4I2VA

X-ray structure of the unliganded uridine phosphorylase from yersinia pseudotuberculosis at 2.12a resolution
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
250
structure length
250
Chain Sequence
SDVFHLGLTKNDLQGATLAIVPGDPQRVEKIAKLMDNPVHLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGVRTFLRIGTTGAIQPHINVGDVLVTTAAVRLDGASLHFAPMEFPAVADFSCTTALVNAAKSVGATTHIGITASSDTFYPGQERYDTFSGRVVRHFKGSMEEWQSMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNEETMKATESHAVKIVVEAARHLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uridine phosphorylase
publication title X-ray structure of the unliganded uridine phosphorylase from Yersinia pseudotuberculosis at 2.12A resolution
rcsb
source organism Yersinia pseudotuberculosis
total genus 77
structure length 250
sequence length 250
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2012-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4i2vA00
5CXSA 1Z5OA 4TXLA 3KHSA 3FB1A 1LV8A 1VMKA 3KVRA 3ODGA 1A9QA 4K6OA 4EARA 1A9RA 4WKBA 1YRYE 1U1FA 2I8AA 1PKEA 4L5CA 3NBQA 3OOHA 1RYZA 5CXQA 3PNSA 1NC3A 1ODKA 2OC9A 3UAVA 5B7NA 3BL6A 4TTIA 4BMXA 4LKRA 1JPVA 5F78A 3EUEA 3OCCA 3NM6B 1A9PA 1A9OA 2HRDA 2QTTA 2I4TA 3ONVA 4R31A 4JP5A 3OZEA 1OU4A 5DK6A 4RJ2A 1LVUA 3NM5A 4F1WA 4NSNA 3PHCA 1PR4A 1U1DA 1PF7E 1JDTA 3MMSA 3KVVA 1YR3A 1K9SA 1T8SA 3O6VA 5F7OA 4DANA 4D98A 4WKNA 3FAZA 1VHWA 1JDZA 4M1EA 1RXYA 1Z39A 5I3CA 1T8YA 3KU4A 4L5YA 1Y1SA 1RR6A 4TS3A 4MCIA 3T94A 4YNBA 1OV6A 1RCTE 1WTAA 4G8JA 3FWPA 5B7PA 4F2WA 3E9RA 4FFSA 1ODIA 1I80A 3OF3A 4KN5A 2AI2A 3LGSA 4M7WA 1Z35A 4PR3A 3MB8A 4L5AA 1PW7A 1LX7A 1CB0A 1YQUA 1B8NA 4E1VA 3DJFA 3DF9A 4LNAA 1ULBA 5F7JA 5CYFA 4NY1A 4LDNA 1RXUA 2HSWA 4DABA 5FAKA 4DAEA 1PR1A 3UT6A 4BMZA 1T8WA 4DA8A 1YQQA 2AI3A 1U1GA 4GLJA 2A0YA 3E9ZA 1TCVA 3GB9A 4UC0A 5ETJA 1SJ9A 4YO8A 3D1VA 4LZWA 5B7QA 4GMHA 2OECA 3BJEA 3DDOA 4BN0A 4GLFA 4OGKA 1K3FA 1JDSA 1Y6QA 5KB3A 4JWTA 4TXHA 4R2XA 4OGLA 4G89A 1PWYE 5CCDA 5EUBA 4DA7A 1U1CA 3P0FA 1TCUA 4QEZA 4L0MA 3K8QA 1NW4A 3NM4A 1Q1GA 4BMYA 4TTAA 4YMLA 1Z38A 1ECPA 3PHBE 1CG6A 1RFGE 3GGSA 3INYA 3EMVA 4NS1A 3FOWA 3BSFA 1N3IA 1RT9A 4DA6A 3IEXA 3DPSA 2P4SA 4DAOA 4P54A 4YJKA 1PK7A 3OPVA 2RJ3A 5CCEA 1T0UA 1Y1QA 2A0XA 4QARA 5EFOA 5B7GA 4TYMA 4TTJA 1Z5NA 3DP9A 3UAWA 2AC7A 2ISCA 3UAYA 3UAZA 2GUWA 4G41A 1V4NA 3OZBA 3BGSA 1OUMA 4TXNA 5F76A 4F3KA 4OF4A 5F7ZA 3OZCA 1FXUA 4MARA 4DA0A 4H1TA 4D8XA 4TXMA 1A9TA 4EB8A 5JPCA 1Z37A 1VHJA 4TS9A 1VFNA 4QATA 2IQ5A 4WKCA 1JDUA 1G2OA 4DARA 1RXSA 3C74A 1RSZA 4GKAA 3IOMA 4L6IA 1RXCA 1SD1A 3E0QA 1A9SA 3SCZA 1Z33A 5C80A 5F77A 2QTGA 1NC1A 1V48A 1V45E 2H8GA 1SQ6A 1U1EA 3PNPA 1M73E 4D8YA 3FNQA 3LA8A 5IFKA 1PR6A 4JOSA 2A8YA 1K27A 3ENZA 4D9HA 2XRFA 3TL6A 4OEHA 1XE3A 1Y1TA 3F8WA 1TGVA 2PGAA 4IP0A 4QFBA 2QDKA 1JP7A 1Y1RA 3EUFA 5IU6A 5EPUA 2BSXA 3KVYA 1JDVA 4M3NA 4F2PA 1V2HE 2HWUA 1B8OA 1ZL2A 1QE5A 4PNPA 4QASA 4OY3A 1TD1A 3LBAA 1PR2A 2B94A 1Z36A 1Z34A 4LNHA 1YBFA 1OTXA 2OC4A 1OVGA 4X24A 3FUCA 2AI1A 1JYSA 1ODJA 2HN9A 5CYGA 3KUKA 1PK9A 4TXJA 2ON6A 3OZDA 1PR5A 4U2KA 3EEIA 3K8OE 2OXFA 2A0WA 1V3QE 5F7XA 3U40A 2Q7OE 1OTYA 4I2VA 5F73A 5K1ZA 4WKPA 3OOEA 3O4VA 2QPLA 3QPBA 1PBNA 3P0EA 1A69A 4D8VA 1Y6RA 1V41E 1Z5PA 1ZOSA 4WKOA 1ULAA 4MCHA 1T8RA 4F3CA 1PR0A 1TGYA 4QAQA 1SD2A 1ODLA 4OJTA 3UAXA 1C3XA 1JE0A 2QSUA 4ECEA 1JE1A 4R2WA
chains in the Genus database with same CATH superfamily
1P5HA 2X3YA 2GARA 1U8YA 1TQ2A 1ST2A 3QNMA 3T3PB 1V8PA 2TS1A 4EIWA 2Q2NA 1EGAA 1IZ0A 2I6UA 4R2LA 4RPKA 621PA 4Q21A 2FQQA 3AHFA 2BFNA 3DVAA 1XYVA 3PL1A 1MQ9A 2F8LA 2EGHA 2QW0X 2XPCA 3QLUA 4GYWA 4M8NE 3PC8A 4MI3A 1DL5A 4LYDA 4B71A 1FPQA 3GRRA 4A8PA 1DAHA 4RD3A 3PGXA 2FEXA 2X13A 4F4IA 1PHRA 3BGIA 1DARA 5EG5A 2X7XA 3AC0A 1YFZA 3IP1A 3EFOB 1A9RA 3Q2OA 5BWBA 3WJAA 3B6KA 3ZGNA 4D3DA 4EGSA 3IDFA 4YCJA 5IG2A 4LC1A 1EJ0A 1KS2A 1XTVA 2G4VA 3G1TA 4HQNA 2O57A 2X8AA 4WXEA 1NYLA 2ONCA 5CVJA 1Q7TA 2ZIFA 3AR9A 4X6LA 1U1FA 3WLQA 2PMBA 2PK3A 1TVKB 2IC5A 2JCYA 3TKYA 6ABPA 5BWLA 3ZXSA 5BN5A 3V8NA 4E2XA 5KMGB 4K8RB 3JQGB 1U2GC 1VA5A 1IXRC 3ZTWA 3QELA 4UTPA 3GXOA 1XR3A 4HZUB 3D2CA 5T4BA 3R7NA 1BXRA 4DBLC 3I30X 2Q21A 1PFGA 3HADA 5CLGA 4D02A 4BKOA 3RC8A 3WADA 1IZZA 1UKVY 2ROQA 2ODQA 3L4SO 4YH1A 5DI3A 3NQ41 4TV9A 2WYVA 1VYTA 2I2XB 4LPKA 1GOTA 4HRXA 4NNJA 1V4BA 3V34A 4HWPA 1M6VA 3U4AA 5L9AA 1JR2A 1Z47A 4CDGA 4M76B 5DX0A 5CH5A 2F2TA 3VH3A 4JZYA 4JP1A 2Y77A 3GIWA 1Z4QA 4QXRA 4YI3A 3H11B 2GEUA 1BGXT 1ILWA 4OQDA 1QE3A 1RACA 4P34A 1A8PA 1Y4UA 3A8TA 3MPOA 3TW4A 1OJLA 1FDOA 3UHJA 5B5SA 2FR8C 3AL3A 4LXTA 4B2YA 1Y6GA 4RTNA 1TCBA 2REQB 3JWGA 1OU4A 1Y1KE 3DOHA 4MNTA 1M2JA 1KC3A 3JATB 5ALKA 3SC2A 3VZCA 4DC0A 1N2CA 4YQFA 4ZVKA 3KQMA 5DK6A 3OQMA 1UT6A 1CDEA 2O0MA 2PTGA 3WKDA 3ZZ1A 3KWLA 3NM5A 2H7XA 1GFIA 2GF9A 1FB5A 1SBIA 4QSHA 5AVKA 1VCOA 4TM8A 3VRHA 3VTFA 3BB4A 3R75A 1PF7E 4XYLA 1DKNA 3D9QX 2LV8A 1G18A 3G9UA 3TLXA 2ZJFA 1SCNE 3AUJB 2W4IA 3MMXA 3DM5A 5B58T 2B2XA 2X2PA 1SOUA 2FZ4A 4LXYA 3WB1A 5BORA 1WM1A 1SXGA 5E1DA 4EEZA 1C2YA 5B4UA 1RQPA 4DLBA 1Y0BA 3GLFA 5KWIA 2JL1A 4WKNA 1TKAA 1YJ5A 4N0QA 2IV2X 2VK4A 2W37A 2WRZA 3G0DA 1E63A 4KX5A 4OM8A 4QPCA 3WLJA 