A 3CLUD 4MUJA 5DLPA 1LA2A 2W2XA 2CBXA 3EXEA 3LW8A 5EEGA 3FCUB 2JJ8A 3AETA 2R8XA 1I4WA 4LZNA 4LY6A 3NHWA 2VN8A 3QI7A 3IE1A 1I14A 1WBJB 4HPWA 1UAGA 2J48A 3GDHA 1LBTA 2P3QA 2YMLA 5EJ6A 4GUDA 1J8VA 1JIVA 2I3ZA 2H1SA 1J0CA 4XCVA 2OORC 1QTRA 4XJTA 4UBIA 4CKCB 4BO7A 4CFSA 1PJQA 3NRCA 3HEBA 4B85A 2FN3A 2WQZA 4TV8A 3PENA 3PICA 5IUKC 4BP3A 1ESEA 2CDAA 3CX7A 3HDTA 2X5XA 4HDKB 4OBWA 1ULHA 5IM4A 1NRJB 3ET5A 2XCUA 1UXKA 2VA9A 1U81A 4GPZA 5DOZA 1CNFA 1WV1A 1ZW6A 3H2IA 3TG2A 4HB0A 3ZDDA 4FYJA 2EFHB 4K6FA 5KUTA 1VBFA 2VDMB 2P1RA 4S1NA 5I5EA 3GZTB 4OJTA 2V59A 4HHEA 1FMJA 1Z39A 3SP1A 1U99A 2Z9DA 2ZDGA 1DDIA 3A36A 4HO1X 3ELYA 4N3BA 1CY4A 3KSMA 4YGXB 4ZAYA 1DHRA 1INLA 4PLZA 1DEXA 3M6FA 2A9QA 4UOQA 2A2ZA 1DXHA 3VU9B 4EB6B 2EAUA 3EH2A 2W48A 3HJRA 3L4EA 4XDZA 5FL7D 1JFFB 4LNUA 3TJMA 3BQMB 4ZOBA 4LPKA 1PZMA 3K7EA 1UBJS 1K97A 1C1DA 3WGMA 2FUG6 1SXPA 2ECPA 3WSTA 1KH1A 3RJMA 1J25A 5TMBA 4Q4AA 3F3KA 3HCFA 5EERA 4IX1A 1DMSA 3QH4A 4CIAA 5FHQA 2GYYA 2KLHA 2CDNA 1PVOA 2JFYA 1JDJA 1V71A 3IIKA 5GJWC 1A50B 1H2HA 1Q7EA 4Q18A 3UY4A 2VAXA 1E2HA 4II3A 1RI5A 3DHVA 4Z7NB 2ZUFA 2Y66A 2AOUB 3R8FA 5JCOA 4ZC8A 2A9PA 5KOHA 2DMRA 4KHZA 4JJ8A 2QIPA 3A37A 2G67A 4FS3A 1HQKA 1IPEA 3IEKA 2P9HA 4OHBA 2E5WA 3DEAA 3A4IA 3U7HB 1U5BB 4A2CA 4M1WA 5FWYA 2PZAA 2XNDA 1MKYA 4UC0A 1M2JA 3O3CA 2PVSA 1AUQA 3DNPA 4OQZA 3RW9A 1ZA2A 1E9DA 1NTOA 2W42A 4C4XA 3E18A 3G79A 3N2GA 3B48A 4R41A 1HT1E 1QZTA 2KS6A 2YXBA 3AB8A 5BW5A 5CCEA 4IFEA 1N34B 1XKTA 3PLRA 4E6PA 1ZCZA 1QSGA 2F3TA 3R3WA 4D6XA 2P2SA 5D6NA 4M4SA 4B4DA 1KS9A 4RVUA 4G5YA 1ZD5A 1WU8A 4BNXA 5KTSA 5EOVA 2G9VA 3WV4A 2QLJA 2GPJA 3VO8A 4FOPA 2DX7A 5ALNA 1P61B 4KO8A 4ZCQA 3WXBA 2CSUA 4YV7A 5EJEA 4H3VA 2G0NA 1RHMA 1QBGA 4X5OA 1OH5A 1R8JA 1C8BA 1R4MB 2BR4A 4KO2S 5F3WB 1OF1A 2QTVB 3Q2OA 2K2WA 1YR6A 3SXPA 2Z2IA 3PC6A 1Q0PA 2IIVA 3BSYA 4X93A 3ZWXA 4F1KA 4KVAA 1ULUA 1YQEA 4WH0A 2VQFB 2HBZA 5J2TF 4DZTA 3IQWA 4LRQA 2K5UA 3K8YA 2RBKA 3G5MA 5E6RA 3C7AA 2ZDQA 3M6LA 5CD1A 1P1IA 2WF6A 3MJCA 4X1OA 3DEJA 5KNCD 1ZOIA 2Q9AA 3QENA 5H7XA 1TU3A 1YCHA 3RT1A 3WIBA 5IVPA 4P86A 3PCRB 3KJIA 4KX3A 3BTSA 1DAHA 3KQQA 4DCUA 5BQ3A 3NBXX 1QO0A 2BFPA 4AS2A 1IULA 1QC5B 2XMGA 3WL4A 3KQYA 4BNKA 1E6EA 1E9VA 2QIOA 3DQPA 4ZREA 2WIGA 2GVNA 1K2VN 4LJRA 2FLKA 1EP2B 1XJCA 3FAZA 4FQ5A 3L1JA 1HM5A 2YWDA 2IP1A 5FA8A 3V6LA 3O90A 5BNWA 2L69A 2IOFA 4B6SA 1P4AA 1PK8A 1OVMA 1W30A 2QEQA 1KWGA 3CRMA 4BP8A 1E98A 5HW0A 1Y8RA 3I37X 4JAVC 1I6WA 1JV2B 5CDFE 5F3DA 1AQNA 4RY0A 1LKZA 4Y2VA 4C6TB 2XT0A 4IINA 4ND3A 13PKA 2XB2A 1Q0HA 3K0KA 1NVFA 2WJZB 3DDZX 1UZMA 3NBUA 4FD2A 4GZ5A 1ZESA 3VXKA 3KT8A 1Q0RA 3G5TA 3C45A 5K99A 1JVBA 3DFIA 2X5OA 2XUOA 2R1VA 2E4ZA 2Y1DA 5F9MA 3AVTA 2LDBA 2IY9A 1JTVA 3S99A 4RYDA 5A7HA 3T3NA 1CUJA 4ZQEA 3VR6A 3IKJA 3WYDA 1E4VA 1P39A 4LYEA 3VZPA 2O8CB 1WPRA 4B40A 3FZYA 4XIJA 5LDHA 1UT6A 4BNJA 1L5HB 1CUBA 2G3YA 3P20A 4FZJA 4MPDA 4YBZA 1IM8A 1KDZA 2GESA 2HXYA 2OXIA 4PRZA 4HNGA 4NCAA 3ZE7A 4YXFA 3GEIA 3OO0A 4C2TA 4PG5A 1DX4A 5IC4A 2C57A 1CUVA 3VZSA 1K3TA 3A1NA 5BYKA 4KPYA 2MSWA 5EE9A 1LS6A 3DVSX 2OC9A 3LCCA 2HR1A 3T7JA 1GG5A 2DP4E 1GPUA 2G7ZA 2V9CA 1OYOA 2DPHA 4A16A 3ILXA 2I7XA 1E9RA 3OC0A 2JIDA 4Q01A 5CDUA 2EBFX 2AH5A 4P35A 