2ASEA

Nmr structure of the f28l mutant of cdc42hs
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
178
structure length
178
Chain Sequence
b'MQTIKCVVVGDGAVGKTCLLISYTTNKLPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division control protein 42 homolog
publication title Solution Structure of an Oncogenic Mutant of Cdc42Hs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 18
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2005-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2aseA00
1G7CA 1G291 1WDTA 1XMSA 5DHFA 3B60A 1TF7A 2BDTA 1YJ5A 2BIFA 4HAZA 1FX0B 4JL8A 2CL6X 2YJTD 3EZ9A 5K8LA 4B32A 2VHJA 3CWQA 2WV9A 2XZOA 4LV6A 1HEIA 3SJBA 1KK2A 1NMZA 1G1MA 1Z08A 2YVUA 2O8FB 2B21A 3BERA 4NU0A 3X1WA 4Q1BA 2K5UA 5CB6A 3U61B 1B23P 2EYUA 1E0KA 1C1YA 1VG1A 2IYTA 2VEDA 3L8YA 4QJ4A 5FUYA 4DUGD 1CJVC 4UNNA 2AHOA 3IBYA 5SZKB 4GP6A 3L0IB 2IYRA 3AUYA 1DADA 4Q4AA 3R7WA 1SKQA 1SVOA 1KTVA 3GLIA 1Q3HA 2OCAA 3EC2A 4PQFA 2B92A 3L82B 4G5QA 1XEWY 3I1FA 5GJCA 2FSHA 2V7QD 1YE8A 3IO5A 4M8NE 1MO6A 2IEYA 1YU9A 3EPLA 1X8LA 3H86A 1KI8A 1CF4A 1W5TA 2Z83A 1XJCA 3FFAA 5EXPA 3I62A 2ODBA 3LO5A 1XZQA 3CLVA 3WHLA 3SQXA 1KK1A 4A36A 3L43A 2FWRA 4CGZA 4BEJA 3D31A 1N6IA 1RRFA 1Z29A 3G5UA 1KI2A 4MRPA 4TMXA 5EUQB 4TLDA 5BQ5A 2CLCX 1KI7A 3GJ6A 3DKVA 5BYKA 5KO2A 2VP5A 1W0KD 1KDOA 4KI0A 3A4LA 4DSOA 4Q03A 2H17A 2OG2A 5JECA 3B8HA 3A37A 2ZITA 2BCJQ 4JSYA 2H1LA 3EPJA 2QTHA 3THYB 1G17A 3THWB 3GLFB 1F60A 2GAAA 3NXSA 4X8HA 3UMFA 2Z43A 3SFVA 4PO1A 3GLHA 3RLFA 2QRNA 5FTNA 4OJQA 1IONA 4OJKA 1IJFA 2MMGA 5JMTA 3M6AA 2RGBA 3ADBA 1MKYA 1GM5A 4WIAA 4UNQA 4RFVA 1RZ3A 3PQCA 4PPFA 8OHMA 2DY1A 3EAQA 3MJHA 4MYCA 5DN6A 1Z22A 5HCIA 2LCFA 4IVQA 5TMPA 1XU4A 5JSZA 2ZI4A 1W2GA 2RB4A 3QPVA 1Q1ZA 2CBZA 4PC2A 1XEFA 2XNSA 2ZUBA 1L2TA 1G3MA 3GJ7A 2V4ZA 2OILA 4LYHA 5BWMA 2C04A 3U7HB 1A7JA 3VKHA 4PHFA 1FZQA 5A0FA 3GMTA 2P5SA 4Q1EA 4BQSA 3PJRA 3THXA 2ZRHA 4QGAA 2O5VA 1E1QA 1WRBA 2NG1A 2QQ0A 4PQYA 1ANKA 4I1VA 2IK8A 3U3RA 5FOWA 1GAJA 5L3QA 1DTSA 1JAHA 2DWQA 5J4YA 1GL7A 3C5CA 1CR2A 3EWAA 4LJ7A 4TL8A 3WBKA 3L8ZA 2JJ2D 4GRAA 2JGNA 2F6RA 3GP8A 3Q3JB 1N0UA 4B6FA 2P5TB 3LWNA 3OZXA 1YR7A 2MMCA 3ZVRA 1NI3A 3EIHA 3SJZA 1KMHA 3VR4A 1OH6A 2GVZC 1FFHA 2WWXA 3KKQA 2ZSEA 2DB3A 4IFBA 3IPXA 4I1SA 1NN5A 5FBQB 5KYKA 3MUFA 4B3CA 4FMBB 3IHWA 2BM0A 1P9NA 1XXHA 2XNDA 2R6FA 2YWGA 1Z3IX 4HAVA 4MGIR 2D2FA 3PR1A 4JJKA 4XVUA 1VECA 4D4JA 4M1TA 3R8CA 1E2NA 3BAFA 2GZDA 4PANA 4EPYA 2ZRIA 4LYJA 4RD6A 3T1TA 2RGDA 1U98A 1QF9A 2V6JA 3CRRA 2F1JA 2GAOA 3AP3A 4NCKA 5JS8A 2QENA 1ZYUA 1XP8A 3P1JA 4IDNA 1BIFA 1Q3TA 2KE5A 2YHSA 5GVRA 1Z0DA 3GJ3A 1HV8A 2CEAA 2ZPTX 4MQBA 1C4OA 2ZR0A 1SVSA 4DIDA 2ZR7A 4ACAA 1A4RA 4GFDA 1ZU5A 1XTIA 4B76A 4JIMA 2QBYA 4OI4A 1Q12A 1NJFA 4PAOA 1C9KA 1HTWA 2J0SA 2YOFA 2ZUCA 2ONKA 4KVAA 1SVWA 4QM6A 3K0SA 1RW4A 2VHQA 3IILA 1CKEA 1R0WA 2BM1A 2JJ1D 3OEHA 4G5SA 2C9OA 3K0EA 4HUQA 3DMNA 4G3XA 2EU8A 2ZUDA 3FPAA 5CYOA 2ZJOA 4DEYA 3IIJA 1N25A 1W36B 2BBOA 5JCZA 1PLJA 3Q7PA 3J81k 1TQDA 3GJ4A 2Z5FA 1G8GA 2ZRCA 3UIEA 4Q4AB 1JECA 4C2UA 3PUVA 1ZMXA 3HPRA 4QHSA 4ZDWA 4KAXA 4ON9A 2VP9A 4HSEA 