2ASEA

Nmr structure of the f28l mutant of cdc42hs
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
178
structure length
178
Chain Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKLPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of an Oncogenic Mutant of Cdc42Hs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Cell division control protein 42 homolog
total genus 18
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2005-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2aseA00
2A5FA 1BMFD 3GLHB 4BFTA 4B74A 2WIBA 2NO1A 2WICA 3K9HA 4M1OA 1LF0A 2FU5C 1C4OA 5EZ6B 4RVCA 2WPDA 2ZS8A 4UNQA 1ONBA 3KFVA 4BECA 4C2UA 1F5NA 4XH9B 1Q0UA 1T5IA 5LBIA 4FMCB 5LB4A 1KKMA 3VHLB 4DWJA 4S35A 1KSGA 2CLSA 2FPKA 4LHWA 4D25A 4AI6A 1IN4A 4A92A 1VYTA 5AJWA 2VHJA 5FBLB 2W58A 4GPTA 2HXSA 3R7WA 2HF8A 2V1UA 2O8BB 2J3EA 3GD7A 5CJPA 5A0FA 3RANA 2KWIA 1YZTA 3K09A 3K1JA 1AKEA 1SVWA 4AKIA 1GNPA 2CCKA 3CR7A 1CR2A 5HE8A 2JDID 2QAGA 4MH0R 1X86B 1Z08A 2NO9A 2O0JA 3NBZC 5JEDA 4HUTA 4NHOA 4MGYR 4DXAA 2VA8A 2YINC 3SFVA 1D9XA 2CNWD 1EXMA 3GJ6A 4RCYA 3KUCA 2IXGA 3CBQA 4KODA 5CK5A 4RD6A 1P9WA 2FZ4A 3TW8B 2WSSD 4KXFB 4MGKR 4A2QA 4DDWA 2BVNA 1K5GA 5JJKA 2W6IA 1Q12A 4ZIRA 2F1HA 2ZR7A 2ZJAA 1XEXA 1M1YE 4MA4A 3ASYA 1ZM2A 5FL3A 2MSDB 3TVDA 1ZM4A 2GEDA 2PLFA 4OQXA 4MKHA 3TAUA 1AS3A 4NZYA 3LW7A 5EP3A 3EPJA 3FWYA 1ZM3A 2J7KA 2VHCA 3HU2A 1Z0DA 821PA 1E2FA 4WAUA 2IYSA 1S8FA 2GVDC 4YXWD 3LQQA 1Y3AA 2ODBA 2BEJA 4MUBA 2XTMA 3MWLA 3ZS8A 3V9PA 1SKYB 3CPEA 4JLMA 3AVVA 4BGDA 2BIFA 4WW0A 4TLBA 4U02A 3K09C 3IGFA 3MUFA 3OIUA 3VU9A 5DI3A 4ZV4A 4EPVA 1VG8A 1SQ5A 4HLUA 2GJAA 1JQJC 3VR6A 4PPQA 5CM8B 1H65A 4IJMA 5FOUA 2V7QA 1ZM9A 3N2IA 1EWRA 1PJRA 2OCAA 1S1MA 4AG6A 2VF8A 3VKWA 2R6CA 4HLDA 4Q1EA 5M04A 2Q9BA 5H70A 3KJEA 4PC2A 2AD5A 4DT1A 2GHIA 4P31A 4IXNA 4F7WA 3HP1A 2ZI4A 3BH7A 3RS0A 3EPLA 3T61A 3ZD6A 1AK2A 2ONJA 4NP6A 5E7IA 1NVXQ 2YNMA 4GFDA 2C77A 1C9KA 5FL7D 3FDIA 2WM9B 1I4TD 5K8LA 1FFHA 4B35A 1RJ9A 5FTLA 2EYQA 4KCGA 5A5GA 1IXRC 3TQFA 2GF9A 4G5GA 4DLXA 2HLDD 3PG5A 4TT3D 4F4CA 2XZOA 3MGCA 1GRRA 1YRAA 4AYXA 1P72A 1QHHB 4II7A 3SZRA 2H18A 4NYIQ 2V8OA 2QSYA 3AUXA 4KSBA 4Q1BA 2RB4A 1CJTC 1E9RA 4XVQA 1R10A 3QKUA 5G53C 4CZ2A 4LRWA 2ZYWX 4HAYA 1D2NA 1G41A 2OCBA 2JCSA 3DHWC 4QJ4A 1T4GA 4UNNA 4LJ8A 3VR2A 4DEXA 4GSYA 2FFAA 1MV5A 4C0JA 1ELOA 1CIPA 2ZYUX 3U44B 2BMDA 2VSFA 4PC1A 3EWAA 1CJVC 4P4SA 4W7SA 3ZLJA 2OEPA 3A1TA 1K6MA 5BQ5A 4A82A 2J59A 2RH5A 3HU3A 5C46F 3U5ZB 1XTRA 2GK6A 3PJRA 3RRMA 1FP7A 2I3BA 4UJ5A 1Q21A 1E2NA 5B57C 3GJ8A 2ZSEA 2JAQA 2BEKA 2R8RA 4YDHB 5KOYA 4XOIA 5IDVA 3NIBA 2ZUDA 1GTVA 2AFIE 1DAFA 2OBLA 4RJLA 1XEFA 1KHTA 1Z5ZA 5AJVB 3U2QA 3CRRA 4E22A 2BBWA 2VP9A 2WWXA 5AUOB 1IY2A 4M2LA 4AKEA 1S2MA 3DZDA 1AIPA 2HJVA 3CRW1 4DJTA 5HTKA 4RD2A 1E0SA 5DHFA 4YQFA 2ORIA 1M8PA 4OJKA 3OAAD 4JVMA 4R98A 1YQTA 4GL2A 1UM8A 2WVJA 1Q20A 1F3OA 3QPVA 2WAXA 1ZCAA 3QSYA 3B1VA 4QHTA 1P2TA 1V5WA 1X8KA 2FMXA 3E2IA 2P3SA 1ZJ6A 2H5EA 2IL1A 3AVWA 1T5LA 1ANKA 1E2GA 4KJZA 3ZGXA 4DIEA 2CHVA 1YJ5A 2ZRGA 4DLYA 3LX5A 1GKIA 1N5JA 2J0SA 1M7BA 4LYJA 3MSXA 2NO0A 3RSOA 2QU8A 1H8ED 5D3MB 5TXGA 1VYVA 3PUYA 3FPAA 5L3VA 1NG1A 2RMKA 2OXCA 4GP7A 2YYZA 4R2IA 3OEHD 2REOA 3WHLA 1ZYUA 4IDHA 4LBWA 2ASEA 4M0LA 4BZQA 1RRCA 1M7HA 4WBSA 2CL0X 3MJRA 2QM7A 2DWQA 1SULA 4BASA 3NBFA 2ZU6A 3EZFA 4US0R 3A4LA 4QHSA 3NWJA 2PEZA 2ZSAA 4Q7JB 5JWHA 5JECA 4PAMA 4NU0A 5H68A 4A36A 4AK9A 1G5PA 3JVUA 2AWOA 3SE0A 3W3AA 1E0AA 5C2JB 3REFA 3VQTA 2GBLA 3GLFA 3ADCA 2V55B 2BCGY 2QEQA 2UVQA 1VTKA 4Z8YA 1GNRA 4B33A 3B60A 3SJCA 5JS7A 2J45A 5EZ5A 2WSSA 2G1JA 4D81A 3P27A 5KU1A 3DOEA 2VH5R 1CR1A 3KKQA 2EFGA 2WJVA 4LWZA 1KI7A 1IAQA 4OQFA 3GJ7A 4Q4JB 2RGDA 5IK2A 1J7KA 1NIJA 4PSVA 1P5ZB 2XX3A 4M1YA 3VMFA 3GLGB 2BWJA 4R71A 4LYAA 1ZUIA 3K8YA 1JECA 4MYTA 2PCJA 2FA9A 2WJGA 4TL9A 5DYIA 4GDFA 2FEOA 2NZ8A 2CK3D 2ANBA 1GRNA 1W49A 1XMSA 2P0EA 3TW4A 4QFMA 4F93B 1CU1A 4O2LA 2WIAA 1G3UA 1CR4A 1OW3B 3P4YA 4ZDWA 3BE4A 3FFAA 4Q4HA 2VP4A 3A36A 3DOFA 4W5WA 1OXSC 1XXHB 1HUQA 4EPYA 1VIYA 3ONWA 1RRGA 1TL7C 4LJ7A 2HT1A 4HZIA 2RHMA 1D9ZA 4D4KA 4Y0AA 1R0XA 2C95A 2FFHA 1H8EA 3CZQA 3GJ3A 1NL3A 2FWRA 5LDDC 1GWNA 1KKLA 3L0OA 4JJZA 5EXPA 3TUIC 3I72A 2OG2A 4IVRA 5KDLA 3CONA 5JJIA 1X8LA 2O8CB 1FPMA 5JRZA 3H84A 1LF5A 1OYWA 2GXUA 2RGNA 4L9SA 4RCZA 5L3RA 5B64A 4ESHA 3SBEA 2IA5A 2W2XA 2JLVA 1W7AA 1T91A 1SGWA 2ZI6A 5KPJA 3QBTA 3WP0A 1HY3A 1TTTA 2YWHA 2FFQA 2ZI5A 1KK2A 4FD2A 2FZLA 2P6NA 2XJ9A 4I1SA 1BMFA 3SQXA 1TNDA 1TQDA 3QXHA 3VKGA 3ZZTA 2QP4A 5KNCA 4GZLA 5B58C 3FE2A 3A6PC 2WBLC 3AF3A 4QGAA 1GG2A 2QPOA 2BV3A 4TT3A 1SVKA 1VCOA 1W0JD 3U3MA 1F60A 4W9MC 4OJQA 2EYUA 2QSZA 3B6EA 5G3YA 2QAGB 3PVSA 1W36B 3KDSE 3B85A 4V0LA 3SC3A 5DI9A 1XJQA 3DKPA 3P20A 2QENA 4TQUS 2G77B 5DHAA 3CF6R 5P21A 2H7VA 4IFBA 3IKJA 2YWEA 1U81A 1E2PA 2BBOA 2ZRHA 2FOLA 2RGCA 4KFUA 4UNSA 4B2PA 1E0KA 2VP5A 1ZM7A 3CZPA 1TADA 2ZUBA 1JEEA 3IO3A 2ZANA 2J7PA 1N3BA 5FBQB 3UMRA 4DKXA 3V4RA 2IYRA 4B3XA 1G3IA 1OFTA 1G3MA 2P6UA 3Q7QA 4MUAA 1E79A 1GZSA 1VG9B 2RAPA 4PSKA 1S0UA 2Z4SA 2OFWA 3QKSB 3ICQB 3BK7A 2CJWB 3U4QA 2RGNC 2GCOA 4X8OA 1NN1A 