3SE0A 1T0JB 4HNGA 4AD8A 4C4PA 1QZUA 2QTNA 3JYOA 4IDDA 1RAFA 3ABIA 3NW9A 4R3NA 3UH1A 1GNTA 1U9IC 4RTJA 2V1UA 1WMEA 3H2HA 4Q93A 1EFPB 4BRUA 4E1AA 3KQHA 1W88B 2IIPA 4JROA 4NJMA 1F9EA 1H2WA 1GGHA 2ZU0C 1H2EA 4JV5B 2B20A 3TD2A 3D5TA 1ZSYA 5AOBA 4O4HA 3RGGA 3KOXA 4XUEA 2REXB 4MCIA 3VISA 3BXPA 3B38A 2Y3IA 4MUNA 4IG4A 4U7GA 1MG0A 3CR8A 1FEZA 2CXPA 3CXUA 1XZKA 4MEJA 2WIFA 1HQCA 4RSMA 4D9BA 1ULZA 2EZTA 4K9LA 5BQ5A 4JL5A 3IQWA 1PZHA 4GC5A 3LQQA 2HCBA 4BVAA 1M1UA 2H08A 3H7AA 3C4VA 3JQ8A 1OROA 2GT1A 4TMWA 5EMLA 5H16A 5ADWA 4PWYA 3ROTA 4DRXA 4JS0A 2P6UA 1B7GO 1R0ZA 1O97C 1RMTA 5ESWA 5AXBA 1FFWA 1E77A 1H1TA 2B2NA 1KDZA 2PT7A 2R6CA 4W9NC 2P1DA 1KIFA 3VYRB 4QU0A 1YB4A 1OASA 4JWKA 2O3SA 3OBBA 2Q1TA 1G7TA 5DZSA 4K6FA 2WMNB 4L8FA 3WWZA 1QC5B 3W8FA 1HYGA 2C99A 4FHEA 4AYWA 5KSZA 3NBMA 4ND8A 2WYHA 1UOOA 3ADKA 4EY6A 2X9QA 4AKEA 2PVCA 1WMAA 4ZK6A 5DTIA 4UHDA 3DWGA 4QDXA 4O3FA 3QUQA 4WW0A 2I5PO 4KFTA 4Q3KA 3V8PA 5MN6A 1KDTA 2ZSBA 1HGXA 4OHUA 2HPAA 3V4SA 1USVA 2CNBA 4EVIA 4WVLA 4EYQA 1N78A 2C5LA 4PLHA 3QEJA 4FFRA 3GDHA 5E1MA 3H8JA 1HYQA 1ULBA 2FRVA 1M33A 4KWIA 4ODIA 2I54A 2BEUA 1ZL0A 5JVDF 3EGVA 3DOEA 5EIBC 4ZYLA 3OJEA 2KI5A 1VSTA 3L1UA 3T7RA 4ZQEA 3JD4A 1XTKA 2WAXA 4C30A 2RDMA 4S0XA 4AUKA 1KPIA 4IQ8A 4NG5A 3R7BA 3D7SA 2HZ7A 3ZD6A 1U8FO 3RABA 2G4CA 3A4TA 4DJDC 1U1GA 4E5YA 1KDVA 3NJ8A 4KR0A 1DWQA 5EHIA 2WFAA 5E7MA 4BNFA 4DCVA 3AFOA 1E7QA 4E5DA 1N3BA 2R65A 3PP8A 4ZQFA 3ZWYA 4G0VA 1TI7A 3SDSA 1JV2B 2EBHX 3L49A 2WWHA 4YC7A 5F3RA 1Y3CE 2EJBA 2PT9A 4KQWA 1GARA 4YO8A 5A3SA 4ENUA 4GKVA 1CK4A 3O93A 3BMOB 1JDNA 1K0UA 1KGSA 3AOEC 3R44A 4P7JA 5KAPA 5JYDA 1S5PA 2JCVA 1E9CA 2FMTA 4GLFA 5DYGA 1BVRA 1OKKA 1R0SA 5BSUA 2GFIA 1REQA 4BNVA 3ESAA 1LW7A 2GCIA 3NC4A 4M0PA 4NMMA 4O4IF 4UFOA 3K0BA 1QP7A 3AI7A 4EGCB 1SVIA 1QFJA 4CWAA 2JHPA 4RZ2A 4F93B 1ZX1A 4R2XA 1ACLA 1E20A 3C5EA 4TUYB 2ZP1A 1I33A 1R9NA 1XAGA 3PSAA 4LX8A 4XKJA 4P38A 1JAIA 1E6UA 3AR3A 4Y1EA 5JNSA 2K2QB 2GJKA 2H16A 3WQQA 2DFVA 1UM8A 2J0EA 3SVZA 4I08A 3GHYA 4LJ9A 4ZVLA 4YAUA 1ODSA 3WAGA 3E3NA 4W8HA 1JKFA 4W5QA 2BEKA 3U3ZA 4KITB 1BC5A 2Y1DA 3L8CA 3Q2KA 1TPZA 4RBNA 5EXXA 3W1EA 3WWDA 5FUBA 4I1UA 3H19A 3BXEA 3BEOA 4JC8A 3E27A 3VKFA 3CGGA 3W6OA 4M99A 4BMYA 2O1SA 3F2VA 4G23A 4NIMA 2G83A 1SIBE 2Q07A 2YZKA 4LGVA 1FU4A 4D97A 2QMUA 4KQFA 1D5WA 2WZQA 4YAFA 1SVMA 4HC4A 4OAPA 1EZ4A 1D2MA 3NHUA 5ALDA 4IEFB 4EMSA 3NPMA 4M55A 4ER5A 3HVRA 2JIBA 3VNAA 3G8CA 3D6AA 3LW8A 4KXQA 2YWXA 4P4GA 4NZPA 4WL0A 3ADOA 4A03A 3KNZA 4MI9A 3M6FA 2OZEA 1ZAYA 4H4DA 3W5SA 3PR1A 4HDQB 1M3SA 4P81A 2OYCA 2ZVDA 1PT5A 3OA2A 2PGJA 3RVDA 2CNOA 1EVKA 2ZSFA 2P6OA 1GZ5A 3RQSA 3OQJA 2EARA 2HLHA 1T5HX 1NF9A 2FV8A 1N6OA 1F48A 3H04A 1N0VC 3EZ6A 1IVYA 5B1YA 2ODAA 1SOVA 2GTPA 2O8NA 2XRMA 4WUVA 2NO7A 4X20B 4C0QC 3PFKA 3GEEA 3DO5A 3MCAA 5KX5A 2NQ2C 2HRRA 2DE0X 2QYOA 1NVGA 4Q02A 1RJEA 2SKEA 5AOCA 5HFJA 5EJ9A 2XYVA 4JUFA 2ZB3A 1L7XA 4UVGA 4H6XA 3RC9A 1TUEA 5ADUS 4DS3A 2VQEB 4OLBA 4DUGA 3ZU5A 4LEIA 4PW0A 3TECE 2W42A 4C7KA 3EB9A 1EINA 3A2NA 3GPIA 1XD8A 3L02A 1WSBA 1PJ3A 3A1UA 4U8GA 1DJNA 1F17A 3OZBA 5D3MA 3MVEA 5G4KA 4ZXFA 5A02A 5JCXA 2BD0A 3HO6A 1NW5A 3G2QA 1MO2A 4DIBA 1GGEA 2PUAA 4L8WB 4G37A 3DEIA 1SQSA 4C08A 5F7ZA 1SFRA 4TYWA 2J9ZB 5EQDA 4CG2A 1IN8A 1M1NB 1QWOA 4MARA 5CT9A 2RG1A 4NCXA 4A7PA 4U6NA 1QVRA 1LQ2A 3ZE6A 1SCBA 1IK6A 1OFHA 3L1JA 4I3HA 5AJUA 2HI0A 1QMPA 3D4NA 2VUUA 3O94A 4RH0A 2XTNA 3IR7A 4Z54A 1A96A 1M2KA 2ORWA 3AILA 5DSZA 1T0BA 1PJBA 4BKMA 2OZPA 3MBKA 2TMKA 5HTKA 3WK6A 3R3JA 3WYGA 1CQWA 4YDQA 5I5EA 4ZYWA 4Y67A 1S02A 1WHTB 2SCUA 2YDYA 4PC3A 2ZCJA 3QFFA 1UDBA 1EFLA 1LVHA 4QOJA 2D5AA 5EY5B 5C4MA 2AV6A 4GAEA 5FI3A 2F8MA 1PJ8A 2BH2A 1N3YA 1VG8A 2VDQB 3OFVA 3P0IA 3ZDXB 2O8BA 2XEDA 1CUAA 5TMDA 3EYAA 1IQRA 2RB5A 4LRTB 4IMRA 1OXTA 2ZCVA 3ZOKA 2P6NA 5C80A 3PX7A 3SVLA 4XM1A 3PUXA 3BRSA 3F6YA 1T2AA 2QTGA 3PT9A 3ELDA 3G17A 3P7MA 3BWEA 1JSXA 1T9HA 1LLDA 2EFJA 1ZH6A 3DXZA 1DTEA 1KFBB 4HB0A 3HXPA 1GL3A 4WCFB 1C4XA 4EKGA 5C18A 1YTUA 2XWJI 5AESA 1NC1A 1MZPA 2XMSA 3R6WA 4AO6A 4OIMA 4CMHA 1JHZA 3GT7A 3IBSA 4DL9A 4UOZA 4CIDA 2DUWA 4GHWA 1JECA 2XZDA 1QHSA 1L5YA 2PZMA 3GVHA 3I73A 4G8BA 4I55F 4R6XA 4BTVA 4DSTA 5KHLB 1NLMA 2GZDA 2VBFA 4YAWA 3LRTA 1WULS 2Y05A 3AB3A 4LMAA 5DLQC 3THOA 5KYYB 1JW9B 2DOKA 3MMNA 2BLLA 2FSFA 3S28A 2A3RA 2Y9MB 1I3CA 1S6YA 1J0XO 1C50A 4UKDA 3W4KA 4BE7B 3FOBA 2HRQA 4N0MA 2WM3A 2AFIA 1PR6A 2Q2WA 2X15A 3ND9A 3G2MA 3QU4A 5FUXA 4BO8A 5AXCA 2OBMA 3UFXA 2JHGA 4YAOA 2VDKB 3EGCA 4Q15A 1SVKA 2YWHA 2JCBA 3RKUA 4CI0B 3EEFA 2QAGC 2YBEA 1V3VA 1E3LA 1KH2A 5KTKA 1V1MB 1QDLB 1OTHA 1Z4KA 5ALPA 5EKXA 2P27A 3Q3VA 5CVCA 3TBHA 3O92A 1QRDA 3KJIA 4AKGA 5D3KA 2Z8XA 5FI1B 2O8EB 3WOVA 5EJ6A 1U90A 4J0GA 4XR9A 1HSOA 4Y0AA 1OHHA 1UXJA 1JP7A 1USIA 2Q6IA 4DMCA 5I9NA 4E13A 2PN1A 4G0YA 5GZ3A 3A27A 3RVQA 5HR5A 4X54A 3ESBA 2P2DA 1A1SA 1XSEA 2PZGA 3LQ1A 4LOJA 4PPNA 3T0GA 4BB0A 4MYHA 1KSJA 5FTNA 4F2PA 3WZMA 3OJLA 3EY9A 1QFXA 4DUZB 3ANTA 1UKEA 2OESA 1E5XA 1K63A 2K4MA 3WY9A 2OFOA 2XQKA 2YQ5A 4RPJA 1ISJA 2XOKA 3HDHA 1FRVA 5FX2A 2O2SA 1PRYA 1Q6ZA 3RAGA 1TC2A 3PE6A 2ZSUA 4HNHA 4DMGA 4UCFA 2J9YB 3B9QA 2E3JA 4QOFA 5KWVA 2BUBA 1C1XB 1TEXA 1AS3A 1JWAB 4HYYA 