2ASEA

Nmr structure of the f28l mutant of cdc42hs
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
178
structure length
178
Chain Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKLPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division control protein 42 homolog
publication title Solution Structure of an Oncogenic Mutant of Cdc42Hs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 18
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2005-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2aseA00
2GJ8A 4Q48A 4DZZA 3RC8A 1MO3A 3PEYA 3C8UA 3F5FA 2IK8A 5AJWA 1SXJD 3MWKA 4A6XA 1TF7A 2IYQA 4GFDA 2IF2A 2NPFA 1WRBA 4LSGA 2DHRA 5FL7A 5JWHA 4ZDWA 2VSFA 3I5XA 1GWNA 2IS4A 2C04A 4C0KA 4DCNA 1V43A 3CKLA 2ZVPX 5AK0A 1FW6A 5F9FA 2C2HA 1PV4A 3A1TA 2VPPA 1L8QA 2AR7A 3M4YA 4D4MA 3SEAA 2YVUA 4RFSB 2GA8A 4Q4AB 1YZNA 4L15A 1FZQA 1E98A 1VCOA 1VG1A 2WWXA 4B48A 4OHWA 1C1YA 4U5XA 4LJ4A 3PCRB 3K09A 1T3SA 1N0WA 3G5UA 1KDRA 2ZSFA 4Q4AA 5P21A 4F7WA 1NBMA 5EP1A 1HY3A 4US0R 4IDHA 3DZ8A 1UKZA 3B78A 1G19A 1WMSA 1YR6A 2BEKA 2FSGA 2P5TB 2R6CA 3HJNA 3VMFA 4HUTA 2JJ2A 1UJ2A 2IYRA 3IEUA 1TEVA 4E5UA 2JJ8A 2PLRA 2WWFA 2QY9A 1WQ1R 3TQFA 2C99A 4A82A 1G7RA 1KI2A 1EFRD 4LJ8A 1CIPA 2QAJA 4BFYA 4U02A 1E0AA 2ZJ8A 3RC3A 4BFSA 2PMKA 5FTKA 4CGZA 5DYGA 1GRQA 2PL3A 2QP4A 4M9QA 3VNVA 1G8YA 2VA8A 4CDGA 2AK2A 3CF2A 4S2EA 5DN6A 4IKEA 3W3ZB 1QG2A 5HCNA 1OPXA 3ETLA 4KAXA 1SXJE 1S8FA 1W2GA 4LX0A 2IWHA 2ODNA 2JASA 5FPKA 3GFTA 1UDWA 1F2UB 2QPOA 3KQHA 4Q9IA 2DWQA 4KV9A 2PJRA 4NU0A 4A2QA 3OEEA 1P3JA 1BMFA 3WYGA 1VHLA 4M22A 4XWKA 1OT3A 5JI3E 1F2UA 2ZEJA 3UIEA 1ETUA 1GP2A 3ASYA 4HSEA 1YZUA 2ZI4A 2N1BA 2A5DA 4BEBA 1W1WA 621PA 2FH5B 2KWIA 2JIZA 4LPKA 2UZ3A 2F1JA 4GL2A 3MMPA 4ZKDA 1N2CE 3CBQA 4MRRA 4OK3A 3V4FA 3GMTA 2ZS9A 2KSQA 3PVSA 1UBEA 2CJWA 1D2MA 2XB4A 3E5HA 4JL8A 5FR2A 3REGA 4B44A 3ASZA 2QBYA 3CRRA 1Y63A 4HDOB 1GOTA 2QRNA 1J2JA 3MG9A 3SJCA 1Q0UA 4URVR 3A4LA 4NCHA 2RCNA 2WAXA 3B1WA 1JJVA 4YMUA 1KI4A 1PLKA 1GUAA 1S0UA 4B33A 2OBLA 3B5JA 1U8ZA 1X3SA 3LD9A 4XVUA 2IYSA 3IDQA 1D9ZA 2HXYA 3KX2A 3AVOA 4MKIA 1OLOA 1YZQA 5EE3A 4K46A 1UBGA 4CRWB 1Z2AA 3F8TA 1KO7A 1ZD1A 2CK3A 2Q21A 4XWOA 1P73A 1N5IA 2HEIA 1SVMA 1S1CA 2Y8EA 4C7OB 3NEJA 4D4JA 2O8FB 2VHTA 1IY0A 3CZQA 4BFZA 1NIJA 1IN7A 3BWDD 1R8QA 2RGAA 1G18A 4QHSA 5ANRB 1QDEA 4C7OA 1P60A 2GAOA 2FWRA 5SZHB 4LC1A 3TQCA 1MV5A 1XEWY 4B35A 3QSYA 4AURA 2P6UA 1Z0JA 3QG1A 1LTQA 3LDAA 1TF5A 4Q18A 4ZV4A 3NIBA 2GBLC 1R7RA 4FD2A 5HKKD 4Q7MB 4C0HA 2CCKA 1GNQA 4KLZA 1E1RA 1FQJA 4UXIA 3FB4A 3HDTA 1FNMA 2XNDD 1AGPA 2AKAB 5L3SB 5F3WB 1DAFA 3LX8A 4ESHA 4E03A 5JLJA 1N6OA 3DHWC 3EPKA 4DDTA 4MDFA 4DVGA 2J0QA 3TUJC 3T12A 3SI7A 2VRWA 3T15A 2QAGB 4BGDA 4TL6A 2P65A 1H65A 4UJ5A 2VYFA 3M0EA 4XH9B 5FUYA 4GOKA 4M1KA 3N5CA 2GNOA 4WBSA 2AKYA 1JR3D 2GF9A 2Q3FA 2QAGA 2W6ID 1S9DA 4JLOA 5J5CA 2YJTD 5KTYA 5JJLA 2ZXUA 5IRCD 4NYIR 2BBSA 5J4LA 2QG6A 4ZCLA 1R4AA 5E7JA 4NYIQ 2ZI9A 4FI3C 3WP0A 5F2EA 2J87A 2C5LA 1W0JD 2WWYA 2ZSBA 3W8NA 1R2QA 5DI3B 5IK2D 1CEEA 2HV8A 4R98A 5KO2A 4Q00A 1DAGA 2ZI6A 2QP3A 1KO5A 4A2PA 4UNNA 5C1BA 5JWRA 2ZRCA 1RC8A 1A1VA 3BERA 3ZLJA 1FTNA 1SXJA 1E2EA 4FMCB 4JLKA 4JYBA 2J7KA 1KO4A 4GI7A 4MKHA 4Q5IA 3WNCA 5B30A 3NHAA 1E69A 3ONWA 1AZTA 4LYAA 1OSNA 4DHEA 4C2UA 4DDWA 4FCTA 2BJVA 2QM7A 1WP9A 3FGNA 3NBYC 2VL7A 3EZ7A 1GM5A 1KAOA 4GP6A 4CEIB 1EWQA 4TL7A 2EYUA 4KBGA 3SFVA 1G41A 2KBEA 2WAYA 3CRMA 1Q44A 2VEDA 2RKOA 3RRYA 1U9IC 4JT4A 3QKSB 2HF8A 3B2EA 3K53A 4PSKA 5B58C 3K0SA 5L3RA 2RHDA 521PA 4DUGD 4MDEA 2BC9A 2R8RA 3OE7D 4CT5A 4OHVA 5FTLA 1E1QD 3CF0A 2CL6X 3I4LA 3I72A 1NMYA 3QKSA 1E9EA 2ERYA 2IUUA 2FFAA 4M0LA 4C3ZA 2ZR9A 3AP3A 4O3MA 1YKSA 1JR3E 3TGPA 3PUVA 2ZJOA 2OBMA 4W9MC 5JBQA 4DXAA 2BMDA 2WICA 1G3RA 1EFRA 4FWIB 1II9A 1ZUHA 1NSTA 4L4UA 2WWWA 1Z6YA 1Z28A 4NCJA 2XXAB 5G3ZA 4JL5A 4R7ZA 1SVSA 4B73A 1Z6XA 1BYUA 1LFDB 1Q1EA 1W5TA 2P6NA 4PPNA 3WNBA 4ASUD 1GKUB 5LDDC 1NY6A 3R9WA 4NYJR 1ODFA 2GWHA 5AUNB 4NYJQ 2UZIR 1PLLA 3UPUA 4AY2A 3TW4A 1M7HA 3NH9A 121PA 2QL6A 3BBPA 1IQPA 2OG2A 1MT0A 3IQWA 4MKGA 2J7PA 1Y3AA 3PUXA 5JS7A 1ZP6A 3QIAA 5H8WA 4BFWA 3I32A 4IDNA 1I2MA 4NMMA 4C0SA 1NJGA 4TTQA 3PUWA 3AF3A 1CJMA 1KIMA 1QHSA 4BPBA 3K0FA 1IONA 2A3RA 5EP3A 4CZ2A 4D80A 4B34A 4JKIA 4HATA 4HB3A 4ZI3A 4C30A 2EYQA 3Q5EA 1S9HA 5D3QA 1AA9A 1C9KA 3PXGA 4AK9A 1M7BA 4C2TA 4AI6A 2OESA 2C78A 1UKYA 5KUTA 4Q4LA 3OEHD 4M8NE 2SHKA 2FSFA 1NSFA 1ZNXA 3GCGA 3QBVA 2XJ9A 1JXOA 1GTVA 1Q1ZA 4NDZA 3DOEA 2BOVA 3W9YA 1JB1A 1NMXA 4F38A 1ANKA 4HAXA 4TN1A 2WJVA 4WA7A 4LJAA 1MO4A 3QVUA 2H7VA 2ZRDA 3C16C 2PBRA 2PCJA 2I3BA 4A1FA 3KKQA 4EIWA 2VSXA 3BD9A 3DVLA 1XXHE 5IT5A 1E94E 1KZGB 3CIOA 3TR0A 1ZM7A 2V7QD 1HE1C 1TUEA 4QBHA 3IEVA 2GJKA 3QF7A 1QZXA 5SZIA 3U6BA 4PC6A 3GP8A 3X1XA 4MKFA 1NMZA 1J70A 1TTTA 5JCPA 3PR1A 3ZD7A 2GCNA 3CPJB 2NTYC 1KSFX 4B2LA 1I4DD 3LQRA 1XEXA 1E2DA 4QGGA 1WBBA 1XFAA 2ERXA 1SVWA 5JSZB 4KYUA 4QBGB 2ZANA 3TJZA 4FIDA 4BUJA 3I73A 4NKRA 1TAGA 5DNYB 5JSZA 4BRUA 4DRZA 1OKKD 1MH1A 3BGWA 3HWSA 4OQMA 3QOFA 2YZ2A 4TQAA 2ORIA 2OEPA 3LRPA 3KFXA 4V03A 2XOKD 3Q72A 2O8CB 5HKKA 4QKQA 1FNNA 3CNNA 2ZRLA 