4W6QA 1R0YA 2W83A 3DF9A 3QVOA 3BJMA 3V5NA 2WV7A 4MR8A 5DM60 4EL0A 3B9RA 3GFOA 1DO0A 4Y7CA 2OEPA 4F3NA 1VLQA 4MUIA 4QDKA 1WP4A 3PQ2A 3GJ4A 2DULA 2AN9A 3K1ZA 2IV7A 2FWJA 2C54A 2EOAA 4HWOA 3WJAA 4ASUA 1Z26A 1V9LA 2WMYA 3L18A 1D0VA 1DIRA 5FB3A 4U2CA 1KYZA 3E9DA 3H5LA 2V98A 2HSJA 2ZUCA 4MQMA 1EUCA 3LDAA 3LPCA 3W6NA 5B58C 3LI2A 2BE9A 3NOQA 2GAOA 2ZM5A 4DB2A 5JJIA 4OXRA 5JLAA 4ALMA 3I0MA 3M4XA 1XXLA 3K6KA 4K6HA 4GU5A 4NDNE 1W36B 4MWOA 1XDBA 3ND5A 2UVQA 3AF2A 1XG5A 1UANA 2XSZD 3KR9A 4O2BF 4EJMA 1ZGJA 4XD7A 3RSCA 2AKAB 1JXQA 1LLCA 1P9LA 3A14A 2O2DA 3HBLA 1UFRA 2O1SA 3QEKA 1XZQA 3UICA 4UEWA 4B6PA 3EAGA 4RV5A 4EP1A 1GYRA 2QRQA 4LOIA 4KSYA 2CFOA 1AHPA 1O5TA 2AE2A 4HFRA 4JNKA 3OOEA 5H3HA 4DUYB 1TO1E 1Q0SA 4OJQA 3OIDA 4NS4A 1ISHA 2QP4A 3CYFA 1EVQA 1DZIA 2OFOA 4M6WA 5DHRA 4OAOA 2F1KA 3EW7A 1KETA 3PU6A 3LHIA 5KQLA 3UV6A 1J5EB 1FTNA 4JCCA 3HA2A 4F5ZA 4YT4A 3JZDA 4LOKA 2RK6A 3I9V6 3K9NA 1JAYA 3D7RA 4KR2A 4MUHA 3LUAA 2BT4A 2FQWA 3EIFA 4LWPA 2YZMA 1GJRA 2XWQA 4EG8A 5KKNB 4CLEA 4S1PA 4ZXPA 2VSFA 4YV0A 2VPZA 2QTFA 3VYRB 1J33A 3DPUA 1MO4A 3AR6A 3H19A 3TOCA 5FH9A 2FMKA 3EDYA 4B83A 4ZV4A 3EXIA 1RRKA 1MR3F 4RNDB 5EKUA 4LSWA 3ONFA 4TN1A 4M8SA 1HL7A 1W5SA 3M6VA 4KAJA 3W9SA 4C9BA 4B6EA 2A7XA 4DMHA 3QIVA 4Y0VA 1JG4A 1UC5B 2G1AA 3IT3A 1NNUA 4QFDA 3WBKA 1RCTE 1IJKA 3RRBA 3H86A 2ZGVA 5FLKA 3NM5A 4PZ9A 5G0TA 1JAHA 1F2DA 4WLEA 1NONA 4P54A 3RAFC 1IN7A 3TQHA 2O07A 3MWLA 4EYOA 7REQA 2JAUA 1YXMA 2IYNA 2WDZA 3P94A 4FGSA 2XCRB 1C1HA 1JALA 1HH4A 1VE9A 3F3SA 1E1KA 1CZOA 1YB2A 4ER7A 3VFDA 5LZ7A 1AK2A 4XIYA 2YHBA 1E59A 4D1YA 3V2GA 2OVFA 1NYLA 1Q5PA 1NVBA 3QE9Y 1DBPA 3E5RA 5CH3A 4DRYA 4Q4LA 2PJZA 5AKXA 3K9FC 4EHJA 2WJYA 3CW9A 3R7SA 1JDPA 2WJ4A 4NICA 1SCUB 4OGWA 1USUA 3JVIA 4HC4A 5BQOA 4I1YA 2A88A 4KW7A 4DJAA 1ZD2P 2A3RA 3GEGA 3VV3A 1PAUA 2FQXA 1FDTA 3D6HA 3L4BA 2PGJA 4K9DA 4QELA 5HE8A 1UOEA 1PE0A 5KCMA 5HNKA 2Z1MA 2BMEA 4MINA 3TQCA 4ZICA 2EYQA 2O5CA 3M6WA 2CVHA 1X9HA 2W93A 5BOSB 2R8YA 4C6SA 3WLHA 1CFJA 3WGHA 2QPTA 3DP9A 3ITEA 4RHUA 1G6OA 4TROA 3TMYA 3I32A 4CIVA 4E3WA 5JH7A 1IHPA 4BLSA 3LFUA 3NIBA 3H8SA 4IGAA 3NIDB 3CS3A 5E4FA 3MWJA 4UNQA 5CM9C 2RGWA 3E58A 2J7PA 1SBNE 4C4AA 3OMLA 3AC0A 5JPCA 1S2OA 1W48A 4MPTA 3QI2A 4YFVA 3BMCA 2DERA 4CIYA 1BCRB 1I01A 1MW9X 2VLBA 3F5SA 1ETUA 2B0CA 2EFYA 1Z35A 1NFFA 4H3HB 4DQUA 4F2WA 4R71A 1RXCA 2PSEA 4LOJA 5KWEA 1YL5A 1I2DA 4TQAA 4LYFA 5SZIA 1E1NA 4KRYA 2X9VA 3NLLA 4GOND 2PUCA 1LSJA 2J41A 2PNJA 4RD1A 5JAQA 1EB9A 3S5JA 4ZOLF 3AHHA 1U0FA 5AW3A 5LXTF 3F6CA 1VI2A 3D2BA 3D3WB 4KFRA 5LQUA 2YZ7A 1FRVA 3K0BA 3QMMA 1U0RA 3L5OA 4X44A 5GV7A 1WCIB 1QO0D 1L5GB 1UWCA 3HJUA 3N7TA 4MP3A 1EVYA 4V0SA 1FUKA 5ADUS 2WP0A 3OOSA 4OYYA 4JI0B 3CVOA 2C2BA 1C1XB 4R8KA 2O48X 4YJFB 2WJ6A 3KJFA 4UTXA 5THXA 2E1RA 5CBPB 2I2CA 1OAKA 2WU1A 2IY7A 1QV7A 1ENYA 4U3JA 2GFHA 3GVXA 3HN6A 3JQ9A 3ILSA 2K7ZA 3KC2A 2R7AA 3MMXA 1WDLA 2CVPA 4GUAA 5LD2B 2YOHA 2V74B 4IZIA 1FEZA 1UBNA 3G9QA 2ZPUA 1P31A 4E09A 3ICVA 2AWOA 1M10A 3R9XB 4RJLA 1KMQA 2RHBA 5I7VA 3A0RB 1QWSA 3RFFA 3SFTA 2NYUA 4JJ6A 5BSRA 5HOEA 3EUEA 1EUCB 4M55A 5EPEA 3P0JA 1ZH6A 2YIDA 4QQFA 3LOPA 4OK5A 1TNDA 5TXGA 3JQAA 3IIMA 4PF1A 3H05A 2XKAA 4LBWA 4YMSA 5G3YA 4QT0A 1ZJWA 