2VPPA 2G83A 4URYR 4JLOA 3OESA 2QGNA 3GLIA 2GXQA 4GP6A 2FX3A 2DFKB 3THXA 1IY1A 3BC1A 1Q1BA 3AF0A 3E1SA 2BDTA 3SN6A 2FGKA 3VU9B 1PLLA 4FI3C 4OHVA 5GJWC 1G4UR 2W6JA 1E1RA 4NONA 4K8OA 2VTKA 2GWHA 3TKLA 3U3RA 2RGEA 3KZ1E 2RHDA 3KFXA 2JLSA 1VPLA 3M0EA 1R5NA 1U8YA 1CXZA 4V03A 3SHWA 4A4DA 1II9A 3DPUA 2VP6A 3BIFA 1CJMA 2IYVA 4FIDA 1SXJC 4EJSA 2PX3A 1OF1A 3C5HA 4OHYA 3ZH9B 3QF7A 1R5OA 2GJ8A 4ABYA 1J90A 3IPYA 3RHFA 2D7CA 3DDCA 3QVVA 4FCVA 4NL4H 2QTFA 2ERYA 2GJSA 2OBNA 3RWOA 4B44A 4D4JA 1Z0FA 4UXHA 3TE6A 3THYA 3EZ7A 4KBFA 1NJFA 3KQHA 4C4PA 1W0JA 2QT1A 3W8RA 4BLRA 4HDQB 3SU8A 4NCHA 5FUWA 3QF4B 4BLSA 2OBMA 3IEVA 1TU3A 4FXPA 4V0MA 1JEDA 1EX6A 2ECKA 3AVYA 3R9WA 4KSCA 2KSQA 4M1SA 4DCNA 4ZDJA 5AUPB 2QUZA 3PEYA 1IQPA 2ZSBA 1TQ4A 2C9CA 3CNOA 1W36C 2W6ID 4FN5A 2AK2A 1S3GA 1JPNA 1NY6A 4D0NA 4GOXA 4JL6A 1N6KA 3O8RA 1P62B 5FI1B 2GVZC 3G82C 3M6AA 2NPIA 2DYKA 1KK1A 3N5CA 4ILEA 1YZQA 3CPHA 3VX4A 3T34A 2IX3A 1E6CA 3I8XA 4Q1AA 3FMOB 2EFDB 2HJGA 2H57A 3VX3A 1E79D 4AYWA 1OB5A 2ZETA 1KK0A 3CX6A 1MH1A 3D6TB 3DM5A 1NVWQ 4GZMA 1CS4C 4BE7B 4E07A 4P4SB 4C2TA 2JGNA 4A1FA 3QPUA 1OH5A 2P65A 3HR7A 3LAWA 1UPTA 4AG5A 2EQBA 5FUYA 2AL7A 2ZRKA 1JJVA 2C99A 5J4LA 2GNOA 5BN3A 5J4YA 3T06B 1Z6XA 4CDGA 3AKDA 4DLUA 1ZU5A 2FDCA 4AD8A 4AKGA 2OE2A 1FNNA 2BBTA 3K9NA 3SJAA 4LJYA 5ELXA 1S3SA 1IXSB 1YZLA 2OFXA 3GLHE 3ZZUA 2GILA 4B3BA 1Z63A 2YWGA 4NCNA 3ADDA 2O0KA 3C4JA 5CDFA 5BN5A 2VHUA 1P3JA 4PAQA 1YZUA 1E1QA 1N25A 2WMNB 2G9NA 1GL6A 3U3JA 5HCIA 3DO6A 3VNVA 4IDQA 4D0LB 4HYYA 2W2VA 3PUZA 2GCPA 2J0VA 4QGHA 1N6NA 1DAMA 4QNRA 4M9XA 1KAOA 2G1KA 2ZAMA 4PQYA 4EDHA 3W6OA 4PO1A 5FPHA 2JJ2A 3KB2A 2ZYTX 1O3YA 2EVWX 2GEUA 5FBWB 1OFIA 2ZQ5A 5C4MA 2FG5A 2QMUA 4P4UA 5DISB 1E2DA 2OZEA 3R9XA 1KJYA 1G7SA 3BORA 1UBFA 3QENA 5CDFE 4LSGA 3ZQ6A 2ZAOA 5LD2B 3EIEA 3R9IA 1ESMA 5JWRA 3Q7PA 2GTPA 3GEHA 3AVUA 1P75A 1K8RA 1KI8A 2IXEA 2CCJA 3VR3A 4NE2A 2QN6A 4G5OA 3WYFA 5C18A 4Z51A 4V0OA 1II8A 1ZUNB 3C5CA 1XEXB 4JVLA 2QTVB 3X1ZA 1ESNA 3QG1A 4UNPA 3DM9B 2GAAA 3PITA 1VMAA 2J41A 1TUIA 1AM4D 1E2EA 2CHQA 3WMFA 2JDIA 2CDNA 1E98A 4LPSA 1Z2CA 5EQTA 4OYHA 4XVRA 1SVLA 4LUCA 2ZJ2A 5JZVA 1Z6GA 3AVTA 5TY0A 1JBKA 2PL3A 4JLNA 5JCPA 1MO4A 3JZMA 4JVSB 4RD0A 3EZ2A 4U5XA 4M9SA 1PLKA 3PQCA 1FNMA 1E2MA 4HSEA 3GLGE 2JIZA 2C5LA 1XTQA 2B21A 3KTAA 2YOFA 1ZNWA 2Q21A 4D82A 1G19A 2B92A 3I92A 4XWKA 1RKBA 1IN6A 4HAUA 1SVIA 1AQYA 2ZJBA 3Q8XB 1E94E 1GL9B 3KQLA 4LJ9A 4BLOA 1XDBA 1ZNZA 2CLCX 4A0HA 1QDEA 1HV8A 4PTLA 4OQNA 3D3QA 3LQRA 4TWZA 4LGMA 4OI2A 4PHFA 1XJCA 3BERA 2EWWA 4OBEA 4WVFA 3UIEA 2ZR9A 2JLZA 3THOA 4A8JC 1FUKA 1WMSA 2ATVA 3EW9A 4FWIB 3FKQA 1N6HA 4RSGA 4FMCF 3CH4B 1RE0A 3IPXA 2REBA 5KSPA 2D06A 3KJGA 2GZHA 3ADKA 4L4UA 4V0KA 4CIDA 3TRFA 3FTQA 1XB2A 4LHVA 4C0AC 2OCYC 4B2IA 2JJ2D 2ZRCA 1ZMXA 3BB1A 1UBCA 3CRMA 2QL6A 1SXJD 3LV8A 3TR5A 5J4KA 1Q1ZA 1QZXA 4AKHA 3Q85A 2KI5A 2WV9A 8OHMA 1JXOA 4LX0A 1HT1E 1WQ1R 3IHWA 5J40A 4B48A 3I5YA 5FOSA 3QUSA 1ZVQA 2OM2A 3ZVMA 3LVQE 2JJ1D 5EP1A 5D3QA 2IC5A 1UKYA 4ZKEA 3CKLA 4PHGA 3WHKA 1D5CA 3UWOA 1XBTA 1TQ2A 1KJZA 5K8TA 1JR3D 5E7JA 1AA9A 4RFSA 1E9EA 2R6FA 4FMDB 2A7QA 2ZR0A 2UZ3A 221PA 3BJIC 2VHTA 2ZJ8A 1LV7A 3PUWA 2WSMA 3Q5DA 4URZR 3TMKA 4DSNA 1U98A 3FMIA 3OEED 4PHHA 5LD2C 4W5JA 1SHZA 4YMTA 4G3XA 3UPUA 4EPXA 4YDSA 1SVMA 2RGAA 2A78A 2ZPTX 1COWA 4C0LA 1FTSA 3PUXA 1NBMA 4TL7A 1RW4A 3CR8A 4ASUD 3MWJA 2YZ2A 4CRWB 1L7VC 1Q3HA 3KKNA 1N2CE 4N1AA 4BFYA 3V4FA 3K0AB 1ZW6A 4D4LA 2GEVA 4DZZA 2QQEA 3RDPA 2R65A 1KY2A 3T1TA 1N0VC 2A5JA 1J70A 2IBMA 3GFOA 3NH9A 3BWDD 4B76A 4QG7A 4PAOA 5DSZA 1MO6A 3U4QB 2GCOB 5FOXA 4ITRC 5CK4A 3VNUA 3WNCA 2WHXA 3QXXA 4DCSA 3GLIB 5FTKA 1GVNB 2RGGA 4EPTA 1KDRA 2J1LA 3BFXA 1T0JB 3BGWA 4Q9JA 5D3MA 1XJ0A 3PUVA 1P2SA 4BQSA 3CUEF 3THXB 1GM5A 2GA8A 2G0NA 1Q57A 2LWIA 2XNDD 4OHXA 1UDXA 1NN3A 1RFLA 3CRVA 4AURA 1KDTA 2H17A 2OLKA 3RRNA 3CF0A 2BCJQ 2WOOA 4UKDA 1I4LD 3OAAA 1KTVA 3UATA 1VKJA 1OHHD 3KQKA 4Z8XA 2A5GA 4OK6A 1LY1A 1EFRD 2QAJA 5SZIA 5DN6A 5E7MA 4B73A 4IEEA 5E4FA 3FGNA 2JJ1A 3FHTA 3B1WA 4DLSA 1GDDA 1P61B 3ECCA 4EJSB 3U7HB 3VFDA 2FGJA 3AP3A 3DZ8A 1LW7A 3MMPA 5TB5A 1E2KA 2W6JD 2AFHE 1PLJA 1RYHA 3FFBA 4IOMA 1TX4B 4NDZA 3H4MA 2F1JA 4RZ3A 1G9XA 3T1QA 4C7OB 2QE7D 4C3ZA 1W1WA 2WZQA 1PVOA 2A5DA 1ZU4A 4QGGA 4MGIR 1S9HA 2Q9AA 5B2ZA 3T35A 3U3KA 1QBKC 3CM0A 5FTJA 4QHYA 1FX0B 1L4UA 2OHFA 3EAQA 2D62A 3RS4A 2X8AA 3SI7A 3BRWD 4KLZA 4LJ5A 4DUGA 4O0MA 3AP1A 2QMEA 3L0PA 2C98A 1UBEA 1P7CA 2WWFA 2ZJZA 5GADl 4GOKA 2WKPA 4LHXA 1LTQA 1NLFA 4FMBB 1Z83A 4A0GA 4BFZA 1AGRA 4B2LA 4ACAA 3VR5A 4XTRA 1MT0A 4ON9A 3EZ6A 3LBHA 4DCTA 1EFCA 4Q4HB 1R6BX 3JVVA 2F43A 4RD4A 1GFIA 1XXHA 2E87A 2B7CA 3AVPA 2W2TA 4KYUA 4CT4B 5C1BA 4Q4LA 4OI4A 4BLTA 3WMGA 1G5TA 1BOFA 4QJ5A 4ACBA 2WOJA 2YOGA 2ERXA 5K8UA 3QQ5A 3QPWA 1ZC3A 4Z54A 1ZD9A 1TU4A 3AF4A 4UXJA 3PEUA 3QOFA 1E0JA 3RLFA 3O8CA 4KYIB 4DRZA 2MSCB 3AP2A 1G8GA 3B13B 3RNLA 1DO2A 2F3TA 3DEFA 4KVGA 3GEIA 1QVRA 1DBSA 2PLRA 3TNFA 2JA1A 3LH5A 1OXUA 3BAFA 4BWYA 3WY9A 4PZYA 4H1UA 3PXGA 1ZC4A 1ODFA 1H8HA 4F38A 2NTYC 1GRQA 4DSTA 2QGZA 3PV0A 1KDOA 3K0CC 3L8ZA 4IDPA 2B6HA 2FEMA 1X3SA 3AUYA 1NMXA 2QMOA 2CBZA 3KQNA 