2O5VA 4TSFA 1XTQA 4MQBA 3SDZA 3K0AB 3P1JA 4LPSA 3CWQA 3A1VA 3Q7PA 2FNAA 4V0OA 4JLBA 1NN5A 5FPSA 3GLHE 3U7EB 4IDOA 3B8HA 2NIPA 2H1LA 3BH0A 3LQQA 1TQ4A 3B13B 1W49A 1XPRA 1OFTA 4PQFA 5FOXA 3SE0A 1CKEA 1F48A 1JR3A 1U99A 2W6IA 2L0XA 3MWJA 2VP2A 2H92A 3MCAA 2CNWA 3SS8A 4JZKA 5IF9A 2EVWX 1H8EA 1EESA 1Q1QA 2QT0A 4IOMA 3WHKA 4Q4HB 1DAIA 4Z51A 4MRNA 2WPDD 3Q9LA 1T91A 4J0QA 4D0GA 2DY1A 3LV8A 4O0MA 3UMFA 4RD1A 6Q21A 2RGBA 3QI2A 1XRJA 2WJIA 1ESNA 2W83A 1G4AE 1RFLA 4Q4HA 4N3NA 1E99A 4GOJA 1EK0A 1L7VC 1OFIA 4NYMR 1HT2E 4N0EA 4NYMQ 5CIWA 3RSLA 2ZRMA 1OFHA 2NO9A 3TSZA 1KTVA 1G5TA 1W2HA 3QKTA 1NG9A 1OB5A 4M1SA 4V0NA 1ZUNB 2X2FA 4BLRA 4HAZA 4MRPA 3GEEA 3BK7A 2E9SA 1BH2A 1KK3A 2JJ1A 2ZI3A 1U81A 4O2LA 4EFNA 2QPAA 1OIWA 3BH6A 1ZUIA 1CR0A 1YRAA 2BMFA 3EIHA 4RY2A 1QHYA 1W36D 1XJQA 3EZ9A 2ZS7A 5DHFA 2CE7A 3IBGA 4GT1A 1HEIA 3CWZA 2J59A 1CU1A 3SJBA 4IEEA 2F55A 3NBXX 1W4BA 3NVAA 3EPHA 4RZXA 3L0SA 4DUGA 1S4QA 1E2NA 1HURA 2P6RA 5KNCA 1ELOA 1ZNZA 4AD8A 2QMUA 1OXTA 3I3SR 5CM8B 2AHOA 5JI2E 2AXNA 4MH0R 1GL7A 1G9XA 2QQEA 1G7CA 1XEFA 3LH5A 4QM6A 1YU9A 1NVWQ 2FOLA 2HXSA 3SBDA 4PPQA 1G4UR 4RFVA 2V1XA 4B3CA 2DFLA 1N6PA 2AK3A 3SR0A 4BZXA 3EW9A 1XXHA 1Q22A 2IEZA 3LLMA 4GZLA 4ACAA 1VG0B 2O8EB 1QHGA 1OIXA 4ASUA 3WBJA 2IF0A 3IPXA 4L9SA 1ONBA 4OQXA 3OIYA 3QXXA 4P31A 4HI0E 1P2SA 4LI0A 4YQFA 4TMWA 3QF4A 1W7AA 2ZYUX 5FTJA 1OH5A 1FP6A 2HJVA 1G21E 4RD0A 4UNSA 1GL6A 4B75A 4MGIR 3BIFA 2JLSA 5GVRA 4YMVA 3CX6A 2ZE6A 1ZBDA 3FYHA 4I4LA 3O8CA 1UM8A 1CS4C 2GAAA 1VYTA 1GG2A 2IYTA 4JT2A 3BORA 3DKPA 4LYJA 2PCLA 2EWWA 2IYLD 2OLKA 1P9RA 1KI7A 3BE4A 1NL3A 1VTKA 2XSZD 2BIFA 1A2KC 2QGNA 2QI9C 5J4KA 1YJ5A 1E9RA 3DM5A 3CO5A 3L2OB 3A1WA 3FKSD 3M6AA 2OCBA 4QM7A 1DO2A 1TPZA 3GLHB 2PLFA 1KO1A 2B8WA 4EKDA 4IFBA 2WSMA 1JQLB 2CVFA 4JL6A 4I1OA 5CIQA 3TW8B 3RS5A 2WKRA 4PHGA 1JI0A 3GLHA 2N42A 3LFUA 3HYRA 3THWB 1NLFA 2FX3A 3FMPB 5JEDA 1VPLA 1XZQA 4A0RA 3SQXA 2ZE5A 1E0SA 4DSNA 1I2DA 2FGJA 3THWA 2WM9B 1KI6A 1NN0A 1SKQA 3HPQA 4G0NA 3ZQ6A 5JZVA 4Q7JB 4BLTA 2ZR0A 3RNLA 2Q9BA 4DCTA 2D2EA 1U8AA 2J1LA 4Q4JB 2I4IA 5EE9A 2QEQA 4ACBA 3ZVMA 1JBKA 4Q1AA 2W00A 2WKPA 2QENA 2EW1A 4WAUA 3ZZ0A 3QEOA 4CT4B 4DT1A 3H1TA 3W6PA 1FX0A 2P5SA 2ZVQX 1BS1A 1ZYUA 1G8PA 2REOA 3NBZC 2DFTA 3LW7A 2XZOA 1E3MA 3J81k 5CYPA 4C0AC 4B3GA 4OHXA 1G1MA 4O2RA 3CNLA 3I8XA 2J41A 2RMKA 1XD2B 1JJ7A 1N6KA 3EPJA 2IYWA 2QORA 2JGNA 1RYHA 1PVOA 3U3RA 2OM2A 3O8RA 1E2JA 3LY5A 3AUYA 1XD2A 3JZMA 4C0JA 1J7KA 3BFKA 4JVMA 2D7DA 4EAQA 2WMNB 2EFEB 1OHHD 1CJKC 3QXJA 4KCGA 5LBIA 5HE9A 1CLUA 1GDDA 3KTAB 1A82A 3ZGXA 4JYCA 1KGDA 2OE2A 4LV8B 1AS3A 4QJ3A 3VFDA 3VR1A 1DPFA 1ZC3A 5GADl 5E4FA 4ZCMA 4KVAA 5CYOA 2Q3HA 1A2BA 3WYFA 3UATA 1LNZA 4LHVA 4G5QA 4DB2A 3H4MA 3UKDA 5KOYA 1TQ6A 1Z3IX 3AGPA 3GD7A 4TT3A 1NY5A 4P32A 2Q6TA 2H57A 2ORVA 3CH5A 1U90A 2ZAOA 1Z6TA 1D2EA 4V0ME 1WBDA 3ZD6A 4BZQA 2QMOA 4MYCA 4F4JA 1VYVA 2FSHA 2WPDA 3LW8A 3RLFA 4PR0A 4CIDA 2GVZC 4KBFA 5LD2C 2NO7A 5K8LA 1FL9A 4LJ9A 2IUSA 1BKDR 4XWAA 3RWMB 5FBVB 2B92A 1SVKA 4IW3B 1GNRA 1E9CA 3PV0A 4KFUA 4ZPXA 4WIAA 1U9IA 2ODBA 3TUIC 5BN4A 1UBFA 2MSDB 4DLRA 3NDBB 2WTUA 4D0LB 4LDJA 3K9GA 5L3QB 2HT1A 1L2TA 1VDZA 1X1SA 3FDIA 1GZSA 3PEWA 2X19A 4KFTA 2F6RA 2H17A 2F7SA 1W4CA 4AKHA 5L3QA 1TL7C 4UJ3A 1SHZA 4RZ3A 1Q1BA 1KI3A 4IVPA 4XVQA 1XNJA 4QRHA 5K8UA 3P20A 1W4AA 4HB2A 2NMVA 5HZKA 5LPNA 2IXEA 3QXSA 2LKCA 1H8HD 4PC1A 4FW9A 4B71A 2HF9A 4Q9LA 3EZFA 3IHWA 4G3XA 3WMEA 1LVGA 1ZD8A 2HYDA 3BOSA 3LXRA 4JVLA 3LAWA 4HLUC 1P62B 2ZYTX 4DLWA 1F60A 4TYYA 3M1IA 2REBA 5FOVA 1RVDA 2HLDD 3AKCA 3ADCA 1G8HA 5HZHA 4PC3A 2Z6VA 2ZJ2A 3LVRE 4QXAA 5EE1A 5ELXA 2WJYA 1RPZA 3KDSE 4A8JC 4GBMA 4MYHA 1YRBA 2X77A 2MMCA 3WMFA 2BEJA 4DLTA 3MWLA 3N2IA 5KU1A 1QF9A 3A4NA 4PSAA 2ZRFA 1FOEB 2GHIA 2ZTSA 4LBVA 4LJ7A 4GZMA 1G16A 4OQFA 5EXTA 4ESVA 5CB8A 3GJ6A 1DS6A 4X8HA 2QUZA 1FUUA 3QPVA 2EU8A 1IXZA 1KJZA 2VF7A 2F43B 2G6BA 4G5OA 1SVOA 4DIEA 1OF1A 5TARA 1E79A 2ATVA 1Z0DA 5FUWA 4LJ6A 3KL4A 3VR4A 1YZLA 4W7SA 3GLGE 2F43A 1UFQA 4TTPA 3I1FA 3WYAA 5BXQC 1WDTA 2CJWB 2XSZA 2QBYB 1M8PA 2QGZA 4LHZA 1JNYA 3A4MA 1R6BX 1ZU5A 2Q9AA 3K0EA 4I99A 2IYXA 1G7SA 3U3OA 4DSTA 3DPUA 4D2IA 1ZMXA 3EWSA 2RGCA 4TQ9A 1OXSC 1S96A 1VYUA 1XTJA 3Q5DA 3U7FB 2IS6A 2O8DA 3EA5A 3LBHA 5FTMA 3DDCA 2FFQA 4MGYR 4URYR 2OO7A 1COWA 4B3XA 1JXMA 4JIMA 1LS1A 1NLZA 5DHAA 2ONJA 1FFHA 4GPTA 4A0HA 4DLVA 4UKDA 1VMAA 1G8FA 2CLCX 2QP9X 4TLBA 3L8YA 4Q1FA 5CITA 2JLXA 1W48A 1PZNA 1KMQA 3IILA 5JCZA 2JLZA 1KY2A 4W5HA 4DBLC 3AUXA 3KUCA 2OCAA 1WE2A 2IX3A 3AF0A 3AV0B 4M4SA 1D2NA 1GRRA 1UDXA 3F3YA 4E22A 3RANA 2ZRKA 1CP2A 4TLCA 2CE2X 1UBCA 2IXGA 2VHCA 4V0MA 3RAPR 1E2FA 4TWZA 1R5BA 1N6RA 4KU4A 3FHOA 3LBNA 4LYFA 4YXWD 3SHWA 2D74A 2ZRBA 2ODEA 2QT1A 721PA 2YC4C 2REXB 3B6EA 1JALA 1Z6GA 2GJSA 3U3MA 3E1SA 1AGRA 2NOAA 1FP7A 2W6JD 3QPWA 4B6EA 2GKSA 1Q21A 2GJ9A 1AK2A 1EG7A 2NPIA 2ZU6A 2JLWA 2QSYA 2QQ0A 1LB1B 4M1YA 1RZ3A 4PHTA 3AKYA 3T5DA 2CCJA 2G3YA 1AJEA 1Z0FA 2OHFA 1DARA 3LBIA 3K70D 5FH9A 2OXCA 5EP2A 2WWHA 1BIFA 3KKNA 5FBQB 2XITA 3B60A 1ZW6A 2R2AA 4QGAA 4ZCIA 1IHUA 3EIQA 3CLVA 2R6FA 3VKGA 3PQCA 1TQ2A 4Q01A 3EPLA 2AN9A 3QY0A 4DIDA 4Q1DA 1X6VA 