4I2VA

X-ray structure of the unliganded uridine phosphorylase from yersinia pseudotuberculosis at 2.12a resolution
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
250
structure length
250
Chain Sequence
SDVFHLGLTKNDLQGATLAIVPGDPQRVEKIAKLMDNPVHLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGVRTFLRIGTTGAIQPHINVGDVLVTTAAVRLDGASLHFAPMEFPAVADFSCTTALVNAAKSVGATTHIGITASSDTFYPGQERYDTFSGRVVRHFKGSMEEWQSMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNEETMKATESHAVKIVVEAARHLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine phosphorylase
publication title X-ray structure of the unliganded uridine phosphorylase from Yersinia pseudotuberculosis at 2.12A resolution
rcsb
source organism Yersinia pseudotuberculosis
molecule tags Transferase
total genus 77
structure length 250
sequence length 250
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2012-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4i2vA00
5CXSA 3NBQA 3NM5A 1A9RA 1PR4A 1RXYA 5IU6A 4M1EA 1Z39A 4TXHA 1ECPA 1CG6A 3UAYA 4DABA 1JE0A 1OTYA 1T8RA 1Z5NA 4LKRA 2OC9A 1V3QE 3PNPA 4DA7A 2AI1A 4K6OA 4DAOA 1B8NA 1PR6A 2AI3A 2I8AA 1YRYE 4PR3A 4D8XA 3F8WA 1V2HE 3O4VA 5FAKA 5K1ZA 3UAWA 3FB1A 1TGYA 4H1TA 2HN9A 1T8SA 3DDOA 3OZEA 3OZDA 3EEIA 3P0FA 4F3CA 2AC7A 4P54A 1A9TA 3GGSA 4L5CA 4F1WA 1OV6A 3OZCA 4R31A 5EUBA 1NW4A 4OEHA 5CCEA 2P4SA 4DANA 1PK9A 3K8QA 4KN5A 4QARA 4TTJA 4MCIA 1C3XA 2GUWA 4JP5A 2IQ5A 4QFBA 1JE1A 2Q7OE 3LA8A 1A9PA 2OXFA 3E0QA 4JWTA 4L6IA 1RXSA 4QEZA 2A0YA 3FAZA 3K8OE 3BJEA 1U1GA 1Z38A 2QDKA 2QTTA 1Z34A 4OGLA 4F2WA 3OOEA 5DK6A 2A0XA 1RYZA 3GB9A 1YR3A 4WKBA 2HSWA 4D8YA 1ULBA 4GLJA 4X24A 4M3NA 1PR5A 4TXNA 1T8WA 3PHBE 4D9HA 4TXJA 1I80A 1YBFA 3DPSA 4LZWA 1SQ6A 2QSUA 3DF9A 1Y6RA 5F73A 1SJ9A 3C74A 3UAXA 4U2KA 4YJKA 4YMLA 3EUEA 1RSZA 5EFOA 3FUCA 4M7WA 3OPVA 1VHWA 2BSXA 4G8JA 4L5YA 4F3KA 3BGSA 1A9SA 4EARA 1JP7A 1LVUA 5F78A 1N3IA 3INYA 1PF7E 1ZOSA 3IOMA 3BSFA 1Z5OA 1ZL2A 1ULAA 5F7JA 4DAEA 4D8VA 1SD1A 5B7QA 1TCVA 1YQUA 2B94A 3T94A 4IP0A 2XRFA 3SCZA 2ISCA 1JDTA 4WKNA 1VFNA 2ON6A 2OC4A 4R2WA 4TTAA 2HRDA 4EB8A 2PGAA 4LNAA 1K3FA 4NS1A 3MMSA 1JDSA 3U40A 4TTIA 3BL6A 1XE3A 1V45E 4L5AA 3KUKA 3KHSA 1YQQA 4R2XA 1NC1A 3LBAA 4YNBA 1B8OA 4G41A 1LV8A 4TXMA 5C80A 1RR6A 1PWYE 4I2VA 4MCHA 5KB3A 1WTAA 2OECA 1ODIA 3UT6A 1VHJA 5F7OA 4OJTA 4WKOA 1V41E 1OU4A 1A69A 1LX7A 1RFGE 4E1VA 4ECEA 5CCDA 4NSNA 3NM4A 4DARA 3UAVA 1SD2A 3OF3A 5CYFA 1ODKA 5I3CA 1RXUA 4PNPA 3TL6A 4D98A 3OOHA 5CYGA 1CB0A 1U1DA 2H8GA 3EUFA 1OVGA 4LNHA 4JOSA 5EPUA 4BMXA 1U1CA 1U1EA 2QTGA 3PHCA 5IFKA 4GLFA 4GMHA 4RJ2A 1PR2A 1TCUA 3E9RA 5ETJA 4TXLA 5JPCA 4NY1A 1ODLA 1V48A 2I4TA 1T0UA 1Z35A 3ODGA 1RXCA 3PNSA 1Z37A 1PK7A 2QPLA 1OUMA 4BMYA 1JYSA 4TYMA 3OZBA 1QE5A 3LGSA 1A9QA 4BMZA 4QASA 1PBNA 2RJ3A 1TD1A 3IEXA 3QPBA 1Z33A 1K9SA 1U1FA 4DA6A 1NC3A 1JPVA 3NM6B 2AI2A 1T8YA 3P0EA 3KVYA 4G89A 1Y1QA 5B7PA 1RT9A 4TS9A 4OGKA 1JDVA 1Y1SA 4OY3A 1Y6QA 1Z5PA 3UAZA 1A9OA 1RCTE 2A8YA 4WKPA 1K27A 4LDNA 2A0WA 3D1VA 1PR1A 3KVRA 1V4NA 4BN0A 1PW7A 2HWUA 4L0MA 3OCCA 5B7NA 3DJFA 4FFSA 4DA0A 3O6VA 1TGVA 3EMVA 1G2OA 4DA8A 4TS3A 5F7ZA 4QATA 5CXQA 4MARA 3DP9A 1Q1GA 3E9ZA 1Y1TA 5B7GA 4F2PA 4OF4A 1Y1RA 5F76A 1M73E 4QAQA 4YO8A 1PKEA 1ODJA 1OTXA 4GKAA 4UC0A 1VMKA 5F7XA 3FNQA 3FOWA 3ENZA 3MB8A 4WKCA 1PR0A 3FWPA 3ONVA 1Z36A 1FXUA 3KVVA 1JDZA 1JDUA 3KU4A 5F77A
chains in the Genus database with same CATH superfamily
4LJ9A 2NNLD 3ZY5A 1Y4ZA 2WTXA 3M70A 2PE5A 4PIMA 3RT1A 1OZGA 2WI8A 4Z4CA 4RMHA 5I8PA 3JR7A 3QLUC 4O0LA 1WZ2A 1H2AS 1G98A 1O8CA 4MYTA 4R8RA 2FJ0A 3OQ6A 3BTUA 4JYCA 4UMFA 1P9RA 1C1XB 3WRVA 3K5HA 1X94A 3RJ9A 2EZ9A 2Y93A 2ZETA 1AD2A 1P0MA 3MJCA 4HC4A 3VA7A 3QF4A 2H0RA 2XF8A 1RXIA 3C7CB 5T8KA 3SHFA 2OK7A 1UP7A 4R0MA 3BF8A 3CX3A 4QGHA 5MDHA 5T57A 3C3CA 3BGVA 1IM8A 1XZAA 2EYUA 4DABA 3PUZA 1IQRA 2C59A 4QPZA 1TQHA 4AS1A 1D1TA 4TLLB 4IDHA 1Z13A 2X22A 1T1IA 2YJTD 3WK6A 2P5YA 4FIZA 2PR7A 1J33A 4B09A 1X8LA 2XOKD 1ADGA 1J5XA 1OTYA 3HBNA 4E2YA 3ZE2B 2A9FA 3U4QB 4QXMA 1QAMA 5F3RA 3H2GA 3L8HA 1E6KA 4Q7KA 3AB7A 4LF9B 1F2TA 2OEPA 2VOEA 4PAMA 2ZQ5A 1J07A 2HPHA 4DA7A 4D9KA 4PFSA 3PCTA 4PWZA 2QAGC 5KNBD 1XTZA 5K3BA 4BGUA 4FK8A 1S89A 2JCGA 3V8PA 2XNJA 3DQZA 3JASB 5FWXA 3U0VA 2R5WA 4D8XA 1YA4A 1K3UB 2VPXA 1RCFA 1D1QA 1VHQA 3LBYA 3RG2A 1FTQA 1VFPA 3UXEA 4BXOA 2FRDC 5JVDF 3EZ9A 3H9GA 3JVDA 4O8CA 3EC1A 4A10A 2NU7B 1HNZB 3ZW8A 4MCAA 2OP0A 2M1XA 2BMJA 2LKDA 1H94A 1P9OA 3FMVA 5A7HA 5THQA 1VKHA 1WBJB 2JI8A 3NAQA 1P5JA 1A2OA 2QSJA 2QVCA 2WC1A 3D6FA 1RWOA 3G3EA 3OZEA 4K6FA 4JJ4A 5JDCA 1KF0A 4H0FA 1GA1A 5AI6A 3MIZA 4CR6A 4D99A 5IT4A 2I34A 4HBZA 4YP0A 3RVKA 2XWPA 3PICA 4Y67A 3W6UA 4ARSA 4OOFA 2ADMA 2XIQA 5AW9A 3PEWA 4P7GA 4QSHA 2IDMA 3K0CA 4V1CI 3H0KA 2N9UA 3WSWA 5EJEA 1HXHA 1RTKA 1S4QA 3JQFA 1W4ZA 4R31A 3BL5A 5IXSA 4EHDA 3WMXA 1YC2A 3P4UA 2WKPA 4MVJF 2WDZA 3K8QA 4Q4DA 4CIBA 1MJGM 1XB2A 1E18A 1XOIA 3K0KA 2XA2A 4PHFA 1RMQA 4RWEA 3WGVA 2L19A 3JZMA 2O5EA 3G2PA 2F6RA 3NJ4A 3C7KA 2QEQA 3BQMB 5LQJA 4M83A 1SOMA 3H5IA 4QVKA 1AZLA 3PBKA 1YJQA 2P9JA 1QUEA 2YJ3A 3CRRA 4IF6A 3EHDA 1VLMA 3AQIA 3VR6H 3F4BA 3I72A 4MWZA 3FAZA 1CUHA 3GOHA 4BTLA 