1MABB 1U8ZA 1E9AA 4TZ0A 1DADA 2ZE5A 2QRZA 4RKEA 1NVUQ 2J87A 5FPSA 4C0HA 2D7DA 1YZGA 1OIWA 1UADA 5IHPA 1T0HB 3LLUA 4X8HA 4JLAA 1E9SA 1KY3A 2AR7A 5FOVA 4QKQA 4TLCA 1WF3A 1OXTA 2EFCB 1X1RA 2WWHA 3WP1B 1CRPA 2QPAA 1GOTA 2V6IA 4OI0A 1FW6A 2QG6A 5J5CA 3CIOA 2BJWA 5L3SA 4EQ6A 5EE3A 1YKSA 4XSHA 3WBKA 3B8HA 1J8MF 2VBCA 1YHNA 3X2SA 2XOKD 1W4AA 4R2HA 3QKSA 3RYTC 3GCGA 1KSHA 2CJWA 3NBYC 2CNWA 4LHYA 2YKGA 3O47A 4KI0A 2PMKA 1QHXA 1E69A 5KSZA 4C0BA 1R0YA 4D0GA 2WAYA 1COWD 2XSZA 4IOJA 1GSIA 1HT2E 1KAGA 4F91B 4PQFA 3QXCA 5AWFC 1CTQA 1L2TA 4QC2A 5CB8A 2Q3FA 3U60B 3I8SA 4NYJQ 3RWMB 3K70C 3LD9A 5L3QA 3K0CA 3KTAB 3GPLA 1WE2A 3ZVRA 2J7PD 3G5UA 2HF9A 5KO2A 1BO6A 3I61A 3P26A 1TF7A 4UXIA 1DTSA 3GJ5A 1CP2A 2J0UB 1DO0A 1G3QA 2IK8A 4CEHB 3A1SA 1N6IA 3GJ0A 3CLVA 4QM6A 4U00A 3KQUA 1T8TA 1Z0AA 2CCGA 2XTNA 4M1WA 4PSAA 3W6PA 3ADBA 1IJEA 4R7ZA 4TSFA 3QVUA 4YMUA 3P4XA 2ZJ5A 2MMCA 1BS1A 2LKCA 5BYKA 1CBUA 3AVOA 1RVDA 1JNYA 1DAIA 4US2R 3GMTA 1WA5A 4NCKA 5F98A 4YMVA 2Z83A 2GETA 2BMEA 3LFUA 1QG4A 1FMLA 4JS0A 1IN7A 2O8DB 4E03A 2V1XA 2J5XA 2UKDA 3KJHA 5FOWA 3NHAA 1NLZA 1N6OA 4I1UA 3FHOA 1IN8A 1OE0A 2XJ4A 3A1WA 2DB3A 1FP6A 4Q9LA 3A4MA 5CYOA 1UKEA 4MGZR 421PA 1SXJE 1Z47A 3AKYA 4IHQA 3LBIA 4A8JA 4JT4A 1RRPA 4GMXA 1RC8A 3LO5A 2C04A 2I1QA 3TQCA 1ZIOA 3U7EB 4LHZA 4A15A 2J9RA 3JZAA 1VYUA 4O2RA 2GAOA 3QKTA 4LBVA 1E2JA 2GXAA 1LVGA 1R4AA 2ZVPX 3OIYA 2PCLA 3OZXA 5FBVB 4PZZA 4M1MA 2FJUA 4OHZA 1BYUA 2A5YB 2HLDA 5DE3A 1NKSA 1HE8B 2NIPA 3OFNA 2IYTA 1ZD1A 1N0WA 3W5IA 3B9PA 1IY0A 4N3NA 3WRYC 5EUQB 521PA 4XWAA 1DAKA 1DAGA 4I81A 1AS0A 1R7RA 4B43A 1M6NA 2ZS7A 2PJRA 5HZKA 1NJGA 2B7BA 4B47A 3NVAA 1V43A 2JLYA 2HCBA 3AKCA 5AR1A 5CITA 1OH8A 1JB1A 1KO1A 3RC8A 2ORVA 2Q0HA 4R9UC 5FPTA 3K9LA 2AX4A 2IYLD 1ZUHA 2F3RA 2HXYA 2PMDA 1KO8A 1F48A 4JSYA 5JRJA 2YJTD 4Y0VA 2WJIA 3K0AA 3TUJC 5F9FA 2HEIA 4TMVA 4Q1DA 1Z3IX 4S2EA 3F3YA 3ZDQA 1P2VA 1ZAKA 1FL9A 2OILA 3K70D 1DEKA 4BFSA 2XXAA 2J0QA 3TUZC 3W6NA 2GK7A 4TLAA 4TSFD 4TL8A 4URUR 4QBFA 4M9QA 6Q21A 4DVGA 4PFSA 1YRBA 4ASUA 1KJWA 4Q5IA 5DO9A 5BXQC 1QG2A 2NMVA 5F3WB 2BM0A 3HU1A 4MDEA 5KNBA 3MJHA 3T15A 1N6PA 1GUAA 1UDWA 3H86A 4LBYA 3VHXA 2GZDA 4Q9IA 4FCWA 3AM1A 4MYUA 5JFGA 2IYQA 2RKOA 1GITA 1CRQA 4AC9A 3B1XA 2ZRBA 3CNLA 3THWA 1U9IA 3QBVA 1W0KA 3RS3A 3ZQJA 1T3SA 3QG5A 2F1RA 3S1AA 1CJUC 5GJBA 1YU9A 4K46A 4EIWA 3C8UA 1JR6A 4WZAE 1NKTA 1PV4A 1II8B 3M4YA 4XIGS 2AKYA 5JHHB 3IEUA 4RY2A 1Q1QA 3F5FA 1E32A 1AGPA 1XX6A 4ZI2A 2NQ2C 1Z07A 2V7QD 3CX7A 4B3GA 4WIAA 1CJKC 1BYIA 2Q6TA 4EFMA 5KYKA 2NG1A 3A1UA 4RKFA 5CYPA 3UK6A 2ZSFA 5SZJA 1RPZA 2PJZA 4WXPA 3OEEA 4IFEA 3W9YA 4JL8A 4KVAA 2XB2A 1DAEA 4X8LA 3U6KA 1NVVR 3L43A 2QP9X 1SVSA 1W46A 4JIMA 1VIAA 3IDQA 5C4GB 1QHYA 3B9QA 4DDTA 3UKDA 4PPNA 5EP4A 4E09A 1TPZA 1KK3A 4Q02A 4HB2A 5J4VA 5JSZA 1RYFA 4PANA 1D6JA 1ZRHA 2ODEA 3IHLA 4LPKA 1SXJB 2D2FA 2VP0A 1EWQA 3LXRA 1Q22A 2BC9A 4HDOB 4BLQA 1KI1A 2OUKA 2HUPA 3RAPR 3NDPA 621PA 4PR0A 3DVLA 1J2JA 4KITB 1MRNA 2F1IA 3I62A 1NY5A 5SZKB 2YWFA 3I4LA 1D2EA 1KO5A 3C15C 4P4TA 1F2TB 2X77A 3B1ZA 2QY9A 4DSUA 1WRBA 3EC1A 121PA 1Z6AA 4AYTA 3NC0C 2F43B 2JIZD 5FOTA 1E2LA 4J0QA 4C0KA 1NF3A 1JPJA 2QA5A 3ICEA 1JR3E 3PIRA 3NG1A 5CM9C 3W3ZB 2NGRA 4CT5A 3A37A 1W36D 4HDCA 1XXHE 4JVNA 1MOZA 4QBIA 4JSTA 2EW1A 1ETUA 2PH1A 2ZUCA 2AN9A 4N0DA 3SYLA 1KGDA 2KB0A 4K81B 1GNQA 3F0TA 1Z0IA 2OLJA 3Q5EA 4P0TA 4URVR 1E9CA 2IF0A 3A8TA 1EFRA 5IT5A 1TF5A 5UKDA 3TSWA 2ZE8A 1W4CA 3FMFA 1IOZA 4DCUA 1OB2A 3HJNA 3EWSA 3BFKA 2JEOA 5EE1A 2WMOB 1XZQA 2F55A 3I32A 3ZS9A 4LDJA 2R2AA 3TGPA 4M1KA 1U0JA 4PX9A 4URXR 1JAIA 2ZRPA 4RFSB 1G6OA 1KSFX 3IO5A 1ZD8A 1GILA 3LBNA 4KFRA 4ZPXA 2PZEA 1KO7A 3L0SA 3R20A 3MCAA 1IM2A 1E2HA 4IEIA 4HLUC 1Z0JA 1E1QD 1PUJA 4B32A 1MABA 1Q1EA 3B82A 3W34A 4A6PA 4AWXA 3BB3A 3TLXA 2PT5A 2Q9CA 4PC3A 3QKRB 1Z6YA 4NCJA 5FTNA 2G0TA 5A4JA 5JWOA 2QBYA 1KNXA 1JI0A 1OSNA 2I1VB 5JMTA 1XU4A 3SYKA 4YLGA 2V3CC 4L16A 2ZJOA 4QJ3A 1G18A 4OK5A 4ARZA 4D80A 2F9MA 1EX7A 1FUUA 2BBSA 2HYDA 5JI2E 2F6RA 2O0HA 4FW9A 3WNBA 5KSYA 4LYHA 2P2LA 1ZNYA 2CMKA 3C7KA 4C30A 3LNCA 1EFHA 1XZPA 5L3SB 1M7GA 2EU8A 1UEJA 3AF2A 4JT2A 2YC4C 1FQJA 3OIVA 2ZI7A 3QY0A 4L5BA 2IYXA 5KUTA 1A2KC 1DARA 5G3ZA 1XRJA 3DMDA 4FCTA 1WBDA 1HTWA 3BBPA 1QVAA 3NBXX 3X1DA 1PUIA 2WTUA 4C9BA 4CEJA 2FSGA 2ZRIA 4PO8A 1K5DA 2OSBA 4D6PA 1XTJA 2DPXA 1WBBA 1P9RA 3T1VA 2QQ0A 1XNJA 2N1BA 1Q44A 1E3MA 3EARA 3MFYA 1DPFA 3SJZA 4Q66C 3KB1A 3ND8A 4HUQB 3NTUA 4LV8B 5EP2A 3LXXA 3RS2A 2IHBA 3ETLA 2ZRAA 3SOPA 5L3QB 1IN5A 2A3RA 4GT1A 3U61B 2XZLA 1N5LA 3Q72A 1XD2B 4HZUA 4GBMA 3LRPA 4UJ3A 3LA6A 4G5SA 2KJQA 4B34A 1PZNA 3CRQA 3SS8A 5EXTA 3Q9LA 3LDAA 4NYIR 1W4RA 3CO5A 2R44A 1DS6A 4DC9A 5JLJA 4ESVA 2FPLA 3NC1C 1KI2A 3WXMA 1QF9A 2C03A 5GVRA 4ZKDA 5EJEA 4KV9A 1H8HD 1T9HA 1FOEB 3K0FB 1ZNXA 2OV2A 2AXNA 4CEIB 2CK3A 2IF2A 4I1OA 4B3CA 3NDBB 3K53A 2IWHA 4Q7MB 2WWWA 1E1RD 2WKQA 5FR2A 4ZDKA 4M1TA 1F2UB 1LS1A 3NXSA 2VRWA 1Z8FA 4LCBA 4HATA 4KHZA 4HB3A 4JBWA 4FWTA 4C7OA 3BH6A 2I4IA 4U7DA 1YE8A 1F6BA 2OT3B 3O8BA 3VR1A 5J4HA 4ZDIA 2REXB 1HQYE 2O8EB 2O52A 1FX0A 2N42A 2IEYA 1G8PA 3SYNA 3D7MA 4BEBA 2IUSA 1E4VA 4I99A 1OPXA 3IILA 