2ASEA

Nmr structure of the f28l mutant of cdc42hs
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
178
structure length
178
Chain Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKLPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Cell division control protein 42 homolog
publication title Solution Structure of an Oncogenic Mutant of Cdc42Hs
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2005-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2aseA00
2ZRGA 4WAUA 1TMKA 1QHYA 3UIEA 1P2TA 1G291 2XAUA 1VYUA 5KO2A 2JJ1A 1G4AE 1QG2A 3FOZA 4M1YA 1NY5A 1ESNA 4E03A 5EZ5A 3L2OB 3K0CC 2WMOB 2D7DA 1ANKA 4ZCLA 2A5DA 2C04A 4XVQA 5A4JA 3DKVA 1R8QA 4WXRA 2FSFA 1GKIA 1GP2A 4JMPA 4QOSA 4LZZA 1EFTA 2XSZD 2E87A 1GNRA 3BERA 4L4UA 2J0QA 3SQXA 3I4LA 2YOFA 4X8LA 1KKLA 1MV5A 1DBSA 1R10A 3GLIA 3LQQA 1E98A 2YINC 4OQFA 4ARZA 1HV8A 3EWSA 4C9BA 4DKXA 3TGPA 5J47A 3U3JA 4BFSA 1Z29A 2HCJB 2W2TA 3D6TB 1ZUNB 2CVFA 2GNOA 2PLFA 2RB4A 1DG1G 1XEWY 3EIHA 1BO6A 1T0HB 1QHHB 5IK2A 3X1YA 2ZYUX 2QPOA 3ZIAA 3IIJA 1RYFA 3GLHA 5LD2B 2DWPA 5AJXA 5JJKA 5F98A 4I81A 1DAFA 4DSOA 3KX2A 3RWOA 1XZQA 5KDOA 1VECA 1ZD9A 2ZSBA 1JECA 1FMJA 3LVQE 2AX4A 1WXQA 2JDID 4XTRA 2B6HA 2VRWA 3KXLA 4HAYA 3SZRA 1XCGB 1FQJA 2CXXA 2OUKA 3WRYC 2YKGA 1XD2B 3IHLA 3CH5A 5JLJA 2O8FA 2F43A 1XXHB 3I8SA 4DLRA 3CW2A 1F6BA 3MJRA 2WJYA 2WPDD 1N0UA 1RZ3A 3L43A 2AXPA 2A9KA 2FN4A 2ATXA 4IDHA 4MRPA 4P32A 1E9CA 2Z4SA 2OAQ1 3QY0A 5HE9A 4DLVA 2K5UA 4DJTA 1IHUA 3FVQA 3N2IA 3UK6A 1MO3A 4NL4H 3FGNA 4TSFA 3BB3A 3BXZA 4G5QA 4Q01A 5F9HA 2OCBA 3OE7D 2QTHA 3QUSA 3T1TA 4HUTA 1UM8A 4BUJA 3ZYCA 2P67A 2HDNB 2H17A 2P65A 2VO1A 4DT1B 4FWTA 1KMHA 3ADDA 3ZQ6A 1R5BA 3BWDD 4WIAA 3A4NA 4TLAA 2FEOA 3CF0A 2O8BA 4B3GA 4IDOA 3DZDA 3QQ5A 5D3QA 5EP3A 3P27A 2GRJA 4LBVA 2IX3A 4Q1EA 3QXXA 5FTKA 4LYHA 1ODFA 3B1WA 2O0JA 5HZHA 1W2GA 4PSKA 3CZQA 4YMVA 5CB6A 1M7HA 1T6NA 1KI8A 3A1SA 2PMKA 2B8WA 4LHWA 4D2IA 5BN4A 4GOXA 2PX3A 2ZROA 4Q19A 3OESA 1XEWX 1L7VC 4U7DA 2EW1A 5E7JA 2GJ8A 4PHTA 2R6GA 1ZU4A 3QKRA 1NLYA 1SVMA 2WKQA 5E4FA 3SHFA 3BBPA 3K70C 5FUWA 3ADCA 4NTZA 4M1TA 1LY1A 3EPHA 2IEZA 5BYKA 1KO1A 5KOYA 3CPEA 2JLWA 2JASA 2ERXA 4QFMA 4JL6A 1UKZA 1CULC 3DMDA 5FOUA 3LX5A 4YLGA 4LDJA 4YQFA 1OXXK 4PZYA 4RD2A 3KUDA 2ZI5A 4K46A 3TIFA 2GVZC 4JVSB 1W7AA 2RGNC 4JZKA 2PX0A 4HDQB 3O8DA 1C1YA 4RZ2A 1KO8A 3MD0A 1F2UA 2Z4RA 4M21A 3Q5EA 3NIBA 1ZC3A 1UBFA 5DE3A 3RSLA 4P4SB 5DH9A 1U8YA 4F91B 3CUEF 1S96A 1SVOA 1SKYE 3DVLA 4RFVA 4BWYA 2FZ4A 2AFIE 2FPLA 1WBBA 4U00A 3ZS8A 1CR1A 1OE0A 2GK7A 3HYTA 3LXXA 3X2SA 4AK9A 4MDFA 2HLDA 2VF7A 4D80A 4CEHA 4IDNA 1EXMA 3FMIA 1SVIA 3BS4A 5EXXA 4CIDA 3VR1A 4C0LA 2VSFA 4XSGA 3HU2A 4QNRA 4HZIA 4MKFA 1ELOA 4NYMR 3TRFA 4OHVA 3UMSA 4DXAA 4Y0VA 1OLOA 2ZUDA 3K09A 4IDQA 4PO8A 5FH9A 2AD5A 5AR1A 4AC9A 1E2NA 4C0AC 2ZM5A 1OB5A 4D25A 3OFNA 2AN9A 4EDHA 2ZE6A 1D9ZA 4UKDA 3AEZA 5KUTA 1EFHA 4XWOA 1KTVA 2BBTA 4WZ6A 1N6IA 1YHNA 3EC1A 4LPSA 1NVVQ 1W4AA 3UATA 1N6LA 3AVUA 1JEDA 4TL7A 4Q4JA 2OFOA 2ZJ2A 4JLAA 4JLJA 5EUMA 1L2TA 1T8TA 5F2EA 1OH7A 2BOVA 3L0OA 5UKDA 1LW7A 4RD6A 2Z43A 4DB4A 3BJIC 1DPFA 4MGKR 4B3DA 4NCKA 2ASEA 3B5JA 1O87A 4M4SA 1DEKA 1W48A 4UJ3A 4N0EA 3VTKA 2VBCA 3U44B 3B1VA 5JJLA 4D6PA 1W0KA 1E2MA 4DC9A 1A82A 2UZIR 3AF0A 4A8JC 4AG5A 1XTKA 4DZZA 1M7BA 4KFSA 2ZYWX 4MRSA 4TLDA 2FFQA 3HWSA 2JIZA 4RCYA 4YDSA 1EWQA 4AG6A 5CIQA 3M4YA 1Z63A 2UZ3A 3B82A 2UVQA 5EXPA 3P1JA 4ASUA 4AYWA 3SI7A 4A2WA 3G82C 1FMLA 4FCVA 2D06A 2W83A 2R8RA 3SQWA 1UBEA 4OHYA 4RZUA 5JSZA 2AK2A 3VR5A 3THXB 3IO3A 4GMXA 1SHKA 2BM0A 3K9NA 3MLEA 1P72A 1XCMA 1CR4A 2WWIA 2V3CC 1NMZA 2JLRA 2ZJZA 5GJBA 2F7SA 4Q4HB 1E94E 421PA 1COWD 1NN1A 2IHBA 3AKDA 3FMOB 1IBRA 4LYFA 5IRCD 4DCTA 4BGDA 2IS2A 3PEUA 1EFUA 2IS1A 5G41A 4EFLA 1VTKA 5B58C 4NCJA 5CK4A 4G5GA 4L5BA 2A5GA 1MO5A 3GLGB 2RKOA 3GPLA 3QENA 2QPAA 3PJRA 1HEIA 3K0AB 2EYUA 2FOLA 2QU8A 4TMXA 4TYPA 1EX7A 2OEPA 3GJ7A 4MKHA 1WQ1R 2DR3A 2YOHA 3U3RA 4QGFA 2V8OA 4M1MA 2KI5A 3H1TA 3CRW1 1L8QA 1QG4A 4HAVA 3UG6A 3OAAD 2FU5C 4HAUA 5DGXA 3ZZTA 3SR0A 2NQ2C 5KPJA 3ZD7A 4IXMA 1XEFA 1E79A 1QHGA 2JGNA 2ZEJA 4OI2A 3AVXA 5AK0A 4JLMA 2VP6A 4GFDA 1G64A 3PEVA 4Q9LA 3K0FB 1E2HA 4Q00A 3VKWA 2L0XA 1TQ2A 3EZ2A 4N0DA 4DLTA 1NG1A 1OW3B 1W4BA 1JBKA 4IOMA 1N6NA 4G01B 1P61B 4OK5A 3AVVA 2A78A 3I5YA 4LOAA 5AUNB 3AVTA 2JA1A 2IS6A 2YWEA 3FB4A 3RLFA 3BH6A 4LY6A 1XXHE 1RRFA 3LWNA 4N1AA 2H5EA 4UXJA 3EX7C 4QJ5A 2JAQA 3EIQA 2DFNA 5EE3A 4ITRC 2Z5FA 4BFVA 3IEVA 2FEMA 2G6BA 3RABA 5CM8B 1YRBA 4EPRA 3LFUA 2ZUCA 3K9GA 2PZFA 1SVKA 4LBWA 1OXUA 2O0KA 5TY0A 3Q9LA 1CXZA 3U7HB 1T5IA 2GBLC 3AF3A 3IIKA 1Q3HA 3AKEA 4G1UC 4DUGD 1RRCA 1NJFA 4OQLA 1OH8A 3ECCA 2H7VA 4TTRA 4CRWB 1XB2A 2QT1A 3IILA 2C8VA 2DB3A 5DHAA 5JMTA 3WRXC 3KFXA 4DDTA 5K8LA 5TMPA 4KXFB 1XPUA 4CVNA 4ZKDA 2DFTA 2WSMA 4ZPXA 2VSXA 3WMGA 3JVUA 2R62A 3KDSE 3LBNA 4XSHA 1MABB 3U4QB 1U99A 2C99A 1YR9A 1XPRA 1SXJB 4P0TA 4A6XA 4PPFA 2G0NA 4NCNA 4GMDA 4BEJA 1OYWA 3VHLB 4LJ6A 4PHHA 2ZRPA 3ZD6A 3A1WA 1QHIA 2Q21A 5AJYA 4M9QA 5TARA 3U6BA 1R5OA 1DTSA 1TUEA 1E96A 5G40A 1J90A 4KYUA 4UNNA 4Z54A 2IF0A 4R2HA 4QRHA 1CBUA 1OFHA 1FW6A 1S1MA 4FD2A 