4I2VA

X-ray structure of the unliganded uridine phosphorylase from yersinia pseudotuberculosis at 2.12a resolution
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
250
structure length
250
Chain Sequence
SDVFHLGLTKNDLQGATLAIVPGDPQRVEKIAKLMDNPVHLASHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGVRTFLRIGTTGAIQPHINVGDVLVTTAAVRLDGASLHFAPMEFPAVADFSCTTALVNAAKSVGATTHIGITASSDTFYPGQERYDTFSGRVVRHFKGSMEEWQSMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNEETMKATESHAVKIVVEAARHLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of the unliganded uridine phosphorylase from Yersinia pseudotuberculosis at 2.12A resolution
rcsb
source organism Yersinia pseudotuberculosis
molecule tags Transferase
molecule keywords Uridine phosphorylase
total genus 77
structure length 250
sequence length 250
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2012-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4i2vA00
1A9SA 1JDTA 4GLFA 4L5AA 1SQ6A 1PR0A 3NM6B 3OZEA 4TXJA 5K1ZA 1A9TA 2PGAA 3BJEA 3OOHA 1Y6QA 4QATA 4TXNA 1RXCA 3E9RA 1A9OA 5F77A 3F8WA 4BMXA 1PW7A 1JP7A 1NW4A 1RR6A 1TCUA 3OZDA 5CCEA 2HWUA 5F7XA 3BSFA 1TCVA 1PR1A 1Z5NA 4YO8A 4DABA 3UAVA 1T8WA 3MMSA 2ON6A 1JDUA 3ONVA 1LVUA 1V48A 4DARA 3KVRA 1SD1A 2AI2A 3EUEA 4GKAA 1Y6RA 1Z38A 4D98A 4WKCA 1PR4A 3LGSA 1QE5A 4F1WA 3EEIA 1WTAA 3DF9A 3ODGA 2HSWA 1RCTE 3GB9A 3IEXA 3DJFA 1K9SA 4K6OA 1YRYE 4I2VA 3P0EA 2AI1A 3OOEA 1JE1A 1G2OA 3IOMA 3OPVA 1OU4A 3MB8A 3DDOA 3FUCA 1Y1TA 1PBNA 1V41E 3O4VA 1TGYA 1OTYA 5B7QA 1A69A 1CB0A 3PNSA 1A9QA 1OUMA 5B7GA 1Y1QA 3DPSA 4IP0A 3E0QA 2BSXA 3FNQA 1V2HE 4QEZA 1PK9A 4M3NA 1K3FA 1OTXA 3NM4A 5B7PA 4YNBA 2OC9A 2QPLA 2B94A 1V3QE 4OGKA 4X24A 4M7WA 4WKPA 3EUFA 1RXYA 2OC4A 5EFOA 1I80A 4OY3A 1VMKA 4KN5A 1VHJA 3UAXA 1YQUA 1YBFA 4TXHA 1SJ9A 1A9RA 1PK7A 1VHWA 3KVYA 3PHCA 1RSZA 3OZBA 1T8YA 4DA7A 4F2PA 4L5YA 1ULBA 3FB1A 4PNPA 3DP9A 3U40A 4UC0A 4D8VA 5F73A 1ECPA 4OJTA 4D9HA 4LNHA 4F3CA 1Z34A 4JP5A 4TYMA 5EUBA 4OGLA 4JWTA 5C80A 1PR2A 1TGVA 5CYGA 2RJ3A 2QSUA 5CCDA 4YJKA 4OEHA 1T8RA 5JPCA 4TTAA 4BN0A 4L0MA 3BGSA 4NY1A 4G89A 3P0FA 4MCIA 5IU6A 3PHBE 4R2WA 3T94A 1Z5PA 2OECA 1U1GA 3OZCA 4L6IA 4RJ2A 3UAZA 2GUWA 4QASA 3EMVA 4NS1A 3UAWA 1T8SA 3LBAA 3D1VA 3OCCA 1Q1GA 4PR3A 1Z35A 1A9PA 4DA6A 4EARA 4TXLA 4D8XA 2ISCA 5CXQA 3O6VA 1PR5A 5CXSA 3UT6A 1N3IA 1RXUA 3C74A 3SCZA 4EB8A 2HN9A 3FOWA 1B8NA 1JDZA 5F7OA 1Y1SA 1U1CA 5B7NA 1PF7E 1NC3A 1XE3A 4LNAA 4JOSA 1U1EA 3NM5A 4LZWA 4F2WA 1U1DA 3K8QA 3OF3A 1RFGE 1FXUA 3KU4A 1Z5OA 5KB3A 2I4TA 1JDVA 3ENZA 1ODIA 4M1EA 4DA8A 3KUKA 4TS9A 4BMYA 2A0WA 1RXSA 1K27A 2OXFA 1CG6A 4G41A 1U1FA 2IQ5A 4D8YA 2HRDA 4ECEA 4OF4A 5F78A 2AI3A 5F7ZA 1JPVA 2QTTA 4BMZA 1JDSA 4MARA 5FAKA 4GLJA 1YR3A 4MCHA 1JE0A 1PKEA 4LDNA 1NC1A 4L5CA 1T0UA 4WKBA 3E9ZA 2Q7OE 1RT9A 3PNPA 1ZL2A 3KHSA 5ETJA 4YMLA 2QTGA 1B8OA 4WKNA 5I3CA 4U2KA 2AC7A 1PWYE 1LV8A 1PR6A 3BL6A 3GGSA 4H1TA 5IFKA 4QAQA 4TTIA 3LA8A 5F76A 4GMHA 4FFSA 3TL6A 1Z39A 4LKRA 1ULAA 4NSNA 4QFBA 4F3KA 3FAZA 1ODLA 2A0XA 4TTJA 1Z33A 2H8GA 4G8JA 1Y1RA 3KVVA 4P54A 4E1VA 4QARA 1YQQA 3K8OE 3INYA 1RYZA 3FWPA 4DANA 2XRFA 1OV6A 1ODKA 2A0YA 3QPBA 1Z37A 4WKOA 1ODJA 4TXMA 1VFNA 5CYFA 4DAOA 1OVGA 3NBQA 4R2XA 1LX7A 1M73E 1V4NA 5DK6A 4TS3A 5F7JA 4DA0A 1JYSA 4R31A 1Z36A 1TD1A 2I8AA 4DAEA 2A8YA 1C3XA 1V45E 1ZOSA 1SD2A 5EPUA 2QDKA 2P4SA 3UAYA
chains in the Genus database with same CATH superfamily
2A9VA 2DPHA 3AT1A 4D3FA 3IV6A 5F64A 3ITNA 1GYRA 2GESA 4BVFA 2C7VA 2BSAA 4MWDA 5LN1A 1OYWA 4N9QA 1P60A 1WUYA 1DSSG 2Z2XA 3NM6B 3WFJA 1GTZA 2QTMA 4DBVO 5CB6A 5FUYA 2XWPA 4KR9A 1OB2A 5EMNA 1KMHB 1Y1PA 3OD1A 1J06A 1MUUA 5DHRA 3HCAA 5HRAA 2P2LA 3JAMA 1SO8A 3W5CA 1WBDA 2HJWA 4S1TA 3OEHA 4B44A 5LP6F 2CT8A 2YASA 2OAEA 3AW8A 1OXMA 3VPSA 4BGUA 3TEJA 4DZZA 3C6MA 4P82A 5BWMA 3C7CB 2FCRA 4Q3DA 3CVOA 3TBKA 1P8JA 2F64A 3FLAA 4QUGA 4HRAA 3VPAA 4CM8A 2LRHA 1YS9A 5F21A 1NW4A 3H4MA 4OL9A 4B75A 1XMSA 5LDHA 5C51B 1PE0A 4PV7A 2IYZA 3IIEA 4GDMA 2FJUA 4KQ6A 4UUOA 3VPHA 3WGYA 1RZVA 3O26A 1QYIA 4PFKA 1EXMA 1J42A 1XDZA 2IZ5A 3G2QA 3GCXA 5JZSA 1E8MA 1ND6A 3DE6X 2C94A 3GAAA 3O38A 3SQWA 1CUXA 1WD7A 3STXA 5IT9A 4ARVA 3QU7A 1XDWA 5FT9A 5BQPA 1IK4A 2YWCA 3HB5X 3LLCA 2EG5A 4MV6A 1SMKA 4O4HA 1Z7YA 2H7XA 4JVSB 4G4SP 1M1NB 4KSYA 2ON6A 4H1WA 1GGNA 2ZRMA 4V3CA 3VKFA 2QJTA 2XTJA 4Q00A 4TYYA 3A7EA 4Y30A 5DO9A 4NARA 4R8SA 3PUXA 5EJ7A 5EHNA 2Z1NA 5L4NA 1KJ9A 3F78A 4WNAA 3VVLA 4E5KA 1HRKA 4DUPA 5HS4A 3SYLA 5D7BA 9GPBA 4MWOA 4RD2A 5AUQA 2WD9A 4MS3A 4C3OB 5LXTB 2HLDA 1NUUA 3R7LA 3VKUA 2BGWA 3BSSA 3PDWA 1HEYA 2BELA 4WTOA 1E5LA 3A70A 5JRDS 3HFGA 3FJ1A 3LHDA 4KP7A 1BS2A 3JQFC 3NDPA 4K9NA 5FTJA 4L15A 4C3VA 1ZU5A 4CGYA 4DF3A 4I4TB 1KK2A 1NDHA 4CCYA 3NH9A 1SU8A 4QYIA 3ZWBA 1YCGA 2PQ2A 2QYSA 3I9OA 4NENB 4TT3D 4DWJA 2XE7A 3EK2A 1OI2A 3I23A 3ID6C 1RPJA 5KI6A 4R6XA 3BE5A 3DF9A 5JAHA 3OY2A 1U90A 1ZWLA 1N6IA 3A10A 3N8HA 1G0OA 4K40A 4AWXA 4XWGA 4TRRA 2DFKB 3LF2A 4YRSA 5M29A 4JC0A 1K9SA 5FUXA 5B3LA 1W2GA 3VJLA 5MF6A 4DL9A 2R00A 1C30B 4J9UE 5JATA 2YUTA 4ALJA 2G0NA 2QJOA 1OAAA 3F97A 2R65A 2SKCA 3ONDA 3SM9A 3ZDZB 4D4MA 5JXJA 3PR2B 3WIBA 1NYRA 1U94A 2FLKA 2VUUA 