3FYHA 2AD1A 4LI0A 4JJKA 2WJYA 3U6BA 2Z6VA 4O3MA 4A8JB 2BHRA 1XCGB 2FE4A 4DLTA 1KI9A 1NSTA 2D2EA 4MRPA 3CPJB 1XTSA 3KXKA 3R8FA 1LS6A 1U90A 1VG0B 1XCPA 4QXAA 4A0FA 1Z2AA 4DB2A 1W44A 2XITA 3WYGA 2JATA 3RC3A 2DR3A 1E9BA 1KYIA 3CNNA 3ZJYA 5DIFA 3T5DA 1W5TA 4AIIA 2CEAA 4OL0A 3EPKA 4CVNA 5BWMA 2QM8A 4WZBE 4DEYA 4DLZA 3NHBA 1OT3A 1NMYA 4JLDA 4LV5B 3VR4A 2HCJB 1DELA 3D31A 3J81k 2HV8A 5CJ2A 5TDHA 2PT7A 2ODWA 4P33A 2FSIA 2H16A 2IEZA 4XVUA 2MSEB 3QI2A 5AJZA 1RZ3A 2DHRA 2LKDA 2QROA 5KDOA 1LFDB 4L8GA 1W2GA 4Q4AB 2DFLA 1JXMA 1KZGB 3L82B 3OEHA 1KMHB 1KDPA 1XD8A 2H8KA 3FOZA 1NP6A 2CVFA 3CX8A 4LOAA 4EAQA 1KMQA 3RVBA 1OH7A 4A0RA 1IJFA 4Q9KA 2EFEB 1HE1C 4JBXA 2RGXA 1G1MA 3E70C 3M1IA 4PHTA 4M21A 3L8YA 4PZLA 1P4SA 4HEJA 4JLKA 3EIHA 1NBMD 3TR0A 3DKVA 3LLMA 3GLIE 1ZP6A 1UEIA 1G64A 5J47A 4ZCMA 2DCUA 1XCMA 4WA7A 5DH9A 2IYUA 5L8VA 3B1YA 3B7GA 2NPFA 1KNQA 3EG5A 4KO8A 4OKSA 5EUMA 1JJ7A 3X1XA 2AKAB 4Q7LA 4XJXA 3IBGA 2R62A 1CKEA 4PC6A 3QXSA 1A4RA 1US8B 3V00A 4KFSA 4KFTA 4H9GA 1NIPA 3I5XA 2YHSA 3GFPA 1HQCA 1AS2A 3RRZA 4N0EA 4EKDA 2VEDA 2RCNA 3CWQA 4ERNA 1XWIA 3I3SR 4BEJA 2W83A 1R2QA 4X8MA 5JJLA 3MWYW 4PXAA 2EWVA 2XTZA 4MRSA 1R0ZA 2VSXA 5H1YA 4JYBA 1N6RA 1XEWX 1HA3A 2X2FA 3K0EA 3OFND 4JYCA 4EQ6B 3ZZ0A 5B30A 2VHQA 3BB4A 3SNHA 3SFZA 4OQMA 4M4SA 3A4NA 2ZRNA 3H0KA 4PO9A 2X19A 5CIQA 4Q1FA 2IUUA 3HYRA 5FUVA 1GL7A 5BN4A 1J8YF 4M53A 1GIAA 1KSJA 4LJ4A 5EE0A 1QHSA 3LVRE 2A2ZA 1AZSC 3EASA 1OFUX 1E2IA 2IW3A 3FKSA 3IIKA 3RS5A 3LX8A 4BPBA 3W8NA 4C0QC 1VG1A 4V0NA 1EGAA 2QP3A 3CH5A 3L2OB 3QEOA 3QIAA 4TMKA 4M22A 2IS4A 1U94A 3NEJA 1Q3TA 3B2EA 4GOJA 1OLOA 5EXSA 2AK3A 1U0HC 2WPDD 5DYGA 1QRAA 5AK0A 1QHNA 3N70A 2O8FB 1XP8A 3H1TA 5JSZB 3ZYCA 2CE7A 2XAUA 2J0UA 1ZINA 4JLPA 1NVVQ 3REGA 3W90A 4Q9HA 4B3FX 4CEHA 1D2MA 1FZQA 1UAAA 5GJVC 4JLJA 1VHTA 3UG7A 1XPOA 3T1OA 5GVSA 1XMIA 4URWR 4I4LA 4TMZA 4M8NE 4IVQA 5TARA 2X1VA 4GNKA 2C9OA 2Z4RA 1SVOA 1Z29A 2G88A 2L0XA 2ODNA 1KO4A 3GLHA 4DUGD 1G291 3EZ9A 1NG9A 3WRXC 4EPWA 2DBYA 1C1YA 5TMPA 1OYYA 1EFTA 2C96A 5FTMA 1WCV1 2A30A 4G5QA 1KI3A 1ZIPA 4TQAA 4DSOA 1Z6TA 4IXMA 1E4YA 2O8DA 2ZRLA 1XD9A 4GRAA 3W5JA 4A9AA 4IOLA 3OIWA 2EFHB 3BFVA 4G1UC 4KAXA 2Z0MA 3SR0A 2CVHA 3ZVLA 2IUTA 2O8BA 1UKZA 2ZE6A 2GKSA 3UANA 1B0UA 3P1JA 3U7GA 3CW2A 1KZ7B 2CE2X 2VP2A 3DMNA 4BFWA 4IKEA 2QTHA 3GEEA 5IF9A 1VCIA 1N0UA 5HKKD 3HPRA 2IS2A 4G5RA 4XSGA 1N5KA 2DY1A 1A1VA 1P73A 1Z22A 2FN4A 4L15A 2ZRMA 1OH6A 4EPRA 1MKYA 3SHFA 1YZNA 1U0LA 3SDZA 2LCFA 4XD7A 4QGFA 4D4MA 4LJAA 4EFNA 1R5BA 3FMPB 4ZIRB 3Q3JB 3ZD7A 3SJBA 1GP2A 4ZCIA 1IBRA 3K0SA 3GP8A 2FF7A 4EUNA 1MO5A 3CB4A 4UNRA 2YV5A 1TEVA 4MRNA 2QBYB 2R9VA 3AVQA 1FQKA 1OFHA 1G16A 1JR3A 2V4ZA 3AV0B 2VO1A 1Z0KA 3WBJA 2CL7X 3OF5A 4TMTA 2GBLC 5JI3E 1T8UA 1U8AA 4Q01A 3WNDA 4TZ6A 4NYMR 4FINA 1A7JA 3AQ4A 4I1VA 2FSHA 1I2MA 2WWIA 5KTYA 4BRWA 1G7TA 4LK2A 2PZGA 3BH0A 3PENA 3RS7A 2XXAB 4YC7A 2P5SA 3TH5A 2W0SA 3K9GA 3UG6A 1EESA 5DI3B 2OXRA 1MO3A 1DG1G 3GJ4A 1HURA 1G21E 4MDFA 2VSOA 2Z43A 3AF1A 3X1WA 3MAAC 1UF9A 2WJJA 4HI0E 2QZ4A 4NH0A 2ZVQX 1E99A 2WJHA 4TTPA 5JHGB 2HYIC 1VHLA 2B8WA 2IWRA 4DDUA 2Q3MA 1OXXK 4MITA 1VCNA 2O5VA 4HB0A 1KI6A 3R8CA 1WXQA 3THWB 3FHCB 4MRVA 2ATXA 4DHEA 3B78A 3MRSA 4HZUB 2E1RA 1UBGA 2XSZD 2WWYA 4HAWA 2BKUA 3EA0A 4TTRA 5KNDA 3S1AB 4B75A 4EJSC 1G7RA 2NZJA 1XPUA 2GRJA 4JLVA 3TIFA 4XWOA 3AB3A 3N2EA 4Q7KA 1W47A 4QBGB 4TN1A 3NEYA 2OAP1 1XMVA 1EFUA 5DLQC 4BZXA 4WZ6A 2ZS9A 4PC7A 3NKVA 1GKUB 3AH8A 1DOAA 1NBME 2C8VA 3AGPA 2HDNB 1FTNA 2XZPA 4JMPA 2ZRJA 1TEXA 4P3YA 1U2RA 1DAHA 4JKYA 4PQRA 3DL0A 3FVQA 5JS8A 4Z1MD 1P9NA 4DDVA 4RZXA 5HZHA 3EX7C 4LBZA 1CLUA 4ZCLA 5JCZA 3QJYA 5KSOA 2FH5B 3IBYA 1X6VA 2RGBA 1NN5A 1UKVY 1R8QA 1E9DA 1AZTA 4ZI3A 2JASA 2IYYA 5CLLA 5FR1A 5HE9A 2Y8EA 4NYJR 4OI1A 4IW3B 3ZIAD 4MYHA 4YONB 1SXJA 4TYPA 1KIMA 1M74A 2H1LA 4Q03A 4DB4A 4NYMQ 3EXAA 1CULC 1W2HA 1E2QA 2AXPA 4FMDF 4IVPA 4YXWA 3D8BA 4GMDA 2JLWA 1BIFA 3PEWA 2WWGA 4DIDA 2ZJYA 2P6RA 5K8IA 2VF7A 1F2TA 5E95A 2PX0A 5EE5B 2DFTA 4HAXA 5FFMA 1QHGA 5DNYB 2OAQ1 1N5IA 1SKQA 3G0HA 2VIIA 3PFIA 1B23P 3CWZA 3BS4A 5KHOC 2QAGC 1MR3F 1XMJA 4IOKA 2ZEJA 2ZM5A 2ZI9A 4POAA 1AJEA 4KU4A 1SHKA 3EIQA 2OCPA 5E3HA 3BD9A 1A82A 4F4JA 3U7FB 3IQXA 4RFVA 3IIMA 5TVKA 1E96A 2VQSA 4OQLA 4NKRA 4DLWA 2OFOA 2R6AA 2PEYA 3PCRB 2YOHA 2MMGA 3I1FA 3R7WB 4H1VA 1KMHA 4LYFA 4Q47A 4QRHA 3TJZA 3LY5A 1AQUA 2ZITA 4L9WA 2KBFA 3KKPA 2IHYA 3KUDA 3UWKA 3UMFA 1VECA 2QNRA 1S9DA 4F92B 5DGXA 1NMZA 1RRFA 4YMWA 1YR7A 1P60A 1G8HA 2P5TB 2CLDX 4JBYA 4DBLC 5TV2A 1GAJA 1NSFA 1XF9A 2JLXA 1S1CA 3KXIA 3NH6A 1JAHA 4Q00A 1BH2A 1HYQA 4AY2A 5ANRB 1KOFA 4HAZA 3OHMA 5FI0B 1I4DD 1G8YA 4B6FA 1T3HA 4YMSA 1XTIA 4NPHA 3QKRA 4TYQA 4RD3A 1US8A 1HEIA 4HLQB 2R6DA 2ORWA 1A2BA 3KL4A 3GLFE 4B6EA 721PA 3AGQA 4A6XA 2F9LA 3HWSA 4LJ6A 2H92A 4DLVA 4TYYA 1OV4A 3MG9A 1EK0A 2XB4A 5FBRB 1G5RA 4WXRA 2FPMA 1R8SA 1WB9A 1X8JA 3LWNA 4TYWA 1OKKA 2YVUA 4ARZB 4WOPA 4V02A 2C9YA 3IIJA 4QOSA 4W5HA 3T12A 4NBSA 3X1YA 3BXZA 2XNDA 5FPKA 1M34E 4MQBA 1W0KD 3MWKA 5HR5A 1MRSA 2QI9C 2R6GA 3QE0A 5AJYA 3KXLA 4IRUB 1TMKA 2D74A 1D8TA 2XEXA 3C14C 4TQ9A 3FB4A 5CB6A 2IT1A 3PR1A 4BFUA 