4JVLA 4HAZA 3S1AB 1OFIA 3M0EA 5J4KA 2GAAA 3RS0A 4URUR 4TLBA 1G7TA 1SULA 3CR8A 1XBTA 3BB1A 3O8RA 1KI7A 3VNUA 1QHXA 4BZQA 3PVSA 4G3XA 4TSFD 3UXMA 3RDPA 1NRJB 1NSFA 4NU0A 3V4FA 1BS1A 4BLRA 4QBHA 4TYYA 1X6VA 4NZYA 4L8GA 1SXJD 3BK7A 1KZ7B 1QHHA 2RGDA 4DBLC 1R7RA 1XRJA 3C4JA 4BECA 1KDTA 4PFSA 4PHFA 4PC2A 4DCUA 4DLSA 4EJSB 4I1OA 4ZI3A 2OG2A 4B6FA 1VCMA 1SVLA 1ZM3A 3QXJA 2ZRCA 121PA 4LC1A 3R9IA 1AS0A 1VCOA 3AP2A 4EKDA 2RGBA 2XZPA 1Z5ZA 3KUCA 5HPYB 3P26A 3C5HA 1X8KA 1XU4A 2OBNA 4D4LA 3K9HA 3AVQA 1ZU5A 1VHLA 2QMHA 1XD2A 2FF7A 2B7CA 3T1VA 2GVDC 1CJTC 1XXHA 2J1LA 2GEUA 4OHWA 4DB2A 1XMIA 1ZC4A 3W5IA 4KO8A 1AQUA 1D2EA 4JYCA 3ICQB 2CCGA 4HUQB 1CJKC 1K5DA 4TLCA 1GIAA 1E32A 1P9WA 4C0KA 3TAUA 5FOXA 4BFYA 1NLFA 4OI1A 4KODA 2QMEA 1H65A 3MWJA 3U7GA 1G3RA 1RVDA 2D62A 4Q4AB 2PEZA 4TQUS 1MRNA 2VP2A 3PUYA 3DM5A 3FYHA 1Q1EA 1E9FA 3GFTA 3N2EA 1HT2E 1D2MA 3G0HA 2QUZA 4TN1A 3CB4A 4DT1A 1GZSA 1Q1BA 1MH1A 1KJYA 2CNWA 1G16A 2GHIA 1P60A 4PC3A 4OL0A 5FTJA 3R9XA 3IO5A 4ZIRB 3SYKA 3H0KA 4Q02A 2VPPA 4MGZR 2OXCA 2DPXA 1R8SA 4NP6A 2NIPA 3MWKA 3I3SR 1D2NA 2C5LA 1HE1C 4PXAA 1KI4A 1XD8A 3VAAA 2IBMA 1EX6A 2A3RA 1FZQA 2HLDD 3REFA 5FBQB 3TSWA 3VU9B 1C9KA 3NBYC 5AUPB 4KSBA 2WJVA 4B2PA 4RD4A 4QHTA 3LH5A 3EC2A 3LD9A 4M9XA 4A0GA 1IN7A 1Q57A 2AR7A 2GJ9A 4IJMA 2AFHE 3DL0A 4IHQA 2ANBA 3NVAA 1SHZA 1N6HA 2VLIA 1FUUA 4PC1A 4Q5IA 3EZ6A 3KJGA 3OFND 3KJHA 5FOTA 4ZDWA 4XTCS 2FH5B 1NIJA 2ZE5A 4LJ4A 5FPYA 1JR6A 1G7RA 1R0WA 3RS4A 5HZKA 4MRRA 4O25A 1KK2A 2RGAA 4FMBB 5EE5B 1OIVA 4KLNA 1VG1A 1ZM9A 2GZDA 2WBLC 2CHGA 4Q7MB 3GLGE 2J46A 4AKHA 1OSNA 2DY1A 4DLYA 4EQ6B 4JL8A 2BEKA 4EPVA 2R6DA 3DMNA 4P4SA 3TUIC 1NKSA 1ZUIA 1LV7A 2WV9A 2V6IA 5A5GA 4RSGA 4GSYA 4URVR 5M04A 2MSDB 1EWRA 2QQ0A 4XJXA 2ZJYA 3FTQA 4IEEA 5CM9C 5EP1A 1LFDB 1YZUA 2BBSA 1UKYA 2ZU0C 3IBYA 3QXSA 4M1SA 5AUOB 1W0KD 2BIFA 3PEYA 4B2LA 3TAHA 3R9WA 3OEEA 4AI6A 4L16A 2AD1A 1ZM2A 2ONKA 4UJ5A 5CYPA 3RSOA 1UDXA 5FR1A 1DG3A 4X8MA 1G3IA 1R2QA 2FNAA 1I4TD 4ASUD 4LHZA 1J7KA 2W00A 4URWR 4BASA 3SHWA 2GILA 3W8RA 5FTMA 1US8B 4JKYA 4U5XA 1WA5A 2QT0A 1FTNA 2X8AA 4Q18A 3KQUA 3CRVA 4LRWA 3KKQA 3CKLA 4E09A 4LJYA 3GEIA 4M9ZA 1W2HA 3GLHE 4M53A 3C15C 2OESA 4U02A 3PENA 1YZGA 3DPUA 1GRQA 1M2OB 4NCHA 3UWOA 1AN0A 5JEEA 4Q9IA 5CITA 1P2VA 1DOAA 1KIMA 2IT1A 1GL9B 2XX3A 2IXGA 4KLZA 4QNMA 1PV4A 3ZGXA 1E9DA 1Z47A 3U44A 4P3YA 3UANA 1W36D 1ZNZA 5HTKA 4BE7B 2ANCA 2BMEA 1IN5A 1TTTA 1JNYA 1NVVR 2RH5A 3BFXA 1N2CE 4X8OA 4KCGA 1JALA 4W5WA 4F93B 1E4YA 5EUQB 3U3OA 1TEVA 2WJJA 4RCZA 2WHXA 5KYKA 1S3SA 3ZVRA 4DCNA 2Q3MA 1BH2A 4FMCB 4IKEA 4M0LA 3O8BA 2OO7A 3SJZA 1G9XA 1P3JA 1OIWA 2XXAB 1X1RA 1DVRA 1E79D 4EPWA 1ZCBA 1SXJE 3I73A 3RRZA 2VIIA 3ND9A 3THWB 3THXA 1G3MA 1MO4A 1ZM7A 2PBRA 1KGDA 2GJKA 3BAFA 3G5UA 1WP9A 4GRAA 4Q4HA 1RPZA 4DWJA 3KJEA 1P9NA 2ZRIA 3WYFA 4LV5B 4E5UA 4HLUC 1Z6YA 2CL6X 1JPNA 3BE4A 1E2PA 5EXSA 4DLWA 4HDCA 3WNBA 1PLKA 3AF2A 3TSZA 3GLGA 1N5LA 1NF3A 3VMFA 4ESVA 2VP0A 1OXTA 3K0AA 4MGYR 1OXVA 2GA8A 2IYVA 1RIFA 2WOOA 1JR3A 3LW8A 2ZR7A 3D31A 3MGCA 3VKGA 2QAJA 2IW3A 2ZRKA 2H1LA 3KKMA 1E4VA 2WICA 1PUIA 2GKSA 1D6JA 4HB4A 3TBKA 1E2FA 3EA5A 3TMKA 3CF2A 3NG1A 4FMDF 4ZI2A 2VA8A 4R9UC 3K0FA 3Q8XB 3RANA 2LCFA 3AVWA 4DUGA 1NSTA 1JXOA 4DIDA 1IXSB 3ZH9B 2IUTA 4I99A 2IYZA 3BRWD 2GZHA 3AF4A 4DLUA 5E7IA 2QAGC 3T06B 3WMFA 1X1SA 2ORIA 2VH5R 3NKVA 1KSHA 2OSBA 2O0HA 3TSOA 4IXNA 3TR0A 2G3YA 4LJ8A 1CJMA 3MSXA 4EPTA 1WRBA 2PZGA 1DAMA 2WWWA 3NBXX 4PQYA 2GJAA 721PA 1XTQA 2P5SA 4BLQA 2GF0A 1GKYA 1TF2A 4NPHA 4URYR 2P0EA 1D8TA 1MR3F 5P21A 2F6RA 4C0BA 4OI0A 4UQOA 4BLTA 4V0ME 2Q9BA 2P6RA 2QGNA 1KJZA 4DSNA 3GEEA 4XVUA 3LBHA 4GNKA 3IPXA 3NDPA 3NTUA 2JLYA 1CRPA 3CM0A 2DYKA 1TQ6A 3CRMA 4RZXA 2W0SA 4HSEA 2AKAB 1SZPA 4V0OA 4O0MA 3NH6A 2V9PA 2V6JA 2Q0HA 2CEAA 5FI1B 4DHEA 4TYWA 4PPQA 2C9CA 4HLDA 2J0UB 1BMFD 5L3RA 1HTWA 3F3YA 1HA3A 4PAMA 4GBMA 3C41J 3IPYA 1CRQA 3AVOA 1J70A 4BFTA 4DSTA 1MABA 5FI0B 3U4QA 2ZI7A 1T4GA 2ZJOA 3WNCA 2G9NA 2I3BA 1RW4A 1U9IA 2OFXA 5C46F 1SXJA 3B60A 5CLLA 2FSIA 5BN3A 5L3QB 4KFUA 4TTQA 3QKSB 2UKDA 4MH0R 2Q9CA 3HU3A 4YC7A 3QG5A 5F3WB 2VP4A 1XZPA 3B1ZA 5H68A 2FDCA 1XMVA 5J4YA 4LJ5A 5CLQA 1HH4A 2ZETA 5FUYA 1I2MA 4KSCA 5J5CA 1P62B 1YU9A 1XDBA 1G1MA 3AGPA 4MGIR 1TX4B 2HT1A 1Q0UA 5KNCA 2FV8A 4JBYA 3I92A 4GT1A 2OAP1 4Q21A 3V00A 2GDJA 1E69A 4W7SA 1IAQA 2OHFA 3W3ZB 2J0SA 3U3KA 3S1AA 3E2IA 2ZVPX 2LKDA 4O2RA 3I72A 3QSYA 1S8FA 4GI7A 5CIWA 5J4LA 3L0IB 1OH5A 4Q9JA 2YVUA 3O8CA 4JT4A 4XWAA 4BRUA 4JLKA 4DDWA 3I8XA 4R7ZA 3EIEA 2WVJA 1NJGA 3QVVA 1P9RA 1T8UA 4CT4B 1M34E 5BW8A 1EFRD 4G5SA 4Q1CA 5KHOC 2CNWD 4EJSA 3M1IA 3SS8A 1OFTA 5JECA 1E2IA 1KI2A 2NO7A 1CF4A 2IYQA 3NEJA 3DDCA 3K53A 5B64A 1QVRA 2QPTA 1ZMXA 1DARA 2EFCB 2ZJAA 5FBWB 5ELXA 2OT3B 3B2EA 1QVAA 2H18A 1ZNYA 4R98A 2W0MA 3ZVNA 1KSJA 221PA 3AF1A 4C0HA 4GPTA 2IYTA 2HF9A 2BCGY 3ZDQA 1YE8A 2NZJA 1UKEA 2GK6A 4HUQA 3T1QA 2J7KA 4WXPA 3WY9A 2CLDX 2F1JA 2WWHA 2IYYA 4PO9A 2W2XA 3Q7PA 4ZDKA 3E70C 4V0MA 4HI0E 5EP2A 2CK3A 2H16A 2EFGA 4Z1MA 2O8CA 4Q4AA 3P32A 4QHYA 3NBFA 3MWLA 5L3VA 2ZS8A 3ICEA 4Q03A 1NN3A 4DRZA 3LX8A 1AIPA 5H70A 2CHQA 1U81A 3HU1A 4LGMA 5TDHA 