4KPFC 4LXHA 3ZGYA 1J42A 4JHLA 3O73A 3SIRA 3F6BX 5F9HA 1DX6A 2QLBA 5AJWA 4GRDA 3KQWA 5K0JA 1CRLA 2GDZA 3ZQ6A 3DV0B 4GZ3A 1IQPA 1R0XA 4J43A 1G8FA 3Q7QA 3CZAA 1YR3A 3L7AA 3GLHA 1RXSA 3QV1A 1L5HA 3UAZA 5K03A 3PSAA 4DV0B 4ZEVA 5MGNA 2V6MA 3HA7A 1GPWB 1LDMA 3VSCA 4YVFA 3A8TA 1KKUA 1Y8QB 4PYMA 4HXEB 1UAAA 3WHIA 4FSXA 4MQBA 3ML1A 1EZ1A 2CJXA 3WFZA 1X87A 3A9VA 1HLDA 4QWMA 1V41E 621PA 4K03A 5BORA 2WYHA 1HFJA 4YJGA 1EVZA 2R44A 3MN1A 4RVDA 2XUHA 5J1TB 2ZUBA 2I9PA 2GK6A 4MS3B 1CZKA 3QRWA 2FQQA 1TFRA 3BE8A 4JXJA 1JGTA 2G09A 2QVZX 2A92A 1T1RA 3MTAA 2DWPA 4PHTA 1K5DA 1EE2A 4QDJA 2JC3A 5JRJA 3WL3A 4A27A 1UBCA 3IMEA 3G8AA 4ZI2A 1Y7HA 5JVDA 5KJEA 4HGYA 1BHQ1 4ESVA 1NJ1A 4IQFA 1G291 1HZZA 4LX8A 3T5BA 1JXAA 3MMZA 3RGWS 1HMPA 2VWQA 1P4HA 4UUQA 4EKDA 5KC8A 2WP8J 4ND8A 5A02A 3CWCA 5ALLA 2J07A 2ZRCA 2BHNA 3T1QA 3FB4A 4QOHA 2GXQA 3VNSA 4ZZ0A 1YDWA 4X0EA 5KYYB 4EPXA 2XSZA 5DBHX 1J9ZA 1T0PA 3TUIC 4DHWA 3Q3CA 4YCSA 4Z54A 1K1EA 3E5MA 3HN7A 1J07A 4N82A 2HTEA 1UBOS 1Z5ZA 3LHSA 4BV3A 4L5BA 1CQPA 2IDZA 3H3XA 1CE8A 4JJEA 4PGAA 2REQB 4C0HA 3OE7A 3N0XA 4MTLA 2XQGA 3GFPA 4KQMA 1P1RA 3TB6A 1MOSA 2CFSA 5EE1A 3SYMA 1XAGA 4AKSA 4MIYA 2VG8A 2JFQA 3A7DA 2VHUA 1GYPA 3JQGA 4KDEA 5BSUA 3IT2A 4Q4JB 4R6XA 4BAGA 3OM8A 3IVRA 3NBMA 3RV4A 4QG3A 2Q2WA 3MYRA 5IVKA 2GKGA 2HU2A 3BREA 3JU3A 3IMGA 3DZCA 3LY5A 3FIUA 4ZEWA 3RU3A 3UCFA 1JL3A 2X22A 2ZROA 1QHHA 4HDQB 2QJTA 3ZY5A 5L7WA 4FU0A 3G6WA 5HKBA 1PLLA 1VA4A 2QTBA 4CL3A 3USES 1XRQA 2LCFA 3EVFA 2LDXA 3SLKA 3HZOA 4INJA 1BMTA 1LZKA 2ZVJA 1PG2A 3FPHA 3GARA 3M82A 4D9IA 3PEVA 1H9AA 3SMVA 2HIMA 2NLOA 1O0CA 3K70B 3K30A 1E6WA 1DLJA 2IYTA 1T25A 2H06A 2AEFA 1SD1A 1WB6A 5EI5A 1LV8A 4O5OA 1UFVA 3RAEC 2IXFA 4JJGA 3GRRA 1D2AA 3WL7A 1HE4A 3LX5A 4DCVA 5BNZA 5KYYA 2B5OA 1PQPA 4M7OA 4X8OA 4I46A 4L78A 4BEWA 3S5UA 5H1YA 5C37A 1BXKA 2UZ0A 1JAZA 1U6KA 4TTVA 4TZTA 4W9MC 3RUCA 1G1MA 5F51A 2C9DA 1YJ8A 4R7ZA 2ZIEA 4PPFA 5TMDA 1W5AA 3AHFA 1PT7A 1GQYA 2YS7A 3OMXA 3R9WA 3ZBPA 5IKXA 1OGIA 4GYYA 3HABA 3RADC 1MJGM 1J1IA 2JFNA 1QFZA 2H07A 3RANA 2QJOA 1UKZA 3OP4A 1Y6GA 1HY3A 2H8GA 2FRDC 1Q44A 4R83A 5K3DA 3RC7A 1A4IA 4PGGA 3JQCA 3AFGA 4B48A 1AHIA 3P9IA 2EW1A 2W2QA 1KYIA 1GN8A 3QLUA 4M2LA 2ATXA 2J32A 1IHOA 1P73A 2RFLA 4PXAA 2C3OA 2H4HA 3CWZA 4YO7A 2QBYB 4S1VA 3TNYA 4LRYA 3U7JA 4CT4B 3LFTA 3MRSA 4YAGA 1SQGA 3QU5A 1OLXB 4IG4A 4Y2JA 4CJXA 1EEXB 3EARA 5K0TA 3JCZA 3CF0A 4PXSA 1M74A 3ZE1B 3BXFA 3JQPA 4GMDA 3TTTA 1CQJB 3CUUA 4TV9F 2O8DA 4KMMA 1T8SA 1BVYF 1UL1X 2OCAA 1QE3A 3UMFA 4PZCA 3ER6A 1IY1A 3FFTA 4DMLA 4NR0A 4QHYA 2XJ9A 4CLRA 1HG1A 2PZBA 4OB6A 5AM4A 5DULA 3S2ZA 3WYGA 5FP0A 2MYPA 2QUAA 3FGOA 1RAGA 5CA0F 2FEWB 2K4MA 1BXGB 1W2GA 3EDCA 3HACA 4MLCA 1GDTA 3IJRA 1ZCFA 4B3HA 2P8JA 1R0SA 3IS3A 3IOCA 1N6OA 4PC7A 3TRIA 2HTFA 2QHXA 2WTXA 2WPDA 2R96A 1PT6A 1IXKA 1E5LA 2A5JA 3A6FA 1E9AA 1JHXA 4LJLA 1GUZA 4N8SA 3DR3A 5ED0A 3SC3A 3KKZA 1M6HA 3GRZA 3RRFA 3SQOA 3E3MA 3VMMA 1ENPA 1UMBB 3SZMA 1NVMB 3OZCA 3MIIA 1C5KA 2NPIA 4B2LA 3T8YA 4JP1A 1CUFA 1OXMA 1XTKA 5EUCA 1AQLA 5DI3A 2ZWVA 1D03A 1YZNA 2ZSBA 3P5BA 2X5KO 4HLCA 4B5LA 1KTVA 1X7ZA 3ABIA 4DLPA 4UNRA 4PC3A 5J2UB 4M8NE 3UG7A 3DWIA 3K71B 3FMPB 4Z99A 1S2MA 5AYVA 5NULA 2RHDA 1V2HE 