3RWBA 4UTRA 2ZYWX 3P9XA 1RWKA 4FHGA 3WGIA 1NVUQ 3DLPX 2QI9F 1X0XA 3PCXA 2BEVB 4PQFA 4WEQA 3HBJA 4B32A 4EL0A 5ITZB 2GAAA 6PFKA 4H18A 3PKZA 1R4ZA 2C7BA 2YZMA 3H5IA 1NURA 1PJCA 1XTRA 3KLOA 4HFMA 1L1FA 1L7EA 2QOEA 3WL6A 4AM8A 2CCJA 4AJPA 4X3CA 2G1KA 3M4ZA 3OFSA 1SVNA 1UZUA 5I5GA 4RQTA 3ENNA 3SIWA 3I23A 1K5GA 4U2KA 5EJAA 2V5VA 2VAVA 2XQGA 1OLSB 3IUMA 1Q7CA 4KQCA 2AOWA 3L0SA 4Y6QA 3EEIA 5AKIA 2VZLA 4FI3F 1CWUA 4XH9B 3VOBA 4PHHA 4BO3A 2ZATA 3NYRA 4PINA 1AVTA 4UXIA 1R4MB 4MYTA 2W4MA 1YB2A 4LSMA 5F1PA 3AEXA 4KDRA 2QQ0A 3CPEA 4DJEC 1JYEA 2J3HA 1JEEA 3DYIA 4R1TA 4KXUA 3BL5A 1JMYA 4Y2GA 1AMNA 3ZJVA 2PRZA 1UJ2A 1KBQA 2VI5A 4EABA 3AM1A 4REQB 3LG2A 1H8EA 3EGXB 1MIOA 1EZZA 3ND6A 2IS6A 1Z5PA 2JCXA 2RK6A 3NDBB 2IJGX 4YLEA 3RRJA 2YUTA 4JB0A 4LXUA 5AKYA 5FT9A 3GCGA 3AKYA 3W3AH 3L0CA 1PR0A 3A4IA 3MRXA 1VIMA 3UMCA 2DERA 4QAQA 1CUCA 2CJFA 5A9SA 3T1TA 4XYMA 5HQJA 2QRLA 5F5LA 5M34A 1TM5E 3EIQA 1STOA 4TYPA 1M6HA 4YLYA 4EAQA 1E1QA 3DWIA 3EIUA 3PUWA 3ZGZA 4GMXA 3DS8A 1YZ3A 2O3RA 1KEVA 2WNSA 3T3EA 4PBRA 3WGOA 3U4DA 4BV3A 5FEUA 1NR7A 3P2EA 1TO1E 5DHSA 2CFIA 1BKYA 1MOZA 4KQGA 4RF4A 1HX7A 2EF0A 1UQTA 3Q11A 2E85A 3I6QA 4AJNA 1PG5A 3A2KA 3ICWA 3T3MB 1PGPA 2ZTUA 4ZV4A 3CUSA 1LSOA 2H11A 3RVKA 1NJ6A 3LFHA 2I7CA 1D0IA 3RO7A 1XPUA 5BPHA 4DJAA 1OH6A 1DBIA 3IT1A 4Z3DA 2IU0A 1GKIA 4A2WA 1L3CA 3LRPA 1F8FA 4Q66C 4IZIA 2ZJ8A 3KD2A 4A27A 4MYSA 2A9FA 4J2TA 3LIPA 4INJA 4PLFA 3DV0B 2XJ9A 1UDRA 3A14A 3KHUA 5AP9A 2BFAA 1T3SA 3UF0A 1NM5C 1YRLA 5KYVA 5EKSA 3WK4A 3HFJA 5KQGA 4DV6B 3BWBA 4G6ZA 4RQAA 4MUBA 1ZN7A 2ONKA 2ZAOA 3GGGA 3LC1O 2NZJA 4TSFD 1DAIA 8MHTA 3IXLA 1F8GA 1BQEA 3OAAD 2MR5A 2WG0A 2AEJA 3BGDA 3EVDA 2R11A 4B3DA 3HB9A 1MB4A 4EB3A 5F4BA 3OQBA 1UPUA 2FQWA 4XGRA 3DCNA 2WU8A 4LV6A 4ZXPA 2WHRA 2IH2A 1XTSA 1NTRA 4GMFA 1XZPA 4IUDS 1E6LA 1C30B 4TPKA 4PSVA 4U8HA 4BMXA 5IK2D 4C7OA 2R8XA 2RKBA 3QFHA 5L6LB 2NU6A 2HA7A 2E18A 1NNI1 1YZTA 1SG0A 3QLVA 4A2PA 1F0PA 1XJWA 4ZP1A 4BNLA 4EGFA 4RPGA 1JG7A 3I2JA 2W2LD 2ZRKA 4LHYA 4ZOLF 1P4AA 5D51S 1SA0B 1Z0AA 2B4QA 2KMLA 3HJBA 3GH1A 3QI2A 4NBUA 5AHKA 1JVBA 3NJRA 5IDWA 5ALMA 2WHQA 2WOOA 3GRAA 3HEBA 1C7JA 1E4VA 1TCCA 1U8ZA 2HJHA 5L3VA 1V8ZA 3QKRB 4HXYA 5HP4A 4W8OA 4OFWA 1LBQA 5CIWA 1N6IA 3D64A 3QVLA 5JJLA 4KE7A 5EMKA 5FO0A 3ZHBA 3LX8A 2OHHA 1WXGA 3AETB 3UBMA 4AYXA 2CK3D 3MMSA 4HEHA 3SE7A 4QM7A 13PKA 1BN6A 1GKKA 3EPRA 1ZJWA 3TF5A 3W2GA 3W1VA 1PG2A 3HO8A 3M9WA 3LPLA 4B6QA 2RE8A 1GGJA 4CFSA 1CVLA 5SZKB 2GXQA 2DCUA 3H5WA 3Q9LA 1HPLA 1PHPA 2PFGA 4MVWA 4DANA 2A0FA 2GBPA 4ZCLA 1HNNA 3LDFA 1GYPA 3QLJA 1JDPA 4MV5A 4YRNA 2XXBA 2DVMA 4HXFB 3FAZA 4CQMA 2QNIA 2GD2A 4NDZA 1NZDA 2GJ9A 4GKBA 4HMOA 1VCHA 2Z2KA 4MOWA 3CO5A 4DREA 5C8YB 3K9LA 4LOIA 3QVWA 5G0VA 3X1DA 3EF0A 3HMQA 5HE8A 2Y1FA 2XYQA 3KYCB 5JZOA 2IEGA 2D2EA 2IX3A 1TTTA 5KNCD 1N36B 4OU4A 3D0RA 5CA0A 4B2IA 5JAIA 2QJRA 3C6KA 1YT5A 1EK1A 2LIVA 1AGRA 2HDWA 1K5HA 2JVIA 2ZRJA 3PLRA 1WEHA 4LJKA 1TD9A 3E2PA 4OUDB 4YMGA 2ZZMA 3MGCA 1EK0A 1F5NA 5JECA 3JCZA 1UFVA 5LIRA 1WTAA 5BOSB 1I4WA 3EZLA 1MIHA 2HMTA 3BE5A 3HR4A 2BF7A 4BOYA 1SXJB 3GLGE 1C29B 5IYZA 3CCBA 3WICA 3PA8A 4IICA 2O2CA 2J5BA 3PWTA 3EODA 4C7MA 2ZS9A 3FSGD 1BXGA 2JFHA 4CKCB 3K9QO 4C6TA 5IASA 4DDWA 4HJRA 1BU8A 3A9CA 3A70A 1CRPA 5D86A 5ECYA 1XDWA 2DG2A 1ZIYA 1IWBB 3K0FA 4XQGA 3S40A 3K1TA 1QP8A 4AUNA 2A33A 2C78A 1YMVA 2IGBA 2XT6A 3CUKA 3OIDA 2JLYA 2V8BA 4Q03A 1VCIA 1Z9BA 4KRXA 3WB2A 1OWMA 5FBRB 1CB0A 2IY9A 4Q4CA 3LY7A 2WLSA 3UM9A 4RXTA 3STTA 5EMJA 1CCWA 1FDSA 5KOJB 3CRW1 5BP7A 3WB9A 3P20A 3AGQA 4DSUA 4E88A 3W3AA 4WZBB 1J8YF 1EVLA 5LUBA 3PFWO 3U0BA 3JWJA 3KL2A 2D7DA 1RLTA 2QUIA 2YZ7A 5EUQB 4TWRA 3K4PA 4K9KA 4DILA 2J5RA 1IULA 4BO1A 2IEBA 1J0DA 2COUA 3OD1A 1M1XB 3E5RA 1VMIA 1FDUA 3AF6A 3IVAA 4MS4B 2Q49A 1U0RA 4XWAA 3TQHA 3LQYA 1YI0A 4UUMA 5ALYA 3ZEAA 1C7FA 2I76A 3K35A 2Z56A 3GB9A 2C4HA 4KKXB 1XA0A 4KSYA 5K6TA 4TRJA 3TW6A 1P75A 2QW8A 3FTPA 4YJHB 4Z1MA 3LP5A 4DOMA 2JDID 3TLBA 5JC8A 4BJ5A 2RSLA 3BJEA 2Q5EA 4F56A 3UGTA 1BCRA 4D96A 2WYOA 4M7OA 1E9SA 4E1BA 4D4JA 4UHKA 1X1RA 4CRWB 1U2QA 5H1YA 3WK5A 2OKGA 1SU8A 1V71A 4P32A 1Y8QB 2IUTA 1P4HA 3PXUA 6REQB 5F9FA 1DFIA 3R3WA 3EVBA 4PAGA 3ZV5A 4H08A 1DPGA 2YJ6A 2KB0A 4XLLA 2VO1A 3I5UA 4C01A 1O3YA 2AKYA 2RAFA 1GZHB 3EFHA 2VK8A 2F59A 3P0FA 3R6TA 4X71A 1PNRA 1GQ2A 4OQYA 2I66A 3RVSA 4Y2YA 3VR0A 1BWPA 2EC5A 4IKPA 2AT1A 1N33B 2JCGA 1GPYA 1O96A 4ZKDA 1D4AA 1MPXA 3FG9A 1GUYA 2IDMA 1B76A 1R37A 2NV0A 1TFRA 2N46A 3BXOA 4KAXA 4WKGA 2BF4A 4PIMA 3HDQA 5A3VA 1OIVA 4FGJA 4NH0A 3WKEA 3I72A 1EB8A 2ZTLA 3LTEA 3P45A 3V9PA 4JHLA 4EUFA 2ISSD 2GSWA 3IMKA 3R7WA 4YMLA 3Q3CA 3S1AB 3HP7A 3CMCO 3QYPA 1UM9A 1I36A 2GN1A 4OJNA 4O4JA 4R2KA 5IJ9B 1RFGE 1GZVA 2GM9A 2OXIA 2FX2A 1ZU4A 3OKAA 2G36A 2O4UX 4JYPA 2G1JA 2YW9A 1F51E 3QE9Y 2XH8A 1ZI8A 1TM2A 4BNUA 1AUOA 3BSFA 5H3HA 1V39A 4DC9A 1L5HA 4ZHQA 3PNKA 4ALLA 4CDRA 2CXUA 3G0OA 1CDZA 4O29A 1A88A 3IH5A 3L43A 4HQRA 5C7LO 1DDIA 2BCJQ 3ER9A 1PK7A 1QQ5A 4FONA 2ZWIA 1QFYA 4UZFA 1P18A 1XXHB 3AF2A 2XE8A 2AS0A 4KLZA 5T5QA 1S8NA 1HG1A 3G88A 2WWWA 4ZDIA 2NPFA 4QXQA 5ALJA 4HAIA 3V7WA 4O1IA 1F06A 4U4AA 2XD9A 3VZDA 4D82A 1WDLA 3CW2A 4JOBA 5CCEA 4Q37A 4E5MA 2YXPX 1MF7A 1QX3A 