2Q6TA 4PHGA 3ZVMA 3R7WB 1E9AA 3BH0A 4HAXA 2ODEA 1KMQA 2ZI6A 4OK6A 2F55A 3PR1A 1GTVA 1ZJ6A 4TZ6A 1T5LA 4ZIRA 1KYIA 1H8ED 4P4UA 4OI4A 2YC4C 3E5HA 3SDZA 3I62A 2XNDA 1T3SA 4I1UA 1XD9A 2IHYA 3P4YA 5JWOA 4LPKA 4B71A 1NVXQ 1KDPA 3B8HA 2ZTSA 1N25A 1M7GA 2FFHA 2ZANA 2A5FA 1U94A 2QRZA 2FFAA 4RKFA 4DCSA 2EVWX 3VU9A 3CNOA 1S9HA 3CPJB 2CBZA 3GCGA 5TXGA 4CT5A 4LHXA 1OFUX 3UWKA 4RD1A 3TJZA 2IXEA 1FPMA 3TLXA 1G17A 3BFVA 1JAIA 1GRNA 5IF9A 1E1QD 3X1WA 4JL5A 4ZDJA 1Z0DA 4Q1AA 2AK3A 3GP8A 1G20E 3OEED 1AKEA 3FDIA 4GP6A 4GL2A 4JSYA 2OILA 5FPHA 3I1FA 2VHCA 4XIGS 5JZVA 4FI3C 1C4OA 1Z2CA 1TPZA 3CX8A 1SXJC 4HB3A 4POAA 3BB4A 2E1RA 4EPXA 2IK8A 5FR2A 1WF3A 1G8GA 4EQ6A 2OBLA 4FXPA 1VG9B 4RJLA 4TYQA 1TEXA 3KL4A 3I61A 1GOTA 2BWJA 1SKQA 2IXFA 3ZZUA 3K0EA 3U60B 5DYGA 1E9SA 1X8JA 4EFNA 1WCV1 1GWNA 1UADA 4URXR 2C03A 1V5WA 4BLPA 1M6NA 2HV8A 4A6PA 2WAYA 1E2KA 3GD7A 4CW7A 3C16C 4MKGA 1F2TB 1R0YA 2NG1A 1O3YA 1WMSA 2N1BA 4RFSB 3RHFA 3B1YA 821PA 1N5KA 2JJ8A 1GNPA 2NO1A 5JFGA 5E7MA 2IYWA 1GVNB 3VR3A 5BWMA 1G3UA 3AH8A 2J41A 3MRSA 1UEIA 4R71A 1G5PA 4IOJA 1YQTA 3THYB 2G1KA 2H92A 4J0QA 1RJ9B 1IXRC 3KQNA 1US8A 2CLSA 3SU8A 4KFTA 3K1JA 4B48A 2ZITA 1RKBA 1Z06A 1Z08A 3REGA 2TMKA 4RY2A 1Z6TA 1S2MA 4PAQA 4LHYA 2OFWA 4PANA 1JAHA 4WA7A 3QBTA 1Z0FA 5JBQA 2CMKA 4DEXA 1E2EA 3LNCA 4YMTA 1DAGA 4DDUA 5H1YA 2BJVA 1VIYA 2IYUA 4FINA 2CE2X 4C2UA 2NGRA 2RHMA 2P3SA 5FUXA 3QJYA 2AXNA 5BYJA 1A7JA 2HJGA 4IRUB 4M8NE 5J40A 3ADBA 1LVGA 1P5ZB 2QP9X 2ZSEA 3RYTC 3RS5A 1QF9A 4TZ0A 1YR8A 5FL7A 3QIAA 1AZSC 1FX0B 2ZSDA 4C0JA 1B0UA 1JR3D 1XTSA 1AS2A 3QXHA 3K09C 4V0NA 1CTQA 2QTFA 2REXB 3WYGA 2QP3A 3KXIA 3SE0A 5ANRB 4OHZA 4X8HA 2E9SA 4ESHA 1X8LA 2XXAA 2VEDA 1X3SA 1EFCA 1FUKA 2CE7A 2KJQA 4PQRA 3THWA 5G53C 4LI0A 2DCUA 4I1SA 4YMSA 4GDFA 4B3BA 5SZKB 4LCBA 2QEQA 1Q1QA 2ZREA 3IHWA 4A82A 3N5CA 2IL1A 3CIOA 4GOKA 4B47A 4ZCIA 4QM6A 3DOEA 1E1RA 4JLVA 1NN5A 5J4VA 2ZJBA 3TE6A 2J7PD 5FUVA 3VX4A 4WBSA 3MMPA 3T34A 4JT2A 1WBDA 1NY6A 1R5NA 2OCAA 4C0SA 4C7OB 1Q20A 2BMFA 2GCOB 1KY2A 1BYIA 3VQTA 5L3SB 2REBA 4KITB 4TQAA 5K8UA 2QENA 2FJUA 4NKRA 2ZRMA 1KJWA 3B9PA 3X1DA 4A4DA 4H9GA 2ZS7A 2C2HA 1CU1A 2OE2A 2QORA 2QMOA 3NXSA 2MSCB 3Q72A 4Q7LA 1KK3A 1OKKA 2ORVA 4NCIA 1AGPA 1U90A 2D74A 1G8PA 1M74A 2BKUA 5AJWA 1ZBDA 4B43A 4JLOA 2QSYA 4S2EA 3QEJA 1SVWA 1F5NA 4BEBA 1T9HA 4A8JB 1E99A 3TVDA 3MAAC 5EP4A 2QY9A 2R44A 1T91A 3AQ4A 2O8EB 3CNNA 3I5XA 1KI6B 4Q1BA 4O3MA 4LSGA 1FTSA 1XTRA 3W3AA 3GJ0A 1YZTA 2ZR0A 2BC9A 1Z8FA 4QGGA 1BMFA 8OHMA 1GG2A 4Z51A 3H2YA 3NWJA 4GZMA 4OJQA 3EASA 1IM2A 1A4RA 4AYTA 3LA6A 4P4TA 1UAAA 2C98A 2C9OA 1G8HA 4DLXA 3GFPA 1ESMA 2GAOA 4QXAA 4TL8A 5FL3A 1CR0A 4LJ7A 5BQ5A 5EQTA 3RWMB 1W36C 2OLJA 1AZTA 2OM2A 3LW7A 2EFEB 3AGQA 4PSAA 2J3EA 5DLQC 3EXAA 2IEYA 4Q1DA 3QF4B 1DS6A 1G3QA 5EXTA 2V1XA 1PZNA 3A4MA 4QGHA 1RRGA 5AJZA 4A0RA 3BIFA 2QBYB 2JJ2A 2JLVA 4OQNA 3VKHA 3T5DA 2VSOA 4B76A 4C2TA 4YDHB 3FHTA 2GEDA 1P6XA 2J0UA 2EYQA 1VPLA 2ZE7A 2FFBA 1IXZA 1EGAA 4CEIB 1II8B 4II7A 4MITA 3FPAA 1VIAA 4JLPA 1EG7A 2LKCA 2QP4A 3HR8A 1E9RA 4B44A 1S3GA 2PT5A 4IDPA 1G5RA 1MRSA 3JVVA 3KB2A 3U2QA 3BORA 3WYAA 2PEYA 5GJWC 1RFLA 4NE2A 4KV9A 1W4CA 2DWQA 5L3QA 3WNDA 1U0HC 2BEJA 2PCLA 3SFZA 3QKSA 1EFRA 3B13B 3U5ZB 2FE4A 4IVRA 3OIYA 1TAGA 1QZXA 5FFMA 2FMXA 4IVPA 2F9MA 4NDZA 4ZO4A 2NPIA 3GLFB 2ZYTX 5TV2A 3W5JA 1E2DA 1N6PA 2CCKA 1Q12A 1HUQA 3IIMA 2JLZA 4TQ9A 1L4UA 1KZGB 5TB5A 5GJCA 3SFVA 4KBFA 4BLSA 5JEDA 2XZLA 2WSSD 3IGFA 2I1VB 4JBXA 1GSIA 3QNUA 5B30A 4HLCA 1TADA 3QI2A 4Q1FA 3RNLA 1EESA 1WDTA 4DIEA 1KOFA 1AA9A 2VHTA 3B7GA 5EE9A 3FWYA 1JPJA 4LHVA 2CK3D 2XTMA 4Z1MD 1JQJC 2YZ2A 3SEAA 3ETLA 2R6FA 2WKPA 1VG0B 1II0A 4WVFA 2QMUA 4JLDA 2JATA 2VP5A 1RC8A 2NZ8A 1ZNWA 1N6KA 1JJVA 1TQDA 4G0NA 2O52A 3FHCB 4CF7A 3L8YA 1P2SA 2G77B 4B75A 3CONA 4UNQA 4L9WA 1QHNA 3LAWA 2IYRA 1K8RA 5CJPA 4QJ3A 4PPGA 1GKUB 4UXHA 2Z83A 2JLUA 2XNDD 1KDRA 1IY2A 5KU1A 3OZXA 1DE0A 1H8EA 3R8CA 2AHOA 2C95A 5FOSA 1YZKA 3AVYA 2GXSA 3B78A 5D3MB 3SJCA 4K81B 5FTLA 1Z83A 3D3QA 1TU3A 1XCPA 3K0CA 4D82A 4V03A 4QKQA 1BKDR 1JR3E 3QBVA 2QTVB 4KYIB 4G5RA 2WJIA 1P7CA 3WBJA 4AY2A 4M1KA 3VX3A 2G0TA 2YYZA 4MRNA 3UG7A 2HXSA 3MUFA 3GQBA 3EG5A 5AUQA 1ZW6A 4XD7A 1KNQA 4DEYA 2OBMA 1ETUA 1OHHA 1XMSA 2WIBA 2X19A 4QHSA 1IQPA 4LK2A 5LPNA 1XP8A 1E1QA 1Z6XA 3Q3JB 4GOJA 2DBYA 3DEFA 2VF8A 1Z22A 1NVUQ 1RRPA 2PJRA 2ZRJA 1E0SA 3R7WA 3H86A 2F3RA 1S9DA 1TQ4A 4XOIA 3PXGA 3VHXA 5JRZA 2V7QD 4OBEA 2PLRA 4Q7KA 1IN6A 5FBLB 1J2JA 4D0GA 2BCJQ 4D4JA 5LD2C 1CR2A 2NOAA 2DHRA 1HQYE 1E2GA 1QRAA 1Q1ZA 1QHSA 1N6OA 4BRWA 2ODBA 1W44A 1PLLA 3SJAA 2ZRAA 2CLCX 1FOEB 2FPKA 2RHDA 1N5JA 5EE1A 4MA4A 5DO9A 3EPLA 3U7FB 3AB3A 4DVGA 1LB1B 1ZCAA 2EQBA 5CYOA 5DI3B 4NHOA 2W2VA 4QG7A 1GL7A 2VTKA 1IY1A 3ADKA 4HZUB 3EZ7A 4B34A 4A15A 1ZM4A 2HJVA 3A1VA 2F1HA 2IC5A 1DADA 4GZLA 3BD9A 2BBWA 3T61A 2MMGA 2GF9A 2JLQA 521PA 1E2JA 2ZE8A 1W0JD 3B6EA 3EARA 4YMUA 2ERYA 2DFLA 4WZAE 5AJVB 2QROA 2XOKA 2XJ4A 2YWGA 1UDWA 5KPDA 3MCAA 3W9YA 1OPXA 1AM4D 2O8DB 3SNHA 1Z3IX 1DAKA 1AS3A 1E6CA 5HKKA 1YRAA 5DHFA 2EFDB 5F9FA 2XGJA 3FKSA 4ILEA 1AQYA 4CDGA 2AWNA 2IYLD 3GJ5A 1FNNA 1F2TA 4B33A 2RAPA 