4KQWA 4IF6A 1CDZA 1XNHA 3DE7X 3B1KA 1X86B 4IKOA 2BW0A 2DUWA 3JD2A 4Y2SA 1PUIA 3WRWA 3AFIA 1RP1A 3DKPA 1BDBA 4KXQA 5ENZA 2G4CA 3PJRA 1NU8A 3L7MA 4RVFA 5GM2A 3LBFA 1IQUA 3LIPA 4AYTA 4E5KA 4JSRA 4BZZA 4L2IB 4O4HB 4B9EA 2Y9PB 1PFWA 2ZKIA 3ESCA 3KCNA 4ZQFA 5BSMA 3AVXA 1EDBA 3B20A 3JD3A 4JLKA 3IULA 2D0PB 1J99A 3ZN2A 4D0RA 4L8YA 4O2LA 1NI4A 2RARA 2XUFA 1K6IA 4OHRA 4R98A 4RTKA 1VZ3A 1X19A 4FLEA 3IE0A 4G9EA 4MPRA 4XWYA 2J6BA 2AUMA 3EULA 2B36A 3PVSA 4FIDA 1EGVB 3WLTA 4HNQA 4P4UA 3DL4A 3ZTWA 2N42A 2Z30A 4F3RA 1EQUA 3TEMA 1VXRA 2AQHA 1GSAA 1WZNA 4EVIA 2FPUA 4M8LA 2WJIA 3PEFA 4F8JA 4E51A 2O23A 1JJBA 1LDBA 3OP1A 4OIMA 2G5TA 2WMDA 2CF5A 3HYRA 3KEMA 2FFJA 1ZUNA 2ST1A 3PDHA 4JVLA 5KHOC 4FUQA 4QRIA 3STYA 1H5NA 2V7VA 2YOGA 2Y0BA 4J91A 1N0VC 4YRGA 1AF4A 5KDLA 3SOZA 4HSGA 5KCZA 1TPZA 1Z4NA 2VS1A 2BFEB 3C98A 4JLPA 2AT1A 3QA9A 4F6CA 4W9RA 4QO8A 3WVNA 3FM9A 3KUXA 4JVSB 4L95C 5ITZA 3AR3A 1Y4SA 1TAGA 2C88A 1NSYA 1BMFA 4IDCA 2O3JA 4YJ2F 1XDGA 3IHTA 1MCZA 5IABA 2NO1A 3PFIA 1R4ZA 3PNYA 4X8LA 1OWMA 2QAGB 4U00A 4A5OA 1OTHA 4DTCA 1KI2A 3IOYA 5ALEA 3S1SA 2O2GA 2XMBA 3TLGA 4TWJA 3VDXA 3VPDA 1ZINA 1IFXA 2Q1TA 1ITZA 2FZGA 4C2AA 1D2RA 3DFKA 2AYZA 4XR4A 3U80A 1E9SA 2YXPX 1VKRA 2QDXA 2V5UA 3P0EA 2Y0CA 3QTLA 5DN9A 1L8LA 1G8MA 5F4ZA 4ZT7A 4ICIA 4BDSA 4MXDA 1R0CA 4D9EA 4ZYUA 4FMBB 2CE2X 2E4AA 2XNDD 2G76A 3PXUA 1H4VB 3BL5A 4WLFA 2EZTA 3AETB 4ZCTA 1BROA 4F11A 1UXHA 1L7OA 5CURA 4OOFA 3V8EA 4D4GA 4EJ6A 5TVKA 1GV0A 3HR4A 1IJFA 1DI0A 1DQZA 5AK5A 2VPWA 2AKYA 1KRHA 1N2BA 2WYUA 2P2CA 1SVOA 4D5EA 1GA6A 5ERGB 4B35A 3ZZMA 1XNQB 4O0MA 2YX1A 3CNNA 3T52A 3NRBA 4S1WA 1XHFA 5IK2D 5JZVA 3AIIA 2E2WA 2XWBF 3AEQB 4QZVA 5JFTA 4H9GA 1Z3CA 1U2GC 1Z6YA 3LLSA 5K0ZA 3MJRA 5KSZA 1E5TA 2ZRFA 3BVPA 2RK4A 1CRWG 2C04A 1Y34E 5KPDA 1QHGA 2H3EA 1A5ZA 2EEPA 4X63A 3RASA 3KR0A 3FROA 1EQ2A 1KDPA 2QK4A 3RBAA 1TIBA 1U4SA 3V4RA 4R84A 2CWDA 1JEAA 3N2IA 4RACA 4Q4JA 2DVMA 4ZVQA 5ICEA 1T43A 4KQ1A 1U2RA 2AVNA 2JI7A 3KV1A 1D07A 5TLSA 2B37A 3AVQA 3QLUC 2C00A 2Z4TA 1JSXA 4AM8A 5JO0A 4LVOA 4YMUA 1NSFA 5WRFA 2F9FA 1PIWA 3EWIA 3IO5A 2IPLA 4Q21A 4P08A 4I8XA 4G37A 5EKSA 2JFUA 2DT8A 4NIMA 5KBYA 2PQ0A 3WNZA 2D06A 4KN9S 4RPLA 2XOEA 2VJAA 4JR0A 3DW3X 1IONA 3RSZA 4EBFA 2XXJA 4NEQA 1SXJE 2CF6A 5ALQA 1KZ7B 2OQIA 1A9SA 1T2FA 1K8YB 3DHEA 3KAKA 3KKEA 3SE0A 1C4WA 4X7PA 5FULA 3ZBUA 2UV8A 3E0QA 3FWPA 3NUQA 2WFZA 5JVDB 2GK3A 4KXFB 2KYRA 4R9RA 1O2DA 5BSKA 3DB1A 5DTQA 3EK2A 4Z6KA 1U5BA 5FWYB 3FDIA 3KOMA 4BO3A 3LQQA 2OGZA 1SUPA 2AC7A 2DWQA 4LGCA 4IOJA 5E38A 3AYZB 4YJ3B 3VR2D 3V32A 2JCSA 1YZHA 2D3WA 3IAAA 5GTDA 2PUEA 2YZGA 3EGXB 4TKLA 2V8OA 1UBHS 1M1ZA 3GELA 1SU4A 1BVUA 1T2NA 3B1WA 3TMKA 5K3FA 2DPGA 1CLUA 3NWPA 2X2OA 3NEPX 1F2UB 4M9RA 2BR5A 4RX1A 1ZI6A 2WF9A 3SF8A 5KYXA 3LCMA 3OM1A 1HTTA 1U02A 2JFXA 2HMWA 4NC9A 1XI2A 3NMUF 2L82A 4H7DA 1Z08A 4RV9A 1NW4A 3GT3A 1R0KA 2FWBA 4GEGA 4HH0A 4M9XA 3TNJA 3DAOA 2DWCA 3BL8A 2EJWA 4L4ZA 1XCMA 4QYTA 5SY9A 3RS7A 2PBFA 3CLHA 1YH3A 4HN4B 2IIQA 4FNAA 4MVJE 4O4JB 4XR9A 1FCJA 1G5IA 3GJ6A 1OHHD 3IOEA 4FINA 3PXCX 4ZT4A 1VE6A 4L07A 5I8PA 3D7LA 3DMHA 1GARA 3H5IA 4CVNA 4JC8A 2Q3BA 1WDTA 3HCRA 3P0RA 3OQMA 3P9CA 1TA9A 2J3QA 4YCAA 1PDVA 1JF8A 4JQSA 3TW4A 4RVCA 