3B1VA 3B82A 2IA5A 2JDID 3FHCB 4BFUA 3BS4A 1Z22A 1R10A 3I8SA 4LBZA 4AKGA 4QNMA 1HQYE 1VIYA 1WCV1 1Z2CA 4H9GA 4B3FX 3ICQB 1GKYA 2GILA 2QMEA 1XJCA 2D62A 2FPKA 4RZUA 5TXGA 4BLOA 5JS8A 4IOKA 1XX6A 1E2QA 1VHTA 1NKSA 2YC2C 1SXJB 3X1ZA 5JJIA 5C18A 4JLVA 1SGWA 2OILA 4AKEA 2CLDX 3ZH9B 1M34E 4HAVA 2BV3A 3EAQA 2Z43A 2VSOA 4RKFA 3SBEA 1N5LA 1G7TA 1NI3A 1DTSA 4P4SB 1LW7A 4US1R 5EZ6B 4C0BA 1OIVA 1X8KA 1Z83A 2R9VA 4IEIA 3W5IA 1T4GA 4JLAA 5BWMA 3FPAA 1SHKA 4JLMA 5AJYA 4GMDA 2FV8A 4JMPA 3GLGB 2GXUA 2G0TA 4B43A 3HPRA 4P4SA 1KNQA 1G64A 4BFTA 1E2HA 1UEJA 2AFIE 4V0LA 3C15C 2Z5FA 3GLGA 2B7BA 2DYKA 4Q1CA 2KI5A 2RGDA 3SYKA 1AIPA 3SFZA 3A6PC 2F1IA 2VHJA 1HUQA 3IO5A 5D3MA 4MITA 4ZKEA 2O52A 2RGNA 2GEDA 4QJ5A 4V0KA 1KY3A 1F6BA 1QHIA 3PITA 4D82A 3GPLA 1S3GA 1TADA 2PMDA 3LLUA 1II0A 1KKLA 4G5GA 1N5JA 2A5YB 3QVVA 1H8HA 3ZZUA 4GOXA 4DLSA 2H8KA 4PZZA 2ANBA 3S1AA 1G6HA 2LCFA 4GNKA 1XCGB 1E0JA 1EXMA 5TY0A 4F93B 4JVSB 5GJBA 3SZRA 1E2GA 1V5WA 2IW3A 5KPJA 2QU8A 5GVSA 3L43A 2ZS8A 3TRFA 2FEOA 5EJEA 3NXSA 1IN5A 4PQRA 4OJQA 1IY1A 4Z1MD 5JJKA 1N3BA 4RD4A 3BXZA 3DMDA 4AC9A 3FMIA 4URWR 3DKVA 1ZM9A 3R9XA 2V6IA 1QRAA 1KNXA 2RHMA 3UG6A 3K09C 1LF0A 2FFHA 1W4RA 2FG5A 3K0FB 4OI1A 3VX4A 5HE8A 2J9RA 1T8UA 4I81A 1DG1G 3AM1A 1J90A 2R62A 4LRWA 3RVBA 1IN6A 4A92A 2PX3A 1DAEA 5CJPA 3U4QA 4MA4A 4EUNA 5KYKA 2C96A 2R6AA 2NO1A 1YZKA 2MSEB 4YC7A 3CRVA 2FJUA 3V00A 2JLYA 5EE0A 4TYWA 5C4MA 4MRSA 2ZM5A 1CBUA 4RD6A 3D31A 3QXHA 1IM2A 3RS0A 3BFVA 4DCUA 1TU4A 3P26A 4NCKA 1G3UA 2OFWA 2QPTA 4HYYA 5AJVB 5FPHA 1XPUA 3BB4A 4W5JA 4IOLA 2IHYA 1X8JA 2ZJ5A 4N0DA 3RS4A 4A36A 3JVVA 3KQNA 1G5PA 2QROA 1ZD9A 3OHMA 4KSBA 2C9CA 3IGFA 2IYZA 3P4YA 2Q9CA 4LUCA 2G77B 1KZ7B 1N6NA 2DCUA 1D8TA 1CJTC 4PPFA 2Z83A 1G6OA 3UWOA 3VAAA 5GJVC 3THXA 3QKUA 5G41A 4RVCA 4HZUB 2IEYA 1R0ZA 1CRQA 3FVQA 3ADDA 5B64A 2FE4A 1YQTA 2DBYA 3KUDA 2D06A 2FN4A 4EQ6B 5FOUA 2J46A 4BQSA 1P4SA 3EA0A 4MRVA 3AKEA 4ZO4A 4HAUA 4FINA 4HZUA 1RIFA 5IHPA 2H5EA 3CRQA 2W2VA 1XEXB 2P0EA 4EQ6A 3LNCA 4XJXA 3TVDA 1RRGA 2Z4RA 2VP5A 1GAJA 3C5CA 3CNOA 3K0CA 3Q85A 2IBMA 5FUVA 3AVPA 3R8CA 4U7DA 3I62A 3ICEA 2QM8A 3G0HA 1XMVA 3DM9B 4HEJA 5M04A 3FFBA 5KNBA 1E9BA 4OI2A 5JHGB 1VCIA 2C98A 2BBTA 4YXWA 3IUYA 4TYQA 4PAMA 3W8RA 2ZRPA 5FBWB 4NTZA 3KJEA 5DSZA 1L4YA 2PZGA 4IVQA 1A7JA 3RRMA 1NLYA 3EWAA 4HLQB 1WXQA 4PAQA 1TX4B 3DMNA 4LGMA 3HP1A 5DE3A 3VNUA 4IDQA 4WW0A 4QC2A 3UK6A 3RDPA 3OAAD 2OCYC 2A78A 3ZS9A 1AM4D 5B57C 3DEFA 3KQLA 2XNDA 2ZU0C 1S1MA 1E2MA 4M9XA 4MUAA 1P5ZB 3UG7A 5JWOA 3GLFE 4YLGA 4EJSA 1EX6A 4AYXA 4PO8A 3CPHA 3AVYA 1XD8A 5CB6A 4WZAE 3F0TA 2PEZA 1CR2A 4PTLA 1AS0A 1LS6A 3WMGA 5JECA 2IUTA 5J4VA 1ZM3A 2W0MA 2ZRAA 4FN5A 2JDIA 2FZLA 1FUKA 3NKVA 4OK5A 4DDVA 2LWIA 1R0XA 2CVHA 2ZITA 1XB2A 1VIAA 1G20E 1UPTA 2ZI5A 4Q47A 1LV7A 1E4YA 3IHLA 5FBRB 4FMDB 4QHTA 1W0JA 2ZJZA 3WXMA 4Q66C 2MMGA 4B76A 4X8LA 5IK2A 3KJHA 4RKEA 1G291 3ZIAD 2OBNA 2QE7D 4LBWA 1RRFA 1J8MF 1I4TD 4M2LA 4Y0VA 3NHBA 3SHFA 4UQOA 5DH9A 2FFBA 1N6LA 2GXAA 2GCOA 5EE5B 2ZJYA 2PEYA 3X2SA 2F1RA 221PA 4L9WA 4L5BA 4KFRA 2BM0A 2WKQA 2QAGC 1IBRA 1XTRA 5C46F 1OH8A 2GRJA 4AKIA 2ZUDA 2ZETA 3B1ZA 2DFNA 2NGRA 4HLUA 4JKYA 2DWPA 4FMDF 1KDPA 1K5DA 4IXMA 4JBYA 4V02A 2CHQA 2HCJB 2DFKB 2O0JA 3B9QA 3OE7A 4LK2A 1DAKA 2BBOA 1E1QA 2QNRA 1DADA 2GVDC 1IN4A 1JECA 1M74A 1ZCAA 4A8JA 3KJGA 3IBYA 4URZR 3SYNA 4RJLA 4D4KA 1XXHB 1SXJC 1SVIA 1XEWX 1Z5ZA 2G83A 2KE5A 3WNDA 1YZGA 4UNRA 4KYIB 3SOPA 1N6IA 3VR2A 3OIWA 1NBMD 4O25A 3AQ4A 3QF4B 2VP6A 2GXQA 4AIIA 2VTKA 2VHQA 3LO5A 2JJ2D 2OT3B 1DG3A 3H2YA 2V9PA 1P2VA 5E3HA 2D2FA 4IOJA 1NRJB 4CEHA 4Z1MA 2J45A 3PEVA 4JJZA 1GVNB 4M1MA 3ECCA 4DCVA 4F4CA 2GZAA 1X86B 4ZDKA 1S3SA 2O8BB 3QBTA 4JJKA 1VG9B 3A36A 5CDFE 5JHHB 2CCGA 2ZSDA 2IXFA 1NVXQ 2ZJAA 2FA9A 5DN6D 3PFIA 2O8BA 2GDJA 2R6GA 2GF0A 3U61B 3SN6A 1KMHB 2WWGA 2XTMA 3RS7A 2EFDB 4B2IA 5EXPA 4NL4H 3WBKA 3CX7A 5HCIA 1G17A 4RSGA 1KMHA 3AEZA 1E9AA 4JSTA 5EXSA 3K9NA 3OEHA 2YWHA 2ANCA 3GLFB 4PFSA 1BMFD 1W46A 3H84A 4OBEA 5DGXA 3VR6A 4DLUA 1JAIA 1AN0A 3GEIA 4RCZA 4F4IA 4WOPA 5KSYA 3GLFA 1M1YE 3AF4A 1OH7A 1BYIA 2HUPA 4Q7KA 3KQUA 2HJGA 1KI6B 3VKWA 4PHHA 4B3DA 4QHYA 3AVQA 4P4TA 1GILA 5KDDA 3AP2A 2F9LA 4BLPA 3VR5A 2V7QA 3ZYCA 1AS2A 2GCPA 4EPYA 3RS2A 1L4UA 2CHVA 5FOWA 1G3IA 2ASEA 3VU9A 5A4JA 3SJZA 2WSSD 1VECA 1J99A 4DT1B 2QSZA 4IVRA 2YOFA 1K6MA 3I92A 2GETA 1FX0B 2GBLA 1ZRHA 4A4DA 2OFOA 4QJ4A 4K8OA 1XP8A 1ESMA 1XPOA 2IYYA 2P3SA 4Z8YA 2DB3A 4M9SA 1OYWA 5J4HA 1DE0A 3WY9A 2BKEA 1N6HA 1PJRA 2EFHB 4PPGA 3U3KA 4NBSA 5E7IA 1DELA 1EFUA 5UKDA 1U0JA 3T35A 1OKKA 1E9FA 1JPNA 1E9DA 2OUKA 2G1JA 2OCPA 2ORWA 3DOFA 1ZINA 1HH4A 2XOKA 5FBLB 5E7MA 2BCJQ 4HAYA 4KLNA 2WJJA 4DSOA 3K9HA 3CM0A 3VR3A 3QXCA 1U98A 5KDOA 4WZ6A 2BMEA 2EFCB 1O3YA 1Z0IA 4M1OA 3DZDA 1KO8A 3AB3A 3QG5A 2XTZA 1IY2A 4TYNA 1MR3F 2FGKA 3G82C 2C03A 4HB0A 4W5WA 3FE2A 5FOTA 3NWJA 4QNRA 5AJZA 2F1HA 4IHQA 1T0HB 1E1RD 4TMKA 4UXJA 5FUXA 4DEXA 2A5GA 3KXKA 4OI0A 3NDPA 2W0SA 2IS1A 3NTUA 3CZPA 1RKBA 3EXAA 2C9OA 1GL9B 1OYYA 4KVGA 5BN3A 4D81A 4NZYA 4QFMA 3R7WA 3RS3A 1IOZA 1W0KD 1QG4A 2PZEA 1KSGA 3OFND 3B1XA 3GFOA 3AP1A 5CK4A 3THOA 1T5IA 4DC9A 5F98A 4ERNA 