2EBUA 3BRQA 4HH1A 4MUBA 3TW0A 2UAGA 3H2SA 2GJSA 2RK3A 5B5SA 1KQPA 4L0CA 3BAZA 1MX3A 2FPSA 3MB8A 4E08A 3DT8A 2OILA 3N58A 5C0OE 2CGEA 1BRMA 2I55A 3RWBA 4BLTA 4I1IA 4NBVA 5K4AA 2Z5FA 4FGSA 4KAJA 2XADA 4ZPXA 2FVXA 1ST2A 3OZGA 1CQJA 4DJJA 3A2MA 4X44A 3S2IA 3ONEA 2BHNA 3ZXUB 4XQCA 1YZVA 2ZUDA 3LBYA 2BZGA 3KEFA 4HFNA 4NNJA 2PUAA 3KKEA 1OZFA 4UHJA 4W99A 3DPSA 1QTIA 3P0IA 3SKXA 2OBNA 2QRMA 1MO6A 3F7NA 1GTRA 1HUQA 4S1WA 1TM4E 1DTWA 2B0JA 1SBZA 1T13A 5E6RB 2O2YA 4J4TA 3I1YA 2G1AA 3EAFA 4O2BF 4BIIA 5KVAA 3CLTD 2L18A 2MYUA 3AHIA 3BMNB 4PLPA 5BQ5A 1D1QA 4R05A 5TGTA 1TZMA 5JLJA 5LB4A 2NSHA 3ZHQA 3W6OA 5CA1B 1KZ7B 2PFKA 2QRJA 3CRQA 4M9CA 3BGOS 1HQCA 1XTZA 2IRWA 4NK4A 4U3JA 4EOGA 1U31A 5ERXA 1K7CA 1T4MA 3TO5A 1RHJA 1PW5A 3NV9A 1O95A 1A9XA 4DV0B 3P45A 1L3BA 3HN6A 3QITA 1GYQA 2XKJE 2ZU6A 1DJQA 4RKFA 1PN3A 4HBGA 1EQUA 3KVYA 5LFAA 1R4MA 3DBHB 3F5SA 4Q3LA 4AJEA 2DFLA 5IKPA 1N6LA 4ZQGA 1IMOA 4JELA 3W8EA 2FMTA 3CRZA 3V7UA 4DBLE 4A0QA 3TG8A 1DKOA 2JGRA 2Q6TA 5KPJA 1X1BA 4JP1A 4YPOA 3W2GA 2WWXA 2J67A 3U40A 2EP5A 2G9QA 3M1LA 4A8HA 5JYEA 2FRXA 3DVLA 3H5RA 3LO8A 4TTVA 5FQNA 3B2NA 3ZGYA 2FU5C 2QTNA 4ARZB 5JUWA 1UM9B 3L7IA 1JEYB 1XEXA 3DEAA 4PC7A 4YGXB 1RXEA 5DSXA 1KZ9A 1IB6A 3B3GA 1QP0A 4O1HA 5DYYA 3EZ9A 5DHUA 5L7YA 3LXRA 4K28A 4X8OA 2A1TS 4PICA 2JFGA 3GGOA 5EPEA 1E2HA 2Z83A 3K3PA 1KZHA 4EPWA 1TA9A 3D8UA 3F1KA 2V7TA 1VKRA 4J1TC 4MIOA 1GA6A 4DKJA 3GJRA 5FPPA 3KAQA 2B8WA 3OFNA 1OGIA 5K01A 1BCRA 1LH0A 1TCAA 1YQWA 3O4HA 4GMGA 1FDWA 4MS4A 5HCIA 3EXIB 1ABEA 2JBHA 3QIAA 5G3YA 4BV3A 3ETLA 1RPNA 1EZ4A 2CLFB 4FJ1A 3ZDEA 1L1RA 1EM6A 4UJ3A 3I34X 1BMDA 1DMRA 2R7LA 3NQ41 1ZGZA 1E1QD 3BWXA 5DNDA 3HYNA 5EZ5A 1U2DA 4QAJA 1GQOA 3C41J 3WFZA 1O96A 2NU8A 1GRQA 2EATA 4BX0A 2KBFA 3AIIA 4GS5A 1DDOA 3C6KA 3ZD6A 2WJZB 1VHLA 4YRGA 1ML4A 2JGAA 3PHBE 4Z54A 3HE3A 3R8XA 1NX6A 5IP5A 1QCCA 3TQIA 2O06A 4AQDA 5TF4A 2QX9A 3L6CA 3CC8A 1M10A 2UZ3A 2HU8A 1ZZEA 1BGWA 1ZUNB 3SFZA 4DMGA 4EB6A 3O9ZA 2ZCJA 4FJ2A 2J9GA 4ACAA 3KU1A 4LC1A 4Z3DA 3L43A 2MYNA 3L4SO 4GSKA 5BNIA 1Q3HA 4OHUA 2XBUA 3U7HB 4CGZA 2HZ7A 1E2EA 1XDSA 3N76A 3CF4A 1VLHA 4I6GA 2RAVA 4RQTA 1HL3A 1AKTA 4CQLB 2W6MA 5G3ZA 5JSQA 4LZAA 2Q5FA 1JYFA 2X4IA 3KHUA 1RI5A 1JU9A 3PGLA 1AXGA 4XRGA 2FR1A 3IGFA 1LNZA 4WZBB 2OYCA 1YD7A 2BUCA 2OV6A 2ZVDA 3MSCA 3UEOA 2RI6A 3SE7A 4KFRA 5JSHA 3L1VA 1CY8A 2XEDA 4KUHA 4WJLA 4ABYA 1JEOA 1NVVR 4MVXA 4CW7A 5JE8A 4RTNA 2M6KA 2DLCX 5HRCA 1BS9A 1JDZA 3I05A 4EB6B 5JBNA 4X20A 4FC7A 4PBTA 3ICQB 4UQOA 3MMXA 1XBTA 3RC1A 2XDYA 3ESCA 1I9CA 4O2AB 3NWOA 4R7GA 3GRFA 4NYJQ 4V1CB 2Z6UA 1VKJA 4R7ZA 5ICFA 4LGYA 4CF7A 2CEAA 1XD2A 2I22A 2O3RA 4Z4EA 4K46A 3ZHXA 5KJEA 4JT9A 2FKNA 1VB3A 2WUEA 2EHJA 1I9GA 4FZ3A 5DNUA 5M7EA 3ORQA 3DS8A 2GGSA 3PFNA 1W73A 4P98A 4BPRA 3Q40A 1ENPA 3HC7A 2K7ZA 3IVMA 3K0BA 3GRKA 3K0FB 4O02B 2BFCB 1L4KA 4PLFA 3T7JA 1EH5A 3QY0A 1C0PA 4O1IA 4AW9A 1P0MA 2PV7A 1AU9A 2VQ3A 3EQ9A 3ZOZA 3PGVA 4MCAA 4OGGA 2DPMA 3GJXC 3CVYA 5JLAA 3R0IA 1Z15A 4HDRA 3MWFA 4YREA 5ERGB 3NW9A 4Q9JA 1LZLA 1EXNA 1R37A 2A5JA 4I1UA 3LH5A 4BGVA 1KJ8A 1QH1B 2HX1A 5ENVA 1ZMOA 4J7AA 2QRVA 4QYTA 2H1WA 1EDBA 4UBJA 2AHOA 1H4SA 2QZJA 3P19A 4AG5A 4KQXA 1JHMA 5K51A 2YIJA 1UMKA 1NG9A 4BECA 2CYBA 2GNPA 3OLZA 1D1TA 1A2KC 1KMNA 2RGCA 2Z8YM 3NYRA 1XK7A 1II8A 3UOAB 3TH5A 5FLYA 3O0DA 3K0FA 3GA5A 2GKSA 3K70C 5HFAA 4BKMA 4I7EA 4L2IA 4ABTA 4AY2A 3N8NA 3UB4A 3VU9A 1RMTA 2G4LA 4NVRA 4X97A 1XZDA 2BEUA 5F3DA 3ACBA 4MVWA 5DYWA 1DC6A 4CR8A 2FEOA 2DHDA 4N3CA 1HQDA 1KFKB 4PZYA 3WLOA 1KNXA 2FSUA 2ZRFA 1I0LA 1KGDA 1R9MA 2C0QA 2C7BA 1CLEA 1NJ5A 2F00A 3G2LA 1ICEA 4AUEA 3G5TA 4JI0B 1N0IA 2HM7A 3R9KA 1T43A 1JDBC 4GQBA 4OPMA 4AC9A 3CX3A 3V34A 4U7HA 5DTQA 1CU1A 1E3IA 3QI7A 1LFAA 4LTNA 821PA 1P1KA 4K05A 3VZPA 1BW9B 1UK9A 5KQRA 1M6WA 1SQFA 4G9GA 5IF9A 2YMLA 1EP1B 2VPXA 3DHEA 3U3OA 5K3EA 1XAIA 3CB4A 2ZUVA 1YKFA 5DCWA 5F51A 3AU8A 4CLXA 4HN9A 1I4TD 3DV0A 3VDXA 2VDVE 4IQ8A 2ISQA 2FQ1A 4TS4A 5CB4F 4NV3A 2C3MA 1KOFA 3NGXA 2EDCA 3H1FA 4G3XA 2A58A 4JB2A 3BE6A 1G21B 5C3UA 1YV9A 3ON5A 3GIDA 3Q7RA 1HG0A 1G42A 1ZVQA 4FT2A 4U6SA 5JPDA 3EMBA 5ERYA 4D2IA 2PX5A 4H7KA 2JFVA 3OPMA 4JU9A 1WCV1 3ZLBA 2VRNA 3OHMA 4ZMBA 4JS0A 4WLUA 1TVCA 3TLGB 2H54A 3DKPA 4CMEA 1SBYA 1NZDA 2GTPA 3E7PA 2G1KA 3LHFA 2EFGA 3Q8MA 2M1XA 1J0CA 2WD8A 4HEA1 4C0QC 3AI1A 2ZIXA 5BR4A 2UUOA 1CRLA 2AS0A 2MYTA 3LP5A 5AM1A 3TDKA 2Q5CA 1X80B 3RJTA 4WCDA 5CP8A 4LHEA 4D6PA 4CZ2A 2JDIA 1X38A 3PFBA 1A5SB 2WB4A 1S2IA 5TQJA 4RXMA 1LKZA 4M49A 1J4AA 2WM3A 4R5MA 3AFOA 4N03A 5FKJA 4AP5A 1KFJB 1XTPA 2HXYA 4HH4A 2C78A 5CA1F 1KS9A 3RS7A 1N9GA 1F06A 1V8OA 3LUJA 4MX8A 1DUIA 2ZJ7A 1U9ZA 2WVHA 2QRZA 1W8DA 2X8JB 2RKBA 2XYGA 4FSXA 5TEVA 2I2FA 3DL0A 4QDOA 2OBFA 2OQ2A 3R3SA 4J8PA 5E3JA 4P7KA 4BTLA 4KQKA 4YASA 2CJYA 3HBAA 3O82A 4LZPA 4YTEA 2KS6A 1YCDA 2UKDA 1PLJA 3ZY6A 3UJNA 3T4EA 3LNTA 1AMOA 1XEXB 1FTWA 3QSGA 2IYRA 4O63O 4X63A 3VNVA 2MMCA 4NPCA 4OP1A 1CZNA 1L5NA 2ASVA 5AM5A 1E2BA 1M2FA 5C7OO 5FOQA 2JAOA 1GUFA 4FUTA 1X0XA 1M9NA 4Q47A 3ABSB 2YZMA 1QHSA 4U2GA 4LF4B 5D86A 2IBSA 1M1YA 2O0JA 2NO5A 4KAXA 4MI3A 2LCQA 3O4JA 4IEEA 2FR0A 2VPTA 2WT9A 2W8BA 5FL3A 3O84A 3MCZA 1MB4A 5DP2A 5H1YA 1VLJA 1ZCZA 2A5FA 1V16B 