5EAIA 5FF9A 3W5IA 1RHRA 1U1GA 1K4MA 1KR2A 1RLUA 2HI0A 2VJMA 2VZEA 3BS4A 3G7UA 1D7AA 4PG4A 1NM5C 1Z4MA 5G1NA 3HP4A 5BMOA 2RBGA 5A03A 4PO1A 4X84A 2PUAA 4LCBA 1R16A 5EKTA 5A06A 4QQ8A 3EXIB 3L82B 4HD8A 1GU0A 1DADA 2GZMA 3UH0A 2H51A 4CF5A 1N1GA 1YZTA 2CL5A 4DNXA 2IHJA 3ZD7A 7ABPA 1S9HA 1ID1A 4OQ4A 2QYSA 3O5AA 4GGPA 1W25A 3H2IA 5FTKA 4RENA 2XBUA 4BGVA 2Y27A 1DZIA 3GP8A 4H17A 3VTFA 4JBNA 1EVZA 4H3HB 1XJWA 3MLBA 5TC4A 3T1QA 4OATA 1OGYA 6AT1A 1VQ1A 1BGVA 4EABA 2X58A 3EA0A 1NYLA 2D2FA 4HWSA 4IVPA 3ROQA 3MS4A 1G1MA 5AK3A 4MVXA 3SJZA 2XNSA 1DS6A 4NENA 2NVUB 4I9NA 4UHCA 1C30B 3IP5A 5B2ZA 1UKZA 4EITA 3EDMA 4CMCA 4XW2A 4ZYVA 1AS0A 1FVOA 1NVVQ 3UT0A 3VZPA 2E6UX 1ZK2A 3WMGA 2SKEA 4WFQA 1CRQA 1QMPA 2P5SA 1NVTA 2JGNA 3GEHA 5FIUA 1OHHD 1MQ9A 5BV1A 4YMLA 5F1KA 5KJCA 1MIOA 4RKQA 1BKSB 1Q3HA 2NXCA 4KE9A 1U6JA 1ZOPA 1LPMA 3IAS6 4I55F 1HQKA 2B1RA 4MHOA 5EFOA 1H6CA 3ED1A 3AUFA 2BMDA 3V1MA 1XZEA 5BP7A 5JWOA 2ZTLA 1WMFA 3GBSA 2X0NA 4M0EA 3C7TA 2P9GA 1EEXB 5K3AA 3CO0S 3DE4X 5ALNA 1R0XA 2BEKA 1JX6A 2ZLBA 4HN2A 4XASA 2YHUA 2Y3IA 2JIRA 4G8JA 2IEYA 5DSZA 4FI3C 1N6OA 2ZAMA 3N7TA 1YRBA 1YC5A 3DDUA 1P45A 3WWEA 1R00A 2BM1A 2LP4Y 4IJVA 1CIPA 4AJOA 2JZNA 1O89A 3LDGA 4X71A 1KJWA 4L08A 1PF7E 2HYDA 3HFJA 5M3BA 2WSLA 2WG0A 2OCIA 2FPSA 4IDFA 4YPFA 1N0HA 3RYTC 3G2JA 3OQMA 1G8KA 5CBKA 4DAEA 3A0RB 5K0SA 1V8OA 1Z26A 2PKCA 4O4LF 2XB4A 3OZWA 4JLMA 5TQ0A 1E3EA 2V74B 4X1OA 2EX4A 1CUUA 1N5JA 1ZU5A 1JDTA 3URMA 4NDNE 1RWXA 1PN3A 3CNBA 4URYR 1RXVA 2VAPA 1CTQA 1XBTA 2ZJFA 4CEIA 4Z9AA 3DHYA 2ODQA 2CFIA 4NZNA 2A78A 1L7NA 1M74A 4QNMA 3HJHA 3DLHA 3AFMA 3LRPA 3MNFA 2HDNB 2WYIA 2UDPA 2YVLA 1USKA 1EX9A 2P4HX 4II3A 4MPJA 4M9QA 1XUOA 1XEWY 1QH8A 2I29A 4D0RA 1NFRA 4FNMA 3I64A 2I6GA 3KZOA 3MCUA 4OVKA 3ZVKA 4Q1AA 1SHLA 3KP1A 5FOUA 1JDSA 4HOYA 3JWIA 4X1KB 2QORA 2PKXA 3U60B 4PHGA 2BI8A 2CCGA 4BWVA 4QJ5A 5BT8A 4PPGA 1JEOA 5EMNA 1XZHA 5AOBA 1HDYA 1DWPA 1A1SA 1CZHA 4JOQA 5CVUA 4TV8F 4DY6A 5CIQA 4B33A 2QJRA 1KP3A 2VPTA 4RE6A 1W75A 2CBZA 2IOYA 3KPVA 3BMNB 1W0CA 2FEOA 3TOXA 1QQTA 1YQQA 1IIRA 3NOQA 1RDFA 4CL0A 4R2XA 5CFQA 1YDMA 4DF3A 4Z4FA 3WTCA 1E1QA 4ARZA 1FPQA 1WMAA 5KWIA 1RQPA 4NNJA 2YUTA 1QORA 1W2GA 5K6AC 2H7CA 1ENPA 2R68A 3KO8A 1E2FA 4YJHA 1PWYE 1JHYA 1ULSA 2Q0HA 2YW9A 4J0QA 5AKEA 3PIDA 2JANA 4ZTZB 2GCOA 1YZ3A 1QG6A 2GZRA 1C8KA 2BM9A 3B36A 4IOMA 4MCHA 3TGWA 4NBSA 1D2CA 3VOTA 1WTAA 3OFND 2Z5FA 4TZ0A 2IH4A 2REXB 1P39A 1E92A 1YKSA 4XFJA 5L4SA 1PT8A 3UT6A 4B0PA 3L8CA 3IUPA 4JQOA 2C5FA 2FH5B 4KBFA 1C4KA 4D56A 2GXAA 3HB9A 4A1OA 1EWVA 1US8B 1PSDA 2AD5A 3ZPXA 2JAXA 1LX7A 4URUR 1ZKDA 4V1CB 2X0DA 1NYRA 4ZAWA 1UDXA 1NY6A 4KBYA 2D0IA 3M6IA 1MH9A 3NASA 3FNBA 3WIBA 2PQ6A 5TPWA 5HIAA 2WM8A 4DWWA 1N36B 1I3NA 1NUHA 4K8OA 4TV9F 1E61A 3LUAA 4K1LA 3AESB 2A88A 3TW8A 5I7HA 1QLWA 3TGPA 3NBFA 3QY0A 4WGGA 3B1YA 3F6BX 1BH6A 1QFZA 5TVKA 4LQDA 1BRTA 1V35A 1GQFA 2FG5A 3DMDA 5FUYA 1E0SA 2AN3A 1XKLA 2GSDA 3RVPA 3W2HA 3H17A 4WTOA 2NSLA 3ZH2A 1UR5A 5T67A 2YJNA 2WVHA 4FLMA 4GVPA 4YUWA 1I3KA 3HUFA 3HKDA 2FB9A 2NZXA 3TE6A 1CJUC 1HYGA 1XD2B 1Y3BE 4DMLA 5LD2C 2FSUA 1KI7A 4KXUA 4TT3A 1SKMA 4Q1EA 3QWAA 2XPCA 4AJJA 2VUTA 2WWRA 2F67A 4GI7A 1CF4A 1I01A 1P75A 1R0BA 2JGIA 4G84A 5AJYA 5FPKA 5J4LA 4GL2A 4Q39A 2DQSA 3GMTA 2DB3A 1F6BA 4PBTA 2E3JA 5HQ3B 1DQSA 1P4RA 3DVLA 1J8QA 4L4XA 2PEYA 2WTNA 2OK8A 1ATZA 3AUYA 1GU7A 2JVJA 4V3CA 3D3WB 2PX2A 4DMGA 1U2PA 3WKAA 2B3TA 2P6OA 3FRHA 2WF8A 1YQGA 4ZCRA 4ZHQF 3VH4A 3AI2A 4MI3A 2CHVA 3FUUA 1CR2A 3QOYA 4XEUA 2HWKA 5DWDA 3AOEA 3I9OA 4GUDA 2OHXA 3IQZA 5ADUS 1O5TA 1GUZA 4JKYA 1Z0UA 4KO3S 4D8TA 3S99A 3O8OA 1QE5A 4M88A 3WKCA 1DWQA 3I3OA 2O54A 3PJRA 2CL0X 4DJJA 4DR6B 5DHSA 1M6YA 4RU1A 4IH4A 1AIPA 4OCZA 4MEAA 2OILA 3VZRA 1K5GA 1U2EA 1QIFA 3H4VA 4UHKA 1B0UA 1J0XO 2LVBA 4I1OA 4GRIA 1IOZA 1QRRA 3C16C 1P74A 3DV2A 4YI3A 4LX8A 1BC5A 5EC8A 1OZAA 1SHUX 4IGEA 1UAGA 3RSCA 3WGQA 2JEOA 3GLIA 2IH5A 3UICA 4G0VA 2PY6A 1PFKA 4CQNA 3IHKA 1ZX1A 2XUIA 1A7KA 3BBLA 4MLCA 3U9TA 5CFNA 1E2NA 1R66A 4U4AA 4HBGA 1LD3A 1ZLXA 2HTEA 4L3WA 3I2HA 4XVRA 3SQOA 3HUEA 3ZU5A 3OIUA 1T34A 4WGFA 5FNVF 4DIBA 1QH0A 1AKEA 2G6TA 2XB9A 2Z2JA 5EG5A 5SICE 1RLOA 3ZCXA 4ZI3A 1U4NA 1KPHA 3RT9A 4ENPA 4GQAA 4RC9A 3ACBA 3DLBA 1PE0A 1OJ7A 3TAXA 3TNFA 1K89A 2W0SA 3DMNA 1E3QA 2OGWA 4J0DA 3O8LA 1NYQA 2O9JA 3WZMA 3NBAA 3UKOA 3ADOA 1YB2A 3D81A 3SLRA 1LPPA 1OI2A 3B89A 2X41A 1T4DA 3N74A 4L7QA 1D5WA 4RK4A 4WK0B 2QU8A 3PDIB 4AULA 3R9WA 1LFAA 2JS7A 3QBTA 2O4CA 2IFTA 4MV9A 1NQWA 3OZIA 5BW4A 3KB6A 5TT0A 4DMMA 2W2PA 4KQ6A 2BDTA 2H2IA 2NPFA 4LY9A 4G4JA 3M6FA 4AYTA 1LI5A 2J4FA 2Q3BA 4BLSA 5KOYA 2GNAA 3CPSA 2YZKA 3IOYA 1Z4QA 1A50B 3IP3A 3IULA 4LSMA 1VBMA 5K3DA 4D81A 4X64B 3ZY4A 1Q5PA 1ISFA 2ZYRA 4D9EA 4U9HS 2NZ2A 3JZAA 3CR3C 1TA9A 4V0LA 4YROA 5C1BA 2XCLA 2PGIA 3BSSA 4GR5A 4AJIA 5DTEA 2ZRNA 3K6SA 2BSAA 4DMCA 1ITZA 4ENSA 3KK0A 5K05A 3NRBA 1DT5A 3SC2B 2GZ2A 1W4BA 3LW8A 1YVDA 2LWIA 1SUWA 5AK4A 1QYXA 1SXJB 4YACA 4QTUB 4ALKA 3I92A 2XT0A 3CX6A 1I32A 1RM0A 2BFFB 2J6CA 4E5VA 4GUAA 4ZRMA 2D1RA 1UBNA 3D8RA 4QIHA 2RMKA 4QEKA 3IPAA 4CTKA 1RABA 1WSAA 5F7ZA 5BUSA 4N39A 4B8YA 4A15A 1FS6A 3CH6A 4G63A 2H5JA 3DYVA 2EX1A 3A3PA 3RIHA 4E30A 1MAHA 3BUSA 