4O0MA 1YZKA 4BZQA 3B1YA 4JLNA 3ZVNA 4QBHA 1LF0A 5UKDA 4TTPA 1YZLA 5C4GB 1VHTA 1JEDA 3QE0A 4EFLA 4HLDA 2ZI7A 4YMSA 1P3JA 1X8JA 4N1AA 4Z1MA 4ESHA 1ZNXA 1U0LA 4CIDA 1W4BA 3KFXA 1G41A 4ZKEA 1NP6A 1HQCA 1X86B 4HAUA 4I81A 1JALA 3C8UA 4AY2A 1W47A 3WRYC 4KU4A 1I4LD 3U3OA 4LJ9A 3TGPA 1R5OA 1DO2A 2C78A 5F98A 4DLZA 3RS3A 3RSLA 2CMKA 1KDPA 2BEKA 1N6RA 1ZD8A 4UNSA 1NMYA 1YKSA 3AGPA 1E0SA 1MO5A 5E7JA 3ZZUA 1IN7A 5EP3A 4H1UA 4MGYR 1U8YA 3MWLA 3QJYA 2B7BA 3NC0C 3T35A 3MWKA 4B71A 1VG0B 5BN4A 1T9HA 5AJXA 3CWZA 3DKPA 5EZ5A 2VH5R 3GLHB 1FL9A 1G6OA 1N0WA 4JL6A 2IS6A 3D8BA 4A0FA 4ZDKA 1N6PA 4P31A 2FPKA 4PHGA 1FP6A 2EFEB 2NPFA 2XITA 3EA5A 5EJEA 1JAIA 4MH0R 5JSZB 2ZYUX 3UWOA 2JDIA 4HZUA 1U0HC 4L9SA 1DEKA 4FWTA 3MCAA 5CJ2A 1T0JB 1LS1A 2GA8A 3K9NA 2I1VB 1SXJA 3T06B 1TU4A 1SULA 1H8EA 3OHMA 2QSYA 4FCTA 2ZRMA 4TQAA 4IVPA 4MRRA 2IW3A 4UXJA 2DWPA 3FHTA 2CHGA 5KOYA 5EXSA 2PZEA 2RGGA 1RE0A 3AP1A 4OQNA 3THXB 2G88A 5B2ZA 1OYWA 2DWOA 1OFIA 2ZE6A 1X1RA 2OESA 4II7A 4NCHA 4Q47A 3REFA 5L3QB 3PEWA 3FDIA 1R8QA 2WJIA 2AN9A 1KYIA 4M1WA 4MGZR 5TY0A 2F3TA 1IBRA 3BC1A 2QZ4A 5J4LA 2BHRA 4BE7B 2ZRLA 3NC1C 5H8WA 2GXSA 3WMEA 4N3NA 1T6NA 4KYUA 1A5TA 4HDQB 5DISB 1KGDA 5DIFA 4LYFA 2D4HA 4JZKA 3RRYA 2X1VA 3VR3A 2JAQA 4LHVA 4GDFA 3QXCA 1XD8A 2HCBA 2CVHA 5HE9A 5JJIA 3PUXA 3U3JA 1XCPA 3A1SA 1Q21A 4QM7A 1WMSA 1ZM2A 4RZ2A 1ZVQA 1S8FA 4XOIA 4PX9A 1YZUA 1KO5A 3OE7A 1D5CA 1PJRA 4EFMA 1PUIA 4OHWA 2FNAA 3FGNA 2ZAOA 2GKSA 3K8YA 3SJAA 3VR6A 3QUSA 4MRSA 3RS7A 3W6OA 2FSIA 4DDTA 2FN4A 3K1JA 2GXQA 1YR6A 3OEED 2CCKA 3OFNA 3B9PA 5H68A 5L3VA 1KHTA 4RFSB 3ZZTA 4Q00A 3CIOA 5GJVC 4YMVA 1KO7A 3HWSA 1UJ2A 3TAUA 1CLUA 4CT5A 5GADl 1NJGA 1WA5A 3CRMA 4QGFA 1XRJA 5J47A 2QPOA 3LBNA 1XMVA 3SZRA 4LK2A 2G3YA 2VQSA 3PV0A 5FBRB 1XDBA 4NP6A 4OI0A 2PZFA 3EASA 3ZD6A 5J4VA 1KO1A 5KNCA 1OHHD 1XTRA 2HXYA 4A6PA 2QTFA 1H8HD 4YMWA 2QROA 1DARA 5CLQA 4HDOB 3WXMA 2HYIC 4EPRA 3Q5EA 2ZYTX 3X1YA 4LHXA 4KITB 1GDDA 2F43B 2QEQA 4DRZA 3ASZA 1EX7A 5KSZA 1E79D 2ZRKA 2XOKD 2ZANA 5GJWC 2IL1A 3V4RA 1JXMA 4KO8A 4DT1A 5EE5B 2HXSA 1XD2A 3PEUA 4YONB 1ZNZA 1GNQA 3DEFA 3I3SR 3ZIAD 2WWWA 3K0CA 3CKLA 2OM2A 2NO0A 4OHXA 1NRJB 4Q1CA 5IHPA 2OBLA 1VYUA 4C7OA 5BN3A 2W2TA 3QI2A 1XJ0A 3RS2A 2TMKA 4C0AC 4TYQA 1BYIA 3A1TA 1N5LA 2B8WA 4Q7MB 4ZPXA 3QIAA 3UK6A 4PQRA 1N5KA 1YR8A 2CJWB 3K9GA 2OAP1 3B2EA 4HZIA 2HV8A 4CW7A 1QHSA 2ZSDA 3WYAA 4EIWA 3BH6A 3UKDA 4E03A 1R0XA 3A1VA 5B57C 3GJXC 4MRNA 1XB2A 4PC7A 1R0ZA 1WP9A 3AP2A 3S1AA 1E3MA 4JLBA 4RD1A 4D80A 4E22A 2KBFA 2C98A 2FGJA 4M0LA 3CPHA 4PC6A 5E95A 2IYVA 2QSZA 3EW9A 3OIWA 4FMCF 3RC3A 2QQEA 2EWWA 1T91A 5TVKA 5DNYB 4LRWA 3MMPA 4BFVA 1G8PA 3B9QA 4WBSA 3WHKA 1GOTA 3PENA 4NMMA 3QEOA 1GL9B 1VCIA 1M8PA 2PMKA 4FXPA 4DEXA 3HR8A 1SKYE 5AWFC 2DFKB 3BFXA 1II8A 4KFTA 2O8CA 1SGWA 1W4CA 4HZUB 4JLJA 5KNDA 1GITA 2VA8A 1G3RA 1KMQA 3I73A 2C2HA 4CDGA 4GMDA 5JJLA 2AFHE 2QMUA 1FX0A 4KFUA 4I1OA 1L4YA 1T5IA 5K8UA 4BLQA 1E9RA 1TAGA 1VYVA 2HJVA 2VHTA 4IHQA 1U9IC 2KJQA 1LY1A 2EFCB 3TBKA 4DKXA 2O8FA 2XB4A 5FTLA 3SYKA 2OSBA 1E1RD 1IN6A 1SVIA 4NDZA 2QG6A 2FU5C 5E3HA 3LH5A 1K5GA 2QNRA 5ANRB 1XTKA 3HP1A 2BEJA 3RS5A 