1YTLA 4R6WA 3WGMA 3WMXA 4QPNA 4CIAA 1NY5A 1WZEA 3RBAA 2D0OB 4JL8A 5EUCA 3WSWA 2EG9A 1H0SA 1AMOA 2A1IA 3HKDA 3LT5A 4DR4B 1A76A 3RTDA 2G3YA 3ZNNA 4AJ2A 4QPDA 4D0LB 1ORRA 2JGLA 3ZWNA 3FHTA 2ISCA 3AM3A 4OREX 2BRUA 1G19A 7GPBA 2AF4C 4ZMRA 4CMEA 4S24A 2X4IA 2QMQA 4C2UA 4G5FA 1J06A 1K6IA 3R8XA 2FPPA 4BP3A 2AFIE 1AKWA 4I19A 3IIKA 4XJXA 2QN7A 5JBNA 5FQOA 2XNHA 4A6XA 2ADMA 2BC9A 4OF4A 2HQRA 2E4YA 4YPVA 3VR2A 3C2QA 5H4HA 3W8EA 3ME5A 1CS4C 1HY3A 5AW5A 3KRTA 1SCJA 1L4KA 3R3SA 1Y9ZA 3GLQA 3KJFA 4R5MA 3KR9A 1D8AA 1O6CA 3GRCA 3HZHA 4DV7B 4BO9A 3ZQKA 4QBKA 1MX9A 1FZTA 1P5ZB 5LCXA 1WXQA 1T3LA 1ZGGA 3LA6A 4P36A 1ZKMA 1Z37A 2GK6A 3FNFA 1RM0A 4RL6A 3SSAA 4D74A 3KD3A 4EGJA 5BNWA 1GEEA 4GPZA 5HZMA 2H18A 3QVGB 3RYHB 4DJFC 2Y27A 3A6LA 1OE0A 2ZVJA 3PD1A 4NYIQ 4V0RA 2W6NA 2Z09A 2CLHB 5DI9A 4MS3B 1ZRMA 4OQNA 4DLLA 4CR7A 2GCOB 4A15A 2BGNA 4KO1S 1RSZA 3FDJA 5ENZA 4P98A 5FULA 3U7JA 2YQZA 4DYHA 3UGJA 2HJVA 4OXIA 3UKJA 4PHCA 1Q1ZA 1QCZA 3FCAA 3NWJA 2OCPA 3IV6A 6NULA 2DT8A 3ROPA 3LUAA 2V6GA 4CDNA 1AS2A 5HK9A 1E32A 4UE3S 4X1IA 4O2AA 1V6CA 3U5TA 5CB4A 2LNDA 3A4LA 1IQPA 2G6BA 1R6XA 3C98A 3CMMA 5F77A 3ZHTA 1EXDA 3F90A 1IPHA 3BFPA 3NFYA 3BL8A 4WV3A 5H82A 1H6DA 2PH7A 1NXOA 4DEXA 3KQVA 5HGXA 3IUQA 2HLPA 1AUQA 3RUHA 1RWMA 2W6PA 1QUEA 4BVKA 2TECE 2Z1NA 2EZ4A 4XD2A 1W0JA 5EE9A 3ZWDA 3C6ZA 2OAP1 4HDCA 2ZBFA 3IOYA 3NV9A 3CF6R 1AKRA 3ODPA 2EGGA 3KWMA 2JZOA 1NLZA 4TV8B 1RAAA 1RHUA 4NBRA 1S2GA 3B51X 4WDQA 3LY8A 4PAOA 2FFQA 4P7FA 3M4YA 4UMDA 1SH7A 2GWHA 1U2GA 3NEYA 3HYTA 1E18A 1OREA 2H9IA 4MB2A 3F9RA 4OYHA 2J7PD 4UMEA 4E5NA 1KYTA 5T64A 2C2OA 2ODTX 2XRFA 1C7QA 5AM2A 1PTJC 1P1JA 4W7IA 4I81A 1KDRA 1IN7A 3RBVA 4V0QA 2C84A 3AU8A 1L7VC 4NU5A 3BDVA 1TPYA 1GITA 4LY0A 4CKEB 1JG6A 5T6MA 4C4RA 6ADHA 1U2RA 2H57A 4B3SB 1JIIA 1N25A 4C4YA 4CNQA 5L45A 4ZDWA 2CMFA 2V4ZA 4K6MA 5BN3A 1VJ0A 2AVDA 1NTOA 1BVYF 3E0XA 4H4EA 2QE7A 1M0SA 2FR8A 2G9RA 1F2VA 2ZRIA 1ZLYA 3GU3A 3TJZA 4M9SA 4LQLA 5FPYA 2G4LA 2HF8A 3G0HA 1AO0A 3T8YA 2BCGY 4D8UA 1SZDA 4ZGGA 1QG6A 4KLAA 3TTSA 1NA5A 1E5TA 4KX3A 4ZDJA 4QX6A 1I32A 4HXEB 2B9EA 2E6UX 3N74A 3RU3A 2XDAA 1GPH1 3DMRA 5AD1A 1P2GA 2PLWA 2YWCA 2C98A 2P30A 4KFUA 4OPMA 3ANYB 2DM6A 2B25A 2AI1A 5DNDA 4P4TA 4OB6A 4YJ2F 5K01A 8GPBA 4MGZR 5CYGA 4FYPA 4BEBA 5K0CA 3TI7A 4BAGA 1PK9A 3L07A 1E6MA 3LWBA 2PIAA 2OQRA 2BONA 1B6TA 2BR5A 1V16A 3K92A 3MWFA 2LR0A 5FBLB 3SNHA 1Z2EA 2Q5FA 3EZNA 5DYTA 1S1CA 2VLBA 3B3AA 3PQ2A 4N0EA 3SFTA 2HYIC 4MYDA 3FNEA 4NPCA 2CHVA 3O4IA 1NBMD 2VZ8A 2KLHA 5EPEA 4ZYYA 5HJ7A 2GZHA 4NNOA 4KLRA 1I3OA 3LW7A 4MYCA 1MJGM 4BCDA 3N7UA 4KPUA 4GLLA 4IO1A 3JYQA 1DLIA 1G0OA 2B1IA 2NMVA 4RCZA 4RJIA 1V3QE 2LTAA 3JQEA 1PYDA 5CFOA 1NF8A 3DDSA 5EJ4A 1RCFA 3PGKA 1XEWY 3SHFA 5K1ZA 1ADGA 2X2FA 1VLMA 4TLMB 2Q7DA 3HHEA 5FL7D 2JLCA 3TL2A 5H81A 4B6RA 5LQNA 3U09A 2HHHB 2H5JA 5DOVA 4TKUB 4NULA 1VI6A 2I2WA 2L19A 1CJBA 1PQWA 4WKOA 5AM4A 3ULKA 1QYCA 4EJ6A 5FUMA 1ULAA 1X1SA 2FSSA 5CB0A 1XZQA 3R7DA 5M7EA 5GJBA 2JLRA 4NJOA 4W9NA 2BKAA 2JGKA 2IF2A 1J56A 2FX5A 4GS5A 2F48A 4IL5A 1CUXA 1VBFA 2JIRA 3UAXA 3VH2A 4C7VA 2LKDA 4UMFA 1DKPA 3ZH9B 1XAIA 4EY4A 3F67A 4OKIA 3W06A 2JLZA 2GEVA 1LH0A 2Z98A 3KUDA 1CEYA 1KOFA 3FRIA 3VOSA 4JGIA 1ZMOA 2QLLA 3OZGA 4WBNA 2XZPA 4FGSA 4J75A 3SF8B 5D3QA 1E79D 1DBRA 1XZNA 2GLTA 5AW6A 1QYRA 2H2FA 3H6HA 3FB1A 1L7BA 1PDWA 3MHTA 3ZDQA 1K86A 1K8QA 1T9KA 2MOKA 2X7HA 2HMYB 3K1ZA 4O08A 3SF0A 2AOTB 1T6XA 2EKDA 4M9QA 3Q1LA 5EWMA 4QHSA 3ZKWA 1A9QA 4MV3A 3RVNA 4KVAA 4JR1A 5AQEA 3VC3A 5AVOA 5FCDA 2J3QA 4JLNA 2HAEA 3DBHA 1DWOA 4M1YA 4UARA 4TZTA 2ENUA 2NXJA 3F78A 3LY9A 5C35A 4PQYA 3L1HA 4KTVE 1F12A 3C3BA 5L6MB 3O8CA 1NR1A 3BF8A 1AGNA 4DBZA 1AB6A 4H7IA 4QD3A 2R3SA 3UICA 4DDHA 1VOTA 4KR7A 2JFPA 4C5BA 1SCQA 1HYHA 4KUEA 3NTQA 2FH5B 2XB8A 2GXSA 3E9QA 3L8ZA 3QE2A 1H69A 2NIPA 1GU7A 3OU6A 1HF3A 2ZPUA 3IEUA 3DBVO 3AOEA 2W2MA 3BSYA 5JD4A 4ZAFA 3LXUX 1A2BA 4DV3B 4M36A 5ALIA 2EEPA 4HUQB 6YASA 1SBTA 4LRSB 1YHZA 2CLEB 1IVSA 5LN1A 2QY6A 2WMDA 2D00A 3U0VA 1E2BA 2I0FA 2IOHA 3EXFB 4CKWB 4B6PA 1NKVA 2FETA 1IBCA 3L7YA 4I1VA 4U0JA 5E7JA 3WHKA 4BFZA 1SZJG 1IEWA 4CV1A 1ESCA 2ODNA 2RIPA 2CHEA 3OCYA 5TGTA 5I7SA 5J40A 3F9IA 3K1YA 2QY9A 1V1RA 3L06A 4Q3DA 3U3MA 4N76A 3T52A 4JBWA 3N59A 4CR6A 1OZHA 3MJCA 3HHPA 4R31A 3DW3X 3UMFA 1V6AA 2QL6A 5EVCA 1UJNA 3P2KA 2R48A 2BTEA 3TLZA 5DB4A 3FCSB 2RKOA 5DNWA 2C88A 4X62B 1PV1A 4I4NA 5LZ7A 4HH3C 1FPMA 3IEKA 4FGLA 4H27A 4M89A 1BH6A 3OIVA 4RKFA 5HF9A 2WBLC 3TLGA 1IOLA 1ZH2A 4NSNA 4LOAA 2WFZA 3N3BC 1JHMA 1YB7A 3V46A 3IKLA 1KAOA 4IVQA 2PGXA 3W9SA 1JDTA 1ARZA 4FJ1A 4OA8A 1MVNA 2AYXA 3ETDA 3VMFA 3Q10A 3ZY2A 4GOMD 1RRPA 1R18A 2V4MA 5BSRA 3M6UA 1Z13A 5DNUA 3ZI7A 4RTPA 2DFDA 4PLWA 1KEKA 4M9ZA 4KW7A 4N6OA 3SZRA 4R2JA 5JD5A 3IBYA 2RHLA 2WP0A 4L50A 5DX8A 4OMDA 5EXTA 4AMYA 1VHWA 3O5AA 3TQCA 4BO4A 3UK0A 1GTRA 1UOQA 3VHLB 5BPFA 5FOUA 2PZEA 2QRVA 4WXPA 3GLSA 3GCWA 4RVCA 5TMPA 3BMNB 4RPLA 1PEKE 4LWOA 2J9FA 5AKHA 4I50F 3ZQJA 1Y1SA 1QVAA 3CF4A 3JALB 4RF3A 4U2BA 1RR6A 5HF8A 4ZTZB 3TLMA 2HPVA 3A9WA 3GDFA 3ITDA 3BZWA 3AIOA 2QNBA 3JZMA 3K15A 4PTLA 3W8NA 2V98A 1CUHA 3VU1A 4I1PA 2H1RA 1IOWA 4LC0A 3HXMA 1XZDA 2VWQA 1AURA 1JDJA 1FXSA 3FM9A 3GAZA 