4EG1A 2R00A 4AKIA 3I9MA 3ZWDA 3WK5A 1VYTA 4FW8A 4PG6A 3I9NA 1YIOA 4FC7A 4RGQA 4PR3A 1W1UA 1NBMA 1P5JA 3CR8A 4B7XA 4CEIB 1Y9ZA 2YH2A 4NNPA 4HT3B 2AHOA 3E8MA 4OXQA 1U9JA 5B1YA 2KPOA 5KTTA 3VAYA 1BX0A 1QYXA 3GFRA 4TS9A 3W77A 4R5MA 4OFBA 4F3TA 3EIWA 3OZFA 1W85B 2D5BA 5ICMA 4B2PA 5FR1A 1X1DA 3LS2A 3VPHA 4A8JA 1JHQA 4G24A 3D3QA 3PXGA 3T4XA 3KL4A 2R751 4L85A 4Z7QB 1ICIA 2QSUA 4UQLA 1P2DA 1IQ0A 1XTUA 5HMLA 1LLFA 4U6QA 2R9VA 3EVAA 3W8DA 3WZMA 2Z1DA 5EKDA 1WPGA 4G8CA 5BMVA 1GFZA 5GIOE 2FKAA 2D1YA 1ZSNA 5ELMA 4RAQA 3N7UA 5T57A 4EZBA 5F7XA 1S5PA 3L8ZA 1ZX1A 4QX6A 2A67A 2F43A 4F4JA 2ZJAA 4WBNA 1CB0A 1PI3A 3HLTA 2R5WA 2HD4A 1MFZA 3FZGA 2V6BA 3H99A 4BKUA 3QELB 5FTJA 1UJ4A 3NBKA 1JU9A 2LPMA 3W04A 3AGPA 1DEKA 1V0JA 1XMPA 1STOA 2BFOA 2DH5A 2CJFA 3F3YA 2VJPA 3P9KA 2JIZA 3O1HB 3RRNA 1QHNA 4V0KA 3T1VA 4RZ2A 3DMRA 5CAEA 1EX9A 3ZZTA 2NVBA 3ZGLA 2VCEA 4K9LA 4Y6GB 5E7MA 4F9TA 2AYYA 3DZKA 2DYKA 4AVYA 3M6XA 4BBAA 4HLQB 1IM2A 3O8QB 2G6TA 5D3QA 5KVCA 2HIHA 1FJHA 2ZOSA 2D4HA 4FFNA 2MCFA 3GCXA 5JH7B 1KJWA 3PEUA 1SQ5A 4H7PA 2NSJA 5ECDA 1P4RA 2OGUA 3PGJA 1SCDA 5CNMA 3R5HA 3ZJ4A 3GYBA 3ZW8A 3VGJA 4CM1A 5EWJB 4GMFA 4MA4A 3HB5X 1G2IA 4KB5A 4AMYA 4F46A 1GSIA 2FF7A 3V4LA 5AXDA 2AKEA 3ZV4A 2ZATA 4G1EB 3PEEA 4BTVA 4ZOAA 3TI9A 1J8DA 1IIBA 1CC1S 4OLJA 3ADDA 1JHYA 3GPIA 3IALA 2YHIB 4UBJA 5FTLA 3ONWA 5AI4A 2QU7A 5JHGB 3E23A 1FBNA 4TUYA 5K5EA 1EVEA 3EQZA 2ZJ1A 3THXB 5LN1A 5IARA 3HKDA 1GAQA 1OXKB 2PSHA 3SYTA 4QVIA 1FQWA 4N6GA 3MQFA 3TLXA 3CEJA 3OZVA 1I4LD 5TB5A 1CQZA 2CL0X 2IPNA 1N5MA 4RSHA 4WVLA 2GZ2A 5P8WA 1AGYA 3PQEA 2PL3A 1QH1B 1WXXA 2G04A 4L3OA 1P74A 4J2OA 3ETHA 2A94A 3VR5H 5EAIA 4PG8A 1FZTA 1ZD3A 5C51B 1MX9A 3UMCA 1P6QA 1J2RA 5IHPA 4KXXA 3K1YA 2RMKA 4DN6A 5M04A 4V1CI 4KQEA 3FWYA 1DMRA 2EKZA 1I6MA 3RYCA 1ODKA 5ECWA 1TO2E 3COWA 3P2IA 2DM6A 2C8LA 3NHPA 4RAOA 2GHRA 1ENZA 1PRYA 3HXQA 3NHUA 1OLSA 4FFSA 1P0IA 1ZU5A 3BOSA 3QWBA 1T1GA 1SG0A 4L50A 1N2EA 4KWHA 4NCHA 3WADA 3LD9A 1YQQA 3Q2IA 3DOFA 3KXIA 2YRXA 5IBPA 4DIDA 1R16A 1R64A 2B83A 3L4SO 2XZDA 3V55A 1L4BA 2IU3A 1Z6TA 2R1TA 1M2NA 3SQNA 1BDIA 1YJCA 1RPJA 3LAWA 4N0EA 5EIBD 4C4SA 3I1IA 3WIOA 1R6TA 3JAKB 1V8PA 4AUMA 5JYDA 1WUTA 3CUTA 4UUAA 1ESNA 4U2BA 2G1JA 3B7WA 4V24A 3TZEA 2A8YA 1APBA 4TL8A 3ZLUA 2KI5A 2EGUA 1P0MA 3A2KA 1NXQA 3OJOA 4B4VA 3IE2A 1XTIA 2X15A 4UBNA 3QOFA 3PNVA 3GGOA 1FVOA 2VTVA 3MTEA 1EX6A 4EGJA 2DU8A 4MVJP 3UMGA 2R1TB 5KYUA 4FOLA 3C8MA 2A57A 2ZG6A 4CN8A 2PQ2A 4K28A 1NU6A 1QGOA 1BS1A 1F38A 3MM4A 4MGZR 4P4GA 4YAOA 4LFBB 1XN1A 3DWFA 1CZUA 2ZYUX 4FMDB 3GGJA 4HAIA 4MI1A 5TEVA 3TL3A 3PWZA 4G4SP 4MKGA 5CD9A 4P82A 1K2WA 1XV5A 1Z68A 1NJ2A 3M4JA 5AIBA 3E81A 2ATEA 4UCWA 2RCYA 4GQAA 4AMGA 5EHZA 3N6RA 2GN6A 3KYBA 1Z0ZA 2CXNA 1B6SA 2ZP1A 2Q6KA 3R2JA 1N5OX 4EEXA 4MDEA 4TN5A 1YZLA 5G2OA 3OZGA 5CHEA 1YRHA 4QOSA 4FLFA 4DLRA 4Q1DA 5IVIA 3QE4A 1NIPA 2JEZA 2XRFA 1J7KA 2X0IA 1RZUA 1TECE 4NBTA 3FYHA 1KQFA 5CA0A 4AURA 1T6XA 1EKXA 1VC2A 3QY9A 4D9FA 1XTQA 2ZB7A 4HDCA 1IUNA 2CB0A 3EA0A 4QPPA 2JDIA 4R3NA 3SSNA 4B5KA 4BZXA 3K5IA 2H00A 4C87A 2N3ZA 2BFMA 5EA2A 1OR8A 2BONA 1JHOA 1V8FA 3ETEA 1PJBA 4F8EA 2XVXA 3CZ4A 1TX4B 2CNWA 1U8CB 2GBCA 4S1OA 5K3SA 3QXSA 5KS2A 2QUJA 3ELBA 2X6TA 