1OXXK 2FZ4A 5H68A 2PH1A 3CONA 3MGCA 3AVXA 4B6FA 2GJAA 2ZR7A 1P61B 2RGEA 4NPHA 3O8BA 4OI4A 3T06B 1HV8A 2YOHA 2MSCB 3T1OA 1OXUA 3A58B 2GTPA 4PANA 3IIKA 4R9UC 5EQTA 3E70C 1IJEA 1D9XA 4F92B 2RB4A 4Q19A 3TMKA 4FWTA 1XTKA 3L82B 3SYLA 5CDFA 1SKYE 4TLDA 3TLXA 1W36B 5SZJA 2IC5A 2OAP1 1NJFA 4X8MA 4TL9A 1WF3A 1WB9A 3FKQA 1RRPA 4OK6A 1Z29A 1Z6AA 2ZRIA 2YOGA 3C41J 1KDOA 1XD9A 5FI1B 2V1UA 4PSVA 1KJWA 4BFXA 3D3QA 2QTFA 3EC1A 4BRWA 3PUYA 1EFCA 3OIVA 3TIFA 1KK2A 1XCPA 2HDNB 5CLQA 3HU2A 2WOJA 1CRPA 1T6NA 4TMXA 1GRNA 4EPTA 3T1VA 2RGGA 2W2TA 4MGKR 4XOIA 3WRXC 1AQYA 1HYQA 3FWYA 2XX3A 1TMKA 2FEMA 1CXZA 2YYZA 1QBKC 4A6PA 2J0SA 3KB2A 4WZBE 5KDLA 2AL7A 4JBWA 1Z07A 2V54A 2VP0A 1SULA 1KSHA 4OL0A 3TKLA 4M53A 4RFSA 1KI1A 3AF2A 1QHHB 3U5ZB 3TBKA 4POAA 2AWOA 4BLQA 4CEJB 4DCSA 1T5LA 2D7CA 4RZ2A 2QA5A 1NVVR 4HLDA 4CYMA 4D0NA 4CF7A 1OH6A 1QHHA 3AVWA 1NVVQ 1RE0A 3MAAC 2GESA 4CEJA 1M2OB 3H0KA 3QNUA 5KSZA 1DEKA 1QVAA 2FPLA 2V55B 4A0GA 4FCWA 5C2JB 1NVUQ 4RCYA 1P2UA 2AD5A 3AVUA 1GFIA 2ZI7A 1GIAA 1N25A 1XU4A 3NH6A 4TLAA 1YZTA 5EP4A 4DDUA 2JATA 1MKYA 1JEEA 3OZXA 4D6PA 4G5SA 5CJ2A 2RGXA 3HR8A 4TLEA 3FFAA 3SQWA 3BJIC 4HB4A 3HYTA 5KHOC 2CLSA 4S35A 3L0PA 1OE0A 2K5UA 5JEEA 5FTNA 5KNDA 1NP6A 4DLYA 3BAFA 3VKHA 4Y0AA 2IT1A 5L3VA 4A2WA 4DSUA 2A5JA 4LHXA 5G3YA 4XD7D 5BQ5A 2J7PD 2ZYVX 4OYHA 3PIRA 2O8DB 1EX7A 1Q3TA 2HYIC 2J3EA 4XSGA 1Q12A 3FKSA 3ZDQA 4FMBB 1T9HA 1WA5A 3NEYA 2VQSA 2NO0A 3N70A 2D3WA 1K5GA 2ZSAA 4PO1A 3A8TA 5FPYA 1Z06A 4IFEA 1TUIA 2D4HA 2WMOB 5TMPA 2JLUA 4BASA 1MRNA 2BBWA 1EFTA 1TNDA 1KI8A 3KZ1E 3TVTA 4PZLA 2WBLC 2ZREA 4TZ0A 3UMSA 3GJ8A 4P33A 4Q03A 4L8GA 1MRSA 4BE7B 2GXSA 2ZE7A 2ZPTX 1U0LA 2BDTA 3CX8A 2WSSA 3QPUA 5FOSA 4I1VA 3C5HA 4HUQB 4TZ6A 3NC1C 2PT5A 3LWNA 3U44B 4C9BA 2BHRA 1Q3HA 4HUQA 4KJZA 1Z0KA 3QEJA 4PZYA 4Z54A 3U44A 2GEUA 4JS0A 3SJAA 4HDQB 2ZIAA 1NN1A 3HR7A 3ZQJA 2PZFA 2VF8A 3KFVA 4B74A 1SKYB 1IXSB 3P32A 5SZKB 2F3TA 3AGQA 4QG7A 4AWXA 3IPYA 1XBTA 4UNQA 4QL3A 2OZEA 2XJ4A 3OESA 4B47A 4NE2A 1XWIA 5G40A 4R71A 4URUR 2B21A 2XGJA 2IYUA 4ABYA 5K8IA 2O8FA 1KOFA 4KFSA 5IDVA 1OHHA 3N2EA 3TSWA 3ZZTA 1I4LD 1Q20A 5FR1A 3R9IA 5JMTA 5KSOA 1A5TA 1XTSA 2OFXA 2I1QA 4BZPA 3MSXA 2IHBA 3MJRA 4BFVA 3PG5A 4LC0A 4OQLA 1R5NA 2WWIA 5AUQA 3EZ6A 2OV2A 4B32A 3W5JA 2AWNA 4TTRA 2XZPA 1U94A 1LF5A 2ZRGA 4TSFD 5DO9A 4KODA 4TMTA 1FTSA 1FPMA 3ND9A 2NO6A 1T8TA 1Z63A 2OAQ1 1OV4A 4F91B 1NKTA 3TAUA 1AKYA 4A15A 2PT7A 5KPDA 4GRAA 3KKMA 2YHSA 2J0UB 3EZ2A 4MUBA 5JRJA 4KITB 4YMWA 2I1VB 2ZRNA 2ATXA 3WP1B 1E0KA 1W0KA 5L3SA 5B2ZA 3K1JA 1N0UA 3OFNA 2ZJBA 5G53C 1RW4A 3R20A 4DLXA 2C8VA 2J0UA 3D6TB 2N46A 1EFHA 3TH5A 4HDCA 4D25A 2ZUCA 4IXNA 3D7MA 2A9KA 1G3QA 3BB3A 4DJTA 1Z47A 2BKUA 1XDBA 2CNWD 2CL7X 4I1UA 1VKJA 4PQYA 3NC0C 5TVKA 2BCGY 3X1WA 4XIGS 5AR1A 1H8ED 2C77A 5CK5A 3L8ZA 2CMKA 1QVRA 3LVQE 1NN3A 3QUSA 3MUFA 5D3MB 5LB2A 3IIJA 1CJVC 1GKIA 1OFUX 1YR8A 1MO6A 2JA1A 4EDHA 3AF1A 5DI3A 2YV5A 5FI0B 3SC3A 2V3CC 5L8VA 3W34A 4YONB 3TE6A 4KHZA 2WV9A 4UXHA 5EZ5A 1XJ0A 3S1AB 3U2QA 2VO1A 3U60B 3L0IB 1OJLA 4PXAA 2JJ1D 5HR5A 1KHTA 2ZAMA 5AWFC 1HT1E 1HTWA 2YNMA 3AKDA 4Q9KA 4C0LA 3ZVNA 2EQBA 4CEIA 3PJRA 1O87A 2HLDA 3AVVA 4BWYA 4FCVA 1T3HA 1HA3A 1PUJA 4NH0A 2YWEA 3KKOA 1E96A 4AG5A 4EFMA 3RSOA 5C4GB 3VTKA 2FMXA 4YMTA 1E9SA 1IXRC 4NCNA 4B2PA 1DAMA 1KSJA 2ECKA 2G0NA 4FMCF 5J40A 1GITA 2GK7A 3T1TA 3X1YA 1P9NA 3U4QB 1W36C 4EPVA 2J5XA 5K8TA 2ZQ5A 4C4PA 3TUZC 3QQ5A 1TQDA 4HZIA 1S2MA 3NBFA 4IJMA 5HPYB 4OJKA 4Q9HA 1U8YA 1AZSC 1Z8FA 4JBXA 1AKEA 2GZDA 5BW8A 3ADKA 4UNPA 2A30A 4LCBA 3IO3A 2XEXA 1UADA 1U0HC 2XXAA 3PUZA 4Q1BA 4Q7LA 5FL3A 1G5RA 3CR8A 3MFYA 1UKVY 4LYHA 4RD2A 4E09A 1J8YF 2AX4A 2ONKA 4XD7A 4K81B 1OW3B 1E2KA 2VH5R 2PJZA 1NIPA 3EARA 4PC7A 2FDCA 3BC1A 1CTQA 3THXB 2LKDA 4NCIA 1JAHA 3OF5A 1D5CA 3LA6A 2FF7A 3IQXA 3VHXA 3E2IA 1W44A 3O8DA 4TQUS 4R2HA 1W5SA 4BLSA 3DL0A 1X8LA 1U2RA 3ZVLA 4LBYA 1ZAKA 2QTHA 4IRUB 3KQKA 1E6CA 3I61A 2UKDA 4Q21A 3U7GA 1YR9A 4ZDIA 2IS2A 2GK6A 1ZIOA 1HQCA 1Z0AA 3GEHA 3VQTA 4PC2A 1ZNYA 2ZE8A 4D26A 4II7A 4LJYA 3FMFA 2W2XA 4G1UC 2JAQA 3WRYC 4LOAA 3K9LA 1JQJC 3GLIE 2JLVA 2XB2A 3CPEA 5CM9C 1HE8B 1R0WA 1FQKA 2BJWA 1OXVA 1MABB 1MOZA 1ZC4A 4XSHA 3MD0A 2B8TA 2W58A 3GJ7A 821PA 3KXIA 2GZHA 4R2IA 3Q8XB 1DBSA 1XCMA 2V4ZA 1YR7A 2P2LA 3EIEA 1MABA 3C7KA 3B85A 3EASA 4M9ZA 5DYIA 2W6JA 3OIUA 1KAGA 3A1UA 4OQNA 2F9MA 5HTKA 5BN5A 4JLNA 4AYTA 2R65A 5GJCA 2KB0A 3QKRB 3K70B 3JVUA 4DLZA 2VBCA 4EJSB 1YVDA 2CHGA 2NQ2C 4G01B 1FMJA 1TU3A 3IKJA 1KDTA 2B7CA 3FTQA 4NHOA 4URXR 3QKRA 1ZIPA 2R44A 4ON9A 3SU8A 3T61A 8OHMA 1DOAA 4M1WA 4LY6A 3B9PA 2ZUBA 4MYUA 4WXPA 4LWZA 1TF2A 2V6JA 1F5NA 2H16A 5LD2B 2DPXA 1CR4A 3QENA 4GMXA 3T1QA 4TL8A 5A5GA 1SQ5A 5H1YA 4B3BA 1DAHA 2A2ZA 3RRNA 5JFGA 2EFGA 3CB4A 1YHNA 1P9WA 5TB5A 2O8CA 4JSYA 3TR5A 2BM1A 1PUIA 1KK0A 2JLQA 3PENA 4PO9A 3I5YA 3L0OA 4LV6A 1R0YA 1Z08A 3LXXA 1N5KA 2AXPA 2CEAA 2B6HA 2E1RA 3EG5A 4P0TA 3WHLA 1MO5A 3K0AA 4C0QC 3EX7C 1B0UA 4Q1EA 4EFLA 2ZYWX 4DWJA 1M6NA 2G9NA 2BWJA 1B23P 1P6XA 2WZQA 4AG6A 2QMHA 5LB4A 2QRZA 5EXXA 1RJ9B 1EGAA 4ARZB 1A4RA 2GCOB 2ZRJA 2XZLA 3P27A 2RAPA 4QGHA 3GJ4A 5EUMA 4TT3D 1ZJ6A 2WHXA 