1TEVA 3IKJA 3I5YA 1SVKA 4DCTA 2IX3A 3DPUA 1EFHA 1BOFA 2WWIA 3B82A 3DL0A 3T12A 3R9WA 3N2IA 3REGA 5JWHA 1EWRA 3SOPA 3CONA 1G5PA 1R5NA 2AL7A 1CRPA 4KSBA 4MGKR 4C0QC 1GIAA 1NSTA 3P26A 3F3YA 4Q1AA 1G5RA 3DHWC 5TDHA 3TK1A 5P21A 4XIGS 3CX7A 4QJ3A 2WKRA 3KTAB 1OH8A 3FVQA 1Z0IA 3X1ZA 1E99A 2PJRA 1X8KA 1XTJA 2R9VA 5EP2A 4JBYA 1TUEA 3WMFA 3ZH9B 1W2HA 1T4GA 4A4DA 2XAUA 4QBGB 3KXIA 4B74A 3LXXA 3DVLA 5CB8A 1MRSA 3IEUA 1S3GA 3U7FB 4TYNA 1J7KA 4LPKA 5IT5A 3NBXX 2PT7A 1XFAA 1Q57A 3TR5A 4TL6A 1W44A 4TQUS 3NKVA 5TARA 4QOSA 3O8RA 4WXPA 3O8BA 3THWA 2ORWA 1HURA 4LDJA 1I4DD 2PT5A 4NYMR 3MFYA 2XX3A 4JSTA 1Z63A 3AQ4A 4CT4B 1P2UA 2ZQ5A 4TMZA 3WYGA 1OKKD 3ZDQA 2ZRNA 1E9DA 1XX6A 1OXTA 4DLXA 2QTVB 3QKTA 2PCJA 1U8AA 1P72A 4LCBA 2NGRA 4PR0A 5FUVA 3LXRA 3AV0B 1TX4B 2IA5A 4HLQB 1GKIA 1COWD 1YVDA 2R65A 1MOZA 5HE8A 2P2LA 1ZM3A 1Z06A 3FTQA 2VSOA 3I92A 3X1XA 1YHNA 2YOGA 2HJGA 2QUZA 2O8BB 2BCGY 3V9PA 3GLGE 1DE0A 4JLKA 3N2EA 1D8TA 1G19A 5JS7A 3QBVA 3KB2A 2GBLA 2PZGA 2ERYA 5FFMA 4DDWA 1NLYA 5G40A 2BMFA 4JVMA 3TVTA 3HJNA 2XZLA 1OFTA 4O2LA 3QPWA 3QG1A 2P3SA 1V5WA 5EP1A 3ND9A 1FW6A 3WNDA 3BK7A 3P4XA 1JPNA 1E2LA 1HH4A 2XEXA 2WAXA 2FOLA 2AK3A 2ATVA 4C7OB 3MD0A 1EG7A 1NVVR 3GEIA 1XTQA 3QF4B 2FPLA 5DHAA 3RABA 3RHFA 2VSFA 1HA3A 2H18A 4BRWA 2QMOA 3TVDA 3O8CA 2QP3A 4Q1FA 2W2VA 3NH6A 2CNWD 4FN5A 4G1UC 5EE9A 4OBEA 3OIUA 5KDDA 4FI3C 5FR1A 3W8RA 5JI3E 4DLVA 4QG7A 1E9BA 2NTYC 1R5BA 3QXXA 2ATXA 4TMKA 3CZQA 1Z47A 1AQYA 121PA 1T3LA 1VCMA 1ZD9A 2P0EA 2QI9C 2J7KA 1IXSB 1P9WA 3IPYA 2X2FA 3B1XA 2CCGA 4Z8YA 3S1AB 1E2PA 4Q48A 4DJTA 4DIEA 4NYIR 1E32A 5FH9A 1GZSA 1QBKC 3K09C 5IK2D 1E96A 2QRZA 4Q21A 5CK4A 2QN6A 2W6ID 3IGFA 3B7GA 3GEHA 2JLQA 4AURA 1JR3A 4ZCLA 4LYAA 4D26A 1W0KA 4XVQA 4Z54A 2D06A 3VTKA 2AXNA 4RZXA 1E2HA 2O8CB 5CLLA 1XCGB 1O3YA 2D7CA 4WW0A 3IQXA 5C18A 4FINA 2WIBA 2WM9B 4ZCIA 1ZBDA 4POAA 3E1SA 4LBWA 2A5DA 1I2DA 3TQFA 1QZXA 2F9LA 2ZJAA 5TXGA 3TSZA 4LHYA 3O47A 2YNMA 4F93B 2IS4A 2FA9A 3AKEA 1NIPA 1NN0A 2QP4A 3AB3A 3AGQA 2A5FA 2GF9A 4NYJR 2ZU0C 2V1UA 1OXVA 4DLRA 4FCWA 3H2YA 1N6OA 1D9XA 1CR0A 3I61A 2ZJ5A 1VDZA 4TYWA 1XBTA 1B0UA 821PA 1TPZA 4QJ5A 2AR7A 2GCNA 2ZE5A 1KY3A 4M21A 5JWRA 1TF2A 4NCJA 4PAMA 1E9EA 4Q9IA 3CO5A 2BKEA 2ZSBA 2AK2A 3K0AA 4AKGA 2RGNC 3SYNA 1DG1G 2A7QA 1XZPA 4NZYA 2H57A 2DFNA 4MKIA 5BXQC 5KHOC 4KV9A 2O0JA 2IYZA 1PUJA 1XCMA 1UBGA 4AK9A 1PVOA 4R2HA 4MUAA 1E94E 3CX8A 1P9RA 2WAYA 3FKSA 1QVAA 2JIZD 2UZ3A 2IUUA 1FQJA 1HQYE 5G3ZA 2N1BA 2REOA 4QGHA 1KI1A 1GNPA 1W48A 5CM8B 2GRJA 3LY5A 5CK5A 4MUBA 1XJQA 1GWNA 1JBKA 1JQJC 4XTCS 3ZQ6A 3K53A 2FV8A 3IIMA 5EP4A 3T5GA 1LFDB 2AWNA 3KL4A 4IDPA 4XWAA 1QHGA 2UVQA 1W0JD 1AGPA 3W6PA 1G7RA 5J4HA 4BFWA 2FEMA 4US0R 1KI9A 5M04A 2ZSAA 3AVXA 2JJ8A 3NBZC 4QC2A 1AS0A 3K09A 4P3YA 1MRNA 4BFSA 3CPJB 4QL3A 1U94A 1IM2A 3FWYA 4PZYA 5AJZA 1H65A 5F9FA 2R6GA 5LB2A 1RPZA 4BLTA 4BECA 1XPOA 4BPBA 721PA 3EX7C 3QSYA 3VFDA 1VTKA 4OK5A 4S35A 4ASUA 3DOEA 1FUUA 2PLFA 1HE1C 2O0KA 2GXAA 3SBEA 3QY0A 1U0JA 5KU1A 1Q1BA 2V8OA 4GT1A 2RCNA 4HI0E 5KPDA 1E4YA 3Q7QA 2PX3A 2OXCA 3H0KA 5FUWA 1ZCBA 2IF2A 4IEEA 3NBYC 4QGGA 4NKRA 4OQXA 1S9HA 4U00A 