3IDQA 2DLCX 1YU9A 4WCVA 1G5IA 1O03A 1QIMA 2IT1A 5LZ9A 3DXFA 3OEYA 4AECA 1X7ZB 2PEZA 3NWBA 2IBSA 3I1YA 3V8MA 3SKXA 1J7JA 1NW6A 4G85A 4EY8A 3M6IA 1FTYA 3L1KA 4P82A 4HWOA 3K1AA 4HDSB 4KN5A 2YS6A 2F6RA 2ZRMA 3K2EA 1Z35A 4AUEA 1P81A 1CJMA 2LIPA 4UBJA 4BNWA 2VJDA 3H65A 1W1WA 5DBGA 4B3IA 3BZBA 2W98A 4RQBA 1G9XA 1CE8B 2C58A 2ZBUA 2O06A 4R68A 3GELA 4LWZA 1M2VA 5K8JB 1I7NA 1BU5A 5AVVA 3CV3A 5BQFA 3DL4A 4IEEA 1B8NA 5FI0B 4H7HA 3KEQA 1ZM2A 2JFGA 3SAJA 5KTTA 4A36A 3I76A 3F7MA 3DBLA 3KCNA 3PPYA 4QYWA 3VZSA 4BJ1A 5KDDA 5MN5A 4GZ6A 4YMHA 2NZ8A 4FD3A 1JA9A 4TV9F 2RGBA 1BEUB 2REBA 3JQFA 1JXAA 1ODCA 1N2JA 1SUWA 4COOA 1YFKA 3DH0A 3BK7A 1FYXA 5KJFA 2GYVA 3NYIA 3PA6A 4OGGA 3LDAA 2ZRQA 3OX1A 4RY2A 1WZCA 5AIAA 4RVGA 3OPYI 4ZRNA 3OQIB 3WGTA 1W6RA 2AD1A 2O2IA 3MLEA 4EQZA 1XCGB 1YQQA 3Q7QA 5EIOA 5I4CA 3OCJA 3C3DA 3OETA 5FXMA 4NG4A 2G6TA 2QXTA 4IIEA 3CB4A 1KJIA 2PPLA 1U6IA 1RLIA 3DFKA 1ZKDA 1E3DA 9LDBA 4TL9A 2Z9CA 4NBWA 2CVZA 3JAMA 1M8FA 4XCVA 3MWYW 2HNAA 3HSKA 4PSCA 2JJYA 1R15A 3PDCA 3HEMA 5COAA 5B3LA 4DQDA 1WPGA 2NUPB 4KH1A 3C43A 3ANMA 3R9XA 2OV1A 4QBTA 5JAMA 1JHXA 2AE1A 3C97A 3E4CA 1VG0B 3EHDA 1LDMA 1BN7A 3QIVA 4XA8A 1L9XA 1QU3A 4FOTA 4ID9A 2D1QA 2IYPA 3W7VA 4PANA 4MDFA 3S70A 1HL3A 3MOSA 4JC4A 1YB6A 3DDWA 4ZMSA 2WU0A 2IXAA 2X8BA 1JBEA 4UE6A 1IATA 2HDOA 2QD1A 4C6RA 2A7QA 4FDAA 4V2IA 4XTCS 5EXSA 4YYEA 4IF6A 1UWLA 4RHTA 1CX9B 2PYZA 3A0UA 2TRSB 4TZ6A 2V45A 3ZWAA 2QAGA 4UDYX 4QOSA 2H2HA 2HUNA 2VYFA 3K8QA 1XP5A 2R8OA 4ZPJA 3U16A 3EHEA 3OCVA 5HEKA 2XGOA 3NM4A 3WL3A 2BFFA 2B1JA 3O8QA 1Q0QA 3OJCA 3OJWA 2XRZA 4CQLB 2WIDA 2NQTA 4MVJI 2PPVA 1WCV1 5E6RA 1GWNA 1VKRA 4EBBA 4E3ZA 4MAFA 1GNVA 4KDFA 2V97A 1KSHA 1ZY2A 2JATA 2NV2B 2BKUA 3BTOA 2PUTA 3CEAA 3EMVA 3MWDB 4X3PA 8OHMA 1HE2A 1KU6A 2WNIA 4MR9A 3E9NA 4YO7A 5AK0A 3ADBA 4O2BB 2Y2VA 1VSUA 1G38A 4E15A 2IBTA 2NSJA 5EA2A 1T6BY 2HADA 4REOA 2F3UA 3II6X 4NBSA 1KMIY 4TL8A 4ZPXA 3TUJC 5FBHA 2J3LA 1CYEA 1GL6A 3F7NA 3JTEA 5JW6A 3G0GA 2XW6A 3OT4A 1MDFA 5K09A 1GQYA 2AKEA 3OFJA 3HCDA 4IIDA 2C0PA 2WYWA 3I8XA 1MAHA 3BILA 4GUDA 3HKBA 4K9DA 5LOVB 2NYVA 4FW8A 4GE3A 1ZK3A 4EW6A 4I1RA 2UYHA 3AU9A 3JQAD 3MQ2A 3GJ8A 3LYAA 3I2KA 3UQZA 2PWYA 2JA2A 5DE3A 1KVTA 3H4MA 3ACBA 1I5OA 2IZ0A 3CWCA 2OQVA 4TRRA 1X70A 3FDZA 1C9MA 1EAYA 3PI6A 5CT4A 5AJHA 1VHDA 2X40A 2DHEA 3KQTA 3NHMA 4GBGA 4DLKA 1HNXB 1GDHA 1OA0A 2C20A 3P19A 3NOOA 2HNBA 4FDTA 1EGQA 4ZAVA 4EG8A 1YCDA 3LE8A 4FZ5A 3FW1A 3FKSD 2W6ZA 4PTZA 4L4RA 4X7MA 3SK0A 2X0FA 3OU2A 1MW8X 2C7VA 4P4NA 3KTAA 5ITWA 3WOHA 1DEHA 1T0HB 3AF3A 1G21A 3H2ZA 1MABB 3SQLA 4TXNA 3IBGA 3WYCA 4F3YA 1NQXA 1KMHA 1L4MA 1P4RA 2J1LA 3GZJA 3ZHRA 3CIOA 1TT5A 4DIKA 4DV1B 2Q1UA 4DBLE 3T1VA 3ETJA 3LT0A 1QV7A 3NWEA 4UEQA 2IYOA 3CE6A 3JVUA 4XWWA 1CYDA 1A9TA 3PI7A 2Y4NA 3TPZA 4EG3A 3UC5A 2YZNA 3KEOA 1ZK0A 3GGJA 5D5QA 3QBVA 1WNTA 4Y6OA 4DJTA 5IDXA 3A6GA 4ISCA 3N2NA 1VHJA 2VKQA 2H4FA 1OH7A 1VFNA 4QATA 3TR6A 3I05A 1TO2E 2B7LA 2IYYA 3MIIA 3TZBA 3CUEF 2A57A 2AJLI 5EZYA 2XMBA 2X0RA 2CMGA 2OR3A 1FS6A 1DC4A 4FS8A 1XMQB 4BFSA 1LRLA 5KVCA 5ALXA 1XVUA 3ESYA 4GKAA 5LYYA 5BQXA 1CDOA 2PV7A 1E2JA 1NE2A 4X0EA 3SBDA 4AN4A 5K6AA 2PUDA 1QLHA 1VYVA 2D2VA 1Y42X 2EX1A 5SYNA 2BGRA 5BMVF 2HJGA 1LQTA 2JKZA 2KS6A 4QREA 1Z33A 2VSNA 2ZRFA 2CE2X 4Y8VA 1ZIXA 4KXNA 2MJLA 5DN6A 1YRHA 4WASA 1FFGA 2HIHA 1VSVA 3EZ2A 3SBXA 4MICA 5KOHB 4Y1GA 3WQSB 4ZC8A 1QWSA 2Q6KA 1JEQA 1V45E 3J81A 1FVFA 3AEKA 2Y0EA 4P4SB 3DE7X 5FUQA 1WPQA 3SP1A 2C9MA 1I30A 1OGJA 1R8SA 3IKVA 1SELA 3PZBA 4IBOA 4K40A 1LPSA 1NM5A 1WXXA 3CJQA 4HVTA 5EEHA 5EMMA 4EHNA 3EGDB 1IY0A 4PZPA 3OEWA 5LYJB 3ONWA 3G9QA 3FFAA 1TVCA 2PXCA 3LA8A 1JRLA 2I1LA 5HCNA 1QVWA 3AL0C 1L8OA 4JLSA 1BVUA 5DT2A 4EHJA 1UDAA 1N2EA 1WSWA 4OYRA 4QULA 4R8KA 4C0KA 4YECA 2HZBA 3QGMA 4QYMA 4M9XA 4WCFC 3RW9A 4B3FX 3K4HA 3THWB 4AN0A 2X9NA 2NNWB 1ZGAA 5JT1A 3CQ9A 5KYNA 3AZPA 3WMWA 4D9HA 3I92A 4ZAYA 3ZLVA 4F2DA 4LMBA 1QPBA 1UEIA 1JH9A 3QU2A 3F8WA 3DLIA 4PYQA 3CU5A 2W0SA 5JEDA 4HYTA 2X5JO 5CBPA 5KKNB 2HGZA 1OBOA 3H5NA 4R98A 3PFIA 2V54A 3GDGA 4BO7A 1EWQA 1G9SA 2ES4A 1P6XA 3D6NB 4TYQA 4BNXA 1E3WA 2OG2A 1GRVA 1V9SA 2E87A 4KDEA 5CVTA 3F97A 5J63A 4KO4S 4E32A 4ZFNA 4CIWA 5MN4A 3X1MA 3ML1A 1NOJA 1KNQA 5H59A 3MRVA 4F4JA 3L7NA 2O8CB 3T3GA 3FI0A 3ZKAA 2VTBA 2OQIA 3I9V6 3ANNA 4J2OA 3NWPA 4PZDA 1J23A 2VSOA 4CTOA 5JZSA 2JBAB 1G6Q1 4WLUA 1KDOA 2LVBA 1ZM4A 5LQAA 4JDPA 1A97A 1WXDA 1Z5VA 3OC6A 1JA0A 1MTOA 2FLVA 3C6MA 4ZI7A 5LVAA 1P91A 3NBFA 1OLXB 3NJ4A 4P2GA 2C5AA 1OTXA 4QQRA 2HHJA 3WJ7A 1GT6A 2GVZC 1M10A 3E81A 1CB7A 3TEJA 3V5NA 1B3BA 3RWOA 1UBMS 2YRXA 3FUCA 5E7IA 3ZWKA 3MD9A 3GLIE 5JRZA 5DM0A 1QIDA 4D5EA 3ETNA 3PWKA 2AW5A 1RP7A 2H59A 4RKEA 1EVIA 3AYXB 3E22B 1EUCA 4QZVA 3F73A 5J2UA 3GARA 3AQIA 1JL3A 5JI3E 1ZGCA 5L4LA 3QVOA 4L78A 4F38A 2CC2A 1GRQA 3IX7A 4HDNB 1MAVA 3C39A 1KOJA 2Z58A 4O3MA 3UTDA 4KQIA 4PSKA 2H1HA 3UHAA 5AUPB 2P4EA 3B3QA 1N0IA 3P27A 4JGBA 3VU9B 1E60A 2FW9A 4IX9A 5FPSA 3QY9A 5I7AA 2XKKA 2XF2A 1GQQA 4ZZ2A 5TPWA 3U17A 4CG0A 1MHTA 3TZQA 4B7AA 4GEGA 3B2NA 4Z5XA 3ZZMA 1XPRA 5KPDA 2JLWA 5CGZA 1A8IA 3COSA 3O4VA 5JASA 1YU6A 5K6RA 3HA7A 4JT8A 1BCSB 4V39A 4ERNA 3F4KA 5E4JA 3QEOA 5G0SA 5L95A 5HRCA 1E1MA 2HF2A 