4ZGWA 4IUBS 4YRRA 2WHRA 3HWRA 2WWRA 1R64A 2VHXA 2B6HA 3DF7A 1ISGA 1E2UA 1HDGO 2CDRA 4I8XA 4TZTA 5CYFA 1GNTA 2GBLA 3WK4A 5LQNA 4LHZA 3FF4A 1U2TA 1GY8A 2ZSIA 4WT7A 3UANA 4G2NA 1Y3AA 1Z2EA 3F4LA 4ALNA 1N6PA 5FUQA 2J31A 4P32A 3CLVA 4J0FA 3HVUA 5C8ZA 1XMPA 4CM8B 3TNFA 4DNXA 3N1UA 3SVZA 4TS3A 4EG1A 5CH5A 3A9SA 2IU3A 5J3JA 3HN2A 1A7JA 3TZQA 1ZJZA 1NOIA 2ZI5A 4MKIA 2O3SA 1TE2A 2Q2WA 4MI1A 4L8GA 1K7YA 4RSMA 5EYPA 3COYA 2FFHA 4JLKA 3TQHA 2C2WA 3A8TA 5FTWA 1MFPA 4EFMA 1REQB 4B3FX 4PRLA 4I5GA 1B15A 2IXBA 3EB9A 1T26A 1YZ3A 4MGIR 5DMXA 3CG0A 4GEGA 3NIDB 4XGNA 3LDAA 1WP9A 1X92A 1HO3A 2VXOA 5B12A 1JG4A 1AKRA 3OQVA 9ATCA 1W36B 4FK8A 5DLPA 3Q7PA 3QKSA 3HH8A 5I7SA 4F86A 3A25A 2I80A 5JEDA 2RAPA 1LSOA 4NU5A 5C4IA 1EDDA 1ZGGA 2Z57A 3QV1A 3K16A 1ZNWA 1BX1A 4YCAA 1AQNA 5DX1A 5HFNA 3PGJA 2CLKB 2OBMA 2GRJA 2O8EB 2FEAA 2QAGC 1RJEA 4YV7A 2I7TA 3BD7A 2HRQA 2PH3A 5KTPA 2BE9A 4V1CA 4YA6A 5L3QA 2O59A 1IHXA 1CLUA 2HJGA 1GO2A 2QT9A 5AKHA 4CLEA 4PTZA 1G8GA 1VE7A 3HRHA 2JH8A 4RVHA 4TXJA 4YDSA 2JJ1D 3QJ5A 3ZWPA 4BCBA 3Q5EA 5FQOA 1FP1D 1UKBA 2YYAA 3IAUA 1AS3A 3EXHB 3RKSA 1J70A 3U1TA 2O8BA 2GILA 1SUBA 2DUJA 1PVVA 2FMUA 2H18A 5EEHA 4AVYA 4LDAA 3H83A 2GNAA 5COAA 2I1WA 2VEDA 4JLAA 1NZFA 3GLHE 1Q0HA 4YHHB 1Y9JA 3UYLA 2XXBA 4OAOA 3HBJA 4GSYA 4CL0A 5HPYB 3CLRC 1TJ4A 1RIFA 4I50A 3OJLA 1JH9A 2HFKA 1X2BA 2A9OA 4XIGS 3AR2A 2QW0X 1SBCA 1UH5A 4FILA 1KU0A 1WCXA 2NTJA 2Y66A 3B6MA 3TCXB 1VMEA 2EARA 4CV1A 3KT0A 3GJYA 3P9RA 4PLWA 3DDCA 4GBMA 2OKCA 3WK5A 5L4SA 2A30A 2OCKA 4OX9B 5D3MB 2VXYA 4D56A 4NCJA 3Q6IA 3ZKAA 1NV9A 1Z5NA 4KUEA 4YO8A 3S2YA 5IM4A 4KDRA 3ZY2A 1S3GA 2OVBA 2G04A 3O8CA 2NPIA 1NA5A 1C8BA 3HLTA 2GCOA 3GLKA 1URPA 2VTBB 2YMQA 4ZP1A 3RTEA 4EL0A 1HTWA 2XZTA 1FVXA 3A11A 2C03A 1IWOA 1SQ5A 1JSRA 4AS2A 1T8PA 5CD1A 2BEWA 1KEZA 1QFSA 1IHPA 2IH5A 4BQSA 2VHUA 1A5ZA 3B2EA 4MQFA 4E5UA 1Z75A 1BZYA 1HLGA 3PXBA 3IUBA 4IJQA 1WA5A 1CD5A 1ZBDA 2WVAA 4KIGA 4MGHA 1W4AA 3PIRA 2H08A 2Q3FA 4DARA 2BEJA 5L3SB 1X8JA 3EPRA 2GK3A 2QNIA 4B4OA 1SUDA 2EKPA 3N2NA 3D3WB 2VLIA 1T9DA 2UZ1A 2X6TA 2VBCA 2XV1A 3OPQA 1A9YA 4NEGA 2P2NA 1SKAA 3ZE6A 3ZHCA 1TECE 1JKFA 1GKLA 2H2FA 2HPHA 4H7IA 2JJ2A 4JR0A 1QGUA 4OMUA 1L4NA 5FRDA 1B0ZA 4AWBA 5KTKA 2BYTA 4XTCS 4YCNA 1NW9B 2HU5A 3UKDA 2UU9B 1CY2A 3KB6A 2UZ0A 3D2AA 5DZSA 3IKLA 4LF9B 2WUFA 1T9HA 5J4KA 4LYGA 2VCEA 4Z51A 3A1SA 4J0GA 1BGVA 4WZAE 3THRA 4KDFA 3EEYA 3N59A 3O8LA 2ZIFA 2I0FA 3DZDA 4DR2B 3TUJC 3D9QX 1JVBA 3R09A 3TXXA 2WD7A 2W2TA 4AZWA 4TVKA 3PGMA 4C87A 1UPUA 4KPFC 3LLMA 3OPVA 5JU6A 4ALIA 2C8LA 5D00A 4KRXA 5ALXA 1CULC 3OJEA 1Z5WA 3OOYA 5HZMA 5I48A 4V0KA 1GU7A 3HZHA 1SIBE 3ZHYA 2WI8A 4UEQA 1H4QA 4R81A 4W5TA 2C7QA 4D0SA 1WKVA 1E1NA 1TVMA 2C9MA 2ZXEA 4HLCA 1NXWA 1P7CA 2C58A 2VT7A 2XH8A 1P4HA 4YRPA 5FYDA 1EG7A 1RBQA 2H4ZA 2GYVA 1YFLA 4ITVA 1TFRA 4CJXA 2EIHA 2EEPA 1QHNA 2IOYA 5IBCA 2LW7A 1IBSA 2BR5A 3NTQA 5K05A 2ERCA 2QXUA 4RMJA 2V6JA 4JYPA 1VP9A 2X4DA 3NM4A 3R5KA 1X15A 4EYOA 3W77A 1HLDA 2J0UB 2P6UA 3MJHA 4YDQA 2OC9A 2FVYA 3IKJA 1K4KA 1VRWA 1COZA 3IUPA 1NX9A 3ISTA 4K6KA 3UMRA 2WHEA 4YRKA 3THWB 4H7DA 1FFWA 4BQOA 2V6BA 2R7KA 3D5TA 3W3AD 1K66A 3L04A 2O2HA 2O8NA 3I1IA 3M33A 1W5BA 2OGZA 3NH6A 5BV7A 2MINB 3HL0A 5B1IA 1LU9A 3RYIB 1GTMA 1YBFA 1Z28A 2C29D 4D4LA 3THXA 4EEKA 3MLBA 3UUGA 1I2DA 1PK7A 1RQ7A 1USGA 2VATA 3I6YA 1X70A 3C6XA 1Q0UA 4IXMA 4MA5A 4NWIA 2B6NA 3G5MA 1RSZA 3LCRA 1ZIPA 1GRVA 2WZQA 4MOWA 3WBKA 1EUQA 1P62B 3JVVA 1RQPA 2B5WA 4KPUA 1ZGBA 3N05A 3KFLA 1LI5A 1YBHA 4NMLA 4BRSA 2N9UA 3OPXA 4EJ6A 5BWOA 5I45A 1M2GA 2VNHA 2C54A 1C9YA 2CZQA 4CMEC 3IVAA 4BJHB 3IP3A 4AUMA 5AM0A 2IYYA 3CZ5A 1WCIB 5ED4A 4UZSA 1RM4A 3SGLA 1XV5A 4KTTE 4X5OA 1O54A 1NHWA 4ZV7A 4C4YA 1R0RE 3C4JA 3FZQA 1SNYA 2HK8A 4NV0A 4PLHA 4YMGA 2XGJA 4C2BA 5C9ZA 5H3CA 2Y1OA 3V00A 3ZI7A 1TKCA 4XR4A 4GL2A 3AEQB 5A7HA 1JWLA 1FZTA 2FW6A 3IVGA 4DWVA 1XLVA 2G25A 4RF2A 5FR2A 1V5GA 2JFYA 1QQAA 4LF7B 2RJ3A 1C80A 4JCCA 2M6SA 2UYYA 4YJKA 2CHQA 2OHXA 2GTIA 1JG7A 4H77A 3TXYA 1U0JA 2VYFA 2PSHA 1KI7A 3ZBQA 3M9LA 5AVXA 5EPOA 2FZVA 4Y6LA 2X14A 2QMZA 2RK6A 2ZTLA 4O1MA 2BMFA 2GPNA 2GEFA 4YRAA 1CHNA 4NY1A 1NWCA 1DKRA 3TX2A 4V39A 1AURA 3BDVA 5FA6A 1Y5RA 1WEKA 1KMCA 4E4TA 2DVMA 5C37A 4AFNA 3QBEA 4P4LA 5HHTA 1QP8A 3KIPA 3KPUA 1ZQ1A 5AVSA 1BXGB 3LECA 1K7SN 1X1TA 4HP8A 3SICE 2Z8ZA 5B1EA 2EGHA 4CQJA 3EMVA 1W47A 1YC2A 4GMXA 1CW2B 4B7CA 4LVOA 1NLYA 1KEUA 2I1VB 1NG1A 1T8UA 1B8UA 1Q1GA 1I36A 3E3LA 3IP1A 3KJNA 4TTQA 2H11A 2VBFA 5K3OA 4NULA 4KR2A 2EF1A 3F49S 3O3OB 3ZJ4A 3WHKA 4E03A 1QAMA 3NOQA 3CX6A 3TIXB 4P4SA 4R54A 4H60A 1XCOA 3RS2A 4LK3A 3UXYA 4BKOA 1MV8A 4NF2A 2FZCA 4Z4QA 3IFSA 3K0CC 5HQ3A 1R74A 4P7FA 4ZN6A 4HOYA 4PHGA 5FFNA 4B3IA 1CIJA 1U1IA 4N0MA 2C4NA 2WIJA 3QEBZ 5DFAA 1QAQA 3FB4A 1W76A 5A3RA 1YJ8A 5G53C 3NJ8A 3NX4A 2Q7DA 4HJXA 4BNMA 3R5FA 4I8IA 2Z56A 2PNFA 3A1WA 5I01A 4F1KA 2QPTA 4U9HS 3D6AA 4WXRA 5B3JA 2BVNA 1QRTA 4FR5A 2IHZA 4FGJA 5C5CA 4B3GA 4H7EA 4YMUA 3OECA 2WHYA 4WDRA 4WI1A 4CUJA 4DLPA 2HRZA 2ZT7A 1AO3A 1Y1KE 4PXYA 5JAUA 5BMVF 1N7IA 4M89A 2X7JA 3DMFA 1Q74A 1MXFA 4LC0A 3QE4A 4DV7B 1W75A 3EIHA 5KX5A 4WXPA 5ALIA 3L49A 5CYPA 3DAPA 3KU4A 1XK6A 5HKLA 4Q01A 5HYVA 5I9NA 3K5IA 1AHNA 4R1MA 