1G3RA 2YV1A 3V6MA 1W94A 4BLUA 3FVRA 3JATB 4PG8A 3OM1A 4NI5A 4OQYA 4F5ZA 3HFRA 4RYDA 3T0IA 5D6NA 5HBRA 3CA8A 4GX5A 5JH7F 3FI9A 1PNQA 3K4HA 3W5DA 3H04A 2WIKA 1ZJYA 1XWIA 3LK6A 3PR3A 3UANA 1OA1A 3B60A 4KKXB 5P21A 3UOAB 4L2IA 4LNUA 5K51A 1WPRA 4KZKA 1RS0A 2VNHA 3MRVA 4MR8B 2QYTA 3SPXA 3EGXA 4M76B 4EY5A 5F7XA 1MKYA 3QPCA 1W46A 1O3YA 2Q7XA 4M36A 4PGAA 4BX8A 3WK4A 2HH9A 3THWB 1NVBA 3OAAD 4JY7A 3LPNA 1F3OA 2WKQA 3A4LA 1U8AA 3HEBA 4HY3A 3ZWKA 3OU7A 2Q6KA 2E4WA 4S1WA 2IYXA 3W2GA 4A5OA 3A6DA 2HJHA 2YZNA 4IYRA 2X5NA 4MUMA 4DM4A 1RI5A 1FBNA 1L6RA 3PQ3A 2R7KA 4UXJA 2C4KA 4MQUA 2FUEA 1BXZA 1KRHA 2YQ5A 1EDZA 1NXVA 3M6WA 2FZ4A 3QITA 1QR2A 4PGGA 4XWYA 2XZLA 1RHKA 4UMDA 2HCFA 3W8DA 4ENRA 5AI4A 4NU0A 2WRZA 5IUNC 2MOKA 9LDBA 1VKRA 4Y6SA 3HH8A 1TU0A 3NYRA 3O7WA 1JQLB 1N2CE 4QE3A 4LF4B 1E2KA 4FKBA 1QX4A 4UNQA 2ZPAA 5FORA 4PRYA 2CJYA 2OLJA 3ER6A 1FYXA 1NKVA 1P44A 1GTZA 1TXGA 2B2CA 4RIIA 2N47A 5LQSA 4E51A 1NLFA 1YDGA 1YXMA 5BY2A 5KS2A 1W5TA 5DDIP 1YR8A 2XKBA 1KKMA 3BCHA 4N8DA 3REGA 3VR5A 3EZFA 3N2IA 4NL4H 5ALMA 1Z39A 4CDRA 5CVVA 4EI7A 2O8CB 4TPKA 4CKYA 1NU8A 1UEJA 3GUYA 3CZAA 5JISA 1QHYA 1NIJA 3P52A 5A0FA 4FYXA 1JIJA 1UIMA 1RYNA 4BNHA 1PVDA 1U28A 1SXJD 2DULA 1YB7A 2W48A 2HQSA 4FI3F 5FA8A 4CMGA 1KI1A 1SURA 1HEUA 3QELA 1FNMA 2I0FA 3K9CA 2YBEA 2NYUA 1H8HD 1C3JA 4I8XA 3MTIA 4L6AA 1NFFA 2M6RA 4JMLA 4RPJA 2YMQA 2X2OA 3W5UA 4DNPA 5KUTA 2Y92A 5FJJA 4RMGA 3TD6A 1G17A 1UT5A 1K08A 5KTOA 1GZHB 2J7PA 1T8RA 5KZMB 2ASVA 2GFHA 1A8UA 2GNOA 3TLYA 1ZFNA 4Q47A 3OIWA 3RS0A 1H6DA 2B69A 2DPYA 4M9UA 4C21A 1UCFA 3IXQA 2FWNA 3UG6A 3VPXA 8LDHA 4B3SB 3OIYA 4D2IA 5BYKA 1KYYA 3WDLA 5F2KA 1P1CA 2J0UA 2ZIGA 1VIVA 1PAUA 4ON9A 4EYQA 5FH9A 1OWNA 3TN7A 3IYLW 3SU8A 3RADC 5HJ5A 3T9FA 2W93A 4J3JA 1ENOA 2AOUB 4NZZA 1NQXA 1QTIA 2CVHA 3AG5A 1AN0A 3M6VA 3OCXA 2ZT7A 3NR2A 3PQ6A 2Z8YM 3BIOA 1J8DA 1MX3A 2E5FA 1GSOA 3LQ2A 1R12A 1XQVA 2QN2A 2X9QA 4IKEA 4Q9JA 5GONA 1GHTA 4FLEA 4EA7A 4O4IF 3ESBA 1XDBA 3PFNA 1LSJA 5T41A 1WMSA 1Q44A 2I87A 4LRQA 3SMVA 1I4DD 4YR9A 2RAVA 4CLRA 2CV0A 1EUQA 5AKLA 3CYFA 4HYEA 4CR7A 1Z0ZA 5EWJA 2CLIB 3W6ZA 5KMGA 4MRRA 2W83A 3P2IA 3TMAA 2DLDA 5FTJA 2LXNA 2VPYA 1U4OA 2IEAA 1BYUA 4DYHA 4DBVO 1KO8A 1U2DC 3HL0A 4DXHA 1WW8A 4C4OA 4EHNA 1GCOA 1Y4SA 5MFPA 1HDEA 2C7GA 2IPOA 1QHHB 3P9SA 2GZ3A 3TW6A 1XZLA 1JQ5A 5JLJA 1FVXA 4NR0A 1M6WA 3Q98A 3STTA 2J67A 3QXXA 4L3VA 1R0CA 3IQEA 5I7RA 1O6CA 4N5IX 4KN5A 3RIGA 3RFUA 3VYWA 4WNCA 1H0KA 2Q1YA 2IZZA 1LQ2A 1K8RA 1UJ6A 2RH9B 3OA2A 4H4DA 2B35A 3D6HA 2DQYA 4HK4A 5CK4A 1MNQA 3LCUA 3LY5A 5JCOA 3E2PA 4F04A 1EFRA 3ORSA 1SIUA 1OR8A 4FOOA 4YJ3B 1KDYA 1ELOA 2YZMA 3TKYA 4RM3A 2YHBA 3STYA 3SHQA 1X14A 2QUIA 1NF2A 3NIGB 4PZ9A 4XUCA 5BQ3A 3GEIA 3ZGYA 3CRMA 4PC6A 1GGFA 5JSUA 4I3FA 1TJYA 3T8YA 1NBMA 3KYCA 2EKPA 4MVWA 4PINA 1PFWA 4XAQA 3EGOA 3OY2A 1LS1A 3SR4A 1T3LA 5DNUA 4AMGA 4GBED 4B2IA 1QGDA 2WLTA 1AA9A 2XH8A 3R76A 4GSKA 4OGLA 3TQIA 2PZAA 3IUQA 3SBXA 3VI3B 1DDOA 1C9YA 1E94E 2DBRA 1PK8A 3DZJA 3GB9A 4DILA 2NYVA 2KSQA 2QQEA 3BKXA 4Q9NA 4YP7A 4BYGA 2VQ3A 2C04A 2C7QA 4XJVA 3ZCSA 4BIMA 1O7JA 1I30A 2FPUA 1G5FA 2CLMB 2CWWA 3CSSA 2M98A 5D5PA 2O3SA 1SC9A 4D4LA 3ET5A 3VDXA 2GBPA 1FFGA 1WDTA 2ODWA 3BH7A 1M1XB 2PD6A 1H2XA 1VL0A 1WZNA 1E98A 1CY1A 1U6IA 1W9MA 2ZT8A 4MMYB 5IUKC 3AZOA 5TR9A 4MUJA 3RI3A 4F5WA 4ZZ3A 3BXFA 1G8AA 1MA0A 3UHOA 3R9XA 3W4KA 3MS2A 1PZFA 4BKOA 5HCNA 3FLBA 4KJZA 1M0SA 1QGAA 2F3RA 1ZMXA 3AH8A 3K0HA 3Q10A 3R20A 2HC9A 1HEYA 1OBHA 4K3UA 1K7YA 4Z53A 3LDHA 4J94A 1XTKA 1ZBDA 1E9SA 3KKOA 2VKQA 4KN8A 4FSDA 3B9PA 1BNCA 3AM4A 3H16A 1RPNA 1IQUA 3DBHA 3VZBA 3DMRA 3VKWA 5JC1A 3AHEA 4MI1A 1C1DA 3WBKA 2ZDQA 5DLQC 1C50A 5JSHA 3LUFA 3ZWPA 5C18A 1EGHA 1M2KA 3V8EA 1QNFA 1R0LA 2C77A 3OTOB 1WDMA 3U4DA 1AKQA 4XVUA 3CVYA 2FQ1A 3UWPA 1MDFA 2WIJA 1I9CA 5FB3A 2JFNA 4XB6B 2GF0A 2CE2X 4HVLA 3R4VA 4Y0VA 2I4LA 1ZESA 1GRCA 1WF6A 2ZEJA 2NXWA 2E82A 3PNLA 4G1BA 1CUFA 3SQNA 1ECBA 2J9FB 3Q0TA 3GRPA 4V24A 3ZV5A 1ZI6A 2O8BB 4EEXA 2QAJA 1OI4A 1UZUA 1N3IA 1SPXA 2G71A 5BN4A 2JJ1A 1ZI8A 5GINE 1ZOSA 2ALJA 1SY7A 4L6CA 4OIFA 4Q3AA 3RBZA 2NUTB 3RVOA 3WB9A 4BHTA 4B2PA 2ZRJA 4GT1A 4CM5A 2V0GA 1LTHR 1ULAA 3S6JA 4YMHA 1CQPA 4ZOQI 3E2IA 3UT5A 4C5CA 4DDHA 4YPVA 2FRVA 1I2AA 4HLDA 1G0NA 1QH8B 3QU9A 4OXYA 4B43A 4BGEA 3HWRA 3GPLA 3B6KA 3UYLA 2XRFA 2O7NA 4Q3EA 1KY3A 3B2EA 1NR1A 3H2ZA 4ZOAA 2IDZA 2PQ2A 3DBLB 3ESZA 1M6HA 3LGXA 3MWEA 3IQHX 5E9WA 3NPAA 3UB4A 3UB3A 4URHA 1QHIA 1YFJA 1BKYA 1CCWA 1JVBA 3IOBA 3Q8KA 2AXQA 1X7XA 1M5RA 4DIOA 3GRRA 4RPGA 5DGDA 1WL8A 1W30A 4WFKA 4L51A 3R8XA 1SBIA 1V0JA 5BYBA 2A1UB 4BTVA 4MQBA 3K0AA 3MINB 4DMKA 2QRVA 1DHTA 1VMIA 3C39A 3FDFA 3W3AA 1N5MA 5EJAA 4ARZB 4KE7A 4K40A 4BKRA 1YOVA 4E14A 4JXKA 2CEAA 3BB1A 3ENWA 3IIMA 4K9NA 4ZOLF 4N3CA 4D45A 1ZR4A 3QVMA 2HW8A 3CE9A 4RZQA 2QYHA 2YV3A 5B3JA 1ACMA 1KSFX 3RIYA 2EBFX 1IEWA 4ZOEA 3FPBA 2PS1A 2AT1A 2QTMA 1FZQA 1C0LA 1L5FA 1U2ZA 2WNHA 4KXYA 2ZIXB 3WHIA 3AC0A 2K7FA 4TMVA 1S2NA 1J9ZA 2FEXA 5KJFA 2DUNA 2H17A 3NEAA 4Z2AA 5B2EA 5JAPA 2XEDA 1XTJA 3KB1A 1QPGA 16PKA 1B8OA 2GPAA 1DZ3A 3BFJA 2D5CA 3FI0A 4PLYA 5FPHA 1QFMA 5LA6A 4YJ2A 3GEGA 2FMTA 1LJ8A 5K0CA 1T9DA 1DXQA 3RKUA 3ZZNA 3BK1A 3IALA 2XYVA 3NCTA 