4KN8A 2BDEA 2LPMA 5F4ZA 3UK1A 1WZ2A 3FNBA 2P5TB 3HPQA 4ZVVA 2R6GA 4KODA 1TUBB 2ZR0A 4H35A 4B46A 2C2MA 2WWRA 4ZVTA 2ERCA 1OFTA 5KTOA 1DNPA 3W04A 3DLAA 1JE1A 3JSXA 5FHRA 3ZHCA 2OPBA 5F12A 1U0SY 3QSYA 4WOCA 2HF7A 2QDXA 5DCYA 2VOEA 3E7DA 4UVEA 3BFVA 4ALKA 1DMRA 3FPBA 4MWTA 1LI7A 4PIPA 3NFRA 1K7SN 1JKJB 1E62A 4GBMA 2B7CA 3UPDA 4QRDA 1EIWA 1XJCA 1HOXA 1W85A 3OPMA 4K05A 3KTOA 4GOJA 4KC0A 3JQPA 5KYUB 2WKRA 3N75A 3VYSB 5TC4A 3MQ4A 2I6GA 3P4XA 5JD3A 3NXSA 3ZNPA 4NXMB 1Y5LA 3SMVA 2FX3A 5H9WA 1K9VF 4AQ7A 1K75A 3Q6NA 4TT3A 4AS3A 1IY2A 2HJWA 1HEIA 1PLLA 2B0CA 2JKYA 3LX4A 4WKBA 1JI0A 3BJIC 3TZHA 3FZNA 4D42A 4ZOQI 4B85A 1Y8ZA 3LUJA 4CKBB 1BGWA 1E66A 1HETA 1ECBA 2D1RA 1XTPA 3IP3A 4R1SA 3ZIAA 4N18A 3M3PA 2BE7A 4PCUA 1XCBA 4P31A 3UT5A 5HXAA 3B1WA 1S8AA 4IIUA 1R5JA 3OH8A 4QGAA 2R1ZA 2ZOSA 2Q3BA 1UH5A 2VDLB 5M5BA 4GR4A 2G5TA 3PKIA 4MVYA 2FN7A 4MXDA 2BW0A 4MIKA 1WQ1R 3ZDDA 4QFCA 1E2KA 2PWAA 3X1WA 3PEYA 3FCOA 4Y1RB 4Y2VA 3E8MA 4PNHA 521PA 2CJXA 4RH3A 1CF2O 4HWGA 1PR3A 4DV5B 4NPAA 1FLVA 1YKFA 2ZYGA 5H80A 1J1UA 1CTQA 1UOPA 4WEOA 2WAYA 1VTKA 3WJ2A 4O33A 1U4OA 2HRDA 2WMOB 4MITA 2I4TA 2YXDA 4KB5A 4PCVA 4RETA 4UTOA 4EENA 5JH7B 2Z08A 1DEAA 1ZJYA 4C9BA 1XWWA 3IT2A 5CA1A 1X1AA 3OZEA 2BTQA 3GNTA 3PIIA 1KORA 2B83A 3NIBA 5CDUA 1J0CA 3A3NA 4MVJM 3HDJA 4O59O 3FNIA 4LHWA 1G5QA 2BMFA 5REQA 2JB9A 3DAYA 4O25A 4LYEA 1H2XA 4F1WA 3BTUA 3KQYA 3AFMA 2BE9A 1LBIA 1PR4A 4FMDF 1KIMA 5DH9A 2JANA 3AWDA 4ERXA 5AW1A 3BFXA 2YXBA 4ENTA 2C8VA 2W83A 3L2OB 1U7TA 3DZ8A 2Q1SA 3IFSA 4UPVA 5AXAA 3ZE9A 1O95D 4CL8A 3NBKA 3KDSE 5EESA 1POXA 3GUYA 2G7ZA 421PA 1AN0A 2FPGB 2AMFA 2VUHB 3OKCA 4X84A 4I4TB 3VPDA 2GJ8A 4BZPA 2NADA 2HHCA 5HILA 4AXBA 1IN1A 2FXIA 3A1SA 5FA5A 5FR2A 4O4LA 5KTPA 2WB4A 3KSDO 3D6MA 1U02A 3HL4A 1BS1A 4XFKA 1D3AA 5IC4A 5E6SA 3G8AA 1GCUA 2NX2A 2WVHA 2PS3A 3WMEA 4MW7A 4RZHA 1QJCA 4GSYA 4KK4A 4RPHA 4MRPA 4N41A 5JNLA 3N1UA 3GGCA 1P2TA 4EHAA 1XEXA 4RC9A 1RWWA 3QA9A 4CCSA 5K3AA 1K7CA 1QV6A 3RYIB 3USZA 4AURA 3S7ZA 1QQAA 4K6CA 3T4EA 1OV6A 3HO1A 1EHIA 4LX0A 4U5QA 2GJ4A 4Y6PA 4YDHB 5AKKA 3NNNA 1UPBA 3NXKA 1RQRA 3LHKA 1XHFA 3HWX1 3SSNA 5BR4A 3NHLA 1IN4A 4P4LA 2FZWA 1P3Y1 2WG1A 5SZJA 4F2WA 3WYDA 1SEVA 1OC2A 1YZKA 2OLEA 3DYBA 3FVWA 4FDLA 4UBNA 4UPEA 1Z7WA 3WYNA 4ZJZA 2GPBA 3ZY6A 4JJKA 5ILGA 3G3EA 1VL1A 4FC7A 4QFDA 4M1QA 3ZE1B 5BV2P 1E64A 2Y0DA 1FFEA 1QF9A 4Q9AA 4RPIA 1P4GA 1UBHS 3BJZA 2AI2A 3VX3A 2PA3A 4Y1FA 1U2DC 2R8BA 3D7RA 5FOVA 3AUKA 2W43A 3I39X 3MILA 3VQTA 5KEIA 2QTLA 3UZUA 1UFQA 4IMJB 4LHXA 2QG9A 3LLVA 3MB8A 4MR7A 3W77A 4WN9B 1QGDA 2HA3A 4ZQIA 2O8DA 4HNTA 2B82A 3MJ4A 1GQOA 1TEVA 4G3XA 3HL0A 5AI8A 3O8LA 4KLCA 4MQEB 1Z28A 1JB9A 2WD7A 4HLUC 2C2BA 2A94A 1TYCA 3AZOA 3DFZA 3DMDA 3H4TA 4IWYA 3VDQA 1P62B 2HLDA 2YJNA 3I4FA 4AJ1A 1DO0A 3CLVA 3RS5A 5EMNA 1FYWA 4H6PA 4LOLA 4ETWA 4JYZA 2ZSEA 1USKA 1DCTA 2ZRNA 3X1KA 1NI4B 4CKZA 3TS1A 1UMBA 2PGDA 1K2VN 3PUYA 4EHDA 1Q7EA 1YXMA 2C03A 2FG6C 2W6IA 5JMWA 3C1AA 1VZ3A 3KEGA 1OYOA 1E2NA 5FAKA 1AXEA 4BQFA 2PLNA 4ZCTA 4ZC1A 2JAQA 4AK9A 1X9HA 1NWHA 4ITRC 4LDJA 3I53A 1BS9A 2AXNA 1RPAA 2GEFA 2ZB7A 3P5BA 4QVKA 4J6FA 4L7QA 1XX6A 3BKWA 3DHWC 4IXDA 4PAQA 4XAQA 1CNEA 4WMLA 1Z63A 4OH7A 2FZKA 4GL2A 4RK5A 3R7FA 3EGIA 1CJKC 1TFUA 4OU5A 1PT6A 5TQVA 3SZLA 2NUAB 1N5OX 2B92A 2VBIA 1HV8A 2WKQA 1UK7A 1I2ZA 4PQEA 5ETJA 5SV2A 5A3QA 1W1IA 1E2IA 4PC6A 4JUIA 1NVEA 2R1VA 4WVFA 2RC5A 2V65A 3MFYA 1F1JA 4ND1A 1N0WA 1TJ4A 4JL6A 1DQNA 3O95A 3RJ9A 3KPUA 4OGKA 2J0UB 3OLVA 3PENA 2ZE5A 2AJBA 3FLEA 3IO3A 5G53C 4I1OA 3I9V1 1L4EA 1QH1B 3M8KA 2ZDQA 1RLMA 2AFHA 4I9HA 4TXHA 2P9GA 1GZDA 4QPZA 1U3GA 3RK1A 4I36A 3TFQA 4OGLA 2I3ZA 3VHXA 5DYNA 2ZQ5A 4M8LA 1IN5A 4B8ZA 4EG7A 4Q19A 5DWDA 3INGA 4KYVA 5C1DA 4AKSA 1JLMA 5DHAA 1F0NA 1VKZA 3LCVB 3HVIA 1G21E 2IYNA 5KYWB 5TT0A 3CSUA 5CPFA 3QTLA 3FDIA 4OXKA 4R4JA 2Y76A 3ZK8A 2G08A 4AYTA 2I6XA 2JFNA 3W5IA 1T9GS 1BGVA 4JI0B 1PTJA 1Z62A 1XTIA 3GWZA 1PS8A 1XMJA 1JHAA 1JLRA 3GLRA 1Q0PA 1SCUA 5CA0F 2VHYA 4E12A 2YCLA 1MHPA 4Z4IA 3DUWA 1FYVA 5EWJB 2LE0A 3CIFA 3GN2A 1KAMA 2P5YA 1CUSA 2V7QA 3A37A 3MF4A 4DMLA 1Z38A 5CG1A 3NHRA 4BU0A 4DPLA 1BRMA 2FW7A 2YYZA 5ES3A 3BCUA 4MPPA 1YDEA 3CH6A 1WUIS 3GLVA 2OILA 3FAKA 4Y2PA 1PZGA 4LRQA 4BC1A 1H6BA 1QBGA 1QZ3A 2ORVA 4NZYA 4WZ6A 2OGWA 1R74A 4LQ4A 4BBPA 1VPVA 2X6TA 3MCVA 1GU1A 2EXXA 2YZ2A 2Y66A 3AT1A 3FIUA 4E11A 4A0FA 5LR6A 2R7NA 3GJ4A 4FD2A 5KHAA 3LBIA 3VTKA 1O9HA 4LA4A 1OBVA 3HE3A 2PLRA 4MSUA 4ARZA 1V7CA 5EXEA 4YJKA 1GSHA 3G8DA 3RD5A 1DUIA 5KYKA 2O2YA 1A2OA 3EA5A 4BQEA 4Q0MA 2G88A 3LUBA 2WKPA 4Y9RA 4NU0A 1ZA2A 2IPNA 1ZA1A 1C0PA 1QQ7A 2WHYA 4HCJA 4BGUA 4F11A 1T0UA 4IYRA 1PGNA 1Y1QA 4UHBA 1RIFA 2AN3A 3ZDZB 1IWOA 4LRUA 4YUZA 4IOKA 2YBDA 5DYWA 2LZ0A 3EVGA 4XWYA 5B7GA 3PDWA 4GXRA 4YALA 4C5AA 2YWDA 1R12A 2YH2A 2CV1A 3A1TA 3IEMA 2BMJA 1C9NA 1PKXA 3DP9A 3GJRA 2HSGA 5JROA 1EA5A 2I7XA 4IYJA 5JR3A 2FTKE 4HNSA 3U19A 4QG7A 2CWDA 2EDAA 3ES9A 3FR8A 2EYQA 1HG0A 2HQ1A 4Z8XA 1C7ZA 4RKWA 2PV0A 2YL2A 3DLBA 4CIYA 3V9AA 3V7NA 3OZIA 3AEYA 4E5UA 4LXHA 5JSUA 1ZNYA 3D59A 2X5KO 3QVUA 5LDHA 4LCBA 5C3UA 1Y3IA 1RIIA 5K99A 5HRUA 5JCOC 1XNQB 2HSZA 4CLHA 5J59A 3A6EA 2ANBA 2NQ8A 4E30A 1UC9A 1M76A 1TOAA 2NO6A 3RH0A 