2Q3HA 4HB4A 4CEJB 2CL6X 1NI3A 4Q1CA 5DN6D 5FL7A 1P2UA 3GJXC 2ZREA 1II0A 1Z06A 2QRNA 3GLGA 1P6XA 3KKOA 1NN0A 2PBRA 1BKDR 4CW7A 2ZI3A 4NMMA 1CF4A 2FFBA 2FV8A 1OXVA 5KPDA 4HUQA 3C41J 4UQOA 1W4BA 3EA5A 3RABA 1G4AE 4B71A 4DT1B 4OK3A 4RZUA 1NRJB 4KLNA 1LNZA 1VCMA 5EE9A 4CYMA 1XD2A 4MRRA 2O8FA 2GCNA 3TVTA 4TLDA 3K70B 2C2HA 2GF0A 1OIXA 3UXMA 4CGZA 4P32A 2JLQA 1OIVA 3TK1A 2J46A 1L8QA 3KJIA 3PEVA 1G7CA 1U99A 2QT0A 3EC2A 3FKSD 3QNUA 1RJ9B 3MLEA 1G20E 2V54A 4IDOA 1DG3A 1G17A 3KKMA 4D26A 3K0FA 2BOVA 3TBKA 3HPQA 4CF7A 4MKIA 4CEIA 5F9HA 1W5SA 2KBEA 2BKEA 1XTKA 3CF2A 1QHHA 4JLBA 4A2WA 1TAGA 5FPYA 1F2UA 4IDNA 1XPRA 5KDDA 2ZU0C 2O8CA 3F8TA 1ZCBA 2X2EA 4Q19A 4QNMA 1WDTA 3VKHA 1T6NA 4LV6A 1AN0A 2UZIR 2XGJA 2G3YA 2SHKA 2D4HA 4JKIA 2IS1A 1YR9A 2IXFA 4BFXA 1CR0A 3AKEA 2O8EA 1L4YA 2BMFA 1NNEA 3I73A 3U44A 3RRYA 2GJKA 3TAHA 2NO6A 4TLEA 2N46A 3AEZA 2JLUA 2VLIA 1IONA 2BM1A 2E9SA 3P32A 1G3RA 2NO7A 5FH9A 1O87A 3GFTA 4QL3A 2WKRA 4Q48A 4PPFA 4ZO4A 1WP9A 4HLCA 2KE5A 1Z28A 5IRCD 4QBHA 5HCNA 3U3OA 5BW8A 1Y63A 2GESA 4MKGA 1EG7A 1JALA 1YR6A 3O8DA 2GXSA 4LZZA 5CLQA 1X1SA 3TSOA 4TMXA 2HT6A 4QM7A 1S4QA 2W00A 4TL6A 5AJXA 5FUXA 2OESA 2A9KA 2GZAA 2W0MA 2ZIAA 4RD1A 1OJLA 1UFQA 1VDZA 4M9ZA 3B5JA 3OE7A 5IK2D 3VTKA 1GKYA 3ZIAA 1R0WA 1TUEA 4A2PA 5HKKA 4JL5A 2AHOA 3QEJA 2QORA 4Q4AA 4MYCA 1FMJA 4TYNA 5SZHB 4BRUA 1G6HA 4OHWA 4G0NA 4LY6A 2D3WA 3GQBA 1A5TA 3VAAA 1AKYA 3ZVNA 4MKFA 3L0IB 2ZRFA 2CHGA 1OHHA 4GI7A 2K5UA 1LB1B 4TMWA 2QMHA 2BJVA 1TQ6A 4BZPA 2YC2C 4XD7D 3EPHA 1KI4A 4E5UA 3BOSA 4D2IA 5LPNA 1IHUA 1QHIA 1XFAA 2IYWA 4HAVA 4TTQA 2ZTSA 1DVRA 2BMJA 1SZPA 2XNSA 3ASZA 3SEAA 1G8FA 5GJCA 5JBQA 2GDJA 1T3LA 2C78A 5H8WA 3WMEA 1TF2A 3A58B 2ZRDA 2QE7A 4V0ME 3HYTA 4F4IA 4EFLA 1U9IC 2ANCA 2XOKA 2TMKA 2CXXA 3SQWA 3RSLA 2OO7A 2DWPA 3IUYA 1NLYA 4G01B 2ZROA 4C0SA 1KI6B 3SBDA 3LW8A 4Q21A 2ZSDA 1JQLB 2Z5FA 2AWNA 1DE0A 4XTCS 4PPGA 2VYFA 4O25A 4KBGA 4BUJA 1IXZA 2ZE7A 1YR8A 3H2YA 3GLFB 3KX2A 3THYB 2ZXUA 4DCVA 5BYJA 2PZFA 5EXXA 3T5GA 1ZBDA 1RIFA 2G6BA 4US1R 5F2EA 5JEEA 3QF4A 2IS6A 3WYAA 3C16C 1M2OB 3MD0A 3A1VA 2GJ9A 3AVXA 2NOAA 5LB2A 2FSFA 4NTZA 1I2DA 3ND9A 3QXJA 3TSZA 4DLRA 4Q4JA 2ONKA 2DFNA 5AUNB 4Q18A 5HPYB 3HR8A 4BFVA 1CEEA 2F7SA 2FNAA 3E5HA 5G41A 1XEWY 4BLPA 3OE7D 1W48A 1HH4A 2B8TA 1OKKD 1S96A 1N6LA 2JJ8A 3HDTA 1E9FA 2ZYVX 3IQWA 2IYZA 1YZKA 1SKYE 1YVDA 2DWOA 4JZKA 4LC1A 2JLRA 4Z1MA 4B3DA 1UJ2A 4NCIA 1J99A 5CIWA 2VL7A 4LC0A 2P67A 5AUQA 2V9PA 2QPTA 2V6JA 5G40A 4RZ2A 3UMSA
chains in the Genus database with same CATH superfamily
5AQEA 4PLWA 2A5FA 1BMFD 2VWPA 5AKKA 3HB0A 3HVUA 4N18A 3U7RA 3NHFA 5JDIC 2W4MA 3F7NA 4PYQA 1ZVKA 1RMTA 3JYPA 3O8LA 3RNOA 3E9MA 2FU5C 5C81A 1C4OA 1G5HA 4V2UA 2PE5A 5EZ6B 2E21A 2ETVA 1VGQA 4X7BA 5FLKA 3OT1A 3VPHA 4CNQA 2KS6A 2YW2A 5D8DA 4BECA 3UBTA 3SZUA 3PR3A 3L7AA 1FYWA 1T5IA 5M3BA 3I1YA 4U0KA 2M98A 3P9YA 3VHLB 3WFZA 4DWJA 2UZ0A 4IWNA 5AICA 3UCXA 2CLHB 2VBFA 2O6HA 2Y27A 5A06A 3TZQA 2FPPB 5AJWA 4JU9A 5FBLB 4GPTA 2F62A 2HXSA 4ZO8A 2V0GA 2Q8NA 2VN8A 3BFJA 1Y8RA 3VHRA 1ZUD1 3K15A 1CQJB 1SCUB 1YZTA 3HCCA 4JJEA 4AKIA 1OGJA 3CR7A 4BAZA 2HBQA 2ZRQA 2HCTA 3ABZA 5BQOA 2XLCA 3IDOA 3Q9SA 2ID9A 3P0HA 4YO7A 4CLRB 4EL5A 3RJMA 1JWAB 2QAGA 4ER3A 3NBZC 5T5QA 1CERA 4HUTA 5ES4B 1TYCA 4DXAA 2IOYA 4JK3A 1CUYA 1D9XA 1DZ3A 5LZ2A 4MUGA 3AFMA 3KUCA 4BL5A 4TMFA 4GZ6A 5JSFA 2FZ4A 2VT6A 2DTEA 3GRKA 3LCCA 4JI1B 1VB5A 3AFIA 2FKNA 5I9BA 3UENA 1FMTA 5JJKA 4DTCA 4ZIRA 3I30X 2ZJAA 1Z5NA 1ZUNA 2HMSA 5CEFA 1XEXA 2NSDA 1P8AA 1E6EA 1CE8B 2HNAA 2Q6IA 5EIOA 5JAQA 4BGEA 4XIYA 4YUZA 3QOWA 3MOIA 2IXAA 3TAUA 2TS1A 3LCMA 5HZMA 1FJHA 2QG9A 2X0NA 5ENDA 2WHPA 1ADJA 2JW5A 4NZYA 3FJOA 1M6WA 3I04A 1ZM3A 3W2GA 2BTQB 4F1WA 1NF8A 2G9UA 3NDRA 4EJ2A 3O3OB 4F21A 4UZFA 4P6VF 2IYSA 2XVMA 5TS3A 4FYYA 3SXUB 3TNJA 2V3VA 1O9GA 3LQQA 3D8SA 4E5YA 5C1DA 1GFWA 4RQTA 4LJLA 1LPOA 4LVNA 1C30B 3GB9A 3DGFC 2XTMA 1G6KA 3ZQUA 3ILHA 1ODLA 1GGMA 4BGDA 3A3NA 4WW0A 2CDCA 2F48A 4I5IA 1Q83A 1JFFB 3K09C 4D4HA 5BMVB 3BRSA 5M5BA 2F17A 2P8JA 5C5DA 4EPVA 3SSAA 1NNUA 3VZQA 4PX2A 1M10A 5BVGB 2DBVO 2X13A 4HLUA 1FFGA 5HNKA 2FPGB 3GEGA 2RGRA 1USIA 3B6MA 4F5DA 3I05A 5K99A 4Q39A 4KXXA 1PZFA 5CM8B 2DQZA 3LWDA 1ZM9A 1O4VA 5JBNA 3Q6IA 4HNAB 4PG6A 1N4AA 5KX5A 5DSXA 4EY4A 3OZIA 4UHEA 2FPIB 4KYVA 2C59A 2R6CA 4P98A 3FI0A 4HLDA 1IHXA 5EKXA 5EQDA 4DCOA 5H70A 1TDJA 1SUFA 2B61A 4Q93A 2RHGB 3WWEA 2GHIA 2IYAA 2PD4A 3IEPA 2CNKA 3O2QB 1RZUA 2YHAA 3BH7A 1FFXB 3LQYA 2ZWPA 3R44A 4QSHA 4ZTUB 4DAEA 2H8GA 1WL8A 4XD2A 4ZRNA 3VO2A 3T61A 1GLNA 1L3CA 1MZVA 4O63O 4NP6A 1L5MA 3O82A 3BMQB 5IJ9B 4GFDA 1R6UA 1EDEA 4PSCA 5L4SA 2C77A 1OVMA 3FCYA 2FXIA 3MJEA 2WM9B 3L0CA 5LA6F 3PTLA 2DBRA 3GUHA 5JE8A 4B35A 1JW9B 3TIXB 2EYQA 4PN7A 3ZLTA 1R37A 3M82A 2H2FA 1M2NA 3PFFA 4TT3D 1CNEA 2H4XA 3E8SA 1GRRA 3PGXA 2W48A 2W71A 2QX8A 3CVJA 3FYTA 5LQUA 4II7A 3OCVA 1U8UA 1YTLA 5ILGA 4DYHA 3K9CA 1KU6A 4NYIQ 1IXYA 2V8OA 1GKLA 1IJKA 2QSYA 3IOEA 4RPKA 4Q1BA 3PP8A 1I3KA 1KERA 3DLHA 1XYGA 2XUFA 2QRHA 3JASB 3BCHA 2GN0A 4CZ2A 3UWSA 2OCBA 1IDN1 4HWSA 2OO3A 4C29A 5EIXA 1JEOA 1T4GA 2TECE 4LJ8A 1QWSA 3VJKA 3WGJA 2GZ2A 2FFAA 2ZJ4A 