3KJHA 1H1TA 5ITWA 2AQ8A 4J4HA 5AJZA 4H0CA 5DHPA 4W5WA 4J75A 5GOTA 4AC9A 2VP5A 1T0PA 4FCCA 1O97D 1SVLA 2I66A 2VNJA 2WE7A 4GIBA 3EXFA 4DE5A 1VDMA 4WKOA 3GDOA 3MGAA 4KXLA 2A9RA 4IFBA 5LOVF 1ZGGA 3PEYA 1EK6A 1QU2A 4DR1B 2ZBQA 1LSOA 3GG9A 2P3SA 3JQRA 3TH5A 3BD8A 3FWYA 2QR2A 2ZE5A 3C8HA 2DM6A 4UEWA 4WZ6A 3HKDB 1EE1A 1U2GA 3IS3A 3KXPA 1YS2X 4ZJUA 2VBIA 1XHFA 4HNHA 5H82A 5CB4A 4YLEA 1X9HA 4DLBA 1N6RA 1AHHA 3FR8A 1U9IC 5FWAA 4AG5A 2QG4A 1LY1A 4IUYA 5CLFA 1H2YA 1GV0A 2P7IA 4J0KA 3WLRA 4BQRA 4D8WA 5KX5F 5HF6A 5I7SA 2YBDA 1C1HA 3G89A 4GMXA 4QQKA 4ZGWA 2RG7A 3QFFA 1SWVA 1JDBC 5K4HA 1DTEA 2BRUC 3ROTA 1B15A 3IE0A 4ZU3A 4KUGA 3GLUA 1GITA 3NC4A 4H3VA 3SY8A 5EPUA 1YMUA 3DMTC 4FZVA 1UXGA 3O8NA 4TKZA 4YRPA 3VC7A 3HA5A 3AEKB 1NUTA 3PHCA 5EZSA 1W76A 2QRPA 4KWTA 1CDOA 3F47A 3OEWA 4QUIA 4UUAA 4BE7B 1ZW1A 3NHJA 4D9NA 1TCUA 3G6WA 1E1QD 1DKUA 1OE0A 3M1AA 3NHYA 4OUDB 5ICCA 1Z0KA 4IKOA 1EU1A 3O8OB 1EFUA 2FSFA 2HDOA 3VUEA 1BWSA 4FXOA 2CY0A 4B48A 4G1FA 4NYJR 2BN4A 5AI9A 1Z35A 3R3HA 3KE8A 2XXAA 3TLKA 3GCWA 2GJ9A 3ZX5A 5GAJA 1G5RA 1IQ0A 3ZD9A 1BXGA 3TMYA 2C83A 2G76A 5JYDA 1RQ2A 2RHGB 1HQDA 3OZBA 3L0CA 1VZ2A 1PZEA 1SKAA 3TVYA 2VC2B 1GQYA 4BNJA 3GT0A 1CZNA 3GJYA 3THXA 3M5WA 1UFKA 4BVLA 2LDXA 1T1GA 5KQGA 3Q7EA 1KEZA 2EJWA 4YTEA 2EBHX 4KR0A 2C2KA 2HJSA 4INOA 4IG9A 4WXRA 2AFVA 1FU8A 4KRXA 5D7BA 1BE8A 2DGDA 3DQQA 4TKMA 3RU3A 5CW2A 1Y42X 3TJZA 1PFUA 3EIFA 4NOLA 1WWKA 2VQSA 1GA6A 2XGJA 4WACA 5U4XA 2PCJA 2ZRCA 3JAWB 1M54A 1KDVA 3OQIA 3WISA 4EY7A 5IH7A 1DC4A 2XVZA 4DC0A 1FP1D 4RGBA 1OT5A 2XQKA 4I50F 1O95C 4V0KA 1IG0A 5DGCA 1V8DA 4DA6A 2P90A 2CXQA 4NQZA 4X60A 1IFXA 2YCBA 5ED4A 5BSKA 1KR5A 4PSKA 1OU0A 1V2GA 4EW2A 3VZQA 3IAUA 1KHHA 1F9AA 3GI1A 4HDNA 4TWJA 3V5NA 1PL6A 4ZN6A 1ST3A 4DDUA 1ISJA 1VKNA 4TT3D 4HDRB 1S1MA 4TS9A 3K6SB 4EPWA 1C7EA 2NXNA 3QM1A 3EZYA 1ZH8A 3IILA 3AQ4A 4WLNA 5ENDA 5ERYA 5JU6A 1QTQA 2VHYA 5KREA 5IF9A 1CLEA 2WP8J 2Z5LA 3IR7A 3MJEA 1UMBA 2PQ0A 1PLKA 1COZA 2M9MA 3T12A 1Z5PA 4JJ8A 2BBOA 5EMMA 1YFZA 3QPAA 4D41A 5A4DA 1OXMA 3G8AA 2B1JA 3OF2A 3D1VA 4C0WA 5TF0A 4LVCA 1O03A 2O3QA 3UGQA 3KB2A 1V4NA 4O08A 1P1RA 5LBTA 4CFZA 1E1NA 1TD9A 1WSWA 3AR7A 3GNLA 3K70B 3B51X 4XB2A 2YFQA 4IIDA 3OU2A 1EZ1A 3VTZA 5FJIA 4ZIRA 3G0OA 1KMHB 3NGXA 4EHBA 1XPRA 1AUXA 4BLOA 3IVXA 3RHSA 1SIOA 2C42A 2O59A 1JALA 3V4OA 1EB9A 1ZR2A 4UHJA 3AR5A 4EW6A 4DA0A 1Z0AA 2C2WA 1OXTA 3FN4A 3JYPA 3QBJA 4RF4A 1ZCZA 4Z5XA 1RKQA 4FE4A 2RHTA 5DEIA 3DFFA 4ZJYA 4G9GA 4V3BA 2RHDA 2QXYA 3GT7A 1KC3A 2WYHA 4D92A 3ZE7A 2FDCA 2PRSA 4U6NA 1ZDMA 3VPGA 4YAFA 4DCVA 2JLAA 4H9GA 4Y2UA 1S02A 2W2KB 1LZKA 4GDMA 1DFIA 3AF1A 2OXCA 2CHUA 2IDKA 2I9PA 2PTGA 3MAGA 1M2VA 4F2PA 1HMPA 5HRCA 2RARA 1VA5A 4RTLA 2AK2A 2C31A 4EB0A 1X8XA 1RE1A 4BLRA 3FGOA 1M73E 4EYSA 1XNJA 4CIDA 1QQAA 1E8NA 4Y1GA 2ZUEA 2QRZA 1G2QA 2AKAB 3ZVRA 2FHPA 3BGDA 5HPYB 2C57A 2AH5A 2RSLA 1QDUA 5FI3A 3PE4A 4JI7B 1G1AA 1ULUA 4ASUA 1EZZA 3SYRA 2SBTA 4XRRA 4Z9FA 2CJPA 4KBGA 2ZB8A 4KUHA 3IKJA 2LE0A 3C5CA 4CM9A 2XYQA 5B5SA 4N0EA 4DWVA 3QMWA 4I9GA 2ZZMA 4GRAA 5DYGA 1JSCA 4K86A 4MI6A 4JMPA 4KO4S 1J0DA 2Z98A 3ZWDA 4MWGA 4ZHSA 4RK7A 1LTQA 3C7DB 1UBRS 1MQAA 2OVFA 3IMKA 1Z68A 3ZDCA 5KNCA 1OSNA 1OXXK 2VCEA 4P4UA 4PY2A 2A9KA 5HP4A 3M89A 3QQPA 2IW1A 3C6MA 4DOMA 5I4KA 3FWNA 2CYBA 5DLDA 5BNZA 1TMOA 1JDZA 3WGNA 4TYQA 1E60A 2FFJA 2WMOB 3FYHA 2R6R1 1NY5A 1T5HX 2PZJA 3KU4A 1WBDA 1VKJA 1OC2A 1C7JA 4KWHA 4NG4A 5B4TA 1D03A 1SQSA 3M3HA 3PC4A 1CZLA 1WUTA 4P92A 1C4OA 3X1WA 4G0XA 5AUOB 2JASA 2PFGA 4L78A 1U90A 4NPCA 2CJXA 1DKPA 2YXPX 1DRKA 3ETNA 1WABA 3FZGA 4J1TA 4PQFA 2OV4A 1YBVA 3TZLA 4G3XA 1MVNA 1SC1A 3ZNNA 2HCJB 1QVVA 4M1EA 4OHMA 5IDVA 2XGOA 5KQRA 5CIWA 2R8YA 4EAQA 1XYGA 4X00A 1T5IA 3GFVA 3QBEA 4TXHA 4DLVA 1L4KA 3LOQA 2OO5C 4PQYA 4JP1A 2GKOA 4LOJA 3H65A 2BFEB 4ZT4A 3CVVA 3OUUA 3TUJC 4PAOA 2DFKB 4JR0A 5HKKA 3OFVA 1C3VA 3KT3A 3PPIA 2H4WA 2VUHB 3OPYI 4HATA 5A0TA 1MAWA 1C0IA 3TIFA 2H7VA 4WXEA 3FYSA 4QOHA 3QZUA 3KQWA 4M2LA 1DQRA 4OK5A 1E8MA 4ZCTA 3DEKA 1JA9A 5AI0A 5GONB 3OE1A 4MUKA 3R9IA 5F98A 3PGXA 3IXMA 3H9EO 1DG3A 3L6OO 1D2AA 2HPZA 3I53A 3ZKWA 4G26A 5KTSA 4BVHA 2QLBA 3WS7A 3D59A 1T9GR 2FP4A 2WT8A 3OZUA 2F1OA 2DWUA 2I65A 3I4LA 5DN6A 2OHJA 2OBFA 1I4OA 3M6AA 4ZPXA 3GIDA 4YRMA 1VL8A 1WAMA 3O8DA 3E3AA 3IHTA 4K9OA 3BE8A 3B1WA 3R7DA 3SXJA 5JCXA 1VMEA 2HU7A 3ACCA 1M8GA 3K9LA 3SM3A 4CKXA 5J2UB 1NX6A 4PGFA 4QHYA 1YHZA 3ZV3A 1FTYA 3O8BA 4AWXA 2FZGA 2V45A 2DPMA 1E3WB 2GEKA 1JI3A 1M2OA 2BGNA 1Z07A 2P5UA 5IN4A 3T7RA 4DCMA 4NZMA 5BXQC 1OFHA 1VE3A 2QX6A 3A9TA 5J43A 2GUGA 3EPRA 3SS8A 5AK6A 2LTAA 2I7XA 1PNOA 1WHTA 3CFYA 5JLAA 4LRTB 4F3CA 1WA5A 2GO7A 3VSBA 4CMIB 1DTWA 4YAGA 5CA0B 2BJWA 3KLBA 4W4TA 1HT3A 2KLHA 1UINA 2I22A 2PBRA 4PC1A 3VR5D 3GGSA 3LVFO 4YASA 1KRWA 1VLLA 2A9QA 4L28A 1R5BA 4L1KA 5LUAA 2IHUA 3KBBA 1OBOA 5LU8A 2CXTA 3EA4A 5EKDA 2IPMA 4CG0A 3FCEA 3P94A 4JSRA 1C7FA 4GI3A 8AT1A 5FOQA 2P6RA 4RJTA 3F71A 1MC1A 3Q3VA 4W9MC 3IBYA 1NT4A 3EZ2A 4QAJA 4JA0A 1FFSA 3HM2A 5FWYA 2E4YA 1TI7A 4G5YA 5EXTA 2I7VA 3PUWA 5ARDA 2BF7A 1FRNA 2J7PD 2WJ4A 5LWHA 3LTNC 1M0WA 3E0QA 1IVNA 4TWRA 2UUBB 3PFBA 3T7AA 1XIVA 1KO4A 4M1OA 2XGMA 1Y1PA 2YOHA 4Q02A 1JAZA 1GRVA 1ZC3A 2OHVA 