3HYTA 3VAAA 3PUZA 5KSPA 3P32A 1G3UA 2FFBA 2ZYVX 4FMDB 4LOAA 3MWYW 1E2IA 4AC9A 1R8SA 4DLSA 5AK0A 2WVJA 2ZE8A 4RZUA 5JJKA 2GJ8A 4C0LA 3C4JA 4EPWA 2CHVA 3KJGA 3UWKA 4PHHA 4X8LA 3V4FA 2FDCA 1GNRA 3VNVA 3BH0A 1G7TA 3MG9A 2EFDB 4GBMA 4HB2A 3TAHA 2FZ4A 2RGNA 2AWOA 2F1HA 1XPRA 4Q02A 1J8YF 1TU3A 4A0GA 1NF3A 1S1CA 3FHCB 4M1MA 5FI1B 4CEIB 2C9CA 2YINC 4TT3D 4K8OA 4W5WA 1CR4A 2PJZA 4C4PA 3C41J 5K8TA 3NTUA 5G53C 2ZVPX 4L8GA 1NLFA 3U7GA 4DCVA 4GL2A 1FOEB 1RFLA 2A5GA 4IEIA 2RGXA 5C46F 3MGCA 1UEIA 2YYZA 1ZUHA 2ZI3A 4KLZA 1GTVA 4RJLA 2O8DA 3SHFA 1ZIPA 1P60A 4A0RA 2EW1A 2QY9A 2WBLC 2CXXA 1VMAA 3FOZA 2JLRA 1KJYA 4JMPA 2V1XA 3UPUA 1VG9B 4MA4A 4IDOA 3GLIE 1EESA 1J2JA 2C5LA 3BBPA 4L9WA 4U5XA 4JVSB 1OLOA 4PXAA 2GF0A 2GETA 1KY2A 1KJZA 1WQ1R 3M4YA 4HLUC 4X8MA 2EQBA 5IF9A 2XGJA 3AEZA 4RFSA 3BJIC 5E7MA 2R8RA 4NH0A 1N6HA 4D6PA 2DBYA 5FOTA 1YRBA 2VRWA 5FBWB 5CIWA 1OPXA 2ZS9A 3PITA 4PC3A 3AVWA 2JCSA 2E9SA 4F91B 2F3RA 3OAAA 1XMIA 4PZZA 5DN6D 3QOFA 5HR5A 3NHBA 4S2EA 1KSHA 1E98A 2GEDA 4KFSA 2YZ2A 4YLGA 4MDEA 2CL0X 3UG6A 2OBNA 4HB4A 1P2TA 2BBTA 1NMXA 4AD8A 1HYQA 2ZRJA 1IXZA 4FIDA 1QDEA 2RGCA 1DG3A 3DM5A 3TW4A 2F43A 5HZHA 3TUZC 3IDQA 1DAGA 3DMDA 1MO3A 2XXAB 5LPNA 3BS4A 1E2KA 2LKCA 1NIJA 3K0AB 4DLYA 4B3XA 1M7HA 4R9UC 3DZ8A 2A9KA 1XNJA 2J0UB 2VTKA 5J4KA 2VO1A 2VP0A 2XTNA 2Y8EA 2RH5A 3B1WA 4WZ6A 2WOJA 1NVXQ 4JLMA 1CJTC 1ZC3A 4ILEA 2DFLA 2NO9A 5HTKA 3ZVLA 4CF7A 1AZSC 1Y63A 4CVNA 3QXHA 2WWFA 5JLJA 3VNUA 3FMIA 3HYRA 4W9MC 1WBDA 4U7DA 3IEVA 1KOFA 2KBEA 6Q21A 4TMWA 1MV5A 2CJWA 2MSCB 2VSXA 4NL4H 5TV2A 2GJKA 4V02A 1LB1B 1NL3A 2OFOA 2XNDD 4ITRC 1KAGA 2FJUA 1YZGA 2OLJA 2N46A 4HB3A 3CRVA 2NO6A 2BOVA 1FTNA 2DCUA 1S9DA 5HKKA 2G1KA 2WKPA 3WP1B 2IYLD 4L4UA 2ANCA 5DGXA 4KYIB 1DOAA 2ODNA 3RNLA 1BYUA 3EXAA 4BFYA 4M1KA 4YXWD 3VR1A 4XTRA 2GJSA 1QVRA 3QNUA 1G5TA 2D3WA 4R71A 1JPJA 1E9AA 2PEYA 4B44A 1DELA 1Q44A 1BH2A 4EJSC 2BBSA 1KSJA 4RVCA 4Q5IA 3W5IA 4A0HA 3DM9B 4PO9A 1TL7C 3VX3A 1Z2AA 3JVVA 4C0BA 1GILA 1M34E 1E2GA 4Q9JA 2QE7D 4E07A 5JEEA 1KO8A 1AKEA 1QHXA 1XXHE 2W6JA 2WJHA 1TMKA 3D3QA 2FSGA 5AUQA 1XF9A 2AKAB 2QL6A 3OEEA 2C99A 4W5JA 2ZS7A 4D4MA 1E2MA 1IY1A 3LLMA 1NY5A 3LQQA 2ORIA 3OEHD 5D3QA 4DCSA 3QG5A 4EQ6B 2B7CA 3V00A 4XD7D 4EUNA 1OF1A 4URUR 1BMFA 1EFTA 4KXFB 3IO3A 1KNXA 4ARZA 4LZZA 1BO6A 1MO4A 3QENA 4YMTA 1UDWA 3CNNA 4LC1A 1P6XA 3CF2A 3H84A 4IRUB 1AZTA 1KZ7B 1NNEA 1CU1A 1FNMA 2CCJA 1OHHA 4V0ME 1DAKA 4IJMA 3IIKA 1EXMA 3FMPB 1CRQA 2ZXUA 3EPKA 3AVYA 4QHYA 4KJZA 5H70A 4FWIB 4UNPA 1LTQA 4Q01A 2PLRA 2ZM5A 4EDHA 2WMNB 1E79A 1LS6A 2AD1A 2WWGA 4AKIA 2R62A 3KTAA 1J8MF 3TLXA 3RDPA 1MR3F 4YDSA 3FMFA 3GFPA 3KX2A 3W6NA 2ZJBA 4JLOA 1QHNA 4OK6A 4RD0A 3GJ0A 4TL7A 2GNOA 3ECCA 3KJHA 1QHIA 1OT3A 1UDXA 2O8DB 4PO8A 1S2MA 5FTKA 3F8TA 2N42A 3SNHA 1TTTA 1OSNA 4AWXA 3RANA 4RD3A 1NVWQ 4PSKA 1E9FA 3WNCA 1Q1EA 1ZM7A 2IWHA 1GL6A 4YC7A 4DWJA 1CEEA 4K81B 1MABB 4U02A 1IN8A 2REXB 2WJGA 5JRJA 4V0NA 2I3BA 2QAGC 2QU8A 3CBQA 4F4JA 3ADKA 3LQRA 3SU8A 5FL7D 5BW8A 5GVSA 4EJSA 1GKYA 3JZMA 2D62A 4IDHA 5HZKA 2NZJA 4ZV4A 3A1UA 3ZS9A 3AF2A 4ZIRA 1RVDA 4D0LB 4TLCA 4Q4LA 2JDID 1G7SA 1G3IA 4BLOA 