1FNMA 4RFSA 4C3ZA 3DKPA 3EZFA 2ZYVX 2F3TA 3FKQA 3A8TA 3Q7QA 3TR5A 2ZI4A 2WAXA 5FL7D 3PUZA 3GEHA 1U8AA 1VCNA 3SJBA 4Z8YA 1FL9A 4F4JA 1Z0JA 3A37A 2FSGA 2QN6A 2P5TB 2ZJ8A 3M6AA 4XWKA 1OT3A 3THYA 3HPQA 5AWFC 3KB1A 3C14C 4PQFA 1S0UA 1RJ9A 3B85A 4NYIQ 1G19A 2ZU6A 2KSQA 4ZCMA 5FPTA 5BXQC 2IUUA 1GUAA 1NI3A 1W1WA 3LLMA 1P2UA 4ZV4A 5JI2E 2B8TA 3AUXA 2YHSA 1KAOA 2IYSA 3C8UA 1XFAA 3TH5A 3W34A 1DO2A 1NL3A 2ATVA 1KHTA 2WJHA 4BQSA 4F92B 5E3HA 5KSOA 2RGNA 1VYTA 3NHAA 2IS4A 1E1RD 3PFIA 4BPBA 3BFKA 3L0SA 2BVNA 3TW8B 4JJZA 3RRMA 1VYVA 1ZIOA 2RGEA 1Q3TA 5EJEA 1WE2A 3WHKA 4A9AA 3W6OA 5JCZA 4WW0A 3H84A 3ZZ0A 3FMFA 2J7PA 3CWQA 2D2EA 2ZAOA 4BZPA 1FX0A 4XH9B 2KB0A 4KAXA 4BFUA 4PAOA 3ZVLA 2BMDA 1H8HD 2ZQ5A 3OEHA 1OKKD 1KK0A 5JHGB 4OK3A 2P6UA 1DAHA 1CP2A 1CS4C 2PMDA 4Q4LA 4C4PA 4LWZA 2OV2A 5TVKA 1BOFA 1TL7C 1RE0A 3A58B 3CNLA 4ZDIA 1UF9A 1K5GA 5FPKA 4IFBA 3Q85A 4C0QC 3NBZC 3CR7A 1AKYA 3I32A 3K9LA 1UFQA 3PITA 3C7KA 3GLFE 1G18A 4ACAA 2MMCA 3WP1B 2N42A 3DHWC 2VQSA 4Q9HA 2CHVA 3B1XA 1XF9A 4PSVA 3B9QA 4B3XA 2NO6A 1E2LA 1KSFX 4F4IA 4C7OA 2ZI3A 4LX0A 2Z6VA 3Q5DA 1T3HA 3ZJYA 5H8WA 2GCOA 3BH7A 1XJ0A 3DZ8A 1NMYA 5L3SA 4KVGA 3GMTA 2W6JA 5FTNA 1OB2A 1ZVQA 2GTPA 4NYJQ 5JI3E 1FP6A 2P2LA 5IHPA 1TF7A 1VCIA 4OQMA 2G88A 2JJ2D 5KNDA 4MYHA 5G3YA 1E0KA 4B3FX 2EFHB 2IA5A 2XTZA 1DELA 1Y3AA 4HB2A 1ZIPA 3SN6A 4A8JA 3CX6A 2O8EA 1KI6A 5KDDA 4D0LB 1A2KC 1NP6A 3RC8A 2RGXA 2R65A 3BC1A 1N5IA 2R2AA 4LJAA 4UNPA 4TMKA 4A1FA 2XTNA 1J8MF 4KFRA 2IYXA 1MKYA 1UKVY 2VHJA 6Q21A 1W49A 1B23P 3QE0A 3AKYA 3E1SA 1G6OA 3PIRA 3RRYA 1OH6A 4BFZA 2QNRA 1K6MA 4S35A 3HJNA 3HP1A 3MG9A 3O47A 3TUJC 3QOFA 2V1UA 3FHOA 5CB8A 2J59A 2IWRA 1KKMA 3RC3A 4OQXA 2D7CA 3C5CA 3CX7A 1R0ZA 3QF4A 4LYAA 2QSZA 3NC1C 2HT6A 2EWVA 3NH9A 2QBYA 1E2QA 3ASYA 4HLQB 1G7SA 2G83A 2WTUA 4FIDA 1KDOA 2D2FA 1HT1E 1OXSC 4Q47A 2WSSA 2Y8EA 3EWAA 3RS7A 1ZNXA 5FBVB 4US2R 5KSZA 3A4LA 1OYYA 3PCRB 1NMXA 4EUNA 4CEJB 1A1VA 1II8A 3L82B 2P6NA 3QPVA 4CEIA 4FW9A 1D9XA 1S1CA 1DAIA 4MRVA 2HCBA 2FPMA 1N6RA 1JEEA 1I4DD 4C30A 4DSUA 2F1IA 3GJ8A 5CK5A 4B74A 4LYJA 1KO4A 1LNZA 1BIFA 4L9SA 2X2EA 5SZJA 2ZSAA 4ERNA 1HURA 3JZMA 1MO6A 3MFYA 3KTAB 1F48A 3X1ZA 2QAGB 1NVWQ 1YJ5A 3GLFA 3TK1A 2C96A 2WZQA 3L0PA 1T3LA 4TL9A 1F3OA 3RS3A 4MYTA 2XITA 2AKYA 4LUCA 2I1QA 1SQ5A 1HY3A 4JVNA 2CJWB 4IOKA 4NONA 1LS6A 1UEJA 4MDEA 2I4IA 1VKJA 3NC0C 4FCWA 1CLUA 5KDLA 2ZRBA 4XD7D 4Q66C 4WZBE 2GBLA 4FN5A 1W46A 1OHHD 3T12A 4A0FA 1UPTA 4F7WA 2JLSA 1UBGA 2ZRNA 3BOSA 2GZAA 3RS2A 4B2IA 3KJIA 4MKIA 5L8VA 2A7QA 3ASZA 5B2ZA 4W9MC 1DAEA 1KI9A 2FG5A 3SYNA 4ON9A 5C2JB 5KTYA 5DSZA 2BV3A 1IY0A 1U9IC 5FOVA 4AYXA 4IEIA 4MUAA 2W6ID 4F38A 1M1YE 2XEXA 3CWZA 4OJKA 1TNDA 2V7QA 4OHXA 3AKCA 2X2FA 3KZ1E 3PQCA 3WBKA 1XNJA 1YR6A 1ONBA 1KK1A 2O5VA 2RGGA 5D3MA 4E07A 2YOGA 1IOZA 2DFKB 1IN4A 1Z07A 2YWFA 4LBZA 5C1BA 2WOJA 4AKGA 4QL3A 1MT0A 4KBGA 5DISB 3U3MA 4TMZA 3H4MA 1NBMD 3D8BA 3AUYA 4FMCF 1EK0A 2ZRLA 4IVQA 4PZZA 1IN8A 3LQRA 2EWWA 3LY5A 3KQKA 1UJ2A 1KO7A 5HCNA 3PV0A 4AD8A 2JLXA 1CEEA 2ODNA 1A5TA 1VDZA 3LBIA 3RRNA 3WXMA 2AWOA 3CLVA 3F8TA 3OIVA 3F0TA 4YONB 2XOKD 2PCJA 4AKEA 1SGWA 3CRQA 4Q9KA 2RCNA 3A1UA 1XEXB 3A6PC 4LC0A 4V02A 2PT7A 1W0JA 4M2LA 4JS0A 4BFXA 4EJSC 3CO5A 2IF2A 2YV5A 4A0HA 1QDEA 2Z0MA 1SVSA 3W8NA 1AK2A 3ZQJA 4ZKEA 3K70B 2FA9A 2HXYA 4QBIA 4B32A 1CKEA 2BM1A 3T15A 2ZVQX 5HKKD 4I4LA 4DLZA 4TMWA 4YXWD 1N3BA 3FKSD 1XMJA 2A5JA 4D26A 3LO5A 4ABYA 3IKJA 3CRRA 1LS1A 5FBRB 1U2RA 2G1JA 4AURA 5KSYA 2ZAMA 2HUPA 2QE7A 4F4CA 3U61B 4TT3A 5DI3A 4KJZA 5DN6D 4M9SA 1R4AA 3V9PA 3KQHA 4HZUA 3GFOA 2VHQA 5DI9A 4JYBA 3W6NA 3QF7A 3QVUA 4AWXA 2NTYC 2Q3HA 2ODWA 1G6HA 1LF0A 4XVRA 5K8TA 3HPRA 2WIAA 3LDAA 3UKDA 3D7MA 1G8FA 1YZLA 1IONA 3GLIB 3K70D 3AP1A 4ARZB 1GL6A 3ONWA 3SBEA 3WHLA 2HEIA 5K8IA 2GXQA 1TUIA 1UBCA 3IBGA 2WWYA 4K8OA 3DM9B 1E0JA 1PUJA 2O8DA 1II9A 3MWYW 4RVCA 2JJ1D 2ZRHA 4UNRA 1W47A 4NH0A 1CJUC 2QI9C 4US0R 1ZD1A 4DDVA 2ZXUA 4FCTA 1U98A 2B21A 2V55B 3HDTA 3PEWA 1GILA 5A0FA 2QM8A 1ZD8A 3GLHB 2B7BA 1JQLB 4UXIA 2GWHA 3AP3A 4PZLA 4B6EA 3LLUA 3R20A 3AM1A 3U6KA 4PX9A 2YNMA 1X86B 3TUZC 3EA0A 4JIMA 1NN0A 1G21E 1XTJA 4URZR 4D81A 2H8KA 1Q21A 1Z0IA 2A5YB 2XSZA 3RAPR 2BHRA 3OEHD 2V54A 3EW9A 2O8FB 2F43B 3N70A 2AL7A 2RGCA 2ECKA 4O2LA 5FPSA 2ZRFA 2KE5A 1GNQA 1H8HA 4PC6A 5JCPA 2KWIA 3UPUA 2YC2C 2B92A 5JRJA 3KXKA 4B73A 5JS7A 2YWHA 1AJEA 2FGKA 5JWRA 2GESA 1KI1A 1JB1A 5IK2D 1W5SA 1GRRA 2GETA 2PL3A 3W90A 4R2IA 1NIPA 3V4RA 4FMDB 3FMPB 3ZIAD 4NBSA 5JJIA 2NMVA 3EAQA 2J5XA 5LBIA 2R9VA 2ZRDA 3SOPA 4LBYA 5DIFA 1KY3A 1LF5A 2JCSA 1KMHB 1G7CA 4NYIR 4H1UA 5HE8A 2Q9AA 2ZIAA 4D0NA 3SBDA 3A1TA 1FFHA 3EPKA 2O8BB 4V0KA 5HR5A 2J0VA 3PUXA 2QG6A 2ORWA 4D4MA 5JHHB 2W6JD 2JDIA 2D3WA 1FQKA 1P73A 3VR4A 4QBFA 2YJTD 5EZ6B 4A2QA 4CYMA 4A2PA 3K0SA 3DOFA 2HYDA 2XNSA 1Z6GA 2NO9A 4N3NA 4KU4A 5E95A 1XX6A 1CJVC 1G4UR 2FSHA 2WPDA 3BGWA 4KI0A 4FWIB 5GJVC 3RVBA 2R6AA 3L8ZA 3U7EB 3EZ9A 3QKRB 4JSTA 4TL6A 1YZQA 4US1R 5EE0A 5BN5A 2DWOA 4QJ4A 4LJ9A 2W58A 4M22A 1GITA 3SC3A 3K8YA 4TLEA 1XJCA 4RD3A 2FZLA 2KBFA 2QRNA 2WWXA 3OE7A 2EU8A 1U8ZA 5KSPA 1YVDA 3QPUA 4M1WA 1XTIA 1ZINA 3P4XA 