3C1AA 4O4HF 4OQDA 3RROA 2ZRAA 5JJKA 4DA4A 3DBVO 3UJAA 3GN2A 3DCYA 3E53A 1U3TA 3K72B 2O2XA 2VA8A 4X6UA 1U0OC 4JL5A 4TYWA 3AL2A 4GLJA 4S2UA 1BX0A 1IPEA 3NHBA 5JHGB 2VZ8A 5F3DA 1FFXA 3UMVA 3KOUA 1T1SA 5I9SA 3JALB 2BLLA 2ZJOA 1ORHA 4OMUA 3SDSA 3CPEA 1JDBB 3DF9A 1QZZA 3MC1A 4QTZA 3VPDA 5GIOE 3EEOA 3GLGE 3TZKA 3HKBA 4QC2A 2VPQA 2II6A 2JI6A 4MRNA 1T15A 3B3JA 4CKBB 1SJ9A 4MAMA 1MJNA 3ULKA 5J3JA 1DC8A 4YR7A 3S29A 1HLFA 5DM0A 1L7VC 4RVNA 2GAOA 5IX8A 4JQYA 1GQOA 4IVRA 3U9SA 2YWDA 4ZYLA 2Y1EA 2H52A 4UATA 1DAPA 1EH5A 4H2DA 2NSYA 2KB0A 2DTDA 3M1YA 5IJWA 3RV4A 5FA6A 4AO7A 5HF9A 1ZA1A 3EA5A 4IRUB 4DCOA 4Z4HA 2OV8A 4RY9A 1BKDR 1DBRA 3TR0A 2PRIA 4PXSA 4BFXA 1JHUA 2OENG 2ZUUA 1KPGA 1EFRD 1NBAA 2ERXA 1IHYA 2DUJA 2EX0A 2GBCA 2QE7A 3JS5A 3IEMA 1S6YA 3N0WA 1U4SA 4XD7A 4Z7QB 2XRYA 2UZ1B 3L4BC 3JWPA 2GPBA 2J0VA 2BP7B 1T2VA 2OL4A 3E9QA 4MGKR 3HWSA 5KNDA 1RQRA 1LRLA 1QDEA 2VJKA 5K3SA 2FPXA 3NIWA 2VZ9A 1J2YA 2BONA 4HAXA 1JQJC 2YRFA 3EVZA 1L7AA 1TMYA 3AEZA 4XX0B 5DTMA 1ICIA 5PGMA 2NACA 1GG2A 4RA9B 5CU7A 4DRXA 2XUOA 2P11A 3AY0A 4P0TA 3SR0A 5I7OA 2ZIAA 2R00C 2CDAA 2VBGA 1ZUWA 3V4FA 4DCNA 4X95A 5CAEA 4UTRA 3ZGLA 4PZUA 1JLHA 4DJFC 3GGCA 3BWDD 1X1BA 3O3NB 3C0KA 1FRFS 2B0CA 3DYIA 5ICGA 4CM1A 4EG7A 4LOIA 1KTVA 4EY8A 1KJ9A 3W3AH 3ROKA 3ZXIA 4PSVA 5L3ZA 4D9CA 1PJSA 4TVSA 3A14A 3K0AB 3T94A 2Q6LA 2IPXA 4PZDA 4MEJA 3A31A 1VI5A 1B16A 2D2IA 4OGWA 4EF4A 4J0FA 1BROA 2IYOA 1UF9A 4NOJA 4CV3A 5DWQA 1AHIA 2FK7A 4TWZA 2DLCX 3ELBA 3SG0A 3C87A 3AUTA 4ONEA 3UN1A 3PHHA 3F98A 3QTTA 3ZNQA 3CZ5A 3WGMA 1W5AA 4LBWA 2H29A 3ZWXA 3TDMA 2ZPUA 5JZVA 2W6IA 4RDXA 4DG5A 5EFZA 5ALDA 1LNSA 1USIA 3QW4B 3KQOA 2JLXA 3CWZA 3CLRC 3ESXA 2J5XA 3TPZA 4UXIA 1TCBA 5TS2A 5DN9A 2VJNA 3TNDA 1V45E 2AJ8A 2NWQA 3TO5A 1UKVY 3C6ZA 5LA6B 1BE0A 1GTJ1 1H4TA 2PZKA 4UMEA 5DXAA 1GILA 3U7IA 4E88A 3BJIC 4M89A 4UARA 2QV7A 1OCEA 1XCJA 1XVLA 1PGPA 2J3QA 2VF2A 1IUNA 3OJCA 3QV1A 4UBNA 5DMHA 3RRYA 1QP0A 5CFOA 1H65A 4C2BA 3HE3A 4DB4A 3ZVMA 1RNLA 1DT3A 2HGZA 5JALA 3TJMA 4QUHA 3ZV4A 4Z6KA 4QVIA 1M1YB 3RVLA 2ANBA 2HWWA 4PXYA 4ALJA 2O2CA 2ZI7A 5JW6A 121PA 5FUQA 2AN5A 2JJ1D 3DCNA 4F4UA 3A1UA 4RLFA 2WQ7A 3RCBA 3OI7A 3G2IA 4BB6A 2FMHA 3QUQA 3EE6A 3VR2A 2BH9A 4JIGA 3PT5A 5FLYA 3MM4A 3WWPA 3M7IA 1E99A 2NV2B 4HDKB 1ZNXA 4W5JA 4QOEA 3UTDA 4C6TA 2NNWB 1ODIA 3AJDA 3AZPA 4EUEA 4Z8XA 1D9ZA 4LXTA 3RLIA 1X7ZB 1IN4A 3HVUA 2ZUWA 1WY7A 4AWBA 1A9ZA 2AMVA 2CLFB 3SQLA 4JOBA 1L7PA 2OB2A 4E21A 1I51A 2PZBA 2QN6A 3IDAA 2AJTA 1E4VA 2YFHA 2NO1A 4NS4A 4Q3DA 5IXJA 4WZZA 1BEZA 2QMQA 4HQOA 2HRCA 3WLMA 3KEGA 2CKMA 1HYHA 2AVNA 3KUDA 4REQB 4X8OA 2I2WA 2ATXA 3DL2A 1W6RA 1ZWLA 5T64A 1UBOS 4IHJB 1HFWA 2FVXA 1OZFA 1CU1A 5DBGA 4WA8A 3W3AD 4WBNF 1Z8HA 1TMGE 2BM8A 1RXUA 2FX5A 4JD5A 3VDRA 1OW3B 3OZXA 2P0EA 2ZI6A 4NBWA 4K6CA 4QBIA 4U8HA 4RTJA 4XGIA 4FDUA 1A71A 3NKFA 4IDCA 2GYUA 5DLYA 3BFKA 2I7TA 3KOYA 4LJ5A 1VL1A 4EYEA 5ECGC 3EH1A 1QBKC 3NPMA 5IZCA 3FSRA 4RHFA 2B8JA 4S2EA 1MB0A 3S2IA 4RMNA 5AXDA 4EZIA 1B74A 4KTTE 4CV2A 2PSSA 3T5DA 3WFIA 2UYCA 3ZY6A 4GOJA 2X1HA 2CHEA 1SR8A 2YNMA 3BHJA 4DDTA 5AM2A 2QN3A 2X3YA 1MB9A 5FFMA 5LDHA 1X86B 3DE1X 3SIRA 2OZPA 3DO6A 2FSIA 1CQJA 1QYVA 1KDRA 4TXLA 2AZDA 3ISJA 3Q87B 3LGAA 3FCUB 2XKAA 3ONNA 5L40A 3D0OA 4RHCA 5CD1A 3LIIA 5EJGA 2WLSA 1EYZA 4LJ6A 4XGQA 3S55A 5CG1A 1LJLA 2G9RA 4JS0A 4IL5A 4MV1A 4BFSA 3SQXA 4KRGA 1OI7A 3M34A 1M75A 4P4LA 4C88A 2Q5HA 4IWXA 1Y8CA 1CUZA 1PYGA 3CY6A 1Q21A 4TGLA 5J2TF 3S40A 3TVTA 1QFSA 1Z5VA 3NLLA 5FQOA 1FDRA 1ILWA 2AB0A 1NTRA 5IT0A 4TUYF 1JMVA 4ZRNA 2PVPA 2GCIA 3OQIB 4WDQA 3PNMA 1XCGB 1T2EA 2FFRA 2YICA 1D2NA 3AY3A 2B83A 1ZO8A 3FNRA 3HNPA 4KXVA 4PG6A 5FO0A 2OGUA 2HBYA 4OHWA 5JI3E 4BO5A 1XZIA 3RREA 2J48A 2W4MA 1K2WA 2OV6A 2WHXA 3A37A 2POQX 1K6EA 4LFBB 2ZRKA 4RYLA 5ANRB 1I0LA 4LBZA 5K4AA 4M60A 2I6SA 2RJ3A 2O19A 1H9BA 5B3LA 2FVYA 1XRQA 3UMJA 1XU4A 4A6XA 2OM2A 4OI1A 4OH1A 1EVIA 1JJIA 5JIBA 1I24A 4XCXA 2ZM5A 2B7CA 3NP7A 1N2CA 4QNRA 4DSTA 2BCGY 1BOFA 2FPLA 4PNZA 1HFJA 2ZP1A 3W5BA 1I3LA 2V5AA 3ABIA 3EGDA 4OY3A 3OQPA 3PPYA 5BWOA 2B21A 4KITB 1UMBB 5FKJA 2HM7A 1U0RA 1A3CA 1A98A 3SKVA 3X1JA 1XQ9A 5DGTA 1TIBA 3N5CA 4A03A 3S0JA 5ICMA 4HLUC 5KSOA 1PDOA 3VJRA 2X77A 3LSYA 4YI5A 1A04A 4U02A 3B70A 4HO1X 3MUNA 5J40A 3F7TA 2EBUA 3PUJA 3EPHA 2IYSA 3GQBB 5AM0A 4BASA 3SBEA 2QNRA 3LBIA 1I1HA 1VG0B 4OHBA 3Q15C 2V58A 4A6DA 1X1QA 2DFVA 1Y7PA 5H70A 4BAGA 2PUVA 2WU4A 4JGBA 2VYVA 1AOXA 3OO0A 3TTVA 5ALIA 3GRAA 3GELA 1WLYA 1WLSA 5GGYA 2NUPA 4JB8A 3UAZA 4JKOA 4C3OB 4TKUB 4CKZA 4WBSA 1V37A 1T6BY 4Q66C 3P96A 4RVCA 3RDPA 3TSAA 1I7PA 1NKTA 1WXWA 3CZRA 5K7SA 2CD9A 2EFJA 2X7JA 1ZN9A 1JQEA 3WBJA 3MB5A 2F90A 5IJ9A 1O2DA 2FZCA 2ODAA 4QYXA 3W5CA 4IOJA 3IHLA 1T4CA 3OCCA 2I1VB 3VSEA 4J49A 4Z99A 3GNQA 5BQPA 3DV9A 2Q3EA 3OY7A 2V6FA 4UPEA 5AM5A 4LDRA 1PG0A 4F1JA 3JQ6A 4RD4A 1GZVA 4YAKA 1SCUA 2IBTA 1TQDA 3G2QA 4NYMQ 4ZWNA 1M2VB 1O6FA 4B3DA 2CUNA 2IXFA 5EN4A 5DX1A 3PXBA 2NGRA 3UV7A 3K5IA 3ZCTA 2X14A 3H1GA 4XPIB 3KFLA 3GY0A 1BDIA 2LIVA 4XR4A 2FPRA 1P5RA 2FSSA 5TQ2B 4AN4A 1HSZA 3PXCX 3DE2X 2A0KA 4C0HA 4B3BA 5K0BA 5E95A 3TLEA 4BBZA 1R6DA 2REBA 3UJBA 3TIXB 5CB6A 2Z4SA 4YCBA 1E3TA 3TZCA 2W5UA 1L8LA 4HH0A 3T1TA 2V65A 2P68A 