1US8B 1P72A 1IN8A 3A1SA 3QJYA 1RJ9A 5H70A 4ARZA 2WJGA 3ZVRA 4DEYA 4BEJA 5CLLA 1KYIA 1QHXA 1US8A 4N1AA 2X8AA 2NZJA 2VIIA 4MYTA 1P2TA 1JEDA 2KJQA 1DO0A 3C14C 4KI0A 1N0VC 1GSIA 2C95A 5FL7D 5FPTA 2CXXA 4A8JB 3CF6R 3BFXA 2YINC 2A5FA 1W47A 5EUQB 2XNSA 1CJUC 2VLIA 3GJ3A 2FU5C 3K8YA 1VCNA 4A9AA 5KSPA 2WJHA 1D6JA 4XTCS 1ZVQA 4IDPA 2VP4A 3EC2A 4LJ5A 1KKMA 2UVQA 1CR1A 3CH4B 1LY1A 2JLRA 4DB4A 4YDSA 3VX3A 4Q9JA 3LX5A 2WOOA 3CRW1 4TYPA 4L16A 3T5GA 4ZIRB 2TMKA 4LV5B 3RYTC 3X1DA 1EWRA 4CEHB 3FOZA 2X1VA 3MRSA 2CBZA 3UANA 2IL1A 4ITRC 4G5RA 1E32A 2XAUA 2WIAA 4ZIRA 1KK1A 4LHYA 4D4LA 3QE0A 4KSCA 5DLQC 3GLIB 1AQUA 2OXRA 1E2IA 4P4UA 1XZPA 4AYWA 4EPXA 2KBFA 3UXMA 4YDHB 3PEUA 1YE8A 5DIFA 3GLIA 2V8OA 3THYB 1XMJA 3GQBA 4RD3A 5E95A 4I1SA 1IJFA 2RGNC 2OLJA 1OB2A 3ADBA 1UEIA 2VHUA 3U7HB 2YWGA 3THYA 2NZ8A 2E87A 3A37A 1NF3A 2ZRHA 2FSIA 3VHLB 4P3YA 2A7QA 3MLEA 2O8EA 1R8SA 2G88A 2X2EA 4GDFA 2O0HA 2ODWA 3OEED 5GJWC 3SNHA 1E2PA 3W90A 3AVTA 3HU3A 3Q3JB 3T34A 1E79D 4QOSA 4NP6A 1VG8A 3TSOA 1FMLA 3FMOB 4H1VA 2VP9A 4OKSA 3BB1A 5DI9A 3KB1A 1G3MA 3GJXC 3D8BA 2JIZD 1ZCBA 5F9HA 3REFA 3B7GA 1XMSA 4XTRA 3V9PA 4U00A 1E2LA 1NBME 4CW7A 3KKPA 2NG1A 1NG1A 3VU9B 1F2TB 2OSBA 3UMRA 3ZS8A 3FHTA 1UAAA 4Q02A 3KXLA 2R6DA 3RWOA 5TDHA 2YWFA 4CVNA 1DVRA 2O0KA 3CR7A 3C4JA 3RHFA 2GEVA 1QHNA 2Q3MA 3JZAA 4HLCA 1F2TA 2WIBA 2JEOA 3TAHA 1II8B 2HT6A 4EPWA 2QTVB 4XVRA 3IIMA 1COWD 1ZM2A 2AFHE 1XMIA 1II8A 5AJXA 3W6NA 5FFMA 3TNFA 4KO8A 4H1UA 3P4XA 2CK3D 1M7GA 4GSYA 4M1TA 4OHZA 3V4RA 2BVNA 2HCBA 4BECA 1JR6A 4JLPA 1P7CA 3B1YA 3ND8A 1IAQA 4FXPA 3GFPA 4JVNA 3W3AA 4GP7A 4E07A 3HU1A 3ZJYA 1TEXA 1CF4A 4Q4JA 3OAAA 1XF9A 4ZI2A 5TV2A 2DR3A 2AD1A 4EPRA 3U6KA 2CL0X 1E4VA 2G1KA 4PAOA 2RH5A 4JLDA 1KJYA 3H86A 4A0FA 3O47A 1K8RA 3MWYW 4PX9A 4Z8XA 4TMZA 5J4YA 1BOFA 3K0CC 5BYJA 4DKXA 2Z4SA 1ZM4A 3BRWD 3AH8A 4WXRA 3RRZA 1NNEA 1CULC 1G8GA 4QBFA 5AUOB 4KXFB 2XTNA 3RABA 1Q57A 1UKEA 1R5OA 3Q7QA 3R8FA 2IYVA 3R7WB 3NG1A 2F3RA 1BO6A 1T0JB 2QZ4A 4JLJA 2Q0HA 4PHFA 1JPJA 2YKGA 4QBIA 3TK1A 2ZSEA 5JRZA 2Z0MA 3CUEF 1P75A 3BH7A 1PLJA 4MGZR 4ZDJA 1XTIA 2J0VA 1ZNWA 4WVFA 4YMSA 5A0FA 3GJ5A 1C4OA 2C9YA 2H18A 5BYKA 1SZPA 2P67A 4ILEA 1RYFA 421PA 5J47A 3CW2A 2QN6A 4X8OA 2JCSA 2DWOA 2FPMA 3KTAA 2WVJA 2CDNA 1T3LA 3MJHA 1UF9A 3ZIAA 3GJ0A 4M21A 4QGFA 1SVLA 2QE7A 4LHWA 1KI9A 2EWVA 3K70C 3UWKA 3U3JA 3W6OA 4TMVA 4EJSC 4OHYA 1F3OA 1ZU4A 5AUPB 1GNPA 2ZROA 3DO6A 2PX0A 3KJIA 4NONA 5DISB 4US2R 1RRCA 4HAWA 4LZZA 2IWRA 2BMJA 1VCMA 1X1RA
chains in the Genus database with same CATH superfamily
2Q0SA 4S1VA 4WV3A 4QTXA 1XL1A 3RC8A 2INGX 1M2WA 2Y0DA 4YFYA 5EJ7A 1ORTA 2DVMA 1ICEA 2HRRA 1BQ4A 3LUGA 4EB8A 3INGA 4BU1A 3U5TA 4RXUA 4ZARA 5K0SA 1FMTA 4RS4A 2C2OA 3D2BA 5LP6B 3LTNC 3DWFA 1CJSA 4GLBA 4KIJA 1ECBA 2ACVA 1NYLA 4RAQA 1QDLB 2NPFA 1WRBA 1M5TA 4DKJA 1ZEJA 4ZDWA 5IEJA 4JLWA 3PHIA 5LP6A 4NECA 4FB5A 1PD0A 2VK2A 2VSFA 3SFTA 3I5XA 2C04A 2EKBA 1IHDA 1A72A 2JH8A 4K03A 1YFZA 3O38A 5LJIA 4MKRA 1DC8A 1QG0A 4ZI7F 2C2HA 2JBWA 5JMPA 2VPPA 4KE8A 2C7BA 1TT7A 2AR7A 5BOSB 3GARA 4FFDA 4D4MA 4RFSB 4BWGA 2XVXA 1FZQA 1T5HX 1CJCA 1Y42X 3FPGA 4MS3B 4OHWA 3TPCA 1LQTA 4FDVA 3WA6A 5DM0A 3FLEA 1OR8A 4OHUA 3P2IA 3DMYA 4P35A 2CZQA 3GYBA 1L7BA 3HTXA 2XE6A 3V2IA 1KDRA 1KH1A 2W4IA 1HL7A 3FNIA 2H59A 2G70A 3NRJA 1A5BB 1OGYA 4CQLB 4DCUA 3ZQJA 3DZ8A 3B78A 4OGWA 3RBAA 2FUG6 2FSGA 5I7EA 2R6CA 3HJNA 4HUTA 2DPMA 5JD3A 3OTOB 2IYRA 2AE1A 3AOGA 1CB0A 1J24A 1QIEA 1Y1PA 3JQAB 1O9BA 1MC8A 2PLRA 4JGBA 4E5UA 4ARVA 2Q2WA 2DBVO 1T2CA 5JDCA 5LQJA 1HNXB 1DEAA 2QAJA 1ID1A 2YZKA 4LK3A 3ORQA 1ZIDA 2G28A 2GWRA 3FI9A 3JQAA 2PMKA 3KXDA 5FTKA 3ZCQA 3KHTA 1TC2A 2A0YA 2QP4A 3UA4A 5DM4A 1QAOA 4Y6RA 3VNVA 2H8GA 4RM2A 5I45A 4HGYA 3ZLTA 1CY1A 2QN9A 4OSEA 5EERA 3V2GA 4RPKA 1Q7RA 4HGRA 3IDOA 2ZAYA 1OPXA 3ETNA 5E3JA 2D7JA 1JEQA 3R9KA 3ETLA 5AKIA 4G56A 4U7HA 4K9OA 1S8FA 5C35A 3UGQA 3RFXA 4B7AA 2ODNA 2JASA 3KZNA 1RKVA 1T4CA 3LVBA 4OIMA 3NHRA 4P84A 3R3UA 3KQHA 1XTZA 3NM4A 3NBAA 4WY2A 3SIPA 1LWOA 5K99A 1EFAA 3KBBA 2ZCVA 4C7VA 1IQRA 1AF7A 1MFPA 3ZWKA 5JI3E 4MSUA 2ZDGA 1ETUA 4HSEA 3R7AA 1TQHA 3QITA 1ZXXA 4TRNA 4IPTA 4ZYYA 2Y2UA 5F1PA 4UPVA 2FH5B 4BEBA 2CNNA 2GO7A 2KWIA 4JI4B 4NMXB 3QFRA 1P1KA 4QDOA 4GL2A 1SCKA 3C48A 1M5UA 1YOBA 3L8FA 3TL6A 5KU7A 4GKJB 3GMTA 1W6UA 2A3NA 1FDRA 4B44A 1RWMA 2BCEA 1S2OA 5ALXA 3ASZA 3CRRA 2MJLA 1ZQ9A 2QN7A 2EJTA 3SJCA 1Q0UA 3A0RB 4XE5A 3DGFC 3HGTA 3IE1A 1MX1A 1Q1AA 2RCNA 1YBFA 3A28A 2WAXA 4IF6A 4R2MA 4XPZA 3X2FA 1RIIA 3SZ3A 4YMUA 4B33A 4A0SA 1R4ZA 3B5JA 4GKBA 4XVUA 1Y1SA 3AXTA 1EEHA 2EIHA 1D9ZA 4PNHA 2C4NA 4ZV7A 2HXYA 3KX2A 4AMBA 2J9ZB 4MHTA 1RQLA 4MX8A 5BQOA 1WDMA 3H9GA 2IV2X 4E15A 3L40A 1LPMA 1KA9H 3E8XA 2YJNA 2VUUA 13PKA 2RJOA 2XQIA 4CRWB 3F8TA 4Q3EA 1V9CA 4IILA 1QVWA 1BSVA 1VZ3A 3FCYA 4RVNA 4Y2GA 3TO5A 2HEIA 5EPUA 4H7KA 2Y8EA 5B1EA 2FQXA 4PGFA 2I7CA 3IVXA 1I94B 2R1VB 3IXMA 1B16A 1ZH0A 4ZO8A 1F4PA 3NI2A 4BFZA 4DLYA 3BWDD 4XPIA 4KOEC 1HDGO 1RXCA 4QHSA 4KQGA 1WU7A 2PD3A 4I50F 5E9JA 5JIBA 1MEEA 4LY9A 4NAUA 2NU7B 4LC1A 3FM9A 3TQCA 5LU8A 2Z56A 1XEWY 4TS9A 5HW0A 1QZZA 1W1UA 4B35A 1L7NA 3AZOA 3ED5A 1HG0A 