4IW3B 4PTLA 4JBWA 2J87A 4NYMQ 2C9YA 1I4LD 4W5HA 2WJGA 4Y0AA 3IDQA 1F2UB 1PLJA 4D4KA 2IUSA 2ZSFA 4QC2A 1YR7A 4I1VA 2CCJA 2Q3FA 1E0AA 4KHZA 3OIUA 1HQCA 1U0LA 5J4HA 1NBME 1IJFA 1VHTA 4V0LA 5SZIA 3NHBA 1JI0A 5CDFE 621PA 2GXAA 4RZ3A 4HEJA 1E9BA 4PPNA 2WKRA 1OF1A 2H57A 3UMFA 3IEUA 4CEHB 4H1VA 4PO1A 3PUVA 1HE8B 3TQCA 1F60A 2C77A 2GEVA 3LV8A 4AKIA 4JVMA 5JS8A 2HYIC 2O8CB 2WWFA 4G5OA 1PJRA 2NO0A 3A36A 1Q22A 2N46A 2GCPA 1KAGA 5DYIA 3TVTA 4P31A 3QKTA 5FOWA 4E22A 4P33A 3CH4B 3QXCA 2GCNA 5GVSA 3KKPA 4M1OA 4TTPA 5CJ2A 1YZNA 2ONJA 4EFMA 5KNBA 1VMAA 4MYCA 1Z28A 4NYJR 3FFBA 1JXMA 3TNFA 2REOA 2ZPTX 3WP0A 1DO0A 2BDTA 3T5GA 2OZEA 2BKEA 3VR6A 1GAJA 4Q4JB 5G3ZA 3T1OA 1E9EA 4HB0A 4HDOB 3VR2A 4L15A 1G41A 1QBKC 3TKLA 4HLUA 1NLZA 2RMKA 5IDVA 4PR0A 2XB2A 3X1XA 4LV8B 2BMJA 4B35A 5LDDC 1P4SA 3P20A 2ZJ5A 3CPHA 4GP7A 4CZ2A 4JJKA 3IQXA 3KQLA 1N0VC 1KO5A 2WWGA 3TW4A 3KFVA 2OXRA 3QEOA 3FE2A 1XJQA 1J99A 3CBQA 3VFDA 5SZHB 4CEJA 3SYLA 2OCPA 2F1RA 4Z8XA 2PZEA 4B3CA 1CIPA 3AV0B 1WB9A 3LRPA 4JLBA 1L4YA 1Z0KA 3VNVA 1BYUA 3DO6A 3IUYA 4ACBA 2FX3A 1YKSA 5B57C 3ZLJA 1HYQA 1XWIA 2ZI9A 3R8FA 1TF5A 4HYYA 3GJ3A 1LTQA 1N0WA 1KI3A 1NG9A 1OJLA 4UNSA 4DCVA 1J8YF 4TWZA 3HR7A 4QBGB 1TU4A 5JSZB 2A30A 3KTAA 2VL7A 2QAGA 1ZUHA 1AGRA 4TYNA 4PC7A 5DNYB 1I2DA 2GXUA 4TMVA 3EPJA 5C4MA 1V43A 3IQWA 2W6IA 3ZS9A 2R6CA 1U0JA 1JJ7A 2QM7A 1NNEA 2QA5A 4CGZA 3OHMA 4WOPA 2PJZA 1G8YA 3QPWA 4HAWA 2CJWA 1E3MA 2CL7X 3GLIE 2X1VA 2PH1A 1T0JB 1W36B 2X77A 2SHKA 2JIZD 1OIXA 2HF8A 3CZPA 4OKSA 1NBMA 5JWHA 1SKYB 5CDFA 3WMEA 1GDDA 2VP9A 2FGJA 3LXRA 2GJSA 1S4QA 4JKIA 4BLOA 3GJXC 3QKUA 4IOLA 3TQFA 1RYHA 2BBOA 1Z2AA 5C18A 3AVPA 1KNXA 1W4RA 5GADl 1IJEA 3FFAA 1PVOA 4BZXA 4IFEA 5LB4A 4TMTA 3T35A 2ZR9A 2ZUBA 1ZRHA 1Z6AA 3ND8A 1Q44A 2D4HA 2V4ZA 4MQBA 2A2ZA 3KKOA 4A36A 1G5TA 1FP7A 3MJHA 2XB4A 4Q7JB 1Y63A 4EPYA 4AIIA 3NDBB 4EIWA 2XZOA 1VG8A 3THOA 2FWRA 1COWA 2VYFA 4RKEA 2WM9B 3OIWA 2QQEA 4NMMA 4RD0A 3LVRE 1R0XA 3UMRA 5IT5A 1M8PA 3KKNA 2J9RA 2VHUA 4Q48A 3PUWA 2F9LA 1Z0AA 4MYUA 4W5JA 4YXWA 5HCIA 5LB2A 2QE7D 2BJWA 3GJ4A 1ZP6A 4TT3D 1NKTA 3PG5A 4QGAA 2C78A 4A92A 1GM5A 4MUBA 3CF6R 2MSEB 3HYRA 2KBEA 2WMNB 1P75A 2QGZA 4LV6A 2OLKA 5DN6A 1D5CA 3J81k 4KVAA 2IWHA 3W6PA 1MOZA 3OF5A 2QZ4A 4BFWA 2CVHA 4QM7A 2LWIA 2QL6A 2CDNA 2XJ9A 1W5TA 3F5FA 3OAAA 1XPOA 3NEYA 4OYHA 2JEOA 3QG1A 1XEXA 2ZS9A 4YMWA 2NPFA 1R6BX 2J45A 5C4GB 3GJ6A 4EAQA 1ZAKA 2OCYC 1OV4A 3JZAA 2CL0X 1KSGA 1A2BA 5GVRA 4JLNA 4HATA 1ZYUA 1GFIA
chains in the Genus database with same CATH superfamily
2DSNA 1Z6QA 2OORA 4ZTUB 1G9SA 1A7KA 1ZH8A 5KO2A 3GT4A 4YCJA 1Z4LA 4NENB 4IR7A 4DG8A 1R88A 1YA6A 1Y8AA 3IR5A 4E03A 4ZYTA 3VDMA 5EZ5A 3AYZB 3EYWA 3PTAA 4LZJA 1P5HA 4GOOD 1ANKA 3KQOA 2DETA 2Q7XA 1QTIA 3SWWA 2AZXA 2C04A 1AKWA 1MQSA 4F11A 1R8QA 1Y89A 3DR3A 4TTTS 3ZGYA 5DNCA 1V4BA 1TVKB 2FSFA 3A7DA 4AJ9A 1B7GO 1JJFA 2EX0A 3ANYB 3BXHA 1RAEA 2X1HA 4LZZA 1UDRA 4YWHA 4DCCA 5ITVA 5L4LA 3GRCA 1RWBA 4O33A 4XPIA 3SLRA 4QUEA 2J0QA 5IVDA 3ROFA 3HUTA 4HRXA 4OXIA 1R10A 3M4XA 1E98A 3KOMA 4BQQA 4OQFA 3AFIA 1DX4A 1HV8A 2BUAA 2X7HA 5TMBA 3WBFA 3TGPA 2M9MA 5J47A 4F72A 5I7RA 2R00C 2PBZA 3PQEA 2IEIA 2W5UA 5AW3A 1RABA 3FAKA 1GHTA 3BWVA 2BFBB 4XGKA 1G6Q1 4YPFA 3DLPX 3SZMA 5DCWA 2PTHA 1BO6A 1M1NB 1T0HB 3MELA 5HNKA 4PZ0A 5IK2A 2GYYA 4GR4A 4KJXA 3X1YA 1Y8CA 2I2BA 4BFXA 5HFAA 3CLSD 1NU6A 5CUQA 1O5OA 1Y80A 3K1AA 3M4ZA 4CMAA 1FP4B 2IZ0A 5B3KA 1EK5A 1KQGA 4QYMA 5JJKA 1QTRA 1HEYA 2SKEA 2I22A 3NRBA 1RP7A 3HCAA 1XZQA 1YGPA 1UBRS 2WSBA 3KX2A 4IILA 5CNMA 4ZU3A 5G4KA 1JECA 1FLNA 3VOAA 3LVQE 2ZTVA 3ZXSA 3H8SA 5F51A 1C30A 5BP7A 4XYEA 1QQ5A 3EMVA 3KXLA 4HAYA 1XO1A 1XCGB 2G5CA 4ZOCA 1AHNA 1EUDA 2I7VA 3TD6A 4OM8A 3WRYC 4AF8A 2YKGA 4P53A 5ER9A 5JLJA 3CZAA 3M7IA 3USZA 1NONA 1F6BA 2XD9A 1FUEA 3CW2A 1XZCA 3ENZA 3Q3EA 2WPDD 1NE2A 1RZ3A 1YBHA 3B89A 3DFUA 2FN4A 3P9SA 4MRPA 3VYRB 2PFKA 3QY0A 5LBUA 4XJSA 1SJ9A 2Y66A 2J0EA 4P7JA 2K5UA 4L51A 2Q5CA 2O2CA 1V4NA 5BVHA 4ZVVA 1M2HA 3FGNA 3ZD9A 4BMDA 1JG7A 3QV1A 3HO6A 4ZK6A 5H9VA 2PX6A 4G5QA 4Q01A 1Z7EA 4EVRA 5FWYA 5ED4A 3OE7D 4D9IA 3T1TA 4HUTA 4FD3A 1UM8A 4RKYA 5LZ9A 3GRUA 2I87A 4XDYA 1LBHA 2OLEA 4AICA 3QA9A 3DW1X 4MO9A 4FWTA 5IBRA 1PJ2A 1U0NA 5H7XA 5AVWA 3SJUA 1ZNQO 3L0DA 2FF5A 3A4NA 2OWEA 5K01A 2XKJE 4FC7A 4Z0NA 4DVJA 1QYWA 3AUAA 4JLSA 4B3GA 4UUNA 1KYQA 2GFIA 5EP3A 1F8XA 3VYUB 2GRJA 4EEKA 5IFLA 4D42A 1OLSB 4V1CI 4PGFA 1TLLA 3Q41A 1ATZA 1ODFA 3T7DA 1W2GA 4PSKA 5HIMA 3CZQA 5DLEA 1G5HA 4YMVA 5DRYA 5LQRA 2XMBA 3O8NA 1CY2A 1VE5A 5BN4A 2GYUA 2TMYA 4U6NA 2PX3A 2R7LA 2XB6A 3H5OA 4RF4A 5I3CA 4MV8A 1QYVA 1I7SB 6PFKA 4K6OA 5LQJA 4PHTA 1RMQA 3QKRA 4QWMA 1JAYA 4CG1A 5HBGA 1ADJA 1HE4A 5E4FA 1ICEA 3Q7RA 5GONA 3BBPA 2KW5A 4EP1A 4E31A 1LDBA 2YVAA 4LZWA 4CMGA 1RPJA 1TMYA 4NBNA 3TFQA 1RQ2A 2I54A 3T0FA 3T94A 3CPEA 5KOYA 2JLWA 1NW3A 4Y6OA 4V0SA 4QFMA 5FUQA 1CULC 1KH3A 2C61A 5C1IA 4AQ7A 4YRJA 3A2NA 4DBLE 2KX7A 5HHTA 2Y93A 3ZBQA 2HBYA 4RCVA 1OXXK 4PZYA 2HI0A 2WJ6A 3O82A 3T54A 1W7AA 2RGNC 3VR6D 2VTBB 3G5LA 3C8ZA 3QJGA 4BX8A 4DBZA 4ZN6A 4TWBA 4MNTA 5DE3A 2V7GA 1JDBC 1I6WA 4JZYA 4P4SB 3NGLA 3U4GA 4F12A 1R8XA 1J8QA 