4C0JA 4DDKA 3U44B 1E5LA 2BMDA 2VHVA 3EWAA 5MHTA 1M2VB 3MCTA 3EUEA 3ZE6A 3Q41A 2JIMA 2H7CA 3TX6A 2W98A 3G23A 2J59A 4AXBA 3H6HA 3ET4A 2D1QA 1XTRA 2FN3A 4HXEB 3U5ZB 1QUEA 3AFNA 4R1TA 2IPMA 4RF4A 1UIRA 4BQQA 4KPEC 4PNZA 2VTEA 3HB4X 2BEKA 1PT7A 5KOYA 5IDVA 1B15A 3NIBA 5ALUA 2ZUDA 5IAOA 1GTVA 4MKXA 2AFIE 4IGIA 4MVJI 2OBLA 4PLVA 4UHJA 1MD9A 4J7CA 4BVKA 3GFSA 1NBOA 1IVNA 3RU7A 3PDUA 4E22A 2BBWA 1JQAA 2WWXA 4I3FA 4ZQEA 3VNRA 5AUOB 2GBFA 1IY2A 4YJ2A 4AKEA 2HHCA 2ATEA 1G6Q1 2QD3A 4EABA 3WSWA 1LQ2A 2XI4A 2NYRA 3CRW1 3QFTA 2CUKA 3IHTA 4FHDA 4ZQIA 5HTKA 2OBBA 2X0KA 3UF0A 4AY5A 4OMDA 4Q4CA 1XVLA 3WADA 2FCAA 3OAAD 4PLYA 1OGYA 1IEVA 2BRUA 1J1IA 1NJ8A 1Q20A 5AW3A 5K6TA 1GZ6A 3DPIA 3OVMA 1P2TA 3GGDA 4R8KA 3VR4D 2JK1A 3STYA 2FMXA 2OZVA 2P3SA 1ZJ6A 3AUUA 4UM8B 2IL1A 4Y2RA 1ANKA 4KJZA 3SLGA 1GN9A 3QOXA 1JS1X 1N5JA 2DECA 1NONA 2J0SA 2QU8A 5IHXA 5B2FA 1H8ED 2WIJA 1IMJA 2YFHA 2EW8A 3TMAA 4XDZA 2OPHA 3MUOA 3MK31 3HFJA 3JR7A 4M3NA 2IE0A 3DBHB 3TTXA 2C7VA 4GMFA 3W79A 4Z7NB 4DGSA 2REOA 1ZYUA 4LBWA 4OGFA 3LZ6A 2J9XB 1YJXA 1VL8A 1Z75A 3L04A 4G9EA 1BFDA 4FJ2A 4RLFA 5LCXA 2PGXA 4GXRA 5HSGA 3LMKA 1FTGA 3TR6A 3PT5A 2PHZA 3PDJA 3S40A 5AW2A 2ZU6A 1A5AB 4M0UA 3EZFA 1SQ6A 4US0R 3BL5A 1OV6A 3D5EA 3WLTA 2PEZA 2RG1A 5JECA 5H68A 1GJRA 4AK9A 3GUUA 4WT7A 2AWOA 4Z0HO 3W3AA 3QLVC 4QPPA 4ZVSA 5C2JB 1E0AA 3BQ9A 4DE5A 2GNAA 2GBLA 1KDZA 3B6KA 4N12A 5T4BA 4YNBA 1VTKA 3B60A 3V1KA 4MKZA 3H16A 1AD2A 4AUMA 5EZ5A 1AGYA 2VH5R 5I7OA 1UMDA 3OM9A 1UBTS 2WJVA 1RLOA 4MTCA 2XCOA 4S1PA 4Q4JB 5BW6B 5HIIA 1V9SA 3IB3A 1CUZA 4IHAA 3HVKA 4NPCA 5KBYA 3HKCB 3LLCA 3S44A 3WR5A 3WB1A 4P86A 1TD1A 1Z17A 1JIJA 3L7OA 1ZUIA 4HAIA 1JECA 3F2IA 1X7ZA 4ZAZA 2QQ5A 4D99A 2PV7A 5DYIA 2CK3D 2FZKA 4MARA 2ANBA 4KGVA 5CVJA 1W49A 3IAEA 5ELMA 4AWAA 4F93B 4YV7A 2EARA 3U7QB 1QCYA 4FP9A 1VRCA 2RH8A 2RHTA 1IH8A 2H4HA 3BKWA 3D6VA 3FPHA 5F2OA 1G3UA 1I3OA 3BJEA 1OW3B 1X87A 4KE9A 4P7JA 2V7BA 2VWHA 5MFPA 4GPBA 1QTIA 4MPJA 2WM3A 4Y9TA 2LZ0A 3PC4A 4W5WA 4ZV7A 3ZV3A 2PO7A 3KAKA 3ONWA 4QU8A 3W7VA 5HIMA 5HKAA 4NATA 2J3HA 4PTYA 3H8SA 5AVXA 1BMQA 1AT1A 1K27A 1NJSA 3HJUA 3NUGA 3WWZA 5KOHA 2FWMX 2VOJA 2C3OA 1KFCB 4REOA 2R8YA 2YHIB 3GXOA 1OD6A 1WG8A 2O1WA 3CZQA 1LNQA 3EWIA 3GJ3A 3M5DA 4MR7A 2FWRA 5LDDC 3DA8A 1R27A 1GWNA 2CUZA 4JJZA 2JKZA 4D3FA 3LSTA 1JKJA 2NPOA 4X6XA 3CONA 1OX6A 5JJIA 1JQEA 2QAIA 3D43A 1FPMA 3A0UA 3AR4A 2X1LA 5EWLB 1LF5A 1GZVA 2X3YA 3TQIA 4FGZA 1U31A 3N07A 3UPDA 4XQCA 3ZW7A 2B37A 4GXQA 1T91A 1YDFA 2ZI6A 5KPJA 3QBTA 4H7IA 4RYLA 2R1TB 3H13A 1ISHA 3WP0A 1Y3BE 3KJQA 2ZI5A 5J5AA 3DTVB 3HXMA 4KXWA 1DIBA 3HUTA 5ALJA 2N0SA 3L6UA 1TNDA 1CUAA 3VKGA 4JP5A 1STOA 5B58C 5EIEA 3IP8A 2XQGA 3BE8A 2HRDA 2BV3A 1JIQA 1GQQA 4D74A 1FBNA 3CMCO 3TB6A 1IPFA 3OPQA 1F60A 1YASA 4OJQA 4A23A 3OQHA 2DHEA 3BJRA 3JARA 4PV7A 4X93A 2AZ4A 5F1PA 5H4HA 1FBTA 1KYXA 1O95C 2VPWA 3IESA 4KUGA 3SC3A 5JXGA 2HOQA 3SBXA 1BWSA 1W35A 1I3LA 2PZ8A 1XROA 3RADC 5EMHA 5I4CA 2H7VA 3C7DB 1FTWA 1VJ1A 2JZNA 2WD9A 5JNSA 1PK9A 1SPXA 2OQRA 3RVOA 4L2IA 5F3DA 2RGCA 1JSXA 4TXLA 4B2PA 1CPYA 1RAHA 4CLEA 4ZTZB 2I9KA 1TADA 4Z3OA 5F35A 2I4OA 3V8QA 5JC8A 1D4OA 2QV7A 3KJXA 1J0XO 2B83A 3V4RA 4H7PA 1HYHA 1WMEA 2J4CA 3G7UA 4B3XA 4DA8A 3HK2A 1QH1B 2JHPA 4MUAA 4KQCA 1E79A 1VG9B 4N0MA 2Z4SA 1CDZA 3QKSB 4FNMA 4OH1A 3GJYA 3MLBA 1ZDMA 1NP7A 2AUTA 1RNLA 1NVMB 3H65A 3S70A 2Z6UA 3KSDO 5KTPA 3VZCA 5BVHA 2WIGA 4EUSA 3F6SA 1Z5GA 2UXDB 4HGZA 1VJ0A 3PEFA 4IM7A 5ESXA 2CXSA 5JO0A 1I6LA 2Q2WA 3H1PA 2CLLB 4K05A 4W99A 3EMBA 3BC1A 2EC5A 1JDBB 1V1RB 3HVHA 3E1SA 2BDTA 4JEIA 5DGHA 2IVZA 3K8OE 1RM4A 2FGKA 2V0NA 1PLLA 4P08A 1FFCA 4RC9A 4E88A 4BV8A 4MR8A 3G59A 5TPWA 2W6JA 2VTKA 2RKBA 3BF7A 1L1RA 3P0RA 3TKLA 3LE8A 3ESCA 4BNZA 2RGEA 2PT9A 5K3BA 3KZ1E 4MQ5A 5KAMA 4ZT3A 3T3IA 1VPLA 3H3JA 1R5NA 4A8HA 1IL0A 4X62B 2JPDA 1K1EA 4DF3A 3NFYA 5GIOE 3PT9A 5CURA 3WLFA 3E8MA 2VP6A 3BIFA 1L4KA 1NVTA 1MP0A 3D7LA 4MUIA 4PVCA 5HFAA 3WRVA 1N8NA 1SBIA 1SXJC 1QE3A 2ACEA 3VC2A 1Z9BA 2PX3A 1OF1A 1DEOA 1U7OA 2FUG1 3W4IA 4PG7A 3BGIA 2ZUUA 3TN7A 3G2LA 2GJ8A 2XVYA 1B93A 1J90A 4XGKA 3VYRB 3DDCA 1BJRE 5JZSA 3U4DA 3BMXA 2GJSA 2FK7A 4B44A 3JQ9A 5FYDA 1UZLA 4UXHA 4YN3A 4ARSA 4W7HA 4KBFA 1NJFA 4XJVA 2JAPA 3OUUA 5I9TA 4B7CA 3EVNA 1ORTA 4HDQB 5KQRA 5LOVA 4BLSA 1X7XB 2OBMA 4KKVA 3FNRA 1TU3A 2QXYA 1MJ5A 4V0MA 2NNLD 5TQ2B 1U0SY 1ZVMA 3SMVA 2G8NA 1R12A 5KI6A 2QE6A 4NOLA 4PWZA 3RTBA 3AVYA 3ZCXA 3DUFB 3S4YA 4XFJA 4DCNA 2O2YA 1N7HA 2C9MA 2Y1KA 1PJAA 1IQPA 2PZJA 3C6MA 1J2YA 1FXWF 2G80A 2XA2A 4L76A 2YVAA 2VDWA 4FN5A 5BWBA 2SICE 4H1HA 4AMGA 1NY6A 4M98A 4EI8A 4YAEA 1RPAA 1T2UA 2E7ZA 1IEWA 2YXEA 1IZ9A 3G82C 2C5EA 4TTIA 1KK1A 1YB4A 4LMPA 1YZQA 4RS3A 3VX4A 4BP8A 1TLFA 3HTXA 1LK0A 3T34A 5ARBA 5EMNA 2GEFA 1S2NA 2GI4A 4Q1AA 3I37X 3SHTA 2EFDB 2HJGA 3WRWA 5AKLA 2ZETA 3CX6A 2V5AA 3RROA 3C6BA 4JGBA 3VH3A 4EVIA 2DR0A 3EY9A 2I2WA 2JGNA 4P4SB 4QRDA 3TB4A 2RKWA 5JH7F 2P65A 5EZYB 2G06A 3DAOA 4G1MB 4TSKA 5DHSA 1UPTA 4Y2VA 5SYMA 4AG5A 2EQBA 2XCLA 3KP1A 2EHJA 3A9SA 5FUYA 2G1AA 1POXA 2AL7A 2ZRKA 1U9YA 3L4BC 3DTVD 5JROA 2VSQA 5BN3A 1G55A 1X7HA 1F0PA 1B2RA 4YI3A 3PRJA 4B85A 1V37A 