4J1NA 2WZCA 4MB6A 1N57A 1K3TA 2GCGA 1ZISA 4ND5A 5IM4F 1KFBB 4ISCA 4TS4A 3VO1A 5DHQA 2XQFA 4KO1S 3LLSA 4ZO9A 3NDIA 4LMRA 4TTRA 4YBZA 1WUKS 2XYHA 5F76A 3RUCA 3ZD6A 4QYIA 1Z7EA 1XTBA 1RZVA 3UXYA 4FYJA 1OX4A 1X1EA 3NAGA 3OJFA 5LQDA 4MW6A 5I5GA 1DL5A 3GAZA 3GMSA 6LDHA 5KYXB 4I1SA 1MZPA 1P77A 4MQMA 3VYRB 1CEXA 3WVNA 2F00A 4MQ4A 4X94A 3LTEA 3EVNA 4UCFA 1T24A 2P5TB 1OGIA 1FUKA 2Q07A 3P9KA 4AZSA 2PUGA 3A2MA 2GCNA 2MR5A 3INRA 3OCJA 5E3JA 5IAGA 4WIAA 1LLDA 4ZVPA 2VSOA 3F8TA 1YZGA 4FIDA 5KDLA 3GCDA 1QHFA 1QIGA 3ZJYA 3BGWA 1TU3A 1UJCA 3ZIDA 3VR0A 1AQ6A 1SIWA 4W9NA 4G36A 4RKEA 1MTOA 1QH1A 1QAOA 1N6LA 1T3TA 4HAZA 4BEWA 4ESHA 2GVNA 5AIBA 1WTCA 2D7JA 4OK3A 5IUJC 2C78A 2Y1DA 3O2QB 4P81A 1IJEA 1O77A 2GCPA 3K32A 2CMHA 1DBSA 2GS9A 2NV6A 2XCOA 3QPUA 2IEIA 4LN1A 1TVEA 1MD9A 2P2LA 4IRMA 4Q18A 4CRWB 1ZZEA 5EP1A 2OPHA 2NO5A 3N2YA 4QBKA 3NAMA 4RVSA 4S0ZA 2ZYTX 3CH4B 1L5HA 3BDIA 3PKZA 1A2QA 2IP4A 3FMIA 2Q3CA 3L01A 2JIMA 4QT0A 1L4NA 3V8BA 5ALGA 1K66A 3V2GA 3ZJTA 3ZKWB 4LX0A 2ZB2A 3KV3O 4FKMA 1X1RA 4GECA 5C2JB 1JB9A 2IX3A 4WFIA 5DBIA 3ON5A 5BNIA 4K26A 4KXMA 4F84A 2QLTA 2B98A 2IUSA 2FCAA 3MTQA 5TT1A 4O02B 2VHWA 5LZ2A 1UKEA 2W11A 2R1VB 1H05A 1VC2A 3C2QA 4XWKA 4MR9B 3PTZA 4NH4A 1RYMA 4QZVA 1P31A 3MGGA 3EIQA 1YDWA 1GT91 3AU8A 1P9WA 4KG7A 3DBOB 2C4UA 4KPUA 2Q4TA 2OBLA 3IUBA 3HR8A 4RFSB 1KDTA 1YZKA 5G02A 3SHTA 4ASUD 4JJEA 4L4RA 4U6SA 3LE8A 4QUDA 1T5DX 4CM9D 3FTDA 3INTA 2FWPA 3FVTA 4QQRA 3I39X 4MZXA 4E7OA 1E4YA 5AKJA 5JANA 5JUWA 4KGXA 2YWGA 2RBKA 3GFSA 4DM7A 2CXOA 3Q3JB 5JE8A 4DWJA 1PGNA 3L7JA 3VFDA 2RONA 1MG0A 2W9XA 3RTBA 3VNVA 3PD1A 4Q9DA 5KNCD 4P58A 4C6RA 3M0EA 1NJGA 2EARA 3G9ZA 3RAPR 1NZDA 3BILA 2D1QA 2CNKA 4J8PA 4UD6A 1S3SA 3WWZA 3DHVA 5A3JA 2IXEA 3IBSA 1EDOA 4X7BA 3WBFA 5JO0A 4K05A 2YYYA 5A4IS 2D3TA 4P32A 3JWEA 4BLPA 1F8YA 1PBTA 1TCCA 3CF0A 1Y81A 3HBFA 2MYTA 2VDWB 3M6MD 1KQGA 3PE3A 4S05A 3ITNA 4X1YA 5DASA 5FUVA 4NK4A 5A05A 5HQTA 1SCBA 2WSIA 4JUDX 4PM4A 4J76A 3QUCA 3CB4A 3H8VA 3USCS 2VK2A 4XFKA 4NBKA 3D6TB 3WLQA 2EJTA 3JD1A 4YS6A 4OQNA 3BTOA 4UFOA 2X42A 2OUKA 3QVSA 3LC7O 3PQCA 5EE0A 5GQSA 3SBDA 3ZTWA 5CCEA 4MS3B 1PK9A 3CZ9A 3INNA 3TF5A 2E5LB 2PUDA 2I2CA 2BFNA 4JL6A 5HKKD 5JV5A 5FD8A 1BS1A 3QKRB 1QPZA 3FUWA 3C14C 3PENA 3E22A 3EFEA 1YDHA 1IM2A 1TM3E 1NKSA 1N7HA 5BR7A 5I3ZA 4F5YA 1I2DA 2ZVDA 3UBMA 2R48A 4LXXA 1BDJA 1SIBE 2CLHB 2XNKA 2ZG6A 2Q5LA 3HY4A 3IJRA 1SVNA 3LHSA 4PFQA 2XLCA 1ZQ1A 3GUZA 3UK0A 1Z83A 1CR4A 2JJ8A 1SFRA 3NKVA 4RKWA 1DG9A 4QBTA 5T4BA 5BOSA 5K0JA 1K8YB 2I78A 1KO5A 2GEUA 1EA7A 2A30A 2Y0EA 3B9BA 3EFHA 1MC8A 4JWTA 5DKFA 4I4NA 5EIAA 1G20A 5K0TA 3MPUA 1G8JA 3GF4A 5I9MA 2REQB 3PQFA 4TMKA 4YDSA 4YALA 5E8JA 3LZ6A 4NOKA 1E7MA 3WO1A 4P8RA 3HKBB 5CA1A 1ZW6A 1S5PA 5DN6D 2YJ5A 1BYIA 4E03A 1XTIA 1KEEA 4DMHA 3O0TA 2JVIA 2G1JA 1DO0A 2BHTA 1XZBA 3KWJA 5BR8B 5C7OO 4XZ3A 4PAQA 1YASA 1N5IA 3UJ6A 4CLOB 1T4BA 4TTQA 2H5EA 4YCDA 1JLLB 2QTVA 1PG5A 2JFQA 4CIXA 2H6EA 4C1NA 4H7FA 3N87A 2BV3A 2VJLA 1NULA 5C8YF 4C4XA 4EM6A 2V7QA 2A5DA 4O2AF 5EZYF 3U62A 2YUIA 3S2GA 1VL5A 3NT4A 4MICA 3X1XA 2BFBB 1MAAA 1RBZA 4XIJA 3JARB 3ZHQA 2L0XA 3B38A 4I1IA 1ABFA 3RT7A 3CT4A 1BW9B 3EQZA 3ZEIA 1JQDA 5I4CA 2W6ZA 1R27A 3DUFB 2DUUA 1CZUA 4MLZA 4XCVA 3AVWA 2Z2XA 1GT6A 3WNQA 2FSPA 4HNRA 2DFTA 4R71A 4YQEA 1Z6XA 2QTZA 4RHXA 1NIPA 3B6ZA 3F97A 1AH2A 2PNFA 4M53A 4W1RA 3SJUA 4DGSA 1AN9A 5CAEB 2FX3A 1TUEA 2D0DA 4JP8A 5LQCA 4ZOBA 1CVLA 4HH3C 5I8WA 1CRZA 2MINA 3RC2A 4KX3A 1G5PA 4EMTA 2XAAA 2EIHA 4F2GA 3FOFC 4YRCA 3TAHA 3TZEA 3ZDFA 4B4VA 1XCBA 3RRXA 1W85A 1A9SA 1GLNA 1YHYA 3BGSA 3BKWA 1BQEA 1JDJA 4FJ2A 4FW8A 3ZGOA 1XWFA 3DDCA 3DTVA 3KQHA 4BQNA 1XQ6A 4HRVA 2O8DA 3FKQA 3Q0IA 4WUTA 4N7JA 5CRIA 1SHZA 3MCAA 4R0NA 2EP8A 1QGED 4I6JA 4A9AA 1JEEA 1L5QA 2M6SA 1Q1NA 2FPOA 1XF1A 4YLGA 4E32A 4MPTA 4MYDA 2VRNA 3EJ6A 3HI4A 2C5BA 3DHEA 3GA0A 5A3VA 3IOMA 4FE7A 4GKJB 3GGPA 5FLEX 2XQJA 1EUDB 1MB3A 2YN0A 4LYHA 4HNUA 4LCEA 2J59A 4V38A 4CM4A 1FYVA 3PQ8A 2LPMA 621PA 3K8YA 3PC3A 1II8B 4HNQA 2G8NA 1KORA 1G3UA 4P08A 1YCDA 5ALEA 1CUDA 3MWLA 3WLOA 4FILA 1QTNA 2OHFA 3N0XA 4IP0A 4YCMA 5AUPB 4IEEA 1V4BA 1F2DA 2RGUA 1D09A 2W4IA 3M49A 3GYBA 3LLUA 4OBXA 4CUJA 3S2YA 1KEPA 1Z2PX 2HF8A 1KDPA 2MHCA 2UKDA 3AERA 3PNOA 4IFEA 4QDJA 4QJBA 3ZJ5A 4B83A 1FXSA 4IXWA 4LBYA 1DHRA 2ZU6A 5LYJA 3S7ZA 4OJMX 3SS7X 4BFZA 3PFHA 2XIJA 4Q4JB 2ZB4A 4HMOA 3RBVA 1WXEA 1CDEA 4GM0A 3A7DA 3NWJA 4OQFA 4TMTA 1XZ8A 2ATIA 1HE1C 3ISTA 5H4HA 3RU2A 2WG2A 1GZ3A 5EHGA 3C6KA 3CB2A 4M8IA 2CL6X 1TTHA 1Y3IA 2NZJA 5FUBA 4ZV9A 4S24A 3O73A 4FMCB 5FFNA 4XIGS 4TTIA 1JEYB 5FUXA 3PUIA 1FY2A 2FN4A 4PCVA 2RH4A 3M8KA 1NW7A 4ZU6X 1NJ8A 1LBEA 5CH3A 3HXQA 2QE7D 5CM2Z 2QG6A 1RPAA 2Z1MA 4XD7D 2VXOA 5JXHA 4OHVA 3DZDA 4BE9A 1YS9A 3K2BA 2LGJA 3OCZA 1LZLA 3R6TA 1HC7A 1GPYA 1Z88A 2G04A 5KNDD 3VKGA 1KK3A 3HDHA 3P9CA 2FOXA 1UPAA 3RUIA 4C6TB 1C14A 1L5MA 1X19A 3CZQA 3FMGA 1JBQA 1QQ5A 3DKIA 5WRFA 5DM2A 4LK3A 4F9TA 4TL6A 4JNKA 1C0KA 4A6PA 4HF7A 4TVOA 2O1EA 3STVA 3WNCA 2V7GA 4K3VA 1R15A 1J21A 4AROA 1OTHA 3BD6A 4CCAA 4RZSA 2CB9A 3KZVA 2PKQP 3W05A 4G41A 3WGKA 4IDPA 3A6HA 1YD7A 1V1RB 5KOJB 4OHXA 3LLCA 2AFIE 2XMSA 2FR8C 1GPMA 1LNZA 4JSYA 4MV4A 3QEMB 2C03A 5IN5A 