1T4DA 4GR9A 4DMRA 5JQGA 1L5MA 2KBEA 3ZLBA 4V1CB 1V5GA 3BIXA 3QHAA 3FPHA 2AN5A 1SUSA 1Z83A 1Q0HA 1NVBA 2IYZA 2R2AA 2H85A 2W6CX 3NAGA 5PGMA 1FQJA 1UXOA 4PYMA 4QGHA 3EIXA 3QTBA 4TS9A 5A0FA 2IZ7A 4ND4A 1QYVA 2V55B 3JQBA 2G06A 1RJDA 1EX7A 1Z26A 2W4QA 2I62A 3PJGA 3W2FA 2WUFA 1MH9A 3DNFA 4I9NA 4J1TC 3X1ZA 3IUYA 2YXLA 4V3CA 4LDAA 4D3SA 1T4MA 4JI3B 3UO8B 3EZYA 4UVDA 1RXCA 1W4LA 3BQNB 2Z2YA 2E89A 1DKRA 2A78A 1CJCA 2C3MA 3KHTA 4H4CA 3FYUB 4Z8YA 2OP0A 1TE2A 4ZCMA 2H52A 3JAKA 3SIPA 2SKCA 4HAYA 4V0LA 4RULA 4YS6A 4R69A 2BFEA 2CJYA 2MT9A 2B5VA 1D5CA 3UENA 1XJ0A 3PTAA 4MKGA 4OMCA 3BK2A 3BK1A 3PFFA 1NIJA 1NMXA 4O4JF 4WH0A 5EE0A 1S3SA 1FP6A 2WJ4A 3KB1A 3ZIUA 3L7AA 4ZI2A 2VKTA 4ZIRB 1SNYA 2H8GA 3FKJA 3SN6A 5I3ZA 2VK2A 4R54A 2XKJE 3ZWMA 3KS9A 2PS0A 1T9BA 4UREA 3Q8XB 1WAMA 1R4NA 4ADSG 3FNQA 1HOTA 2PE5A 1N5JA 2CBXA 2VXCA 3OY2A 4P0QB 2SHKA 5GM1A 5LM3A 1HQKA 2XB4A 2HTFA 2VZ0A 4E7PA 3S3TA 5K20A 4RTRA 3PHHA 3I9KA 2GAJA 4KNYA 4O5AA 3X1YA 5CCXA 3L4KA 4L85A 3ENZA 4IJUA 2DQYA 4JXXA 1YACA 1FLAA 1ZUNB 1GKLA 3DUFB 3I0MA 4M46A 4CF7A 4W5OA 2DH6A 2D7CA 3UTCA 4GBJA 3ASVA 3AUUA 1TLLA 1RYYA 2HK8A 2RH8A 2WM8A 3LX6A 1S2NA 4Q9DA 5LA6B 3KOYA 1F0YA 3VFDA 2J3DA 4GKJB 4L6CA 3GNSA 4HNQA 4ZVPA 1ZH0A 3OM1A 1NOIA 4IVNA 4B4VA 3UJHA 3V48A 1BJRE 1MB0A 3U5ZB 1X7WA 1P1RA 3QJGA 3QUSA 5GPBA 2IKSA 3ETGA 3T61A 2B1RA 1CW2B 2CNLA 2ZRHA 5KMGA 2R7LA 5LUAA 4EO9A 2O3JA 2ODPA 4HDOB 4HZUA 4NAHA 1Y63A 2JK1A 3RYCA 4C0XA 5DTMA 4A73A 3T34A 4JUBA 4I1SA 4QG3A 5I7WA 3L7DA 4ZCQA 4W1SA 3EC7A 1ZL2A 1FSZA 1ZXLA 4RU1A 5CM8B 1S8OA 2WSYB 1H66A 3OZSA 4PNPA 1GUAA 2D4AA 2Y8EA 3ABZA 4AS2A 1TD1A 3IKJA 1AZLA 3NLLA 4KWEA 5JNTA 2ZAGA 3QUAA 3DHEA 1Z36A 3GH3A 1PCXA 1A9XA 2AMVA 1HEYA 3EPPA 3RT1A 4LFAB 1C3VA 2H1IA 5C1OA 4OYLA 1A8HA 3H11A 5E9QA 3JW8A 4ZRDA 1TU0A 2PX0A 1E9BA 1WQ3A 2Z1MA 3OZXA 4HLDA 1XQYA 1DRVA 2OLJA 4E31A 5B6IA 2IQIA 1EVYA 3IQGX 4L07A 3TLCA 2IL1A 3KAPA 5DGIA 3KKPA 4ENPA 3AHCA 5JI2E 3DYVA 3JATA 1F4PA 2JLSA 3ZTYA 4P80A 4JD5A 5F52A 4E2ZA 1T43A 1L3IA 4OHFA 2XIJA 4QODA 4EB6A 4OXYA 3G02A 4WWHA 4I66A 4FMPA 3AIKA 3ZN2A 1ICIA 2SKDA 3FDFA 2HRCA 1CR4A 5KJEA 5P21A 1N2ZA 3RG8A 3RUAA 2ZZKA 2OZLA 1UEJA 4MMYB 4F1JA 3A1VA 3TAXA 2C1XA 2PZBA 1UBOS 1DTWB 4HDKB 3FWKA 4G0UA 3L9XA 4EQ6A 4GM0A 2WIGA 4O2AF 3KIPA 5CB4F 2JAXA 4DB2A 1NOKA 1M0WA 4KL8S 4MWCA 1BD4A 3TSAA 2XCQA 4AX4A 1TAGA 2ATIA 2BFBB 1GR0A 3DKPA 1A9ZA 5EIAA 4C7JA 3U7EB 2OOKA 4K0RA 4Q16A 1JFSA 2P65A 2WU3A 3DLTA 1J49A 3QG5A 3TW8B 2W00A 3C5VA 4NCHA 5JPDA 5J1SB 1WDWB 2QNRA 1Y7TA 1IZYA 3GCZA 1PFQA 4QDOA 3ZVLA 6AT1A 2UVQA 3OF5A 3OICA 1H1LB 1Q57A 3WZ2A 2DBRA 3PUHA 5K7SA 4HY3A 5TF4A 1YVUA 2OD2A 5HSGA 1UPAA 1GCIA 3R7LA 2J9GA 1XKLA 2P11A 4C6HA 3CX4A 1Y3HA 1HRDA 1CJUC 1UQRA 3WWEA 4HK4A 3VV2A 1EFAA 2BBWA 2F43B 3L0PA 3WS7A 3V80A 5F9MA 4X1KB 5LQMA 2JJ8A 1TTHA 4JLAA 3KSZO 2Q4BA 1OFUX 2DPGA 2NZVG 4Y6GB 3U39A 3IA2A 3NRCA 4RZ3A 1RWXA 1XDUA 1T9CA 2IHNA 2A5YB 2VT6A 2UZ0A 3IC5A 3NCHA 1OXSC 1HLDA 4P8RA 1W34A 5CX4A 4N49A 5D85A 2AUTA 1V3UA 3WGUA 4PN7A 3EXEB 5DEOA 4RK4A 4U7DA 4PYLA 2ZM6B 5F9HA 5EWLB 5KO2A 1LLFA 4KNVA 1ZCBA 2YIJA 4WESA 3RRZA 2O20A 2P2YA 3GEBA 4N8DA 1UR5A 1IL0A 5A4IS 3D6TB 3NS7A 2OGTA 5DSTA 5L4NA 2HU5A 1A27A 2GD6A 3ASYA 5FBQB 2F4NA 1KI7A 3TN7A 1LS6A 1I0LA 2VA8A 1E7SA 4WLVA 5JC1A 2E5LB 2UZ3A 2E4WA 2FOIA 2J9RA 1RZUA 3FTNA 4YP5A 2X58A 3JARA 3WDMA 4L2IA 4BFLA 4E33A 1W5TA 2XOEA 3DO6A 3CO0S 1W5FA 4LRXA 4M1TA 3LUFA 4GMGA 1TC1A 1Z25A 4BWVA 1WD7A 1YZFA 4JU9A 1KMCA 1RJFA 4JH0A 3SYTA 1DKQA 4I55B 1JXQA 1JQ3A 4KIJA 5TQ0B 1JU9A 4EYGA 5E3HA 1X13A 1RYZA 1MO5A 3PNSA 4HT3B 1PZXA 2H06A 2XMQA 4RVFA 3RI3A 2GM3A 1ODKA 1VPEA 4P7GA 2R86A 3H8SA 5EERA 3WGLA 2O19A 4F4UA 3WTCA 3ZY4A 1CU1A 1DI0A 2W2TA 3UCFA 3D4BA 4DLVA 4NCBA 1VMEA 3MT7A 5I7OA 2FWPA 2QGNA 4YDSA 1CQZA 2F9MA 1XYYA 4Q39A 4UW9A 1H2HA 3FPKA 3M6WA 3WRXA 4I6JA 1P5RA 4EUEA 4CMIA 2DEUA 2XCUA 1ZAKA 1K66A 1LJ8A 4DLWA 2Q1WA 5TEVA 3TIXB 1X1QA 4CZ2A 4ESHA 3GX1A 1ORIA 3KKQA 3N5CA 2IYEA 1E2DA 4PFSA 3G8YA 2C95A 3VZBA 3LLCA 4LK2A 3A3YA 4LYFA 2NO5A 1OZAA 4Q4AB 4UQLA 2ZJ3A 3V97A 2Q5QA 4GT1A 1QIHA 4PHFA 4PO1A 5TQJA 1USGA 2GVDC 2V8OA 3UPTA 3K05A 4QC2A 3CT6A 2XMDA 3VMMA 2P5UA 1BA3A 3AJ8A 1E61A 3P9RA 1QUFA 2B98A 4MK4A 4LI3X 1C0IA 3JRNA 3OZFA 1WWKA 3B52X 3PNMA 2QSYA 3RIXA 1DRWA 1R4AA 1CERA 1QK4A 2WIBA 1Q5PA 2QT0A 2XA9A 4JI4B 1K9SA 1RQLA 3GUVA 5EP2A 2OCIA 2AZ4A 3EG9B 3FYHA 4MAMA 3VKHA 4TZ0A 3DHNA 1VRVA 4JVLA 2WJVA 2FW8A 2YCBA 3ZD8A 5ECDA 5BSMA 3EAGA 4IMIB 4BX3A 2G40A 3CJTA 2ST1A 4FB4A 5KJCA 3H1EA 3IQZA 4RDCA 4HVCA 1ZDMA 3NOQA 1Y37A 1OJ7A 3RVBA 1FC0A 1ZWKA 1QOZA 2M6SA 4WBNF 5BR8B 2QTMA 4HGNA 4YJ3A 2DR3A 1C0LA 1V7QA 3DZCA 4PG7A 1DHRA 3FGOA 3QZUA 1ZD5A 4IJWA 1KYXA 3UHPA 4DCOA 5JCJD 9MHTA 1DIRA 1BVHA 1XL1A 4G1UC 2VBCA 2MYTA 5K0NA 1NXXA 1RM3A 5EJ5A 1PEYA 3QKSB 2OL4A 1W2WB 1W581 3QRWA 3NT4A 3PGLA 2XZOA 1W9HA 3Q0IA 4QM6A 4H60A 4PLZA 2J09A 2AFHE 3G5MA 1PO7A 2IXTA 4DPKA 4QBGB 4YVFA 2OHGA 4D79A 4R1MA 2IS4A 4TT8A 3CNHA 4BVHA 4CL0A 2YFQA 3ONNA 4MRRA 4FYYA 4AWXA 3GN1A 1X80B 4GZ5A 1BX1A 4CEHB 3T5GA 2JGDB 3PLNA 2EKBA 2OCGA 2RGAA 2VHJA 2VJLA 3KBOA 4GYKA 4JY7A 4ZOCA 2YVLA 3OZ7A 2IITA 4DM3A 3F3YA 2HFKA 2H31A 2WINI 2A4MA 3CJRA 