4C4OA 1SVOA 1PR5A 1JDJA 5IAEA 2JJYA 3OG9A 2GK7A 3LXXA 3TZHA 1R1DA 4B6PA 2ENWA 2Z2KA 3R3XA 1T2CA 4CEHA 1ECFA 2YVLA 3O83A 4IDNA 4DIMA 4W8HA 3U3XA 2ZDHA 5DTRA 3C3BA 4YRKA 2CNLA 2FPSA 1U7TA 4QNRA 4ZQHA 5JO0A 3AEQB 3HHEA 3PC6A 2SNIE 4IINA 3JALA 3LX6A 1V3VA 1QKIA 2H65A 2C4WA 2N3ZA 3Q8KA 4ZYLA 5F5LA 3D1VA 3PHCA 4IDQA 5DHQA 5IAJA 4PO8A 5FH9A 2AD5A 2EZ4A 2VTVA 3MUEA 4YJ3F 4XWTA 1E2NA 4XUCA 1UM9B 4AC9A 2V7XA 4R6WA 4M54A 2H1OA 3U4HA 2CNDA 5KX5B 1D9ZA 1R0BA 4RHCA 4UKDA 5TEVA 1EFHA 3TQRA 3WQRA 2JGFA 3ZG6A 4JCCA 3ZV4A 4XWOA 3ZZ1A 4OQQA 3GLTA 3UW3A 3UK7A 2YIDA 1NRWA 1NVVQ 2XCUA 3FLEA 3ABSB 1NMEA 1JEDA 4KK3A 1VMIA 1HT0A 2JIRA 3TO5A 2NSHA 4BZZA 5EUMA 5LXTB 5F2EA 1N5OX 1I51A 3T3PB 2BOVA 2WW8A 5UKDA 4HADA 1LW7A 4AZ3A 4ZC8A 3NNDA 5I7UA 1K98A 2ZATA 3INNA 1DPFA 4MGKR 4JKOA 1MVOA 3D6MA 1NQ5A 1OTXA 2G5PA 2QZPA 2VXBA 2WG2A 4MULA 2HFJA 3KHKA 1Z0ZA 3WMWA 4YPOA 2PFGA 4KH1A 4C4TA 2VDKB 2I7XA 3PJGA 1U3FA 3NV9A 3Q7TA 2XUFA 1VJCA 5JJLA 3I5AA 4WKBA 1E3LA 5H4GA 1NATA 4ZO6A 5CW1A 2QY6A 3CXUA 1GZ7A 3UHOA 4AZ0B 1GO2A 1JKMA 1PCXA 3IP6A 3JW8A 4KFSA 4KO1S 2X40A 3IMFA 4PFQA 3ITKA 1EWQA 1MXHA 1CUSA 5CIQA 1TA9A 3C6ZA 3VJMA 1K88A 4CUKA 2H5IA 3P1JA 3QEKA 1MRZA 4F46A 1YHZA 4AYWA 2GZ1A 3QM1A 2FWPA 3PT5A 3C3YA 4TVBA 1OZFA 5L4SA 2GH1A 3GNTA 3SQWA 4OHYA 3W5UA 4KO4S 2ZUSA 3BXPA 5J58A 1SQFA 4D96A 1A27A 3K9NA 1CERA 4QVGA 3K4QA 1CR4A 3D0OA 4UPDA 1QC5B 2LRHA 2ZJZA 3LDHA 4J0GA 1Y1TA 2PM8A 3EOBI 1NN1A 4LYFA 5K20A 1GT91 3OZVA 2LUOA 4B3MB 3GNSA 1C1DA 3RBZA 3K35A 4BGDA 2IS2A 4K9SA 3LY9A 1O1YA 4E5VA 1RYMA 1KQNA 5IDQA 5G41A 1JDNA 2NXEA 4C20A 4J16A 3CJTA 1QP7A 2GKGA 1MDFA 2A5GA 3B3AA 1G5QA 3ABOB 4MGEA 3T99A 4HAOA 2QPAA 2B4RO 4DC0A 1W19A 4N7JA 1PO7A 2WHYA 2EYUA 2QU8A 1TKAA 1OX4A 4LNHA 2OEPA 4QYXA 4KR3A 4HXGA 3U3RA 2LZ0A 2YS7A 2ID8A 3E7PA 3HA2A 5FJIA 3DYBA 3OZAA 4G5HA 4CXMA 2VAMA 1P3Y1 3MERA 3G6WA 4EJFA 4DMGA 4HAUA 5DGXA 2NQ2C 3INYA 4M7PA 1MUUA 2ZEJA 1QHGA 3GGSA 1NBHA 3AVXA 2XR1A 3LA8A 5AK0A 3HTXA 4GFDA 3OPNA 4Q9LA 3ESRA 1Z0UA 3EZ2A 2YL2A 3MT0A 1GPBA 4KN5A 4J8PA 3MQFA 1PHRA 1OW3B 1JBKA 1N6NA 4G01B 1GTJ1 1P61B 4KPUB 4OK5A 4EA6A 4NOLA 4EG6A 1J2UA 1MB9A 3HCPA 1PJAA 1X7XB 1YR2A 4JNCA 5I8ZA 3U1VA 2HBQA 2AW3A 2VOJA 4C1BA 2NWQA 1ODTC 2QTWB 1K63A 3CB2A 3RLFA 2X3UA 3BH6A 3G23A 3NHUA 4F3NA 1XXHE 4EGFA 2RGUA 1IH8A 5DXFA 3TKAA 1ZUD1 1UPAA 4DSZA 3ONVA 4ZZ1A 3NPAA 4J2HA 2NSJA 4H1TA 5IP5A 2PY6A 2Z5FA 3JVIA 4R54A 3WK9A 1WNFA 1X9IA 2V7UA 2RH8A 2WF7A 2ZUCA 4QUAA 1B6GA 3U62A 3DC7A 1PNOA 3A70A 1OXUA 4WK4B 4DUZB 3FGPA 5TY0A 4RGBA 1FVHA 3KJNA 3Q9LA 5J63A 3WQQA 1T5IA 2W8BA 3IIKA 1HTBA 3LVFO 1QNFA 3AKEA 3E48A 4DWWA 4IWNA 3OUUA 1JKIA 3EHDA 5FEUA 4DUGD 2I8CA 2YXEA 5G0SA 1NJFA 5IBQA 3OO1A 2BI8A 4UZEA 5C5CA 2Y1WA 2XQKA 1K8YB 4U3JB 4TS1A 4D9JA 5FOQA 2YXNA 1CDEA 5DULA 2W22A 5F3DA 1BVUA 3HLTA 3Q0EA 1D2HA 5K8LA 1MP0A 2RGWA 3IKMB 2DFTA 4CVNA 4FW8A 2VSXA 1H6DA 2R62A 3KDSE 4XSHA 2KMLA 1MABB 1RMTA 3RHTA 1NQXA 1AT1A 1A04A 4PX2A 1V1MB 3KYBA 4NENA 3KJQA 4K6HA 5KSWB 4DV2B 4BBPA 1SXJB 3D4IA 3UT0A 4P0TA 1DJNA 3GFVA 4PPFA 3I23A 4A6DA 4BEJA 1JEAA 1LC3A 1UH5A 4L8LA 3JARB 3VHLB 1J20A 1T3GA 2ZRPA 3A1WA 3H9GA 4YFYA 2XUIA 5B5SA 1CS0B 1QH9A 4CM7A 4W82A 4H7JA 4I0WB 2XB8A 4M9QA 1Z6PA 4GXQA 1V5EA 2VK8A 1TVKA 4IMPA 4K0KB 2M6KA 4J90A 1O8CA 1I7NA 3FG9A 1F5SA 5G40A 1J90A 2QL9A 4Z54A 3FHLA 4L78A 1OWOA 2JEYA 2WM2A 4R2HA 2IZ5A 3F7MA 4MEJA 3TMYA 4L57A 3TYXA 1D0SA 2R11A 1OFIA 4HAZA 1UBJS 2D2IA 1TQ8A 1SU7A 1RC1A 1CY8A 1PSDA 2JVJA 2OENG 1G7TA 2XMRA 1I36A 1DOZA 3VNUA 4JBLA 3EBOA 3CLHA 3R3ZA 1YL6A 3PZRA 4G3XA 2HOQA 4OFWA 3SEZA 3UXMA 1C9MA 1RJDA 3ZEAA 3I01M 2ZP1A 3HQ4O 2ZAGA 4LXHA 5IUJC 4ZAVA 3BK7A 1M1NA 1FVXA 4ZMSA 4GX1A 1R7RA 2X76A 3DDSA 1KDTA 3RI3A 1ZJ5A 4Z49A 1V9CA 4PHFA 1KRHA 1FP4A 2HU2A 3IMGA 3PPWA 4HLNA 4ZI3A 2OG2A 2HZBA 2O54A 3IUBA 2YMLA 121PA 1KYXA 3H2SA 5DMHA 5IH3A 1HBJA 4HRYA 3L7MA 1D4ZA 5C0OE 2I7CA 4EKDA 2HMSA 1EP9A 4YV7A 1Y4AE 5DSXA 4NFHA 4RZQA 5CD1A 4FDVA 2F9FA 2R7AA 3AVQA 4O6VA 1QLJA 1VHLA 1VE6A 4YBRA 1TI7A 4JY7A 4LF7B 5EGNA 1GPJA 4OFZA 3KSRA 4R7GA 4DB2A 2HHCA 3L8FA 3N2LA 1J8FA 1BGXT 1H05A 3IAAA 3OIDA 4G07A 3E7FA 3VVBA 1ISFA 3FN4A 5SYAA 3WQBA 5M2QA 2WIDA 5TS3A 4NBKA 1XZNA 1T34A 1DIHA 1GIAA 1WCXA 4BHTA 2VJMA 2Q5EA 3E82A 4C0KA 2X2PA 4YJGB 4OI1A 2IUYA 3ICPA 1A9XB 3GU3A 1G3RA 1ZMOA 2JC3A 3PX2A 2H1RA 2J6IA 2VP2A 3MJCA 3ZHZA 1M6HA 3DM5A 1Q1EA 4RGYA 1JTVA 4I8IA 4Z7JA 2MHCA 5DGIA 1RXWA 1OA1A 3G0HA 1BWPA 4TN1A 3CB4A 2CXRA 1Q1BA 1MH1A 1KJYA 1PS9A 2HRRA 5B1YA 2Z08A 2PKRA 1WULS 3L8MA 4W1QA 5SY6A 3IO5A 1HZZA 4OIFA 1JQEA 4EMBA 1GCUA 1HZJA 2VPPA 3QBEA 4Q02A 4Z0HO 2OVFA 2Z8ZA 3C7TA 1OLSA 1WEHA 1P77A 1QIGA 1XWFA 2RK3A 3MWKA 3PFNA 2YFHA 1G0NA 4LVCA 4DDHA 4PXAA 1ZA2A 1WDLA 2IBMA 3VOBA 4EHDA 5LVAA 1HNXB 2HLDD 1FZTA 1XI2A 2QVZX 1EVJA 5FBQB 3TSWA 3NS7A 4QTYA 3G2NA 5LSAA 2WYIA 2ZQZA 5K0BA 3U7QB 2CJFA 1P6UA 5D01A 1JX6A 1UC4B 2XGOA 3JQAB 4RD4A 5DWDA 4QHTA 3LH5A 4B2PA 4ENPA 1E5VA 4X1OA 2VDOB 4R68A 4M9XA 1ZRSA 2X0JA 4LXQA 2GJ9A 5ELLA 3LHDA 2IH5A 2ANBA 3VH4A 2XF2A 1CRLA 1N6HA 2C7OA 2Q41A 2X9LA 1X77A 4DXHA 3VV3A 2JIBA 4PC1A 4Q5IA 1DC4A 2NZUG 2VT3A 3KJGA 5FOTA 3OFND 