4F4CA 5CDFE 3NWJA 3KXLA 3VHXA 4HAWA 4TTRA 1SXJD 1KK3A 4JVLA 4NE2A 4URVR 2IUTA 4FCVA 2QORA 1RYFA 1L7VC 1H8ED 2OO7A 4GOKA 3BE4A 4MYUA 4IOLA 2O8BA 2ERXA 2FZLA 2C95A 2QGZA 3QKRB 2ZRBA 5L3SB 4CEJA 4JJZA 3NDBB 2A78A 3TH5A 1A1VA 1T0HB 4DDUA 3KKPA 2E1RA 3CH4B 4QNRA 4W7SA 3A36A 3U4QB 3U3MA 4TMVA 2G1JA 2OCYC 1YRAA 2HEIA 1N6LA 2EYQA 2RMKA 5L8VA 1R6BX 1IHUA 4B75A 3QF4A 3T1OA 1Y3AA 1JR6A 4UJ5A 1U2RA 1OH5A 1XD9A 1RC8A 3A4NA 4D81A 1SXJE 3AVVA 4C2TA 2Z6VA 3KKOA 5JCPA 2J9RA 3LFUA 3GD7A 1KKLA 3TW8B 1EK0A 4B3GA 4MYHA 1KZGB 3TIFA 3NBFA 1OE0A 4QFMA 2UZIR 1FUKA 2R6CA 1DAHA 2QMHA 1ZC4A 1R4AA 5F2EA 1TADA 1FTSA 1A82A 2CHQA 5BN5A 4D25A 2O0HA 1JQLB 2L0XA 2ZI9A 3U3KA 4D0NA 3HU1A 4L16A 3OE7D 2VPPA 1W4RA 4DLWA 3UATA 3LDAA 1Z0AA 2WWYA 4JT4A 2BVNA 1LV7A 3ADDA 4WZAE 2X77A 2WPDD 2IS1A 2BBWA 4B34A 4Q9HA 3U6BA 3FHOA 1VPLA 1DAMA 4MYTA 5AJVB 1ZM4A 2C96A 4ESVA 4PPQA 2W0SA 3OIYA 4RCZA 3GLGA 3B6EA 4UXIA 5KTYA 2J7PD 5FPTA 1E2DA 1HUQA 2G0NA 5JI2E 2VP2A 3T1VA 2YWEA 5GJBA 3KQLA 3B1VA 4DLUA 4B6EA 2GWHA 1U99A 4IDQA 3SN6A 3TE6A 2JLVA 2HYDA 1NY6A 5FUXA 3IUYA 1CR1A 1PLKA 2XJ4A 1HT2E 3SC3A 2GCPA 1RJ9A 5AUNB 3FFBA 4F38A 4PSVA 1AS3A 2G0TA 3CF0A 3CNLA 1ESNA 3KUDA 1DS6A 1COWA 3EARA 1OIVA 2VYFA 1DAEA 1S3SA 4V0KA 5CJPA 5D3MB 4TSFD 2F7SA 4D4LA 1R0YA 2WSSD 3CRW1 4N0DA 1G8YA 2A2ZA 4Q4HA 3E5HA 2D7DA 1NKTA 1Z2CA 4IXNA 4JYCA 3TR0A 1OJLA 4LC0A 4BLPA 5LDDC 1HT1E 4C9BA 3ADCA 2JLXA 4ZDIA 1NVVQ 4JT2A 3VQTA 5FBVB 2J0VA 2LWIA 2AFIE 4FD2A 3VKWA 4LJ4A 3N70A 2V9PA 1VIYA 4P4UA 1VHLA 3E2IA 4RD4A 5K8IA 3Q72A 4LX0A 1SKYB 5B64A 1JEEA 1F6BA 4BEBA 2CNWA 4F4IA 1G8FA 2J3EA 2BKUA 5FTJA 1S1MA 1UBCA 2GK7A 2JLYA 5E7IA 1QRAA 2VF8A 3AF1A 4M9XA 4A1FA 1M2OB 2H92A 1X1SA 4MITA 4EAQA 3K70D 4D2IA 3Q9LA 1UAAA 1OXSC 4V0OA 1Z83A 4R98A 4KLNA 2HT6A 1VKJA 1ZM9A 3A6PC 3ASYA 2JLUA 4NYIQ 2DPXA 3LRPA 3LW7A 3R9IA 2RHDA 3A58B 4CYMA 3AH8A 4EJSB 5JWOA 1UKVY 4TYYA 2XSZA 1FPMA 3WYFA 2NO7A 3PEYA 5IK2A 2P6NA 4JYBA 4ZIRB 3KQUA 1GVNB 2WJVA 1RYHA 3MJRA 4B3FX 3SDZA 2GHIA 3CB4A 5EE0A 2W6IA 4IKEA 1OB5A 3CR7A 2ZAMA 4LBZA 4OHVA 4BLRA 1EFRA 1AQUA 1JJ7A 5IRCD 4M1SA 3RSOA 4O3MA 4ARZB 5CITA 3ZD7A 5F9HA 3B5JA 3KZ1E 4BLSA 3GPLA 1DBSA 4CEJB 1P61B 1U9IA 3ZIAA 1F3OA 3AVPA 3TNFA 2Q9CA 1ZCAA 2YOHA 5JZVA 1DAIA 2ZS8A 421PA 5EE3A 1NBMD 4WVFA 4OYHA 1GRRA 5DYIA 1E0AA 2OFWA 1O87A 1IAQA 2IHYA 2OAQ1 4HAYA 1GUAA 1Z6XA 2OCPA 2IXFA 4W5HA 3Q85A 2PCLA 4L15A 4LUCA 5H1YA 4AYXA 5C4MA 2JEOA 5KPJA 5EQTA 2P6RA 1KKMA 3VKGA 2PBRA 3EZFA 3MSXA 1J90A 3I4LA 4DUGA 4PAQA 4FW9A 5FPHA 4CEIA 2SHKA 2OHFA 2HDNB 2CLSA 2Z0MA 3W8NA 1KSGA 4AIIA 1VYTA 2IHBA 4E5UA 2EFGA 4RZ3A 1VCOA 3TRFA 2KB0A 1VIAA 2YC2C 2ZRPA 2V7QA 3GCGA 1OIWA 2MSEB 4M9SA 3SI7A 1T5LA 2JA1A 4XSHA 3KJIA 2OLKA 4Q66C 3AVQA 4G0NA 1RRGA 1NBME 2BWJA 5DYGA 3TSWA 2IF0A 2BC9A 4AYTA 2JIZA 4DDVA 2WZQA 5L3RA 3RS0A 1WF3A 4QRHA 3SE0A 3JVUA 2EVWX 2ZJYA 2AD5A 3HU2A 4WAUA 2ZYWX 2W00A 4GOXA 4UKDA 2CVFA 4IXMA 3AKCA 1GKUB 4RKFA 1UKYA 2VHCA 1W0JA 3BD9A 2WIAA 2QP9X 3GLGB 3PXGA 2V54A 2QAGB 2ZI6A 4URXR 2HLDD 1KI3A 5C1BA 1VG8A 3Q8XB 1K6MA 1BS1A 1IXRC 1YZQA 4XH9B 1WB9A 1WXQA 2ZETA 3OESA 1M7GA 4LBYA 1U8ZA 3QKSB 5AUOB 3CUEF 