3FHCB 3QNUA 3WKBA 4KXMA 1LFDB 4F96A 3UUFA 3HYCA 1N6PA 3QPDA 4KEAA 3VO1A 3TO5A 4WJLA 2G76A 3BRQA 3JQRA 3QOFA 3T3OA 3IERA 4TVBA 5LP6C 1A0OA 4GH5A 2D2FA 4AULA 3DF9A 4IINA 1EESA 1WCIA 2VUSA 1Z6YA 3QV2A 2H4JA 2I9KA 4KRGA 3H16A 2GEBA 1LDNA 2HB6A 2IHJA 2PLFA 3S2ZA 3O1HB 3HWRA 4F5DA 1M1NA 3DDHA 1SK9A 4HB3A 1PR1A 2Z4SA 3LVQE 4JB8A 3ZR4B 4DAEA 5KNCH 1J90A 2IF0A 5CLHA 4F6CA 4NX2A 1JLLB 1OY1A 4BRSA 1Z22A 4P5DA 1LI5A 1DDOA 4GDMA 4GYYA 4OSPA 5BQPA 1BAPA 1K6XA 2DY0A 4QE3A 4UC0A 5CX1B 3TWOA 3V2HA 5K9ZA 2BKVA 2Q29A 1JFFA 4X8MA 1SBHA 2BDUA 2MINA 4FFNA 3E2MA 4ALJA 3BC1A 3OE7D 3BD7A 1G8JA 1FQWA 3KZVA 5KCZA 1CIVA 4ZT3A 2IWHA 4PZ0A 2VXBA 3D3WA 3MS7A 3S5UA 3VU8A 1U0LA 1WBDA 1KARA 5AHXA 2YFKA 4IIJB 2IKQA 4B3JA 4ZA2A 4HV4A 4RUKA 3O90A 2CVHA 4FK8A 1KSFX 1E3SA 1XWFA 1Y6QA 2XUDA 3BFJA 3LWDA 3LLSA 1NUAA 4MYRA 4R3UC 1O94A 2R4TA 4YHHB 1CV2A 5DHPA 3CVOA 2E4UA 2ZUUA 2BFPA 4D2IA 4IGKA 3ANLA 1NF3A 2ZWOA 1K7XB 5I9SA 3TTVA 1OI3A 3ADDA 4HKTA 1POWA 4AF8A 2GYUA 4WCFA 5GONF 5KJ1A 3BXXA 3TOCA 1P74A 3KP1A 3P0JA 3BIFA 2CZCA 1TKBA 4HS9A 5SZIA 1Q11A 3BJRA 2BGJA 5I47A 3DE2X 4QICA 2C5HA 2OV2A 1JAYA 1KR2A 2Q3JA 2QTRA 2Y1OA 3MPUA 1Z2AA 1W36D 5KDLA 1P72A 3KOZA 1YQXA 2F67A 3KKMA 1R6VA 1WOMA 4GFDA 1E7MA 4QELA 3VKUA 4MUKA 1U63A 4LVOA 2PD4A 4OIFA 2QUAA 4R0VA 4KRYA 3GJ3A 3WLNA 1SXIA 1Q6YA 2GBLC 3INYA 4J1SA 2G9NA 1PUXA 5KYGA 1EH5A 1Q12A 1PFKA 2C82A 1QQTA 4FN4A 4WD3A 1CETA 4WADA 1ETUA 5M04A 5HNKA 1U6JA 1JQKA 4HGQA 4N6GA 2JI9A 1KU0A 1U6KA 2DHQA 2EV9A 4L8LA 4LDPA 1DVRA 5IEBA 5T6BA 3RRXA 1P4SA 1L5FA 1RT9A 1ZD4A 1V1MA 4JBIA 4P7KA 1CVIA 4FZJA 4YJGB 3WRVA 3ISTA 3FUUA 4DA6A 4PFKA 3TD6A 3N0VA 4DAOA 1NLFA 2WICA 4JDUA 5AI6A 1Q50A 3O83A 3HWSA 4ZO9A 4B6OA 3ZWWA 4QAJA 3LKVA 2FN4A 1S96A 4AP5A 4ZKEA 3K9GA 1YS4A 5A7HA 4KFRA 1CNFA 1CY7A 2JRCA 2ZXEA 2XVYA 3K0CC 3M4NA 4HB2A 2JI4A 4RW0A 4HFJA 4J94A 4F5WA 5GY7A 1II0A 3BE6A 1W5EA 1I9CA 3PXCX 2I4RA 3DSRA 4JJIA 2VHWA 2MTBA 1C8KA 4MB6A 5CTAA 1V43A 4JLVA 3OAAA 5CAEB 4KUGA 4FOPA 4LSGA 4R1PA 3T35A 1Y80A 3TRHA 3UAWA 3V2IA 5BN4A 2H2GA 4RLHA 1IXYA 4RL4A 3FBTA 3L7LA 4EI7A 2Q8QA 1EP1B 3L84A 1ZD3A 4GU5A 2GUWA 4LKOA 5DU2A 5ED0A 4D4LA 5AVYA 5KSWB 5BNIA 3DTYA 3QMWA 2PKCA 1S0UA 4Z1OA 3COJA 2OCKA 1KVQA 5HS6A 5IK2A 4R5HA 1C7IA 4ES6A 2CLMB 4YRPA 3NVDA 4XJSA 4QT0A 1W96A 1W5AA 2ORYA 1HDOA 1PJ4A 4WX2B 1LVGA 1WG8A 1ZI6A 3LKBA 3QEKA 4IKOA 3X3HA 1TADA 1ZBQA 1HMPA 3LAWA 4KAAA 5DX1A 2W2LA 4BEJA 4CL3A 4EPRA 3EPKA 3VR3D 2HA2A 1GUZA 4ID3A 1W52X 2VC2B 4K9NA 4B7XA 5JTUA 2D1TA 2FZEA 1KEUA 2OP1A 4YQEA 1E2FA 3CLTD 5D00A 5JSZA 2XUAA 1WDKA 3FBWA 3QF7A 1R4MA 2CDAA 3ABOB 2PZAA 1HT0A 5HUJA 2XQJA 4DDTA 4ARVA 2EFYA 3KR2A 1L7QA 4QYXA 5FJIA 5BQ3A 4JB3A 5IN4A 1N6LA 1I14A 4ZYVA 4JQOA 4S2UA 3QHQA 4YAGA 4KRFA 3FLMA 4QDUA 2CK3A 2UKDA 2E7ZA 1PJ2A 2VCHA 2YNMD 1S8FA 2Q3EA 3KWFA 5A3RA 1HEUA 4OO3A 3HXQA 1KP2A 3ZV3A 3A9TA 1EAMA 1G63A 1S89A 1RPTA 2WT8A 3HGMA 4G9GA 3G7UA 4QXPA 5AJYA 3VSEA 1EP9A 4C3VA 5KWEA 1VIAA 1ZG3A 1B2LA 5A6VA 1IB0A 4TGLA 4IWXA 1I3MA 3M82A 3ET5A 4J0CA 1PWEA 4Y9UA 3DT9A 1XXLA 5JAHA 3K6SB 4A1OA 1QHIA 2GBIA 4WGGA 1Z08A 1ENZA 3O47A 1TK9A 3UWDA 4BLOA 4JEUA 5K2OA 4D0GA 3UEOA 1RCUA 1AQJA 2ECFA 4AROA 1P2SA 1L4YA 3HY4A 3FOZA 1GRCA 2XWBF 3H2BA 3HN7A 4ZARA 1KWKA 5T4EA 1BD3A 2X1LA 4IM7A 4HAVA 4JBNA 4E6PA 3B9PA 4QIHA 1U99A 3R0QA 2O54A 4JEMA 4G36A 5H7XA 4RAOA 2PKEA 5HS4A 3C16C 3HM2A 2WJJA 2GZAA 4OHBA 5E0KB 5JFTA 2YICA 2VRCD 3KOOA 5C5DA 5A4DA 2GEKA 4BLVA 3PD0A 5IC5A 3LCUA 2VNIA 2CW5A 3AOGA 2VBGA 5GQSA 3RUCA 2GB4A 1YCGA 2GXUA 4L16A 4LGMA 4OHOA 5BUSA 3L6RA 4JQCA 3GRPA 3REGA 4LHEA 4M0UA 1QORA 4BFCA 3Q3JB 3D3JA 2O7SA 2PX6A 2P9QA 2YIMA 2ZB4A 5DHRA 2JFWA 3MUFA 2PIDA 4NMXB 5FWXB 1Z29A 4KVZA 4AX8A 5JVDA 3E7FA 5F33A 4BX8A 3NBZC 4XASA 3DA8A 3RTAA 4AJ9A 1ZVJA 3COZA 3S1SA 3PQCA 2VJOA 2IHZA 2RCNA 4B44A 3LL4A 4NE7A 1F2UB 4URUR 5GMOA 1GR1A 4A8JB 1X7YB 3LQ4A 1NNLA 3IIIA 4HBGA 2AEEA 4M1MA 1BQ3A 3LD9A 1IJEA 1DAOA 1QO7A 1VZ2A 3WSVA 3U6KA 3LPNA 4FW9A 1EFKA 2BHTA 1GPDG 2PU7A 1V2GA 5KTRA 4IUYA 4IRMA 2P9FA 1GAWA 4EELA 2QPOA 1K0FA 4E03A 1T24A 1UJBA 1YIDA 1Z18A 1BXZA 2BR3A 4MUYA 1DT3A 5CFRA 5EJIA 2Q2VA 1FUYB 1YK0A 4IO0A 4RGQA 1D1SA 1OI2A 3BRCA 3T0IA 3V55A 3RASA 4BWGA 9LDTA 2FMKA 2D13A 1NU6A 1XIVA 2BEJA 1J9ZA 3ITEA 3GPDG 4RGYA 3KL4A 3AUYA 4FMCB 5BR1A 5BNZA 2POCA 3C24A 3USES 4XX0B 1VBNA 3Q3GE 4HR7A 4D4GA 1L8XA 1D2GA 2CFRA 2WTMA 3ELWA 2FR0A 4HQ6A 4LYAA 4OBWA 4TROA 4U3JB 4X00A 3RV4A 3V6MA 4C88A 2X0JA 4EITA 3GDWA 2YVUA 4BAUA 2ADOA 3B1VA 3EBOA 5JAPA 4AG5A 1PR5A 1EFDN 2GBCA 2OGSA 2PT5A 2X22A 3CVJA 3I28A 3RR2A 1T5OA 2TYSB 2HXSA 3AETA 3GAAA 4K26A 4IOJA 2R4QA 1VLVA 4HEJA 5P8WA 3T7KA 1SHZA 2G80A 3UMGA 1ISHA 1GXSA 2R00A 4W5WA 4ABYA 1CVRA 4G0XA 1QIIA 2ZJ1A 1GUBA 3F6RA 3QU5A 2NOAA 3I3OA 4YP6A 3VO8A 3ZLTA 2IV3A 3KYDB 4DMUB 1IOZA 3HFSA 2PL3A 3Q7PA 4F8EA 1E8DA 4JJAA 1G8PA 2H1SA 1M83A 1X9IA 2C5BA 2H4YA 2L42A 1G3RA 2X6RA 4BHTA 5FWYB 5B4TA 5AVQA 5DTQA 4BXOB 3ZV7A 4A91A 2QPLA 1JNYA 2QM3A 3QWBA 5C8YA 3PRYA 4A4DA 1RI4A 2B4AA 3X44A 1WVGA 2QYSA 2RGDA 2X42A 4HAOA 3L6OO 2I4LA 4UMVA 4DMHA 3R9IA 5TEWA 3Q1KA 2AG6A 3ND7A 3WE7A 3CNOA 3KYCA 1Q1AA 5ADHA 3JPYA 3VR6D 3W2IA 5HDQA 1KDPA 1KERA 1TGYA 2KJQA 3THYB 2JARA