1AQJA 2Y77A 3GEIA 1RYMA 1D6MA 1R0XA 3AI2A 4MRRA 5GJBA 3H9EO 3KZMA 5LBIA 1JR3A 4B87A 5B58T 5EUQB 2M6LA 1SQGA 3RRZA 4F45A 1JFLA 2GPYA 3SC4A 5TARA 5E4TA 5CDSA 4LDQA 1A71A 2I2XB 4MHOA 1J23A 2HQRA 1XMJA 3QVLA 4W1PA 3ZGOA 1ZNXA 4G5QA 1SHLA 3C5EA 3WIVA 3GLGE 1HLFA 2J48A 3AVPA 3CZ4A 3JTMA 3PNKA 4F2GA 1KEKA 1W1IA 2B98A 4OGWA 4HYTA 4WBNF 4RTPA 3AB3A 3DQPA 2VF7A 3FGOA 3WGUA 3IMEA 1WUIS 4AJ9A 1K27A 4XTRA 3MUEA 1T9KA 2KE5A 1N5MA 5AHRA 5ALFA 3DP7A 1CG6A 1FP4A 5LUBA 2O7RA 2H5JA 3A26A 4IJWA 5ECWA 3WLHA 3HO8A 4EI9A 4BDSA 4RNDB 4HF7A 2RJOA 4RK0A 1SXPA 3CT4A 2P9CA 2QLMA 3SYRA 1V9CA 3QVKA 1Y33E 3QX9A 1NVAA 2YINC 1NZJA 3REOA 1NBHA 3MJDA 4PFQA 3L92A 4HGQA 3SZMA 2D1YA 3GBVA 2WAAA 4ISBA 2QRNA 4D8YA 4DOMA 3HXQA 3VO2A 3WNQA 4MVYA 5AVJA 4UPVA 2PD3A 2VP0A 5JMWA 4ECEA 5K0EA 3PQ4A 1N5KA 5DEOA 1Z0FA 2UVDA 3VR5D 3WL6A 1FQWA 3LXXA 1BE0A 4DRYA 1W4BA 4HXGA 4TOIA 3I2HA 1PUIA 3X1DA 2ZZNA 4GI5A 2A0KA 3HLYA 5FI1B 5TMBA 2PGDA 4DCCA 3RVQA 2O8EA 4B9AA 1VA4A 2YRXA 3BULA 3PJFA 1PJTA 2JGKA 3PJEA 4RS4A 2W48A 4RX1A 4F4UA 1RBZA 2GNOA 4I5IA 4QGFA 4BE4A 5KX5B 3DEFA 1ZYUA 2DFNA 1QKIA 2DECA 3EVDA 2OGWA 1FUUA 1M6EX 2ZE8A 1AMUA 1XVTA 4LDNA 2C2XA 2DHCA 3E9ZA 5DU2A 1IXSB 4KNYA 1UF9A 4DLRA 4CMHA 3KKZA 1DAEA 1E1RA 1WXFA 4MZDA 4PF1A 4RORA 4W6ZA 1NSTA 1M6VB 1YSCA 1PEDA 4N5DA 1DJNA 2N1MA 1ZP6A 2V5AA 3FRJA 4RV5A 1C7FA 2YZNA 4MR9B 3LT4A 1DBIA 2E55A 1KEPA 4GZLA 3SOZA 3T1YB 1GNLA 2G9RA 5H68A 1ZMBA 3HPRA 4PSDA 3WMEA 5G1PA 3PHIA 2B8TA 4UCQA 3AVTA 3JQDA 3IMKA 3JZMA 4R16A 2OCDA 4QJ5A 3ZVRA 2PTGA 1QMGA 1GZHB 4MULA 4J0EA 2A7XA 1GV0A 3QKIA 4IZ6A 4IG4A 4QAQA 5TVKA 3HCPA 4XJVA 4G5HA 2XF2A 4Z7NB 4M76B 4ZCPA 4XPIA 2ACKA 1PFKA 2IHKA 4LOIA 4X45A 4YMTA 5EJ4A 3IVCA 3LV8A 1FFAA 3O2SB 2OPHA 3HK2A 3P7MA 1FS5A 2CDAA 2ODPA 1K5HA 1TYCA 2EX0A 4HQLA 4AS3A 1F12A 3BWDD 4W1RA 4KBFA 3PK0A 2VJAA 2BD0A 4P1ZA 5BUZA 1V16A 4DPKA 4DDTA 3GA0A 3NIBA 3HLKA 4HAVA 4V0QA 1O2DA 3DHNA 4J6EA 3KTOA 1UJBA 2Z43A 3N0WA 4B3DA 2IELA 5B53A 4XYLA 5BUSA 1QR6A 3LW8A 3ZE2B 5AVZA 2JS7A 4BY9E 4D3YA 1M1YB 1JVNA 1SCBA 3ND7A 1CUAA 3L7BA 3TOZA 4P86A 5CHEA 2VKQA 5A06A 1WXEA 2DH5A 4B9EA 3DA8A 3DAFA 2GBGA 4MYDA 4JI3B 3KSUA 2ZZKA 1YK1A 4L74A 1XNHA 2GVDC 3SIXA 1ODKA 1ZUNA 1N4AA 3ZKWA 5LJIA 5E6RA 1R3UA 1WKBA 1L5MA 2J45A 3ZWKA 1ULZA 2XVYA 3LOQA 4C4AA 2B92A 4MIEA 2NSLA 5EZYB 3HV2A 5AYVA 1NUSA 4ZV4A 2I76A 4L57A 3IELA 4JBWA 3ADBA 2XKKA 3BTUA 4K0KB 1XNJA 2PMBA 4KAFA 5I51A 4IOKA 4RK7A 1Y4UA 4IVPA 4HKTA 2FUCA 1CC1S 3B82A 121PA 3HJBA 1UK7A 4EYSA 1I2MA 3HSKA 3I2JA 1E9SA 1GILA 2WU3A 4ARSA 4WRRA 3TGLA 3BIJA 3DBLA 2PT9A 4ZCTA 3PHLA 3A58B 2IYFA 1G0NA 5AW7A 1PX0A 5CXXA 1CR0A 3DWEX 4N1AA 1RBMA 4M0UA 4UFPA 1SM4A 1C41A 1N5OX 3IAM6 1I2ZA 2CJPA 3G13A 3M82A 3KYDA 3TRIA 5H70A 4BBPA 4MVJG 3I28A 3LT0A 5FL7A 4LFBB 4L0QA 1AQIA 1E32A 2ZB4A 3NEYA 1CRWG 4WLOA 2HR1A 2HC9A 1FE8A 2AZ4A 3WMGA 4UNPA 1IN1A 3AYZB 3E8XA 4DAEA 1KI8A 5LZ2A 3CJQA 3HJRA 3STTA 2J6CA 1KEWA 1XQXA 1ZK1A 4R5HA 1X2EA 1I8TA 1V1JA 3ESBA 2QJRA 4GI3A 3HPQA 4D45A 4IFEA 2QRUA 4GYKA 5DLQC 1KK3A 1VXRA 1QKKA 2GFHA 5LJLA 2FI1A 3I8SA 4Q1VA 4EO9A 3LY7A 4L5JA 1KZ6A 2IH4A 3CZMA 1N6NA 2FQWA 1XB2A 1K0FA 1F2UB 2PGNA 2O05A 2W22A 3AFHA 3EVFA 3MG9A 2HQBA 3OQHA 4FDLA 4C0XA 1LQUA 1TT5A 1TX4B 1IRIA 1JJVA 1U2GA 1KDRA 1NW7A 1SQ6A 1Y5MA 4YIKA 5CBKA 4LI0A 1ADJA 1COWA 2J9XB 3AHGA 2FQQA 2Q2QA 3G8AA 2GZSA 1ADYA 3OLVA 4LY3A 4F8JA 4YUXA 4M9ZA 4ZIRA 3DE3X 4OVKA 3S8MA 3W5HA 1CNMA 2VYCA 5AESA 3IT2A 2AW3A 3FTQA 5EJ8A 4MV5A 1DAPA 1J9EA 1L4MA 1QOQB 2ZJFA 3BJEA 3G3EA 3HABA 4ZAXA 2NU9B 3CSSA 4DIMA 3PNYA 3L7OA 3MGKA 4G9BA 3ZQ4A 1VCNA 3MRXA 1J0DA 1RU3A 4P80A 3VR4A 1Z4PX 1NULA 1A9OA 1M83A 2XCUA 3KSDO 2O07A 4IV5A 2P65A 5COQA 4XJXA 5JTUA 1UT6A 4WLEA 1OE0A 2P2GA 4FBMA 3K15A 4Z0NA 2O2IA 3O93A 2X5NA 2KB0A 5CA1A 2QU8A 3ND5A 3WFIA 5AJXA 5KSYA 4B3RB 2PK3A 3LRPA 5EJ2A 1OA1A 3PC8C 1GG9A 3QVVA 4IBOA 4RY2A 1YKSA 3WL8A 5LLTA 4Q5IA 2QN7A 3TEMA 3ZXIA 1VLLA 2BJHA 3X1XA 2P1DA 1JRLA 2B4KA 3BXEA 4E6EA 5CFNA 3D7LA 2DUUA 3FYUB 3IE2A 4Q7KA 3WK8A 4ZO8A 2VDWB 3DLHA 3I6QA 3FF1A 1P4GA 4Q16A 2UVPB 4NE7A 1B7GO 2YY5A 3ROPA 3RTDA 4BNFA 1RI1A 1FC0A 1X39A 2VNIA 2IA5A 3FJYA 3Q7SA 1JDUA 4UHFA 3GNSA 1GSIA 4FYKA 2VAMA 1T2AA 2ZM5A 1JFRA 1G55A 2VO1A 3Q1LA 2HT1A 1YIAA 2WHQA 1QAOA 2X8JA 3ZNPA 4HX5A 4FI3F 2VF2A 3KVRA 1SD1A 2G17A 2P5TB 2X0FA 3DWFA 3PUWA 4Y2GA 5HW0A 1CQZA 5IVHA 2WKPA 3PCTA 4FOPA 1AKWA 2RHOA 3ZCXA 4S1OA 2QTCA 3HA7A 3YASA 4BU0A 1TTQB 2QEQA 1XMIA 4WSOA 2I3BA 1QGED 2C0CA 3RYIA 3THXB 3I5XA 5AHOA 2C20A 2AFHA 4O0LA 4MJ3A 5GJVC 1BVRA 3E9NA 5KJ6A 3BJIC 3P27A 5HDQA 1EWYA 2ZE7A 5AUNB 4GZMA 1PVDA 5KOHB 3Q8XB 2V6FA 4HB3A 2KYRA 3NVKI 1M6YA 4PX3A 2IU4A 2QNBA 1N0WA 1YHZA 2H9YA 2A5DA 2WJ4A 3PZRA 2UDPA 3PYMA 1FFXA 2F3QA 1YRYE 3KCQA 1NT2A 1FDUA 3DKIA 3KXLA 4XXHA 4IO1A 5DI3B 1C9DB 1NMQA 4XOUA 4PFSA 3UHOA 4N76A 1WG8A 3LZCA 2IK8A 1BU5A 1H3EA 1PTJC 2PUJA 1LC0A 2PVPA 3A6KA 3DAOA 3LGXA 3QWBA 1MA0A 1YB6A 4LISA 3GCDA 4OI2A 1PQPA 3DDOA 4ND3A 5J59A 5KINB 1QJ4A 1RKUA 5AD1A 2DRIA 5BNZA 2R6AA 1EFVA 1R9NA 1MOZA 1KQOA 3T34A 2QBYB 4TWAA 5CB4A 3BWMA 3KCNA 2BZSA 1DINA 1ZXLA 3H9GA 2AR0A 3NASA 1Z5ZA 1YS7A 3R6TA 4FLFA 2PMKA 3TGWA 3WADA 1A69A 5B7QA 3ANXA 4I5EA 2D1QA 4Y67A 