1II9A 3QVVA 3NEJA 1D6JA 3QBTA 5FOUA 4P0TA 5ELXA 5FL3A 3EIEA 4TLBA 3SBDA 3D6TB 4BASA 1QG2A 5A4JA 3Q5DA 1E0JA 2J59A 4G5GA 2R6AA 1RJ9B 3KB1A 1N2CE 1R7RA 3GLFE 3FKQA 1T8TA 2XXAA 1XEWX 1M1YE 3ZLJA 2GK6A 2J0UA 3ICQB 4PZLA 4DCNA 2ZSFA 4A6XA 1G64A 3K9LA 2GESA 1OFUX 3BB4A 5CM9C 3TQCA 1U90A 4Q4HB 1Q22A 2PEZA 2XB2A 1W5SA 2J87A 1UBEA 2X2EA 5FI0B 4CEHB 2MSDB 3TUIC 3LBIA 1TQ6A 2QM7A 2IXEA 4JLVA 2JJ2A 1ZINA 1KNQA 2C03A 4MKHA 2IUSA 3RC8A 5KSOA 2IYSA 4DSTA 4MRVA 2WOOA 3AKYA 3VX4A 3DOFA 1D9ZA 2F9MA 4TT3A 4FMDF 4BUJA 4JLDA 1AJEA 4M53A 1N0VC 4TZ0A 3EA0A 4B33A 1CJKC 1N3BA 3U2QA 1W49A 1CTQA 3HR7A 1LVGA 3LA6A 1NN3A 5EXTA 1ZAKA 3PCRB 2BMJA 1P4SA 2FSFA 4C0SA 4Q9KA 1NLZA 3G82C 4GMXA 2X19A 2W58A 2ZJ2A 4KSCA 3PUYA 2CK3D 3K9HA 1A2KC 4KFRA 4P32A 1TEXA 5CIQA 5LBIA 1JR3D 1KI4A 1ZD1A 5FOVA 3VU9B 4D4KA 3BGWA 1AN0A 1VCNA 2CLDX 5CYPA 1IOZA 1XMJA 2WJYA 3BB3A 4Q9LA 2Q21A 2ZE7A 4GZMA 621PA 2GZAA 2B8TA 2ZEJA 4NCNA 1Z6YA 2J1LA 4LJAA 4OI1A 2OV2A 3KDSE 3WRXC 4GSYA 4F7WA 2DYKA 1AGRA 2Z4RA 4D82A 1ELOA 1P7CA 4I1UA 1OB2A 4QHTA 4EQ6A 2IYQA 4A82A 1I2MA 1K5DA 1US8A 2P67A 2ZROA 3K0FA 1G21E 2O8EB 3WP0A 3FE2A 3AVTA 1P2VA 1W36D 5LD2C 3QVUA 4HDCA 4JKIA 4LY6A 2GILA 3NG1A 4LWZA 1NSFA 3B13B 1JB1A 1M6NA 2WKQA 5FOSA 2I1QA 2JJ1A 4ACBA 4WOPA 4WZBE 4JVNA 1G6HA 4M2LA 1T3SA 1JR3E 2CE7A 3CX6A 4ZO4A 2Z4SA 4CZ2A 2HT1A 3BWDD 4PC1A 2VHUA 1E6CA 2C8VA 1DPFA 4HATA 2I4IA 4HAXA 5FPSA 1F2UA 4JS0A 2ASEA 2CL7X 1F5NA 4C0KA 1P73A 1G9XA 2DHRA 3L2OB 2WHXA 2ZU6A 4URWR 4OKSA 3HU3A 1ZUIA 2XZPA 2QA5A 3FKSD 4F92B 1JJVA 3KKNA 4O2RA 3C7KA 1CJUC 4L5BA 2Q3FA 3C16C 4G01B 5JHGB 5FOXA 2J41A 5DH9A 1UEJA 1NN1A 2D2EA 4HB0A 1N5IA 4A92A 4A2WA 2H7VA 4B3DA 1OW3B 4NBSA 1EGAA 3PVSA 1RRPA 4M22A 3SEAA 1KAOA 4OK3A 3BIFA 3N5CA 2H8KA 1OFHA 4TN1A 5E4FA 4B47A 1P5ZB 1X3SA 1CXZA 4MKGA 1HE8B 1MABA 1PV4A 1TF5A 2NIPA 4NPHA 5SZJA 3QF7A 3LD9A 3R20A 3CRQA 2JATA 2VP6A 2GJAA 4YQFA 1AK2A 1Z0JA 4XWKA 3ICEA 4YDHB 1ONBA 5DI9A 4ASUD 3BOSA 3C5HA 2W83A 2IEZA 4PTLA 4YXWA 3KUCA 3TSOA 1DAFA 3X2SA 2PMDA 3HDTA 1YQTA 1TQ2A 2GTPA 3ZGXA 2JLZA 2Q9AA 4RKEA 1UKEA 1QHHA 2AX4A 1JNYA 2LKDA 2IT1A 4RSGA 3W34A 1XEXA 4OQFA 4V0MA 4QXAA 5AJWA 5JRZA 1N5JA 1AA9A 3PG5A 3QKRA 3I8XA 5L3SA 4JBWA 3B85A 3BFVA 3NHAA 2JASA 2PX0A 2QE7A 2FF7A 1LW7A 1UADA 1SXJC 2D74A 3IHLA 3SJCA 1E1QD 2RHMA 3ZZ0A 1CP2A 3GLHE 1F2TA 1AKYA 4URZR 3U4QA 1FMJA 2IBMA 1NG9A 2PH1A 1Z6AA 1KI6A 3PUWA 5BYJA 4XD7A 3F5FA 1OV4A 4A2QA 1GRNA 2IYYA 3BFKA 3ZQJA 4A8JC 1SHZA 1KDTA 1GRQA 3EZ7A 5IDVA 5C2JB 3C14C 4QNMA 4LSGA 4IW3B 3SS8A 2FGKA 3A4MA 3MAAC 3LAWA 2YKGA 1ZU4A 3R7WB 4KCGA 3GLIB 2EWVA 3U44A 2VLIA 1UKZA 1UF9A 1II0A 2IYWA 2WWHA 5DSZA 3U7EB 2VP4A 2HF9A 4PPNA 4EPVA 4C30A 3NEYA 2GEVA 4AG6A 1EWQA 4TMTA 3D7MA 4BFUA 3WY9A 4DSUA 2FEOA 2J45A 3AKDA 3CH5A 1CBUA 4TYPA 4HYYA 5HPYB 1FP7A 2G77B 3SFZA 2OXRA 3THOA 2VF7A 3A1WA 4IOKA 5CDFA 3C15C 3KJEA 5JEDA 3NDPA 3NVAA 4Y0AA 3KQHA 4C3ZA 4HLUA 3U6KA 1NVUQ 3W3AA 1OH7A 3EC1A 3EIQA 1Z5ZA 3FMOB 3EWSA 3AF0A 1TUIA 3P4YA 4LGMA 2PL3A 1Q1QA 4LI0A 2Q6TA 2IYXA 4UNRA 3BORA 4AKHA 4B2PA 1AM4D 3OAAD 3L0SA 1TNDA 2ANBA 2FFHA 3NH9A 4X8OA 2G9NA 1RRCA 1FMLA 1P62B 5SZIA 