3QXHA 3T3DA 2Q9BA 5M7EA 5LYJF 3H9GA 2VJNA 4LSGA 2BFAA 2UZAA 3CA8A 4ZMBA 4MRMA 2F64A 1IK4A 5CFNA 2JNWA 1I94B 3CLTC 4QLBA 3D8TA 3NO4A 4HFMA 4AFNA 5CITA 5JU6A 1XK7A 1A82A 3EG9B 3STWA 4UREA 1BZYA 5M5BA 2R11A 2NSDA 3ETLA 4TVOA 4XFDA 4IYRA 3L8YA 4RV4A 4D0NA 1W96A 4IUCS 2P9JA 4DY4A 2VNAA 2DKFA 4D3DA 3ON5A 2VK4A 4RMHA 3PEWA 5DTMA 2WTMA 3I2YX 3I04A 3GLUA 4WFIA 1X77A 1JLLA 3EAQA 3OT1A 1YVRA 4A6EA 1TJ4A 1ZH2A 4II2A 3RKRA 3IGFA 5L6MB 5A7FA 1QLJA 1OFHA 4R3UC 4CR6A 2NW6A 2VEOA 1LK7A 3EXHB 4MWTA 1ZHHA 6GPBA 1F8GA 2HAEA 4JLDA 2ZAOA 4JENA 2NXJA 3ILYA 1RBQA 4GF5A 4RDHA 3PZRA 3CTMA 1HYQA 1ZRMA 4K9KA 1H1LB 5KNBA 1NBAA 1Z36A 4DV4B 1PK7A 4JR1A 1U2PA 4L4SA 4ZVKA 1HZJA 4UM9D 3FYSA 4G5FA 4EYGA 3AR2A 1S9HA 4JV5B 2GZSA 4HLUA 1F6BA 2VQSA 2ZYWX 5CP8A 5JSKA 3U4IA 4C0KA 1ARZA 4TLBA 3K92A 2WSMA 3RC2A 1P2FA 3HWSA 3RYHB 5EG5A 3C3MA 1HDZA 5FHRA 4PQRA 2Z2XA 3N0WA 3VOBA 2RG7A 1CUZA 4BV8A 5BWLA 3LHDA 2DPMA 1ZNXA 3IQHX 4D81A 1SEVA 1KYWA 3UJBA 2UXCB 3FWKA 5I45A 3W90A 5DEOA 2XJ4A 2A14A 4DCCA 2PMWB 4D25A 2UUBB 4UOZA 1E3JA 5LOVB 2BWJA 2COEA 4KXMA 5JS6A 1KSHA 3RU2A 3V7YA 3PTZA 3O26A 2VDVE 1E58A 3AHIA 1E4OA 3S8EA 3LKVA 2HL6A 9LDBA 4DEYA 3GVPA 4LF5B 2NUBA 3ESQA 1O96A 2I1LA 2IC5A 4ENTA 3OUUA 4GRIA 4J7CA 4FHFA 5TEWA 4C22A 5IJ9A 1MC1A 3KZNA 4D8WA 1XHEA 3OJWA 2HM7A 1JKFA 4RHCA 4PLCA 1M2VB 4EYSA 2YJGA 3GLVA 3TFWA 2NV6A 5IPFA 2EKBA 2MSKA 5IG2A 3LDFA 2R8RA 2WNHA 2F67A 3F4BA 2PMCA 4HEA1 4ALKA 4CKXA 1NY6A 3WK6A 3DBOB 5BRJA 4D9MA 4BAZA 2QY9A 1MO5A 2B82A 3FE2A 2ALJA 2DHRA 2C5EA 2GJ4A 3H9EO 4HJXA 4KLCA 1F8UA 1V5IA 2WM9B 1VG8A 4WNCA 4XEUA 3SYKA 3UG6A 5CNKA 3RTBA 3TINA 3IAEA 3USCS 8ABPA 4KE6A 1QV6A 2PH7A 3MLAA 4O1HA 3ZYZA 5JZSA 3RG2A 3RHZA 3NCHA 4BMYA 2GXSA 1FYEA 3K15A 4MVJI 4J0QA 4OB8A 5DLQC 3NIWA 2HU7A 5LQCA 5TPZA 4N47A 4KITB 5E7IA 4TXMA 4JI6B 2PEZA 4O4IB 1P2UA 3OEYA 3JZIA 4CQMA 1VP9A 1EZ4A 3G5LA 2OCXA 5B3JA 4YTEA 1PTJA 4UDOA 5ALOA 1AY0A 3MFYA 3NT4A 2IS2A 4R9NA 3CZRA 4HVTA 3O8BA 3BMNA 4FGWA 3RQSA 1RBMA 3FAKA 4ZDWA 4E4YA 5A03A 5ALPA 2D2FA 2TSYB 1WKCA 2F6RA 3ZQJA 1NYQA 1WPQA 3DHWC 2GNOA 4PCVA 2V96A 3Q2KA 2OC4A 3U1BA 1UM9B 2WUVA 4ERXA 2HWWA 1MC4A 4YCLA 1VPDA 1FNDA 2QTWB 4I4TF 4WN9A 4TVSA 4Q9LA 3GQBB 1WXEA 2PKXA 2R6R1 3UFXA 4L51A 3AESA 2EJVA 2NADA 4BFXA 2AXQA 2I2AA 3EZXA 5DX1A 3NJ8A 5M3BA 1SJ9A 4Z7OB 1BS2A 3FPAA 1OAOC 2FMIA 1E5DA 2XUZA 1TAQA 2IEBA 3PHJA 3P71T 1GQ2A 5EWLA 1E5VA 2ZBPA 3I73A 4ZQIA 2EKDA 1E99A 1SWWA 1PDWA 2C98A 3N8IA 2IHZA 4INOA 2R8EA 4QASA 3VZQA 3ZXYA 5BV0A 4J6FA 2F55A 1D3AA 2BEUB 2DFKB 4NDZA 2NZJA 3CVWA 2EF0A 4M7RA 4WK4B 3GB9A 1C41A 1QGZA 1R27A 3H5TA 3L40A 4MQ4A 3IA7A 1K7CA 5A9RA 2BFBB 4BIIA 4PAOA 5CDFA 1O95C 3ESAA 1GFWA 4HWSA 4AMUA 3CUKA 3TCNA 1GRCA 1VCOA 4RWEA 3R7WA 3ZHSA 4ZT3A 3P96A 2A5FA 3KTFA 1U2EA 1H3NA 1ZQ1A 2CJPA 2FFRA 2PO5A 3AW8A 3QG5A 4OBXA 2AG1A 4OGKA 3FUWA 2A4MA 1FU8A 4PSKA 3RSQA 2GHTA 1QP4A 2GKOA 1FLAA 2YFQA 4K6GA 3V42A 3WK9A 4R1UA 2FZLA 3RUFA 3BFJA 2UYYA 3JQBC 4JH0A 1JYFA 2LBPA 4LE0A 4GHWA 3GLGB 2MR5A 4DR7B 4F85A 4MB2A 1PQ4A 4NZZA 3IAM6 1EESA 3UB2A 3BZBA 2ID9A 3ZTTA 1ONBA 2P9GA 3MW8A 3GEHA 4ZI7A 4N5DA 1K86A 5DMXA 1E2BA 3GLRA 1Z8NA 3RRJA 1EJ0A 3C8UA 3P4YA 5I7EA 1K7YA 1SA0B 2FSVC 2G80A 5GAJA 4BX3A 6NULA 