3V5NA 2JL1A 1R0KA 2XYVA 3FOFC 1M0EA 3FRHA 4OJNA 1VJRA 2VQSA 1JAYA 3KKQA 4AIRA 3IHLA 3K6KA 2WE7A 5TMEA 3E0QA 5KOHA 5AICA 2R25B 1NNSA 3VPGA 2XOKD 1XTQA 3LBHA 2JIQA 2FZGA 4RDHA 3NIGB 4RH0A 3RVMA 1PR9A 2WJVA 4JBNA 4D74A 4YMWA 2A0UA 1O96B 1E4EB 3BJRA 3B3JA 3Q5DA 5SYMA 1PWZA 1RJ9B 3CG4A 3WLLA 4DV2B 2JASA 2OXIA 1DELA 1ZD9A 5E8RA 4RMIA 4Q1AA 3H2BA 3H75A 3BEDA 2BFPA 3QHAA 2ARKA 3RU2A 1ECGA 1Z5VA 4CMIB 2IDZA 3Q8WA 1XX6A 4RIIA 3RS0A 5KYXA 5ESXA 5CA0A 2J9YB 4EP1A 3Q2IA 4RHXA 1Z13A 5HF9A 2XT9A 4I0WB 2X9NA 2PWYA 2VNKA 5E9AA 1FSPA 4GUDA 4WOKA 2QZPA 1IZYA 4N9WA 3GIWA 3FTDA 4G4JA 4LRUA 2GETA 3N6XA 3UKOA 2QPOA 4W5NA 1SRQA 3TAXA 5T6BA 3T5GA 3Q8LA 2IW1A 4LXQA 2CN1A 2VK4A 1APBA 3PSAA 1N1MA 1GPBA 2V6GA 3V4OA 3CURA 4FN5A 1OH6A 2MSKA 4LYHA 1L7MA 5E7MA 2W8ZA 4KE8A 5CMLA 5KHLB 4LZNA 1KP2A 1JEYA 3U44A 4JKIA 2GA8A 4MUEA 1OXXK 4KKXB 1SUSA 4QPDA 4UBNA 3WKDA 1DQSA 3A04A 5ER6A 2FAXA 4YO7A 3Q1KA 4EM6A 5JSYA 1ZW6A 2CXUA 2RGGA 3DV9A 3RUAA 5G4KA 1B6RA 3JS5A 1SOVA 4RPKA 1VLMA 5A5VA 1A0OA 2OO5A 4HQNA 3GQBB 5AJHA 1CETA 3NHAA 4JP5A 4ZOCA 2RK4A 3COSA 3QA9A 5BSKA 4NZZA 1FNCA 1XRQA 3QVMA 1XPOA 3HHEA 1MRZA 1TKRA 4PVCA 2BM8A 3G7SA 5K3DA 2YJNA 1YFJA 4NXNB 1HYEA 2QLNA 3IPYA 5A4IS 1TTTA 2GHRA 1JX6A 2ODBA 1MO3A 4G5XA 4ZREA 3HXOA 1G20B 4W1SA 3RUEA 1ZSNA 4QPNA 1BCSA 2PIAA 1S1MA 1G21E 1T8RA 4PHTA 4KGZA 5F1KA 4B3HA 2QI9F 3KK0A 1VXOA 4C7VA 4L0MA 4KODA 4UHCA 1WMSA 1FFXB 1FVHA 3PCXA 4QQ8A 2V7QD 1ZCBA 2FB9A 4DV3B 1G5PA 4HAOA 1RZRD 1TT5B 4IRUB 4DQVA 3F5FA 3LO5A 1V8ZA 3T94A 3ZWQA 4RY9A 1MW8X 1ZOIA 4D9JA 3T3OA 1IC6A 4D9KA 2WKWA 4A1OA 1Z8FA 4P4TA 3UAZA 1A8HA 4IW3B 3UJAA 3OIVA 3ZDAA 5JECA 1DWUA 4HADA 3ESQA 4R9SA 3FPHA 2OHGA 3AEQA 3LC0A 2ZVJA 1XQVA 5EKTA 4NJMA 2HJRA 4ZI5A 2OCPA 3JD1A 3SQOA 2O0LA 2Q1SA 2GWHA 5DM70 3PQ7A 1NNI1 1NN5A 3I5UA 3M6LA 1LA2A 3H6GA 4RDCA 2OAGA 5EA2A 3EIUA 4E51A 4MWBA 1J8QA 4BUZA 4H3KB 3D6JA 1UBSB 2WP0A 2YRWA 3LX4A 4YCBA 3ZY5A 2JBAB 2G82A 2SECE 3UT6A 1GTSA 2O0MA 4E13A 1BDMA 1Q44A 2HGZA 1E79D 2ZAYA 1XZPA 3HYLA 3OE4A 2BGKA 3KOMA 4XR9A 1U2DC 5DI9A 4PHHA 4MW6A 1Y9EA 1J49A 1TCCA 4YUWA 2H5EA 4QNNA 2M1ZA 3DWGA 4Q1DA 2WLTA 3FCUB 1ZH0A 1XRRA 3A1NA 1NC3A 2QRPA 1MAAA 2IIPA 2YZKA 4LX0A 4OYYA 2H92A 2H1CA 2BONA 3PVZA 1R6DA 2HLHA 3GAZA 4W9RA 5JDIA 4BVAA 3DLPX 4RU1A 4E3WA 1AHHA 3D02A 1JU4A 5GONB 4EVSA 5IHPA 2P1ZA 1YJBA 3AIKA 2JK1A 4FHFA 1HT3A 1U8EA 2LDBA 4LZJA 4JKYA 4RF3A 4Q3BA 1N2CB 1KBOA 1A8IA 1EB9A 2C5AA 3K9GA 2OWDA 4OHWA 3EMDA 4ZJPA 1WD5A 1PU2A 2AKAB 1PJ8A 3O90A 4A8PA 1TU4A 3LIIA 1ZUHA 2W98A 4PG6A 3SZ3A 3ZDQA 4AF7A 4C4TA 5KB3A 3MHTA 2OOKA 1DIRA 3OEEA 1ODIA 5EC8A 5IBQA 2IZOA 4HN4B 4YAKA 4YWJA 1II9A 2XITA 3IA2A 1R50A 3SZLA 1V37A 1XD9A 2KX7A 3L40A 3LL7A 3I8OA 4RHCA 2HCTA 4ZXPA 2HMSA 4MVJF 2R6JA 2HJHA 2QE6A 2R4QA 2VTVA 1LNQA 2WDPA 3GT7A 3P52A 3R3JA 5CPFA 5K0NA 3ZXSA 2AKYA 4GLBA 2JJ8A 2ZYTX 3ZIAA 5LXTF 3OFND 4PIMA 2EG9A 5EGNA 4KWIA 1C1XA 2HCBA 4NL4H 1DT5A 3AF0A 4ETMA 1KYTA 1OPRA 2ZRLA 3KQOA 3I58A 4EYQA 2X0RA 3TRFA 4KVGA 3NWEA 3NJ4A 1M66A 4L08A 3D2LA 1O97C 1U1FA 2D5AA 3HS3A 5A03A 1R5JA 3UAGA 4O5OA 4LJLA 3N8DA 1WXXA 1ZM9A 2B7CA 2PKRA 1P2SA 4BB9A 1GT91 4ZDKA 3PE4A 1LSSA 1KOJA 3WRXC 4EF4A 3UJ9A 5IYZA 4O0MA 3CR7A 4CQMA 4EG3A 4I5FA 5F2OA 1F9AA 1PD0A 4ZRNA 2KPOA 1PEYA 4RZUA 1Y3IA 3NXKA 3ISVA 4FFVA 4MGYR 4G1EB 2PKXA 3CTPA 1KFBB 4CHGA 1OWMA 2FPMA 1LK0A 2IZ1A 1T24A 2IOFA 1G9TA 1V25A 1TDJA 4FYVA 5J2UA 5AQEA 2HB6A 2ZAIA 4BMZA 5DULA 3G49A 1W85B 2BKVA 2PCJA 3BL5A 3FAKA 3ZU4A 3ADPA 3J81A 1M5RA 3MQFA 1J0AA 4TYPA 5KWIA 2NM0A 4GP6A 2D8MA 3AUXA 5HCNA 2BFCA 2VL7A 2H2GA 1OXUA 3W5VA 5AH0A 1FU7A 3T3EA 1PX2A 3MBOA 2Q7OE 4N6NA 1JSLA 4OGFA 1M34B 2A1TR 1UJ2A 2MOKA 1R4NB 1SU4A 5K99A 3Q3GE 4UAGA 2OQIA 3ETJA 3MGBA 5TVGA 3UWKA 1SC4A 3RU7A 1NP3A 1BX0A 4YXWD 1NKSA 2GJAA 1H2XA 3IR7A 4IO0A 1MC4A 2BDEA 3ETNA 4IXNA 5TQVA 1KO5A 3B2QA 3I9NA 4WKNA 3EDOA 4FW9A 4U2KA 3VR2A 4PO8A 1YI8A 3TKLA 3K8YA 1JHRA 1RZUA 4LTDA 2V3VA 4BX3A 3VTAA 16PKA 2JCSA 1UBRS 2F1HA 3IP5A 1MVNA 3SC6A 3NTVA 4GE3A 1M74A 3W1VA 1X77A 5JYBA 2FGJA 4BLVA 3MJCA 4OG2A 3I5YA 4TL6A 5KQSA 2ONYA 2PUWA 3QKTA 3VRHA 3E9EA 4FC6A 3ZZNA 4ZU3A 4RZHA 5AVWA 5A4MS 3A0RB 4CG0A 2XQVA 3ZYZA 4AY6A 2O4CA 1G5FA 3ESAA 4DWWA 1E5XA 4Y9TA 3S1SA 1DTEA 3CLUC 3SLKA 2EVWX 1SZPA 4GU5A 2R8OA 2FFJA 4WNAB 4NSNA 4L22A 2XZPA 5JI3E 5ADWA 2JIRA 1YWGO 2ZRJA 2GPTA 3LTEA 1YDMA 4ZXFA 3WAJA 1S2NA 3W3AA 2FDXA 4K9SA 4L07A 1HSZA 4EW3A 3QFHA 5AKGA 1WZ2A 4TMKA 4GVLA 3KQWA 1ZNZA 4I19A 2NSYA 1PR3A 3VR5A 3EEOA 3EBPA 4B2YA 3PR1A 3PXUA 2IV7A 3AVOA 4OHPA 8GPBA 5EKUA 5I3ZA 4F6LA 1XAGA 5ALVA 2EJCA 2HREA 2PAFA 5K8CA 2Q1YA 4B0PA 3H5VA 2ZYUX 4X85A 1DTWB 1GZ5A 4ZEXA 4CL8A 3CN9A 3QPBA 4PYJA 1UC8A 2A5YB 5E9WA 5HNKA 4M0CA 2H7VA 3SVLA 1JR2A 1L7QA 2VYQA 3L5OA 4GECA 1MV5A 3RROA 4D82A 5J4LA 1UOEA 1NKTA 4C2UA 3PLAE 4PQEA 1OR8A 2G76A 2NUTB 3FDZB 4RIGA 3PC2A 3THSA 4F2HA 1J8VA 2JFXA 3R0JA 1U9JA 5LLSA 1QDUA 2QYTA 3R3VA 1UKCA 3BGIA 4PYIA 5HJ2A 1SHJA 2IGBA 3IVXA 1RP1A 3MILA 3SJAA 3OF5A 4PYKA 5JASA 2UZAA 4KX5A 2V54A 1JIIA 2L17A 2HD4A 2G5CA 1EFHA 2MWMA 3BB4A 2R2GA 3ZVKA 1E6KA 1E3QA 3HB4X 4WMLA 1S96A 1LTQA 4BL5A 1R5BA 4ZZIA 2WIGA 4R1PA 1TIPA 3MD0A 2X9VA 3ND6A 1MX5A 3BK2A 1WHSB 3TLKA 