4V24A 1YVUA 2P6UA 2KQUA 2NU7A 3NHWA 2NYUA 2QG9A 2GBLC 3N2ZB 3NIBA 5GTDA 2FY8A 2O2YA 2O7VA 3L8MA 1P2GA 2IJGX 2YRWA 1TTHA 4YMHA 2C9BA 1YUMA 2CCKA 1VLZA 3FAKA 3B38A 4M99A 3EXFB 1FQJA 3H6HA 3MRXA 3NTOA 3QVKA 4UXIA 3FB4A 1FNMA 2OYSA 1OPRA 1WMAA 3EUEA 5L3SB 4BBPA 3LLVA 5F3WB 3PS9A 5B3AA 4ZVRA 1T8PA 2AI1A 4KK3A 2DHQA 3LX8A 4ESHA 1EP1B 1YTLA 3EXFA 1T15A 3OLCX 5AI5A 7GPBA 1SHUX 2ZRQA 2JK1A 3OM1A 3PPWA 4TSKA 3T12A 2B37A 4MI1A 3T7SA 1JKMA 5COAA 4BMCA 2ACEA 2VRWA 4LSZA 3QLEA 1OBHA 1HMYA 1FFAA 2QAGB 2P65A 3ZNNA 1H65A 3C2QA 3ZK8A 4RGQA 4EITA 3T4PA 5HJEA 1EE2A 2VYFA 1LLDA 3ZD9A 4UFPA 4GOKA 1UDRA 1OFVA 4IHJB 2GNOA 4G84A 2GF9A 2QAGA 2AR9A 3F49S 4HFJA 5EVCA 5DNDA 2YJTD 3RM3A 4EGQA 5KTYA 5L45A 5AKLA 5J4LA 4JQYA 4EY8A 3RYHB 4FI3C 4IHJA 1E2BA 1Z4NA 4GKAA 3NTVA 2PSDA 4P6VF 3RVDA 4BAUA 3UV6A 2C5LA 2IRWA 2ZSBA 3L93A 2P8SA 2PX5A 5MFZA 2E4UA 2GCEA 4QPNA 4TZTA 5HGJA 3AR5A 3PZBA 4M7OA 5EKSA 5T6MA 3RYHA 5BV0A 4XQEA 3R5JA 4RHYA 3HXMA 3NNSA 1AK9A 1I1OA 5KO2A 1SU4A 2VJLA 3FRHA 2SBTA 3I58A 4YJKA 1MJGA 3AM3A 4UBJA 3TDNA 1H2ZA 1AC5A 3ZLJA 4R5HA 3ROPA 1P9OA 1XZNA 3EF1A 4FMCB 1WKBA 4M36A 4CL0A 1KO4A 5B30A 3KQSA 1BDHA 3PT9A 2CDRA 3RTDA 1E69A 2IEDA 1AZTA 1V16B 1XZIA 3K2BA 4LYAA 3MIIA 2P1ZA 3O1LA 4G0MA 3H7AA 3HHPA 4GPD1 5DGTA 5EVJA 4C3UA 4D8TA 2BJVA 2QM7A 1C2TA 5G1NA 4UW9A 4DZTA 2ACKA 3GOHA 3BD7A 4DR5B 3NBYC 3H1FA 1F12A 1V16A 4CEIB 2C29D 3FNEA 3FUVA 2DZDA 1SHLA 2FEWB 1GPYA 4HN2A 2O0LA 1PTKA 4KBGA 1G41A 4LNUB 2WAYA 3NOXA 4XDZA 5TQVA 4FOLA 1LVHA 1U9IC 3QKSB 1JLSA 5F12A 2HF8A 5KVSA 3ETEA 2ZUFA 1CZLA 3K0SA 1M5RA 5EPOA 1D1PA 4LNUA 3WJAA 521PA 2IOFA 1IVNA 2BC9A 2ZYGA 3OE7D 1M8FA 4NMLA 4MEAA 3HB4X 4OP2A 1EP2B 4MQLA 2OHOA 5EINA 3QKSA 4P34A 3KKKA 3ZUPA 4JQCA 2IUUA 3RAJA 3E5MA 4C3ZA 5K6RA 1YKSA 3AY6A 4MVCA 2HO4A 3R7NA 3VYTB 1VE9A 5JMWA 5JBQA 4W9MC 1MJ5A 1EFRA 3GFGA 3TZCA 2V4UA 1NSTA 1OY1A 4CKBA 3R0XA 5G3ZA 2L17A 4P36A 4PPNA 3NVDA 4HH1A 5C8YB 1R0KA 2W2OA 2PX6A 3KWLA 3EC7A 4JBGA 3G8CA 2UZIR 3ILXA 4HDMB 3O95A 1L1FA 4D9KA 1L3CA 2H2DA 1E6MA 3GPCA 5IP5A 3ZJ5A 1ENYA 2YQZA 5C8YA 5AHRA 4OIFA 3VO1A 121PA 5TEWA 1IQPA 1WY5A 4JDUA 4M0KA 4HDMA 2UXDB 1DAOA 4Z2AA 2J7PA 4YALA 3CRZA 2F59A 5JH7B 1URPA 3P9SA 1TVEA 4KGDA 3DE3X 4NMMA 4HX5A 3OZIA 2FLVA 1YAHA 5E4YA 3FVVA 1QHSA 4BPBA 4CZ2A 4ATNA 3PVCA 3A6DA 4HATA 4C30A 2W71A 4PF1A 1S9HA 3ESRA 4NMWA 5FCDA 2CW5A 3FPSA 5HFAA 3S2YA 3W8DA 4AK9A 2I5PO 1RAFA 2BFDB 2QZPA 3EN0A 1YRQA 3BWCA 2OESA 1JJBA 1F4LA 4L22A 5I5GA 2C78A 3CISA 1U1GA 1VHJA 1A2QA 1L3IA 4I9UA 2HOQA 2FSFA 3T7CA 4EO4A 3HKDB 3QBVA 1X74A 3AU9A 2RGRA 4NDZA 3DOEA 1JN0A 4EJMA 3K9QO 4LJAA 3NZEA 3NOVA 3QVUA 2H7VA 3F3SA 4MVJG 4ABTA 2ZRDA 1DC6A 4TWRA 4X3OA 1X0VA 3TLYA 2PCJA 3EH1A 3FTNA 3JRNA 3FWKA 3LY7A 4WMLA 2VSXA 3T4EA 3BD9A 5E6UA 1EP3B 3SQNA 1T9ZA 3D2CA 1B3BA 1JJFA 3M5WA 3KC2A 4QBHA 4Z5XA 2ID4A 1UBRS 1Y3HA 3IEVA 3M4XA 4B1FA 3BIXA 1XZDA 3ENKA 2G5CA 5TPZD 1GSHA 3U6BA 1F17A 2UVDA 5CEJA 2PR2A 3ORYA 3OJFA 1NMZA 2A58A 4EY6A 1TTTA 1CY4A 1UFRA 5JCPA 3HB9A 4ZAGA 4G37A 5AI9A 1GSAA 3HB7A 3TRHA 2ECPA 2HRQA 3SY8A 3CPJB 2VJAA 3ESXA 1KSFX 1VJ0A 2DULA 4NENA 3LQRA 4JWTA 2BLLA 4ND3A 1Q91A 1PO7A 4O4HB 1XEXA 2XE4A 2YVAA 5IBQA 1CUVA 3ZJ4A 4IDEA 1NJ2A 2VF2A 3V1LA 4NV1A 4P7FA 3WWOA 4LY0A 2NADA 3T5BA 5M5BA 1UL1X 2VWGA 4CMCA 4W63A 3V7NA 4A26A 4O4HA 3CKKA 1YS6A 5JY1A 4GDMA 5BVGA 4RLSA 4UMFA 3DD1A 2AYYA 1O0SA 2VTDA 3F6PA 4CMKA 2B1IA 4OQMA 4XCVA 3WLIA 4HQKA 1LBHA 3HZHA 5JAHA 2C8KA 2AH5A 4ZRNA 5F64A 2I8CA 2VT2A 3LRPA 2YW2A 3KFXA 2BMAA 2XOKD 4KXMA 1QK3A 1ATIA 3SXPA 3T8YA 4KR7A 1FNNA 4BV2A 2D6FA 4LGYA 3LXUX 1S2GA 4TSFA 1GA1A 1L5OA 4WCDA 1U0NA 4XA8A 3P52A 4MQBA 3CF4G 3HS3A 3P1JA 4G41A 4BV8A 5EJ6A 3A1VA 2BY4A 3Q7PA 1FNDA 2FNAA 3QVMA 4MWZA 4NK4A 1T9GS 5IWCA 4V0OA 1NR5A 3TMAA 1GCUA 3ZHCA 1F8GA 5FPSA 3DBHB 1FDVA 1YO6A 4PG7A 1B2LA 1Y9ZA 2VCYA 4Y6OA 1ZK4A 1QPBA 2QX9A 3N05A 1K6IA 2F90A 2NIPA 5EMKA 3FGPA 4AECA 3RLIA 1E8MA 3D4BA 5B6JA 3T3GA 1AX9A 1TQ4A 3B13B 3DBHA 5G0TA 3II6X 4RDCA 5KYTA 3O5AA 3PUKA 4KG7A 1U0RA 1KDYA 3SE0A 1IRXA 3C1AA 2H1IA 1CKEA 2Y1FA 3OKCA 1F48A 1Q16A 2QMYA 2VHYA 4M83A 4NXNB 2X15A 3G02A 4PCVA 2GI4A 2WWRA 1T1GA 2XPCA 3MCAA 2IZOA 3JTMA 5D5QA 3SBOA 1DBWA 2OD2A 3KOZA 3D3KA 4JZKA 5NLLA 3VMMA 4P38A 1UIMA 2OHHA 4JI6B 2Q3BA 1NTRA 4L4YA 1V5GA 2QT0A 3BD8A 3RAEC 1EESA 2CUNA 2A1IA 4ZYLA 3RUDA 3SJ7A 3WK4A 1N75A 1ZZGA 4RD1A 2DWCA 3WRXA 5JAMA 2HA2A 2H4JA 1RFLA 1CNEA 3U49A 5FPQA 1L7VC 4RV9A 4NYMR 1E3QA 2HK7A 1NOKA 4RCVA 3BWYA 1MVNA 4GXQA 3ROEA 4NDAA 3W9BA 5IH7A 4BNIA 5K3FB 1N2XA 4CJXA 4Y18A 2ID7A 2ZCUA 1G6Q1 2X2FA 4BO8A 4MRPA 4BMXA 3GEEA 2VDLB 2BUAA 5C7LO 3GVPA 4NG5A 5K3FA 2PRYA 4RPGA 1FYFA 4LYDA 1Q17A 5TF4A 1H9BA 1I3MA 5ENDA 2BGWA 4RY2A 1GDHA 1QHYA 1QU2A 3B36A 1XJQA 1U8UA 1E7QA 3DC7A 2J5BA 1L5YA 2XUHA 4HS4A 1DX4A 2PUVA 1T4BA 1GQSA 3LDFA 3P0RA 2QHXA 3CX3A 3D6UA 3SJBA 4DJ5X 4UREA 4EVIA 3NBXX 1W4BA 1XMXA 3LC7O 3Q8WA 2I1LA 4YBRA 4DUGA 1GR0A 3O3MB 1S4QA 1WOYA 3GEDA 3WBFA 2P6RA 1QFMA 2R47A 5KNCA 1ZNZA 4K5QA 4AD8A 1QE5A 2GM5A 4IICA 2FJPA 3GQBB 4C2AA 3UJAA 4DC0A 2Z98A 5JI2E 1BX3A 1G9XA 2QQEA 1XEFA 2QJOA 4JENA 4R40A 5E8RA 2HWYA 3EFEA 1ZK3A 2HXSA 