3QXSA 3T15A 4P4TA 5DI3A 1XWIA 5AR1A 1UFQA 2OT3B 4ZDJA 1Z0KA 4M1YA 1US8B 3K0FB 2AXPA 1OYYA 1D2NA 2BMEA 3BRWD 5FL7A 1D2EA 2ZJZA 2KI5A 2HCJB 1YZNA 2H5EA 3SYLA 4URYR 4B73A 1KSFX 2QMEA 2YWFA 3M0EA 4US2R 4Y0VA 2Q0HA 1XTSA 2UKDA 2GDJA 2W2XA 2KWIA 1AS2A 4Q4JA 1MH1A 5EUMA 1UM8A 4LBVA 1JI0A 1K8RA 2ZJ8A 5KDLA 3F0TA 1H8HA 2E87A 221PA 2F1RA 4M4SA 4UJ3A 5A5GA 4Q1DA 3T34A 2G6BA 3GFOA 5D3MA 5DE3A 2NOAA 4HEJA 4GPTA 4KBFA 2ZREA 4A15A 1F2UB 1R2QA 3W3ZB 1SQ5A 4EPTA 4BFZA 4LPSA 4BZXA 4QKQA 1W1WA 2XOKA 4A8JA 4Z1MD 1ZUNB 5FR2A 2ZR9A 1S96A 2W0MA 2OFXA 2KSQA 2GJ9A 2VBCA 3K0CC 3QQ5A 4JKYA 3T1QA 2ORVA 3W5JA 1ZNWA 2FH5B 3KXKA 5HCNA 3RS4A 1YR9A 4JBXA 1XPUA 1RIFA 2XJ9A 3X1DA 3I32A 2C77A 2H16A 4B43A 1Z07A 1SVLA 1E2EA 1KIMA 2R6DA 1EFUA 3KKMA 1KMHB 2OEPA 5FBLB 3ZS8A 1E4VA 4K46A 1MT0A 4DVGA 1KDRA 1M74A 2GCOA 5HKKD 1OXXK 4OHYA 2CDNA 1ODFA 4LV8B 2J5XA 1PZNA 3BH7A 3RYTC 1XXHB 3TJZA 4V03A 1E9SA 4AI6A 4ERNA 4NCIA 4Z51A 4JLAA 1IN5A 1TQ4A 3P27A 521PA 2GZHA 3QXJA 3GQBA 4TLAA 3WNBA 2QGNA 4C0JA 2IWRA 1A2BA 3K70C 4B3BA 2G83A 3LVRE 2J0QA 3WMGA 4AYWA 3H4MA 4CRWB 4N0EA 3CF6R 3LV8A 2A30A 2QPAA 2W6JD 2WPDA 4R7ZA 3TKLA 1E2FA 4A2PA 1QHHB 1X6VA 3P20A 4NTZA 1XEXB 1WCV1 2QPTA 1R10A 3E70C 3IBGA 1OIXA 4UQOA 2OZEA 4I99A 2REBA 5EXXA 4OHZA 1SVMA 4DLTA 3NIBA 1IN4A 2OUKA 2ODWA 3AF4A 4M1OA 2QBYB 1BMFD 1SZPA 2IC5A 3CZPA 3GFTA 1HY3A 2J7PA 1WBBA 3LLUA 3FYHA 4Q7JB 1S0UA 3ZVMA 1F2TB 5LD2B 4LV5B 2QT1A 3KFVA 4KHZA 2Q9BA 1KI6B 5FPYA 1DO0A 4H9GA 4HUQB 1E1RA 4OL0A 3LX8A 4EFNA 3U60B 2DR3A 2QT0A 3DDCA 4P4SA 1EX6A 2Q3HA 4LJYA 2ZIAA 2X8AA 4TZ6A 3DZDA 3U44B 4PFSA 1CULC 3VR2A 1L4UA 2NQ2C 4IFEA 2XTZA 5DLQC 2VIIA 4LJ8A 4TSFA 2WSSA 4TQ9A 3T5DA 1Z6GA 4TTQA 2FPMA 5JHHB 4MKFA 2A5YB 4MDFA 2ECKA 1U81A 2JLWA 1N6NA 2GVDC 1E2JA 5JFGA 3I8SA 1NKSA 3R9XA 1Q20A 2QAJA 5G41A 3AUXA 1S4QA 2ZRDA 1UBFA 5JBQA 3OFND 1GG2A 5KDOA 4BRUA 3EZ2A 2A3RA 3UMRA 4BWYA 4E09A 1QHYA 4V0LA 1KK0A 2RGAA 2RKOA 1IJEA 1V43A 2QAGA 1G20E 3GJ5A 2EFHB 2V6IA 4NYMQ 3TMKA 1IQPA 1G16A 5KUTA 3UANA 1L8QA 3ETLA 3M1IA 5EZ6B 2QM8A 2FE4A 4GI7A 3T61A 3QKSA 3GEEA 3DO6A 4G5OA 2VL7A 5DI3B 4DXAA 4NONA 3EPHA 2NO1A 1OKKA 4PPGA 4TLEA 4RY2A 4KVGA 2YWHA 1P2SA 1FNNA 4BZPA 2FFQA 1KO4A 3MLEA 2FG5A 3LBHA 4TWZA 3SHWA 4Q4JB 4A9AA 2B6HA 1SXJB 1CJMA 4XSGA 1IY2A 1NG1A 2HF8A 3CM0A 5EE1A 3B78A 2RAPA 3SQWA 3UXMA 1AIPA 2GBLC 3VMFA 1ESMA 3L0PA 3LW8A 3KQKA 1GSIA 1NBMA 3RRZA 4A8JB 4CEHA 3QPUA 2ONJA 3R8FA 1E69A 4FMCB 2ZRFA 2AKYA 4TL9A 3W9YA 1LF5A 2NMVA 4LHWA 4ZI2A 1M7BA 4DSNA 3OIVA 4QBFA 1EFCA 4OQLA 5FTMA 4DC9A 3QKUA 2ZRAA 2IS2A 2BJVA 2BJWA 2P65A 2GCOB 4WXRA 2P6UA 1LNZA 4DBLC 5AUPB 5KSYA 3AF3A 3AVOA 4M9QA 2OBMA 1IY0A 1J99A 1GP2A 2A5JA 4D0GA 4EKDA 1E9CA 4ZI3A 4GOJA 4KODA 4Z8XA 3MRSA 3TUJC 4C0HA 2FMXA 2ODEA 3VU9A 4XWOA 4DB4A 2NPIA 3CPEA 4IVRA 2DFTA 1G8HA 1ZJ6A 1G4AE 1ZW6A 3OF5A 3GJ8A 4JLPA 3O8DA 4M9ZA 4XJXA 2FX3A 1N6KA 2R44A 2ZVQX 2WICA 4LJ6A 3THYA 4GNKA 2R2AA 1ETUA 3GLFA 2WMOB 3RVBA 2XTMA 3RWMB 2NZ8A 3EZ6A 4ZCMA 1W4AA 1FQKA 4OI2A 1Z6TA 4XVRA 1RKBA 2O8EA 4H1VA 3KQNA 3RRNA 1WE2A 3RRMA 2HLDA 5KNBA 3RWOA 4IOMA 4DZZA 4AG5A 3AVUA 5DO9A 1KJWA 3LNCA 1GFIA 1G4UR 1T8UA 