3KJHA 2ILVA 3H99A 4ZDWA 3SVZA 4HWPA 2YJ3A 3ICVA 3WSWA 1NIJA 2ZE5A 1D1PA 5JPCA 1MAHA 5MFPA 2HPZA 2I3DA 5EJAA 3LS2A 4MRRA 4ZOBA 1Q7CA 3HDYA 4PM4A 2PMFA 3NHMA 4KXLA 1L4EA 1LK7A 1M33A 1JUDA 1UL1X 2CHGA 3A0RB 4X41A 2V58A 4DLYA 1TUBB 2P9YA 3O92A 5TSDA 3LWDA 1R16A 1AA6A 2Q2OA 4C04A 4P4SA 1GLVA 4EF4A 1SPXA 4D8VA 4DRYA 1UOPA 2VKTA 4ROSA 3K71B 1Y1SA 1TYEB 2O1SA 2WV9A 2ZPUA 2V6IA 1MF7A 3ZXIA 4E5KA 5CIYA 5KJCA 1TVCA 2R79A 1DC3A 2X0NA 3L7AA 3DR5A 4KB5A 2QYHA 2MSDB 4HX9A 4NBRA 4URVR 1KU6A 2QQ0A 1Q84A 4G41A 3ZCRA 1IHDA 4YRIA 5CM9C 3UTCA 1GSOA 3O1IC 3VR6H 1U3UA 5EP1A 2Q1TA 2ZU0C 4QOHA 5JNWA 4BKOA 5D1HA 4M1SA 3AEQA 2I6TA 1W0KD 4BS9A 4HVTA 1KR2A 2E6UX 3G7UA 1TZBA 1U7UA 4UHFA 5C1DA 4C3UA 4B2LA 1T9DA 4REQB 1SELA 3ZDYB 1JBQA 2BI7A 3FYUB 4ETIA 5T8KA 5CYPA 2IEBA 3N8DA 1W8IA 4JJFA 4HFNA 1UM9A 3G89A 4TRNA 2JFFA 3G88A 5DTMA 2OP1A 2XB9A 4R2MA 5TJHA 5KX5A 1SUDA 4ASUD 3FOCA 1M5TA 3K31A 3TRHA 1XDGA 5DP1A 4BATA 3P0IA 2GILA 3ZXUB 4RORA 5FTMA 1US8B 4JKYA 2LCIA 4HNQA 1FTNA 1TPYA 3R9KA 4HDRB 2ST1A 1WSBA 2CY0A 4OA5A 3CKLA 1G2PA 2M98A 4JC0A 3EHEA 1WZNA 4AMGA 1N2ZA 3DFZA 5LXTA 3I0NA 1B3BA 4M9ZA 1W2HA 2NO4A 1Z5GA 4C6TB 9ABPA 1XQ1A 4M53A 1YFLA 2OESA 4U02A 1WZUA 2NADA 1RZRA 3DPUA 1WM1A 6NULA 5DTEA 3Q6IA 5HIIA 3W5SA 5HJ2A 4ETNA 5CITA 2CXSA 2I62A 1AB6A 2WAAA 4AKSA 4TYMA 2IT1A 2CHEA 2BE7A 3KV1A 3DLIA 4RQTA 4KLZA 3QKIA 3HN7A 4NOJA 1CJCA 4QNMA 1GZDA 2JFYA 1B4DA 5B36A 3W04A 3UANA 1ZNZA 1ZMBA 5HTKA 2IOQA 4J3FA 4RLFA 4TUYB 1IN5A 3WHPA 1ZN2A 3CTMA 3G17A 4UM9D 5ALZA 1TTTA 4AZ0A 4KCGA 1JALA 4LE2A 4W5WA 5DCYA 5KWIA 3QMWA 1E4YA 2HAEA 3U3OA 2WU4A 1Q17A 3BCHA 1XA0A 2LIVA 2ONYA 1MH9A 3CLRD 4B4OA 5KYKA 3SZGA 1Z2DA 1C7FA 4U2EA 3JX9A 3T4XA 4INPA 1WTCA 1E1YA 2YXLA 2OO7A 1G9XA 1P3JA 4ZEWA 2XXAB 2PUWA 5I4CA 1E79D 1JILA 4DXDA 4EPWA 1SA0B 3QE3A 1N9GB 1RHKA 4PYKA 1BS9A 3F5MA 3H8VA 4P4GA 1PFVA 2P3LA 1WB6A 2VIIA 3QTLA 2SKDA 3ND9A 5AM5A 1X1EA 2B2XA 2GNAA 3THWB 4WNCA 2QIPA 1G3MA 2VQ6A 4AQYB 3FSRA 1GN8A 3HZRA 3QVSA 2GEBA 1KDVA 3LDUA 1QC5A 3FTNA 4MW0A 1NW4A 3HVJA 2VEOA 4E7PA 4YQEA 4EWLA 4H4CA 3B53X 3P9RA 4R0NA 4BNIA 4DWJA 3D5QA 1RAGA 1NM5A 2AOWA 2PA3A 3D0KA 2AT1A 2ZRIA 4MHOA 3JYLA 2AN1A 3WYFA 5D1NA 4YX9A 3Q9NA 1Z6YA 2CJPA 2CL6X 1NMQA 1B1AA 4GW3A 1SC6A 4RXUA 4CKWB 3RV3A 3HDJA 3DEYX 1GG5A 4WKPA 2ZM6B 3DZJA 4HL6A 4P7GA 2O2DA 4PU0A 1OGJA 1Y5MA 3AWDA 1E89A 1RU3A 2DFDA 3LFHA 2HCFA 3WRVA 2ZCJA 2B3DA 4MUKA 1TYDE 2VTDA 2ZR7A 1KYWA 3D31A 3I58A 3LW8A 3MGCA 3UWMA 2R84A 3M33A 2QAJA 2IW3A 1AV6A 4IV5A 4DYVA 4YV1A 1L0BA 2B37A 1E4VA 1PUIA 1XTZA 1D6JA 5J5VA 2J4CA 3EA5A 3TMKA 3N53A 4BNHA 4R9RA 3NG1A 3LQ4A 3UXEA 1T29A 1XEAA 3Q8XB 1DU4A 5IDWA 1I3CA 1XRSB 2LCFA 3RKRA 2B78A 5JYEA 3AVWA 1JXOA 3D5TA 3NATA 4Q3CA 1IXSB 1LDMA 3RNOA 4NY1A 1URPA 2QIOA 5BW5A 2E3JA 2P9QA 1X7DA 4KPUA 1K97A 2OO3A 5H3HA 3BRWD 1A88A 4B87A 8MHTA 2PUAA 2QX6A 3RKUA 1MCZA 3ZDAA 1ADCA 1X7XA 3WMFA 1T4MA 1X1SA 4H59A 2OSBA 4B31A 1VDMA 4MOWA 4YI5A 3TR0A 2G3YA 4LJ8A 3MSXA 4PTYA 4EPTA 2HRZA 1GGEA 5A4IS 5ALVA 1WRBA 3L92A 1DAMA 4Q6WA 4LIPD 4ZQBA 721PA 4R8SA 3G8AA 4URYR 4NPHA 5EWJB 4RLQA 3KB8A 2P0EA 1QONA 1WMAA 1YZ3A 4TSKA 2PUVA 1A69A 3JPYA 2Q3CA 3KKZA 1S8NA 3ZWKA 4Y2HA 4OI0A 1UPXA 4GSKA 2O59A 4L4RA 1ZKMA 2CD7A 1KJZA 3UCEA 3R5SA 4AJKA 5INTA 5AVTA 3CG4A 2WIJA 4AXBA 2B20A 4MI1A 5EQJB 1SXPA 5GONF 1W581 4RZXA 1JU3A 4FEAA 1H5UA 5FV4A 1SZPA 4J0DA 3E15A 3UAGA 1ES9A 4O0MA 3NH6A 1WVIA 3NBKA 1GUZA 2QMYA 3UB2A 4PPQA 1C3EA 1DCKA 3V7NA 4X65B 3HUEA 2V0CA 1COZA 1FUIA 3AL2A 2DH5A 3EDMA 4U3JA 1BQ3A 4XI9A 5L3RA 3RTEA 1UR5A 4NQZA 2WT4A 3W2TA 3LT0A 1HA3A 2FMIA 3ZJUA 4RGQA 4FU0A 4FZ5A 5D00A 2Z98A 5E7QA 5H81A 1F2DA 1QKKA 3HACA 3VO2A 4YDQA 1PT9A 1MABA 2EKDA 2RBGA 3GIWA 1T4GA 2WQZA 3H8JA 4F45A 3WNCA 1JTFA 2DKFA 1V1MA 2O8NA 3OPYI 4OQEA 1FTGA 1ML4A 2HRQA 2OFXA 4YT2A 1SXJA 3B60A 1UJMA 4YACA 2GD1O 2D1FA 4XFKA 3JARA 5CFRA 4BNVA 1JZTA 1NBEA 2Q9CA 4YC7A 4EHAA 4UQLA 3PWKA 2V7VA 1PT7A 1HNWB 1CS0A 2GK3A 3PGMA 2FDCA 4GMGA 5ALGA 5IHXA 2I9PA 2PPVA 3P9PA 4AXXA 2I6UA 5J5CA 4D1YA 2Y1DA 1P62B 4N01A 4MGIR 4Y98A 2COUA 3AFOA 4Y2RA 1Q0UA 3JQQA 5J1TB 5TMDA 4NS1A 3H5WA 1EHYA 4JBYA 3I92A 4GT1A 2W90A 1VJ0A 4NPAA 3DV9A 1TTPB 3SG0A 3E2IA 3I72A 3BHNA 1QHEA 3IP8A 4GI7A 1I13A 2GTHA 1YR1A 3E27A 1T4CB 3L0IB 4TKLA 5CIWA 4Q9JA 5ITWA 2A3NA 2X8JB 3N2NA 4QU8A 4EUHA 1H23A 5T7BA 2XBUA 2Z6UA 4BRUA 1HE2A 1HL3A 1DV2A 2OCGA 3I8XA 4ABTA 5DBGA 1S2NA 3M5WA 2BELA 3S70A 3UBTA 1LWOA 1IN1A 2FEAA 4C05A 4F8JA 1V39A 5BW8A 4AO6A 3UCXA 3E58A 1HDGO 2R1TA 3GFSA 3CVWA 4XPZA 4Z99A 3WKCA 1D2RA 2R25B 1DDOA 3EJWA 5EHNA 4HWTA 1OFTA 1EWVA 1DEAA 1DQNA 1VHWA 1B8UA 2ECOA 1T6YA 2D0PB 2PSEA 4L4YA 4MMZB 2NO7A 5JECA 5CURA 2HL6A 2O1WA 1ZICA 1JEYB 1PE0A 2VTEA 3UUEA 2C2XA 4RO0A 4UMEA 1ZMXA 2Q8NA 2DUNA 3O31A 1AKTA 4M60A 3OFKA 5ELXA 4MIYA 2OT3B 2VXCA 2H1FA 4MB0A 4UMVA 4MVJE 1DNPA 1JT9A 4R8LA 3SKVA 4R98A 2W0MA 4WFIA 2XUKA 5AQ1A 4DR4B 2Q5FA 2P5YA 1XDDA 3NYIA 3JWHA 2PS0A 2NZJA 1CUZA 1K7EB 2FW6A 2D0DA 2GK6A 2IDJA 5F33A 1N33B 1M0TA 4MWSA 2IYYA 1PV1A 2W2XA 3G8YA 3RAEC 3GQBB 3JAMA 2Y68A 3E70C 3P9IA 3PP8A 4HWSA 4V0MA 1LBSA 4YJGA 4ZEMA 3B2QA 1A9XA 4BXOB 4O8ZA 4QUIA 