3L5KA 1DX6A 2WT9A 3M8KA 5BSGA 1UBKS 4IH9A 3OQVA 2DFLA 2OWDA 2JGKA 1SD5A 1BU8A 3DR3A 3ZHUA 3FGZA 3PXBA 4EATA 4LF6B 2IEZA 1EFKA 1NV8A 4GZLA 1PFQA 1VG0B 2WTXA 1KE2A 3ANSA 1XHLA 2IF0A 1V1JA 3IPXA 2A0UA 1E6WA 3FFXA 2H54A 1PS8A 3JQ9C 4L9SA 1W59A 4L3WA 3NASA 3N86A 5T3YA 2VKQA 5CBKA 4GMHA 3V8MA 2DJIA 2ZYUX 5FTJA 5JPCA 2YFKA 3B8EA 1OH5A 4GWGA 1E6KA 1T5OA 4FPXA 3DLHA 1SBHA 2EC5A 3BIFA 4RVGA 4TRJA 1B0AA 3U7QB 3JQDA 1IQ0A 3CX6A 4CCWA 4CQMD 3KYCB 5AK4A 2IPNA 3FYHA 2F2TA 4I4LA 1W0CA 2C2XA 3O8CA 2CFTA 4EWLA 1DFIA 1IEXA 2V7EA 4H77A 1SBYA 3T5CA 2BFPA 4EKEA 4MJ7A 2IYTA 4ZK6A 3BORA 2AOTB 4CTJA 1WUYA 1PZFA 2PCLA 2HSEA 4ENUA 5FWXB 1SUSA 4HNSA 4LDAA 1AE1A 3IHTA 1MVOA 1KI7A 2XB9A 2PBZA 3I2YX 5KYUB 4N54A 2VT6A 3UTDA 3SVLA 1A2KC 2XTJA 5J4KA 1TCBA 5FWXA 4KPYA 1E9RA 1XQ9A 4YUAA 3A1WA 3M6AA 2OCBA 2I2BA 1DO2A 1NU8A 1TPZA 2P75A 2Y9PB 3AFGA 5B3JA 5ABPA 5J1SB 2FP4B 2E85A 4EFKA 4H16A 1Z82A 4O4JF 2DJ5A 4CPDA 4EKDA 2HCRA 4KKXB 4FDAA 3IUQA 3DHEA 2WKRA 1CDOA 1JI0A 4GOLD 2N42A 3THWB 3HYRA 3ZJVA 3BREA 1DDGA 1Z5PA 3COZA 2FP4A 2B25A 3FMPB 3RWBA 5JEDA 1FFYA 1YGPA 2XE7A 3SQXA 2ZE5A 3B6ZA 3FPCA 1EM6A 1RYBA 1JFFB 5FNVA 1DG9A 1GU0A 1P2FA 1U7OA 2WTEA 4IWYA 2MSLA 3JAWB 3CSDA 1S2NA 1XZKA 2A0KA 4DAOA 3ZQ6A 1T9GR 4MA5A 4OU4A 4G0NA 2WSLA 3WIEA 5CFQA 3WLPA 3ZI7A 1USKA 2Q9BA 2B35A 2D2EA 3JASB 3F9RA 2J1LA 4DABA 2I4IA 5CVUA 3JAWA 3L1UA 4Z9XA 5IC5A 2C1EA 4AJHA 1PJBA 4DBZA 3HFRA 1Z37A 3JASA 2Z6QA 5DXAA 5IAGA 2WKPA 3L6DA 5BXYA 2QN3A 3ZHTA 2QENA 1MU0A 1XSEA 4GZ6A 2PUHA 4X6UA 3ND5A 3H1TA 5HM8A 4ALMA 2VG8A 3KG2A 3VPGA 1DV1A 1FX0A 1IZZA 4QVKA 2REOA 3NBZC 5CFLA 3LW7A 1Q2XA 3J81k 1IMJA 5CYPA 3HUDA 1R5JA 4MQFB 5FAXA 5HQTA 3IUJA 3S1SA 1F14A 1G1MA 2Y1WA 5HUQA 4LF4B 4O2RA 5D87A 3T3IA 4BUZA 2ZKIA 2PXHA 2WD7B 4FHEA 1MORA 1J07A 3DP7A 3FYDA 3U62A 4ZCTA 2RMKA 1JJ7A 4TZKA 3WKCA 3EPJA 4EHDA 5J23A 2JGNA 4MQFA 1YASA 3TPZA 1GYPA 2EFJA 3NGXA 2Q45A 3GN1A 3ZCSA 1PVOA 2CHEA 1T4MA 2WD7A 5JQWA 3O8RA 3DNPA 3LY5A 3JZMA 1XKLA 3OF2A 2ZBVA 2A7XA 2D7DA 5CVEA 4EAQA 3FOBA 2EFEB 1OHHD 4K6FA 2VQ3A 4KCGA 3QP9A 4Y2QA 6NULA 2JGJA 5HE9A 1Y9JA 3ZGXA 5IDXA 1YA8A 1YRHA 3IERA 2NP7A 1PD1A 1SU8A 3VR1A 1DUIA 4GW3A 5K8VA 3CY6A 1DMSA 5L95A 1N32B 4ZCMA 4KVAA 4TKUB 4U2DA 4Z0TA 4ZT6A 1A2BA 2TMYA 5GIOE 3BEOA 4PLPA 4G5QA 2WHQA 3H9EO 4RK6A 3SOZA 3BRSA 1T1JA 1J8QA 2GEFA 1RZRA 1QQTA 3H18A 1Z3IX 3CVJA 5IAAA 1JGTA 3MCUA 5AM2A 1N2IA 3BMOB 2QRMA 4P32A 3TRDA 3GZ4A 3UAXA 4ZYVA 1FRZA 3UTCA 3FOCA 4FYKA 4ALKA 4BO0A 4Y2RA 1XK6A 1FLVA 1U90A 1UOEA 2UYQA 2ZAOA 3GLTA 4V0ME 3V4LA 4AU1A 2ODTX 4QUGA 3IODA 2FRDA 2MU1A 4F4JA 4UBNA 2P4EA 1WOMA 3LNTA 5IJXA 3KO8A 1VKRA 3RLFA 2V98A 2GVZC 4X9XA 1NNSA 2BUCA 2WUFA 2YH2A 3NBKA 4K9DA 5BN4B 3V7UA 4MYRA 4LJ9A 1EFPB 3RWMB 4UD6A 2AMYA 4BFCA 1VJ1A 3ZJTA 2GLTA 3ASVA 1D7OA 1O6ZA 4KFUA 1J8FA 2WF9A 3R0ZA 4OH1A 5ALTA 2FRXA 3VSBA 5BN4A 1FXWA 3GC6A 4S24A 3RUFA 2X5KO 4YJ2B 2X1LA 3GFVA 4N7RA 2J3KA 1QIHA 4D0LB 3KPYA 4KBYA 1O08A 1VDZA 1X1SA 3NBQA 1GZSA 1I1NA 4BP8A 2IPLA 4QEDA 1E3IA 2ZK7A 4B3JA 1KEUA 3F1LA 5DWDA 1W4CA 4AKHA 2WHPA 1TL7C 4HZGA 1D6MA 3C3AA 1KEEB 5HJ2A 3WYBA 4JGIA 1RRMA 4R69A 4EGSA 2JZCA 2VHWA 3YASA 3HJGA 3TS1A 3FTFA 2XR1A 3AIKA 2BKAA 3RVQA 1GYQA 5LQMA 5LLDA 3HSSA 4TV9B 2K6GA 3EWIA 4DHWA 4AS1A 4QT4A 5D3ZA 3GRUA 4X1OA 5ALUA 3P9RA 1KEEA 1QFZA 1OZAA 3BXEA 4HB2A 2NMVA 3QBEA 3OY7A 5HZKA 3QXSA 3U3DA 2IY7A 3ODGA 1H8HD 1E3WB 1NVDA 4PC1A 2PMEA 2AFHB 2D5CA 2XNJA 1FF9A 2AN3A 4DR6B 3BGIA 5KNCH 4G3XA 1ZD8A 1J23A 3BOSA 3RFCA 3LXRA 5BSTA 3LAWA 4HLUC 4EL5A 4J6EA 4OA5A 5LC1A 4RF3A 5FADA 3P19A 4PO3X 3EISA 3M1IA 3R7DA 3UT6A 3ADCA 4LIPD 2HTFA 1MQAA 3G2HA 4R8LA 1KU0A 1XRSB 3D7SA 2Z6VA 1TEHA 4J4HA 4KN5A 2CY0A 4EKYA 5ELXA 4MMXB 1I7DA 3DJFA 2PH3A 2HU2A 1VBNA 4G24A 4EEKA 4U2GA 4EHLA 4EJ6A 1P7PA 2EP8A 1Y4SA 3E9DA 4C4AA 3ID6C 1FOEB 5KQSA 4GZMA 7MDHA 5CB8A 1L1QA 3GJ6A 4BBAA 4E21A 1KJIA 2H9IA 1FUUA 3ESDA 5ALRA 1GRVA 4YUVA 5DGHA 1IXZA 3FPLA 3P2EA 1YS7A 5COBA 3O8OB 4YRBA 2G6BA 4LDZA 3VTZA 5KKAA 1M2OA 5JVDA 3LZCA 1OXMA 2J5KA 1E79A 2R4QA 1H6DA 1YS2X 1Z0DA 1ZICA 4KRGA 1IUKA 1UUFA 4BGVA 1XN4A 4DMUB 5HS4A 1DJPA 3VR4A 4BZWA 4W7SA 2CV1A 3Q6NA 2W2KB 1VE7A 3CLSC 3OC0A 1NASA 2JFOA 2VDVE 3I9JA 3ITKA 2ZYRA 1K1EA 2AX3A 2W8ZA 1J42A 2QXYA 2GRUA 2XMQA 1VL8A 4JT9A 4L95C 1R18A 3DAOA 3HN2A 1LFAA 2W2KA 1XYYA 4DLNA 4CLXA 1JNYA 4BNFA 5IW8A 4DREA 1ZU5A 3LA8A 1XLUA 1TECE 3KT6A 2PS3A 1GLNA 2XMSA 2FG7C 3LPAA 2RGCA 2XDQB 1BCRA 3LF2A 1VYUA 4MJ3A 3U7FB 1HRKA 1SCBA 1PFWA 4GPEA 1V5IA 2P7IA 3B70A 2ZJFA 4IYRA 4UHCA 4JI3B 3V34A 4DQDA 1RACA 3S4YA 3EFOB 3TEJA 3BD6A 2PA0A 3PYXA 4URYR 2W43A 2J48A 2ONJA 1EB9A 3LP5A 4MUNA 1FFHA 3HXTA 3I1YA 3KSZO 1I80A 4ITVA 3B6IA 4XFKA 6AT1A 1K8XB 1Q15A 3EFOA 1FPQA 4ZT4A 5DHTA 5CITA 1T5DX 2QX4A 2YWDA 1IULA 1PZNA 2HLNA 5FWNA 3E3NA 3P2YA 1XNHA 3AUXA 3KUCA 4LVOA 5D7NA 4F45A 2IX3A 5J9FA 3H04A 3OM9A 1B4DA 1GRRA 1UDXA 1W9HA 3ZGNA 4TLCA 2JF0A 3LZ6A 1D1TA 2IXGA 5HYVA 2VHCA 4OHFA 2PJUA 3RAPR 1E2FA 4TWZA 3WGJA 3FHOA 2QVCA 2XOEA 3JW8A 4RHTA 3RSCA 4TOIA 3SHWA 1B3RA 1P18A 4KWTA 3IVGA 5DTMA 2YC4C 1OWMA 2WSIA 3HV2A 4DILA 1SZJG 2SECE 3NCTA 2HADA 2NOAA 4B6EA 3QPWA 3C3KA 2NPIA 3Q7RA 