5JCXA 2GETA 2W6JA 3BG5A 4KV9A 4M0EA 5LZ8A 3TUJC 5HJ5A 1YZYA 2BVNA 2IHJA 1MVLA 2J5QA 2XW6A 4GMGA 4OFXA 5CGQB 1V7QA 1MX1A 1JQ5A 2H85A 3DG9A 3SIPA 1DWOA 4I50F 3L0PA 5E3IA 4EAQA 1XZHA 3RR2A 1Z56C 2FWMX 4CUZA 4MRSA 4WKOA 1EP3B 2BZ1A 4Y2XA 6CHYA 4GVLA 1PR0A 2IL1A 3OCZA 1IUPA 2OHJA 5ALSA 4CKBB 2Q2QA 4Q9DA 1KK1A 1L5SA 2P8SA 4LHEA 1U3DA 5LC1A 1KEKA 1WZ2A 2KSQA 3EXAA 3E1SA 4JQZA 4I66A 3T38A 4FZVA 2PLAA 3ZXIA 4ZQBA 3SD7A 2UYOA 1PL0A 4W6ZA 3SHWA 1G7CA 3F6YA 4ZN6A 2C4KA 3QU9A 4DM3A 2IYUA 2R7KA 4C2UA 2BH9A 3H87A 1H2EA 1W47A 3CNHA 3P2MA 4FYMA 3CEHA 3ZD9A 2EHJA 4TLEA 1EK5A 1G16A 3T35A 1I13A 5F33A 1N8SA 3NHRA 2EV9A 4QEDA 5CFLA 3ABQB 4TS1A 1H0RA 4CKBA 2OBXA 4R7TA 3I8XA 3NYQA 1Y4ZA 3KZXA 1Y1SA 4ETIA 1YQUA 1M7GA 4B71A 1AJEA 2ECKA 5C34B 1C0KA 1EI9A 1KMHA 4F06A 1TKRA 1NM5A 1RQ7A 1XRRA 5HCUA 4ALNA 1LVUA 4NYIQ 1E8MA 2C5AA 3D1JA 4C43A 3TTWA 4G0UA 4GOLD 2APJA 1SCAA 1B76A 1CP2A 2Z4RA 1NVUQ 3RUDA 5GJBA 1N5DA 1ZN7A 4EK9A 3HG7A 1SKMA 1Z74A 2Q3LA 5DEIA 3OCXA 3O5AA 3OIGA 3R75A 4BNWA 2IRWA 1QFJA 1UIRA 3F8SA 4JI1B 1HDEA 4JYPA 1KQPA 1YFJA 3KLNA 3AVYA 1D6JA 3DYBA 4UDNA 4UTOA 3T7CA 2HCFA 3ISJA 1CJMA 4GO1A 1KXZA 1Y7IA 4GZLA 4IUBS 2FYTA 5B3LA 4G5SA 1MD9A 3I76A 3PZBA 2R6JA 3FI9A 4EA6A 1Q0UA 1ECBA 4NMXB 1X14A 4H16A 2MSDB 3I2JA 4KPUB 4Q3OA 3TBFA 1FJ2A 4L75A 1NATA 2OYCA 1CRPA 1XK6A 2FZEA 3AUYA 3FKSD 3RT9A 2QL9A 4D6YA 2HF7A 5C5EA 1JR3E 2QPLA 4PZPA 2QYHA 6ADHA 1QPZA 1DUIA 4WDRA 5DWDA 1PJRA 3T34A 4E2ZA 1IAQA 2OHHA 1BDHA 2X2FA 1NURA 1Z37A 4NFYA 2GMWA 2FWNA 4KP7A 3O2SB 5F64A 1ACLA 1KDOA 2FQ1A 1NPDA 5GM1A 1KRWA 4O08A 5LDDC 1TLLA 2YMMA 2AMFA 4RH1A 4RS4A 1N5RA 5JDCC 2Y2VA 1XAIA 1U7UA 3QJGA 3ANXA 4RCZA 4KQGA 4B4KA 2WF8A 4H7JA 4CL8A 2WHPA 5BSHA 3A1TA 5K09A 1LK0A 4IGKA 3E2PA 4KXUA 1RWKA 1MEEA 5F2EA 3HR8A 2CDRA 3FVWA 4PPGA 3T1NA 4UVEA 1OXBB 1FPMA 3F8TA 4HMOA 4JBWA 5E6UA 5JYEA 3Q8MA 2XBMA 3MWGA 4NV0A 2E5FA 3ZW9A 4HYEA 4EQZA 1NX9A 3I6IA 4DNQA 3ZHXA 1B2RA 4OQQA 2V4MA 1ABBA 1X9GA 3TFOA 4KMOA 3JAWA 1T4DA 2FEXA 2P69A 4TM7A 4DVGA 2W11A 2VYVD 1XEAA 5B57C 3R7DA 4HNHA 4X62B 4MGEA 2QM8A 2PGOA 1TGYA 5HTOA 2ZXFA 3H0KA 4ZVNA 3CISA 4IMJB 4NU8X 4DIBA 2BGTA 3GO4A 4PRYA 4C78A 1TQ8A 3F97A 3B3QA 5FO1A 2FMUA 1YR8A 3CX4A 1CY8A 4Y0AA 4Q3CA 2G77B 2IU6A 2PV0A 4HRAA 4BO9A 1H22A 4WCFB 3WWEA 5AH0A 3IESA 1K4MA 2QNBA 3OTQA 1I2BA 1PG0A 3UBTA 2NVUA 2BPOA 1FNBA 2E85A 3B8HA 2YJZA 4WZBE 3W05A 4WGFA 3G9UA 5FF9A 8AT1A 1LWOA 1PL8A 1U9YA 2BY4A 3DCJA 3E2MA 3RGGA 3EBLA 4WUTA 2FSGA 2CV1A 1NMYA 1ZKMA 3E70C 1W9HA 1CWUA 1G0NA 2D74A 1CS0A 1U2TA 2G40A 3TBHA 2DBQA 2NUTB 3WMRA 3M4ZA 3TIGA 2O8VA 2ASVA 4GSLA 4BX2A 5L53A 3RARA 1N4DA 1WP9A 1Z7WA 5AOBA 2XZTA 4WAUA 2QN1A 1NM5C 5CDHA 3UXEA 4E5UA 4KO4S 4IQ8A 5C5DA 3FMGA 3KR1A 1P9OA 3QYJA 4YIKA 4QBHA 1RS0A 3W2EA 3MCTA 1TVKA 4YRKA 1GZVA 2H1HA 4E12A 1ZM3A 2P5UA 3DM9B 4QNRA 5CLQA 5AUOB 2HLHA 4DJDC 1E62A 1CVIA 1ZK2A 2R25B 2C78A 1PJ2A 1FVHA 2IS4A 2QE7D 1E63A 1US8A 4P4NA 1GR0A 3GEMA 4HXGA 1YCGA 4NKRA 2P2DA 4N0DA 2I22A 3PVCA 1BXRA 3W7BA 3I1FA 3IQGX 4MV7A 3OPMA 4OQDA 5EQFA 3HCDA 1GGJA 3TLEA 2FFHA 4WZBA 4CEHA 4QBIA 3BWEA 4YJ2A 3FPEA 5L51A 5ERYA 4DWVA 2ZYIA 2C4TA 2YICA 2V6JA 3IV9A 2FZ5A 1J0XO 1MA3A 2H7VA 1R4NA 2YN0A 2Z04A 3R20A 4XD7D 