5A4IS 3T06B 2A92A 3L6OO 5HKLA 1V71A 1YONA 3G2JA 4IUCS 3AKDA 4DLUA 4A5OA 3E82A 1URPA 1DU4A 1FNNA 1W94A 3IBCA 1NUHA 5REQA 4HN9A 4LJYA 1L1FA 5ELXA 3ZJ4A 1IXSB 1YZLA 1SXPA 2NAFA 2OFXA 1IBLB 2A9RA 1XQWA 1S2LA 3ZU2A 3W04A 1DIRA 3P5SA 5HMMA 1CRWG 4WLNA 2Q1WA 3C4JA 5CDFA 3OQVA 4MRMA 2LVBA 1LDBA 5AJHA 4HR7A 4I8DA 3K71B 1KVSA 3RFUA 1SD2A 1N25A 3OTGA 2WMNB 3NHMA 4B4VA 2YQ5A 3BDAA 4DJAA 3SICE 4WQMA 2QDKA 4ARUA 5HCIA 3SP1A 2ZT7A 4IDQA 1MB9A 4PSUA 3HADA 2J5QA 3QTTA 4HYYA 3SE7A 2W2VA 4DG8A 1IIBA 2GCPA 1EUDB 2J0VA 3EFBA 2P79A 3D8RA 2OXIA 2IYOA 4HNSA 5M2QA 3VZRA 4LWOA 4R6WA 2PUHA 3R4CA 2EATA 1NNSA 4IAOA 3KB2A 5FPHA 2ILVA 1O3YA 2J4DA 3GDHA 5FBWB 4CLRA 4W1PA 2W37A 5DNWA 1PSZA 1E2DA 3G49A 3RK4A 1DX9A 3QENA 4DSAA 4RGYA 4LSGA 2AJBA 1JJIA 5LD2B 5JWRA 2C0CA 4UM7A 3A70A 2A9OA 2GTPA 2C54A 3GEHA 2C5AA 3QV2A 4MROA 2ZGVA 4HH0A 1TKBA 2QN6A 4G5OA 1EDBA 2Q1YA 1X0VA 1CUSA 5CAEB 3AESB 2HDOA 1II8A 4JGGA 2LGJA 4UNPA 5AHWA 1AQLA 4FFDA 2C8KA 2XYGA 1AM4D 2Y4NA 3QE4A 4BLVA 2GBIA 5EIHA 1JWBB 3ZCVA 3AT1A 4GI3A 1ZA2A 1O5TA 4OYHA 1SVLA 4DJ5X 2ZJ2A 3UQYS 1UCFA 3AMVA 3DYBA 3N9IA 1CHDA 1Z6GA 4KEAA 2CNLA 3AVTA 1JBKA 2PL3A 4KNVA 4ZAGA 5JCPA 4IFIA 3JZMA 4U5XA 1ODTC 3EZ2A 2GD1O 2ZK7A 4F97A 4LMBA 5I7AA 4RJKA 2JFOA 1FNMA 1U2DA 2PWZA 2JIZA 2V7WA 3HFSA 5GM2A 5J2TF 3GEPA 2B21A 5T3UA 4AMUA 2FPOA 2YOFA 5EJ8A 1WW8A 2B30A 3LFHA 1RRVA 1Z7GA 3TCXB 3C6XA 4FC6A 4D9BA 1GL9B 3D6AA 3SIPA 2Z3WA 3KLNA 5AM2A 4FYMA 2J3IA 2V4MA 4N39A 3VSCA 1YFJA 2JFBA 3D3QA 2ONCA 3LQRA 5FD8A 4FM9A 1FFAA 3FYSA 1NYLA 1XJCA 3JZFA 4IIFA 2X5KO 4EEZA 5EJ2A 3BERA 3HZHA 4L07A 4WVFA 4FLFA 1IHYA 3K9WA 1DXYA 3KQTA 1UQRA 3ON5A 1AXGA 3P9QA 4OBXA 2X9QA 4A8JC 3HXKA 1RAFA 2PRIA 3EW9A 4LDQA 2X1HA 5D5PA 1KORA 2C84A 3C6ZA 3KG2A 5LQSA 4TN5A 2GLUA 5IAKA 2IVFA 1QANA 3EN0A 2ZUTA 1P4HA 2REBA 5KSPA 3IAFA 1QOPB 2X0EA 4R2MA 3X2EA 2FWJA 2D06A 3EEQA 2BW0A 1F0YA 4CIDA 3T1HB 4L4UA 4PLGA 2YWXA 2JAUA 3BDVA 1G5QA 3B7WA 1E77A 2OCYC 4LHVA 4V1CI 4RS4A 4C6TA 4U1RA 3BB1A 3TDMA 1SWWA 3IEIA 1C2TA 1N5DA 2X8BA 4GNRA 4RF3A 1RQGA 3LV8A 5DKFA 1APBA 2NVWA 2PSFA 3GGSA 1U9ZA 3H5LA 3JQAA 1PS9A 2FCRA 2NYUA 3Q85A 1ZN7A 2KI5A 4FHZA 1A8PA 2II6A 4GBED 4TROA 2IV3A 2Q2OA 4IUDS 3P8ZA 4ZOAA 3IBFA 4DREA 1HT1E 3IHWA 5J40A 2VT3A 4TQGA 4RXTA 1PZHA 3AEKA 5DLPA 1I7PA 3EXHC 3PGKA 3QUSA 1ZVQA 4H3SA 4MS3A 1NVGA 4QASA 3T7SA 1ZZEA 2JJ1D 5C8ZA 3JQCA 4TS1A 4E5NA 2IC5A 1ADYA 2OR3A 3FOAA 4OLHA 3CKLA 3WHKA 1D5CA 4RE6A 3TEMA 3W6UA 1XBTA 5JAUA 3TG8A 5LYYA 2Q3BA 4TMYA 4YVFA 3RYIB 3O7WA 4RTLA 1EZZA 2G25A 2ZTVA 3D4LA 1AZLA 5K8TA 5E7JA 3ETEA 4RFSA 3TWOA 1M2VA 2BF4A 3FZNA 4F04A 5A2QA 2VCEA 4FMDB 1CUDA 1P1FA 3RVSA 1ETHA 3CKMA 1JA1A 1EEXB 4URZR 1RXIA 4FQ7A 3OEED 4PHHA 1S89A 4W5JA 1LC0A 3F49S 3MUEA 1Z4NA 1DWOA 3H11B 4GG1A 4I36A 1M2HA 3OETA 2YASA 3DOUA 4HHEA 4PICA 1UPBA 2HZ7A 2QBYB 3HO1A 5FFNA 2R00C 1U8CB 2J48A 2VG8A 3SX4A 4Z4QA 3L0DA 2LIPA 1IDOA 2HF2A 4IHJF 2DQ4A 3CR8A 1BFUA 1SOWA 4CRWB 3DV9A 5B7GA 2YMLA 5AW7A 5IT4A 1AKQA 2XYHA 4N1AA 3TQHA 2VT2A 2PG3A 1OY1A 5I3CA 1XQXA 4N47A 2JC3A 3G88A 4R84A 4F3YA 1KY2A 2PKCA 3FPFA 1I5EA 1SBHA 3T1TA 2NVUA 1C9NA 4LJSA 1J70A 2IBMA 2P0AA 3GFOA 1FVXA 5E9JA 4B76A 4G0XA 1E5QA 1OXBB 2P9CA 5GY7A 2JEYA 1PDOA 5HA5A 3TOXA 4D1YA 1E1NA 3WGLA 5BNWA 3U4QB 1P9OA 2VK8A 3QQPA 2E4YA 1FU4A 5ELLA 2QHXA 3E7PA 2FY8A 3W1WA 3GLIB 4EPTA 5D3MA 3VSDA 1XJ0A 3R76A 1PT9A 2FEKA 1IOWA 3JQ6A 1X1EA 2GA8A 2C5SA 2B82A 2EF0A 2QRKA 2G0NA 2WJ6A 3LNTA 4OHXA 3T0GA 1UDXA 3UJDA 1VDMA 2IIBA 4F96A 4AURA 1KJJA 2OLKA 1J0EA 2P2SA 4IIYA 1BDMA 3TEJA 2BCJQ 3VR5H 4CM5A 3ABQB 4M0PA 4TZKA 3FF4A 4OK6A 5E6SB 3AZPA 2QN7A 2J32A 1JZQA 3K1TA 4B87A 5DN6A 2AYZA 3T9BA 4DQLA 5E7MA 5JOQA 4MP3A 2XWJI 2XMPA 3DBIA 1WB5A 3IV7A 4GZ3A 3GOQA 4PVDA 3FHTA 4QA9A 1XNRB 1P61B 2IPNA 4EELA 3U7HB 2P4QA 2CUTA 3OZ7A 5A2GA 3DZ8A 2HHHB 1LW7A 2YS7A 2H3HA 3ETGA 1AGNA 4F3TA 2B94A 2F8TA 1RSZA 2AFHE 2IDKA 2JD2A 3FFBA 4IF6A 4BVBA 4C6RA 4EJFA 3H4MA 4V3CA 2F1JA 1QTRA 2X8LA 3VSBA 1CUHA 4H3KB 1G9XA 5CVVA 1OROA 2W8BA 3T1QA 2WZQA 1YOVA 1PF7E 2A5DA 2QD1A 2E4UA 2PXAA 1J21A 3T35A 5B2ZA 1YK1A 1GXSB 4J8PA 1U3GA 1WZEA 3MJSA 4D6YA 1PNTA 1L4UA 3KOYA 2BKXA 5BSKA 5TT0A 3EAQA 3H87A 2D62A 1TMGE 2X8AA 1BE8A 5FNVA 1YDWA 4O0MA 3E4CA 1G5FA 1I13A 1HLFA 3L0PA 1HYBA 4WLEA 2OORA 4M54A 4XIFA 5HK9A 3IUMA 2EGHA 1SPBS 2IV7A 5C0OE 5GADl 1R50A 4OCZA 2UUCB 4FMBB 1KAMA 4MVWA 4ND8B 2HCRA 4NNOA 1RR6A 4B2LA 4BMVA 5BSHA 1ECFA 4WKCA 4AP6A 3HA5A 3FB1A 3H19A 1Y80A 3UOAB 4ZD6A 4CETA 3ZWVA 2FWNA 4ON9A 3UPTA 1DQRA 4DCTA 1Z6PA 3IC5A 4GLLA 3F78A 3O91A 3U1BA 2R47A 3JVVA 3QVOA 5AVRA 2F43A 1JIKA 1GFIA 1W2WB 2R68A 3G8AA 4MUXA 1DV1A 4MIEA 4KX5A 1V35A 4WNIA 3NWEA 1H1LB 4OI4A 4QJ5A 4EI9A 1FS6A 3E5RA 2I1LA 3DYIA 4GOMD 4YJ3B 1J7JA 5K8UA 3T4UA 4FHFA 5IBRA 3QPWA 2BONA 3TLEA 4DMMA 2NSHA 3HFGA 1E0JA 1I4WA 3F6RA 3RLFA 3O8CA 5I6DA 4PIVA 4TV9F 4ZFNA 1P44A 1DO2A 3GEIA 5ALEA 1V11A 1KZ1A 1DX6A 1G21B 3BAFA 4MR9B 4P4GA 3WY9A 3VI3B 5JAMA 1DQZA 2VF4X 3D8TA 1ZC4A 5DM60 4N6OA 1ODFA 1BD4A 2AXQA 2NTYC 1GRQA 3GWZA 3CKKA 4HZGA 3TCNA 1U1IA 3K0CC 4NCXA 1JZSA 3IP5A 4OMUA 3TEFA 4RO0A 5AXAA 2G5GX 3EFEA 3THSA 4RA6A 5M29A 2GOYA 5HYVA 