1NYQA 4UHJA 4RVNA 1HNNA 1QIIA 4R8MA 2UVDA 1G59A 4P8RA 2ZS8A 3MTQA 4R2WA 5I3ZA 1NN3A 1WEKA 1MB4A 4FYYA 5BYBA 4BTVA 3JS5A 5H70A 3ELWA 4RHFA 4EO9A 3UWDA 2D1RA 4LGMA 4W1RA 2BY4A 1L1EA 2WYOA 3EF1A 5TDHA 1YFJA 3LC1O 3BH0A 3H18A 5D86A 3R7WB 5AIBA 4YRRA 4K1LA 3KSAC 3VHXB 2F55A 1TA0A 3GN2A 3H1FA 3NOOA 1ZJ6A 4R05A 4S04A 3TZLA 4UCWA 3V3TA 4P4UA 3PT9A 4B81A 4K5QA 2B69A 4IYJA 1KETA 3FCXA 2O2GA 4YA6A 3SDZA 4I1UA 1YMQA 2VT7A 5LZ2A 2IHYA 4I9HA 2K4MA 3VTZA 4TS4A 3LKBA 1NVXQ 2NVBA 3CX4A 1XOIA 1N3LA 1DQYA 2WMYA 1SRQA 2FFHA 1GU1A 1ZZGA 1BGVA 5CNJA 1U94A 3TF5A 4RKFA 1NBAA 2EVWX 1A5BB 1GSHA 1UZUA 5TXGA 4MQ5A 4LHXA 3U7QA 1OFUX 1GG8A 1P39A 1VPTA 3JQAA 2LTAA 4RD1A 3TJZA 1X74A 3ENWA 5EEGA 2VQ3A 2Z2YA 5BNFA 1G17A 4MQEB 5C31A 1KQOA 1AQJA 1QTQA 1U5BB 4EATA 1IOWA 1E1QD 4UTOA 1SD2A 4RUKA 3WL7A 2CEKA 2FWJA 2PO7A 3WGOA 1QNLA 3X1WA 4Q1AA 1PYDA 1G20E 2DBRA 5K0CA 3VZSA 4N0MA 4JH0A 5JNVA 2RARA 1L7NA 3VZBA 1WCYA 3I1FA 4YV0A 1B15A 5JZVA 4UFOA 3PIIA 2G5TA 5JBIA 4YCBA 2HDOA 3DQPA 1TPZA 3HABA 5BRNA 5KINB 1SXJC 4BQFA 5ERXA 4POAA 1R6XA 2D7JA 5F5XA 3HXOA 4PZDA 3JRXA 1TUBA 2AE1A 3G9QA 1Q2XA 3DC2A 2DC1A 3ICWA 1T2EA 4RJLA 3T0GA 2PGLA 4CUJA 5LOVA 3U09A 2I99A 2CSXA 1GOTA 3HDQA 1SKQA 1ABBA 3K0EA 3KR1A 2HPAA 1E9SA 5DYGA 1UADA 4URXR 4LDNA 2VJQA 1V5WA 4WJLA 4BLPA 5IYZB 3W1VA 2WAYA 2CFRA 1EFPB 3GD7A 1DDIA 4MKGA 3NTVA 2NG1A 3GMDA 3U4DA 3S7ZA 4UU0A 4RFSB 5EN4A 3T9EA 4AUKA 5LDHA 3A1EA 3EY4A 3BSYA 2NO1A 3KTDA 2ID9A 3FSJX 3RVDA 5JFGA 1T3TA 2IYWA 5E7MA 5L6LB 1DLJA 3VR3A 4REQA 3ZQ4A 5BWMA 2ZZMA 5KOHB 3FYUA 5D84A 4N3BA 1HG1A 2FKNA 1HYEA 3MRSA 3TXYA 4EW3A 2ACEA 2BFNA 5E9AA 1KZ4A 3UMYA 1NZDA 3OY2A 2H92A 2LR0A 3OO0A 3F9IA 3GEDA 5IBCA 1XWWA 1US8A 2CLSA 2IKQA 3N76A 3DXYA 4KO2S 4ND1A 3IXLA 2ZITA 4HDRA 1NWHA 1MQ9A 1KFJB 2R4QA 4NQRA 2TMKA 4OB6A 4BNFA 2OM6A 3OECA 4C6TA 3VKUA 4GR9A 2DMRA 1I1NA 3KBOA 3UMGA 4BP9A 4I1IA 5JBQA 4HMQA 4DEXA 1E2EA 1WUHS 3KYJB 2O9JA 5H1YA 3DPIA 2BFPA 4HNHA 2P6OA 2CE2X 2A4MA 2NGRA 3EN0A 4P5DA 5EA2A 5FUXA 4O4JB 4QXRA 2HJGA 2NX2A 3AG5A 4IRUB 5AJHA 5J40A 3ADBA 2Q29A 1JH9A 1X7YA 2AEFA 2ZSEA 4FHCA 4BNTA 4PYRA 1NJSA 4G2NA 4WA8A 3ML1A 2JEZA 1NWCA 4KZPA 2CLIB 4TUYA 4KP7A 3WFIA 2P9ZA 1TCBA 4XXHA 5KS2A 4ZICA 1ZH6A 3QIAA 3AIOA 4C0JA 3G2QA 2ZSJA 5AW6A 2HHLA 2HJHA 4JYZA 3T7SA 4D74A 1XVLA 4S1NA 1I1HA 2H31A 3ITDA 3K96A 4V0NA 4D02A 2QP3A 2P2GA 4OHZA 4G89A 4QBKA 4LVOA 3R2JA 3TTSA 4EO7A 1X8LA 2XXAA 2VEDA 1X3SA 3WYBA 5A1JA 4BVGA 4DUPA 4RTQA 1JG1A 1SA0A 1N9GA 1QV7A 3V4PB 3IAXA 2RHRA 3AJ8A 3GCDA 4GXRA 4Q39A 5CEEA 1J25A 1TFRA 3THWA 4DIKA 2QW1A 1TAQA 4JMLA 2AMFA 2DCUA 1SOUA 2QTRA 4YMSA 3VO8A 3WIBA 4B3BA 4DJDC 1CUXA 1NUTA 5IN4A 4EEXA 1FFBA 2ZREA 3ZJTA 3HMKA 1JDTA 2ZWMA 5IKEA 2ZBEA 3UEOA 5AVYA 1E1RA 2WNSA 3WIUA 2AMJA 4GBJA 1R6TA 2C5GA 4KYTA 4JP2A 5J4VA 2WNHA 3LKVA 2HDWA 3W1EA 4GO1A 1NVEA 2EHDA 4CKWA 3PQ6A 1NKVA 5CB4B 1Y6JA 4M8SA 1A71A 3Q2OA 4A8PA 1OMOA 1BYIA 4KGVA 2IY9A 4R8KA 4LGYA 4PLPA 2B5WA 3AHGA 2BEWB 3F7OA 5ALSA 1MBZA 1P19A 1R74A 1F14A 3X1DA 2WYWA 4A4DA 4H9GA 1PW7A 1R0SA 2ZS7A 1JU4A 3KPVA 1OC2A 2KLBA 3DG9A 3K5HA 4U7HA 4ARAA 5TGZA 5BV2P 5LUAA 2FSVC 1X8XA 3A4VA 1NULA 5HQJA 3IRUA 2O2XA 1L7EA 2RK4A 4YO7A 1M74A 1YHYA 2DG2A 3IE2A 3WB1A 4JLOA 4EJ0A 4BLVA 4MB6A 4BEBA 3MAAC 3ERCA 3BIOA 4FKBA 2R44A 1XN4A 2QXUA 2D13A 1EDEA 1L4HA 1YOBA 1YDWA 3PL5A 2BF4A 3L7LA 4UE2A 1FTSA 2N0SA 1NVFA 4QJBA 1PFYA 2BC9A 3DMRA 5DHPA 2R8PA 2EL7A 2EKQA 4RH3A 4M9RA 5ADHA 1UMCB 2XMZA 2ASVA 4LSWA 5KU7A 2H4YA 4LFBB 2XCLA 3G7NA 2HO4A 2ZSIA 3ASUA 3DHVA 3EASA 3NJRA 2XY4A 4O8CA 4Q82A 4UHCA 4ZAXA 2C98A 1FTYA 5BV7A 4QELA 1MA0A 4LA4A 5EWJA 1F0KA 3VGPA 3PI6A 4TL8A 5FL3A 1CR0A 3BE5A 3GWZA 3NETA 3DBOB 5EQTA 3RWMB 3W4IA 1UKAA 2J6CA 1OY1A 2PUJA 4X63A 5G0TA 2Q5LA 3LUGA 3LW7A 2EFEB 2OFPA 4BJHB 4PSAA 1Z4IA 2CXOA 2J3EA 5DLQC 3EXAA 1VMDA 1WP4A 3QF4B 5KNCD 1EB8A 1KQFA 5EXTA 1RM5A 3OT4A 1H2ZA 4XEHA 4A23A 4X20B 4Y2VA 2JPDA 4GDMA 5AJZA 3BIFA 1TKRA 1NDUA 3GELA 4PE5B 4PLCA 3VPXA 1GGHA 2XF8A 1V6CA 4IV0A 2HGSA 1QQ6A 1XZDA 2QRJA 3DB2A 1N1MA 3RS8A 3FHTA 3BRSA 4X92A 4ZU1X 3M6WA 1NW9B 4CIWA 3WGNA 3MS4A 2LNDA 3V55A 1G9TA 4MITA 3FPAA 4H7KA 1NPDA 3IYLW 2XA2A 4FFWA 1LK5A 1OVMA 3ROTA 2PD6A 4MI9A 3RIEA 2Z04A 4L02A 1PJ3A 3PDWA 2PT5A 4B44A 3QP9A 4FVTA 5JZMA 2M32A 2OV6A 5GJWC 1BRTA 2YHBA 4KV9A 2DWQA 1O9GA 5GV7A 3WNDA 2PCLA 4CPDA 1EFRA 3MEQA 4IVRA 3CX3A 3I30X 4OA8A 1QZXA 5FFMA 1Q0TA 3ORQA 3HGQA 5JDIC 5JTUA 3IV9A 3NR2A 4B4KA 2WK1A 4P3OA 4Y9RA 4QRDA 4DWVA 4KUEA 1LJLA 2YW2A 1N6PA 1J22A 1QLHA 1MIHA 1R9JA 3TNYA 4CLRB 4M87A 2JLZA 4KR7A 1BEEA 5TB5A 4JYMA 2P0YA 2X42A 2HLHA 2QU7A 3HCNA 3JQCA 3NHYA 4NI5A 3T7TA 3UOWA 3UJCA 2J8ZA 3ZCXA 2CJXA 3ZGOA 5BR7A 1L7AA 4HC4A 3H2GA 1GSIA 1LI4A 4ENUA 5B30A 4AZSA 1YQGA 4KZKA 3TS1A 3I3OA 4DYHA 3Q0IA 3U4IA 1EESA 3WLNA 2B4YA 5MN5A 1G5IA 2BGIA 2I6FA 4PYIA 3HWRA 1T4CA 5KX5F 4TGLA 2X8JA 3B7GA 4TM7A 5L3ZA 4W6QA 2CK3D 1QRDA 3BZUA 1L7OA 4OU5A 3KPWA 1QO0A 2V96A 1VIDA 5K0TA 3HG7A 2MU1A 3M1LA 3F1LA 2WKPA 1II0A 2A35A 2QMUA 5LXTF 1MU0A 1G38A 1FDUA 3I6MA 1S7GA 2JH3A 1TQDA 1ZGGA 1Y1RA 4HH0A 1HE3A 3WLSA 2MIIA 2HF2A 3WIVA 2P27A 4ESOA 5I7SA 5C1PA 1KTIA 1M1ZA