2JLWA 1EG7A 1ZGZA 3B9RA 1FYDA 2OZKA 2B78A 2FHPA 3AZPA 1LB1B 5HRCA 1PYOA 4M0EA 3V3KA 4ISCA 2I9PA 2CCJA 3B12A 5HMLA 1AJEA 1Z0FA 2OHFA 1DARA 4NE9A 3LBIA 3C6QA 3GAFA 4K9PA 1FYXA 1V41E 2IE0A 2BEWB 3KKEA 4HKTA 4LCJA 1BIFA 3HNRA 3RU9A 2A67A 4KIWA 2P1RA 5FBQB 3O4IA 2W37A 5DCWA 2XMDA 3NPMA 1XROA 1IHUA 1MZVA 1UM9B 1YZVA 1E6UA 3CLVA 3EIQA 3MNFA 3ZK9A 5JMOA 3FLMA 3R4VA 4ZP1A 4YAFA 1PG0A 4CIYA 4P8RA 3ENWA 3B82A 3C7DB 3TOXA 2JDID 1UM9A 5AI6A 3RUAA 1FUYB 4BFUA 1FSPA 5CFNA 5IDWA 1Q6YA 5K3CA 1Z22A 5BSRA 5BV2P 1M8GA 1H22A 1Z2CA 1WCV1 3V8QA 1K9VF 3P2KA 3UMGA 3OX3A 4LJKA 4YECA 2GTHA 3Q8LA 4UTRA 3IKVA 1U2ZA 2FPKA 2JIRA 1GCIA 5JS8A 2AT1A 1XX6A 1E2QA 4L3VA 4F86A 5M29A 4F6CA 4P3PA 3EA4A 2OILA 4G1CA 4JLVA 5F3DA 4AKEA 2IYEA 2DPGA 2YXLA 4DZRA 1Q7BA 1F6WA 1M34E 3FYSA 2XD9A 2BV3A 4QEKA 4WDRA 1AMUA 1NBHA 3MERA 2P9JA 3OZ7A 4AL4A 4Y2UA 4C0BA 1QX4A 1DTSA 3MT8A 4US1R 5K0NA 4MB6A 1N0HA 1X8KA 2YRFA 2NTJA 3ZTTA 4G8DA 3VRHA 2CZCA 3NXKA 1K6XA 1EBUA 2FEAA 2PXCA 4JLMA 5AJYA 5AW5A 2NU8B 4G26A 4EARA 5IU6A 3IMKA 4JUBA 2HJHA 2PSEA 3E15A 1FBNA 2GHRA 1L8LA 3DMFA 3O4FA 1CEYA 1RQXA 4CG0A 2MINB 2NU8A 4ZICA 4LZNA 2OVFA 4R2WA 2Y1XA 1F06A 2DYKA 2GSWA 4KR9A 3SYKA 4EY7A 1R1DA 2Y27A 3A4VA 4LA4A 1YE3A 3OE4A 3TX6A 3TBFA 5B7GA 2B36A 3IEMA 1DJMA 1V1RB 1YDFA 3CJQA 4JJGA 5JASA 4Q3AA 3QKWA 1J6UA 5JCOC 16PKA 3BA6A 2JFFA 4INPA 5D84A 2CBXA 2RGNA 3WYCA 4AMVA 4M1ZA 2G4LA 1FSFA 4V0KA 1F6BA 2G9VA 6ADHA 2DQKA 1HT3A 1TADA 2Z30A 2P2SA 5MFPA 5F76A 4YB8A 1LSOA 3H3XA 4GOXA 1UJNA 3M2PA 5HQJA 4UTPA 5IXSA 1K7EB 1YQWA 5TY0A 1KBOA 1DJNA 1I1QB 1MX3A 4Q39A 3NOQA 4HN9A 4LYGA 4K9RA 2YDXA 3ONFA 3A9UA 2IW3A 3GUZA 4WINA 1ZO8A 3ZGZA 1THTA 1H85A 3R9XB 1IN5A 1JU9A 2GBGA 4ZJYA 1NVKA 4D9NA 4KXLA 4BNHA 1XQXA 3DMDA 1I33A 5BR4A 2ZVJA 2VPYA 5HK9A 3CLSD 3HA3A 3ND7A 3R9XA 2V6IA 2Y6VA 3ZQUA 4IGKA 4C0XA 2PX8A 3DE5X 3TOSA 1AH2A 3JQEA 4OI1A 1P0CA 4LKOA 1K2VN 1RHQA 1P1BA 1T8UA 1TRHA 2HB6A 2GM9A 3N87A 4I81A 5JSUA 1IN6A 4QWWA 3DO8A 1YC5A 2R6AA 2C3PA 2NO1A 3AL2A 5KOJB 3JD1A 4YC7A 2PZAA 1WXXA 3CRVA 3V00A 4UU1A 5EE0A 2G5TA 2WFLB 3L1JA 5EJAA 5A7GA 5T67A 4A03A 3RS0A 1IM2A 2QUBA 1NOIA 1ECGA 5AI0A 5KOJA 3DR5A 5AJVB 4HYYA 3VR4H 4ZOEA 1DIAA 1X19A 3OZBA 1R9MA 2Y93A 3FLAA 3NGMA 4L8FA 3BF8A 4LSMA 2WFLA 1VL0A 3D1LA 1RQRA 3EOZA 4N0DA 3RS4A 2H4HA 3KCNA 5EESA 2CLEB 3TIGA 3ELYA 3VR6D 5BURA 3KQNA 1H6CA 1HDXA 4EG7A 2CVOA 3OWHA 3FSRA 2PLWA 2DHEA 3IOMA 1IC6A 1SN7A 1KZ7B 2G77B 4YRKA 3HBLA 4O4LB 2H63A 3THXA 1DFGA 3WX0A 4BKPA 1IPEA 4HZUB 5BY2A 1K7CA 1MAAA 1R0ZA 3C98A 1FYEA 3RHTA 3RT1A 2CV0A 1SA0B 3ADDA 2NVWA 4RMGA 3KUDA 4EQ6B 4P7BA 5FOUA 4BQSA 1P4SA 1R50A 4HWSA 4JBIA 4MRVA 4PGAA 2GZSA 4RJ2A 3O93A 3P94A 4HZUA 4YCDA 5DTIA 1CZUA 1KZ4A 1SA0A 1DTEA 3H2BA 4JODA 5IT9A 2P0EA 4EQ6A 4P82A 1EP9A 2CN1A 3LNCA 5IUJC 3T3EA 1G5IA 2Z4RA 2VP5A 2B2CA 3Q85A 5F77A 1SBZA 1Q92A 3BXOA 1ML4A 2L69A 3IUBA 4RABA 4L5AA 2KYRA 2DAPA 5CURA 1TK2A 3I62A 4G6ZA 4M1QA 4HEJA 4F5YA 5M04A 3FFBA 1H93A 1GAQA 2CF5A 1YMVA 2JFQA 4BWVA 2XH8A 3RU3A 1VCIA 2C98A 4I8DA 3WYNA 5D1NA 4U9UA 4OHPA 4RPCA 4CV1A 1MV8A 3GWZA 3SHQA 5B2EA 2V0NA 3HI4A 3EQ9A 2ZRPA 5HUHA 3RHSA 1X9GA 2VT3A 3OJCA 1B15A 1SG9A 1L4YA 3DLPX 2VI5A 3PDJA 4DNFA 1RI4A 4OLFA 4LXUA 1WXQA 2G5GX 2ODQA 2PZBA 4MLZA 4PAQA 3ED1A 1GFSA 4LGMA 3H1PA 4IDQA 3RH0A 2CNLA 5H4GA 3AWDA 3Q7TA 3RS9A 3WQSB 3I9KA 3OX1A 3AQIA 3V2UA 2A78A 2HHAA 3OE1A 3ER6A 3ON5A 3ZS9A 4UPEA 5B57C 3F47A 3DEFA 1UBLS 2XNDA 1WDLA 4HRAA 1CF2O 4MUAA 3OJOA 3P9XA 1ZGAA 1JEJA 4NAHA 5D51S 4R8MA 1EX6A 1VZ2A 1L5LA 1OOEA 3AVYA 1CUCA 1ZJWA 1NXTA 1VBFA 2GA9A 4H3SA 2PEZA 5FI5A 1P1RA 2IKQA 1LS6A 1F8YA 2H11A 1AO3A 1U3GA 2JAOA 2ZR8A 3E7WA 3ITEA 3ORSA 4G0QA 1ZM3A 1UANA 5KHAA 3IURA 3T3OA 2ZXFA 2AG0A 2W0MA 3H5LA 3TOCA 3NNNA 4FN5A 1Z8DA 3UK7A 3SQMA 1FUKA 1LSSA 2ISCA 1PR1A 3G5AA 3QWFA 2FWPA 4ZVNA 1VE6A 1SK9A 3WQQA 4CDMA 1AHHA 4OHKA 3B1JA 3USZA 1XB2A 2A5LA 2AMLA 2ZI5A 3BDVA 4RHUA 1I6KA 4QJBA 3FX2A 4HEHA 1VSVA 1W0JA 4ZALA 1PRYA 1HXHA 2FSVA 2MSWA 2Q3CA 2VQDA 4Q66C 4PV7A 5AK6A 4A27A 3BCRA 3KOUA 3GEBA 1VXRA 1E6LA 3N2KB 4MICA 4R9SA 3AIIA 4B76A 1TKCA 1U8TA 2CNKA 2DMRA 5TEVA 3KJHA 3NWBA 3KQQA 2GFQA 5G0UA 5ITSA 2WUDA 1YV9A 4W5NA 3GRVA 2OBNA 2H2FA 2IPMA 2QE7D 5CW2A 3G85A 1RRFA 4C4TA 3K1ZA 1YB7A 1Y80A 1SEVA 4XX1A 2IVZA 3PF8A 2R1TA 4LQDA 1OCEA 4Y9DA 1V3QE 2ICAA 1N6LA 1RTKA 4H6WA 3AEQA 2GCOA 4BNVA 3GPIA 1OXKB 3W9SA 2PEYA 3NJ8A 3X2SA 1QCDA 1UK8A 2HGZA 1WY7A 5SV2A 3BTSA 1LRJA 4AJNA 3TLMA 1P8AA 2I6TA 5BN1A 3D7RA 3TD9A 2OO5A 3DDSA 4FHFA 4KFRA 1Y4DE 1G1AA 3QMPA 1XTRA 5SY9A 3FHLA 1WZIA 3PD0A 1JIUA 4J94A 2GRJA 4AKIA 2ZUDA 3B1ZA 5CA1F 2NGRA 4E12A 5AVRA 4Y9UA 2ZZNA 1JIVA 1KVSA 4IXMA 4JBYA 4HBGA 4NATA 4V02A 1YR2A 2W8BA 4LK2A 3UXEA 2XI4A 2JFVA 4PYIA 2RE8A 1WXHA 1E1QA 2NXCA 1GL3A 1T6BY 4BU0A 1WS6A 3K1AA 3IBYA 3SYNA 5DBIA 2HLHA 4ZN6A 3QH4A 3D6HA 2ZUSA 2H5JA 3GDWA 1DNPA 3WL7A 3O9MA 3JYHA 1XEWX 4WGFA 2FN9A 1CY8A 2G83A 3K4QA 5J2TB 3N1UA 1YQXA 4KYIB 2HWXA 3VR2A 5KTTA 4UM5A 5DTQA 1IWBB 4OL9A 2IFTA 2W6OA 4M87A 3FNBA 3LO5A 4K88A 1KMCA 1XAJA 3E2PA 1P31A 4KREA 5E3HA 1XV5A 4N39A 4JJZA 1S6YA 3R77A 4M7RA 3KSMA 4R3WA 4Q82A 3ZBPA 1GVNB 1QQ7A 1JR2