4TZ0A 2ZE5A 1FXSA 4LYGA 2HWXA 5FO0A 1NVUQ 4C0HA 1SAYA 3R7BA 2C3PA 3D2BA 1E20A 1M6YA 1V26A 2JGIA 1T0HB 2XDAA 2FW1A 3E3AA 1W75A 2Q5IA 1E9SA 1KY3A 2B4TO 3PHBE 2A1IA 2ZDQA 5IN5A 2DSNA 4TLCA 1HQKA 1QP8A 1OWNA 2QD4A 4TKLA 2W43A 3DVAB 4LAFA 4PLHA 5ALWA 1C9DB 1YMQA 3CLTC 3VNQA 3W4KA 4AKTA 3V4PB 3O26A 1XMOB 1DXOA 4UREA 2DETA 2XF2A 4ALIA 3IMCA 4EQ6A 1DUIA 4JLWA 5EE3A 5B6IA 4AULA 3B8HA 5L3SA 2RAUA 2AMFA 2D54A 3CIFA 1GZ4A 1EBBA 3OOHA 4O0LA 5JS2A 5JNRA 3AB8A 1LX6A 3QKSA 3R5SA 3N5KA 4R2HA 3U09A 1KSHA 2X3UA 4X20A 3UMYA 3D0KA 3QVGA 2BEWA 3TZHA 4YACA 1QHXA 2OCGA 2ZVJA 1HK7A 5CFPA 4ENWA 3SM9A 3ZIUA 4C0BA 2NTVA 3IPRA 2CYBA 2KW5A 2FUG6 2XSZA 3F1KA 4IOJA 1HT2E 3DTTA 2VXOA 3E5NA 3EUFA 3BXEA 4EKYA 1NMQA 1C7IA 1V1RA 4J9UE 3FKJA 3AI7A 2NU8A 1ZO8A 3HBMA 3HACA 5GV8A 1JE1A 3RWMB 4HV4A 3KTAB 2CDAA 3ZVRA 2QL5A 3G5UA 4MR8B 1DCMA 5TPWB 4ENUA 3BHIA 3FROA 1DTSA 3A9RA 3EAFA 4UXIA 5CLIA 2J0UB 3ITDA 1L8AA 3INNA 8ATCA 1ABBA 1O8CA 3OOSA 3A1SA 5DBIA 5IVIA 1E63A 1N6IA 2QW8A 1FS4A 4GPD1 1BG6A 4MCHA 4RHCA 4YEDA 2WD7B 3KQUA 4PSAA 1QGUB 1UOQA 4M1WA 3W6PA 1CUEA 1FNDA 1Z2OX 1ZSVA 2R66A 2VHYA 5ALNA 5E9WA 4D9MA 3KB6A 3CEPB 2DPLA 3A9VA 4X92A 3QHQA 2H2HA 1EM8A 5HK8A 3NYIA 4JELA 4LTDA 3WK8A 4BE4A 4ZJYA 2VS1A 1P1KA 1JNYA 2EZ9A 3DXYA 4IVNA 2O7SA 1FRFS 4XX0B 1MVOA 5HQ3A 2CSXA 1WA5A 4Q6WA 3MWDB 5F98A 3GELA 4GMKA 1VE5A 5JZOA 1XJWA 1KMCA 4PS0A 4JI2B 1H9BA 2PWYA 3ILSA 3A3KA 1I2BA 4JS0A 4YGXB 5LWHA 3LWZA 2H07A 1O5IA 3FCOA 3P9PA 3TGWA 2FJPA 1N6OA 1IN8A 1O03A 1ZESA 3OPNA 1FP6A 4Q9LA 2DQSA 1GCAA 3KTOA 2MCFA 1X7YA 1RCUA 3OHPA 1XZFA 3UOWA 2O8NA 2PWPA 2Z4TA 4AXXA 3PC6A 4KXLA 1WUHS 3C3XA 3VYUB 3LO5A 2AFVA 2C04A 3PIIA 1SQGA 3FNFA 4KGZA 1ZIOA 2LE0A 5B3AA 3U7EB 5K6AA 2QI9F 4EG5A 3PDWA 3W3AH 2C2GA 3QKTA 5CLHA 3C1AA 1E2JA 4BPRA 5EYPB 4Y6RA 2A8YA 1UKCA 2WUEA 3H9JA 5EINA 2WYIA 4FGKA 3C2QA 3SAJA 3WGGA 4M1MA 2XW6A 3HXPA 3INTA 4Q3KA 4OHZA 2HLDA 4HQFA 4EECA 3KC2A 4OYRA 2QVGA 3OFNA 4C5CA 4EA8A 1ZD1A 1J9EA 3EG9B 4BLWA 4ZYZA 3ZTTA 1KP2A 3VDNB 2C7QA 1O0SA 4NI5A 2ZTUA 3DPSA 3NTLA 4N3NA 3IQGX 1Q50A 2XCRB 1DAKA 1UP4A 1UOOA 5JYDA 1B3RA 1Q0SA 2Q9UA 2R1ZA 2FXVA 4L9RA 2ZS7A 3AXSA 3DP9A 2BE7A 3U9LA 3R09A 3TVYA 3FTFA 3MTQA 3PCTA 3N74A 4H08A 1Y4DE 2ZOSA 4RKRA 1P6UA 1YIDA 1C8BA 1JB1A 4WXHA 3ZHUA 4BNJA 5F7XA 4CLOB 2ORVA 1Z0ZA 2EL9A 5FPTA 1F12A 4L3VA 5GV7A 1A77A 1I5OA 3P0IA 1GSHA 2H0RA 3L93A 4GQBA 1E60A 4LMAA 5IANA 1EUCB 2OKCA 3ORSA 4B7UA 3EYWA 1DKUA 1KO8A 4JSYA 1X94A 4R8VA 4CN9A 5LYJF 2WJIA 3G17A 2J31A 2HEIA 4MUMA 2WF6A 4N8SA 1T25A 3T38A 3LLSA 4DNXA 2QUKA 3DDSA 1SKMA 3ZE7A 1GDHA 3QEKA 4EB3A 1RXUA 1P2VA 2OILA 4DV3B 1DEKA 4BFSA 1H42A 3TUZC 3T4XA 3W6NA 1UPUA 4KPUA 4O4JA 1UDBA 4TL8A 5A4FS 3OIDA 2B36A 1EUDA 4R2XA 4JN6B 6Q21A 1I7DA 4PFSA 5BXQC 5DO9A 4CM4A 1QG2A 1RM0A 2BSQA 2NV6A 2BM0A 4F5YA 1FFWA 3WJ7A 1Y1QA 2WSIA 3A6ZA 4JQYA 3T15A 1N6PA 1GUAA 2YYYA 5GGYA 4IICA 5BT9A 2CZGA 3AM1A 4FUTA 4J6FA 4ESOA 3B52X 3RSHA 4XW2A 2RKOA 1GITA 3OZSA 5H81A 5KTTA 1ZKDA 4JUIA 3SS7X 1KZ9A 1U9IA 2H63A 3QBVA 4ZOCA 1FXWA 3D6NB 2HWKA 1QK4A 3WS7A 2BFDB 2F1RA 3STWA 3ZQJA 3EAGA 3DBRB 4NXMB 4L5AA 1QYVA 1XLTC 2XB9A 2FMFA 4HWRA 4YA6A 5G0UA 3UHOA 5LMZA 1ZMRA 1GSAA 3C8UA 2WJZB 2NZUG 2I6UA 3GRVA 3PX2A 4R9NA 3FCEA 1II8B 4F5EA 5JHHB 4HUJA 4DV6B 2J67A 3E05A 4CV3A 5FPPA 3F5FA 1AGPA 2Q1TA 1KJNA 5CHYA 1GZHB 5E7QA 4LK3A 4ECEA 5KYKA 4ZI7A 1CUBA 1WWKA 4Z5XA 9GPBA 3MJTA 4NS4A 3BK1A 3OICA 2PJZA 1XYYA 3P2KA 4QTUB 3M6MD 5JXWA 3NQ41 4IFEA 4E94A 1DAEA 1D1TA 3DT9A 3SFTA 4G41A 4AP9A 1M76A 1EE2A 4NEHB 2YNMD 1G8KA 1QYRA 3I5MA 5DLEA 1PFWA 4FEEA 5C4GB 1TJ3A 2J33A 5IYZF 3S8YA 3PUIA 4U7FA 5DV9A 3B9QA 1O6BA 1OZ0A 5B1DA 1UBSB 4GI1A 1BHJA 4M0EA 4CCSA 1YQDA 4O4IF 4Q02A 4HB2A 1JEJA 5J4VA 1RYFA 4RY9A 4PANA 2QL7A 4CPDA 3F73A 3U39A 1FSZA 1RFGE 2OGZA 5AK6A 1JNXX 1WZCA 1Q22A 1V47A 1MB0A 2BC9A 1RHJA 4J9VA 5K1ZA 5IKOA 4DLPA 3HCAA 1KI1A 1ULBA 1XVTA 2AOUA 2OUKA 3TRKA 4BO0A 2QZZA 3BSFA 1BX0A 1H05A 3HRKA 621PA 2PH3A 3CH7A 3ZWCA 4DADA 2ZYDA 3REOA 1UWVA 5SZKB 1E6UA 3KSBC 3I4LA 2VDKB 3GLIA 4J76A 5ALRA 1RLJA 1YIAA 1WRBA 3EC1A 4DZRA 3ZVKA 4PNPA 2PFSA 4NJOA 2V58A 2IU4A 1X1DA 4UCXA 1B6TA 2IPAB 2JIZD 2M32A 4KWEA 2Z56A 1E2LA 2EZTA 5FOTA 2H2DA 4C0KA 5L7WA 4WK4B 1NC1A 3ICEA 3C3WA 4G24A 3B36A 1KWGA 4ZVOA 1GPNA 2NGRA 4R81A 4JBNA 4N4AA 3PQ4A 3VJMA 3W3ZB 4UAVA 3KETA 2QIOA 1DBQA 1TA0A 4JVNA 3D3WB 1TFUA 2EW1A 3CWCA 4WNYA 5HTOA 5EGSA 3SYLA 3UKJA 2XB6A 2YZ7A 3O9VA 2AVNA 2B78A 2FDRA 1PFQA 3Q5EA 2YWBA 4P0TA 2IF0A 3NNSA 4TYMA 1H2FA 4YAOA 3RYHA 1U5AA 1Y6FA 2P2CA 2ZE8A 1QLJA 3FMFA 4OFWA 4DCUA 3R6GA 3BFKA 3H9CA 2MSNA 4EG4A 1LLCA 1RIIA 1IK6A 2JEOA 5EE1A 2QN1A 2MT9A 2WMOB 3QHPA 1SUEA 1VL5A 1ZGBA 5B53A 3ZS9A 3KT8A 1R0RE 2R2AA 4MQ4A 3TGPA 3BQMB 3H9GA 4URXR 1JAIA 3NBUA 1FUIA 3VU0A 1SMKA 2ZRPA 4RFSB 1K8ZB 5KVQA 3IO5A 2VYQA 3LBNA 3HEAA 3NT2A 4YI5A 4J2HA 1CJBA 4GPZA 4QPDA 5HGJA 2OCLA 3G2QA 3TLCA 4B32A 4BFCA 5K8JB 3RBZA 3W34A 4HT3B 3WB9A 5DBOA 3SYRA 1QWOA 1VRWA 4PCLA 3TLXA 4QLBA 1Z5VA 2PT5A 2Y05A 1VJ5A 4NCJA 4X1OA 3T52A 2GD6A 1ZI6A 3VZSA 2PUCA 2QSJA 2JCXA 2CHFA 4X7PA 2XAAA 1P7ZA 3BDIA 3G0GA 2ZIUB 1KNXA 1UBNA 1EVQA 2ODTX 2PH5A 4MYRA