1W581 4YRFA 2ZBVA 2H3HA 2YV1A 3SBXA 4OSOA 3WGMA 1U63A 1Z36A 2Q6VA 5FUVA 2BGTA 1FRQA 3NHSA 3O21A 4HDNB 1Z4QA 3AOEC 3EZLA 1O5OA 1BYIA 3IUJA 2VJDA 1I3LA 1CUIA 4MPTA 3GD5A 5TSDA 1QONA 4P3XA 2BFWA 4F6RB 1I3KA 1KVTA 2GT1A 3O95A 4IDNA 1K8QA 2X0JA 5SV2A 4OUDB 2KHZA 4Q1FA 1QQ5A 5CVEA 5DM60 2KW5A 4XB1A 2Y1WA 2CWWA 1WZNA 5EPUA 1DPFA 1XMXA 5CM9C 1TM3E 4DLAA 3RJ5A 3W6UA 1L5QA 2DWPA 1ATIA 3EVCA 3NWBA 3GQBA 2JFHA 1IL0A 4P34A 3LTNC 4DA9A 3LRTA 1SRRA 3GLIA 3ZWAA 1OSNA 3HNOA 3T0FA 3AEYA 2C9DA 3VQTA 1R4AA 5IYZB 5H0IA 3BQMB 4MW9A 3H3XA 3P0RA 3SSAA 4BQQA 1K4YA 2VPQA 2VHEA 1OD6A 1K0UA 2HIAA 1NE2A 1QVVA 2NZ2A 2E85A 2P35A 2RHRA 1NQVA 1PR0A 4U0KA 5L40A 4G5YA 2IP1A 3C2QA 1BHJA 1UKVY 1PJQA 4KYIB 4TKMA 5TQ2B 2W42A 3KAKA 2DWQA 1PK8A 3PFWO 2PGOA 4N3GA 3L7CA 4GOLD 3FI0A 4FYMA 2AOVA 1SUCA 3CRW1 2O8DA 1J07A 4MAFA 3DOEA 2IVZA 1XTRA 1RXCA 3GGGA 4QDUA 4TXNA 4EECA 4K86A 4XVQA 4TRNA 4E07A 1KRWA 4KQHA 2W4QA 5J4YA 1SAYA 5BO5A 4NZMA 3U9TA 1LDYA 1KAOA 2EERA 3ABZA 1ZK2A 4JFAA 3CJRA 3ZG6A 4F4IA 3GK3A 4C4XA 5C1DA 4XJSA 4NC9A 3WHLA 4E6PA 3DZHA 3SQDA 3UZUA 2PUGA 4G8CA 4TWIA 3OFVA 1SB9A 1KAHA 1NF9A 2AR7A 1KHTA 5GONF 1QP7A 4ISCA 5KTSA 2ZG6A 1ARZA 2RONA 1I1HA 3BKXA 5LA6B 2AZDA 3HA5A 3R4CA 4ONEA 4B5LA 5BYAA 3FZEA 1T6YA 2FSPA 1DFHA 1RLOA 4O29A 3QVTA 5G4LA 5E3HA 1G59A 2ES4A 2QD3A 1JFFA 1E5VA 1R6BX 1E2MA 1T3TA 4UNNA 3DR3A 1DGQA 1NR7A 4FD3A 5JAZA 3OMWA 1TMKA 1LFDB 3P97A 3NWJA 3Q9NA 5J9FA 1U11A 3TOXA 2VHQA 3DWIA 3K94A 3WLFA 4DM7A 1EGHA 4R1QA 4RVNA 4WE3A 4RZIA 2V0GA 1FNDA 3I6ZA 1ESZA 2GN2A 3L8FA 4JOBA 4OHCA 5THQA 4J7CA 2GPWA 2VFAA 4B80A 4IHKA 4C7XA 2G77B 4FHDA 3OE7D 3RVLA 5K2OA 1Z4KA 1K63A 1Q1BA 5DK4A 5CEJA 1V6SA 3OPYI 3ZEAA 4S1PA 3WOHA 1YFKA 1K1EA 1LUAA 3WSVA 2J46A 3CLSD 4EY8A 3F6RA 3AFMA 1KK0A 3RARA 1WIWA 2N47A 1DCFA 1G5RA 3CT6A 2YQ5A 3C98A 1ZD1A 3CNEA 3JYHA 4LGVA 1QIEA 2Q5JA 3GGJA 4M22A 5KUTA 5AXAA 4S0ZA 2H52A 5KDDA 4MB2A 1E64A 1ES9A 2DU8A 1SVUA 1NTOA 3DH0A 1EA7A 1SUIA 4IICA 3TFWA 5T4FA 3WLAA 2HQOA 3K4HA 1X7YB 3P71T 4J0JA 3ZDFA 3JZDA 4P3KA 3H86A 3EXHA 5IJ0A 3F47A 3FDXA 1MA3A 2I67A 3NUQA 5EZSA 1N33B 5AXDA 3MLEA 2D3WA 3C85A 2V7QA 3ZR4B 3ICPA 4LXTA 1N2BA 2LVBA 2F8LA 2H6EA 2ZE6A 1C0LA 1E8DA 4PYRA 1QG6A 1U9YA 3OO1A 4HPXB 4ZYWA 2GN8A 1JE1A 4CEIB 2J3HA 2KLHA 4NBUA 3NVMB 1F4VA 1RWQA 2ZB8A 1NQ5A 4C6HA 4LJYA 2DHQA 3KWJA 3MINB 4MPDA 5JZMA 1DHTA 2X8BA 3KETA 1Z22A 1Q20A 3GUVA 4NP6A 2PMDA 4Q3NA 4HI0E 3QF4B 4XX1A 2G5PA 1V9LA 3L6BA 3SC2B 3TLAA 4ER0A 4H3SA 4IXWA 2JIBA 3ANTA 1NMXA 2H00A 4RTLA 4R7TA 4LEIA 4J1QA 5HUJA 2XWSA 3L6OO 5JVDF 4QZVA 2R1VB 4KN6A 3AGPA 1FTSA 1MOSA 1CF2O 1OWPA 2H16A 4RQUA 4E5DA 2CXHA 1AN0A 2GS9A 2UVQA 4E5NA 1H2YA 3EXAA 3HRIA 5D8DA 4IP0A 4ZT4A 4MLZA 4BXOA 1G8YA 1JB9A 3PICA 3GCWA 2DETA 4BUJA 1YE3A 2P4QA 3EW9A 4L9AA 1UZMA 5HBGA 1I24A 1OTXA 3KQNA 1CX9B 4LHYA 4LF6B 2QPLA 3WGNA 4UM9B 4NEQA 3E61A 4FS8A 1EVZA 2RSLA 3I2KA 3Q4GA 3TW6A 3MSXA 2VOEA 4HFMA 3C8UA 2RCNA 2FOXA 3DNFA 2BJVA 3UMJA 4TX1A 1B41A 1XLUA 4ALKA 4HH0A 4C3UA 3D3WA 3HCDA 3S2FA 4Z9XA 4LXHA 1XZQA 2RH5A 2Y05A 4MQ5A 4RLQA 4WGFA 5K9ZA 1HQYE 3RFXA 1YQUA 3JYPA 5TPZA 1GNSA 4LSGA 3TB4A 4I4TA 4A4DA 5FLXA 3C3AA 1T9CA 1ELOA 5CVTA 3AUUA 2O50A 2VHJA 3FPBA 3EAGA 5BQOA 1DBQA 2GSWA 3GUYA 5U4XA 4EIWA 1SGWA 4RD3A 3U4MA 3JTEA 1DKLA 4MPPA 1T5LA 3KSRA 1FY2A 2VN8A 5CK4A 4C30A 1SKQA 3VOAA 3OLXA 4PNPA 3N86A 4XYEA 3AG6A 3BZUA 4DIDA 3SZGA 3WGIA 5G1OA 3WA7A 3K6RA 3WBFA 3V48A 5U9CA 4EF5A 4HNSA 2XD9A 4HTFA 1BQEA 1F6DA 5T57A 3JQ6A 3RU9A 5CCXA 5DGCA 1T6NA 3RREA 2EFHB 1SUEA 4JJKA 3WL3A 3AVVA 1OXTA 1W6UA 1W9HA 3IBTA 3FBGA 1WULS 2XUOA 3LP8A 4FFLA 3QPVA 3GG9A 4Q93A 3BN3A 3S27A 1KH2A 1NRIA 3S99A 3CHYA 3LQ2A 3FYHA 2CLDX 4QULA 4U7FA 4Z5XA 3WGOA 4BJ6A 4PZ9A 2OEPA 4ZHQA 5LMZA 3J7AC 4BNDB 1TGVA 1EAYA 1YQDA 2GHTA 3L07A 2PVSA 2B7BA 3MXTA 4NOJA 4D42A 1B42A 8LDHA 1BDJA 3JQEA 1LLDA 4MTLA 3DLIA 4NHOA 5C1BA 5CDTA 2J9FB 1NPDA 2DCUA 1D6NA 3QYJA 2G40A 1ZOPA 1EP3B 2F43A 3JWGA 4JJGA 1D2MA 4Q39A 4BLSA 1L7OA 2HF8A 3A27A 3KE9A 3O9VA 1Y8CA 4OEHA 4OCZA 1GRCA 4OU5A 3FYTA 2Z6QA 1GCOA 1V7ZA 5JNUA 3R5SA 3TDMA 4KV9A 1M34A 3LQFA 1JYEA 1YJAA 2DJ5A 1TVKA 2WICA 3BH7A 4FYYA 5FBQB 3EZXA 5I4CA 1EAMA 4G0UA 1T35A 1TU3A 2XW6A 1T1EA 4YT5A 3EFOA 3QLVC 2NU6A 4RE5A 5KQMA 4JDUA 5TDHA 4B46A 3RC3A 2OK7A 2QL5A 3L2OB 3FI9A 4LSZA 4G0WA 3ONNA 4LBZA 2JLYA 2WFAA 3VAAA 1TA4A 1S6YA 5JAMA 1TMYA 1PJ3A 1RZ3A 2F1OA 3IHTA 5A0FA 1K75A 4OQ4A 4IY1A 5EZYA 1Z35A 5F1YA 1KI4A 2HT6A 2XVAA 3AY3A 1E9DA 2WEKA 1GDDA 4PSAA 3MWJA 3OY7A 4QDXA 3IEUA 1QDEA 1MABB 5JCOC 1O7JA 4G5FA 2B5OA 4KXVA 2RC6A 5IDWA 4ETIA 2PEZA 4YFYA 3GLUA 4YRTA 3RUIA 4I9NA 5BSTA 4Q9IA 5KYUA 4H0NA 1DJLA 1EK6A 1QYDA 1U7XA 1SWVA 2Q99A 1DKNA 3AY7A 3KOOA 1OX6A 5JT1A 4R2IA 2PN1A 3NONA 1Q77A 4MKHA 4EATA 1YMQA 5JY6A 2PX0A 3AF1A 3GRVA 1W2WB 4UBOA 2ZBRA 4G1BA 4OJQA 5L9AA 3NRBA 3AF4A 2R9VA 1YVRA 1LK7A 3CISA 3DD1A 1PYDA 3QY9A 1S2GA 3FOBA 5F7OA 3QMPA 3OZUA 2R5WA 1UQRA 4HNHA 1JB1A 4MSUA 2WJAA 1Z88A 2Q62A 3TE6A 4TQ9A 1ONOA 3G2PA 4C20A 5BN3A 3MIIA 1AA9A 1E96A 3EQ7A 4NCHA 1FNBA 3B78A 3Q7TA 5CVDA 3CZRA 2NAPA 4QOSA 2GHIA 4ZZ3A 3U7FB 3IPLA 4IGKA 2HK9A 4IL5A 4WWHA 4FCWA 3AXTA 3EE6A 2AMLA 1FCJA 1WABA 4GR4A 4B47A 4CLHA 2GN1A 4DDMA 