1SBHA 3NANA 1U3DA 3A04A 2A9PA 4PSUA 5ALYA 1VPWA 2ZUVA 1NI3A 4H08A 4ZU1X 3WSVA 3CNNA 4HFRA 3SP1A 3WYAA 2O05A 4YRNA 1UMDA 3E70C 3EDRA 3PXUA 5BWCA 5LXTA 2ZRQA 3AR6A 4ESEA 221PA 1NMSA 1FOEB 3ZEAA 1AUVA 4ILKA 3QSYA 1GZ5A 5COAA 4YRGA 2OCKA 3C6YA 2I80A 1YU9A 3ANNA 5FT9A 2HWXA 5LVAA 1WCIA 4BO7A 4E1VA 1CY4A 1XDUA 4TROA 3EG5A 2P40A 3OJLA 3U48A 3VC1A 1T36A 1K86A 4W7HA 3TTXA 4L5BA 1FF9A 2EW8A 5NLLA 2ZIEA 3C3KA 2DCUA 3I2GA 2W6ID 4IIYA 1XK7A 4H6WA 3TI7A 1AKYA 4I5GA 5T4EA 4AQDA 5A0VA 1ZJ4A 4ACBA 2F4VB 3HBJA 1J99A 4GKBA 2QM8A 4KV9A 3UA3A 1LQTA 4AECA 3QKUA 1AKWA 1CQJB 1ZLYA 5CYGA 3OOHA 3MT0A 3VHXA 4ZVQA 3UHFA 4P82A 1EFCA 3MMZA 2YV5A 4UJ3A 1OA0A 4L57A 2Z8ZA 2EKQA 2CHQA 4H7KA 2CXSA 2IZ7A 1W9HA 3M9LA 3RC8A 3GDHA 4DWOA 1MU0A 1DBQA 1V5EA 3EF3A 4JBXA 3VBEA 2PX6A 3GGJA 2MYUA 3I9FA 3GJ0A 4OKSA 1M6EX 3KG2A 2CSUA 2VBFA 5AKKA 2L17A 4AUEA 4LVNA 2UVPB 2Y1WA 2ODNA 3FRIA 1CSEE 3OTWA 1LLQA 1F2VA 1N2EA 3E03A 1MABB 4LTMA 5IANA 1KZGB 4YRTA 3L7LA 1L8AA 2BTOA 2ZJ7A 3F8SA 1LBIA 3Q3EA 2C8KA 3H5AA 1KAOA 4N40A 4BFUA 1K1EA 4K9SA 4TWBA 2VP9A 3QMVA 2H1FA 1OH6A 4O25A 1ES9A 1F4PA 3AHHA 2O0KA 4FINA 4KIFA 2IUFA 4E4RA 5C32A 4WSOA 2FE4A 1GFSA 1YIDA 3SZUA 5F64A 4B76A 3ZD8A 4FB4A 3EGDB 4KGVA 3DMHA 4WOPA 3IELA 4I5FA 3WA6A 2NO7A 4EL0A 3LGSA 3LPCA 4WCFC 3UG7A 6YASA 2MMCA 4FWTA 2FDXA 2OFOA 2Q5IA 4ZV7A 5AW1A 2JG3A 5H3HA 1B23P 3A3KA 4HNAA 3ECCA 3H86A 5EQTA 2AE2A 4QASA 3ZLBA 3OC6A 5DO9A 2DKOA 1VCNA 4MUAA 3JQ7A 3WIOA 5KAPA 5JRJA 4WLUA 3AVUA 3DLCA 4F1KA 3M2PA 4HNGA 2CXHA 2RHJA 3QPBA 2GK7A 2QDXA 3TCKA 4Q05A 1UIRA 1Z06A 5G0TA 4R8MA 5KNLA 1K9SA 2D0PB 1ZCAA 2YC2C 4OYRA 4QU0A 2NUPB 3E81A 3WK5A 5G0VA 2GT1A 1RZRA 3A6KA 2AZMA 5ILGA 4WRRA 3HA3A 2OFPA 2WJWA 721PA 2Q6VA 1VL6A 2FSVA 1I4EB 1SKYB 3WP0A 3FPHA 1FVHA 3IEPA 3NQ41 3PNYA 4RPLA 4X1IB 5JDIA 1UPCA 2HLHA 3LD9A 3ETGA 4H4EA 4AXBA 3BXZA 3F4LA 1T29A 1IMOA 3PTLA 3FNEA 2HA0A 4ZJPA 1AU9A 2FN8A 4TVKA 5EMLA 1IHOA 2PZMA 3HCBA 4BFLA 1N8TA 4X62B 1EUCB 4NCNA 4HZIA 4HPXB 2YYAA 5LQAA 1X7WA 2VHCA 2X8JA 4D0NA 1QKKA 1ZRNA 4Q7LA 1BMTA 4YMGA 2D2VA 3PQ4A 4MRAA 3IVCA 5KYTA 4CL8A 3COVA 3PT9A 4GXNA 4QXOA 3WRYA 1OBFO 2EZUA 3Q5EA 5FPTA 5IVHA 2Q27A 2WUEA 4C4TA 3G8CA 5E7QA 4KNVA 4B6JA 5ER9A 2LCFA 3CEHA 2M2IA 1GV1A 2IYZA 4M7OA 3TQRA 3ASUA 3M4YA 3KJZA 5FL3A 2ZYVX 5ALUA 5ADVA 3FTEA 4YMIA 4V1CA 3KJFA 2JJQA 4B6SA 4JI0B 3NT5A 1W19A 2GRUA 4ISBA 3V8VA 4A91A 1CDZA 1GA4A 3FYTA 1J20A 4BUZA 4D9GA 2WHRA 3D7RA 4M99A 1TX4B 5EIOA 2BC9A 2I91A 5BN5B 1BEEA 4X6XA 2C5HA 1NXTA 4TKLA 2R5NA 4RS3A 5D5QA 4W9RA 3I6QA 1RE0A 2O7QA 1XTRA 4L8WB 5H02A 4LE0A 4OQEA 3C6BA 1PYOA 4L9SA 2DHRA 3L1VA 4RO0A 5FYDA 3V7FA 5KDOA 3QVGB 3SOPA 3C3DA 3E9ZA 1C41A 1Q1GA 2JFYA 3WIUA 1I9GA 3UK1A 2G9VA 1NR5A 2XQVA 4C07A 2BL4A 1CIJA 1PS0A 5ALSA 5H68A 4QFMA 2Q4BA 5LU9A 2B5VA 3D7MA 4LHVA 4EOGA 1B8VA 1CYEA 3AINA 2J6BA 3IDZA 3L7NA 2JFOA 3PGMA 1JEQA 1BEUB 4PSAA 1CERA 5EESA 4AIIA 2PRZA 1IXRC 4R9RA 5IWAB 1KI3A 5ALOA 4GL4A 4YMUA 5MN4A 4MZDA 1SU8A 2QSZA 3H5VA 3ZU2A 5K8CA 1IN5A 3LK7A 3ELYA 3MJRA 4HFJA 5TQJA 4HAUA 3DYBA 1UDBA 3EAQA 2G5CA 1QH1B 5DHAA 4DV0B 2CNDA 5A4FS 1Q17A 3VISA 4E2XA 4BMPB 4F72A 2QNIA 3UB2A 1N5LA 3GPBA 3ORHA 3R9XB 2WQ6A 3D8HA 4MWDA 3O26A 1D2EA 4MUYA 3SYTA 4YRJA 4HQ0A 4FNOA 1MFPA 2GTHA 2X4LA 4MDEA 4RVFA 1AQLA 2P8SA 5TSDA 3SN6A 4PYJA 1FXUA 3JVVA 1FYDA 3NOOA 2KE5A 4AWAA 3KBOA 3IUMA 4CF7A 3K70C 2Z1NA 1KZHA 3TSOA 2RAUA 1Y8ZA 3NT2A 2FN3A 5E7IA 1O57A 4RJLA 2J0QA 4FEYA 1AK1A 1MX1A 1ZOOA 5YASA 3FFAA 1X8KA 1N7GA 5K8TA 1PUJA 3FYUC 4Y18A 1XDZA 2FW1A 2I4RA 2PMWB 1Y0BA 2WMYA 4A73A 3KVOA 1T25A 2P4QA 2PH3A 3T99A 1YRAA 2BUCA 2GPNA 2PTHA 3KHTA 3HXKA 4QO7A 2Q6OA 3IFSA 4PW0A 5IU6A 1E3DA 1NVAA 3E84A 1GZDA 1MOPA 4AP9A 1XTSA 1F1BA 3GLGA 1O4VA 1Z74A 1OLUB 1NW9B 2EHJA 2HA6A 3HACA 4LJ8A 3QVLA 2R79A 1KIFA 3GJZA 4JFRA 1IB6A 4D3SA 1QG0A 1PLLA 4H35A 1UANA 2O2IA 1T5SA 1EGQA 3UNXA 3ZTYA 3G82C 4R3NA 3UJCA 1JPNA 1D2GA 4UW9A 2XV1A 3A28A 4GVXA 4Y2RA 4LKRA 3U56A 3TX6A 1X7YB 3ED5A 2AC4A 2NAFA 2OC9A 1GDDA 1CJBA 4UDNA 5ENZA 4BNMA 1Q0LA 5KWSA 1B3BA 5ALHA 2CKDA 4HN9A 2J3EA 3GW8A 3V2HA 3LW7A 4J9UE 2ZJZA 3RBAA 1WG8A 1YB5A 2OQIA 3C8DA 4EGQA 5JHHB 2XUDA 4YJFA 3O4VA 5L9AA 2FQQA 1Y9ZA 3FDZB 1QKJA 2I3AA 1F8UA 5CT9A 4YIKA 1Z7WA 2W8ZA 1P33A 1YVUA 3IP6A 4IIJA 2J9XB 3ZHSA 4H1TA 4II2A 1G2IA 2P3LA 4IQ8A 2A1IA 1I33A 2QIPA 2ZSIA 4FHGA 3DPUA 4JJGA 4JSTA 1VBNA 4M0FA 1T8SA 1GNVA 1MDBA 3SZMA 5ARBA 1YA8A 4EQZA 4AKIA 4B84A 5EWMA 5BVHB 2NMVA 2F3UA 4R9UC 5KSYA 4JLAA 4O2BA 1RTTA 4XI9A 3WK8A 1GCGA 3PUKA 2PKQO 2HZ7A 5TB5A 5AOVA 1FMFA 1U3VA 1HORA 3EDOA 3WGHA 4N01A 3GAFA 2RH8A 1OPRA 3HCCA 5AXCA 2GPWA 1D1SA 1QV6A 2P3OA 2F9LA 2R7MA 3HV0A 5BOSB 1J8FA 1OWPA 2FHSA 2I3BA 3D3NA 4OHFA 4I4TB 3C5VA 4OEHA 1G9TA 4RL4A 4X8LA 1G20B 4YFVA 5J1SB 4A8JA 3EZXA 2IIVA 3ABOB 3DD5A 1M34B 4Q4LA 3OWOA 1PNVA 2YHSA 3GVXA 3PYXA 3HV2A 1IY1A 4MVJH 4XM0A 1SCAA 5HUHA 4QXPA 2HSGA 5IK2A 1M7BA 4JP5A 2DHEA 1IOVA 3Q1LA 3T3PB 1BMQA 1MOSA 1P7VA 3ET4A 3K9GA 4ZEMA 3ZI4A 1L7OA 5HCIA 2GAAA 1ACJA 5LP6A 2VRWA 1DX4A 4ND8B 1A9PA 2ZYHA 5A6VA 2OCAA 1I6MA 3MMPA 5DYIA 4HQ6A 2WNIA 4RAOA 1G42A 1Z73A 3ORRA 3AF6A 2W2MA 2YW2A 4BPRA 4LHSA 2FEPA 4PYRA 1EAMA 1Z38A 4WJKB 3ROMA 2XMDA 3HYRA 3OD5A 