5KKAA 3AZOA 4A0RA 3FNBA 3RTEA 3QWIA 2PLWA 4IQ0A 1EP1B 1GZ4A 3KHSA 1V16A 3JQGB 1X7YA 1F0YA 1DIOB 3WWCA 3H6KA 3U1TA 3A4YA 5BN4A 4L8VA 4LXGA 3GRYA 2G6BA 4IKPA 2G8LA 2NGRA 1G8AA 1ZQ9A 3QVLA 3R7WB 1D5WA 1TLTA 1VKZA 5BSFA 3O9MA 5IEBA 2X23A 1NXTA 2FA9A 1U8UA 1EFLA 3BSWA 5YASA 5I7UA 1XDUA 3NB0A 2XD4A 2O0HA 1PNVA 3G88A 3HSSA 3LQYA 3OQHA 3NBFA 4QL3A 1NMZA 2F7SA 3JQ9C 3L7JA 5LQAA 2H54A 1NFRA 3GX1A 4QEKA 3LHKA 4M9ZA 1GFIA 4M98A 2X0DA 4L5AA 4CNQA 5CB4F 3MOGA 3O4GA 3R7NA 2PFSA 4R81A 3ZK7A 5CVJA 5B4TA 5BOVA 4GLLA 3ZZ1A 2K7FA 3FOFC 2ON6A 2IQIA 2V4UA 4L8WB 5GONF 3QQPA 2BMAA 2QQFA 2ODQA 5E7JA 5KX5A 3STXA 2O3TA 1AKVA 3VTAA 4REOA 4FZ3A 4MW4A 4A0QA 4XWKA 3G1TA 2RAPA 4FIZA 2YBDA 3VHXB 3ZE2B 2DT5A 1DOAA 1XL0A 2MSNA 2NX2A 3WGOA 3V8VA 5JY1A 1UM9A 3LY7A 1ODLA 4URHA 1RXIA 3PCXA 3KXDA 4D80A 4F60A 3NI2A 3VR6H 4KTVE 4BLQA 2ZIWB 1P7ZA 4OU4A 4YV1A 2JZCA 3L2OB 5IT4A 3E4CA 1SUEA 2VYND 3AY0A 4GXRA 4G9BA 4L72A 2WIFA 2O2IA 1LI5A 2FCRA 1MU0A 1O4WA 2Z9BA 4NCKA 5FWAA 2AOVA 4CG1A 4DCTA 1OX6A 3KOWA 5BURA 4FTWA 4GPD1 3I5UA 3IUNA 3GR6A 4AD8A 1JEDA 2B8JA 3HDGA 3LV8A 1BJTA 1ATIA 3DBRB 3MGBA 4OJMX 4QOFA 1AKUA 2P1ZA 3NONA 3CLRC 5ALUA 1AMOA 3CU5A 2XE4A 5I47A 4MV9A 4ZVTA 4IIJB 4FMCF 5AM5A 3A2NA 1E4YA 1FLNA 2JI9A 4ZI5A 3WYFA 1TM1E 4CF6A 1UPCA 4JK3A 4D98A 1UDWA 5JCZA 3PIIA 1A5SB 3FUVA 3ET4A 5IZ4A 3QJ5A 1NA5A 1PNQA 2VZLA 3SLGA 1MIOB 1UIMA 1Z5WA 3OU7A 4L4RA 5DDIP 2OCYC 5G0SA 3T1TA 3E9YA 2IXBA 4JGIA 1Z7EA 3J7TA 2B92A 5CVCA 3BIXA 3PRYA 2XDAA 4R9UC 2A35A 1VDZA 1VPVA 2OXFA 4ZTBA 4AF7A 3VTKA 2WM3A 5B4UA 3K6SA 2Q5CA 2C2MA 4DSZA 3MJDA 3ZCTA 2VPPA 5D86A 4AY3A 2ZREA 3H11B 5HFAA 4JB0A 1UOQA 4GWGA 1EBFA 1C9JA 2BFNA 3C3CA 2VJQA 3IC5A 5B6JA 1E6MA 3VX3A 2BI8A 1W19A 3UQZA 2YXEA 4RFSA 2OT3B 4JJAA 4QAJA 3REGA 5JAIA 2QXYA 1J0DA 4LJ9A 3EGDA 1NXXA 1GG8A 4L4XA 5CEEA 3BMOB 5KOIA 5IT9A 3HVIA 3KSBC 3OY2A 2NQ2C 3ZQ4A 1J56A 3PFFA 3LDUA 3WRVA 1XPUA 1REQA 3BWVA 3TSOA 5G02A 2JGDB 3OZUA 3TRJA 2D1RA 3D2CA 4Z4IA 1XROA 1VHTA 5DGHA 3C70A 1TQHA 2XNJA 1ZGBA 4ZJYA 3P0HA 1A97A 4Q9JA 1AS2A 1U7ZA 4M89A 4UFOA 2PR2A 4FN5A 3FR7A 1SCNE 1CYDA 4R1OA 3RH0A 1Q3TA 2GPYA 1Z88A 2YY6A 2D8AA 3N0VA 3MRTA 1IM5A 1M2EA 1Q3KA 2LV8A 4MQFB 4NZ9A 3SE7A 2ODBA 2VYQA 4D99A 2WR8A 3O38A 4A10A 1ADFA 2JLUA 3AEQA 3DE3X 1BG6A 3LP6A 3LCUA 2JFHA 3E22B 2FMXA 1R00A 2OZKA 4RABA 4UHHA 2XXAA 1H2RS 1IBRA 3OTIA 4O4IF 1WZEA 5T8KC 2ZE6A 3Q1KA 4AO7A 4IEIA 3TQIA 4BS9A 1LS1A 3K4PA 3FR8A 1C3EA 4LNAA 4L8FA 1WF3A 1CF2O 3FYUC 3WNQA 1KO4A 3CZPA 4KG7A 2ZSAA 1JJAA 4AZ3B 3C6ZA 2I62A 1VJRA 1H6DA 2CMGA 3GNLA 4NHEA 1UC8A 4JLVA 4CM3A 2EERA 4WLNA 2ZSIA 1OTXA 1Z9BA 3PHGA 4QBTA 1XT6A 1SMKA 1VI5A 1GRVA 3G5AA 3WLLA 1Q15A 2B1IA 2DBRA 5EESA 3SZUA 1MW8X 4PZZA 2JFZA 4HS4A 3L0YA 1P0CA 2QVBA 4UNNA 3EZ9A 3AVWA 2HKIA 4KQKA 4QC2A 3WFJA 2JLAA 2W5UA 2KM1A 2HB6A 4ZAXA 4BWYA 4DW8A 1B7GO 3EEFA 3RM3A 4H1TA 1H94A 5CTAA 4UARA 3MXOA 4OI1A 4PCLA 1DLIA 3VC7A 3NJ4A 4UAGA 2J31A 1O6CA 3ND7A 3HLKA 2WE8A 2KMLA 1Z38A 1PS9A 3OEHD 4MARA 4IX9A 1YDMA 1JA1A 2WLSA 3D7SA 4FNGA 3PPWA 1NJ6A 2JD1A 1NJ8A 3G13A 3ED1A 5EJ2A 3VM6A 2IJGX 3SXUA 3N2YA 3UZUA 1E3LA 1E7RA 3GLKA 4BCCA 2C5BA 4ZHQA 5LMCA 3K0CC 2IPMA 3V9AA 2FWRA 4N8EA 4ZOQI 4MYSA 1YS1X 3ASVA 3FW1A 4ZVRA