4J91A 5AK3A 4S2EA 3PQ2A 5JXHA 1WDWB 1KYZA 5D6OA 2FY8A 1QBGA 4Z2YA 4BTVA 4B4VA 1LW6E 1A7UA 1IEWA 1XTJA 3A4VA 2YJGA 1Q19A 2ZUFA 1RFLA 1MPXA 1TAUA 3R7WA 4WVFA 3FMIA 5I9SA 1MXHA 2V03A 4G8DA 2UYQA 5BOSA 4B40A 1GLNA 4HATA 2PX3A 1TAHA 3TR5A 2FA9A 3UHJA 2VQDA 4LOLA 5E7IA 5IJXA 2ZYDA 1XPUA 1ACMA 1PZEA 5CDFA 4GXQA 1E9RA 5BQ3A 2W43A 5EIFA 3DZBA 1RXSA 2ZB7A 2P6RA 2P40A 4U7PB 3D6MA 4HBZA 2WJGA 4YHBA 4MIKA 1U8YA 4LJ5A 2OMEA 4HGRA 4MQBA 3B20A 3IO3A 4ZOLB 1YDGA 4LJ4A 2FOLA 3K9WA 2BFEB 2ZPTX 2OXRA 3TTSA 3UM9A 1MENA 4V2UA 4OK6A 1LPBB 1QIGA 3Q7EA 2Q3MA 3OP1A 4FR0A 4LHVA 2PKQO 3WLQA 1UPAA 4JVOA 5F78A 1MRNA 3GHYA 4WZBE 1KBQA 2QMOA 3MAAC 2QZ9A 3BWYA 2PLNA 1YZFA 1Z62A 5ALLA 1L5RA 2Q21A 4NENA 1C9EA 4BB5A 2NP7A 1MB3A 5K0JA 2NZVG 1ORHA 1T9GS 4O33A 3M6FA 2FGKA 3EWSA 3OE1A 1S0UA 1A04A 5E1BA 4F06A 5CITA 5KIAA 2LBPA 5D3QA 2JFQA 3ZWCA 1E2GA 4I9UA 1ZPDA 4PWZA 4EPTA 3KWLA 4U7TB 1E2NA 1KSJA 1PSZA 3L7AA 1PKEA 3SHWA 4N82A 2CJWA 3LXMA 4WFJA 5GOTA 3ZCRA 2EW8A 1W59A 1I10A 4I1SA 1OZAA 2XF8A 2IUSA 1QHYA 4C7OA 5AHWA 1Q1NA 5PNTA 5ETJA 4MUJA 3FZYA 4KQ2A 4OXKA 4O3FA 1JPNA 2BJWA 3GG2A 2CL0X 3DOHA 3INRA 3KQMA 4QPZA 3BH0A 4WXEA 5E1MA 1ISFA 2OK8A 4MV9A 3QLUC 2AK3A 1FB5A 2WG0A 3HACA 2F1IA 4KKVA 4UCWA 3QOYA 3BL6A 1PS9A 5EHQA 4BVLA 2OLKA 4OJMX 4P2BA 1JEQA 4O8ZA 4P83A 5JO0A 3KV1A 3TNYA 2C9CA 2IPAB 3WRYA 3MRVA 2AFHE 3QX7A 3ADCA 3AF6A 5CVUA 3DE7X 2IYNA 5BV8A 3OIFA 3W4KA 4ZI2A 3SYKA 5GIPE 4PG8A 3H8VA 3FFXA 4PLGA 4AL4A 1K4MA 4Y9UA 5EZ6B 3RDPA 5CA0F 4IINA 4G6ZA 4LJAA 3URMA 1FUEA 1I3NA 3V8BA 4CFSA 3CVUA 3BXOA 2VH2A 1F8UA 4IIYA 3RM3A 1N7HA 4RELA 2WINI 3IXLA 3QXCA 5K8JB 3I61A 2B9VA 2W58A 3ODPA 4TVBA 4XWTA 1T36A 4YAFA 5CX1A 5DXJA 1SKBA 1W29A 3LC2O 2NVOA 3GN1A 2ZYAA 3CEJA 5EXEA 2MCFA 3S3TA 3U44B 5BSMA 2EJTA 1HWYA 4R2LA 3VISA 4Z53A 3M8KA 4YP1A 2WMYA 3C24A 2HSJA 3HL4A 2AQKA 2C1EA 2FUEA 1HT1E 2HHJA 3V7YA 4G8JA 4EJFA 3ZWXA 2QX4A 1JAHA 4TKUB 4UE6A 2QN6A 4GX1A 2JIMA 1GKYA 3MTIA 4H6WA 4W7HA 3FH0A 3RGWS 4B6QA 4QARA 3PQEA 3R0XA 1P0IA 3EGEA 3PB3A 4EENA 1CJKC 1PG2A 1PT8A 2MR6A 3N2EA 3LY8A 4MRMA 4QE3A 2EFDB 4KOAA 5CT5A 5IANA 4LNUB 3CN7A 1EE2A 5DIFA 2DSNA 4FWTA 4IOMA 5L8VA 2A0YA 1PNQA 4C0SA 3OX3A 5DEIA 2RGEA 1TC2A 5FYQA 3K9LA 4WA7A 5HTKA 1WY7A 3H7AA 4JBYA 5LCXA 3QW4B 4Q9KA 3MQ2A 3K0KA 4WADA 4LFCB 4JODA 1DUVG 1FA9A 4WVLA 3F3KA 4POAA 1LLFA 3DBHA 3NOXA 1RJ9A 1VPEA 2QG9A 1THTA 2HA6A 3DE2X 3L7DA 1UANA 2VBIA 3NEJA 3ENKA 4KK3A 5IAKA 4UNSA 3WRYC 3PWKA 5LQJA 2KLBA 3IBGA 3RF6A 2GK6A 1ORTA 2ZROA 1OYYA 1SBNE 4E3ZA 2AOTB 4B6RA 4TSFA 1QIJA 1F8YA 2I2DA 2JG3A 4K1XA 4M87A 3A28A 3Q3HA 5BURA 3AVWA 1A1VA 4TZ0A 3HGTA 1N6OA 5GMOA 3GBSA 3PL5A 2Q0XA 5F7JA 4YVFA 1POWA 2HHHB 4JXXA 3EWAA 2QN8A 4UHKA 4ZYYA 5LZ7A 4FHCA 3OT1B 2UXCB 5JS1A 2QVGA 4KE7A 1WX1A 1XR3A 1VHQA 1Z12A 5AW3A 4HGYA 3TCNA 2OKGA 3A6EA 4MR8A 2WZDA 3RT7A 3WTBA 3LDUA 3KE8A 5EN4A 2YWFA 1XZCA 3HI4A 4P7JA 5EWMA 4LPSA 1XZAA 3UK1A 3EGOA 3IO5A 2NQ8A 4D81A 1M8GA 5E6SB 1HYGA 4F5YA 3N74A 3L46A 1UXIA 4QUDA 4CMJA 4J43A 2H1SA 1W4ZA 2CHGA 4CLRB 1SPBS 4XARA 1FLAA 4FHGA 3PE6A 1JL3A 1IQPA 3K35A 4X62B 4H1UA 3II6X 3IR6A 3VI3B 1SCNE 2QMYA 5JAQA 4BOYA 4X95A 1IK6A 2IHUA 1AB6A 2W6OA 5AIAA 1E6LA 1R1DA 2ZSKA 3IAS6 3QXGA 4C89A 3SOPA 3D3EA 1CY1A 5CLGA 4HXEB 4HLUA 4J75A 4OI0A 2ZI6A 3ZN2A 1RPZA 3MLAA 1PVOA 2C3PA 1UXJA 3ZHVA 2HJVA 4HY3A 2CYAA 1MMFB 5AVUA 1OLSB 4QATA 3TDNA 3JVIA 1KYQA 4KIJA 3OD5A 2QR3A 3IR5A 3QLVA 5KKCA 5JO9A 2ZBFA 4LPKA 4EBFA 4XQGA 4FB4A 4YMSA 3BOSA 2ZS8A 4C4OA 4QGAA 3PEVA 1GZ3A 3I9V6 2QN1A 2Y0BA 3VBEA 2C3YA 1PW7A 2FZEA 3A6FA 3A0UA 1TM5E 4LRTB 3JXEA 4AJ4A 1L5FA 7YASA 2Y0CA 1E5TA 4U9UA 4F8YA 2WLSA 2ECPA 2CLSA 3ICOA 3C0KA 3U80A 4OOEA 2WQZA 4ZOEA 3BT7A 3BSFA 3KVNA 2ONCA 1D0VA 1NVXQ 3GEGA 2WYWA 4M83A 2W2LD 1JLRA 3VUFA 1EVJA 4MQLA 2P9TA 2C59A 3IUMA 4UE3S 3NTLA 4MV7A 1VJ5A 3N2GA 4GUAA 4NMXB 3S2SA 1JKJB 2Q41A 1XVUA 1O4VA 3QMMA 5P8WA 4H17A 4KQWA 4BEVA 2EJVA 4N39A 4CKCA 3D64A 2JCXA 5B4VA 1DRWA 4YQYA 5JAOA 5DNYB 1LDBA 5F33A 1ABFA 1ZM4A 3LLVA 4QBTA 3ZWYA 2EZTA 1XWFA 3LT2A 2NXNA 1HFEL 5JVDA 2REOA 4HRVA 1PZMA 5J43A 2O7NA 4QTXA 3UCXA 3PBKA 2IHJA 1RQNA 1U2RA 1Z38A 1DMSA 2OHOA 1AK9A 3BFJA 1HNZB 2GAAA 1FDVA 1UJ4A 4UATA 4JC8A 1Q7CA 3FUTA 1PR4A 4M0MA 5J1TB 2W2QA 4DR1B 4ZOLF 4AB1A 1MB0A 3V1NA 2WTUA 4F1WA 4K6GA 3KQTA 5BQXA 4EELA 1RHRA 1GTVA 1GAEO 2EBFX 3L7YA 4QIHA 1VL2A 4RIEA 5DGDA 2OLEA 5CAEB 4B09A 5JWOA 1Q3TA 4RXUA 1CFZA 1QF7A 3EVBA 2HNKA 1HE1C 1XHFA 1Z4NA 1B4DA 4BX2A 3S8YA 3L1UA 4B2IA 4TYNA 2QAGA 1EFRA 5ELLA 4NCIA 3IEXA 1EJ6A 1D2CA 1QHEA 1WB9A 4JV5B 4K9OA 1RRGA 4FCTA 2R8ZA 3ZHUA 5KC8A 4A27A 2XE6A 2R1ZA 1ZHHA 3F9CA 3P0EA 5F2EA 2NVUB 3WIDA 3KQQA 3ZVLA 4YQZA 2J7PA 1EK2A 1IEQA 4L95C 3IC5A 1H1LA 2MTBA 1XQWA 4GPAA 4CTNA 3AM1A 3DBRA 2H2IA 2G63A 2RGYA 1KPGA 2FWJA 1D2GA 2PS9A 1VTKA 1O94D 2Y1XA 3HUFA 3AHEA 4IVRA 1ZINA 4UTZA 2C2KA 3OQNA 1TQ2A 1V4BA 3V8NA 1T2EA 3VC2A 1N92A 2PMWB 2PX4A 3K09A 3DEYX 3OBBA 2IPOA 2DAPA 5GM2A 3B6KA 5FOVA 3PQFA 4M86A 2WHPB 3R3HA 1TGYA 4MK4A 1B14A 1YB1A 2NQ2C 5CT4A 1ILEA 3PC7A 4MJLA 3C1TA 4H31A 3VKHA 8ABPA 1N36B 1OUMA 4PSVA 1DX4A 2V7GA 2W70A 3AR8A 2FFRA 3X2EA 3OQJA 1TW3A 3OCWA 2HA2A 4CG1A 2ZJ3A 5KNCH 4B6OA 4W9MC 1JIJA 1KI9A 4QFCA 