4M54A 4GLBA 1Q15A 3KJIA 3QU7A 4MV3A 1SRQA 1G3QA 4QOJA 5CDTA 1RWNA 3EGEA 3V8MA 4P98A 2WNSA 3BD9A 3ELDA 3FGPA 3UQZA 3VGJA 5ARCA 3BIFA 1DEXA 4BVGA 1UM9A 2I4OA 2LRHA 1XEWX 1FSFA 2IHYA 1ONNA 4Q1FA 1RAIA 2G28A 4H7EA 1R1DA 4QRDA 4X24A 1NV9A 4WW0A 5AXAA 5JSZA 4CMHA 1PVVA 3PP8A 2IZ1A 1CXZA 2YY7A 5FOTA 3H2YA 4CEJA 3G2NA 2QMEA 3CLSD 4TMZA 5J58A 1RADA 2PH7A 3HVHA 4U0KA 1E5XA 2WWGA 4B5KA 2HSJA 3EIXA 2G0TA 4D74A 1QYIA 1X1AA 3TLGA 1N9GB 2OFFA 3ROXA 5JSKA 4PHTA 3ITEA 1HETA 4D4KA 5EVCA 1M8FA 2R62A 1UFRA 2CMFA 2B9VA 2FZEA 3LZCA 4MTCA 4BNDB 1F06A 5L3SA 4AD8A 4YCNA 3GUCA 4TM7A 3P71T 3R8FA 5DNCA 3RSLA 3SJAA 1JFLA 1P1HA 4CF6A 1GAXA 2O8DB 1E8DA 1M9NA 2BFCA 1TZ2A 4IDQA 5EHQA 4DHEA 4UQLA 2PJRA 2J45A 2H00A 4RTNA 4Q93A 1X9GA 3UM9A 2W6NA 1CUVA 5BVGB 2QRNA 1ZCBA 3TQHA 1E4EA 3D5EA 3N5KA 2CBXA 4KTVE 3RJ5A 4NPHA 1UJMA 2FWIA 3RYHA 4C1BA 3OT4A 1Y98A 1ZL0A 1IBMB 1EUYA 2DBYA 3ND9A 1KI4A 2PA3A 4LSGA 1NR7A 1U3UA 3PEFA 2AMJA 4PNEA 1VBKA 1BJTA 4JBIA 2R8RA 2N75A 3LKDA 1PJTA 2XX3A 4WCFB 3UWSA 1LEHA 2G07A 1XMQB 4H59A 1QDLB 1QZ3A 3T38A 5AJUA 1KI9A 4F56A 1NZJA 2I76A 3FAKA 1W88A 4I6EA 3CQ9A 5AVOA 2NO0A 4PZZA 4JC4A 3S28A 2D13A 2G5TA 1SD5A 2IPAB 5H3CA 2FFBA 3CLTC 3W79A 4RTSA 2LCIA 1NUQA 3TQTA 3HXPA 1KGDA 4MLDA 2H2AA 2VBCA 1CP2A 3AUAA 4JASB 4ZCMA 3EFOB 5IXYA 1TCVA 3DA8A 1ZUNB 3JD4A 3A1WA 3T0FA 3UK6A 1TAUA 3KYIB 2CC2A 3BM5A 5CPBA 1QAQA 4A0HA 4PXAA 1LVHA 3A2LA 4FCTA 3V97A 1FLDA 1I6WA 2FLVA 2Q3HA 3NUQA 3KSAC 2QQ0A 3PXXA 5FXMA 3U16A 1C3OB 1KJQA 4B85A 2V7QD 4TTAA 1AMOA 3F46A 5IDQA 2A1TR 2V97A 4FONA 2Z6QA 3E9MA 3HA7A 4ARCA 4AZ3A 2F64A 4N4AA 4IQGA 2D8MA 5ELMA 3MGBA 4RKFA 2PU7A 4IJKA 4E07A 2FJPA 4ARBA 1PS9A 2PIDA 4UDYX 2BBTA 3HXLA 2ZSUA 4G97A 4KIJA 3NTQA 2IC5A 5I7FA 4GX0A 3CM0A 3AG6A 1WF3A 3D4LA 4FZJA 2XSZA 2GOYA 4E0BA 2EU8A 3AVVA 1BWQA 1NVDA 3L79A 4B8WA 4L8GA 1JB1A 3LYAA 3W5AA 2NP7A 2CJWB 1P2DA 1Z18A 3L0SA 4WLEA 1NUPA 3H8WA 4NDAA 4ZA2A 1CW2B 3RNOA 1EP3B 3F1KA 3JYLA 3I23A 5FI5A 2DSNA 2ES4A 4MCJA 1CWUA 1PT7A 3D8TA 4RH3A 3UPTA 2F3PA 2RGBA 3BH0A 3KXLA 3LCCA 3ZE1B 1WW2A 1QOZA 1HMYA 1PNTA 1LLUA 1U7WA 1UMDB 1FFAA 1V8FA 2Y6UA 3DTVD 3VOBA 5LXTB 5HRUA 1E6WA 1GAEO 1XZKA 1Z4PX 3GRKA 2C2XA 3LBAA 1E7RA 2JFGA 2Q9CA 3VVCA 3WYGA 5KWJA 4L5IA 1MH1A 1NL3A 5EHXA 4ROSA 1BCSA 1YZQA 2EL7A 3T9CA 2AMLA 2VYCA 1WCV1 4RNCA 1F17A 4P36A 3KQUA 1T36B 1MO3A 4I2VA 2BEJA 3V48A 2HF2A 1TJ3A 3NFRA 1KSJA 4ZODA 5ESWA 4QFCA 3HYCA 1B00A 2Q5CA 2QTHA 3CXRA 3KJQA 4X91A 2P30A 2WFMA 3FF1A 5IMSA 5L6MB 4KWEA 1EFDN 5FL7A 5DM60 1Z6QA 3EXHC 3U1VA 1M67A 1NJSA 3N2EA 4NDZA 1HBJA 4W7IA 4CEHB 2AOWA 1P1BA 3GJ8A 4H15A 4CCSA 2YXDA 3P2YA 4N3BA 1XD8A 4ZJZA 2JFWA 1UEXC 4UTXA 1RM5A 1F14A 3I1IA 4ECEA 5KQPA 3IBTA 3T06B 2VAXA 3RUHA 2QLFA 3ZYCA 1CETA 4CU2A 4B74A 5KSWB 5KVAA 3W7VA 3NNDA 4WNYA 3OF3A 1B6RA 2VSFA 3QXJA 2C0QA 1PWXA 1ODKA 4HYYA 3RTGA 4BYMA 2OM6A 4GYWA 1U8YA 2EFCB 1NMYA 5DNAA 4C7MA 2NN3C 1CB0A 2QUBA 2VJPA 4Z3DA 5KSZA 1EFAA 1GFIA 1XZDA 1RMYA 3DTYA 4QHSA 2WWIA 3IH5A 2OXIA 3EUFA 1F0PA 1C8BA 2NZVG 3NBMA 4LNHA 4P83A 4EMUA 4MHTA 1ZAKA 1OWMA 1RYFA 3I12A 4L75A 3V80A 2OXTA 1SVOA 2A5FA 3JQGB 1IK6A 3R0IA 3OT1A 2BMVA 1MFZA 1NPDA 2ZBGA 3BGIA 3CU5A 3QJ5A 4H6PA 3H3JA 3LO8A 4JLWA 1LGYA 4GPZA 1VI2A 1Z0DA 4K81B 1COWA 3FYUB 3K9WA 1VJ0A 2HYIC 3EEYA 1VRCA 3SR3A 3TRHA 4IIHA 4Y9SA 2ASEA 4OBWA 1T0JB 3SXUA 4Z7NB 3C70A 1HOXA 3B1KA 2HR1A 1I7NA 4URWR 4DIFA 4RH1A 1XVVA 3ZE0B 1ODLA 1P6XA 3IDFA 5J9FA 2Q2VA 1GKLA 1TRHA 4ND2A 5E6SA 2ARKA 2BTEA 2Z83A 1N2BA 1P5FA 4WK6A 1ESEA 4IDGA 4NJMB 4EG8A 3SF8B 1AF4A 1T1EA 3AP3A 4XYMA 4YH1A 5ALLA 4KDRA 2WJVA 3AF4A 2C8VA 5AKXA 2ZJ6A 1S96A 5D86A 1U7XA 4LDAA 5LMNB 1WETA 3LF2A 4BMZA 1WXDA 2P0YA 2NZYA 3X2SA 4JLJA 3GVHA 1FYWA 4JXJA 4QD3A 2FPGA 1NBEA 1PG2A 3A10A 1DLJA 2Q8PA 3B8HA 1TVKA 5GV7A 1GL7A 4C2UA 1E1RA 3IUSA 3QFCA 1CY8A 3SI7A 1RRVA 2ZR7A 1Z28A 3MJ4A 3Q7RA 4URZR 3ZW7A 3VO9A 2ORVA 4NE7A 5HBGA 3RYIA 1X42A 1UUFA 2FR0A 4FYIA 1PJ3A 2VG8A 5HNKA 2QZPA 1DPFA 1DKQA 2PX4A 5IH3A 5HK9A 1MRSA 2WZDA 1X7WB 4YP1A 4IJUA 1JVSA 1YHNA 3GCZA 3JSAA 3P2MA 1OVMA 2COEA 2EYQA 4DJ5X 4CMEC 2QIOA 1YQTA 2VCHA 3H2SA 2G5GX 3CNEA 2WEKA 4CQJA 1UXKA 3GEMA 3F3SA 1FZTA 3DAGA 4HGOA 3WB0A 5EIEA 5FPSA 3WGLA 3P27A 1A4IA 2I9KA 4EG6A 4O6VA 3G0DA 4G25A 2O8EA 3O4GA 4Q4AB 3ORQA 2OV1A 1E5DA 4EKIA 1Y6QA 4Z3KA 2EOAA 4KSCA 1KNQA 5HF8A 5JD4A 1XI2A 4CG3A 4NMHA 2OMEA 5KOHA 4MVYA 3ZQKA 4NMMA 2JFUA 3D02A 3G13A 1WB9A 1DC7A 3CGGA 1OFTA 3U7EB 3ZDDA 3WG9A 3G9XA 3Q3IA 4QUJA 1VPLA 1XMJA 3D64A 2AR7A 3ANTA 1Q83A 4EL5A 5BW5A 3O9MA 3SSOA 5ITZA 1SXJE 4P1ZA 3CEMA 5IARA 2VVTA 3D6NB 1IN1A 2P9BA 3DJFA 2IYAA 3G88A 3LQFA 4R6WA 4ABYA 2R6FA 4LPKA 2AKEA 4FW9A 3E5HA 3FLAA 3O3MB 3PL5A 2O8FA 2JDIA 1SZDA 1ZVKA 5ALVA 3ONDA 1DKMA 2EJVA 2E4VA 2IELA 1DJQA 1UK9A 2VDUE 2VR1A 3AM3A 2Q0QA 5AVVA 3HUDA 5HZKA 3HO6A 3E1KA 2FZWA 2NW6A 3ABZA 3T5GA 3KPYA 5SY6A 5JY1A 5DB4A 3ZDAA 2QXUA 2IU6A 1EK0A 2RHWA 3Q4GA 4ZEWA 1JWLA 4QA9A 3KKKA 3FUTA 3ELWA 1WXIA 4MQFB 3B9RA 1Y4DE 4RHTA 3WQRA 2JVKA 5K0EA 2CJFA 3WWOA 1P91A 3OPQA 4YUXA 1PS8A 5AESA 3NBYC 5B7GA 1UWVA 1ZCFA 2HX1A 1WSBA 3M6LA 1PJLA 3TRFA 3H9CA 1RZRD 2ZCUA 4FNAA 4EGCB 4B3GA 4U2GA 2O14A 3GRFA 2AMYA 4RIGA 4UEJA 5IBQA 3G49A 2Q9BA 3I32A