2VYNA 3LM8A 1XXHE 4ZOBA 2A3RA 4L27A 3WLEA 2E9SA 3CJTA 1NOJA 3T12A 3FE2A 3H7IA 1GM5A 3SEAA 3BREA 2ZATA 4UU8A 4W5OA 1A8QA 4QUKA 1DEOA 4NBNA 3T1NA 2OENG 3S6JA 1O6GA 3TNLA 2GH1A 2V97A 2W6ZA 5KC9A 4WKPA 2WSMA 4XM2A 1WXGA 4M9XA 5KYKA 1XKLA 4IIBA 5D5PA 3ANSA 1LJ8A 1RP7A 3AERB 4KIFA 5B4TA 1I3MA 3WYDA 3DD5A 5K8TA 2EC5A 4FZJA 4CKXA 1TZJA 1KJWA 5TMPA 4BFSA 5DT9A 5BR1A 1JXMA 1SELA 3DVAB 3HXKA 4MUAA 1SOMA 1Z2OX 1GXSA 1CUSA 4OFWA 2DFVA 3QYFA 1MEJA 4EPVA 4UOZA 3LK7A 3CH7A 4ZHQF 4QUJA 4QGBA 1O8CA 5JNTA 1DT3A 4RH3A 1IAVA 5KKAA 2C31A 2ONZA 5H9VA 1BRTA 3ENWA 3W1EA 2IX9A 3ZE1B 4ZJUA 2C9YA 4UMEA 1XEFA 2J85A 1TT7A 2YVQA 3EGCA 1I2BA 2R68A 2BEUB 2OORC 3DDZX 3IDFA 4KXNA 4A9AA 4EH1A 2G1PA 3MMPA 3C1UA 4UOQA 4ZI7A 1FBNA 1I2CA 1Y7HA 3AR6A 1F51E 5I5GA 3UQZA 4D44A 2C4HA 1GYPA 3QXSA 4DRXA 1P7YA 4BC1A 5BW5A 4Q7EA 2JD1A 3ZY4A 1H42A 4QQKA 3GRCA 2HSEA 2CZGA 1HURA 2SICE 2OZPA 3C3JA 5FX2A 3U6KA 5BT8A 1YZNA 4UMVA 2ANBA 2JD2A 1T4DA 1F1JA 3QE3A 2CYCA 3M6MD 3U4AA 4CM4A 1NV8A 4OL0A 4BKQA 2J0EA 1KIAA 3H5WA 3NYQA 3C4QA 4P92A 5LQAA 4HNAA 3K92A 3PVSA 1Y7IA 1SZDA 3NGMA 3UK0A 3GP8A 3DMNA 1X0VA 5EKDA 1M8FA 3H8SA 2E2WA 2GAOA 5J5CA 3ZDCA 3UWSA 1XZNA 2CVFA 1T3HA 2O2CA 1E5QA 4KO3S 4HAZA 2VZ0A 4WY2A 4QU8A 3M6XA 2HV9A 2CWDA 4KTVE 3TI9A 1X86B 2EU8A 1YONA 3GGPA 4V0MA 3V1UA 2AZXA 2YJ5A 5BORA 4H18A 4KWEA 4J2OA 5C3MA 2I5PO 3R1IA 1XN1A 1U1GA 1H2EA 2ZUBA 4GZ5A 3A4YA 4BO0A 5CNKA 2GDJA 1NATA 3FX2A 4M7OA 4PONA 3VKVA 4KJZA 4DQXA 2IP4A 5BW8A 4CIWA 2VG8A 5CG2A 3P9ZA 1VPTA 4X6YA 3L84A 3VGPA 2ZANA 1K7XB 3S28A 4A7PA 1HL7A 1P3DA 4PEVA 2ZZMA 1DRVA 1GAXA 4DG9A 1SU7A 3T38A 3N8KA 3RAGA 1I4OA 4RGQA 1MO4A 5JMPA 1JQKA 3W8DA 3GDWA 2EX1A 1L7RA 3TZKA 1OREA 4AUNA 3M49A 4OLFA 1GPYA 1UP7A 3NP7A 4BMOB 1CPYA 3K1AA 3EDQA 1VOTA 1N3IA 1CVRA 3HA3A 2XDAA 3ZK8A 3C74A 2OV1A 4R83A 3SCZA 4JDPA 3HXTA 3IAM1 4AUKA 4TQUS 3NFRA 4M38A 3F7MA 1FMCA 3P5BA 3EODA 1E3DA 1OJLA 2GCPA 2A1UB 2PV0A 3AUJB 4J07A 5EOVA 2AUNA 4X1IB 4XIFA 1ZA1A 2OSBA 4LHXA 1RI3A 2V4UA 3M5CA 4IZOA 4IXDA 2NO9A 4QJ4A 3VZBA 3OPYB 1U0FA 1WSBA 1U1CA 5FA5A 2WU0A 1G8SA 1DWQA 1LRLA 3M9WA 3ZDRA 2COEA 4HUQA 3GV0A 3PNVA 5KDLA 5C32A 3EVZA 2NUBA 2IYTA 4PINA 4QSMA 3EIEA 1THZA 2G3YA 5BPFA 4PIVA 3KJQA 1OWLA 1C9KA 3O83A 1CJMA 1AZTA 2GZ3A 2WG1A 1MJGM 3DZKA 3GJ3A 1W8IA 3NM5A 3P96A 1FPQA 1P1RA 2LV8A 3DCNA 2L69A 2BGLA 2YWEA 4FFOA 4MPRA 3AJ8A 4P36A 4XX0B 1UP4A 1WU8A 2ZOSA 3D0OA 3QOXA 5K0TA 2ZDHA 1NVFA 2F3SA 1RACA 1RFGE 4JGBA 4RPJA 1EIWA 3GU3A 3KUDA 1CE8A 1DX9A 2OFOA 3EASA 3PQ3A 4TMYA 5TX7A 1B0PA 4TMVA 2BEVB 3V1YA 4CMGA 5FLKA 2B5VA 4JQYA 3U4HA 3V1TC 2PRSA 3GMDA 3IS3A 3NNSA 1NYLA 2RGDA 2WAXA 4PNZA 2WTAA 3Q0IA 4B7AA 2Y2VA 1RC8A 1Y3BE 2YCLA 4IJVA 1KKLA 2JEYA 2NZ8A 4BNLA 4F9TA 4IKPA 4K6FA 2H1OA 3GT4A 4M1OA 2ZRDA 3WGHA 4IJMA 3UXHA 3ISJA 4M7RA 3ESXA 5I5EA 1ZHOA 2V7XA 2Z9BA 4ND1A 5JWHA 1QTQA 1IIRA 1U2ZA 1Y9DA 1DAMA 3OJXA 1IN5A 3KVOA 4KXQA 4E2WA 1EK0A 1R6VA 3QPWA 1DAFA 3X1KA 2FSVA 1J9ZA 4QVKA 2FX2A 2BM0A 1JDNA 3PXXA 5JBIA 3I04M 3L0DA 1DU4A 1FOEB 3B7WA 1UPXA 1VSTA 3B5EA 2GUGA 1F48A 1ZU4A 4XQ9A 2CUZA 4ZVLA 3W4IA 3LOUA 1IEVA 4FKMA 1I13A 1LY1A 4IJ6A 2NQTA 3TMKA 1XSEA 4Z8XA 1MJHA 2NAFA 4KB5A 1KQ3A 3GFRA 3R3ZA 4FGWA 1DCMA 2VDRB 3BFXA 3JASB 4BIMA 1RMYA 1TFUA 2B4RO 5JQWA 2AVNA 4N8SA 1DZIA 1UZLA 2Y1KA 4XDGA 1CDEA 4GC9A 2XUJA 3DDSA 4IZIA 2PS1A 3MC1A 4YJ2B 1PGNA 4ITUA 2XMGA 1Q1AA 4AF8A 2OYRA 4BWFB 1KARA 2PANA 3MYYA 3VU9B 4GLJA 5JZVA 2YOHA 4W1QA 3ER8A 2FW9A 4MCHA 2J0QA 4JQSA 2P11A 2JHCA 4ZVUA 1UFKA 4D4IA 2WFLA 1VJCA 1YBMA 2XUPA 4CL2A 4G56A 2BP7A 4OXRA 1FK8A 3JWIA 3SEFA 1RT9A 2QROA 7REQA 4LGCA 1US8A 2GZ2A 2GLUA 3OH8A 1T4CB 1VKHA 3GRAA 5HA5A 2WWGA 4L85A 2BI4A 3TAHA 1WW3A 2QRKA 1T2CA 1UBOS 2YFHA 3HU2A 1NXOA 1XKQA 3TZEA 1LCIA 1MBZA 1TJ3A 3B13B 4UD2A 2ZUEA 1N3BA 2BFDB 4Z0TA 4YR7A 4N54A 3LHSA 2PUEA 2FPLA 1FFCA 1TIKA 2WU4A 3EG9B 4D9IA 3SBDA 3GRPA 4OHBA 3U5ZB 1NJ8A 3C48A 1VKOA 2O6LA 2PRJA 2I4NA 5BN3B 3EGXA 2J6BA 3WI7A 5JS8A 3HMQA 4IIJF 2HDNB 2B61A 2I1QA 4OA5A 1UT5A 3LA8A 3HJFA 1XQ1A 2XB8A 3D2CA 3HGQA 3VAYA 3CEHA 4IHAA 1YQXA 2ZWIA 2I2AA 2QWXA 5JCOA 3ZQJA 4ZAFA 3ZTYA 2ASEA 3WZ2A 2CV0A 3F71A 3SNKA 4G09A 4BVBA 2RB5A 4F3KA 1Z2PX 5IH3A 1DV1A 1P6UA 2BFAA 2WSIA 3F5DA 2ORED 2VJNA 3G5UA 4ZQIA 3CINA 1VGVA 1XL0A 3T52A 3UV3A 3QF7A 1YNOA 5FORA 5JR3A 1P3JA 3NRJA 3AFGA 1Z29A 1TIBA 1XRMA 1XDGA 1U04A 1JKXA 3AB7A 3LYUA 1LLUA 1N7JA 3Q85A 4Q9HA 5CVJA 4ZVMA 3TZCA 1CEYA 2PS0A 5B2ZA 4AU1A 4EHNA 3ZE0B 3QTLA 5ALZA 1QTRA 2Q3JA 2R66A 1KO7A 4CCYB 3DM9B 5CFQA 3OQMA 1RYZA 3FWPA 3V8RA 1XELA 2Z8XA 4B43A 5A3QA 1OV6A 5JADA 3TLJA 1GU0A 3HCRA 4DWOA 5L3VA 1N9GB 2D8AA 3S4YA 2YVKA 1I6LA 3BZBA 4YP5A 2A4MA 5HCUA 2BOVA 2W90A 4KITB 2IBTA 3IQZA 3EDCA 1K06A 3R7FA 2CLEB 4GEKA 3WB2A 5C4MA 2LDXA 1HT2E 3BHJA 2O5EA 4Q1CA 1VCOA 3ZDYB 2J0SA 2W37A 3QEMB 1TJPB 3KYDB 4QUHA 1CNFA 3QG1A 1MP0A 4QT0A 3VH4A 3OWOA 1I4DD 3GY0A 1KBZA 2HBQA 1X1SA 4DR7B 1MAHA 1PEKE 3ZXYA 4WCVA 4LDPA 1CE8B 2IBMA 4DGQA 2PSDA 4JHXA 3WGJA 2BCEA 1TMOA 4A6EA 3ORFA 1JKMA 3QRWA 5IDVA 3RHSA 5JW6A 2ZVQX 3UK2A 2QL9A 4IGFA 3BIOA 4TKVA 1OHHD 1V4NA 1P33A 2Z9DA 3EAQA 4FOTA 4XB6B 1U0SY 3P9CA 4JUIA 1Z7WA 5JMOA 3NVAA 3WNBA 2IH2A 2XPCA 4NQRA 1PT6A 4AKSA 1JEJA