4NYJQ 3CW2A 3L0OA 1G18A 3AM1A 1Z8FA 3FB4A 2RGEA 1W36C 1CIPA 1ZRHA 3LX5A 3ND8A 5B30A 3A8TA 3I72A 2O52A 4J0QA 4HLCA 2OCBA 2GEUA 3PIRA 3HPQA 4BFXA 1UPTA 4DB2A 2OE2A 2IYUA 2YC4C 3JZAA 4KBGA 4P4SB 3VR5A 3I5XA 4Q19A 1W46A 2Q3MA 3IQWA 4Q7KA 1ZNYA 1JXOA 2GXUA 5J40A 4LJ5A 3G0HA 4R2IA 1CS4C 4DT1B 1E2QA 2J46A 2WJJA 1XD2B 1J70A 3PFIA 4HUTA 5FPKA 4RD2A 1Q0UA 1ZP6A 2WSMA 4B2IA 3UMSA 4JL5A 2HUPA 4WA7A 4I4LA 3VHLB 1G3QA 4P33A 3ONWA 5AJYA 4YMUA 5F3WB 5TB5A 4QBIA 4PHTA 4B48A 5G3YA 1OXUA 2ZI5A 1QG4A 3ZJYA 3UG7A 4GP7A 5LB4A 1DVRA 4OQMA 3CNOA 4DHEA 3ZYCA 4US1R 4AKEA 3U5ZB 1Z28A 3RAPR 2V55B 4RCYA 5J5CA 3CR8A 3B1ZA 2FFAA 4IOJA 2IXGA 4B2LA 3SR0A 4G5RA 3QEJA 4PSAA 4Q18A 4DCUA 4BGDA 2CE2X 5B58C 1I4TD 3LVQE 3MWJA 2C9YA 1T3HA 2YV5A 1YZTA 2XSZD 3BXZA 5SZHB 4GZLA 4O25A 3W90A 2BMDA 1P75A 1D2MA 3K70B 4NHOA 2V3CC 4UXHA 4EPXA 2ZRGA 2BV3A 2CK3A 1BKDR 4ZKDA 1EFRD 2F1IA 1PLLA 4ABYA 2ZTSA 4B35A 2JLSA 2F55A 3H1TA 4LHZA 4Q7LA 4BFTA 1W7AA 1Z0FA 3WBJA 1II8B 1F48A 3BB1A 3PEVA 2WTUA 1ZIOA 1SHKA 3EG5A
chains in the Genus database with same CATH superfamily
2YZMA 3PD0A 4RGYA 4YROA 3HM9A 1GQYA 3WMFA 4ZTUB 1SCQA 4U4AA 1YJ5A 2NW6A 3A1DA 1XNGA 3LKBA 4JL8A 4RHXA 2DPYA 4YUYA 4LAFA 3AFNA 1Q0SA 1KK2A 4DNXA 2MYNA 2V7VA 1Z08A 1JQDA 1UBNA 4ZI7A 3BA6A 4R1MA 2D00A 1FFBA 2K5UA 4L5AA 1B23P 2EYUA 1QYVA 4ZYUA 2ZIFA 4DUGD 4QJ4A 2MTBA 4H7JA 2AHOA 4GP6A 2OTCA 1DADA 5IULC 5IT0A 5AKZA 3GLIA 1KTVA 3QGMA 5FCDA 4IH1A 3HNRA 3EC2A 4EY5A 1RHUA 2JIBA 3L77A 1Z82A 4HWTA 2BISA 2J8ZA 5C0OE 1HK7A 3RTBA 1XMOB 2FSHA 3EQ2A 3IO5A 4JB2A 1ZOLA 4IGIA 4EEXA 1B8NA 4E30A 4Q9DA 1UOOA 3H86A 4EHNA 3EPLA 2QLLA 1N7HA 1FU8A 4E12A 2P9JA 3TGLA 1W5TA 3I34X 2UUBB 3FFAA 3KOUA 3DBRA 5DHRA 3EPRA 3VOAA 2FZ5A 3JQEA 3LO5A 3UPDA 1XZQA 4HWRA 5TPWA 5AW0A 3UB2A 1DOHA 4I50A 4PSUA 3HUFA 4BEJA 1XL1A 3DBHB 3D31A 1O9GA 4U7PB 1FFDA 1Z29A 4FYVA 4MRPA 1DDOA 2Y0DA 4G84A 4KI7A 4IMPA 1AY0A 4EYOA 1RYBA 2H29A 1JG1A 3GJ6A 4H4CA 2VP5A 1EXNA 1W0KD 4JZYA 5DK6A 4D92A 3QW2A 4DSOA 1L5QA 2H17A 2OG2A 3FZEA 5F7JA 3LY8A 2ZITA 4C7JA 2BCJQ 4E2WA 1WCWA 4JSYA 2QTHA 8ADHA 4GC9A 2QQ5A 4R5HA 3THWB 5M2QA 1T9CA 3GLFB 2A1IA 3DSRA 2GAAA 3NXSA 3R2JA 3N0XA 2Z43A 4KYTA 5E4TA 3TMYA 3UMFA 3RLFA 1P0FA 2EJWA 2OBBA 3HKEA 3VO2A 2FZGA 1S3FA 1XRMA 3IXMA 3L8MA 3AUFA 2ZSHA 4I9FA 4BV9A 3R3XA 3IE2A 5ES3A 2CD7A 5JMTA 3M6AA 4RTSA 2RGBA 1FTQA 1MKYA 4OXNA 1GM5A 1MFZA 1WCYA 3F9CA 3KE8A 4PPFA 4U7WA 2Y1CA 5DN6A 5HCIA 1DT5A 1TAHA 2XUQA 5E8RA 3ZBTA 5JCPA 4A6DA 3HCBA 1XU4A 4FQ8A 2H9YA 2RB4A 4BJ3A 2CMDA 1XZJA 2XB8A 5KIAA 4UHHA 2CUTA 4PC2A 3DOOA 4N82A 4DLKA 3TRHA 1I4WA 2I3ZA 3GJ7A 3OLQA 2HQ1A 3SF8B 1SN7A 1CQXA 5KKCA 3I0MA 5C3UA 4HFNA 4L02A 4Y6QA 5EWMB 3KG2A 2P5SA 4MUGA 4QYMA 4BQSA 5CA1B 3PJRA 3OCVA 3CLRD 3K7EA 4OQDA 3BHJA 3PHHA 3J7TA 5LZ5A 4QUGA 1ARZA 1WLYA 2C4UA 2QRLA 3LHDA 5DPMA 2P2NA 1TZKA 4YAFA 1MB4A 4LJRA 1CR2A 4LNUB 2Y4OA 4LJ7A 3B6KA 4TL8A 5DNDA 3VC7A 3AEXA 3L8ZA 2JJ2D 2A0WA 3BRSA 3DEHA 3JRWA 3O95A 2F6RA 4UU8A 5E0OA 3UAXA 5FX2A 3PFNA 5HYVA 4XGRA 4QOEA 1P1RA 1N1MA 1KGSA 2PU7A 1YR7A 3KU1A 3ZVRA 1XHLA 3EIHA 3RBXA 4FN4A 3VR4A 2JGAA 2Q0XA 3WK8A 1AV7A 4UULA 1IBKB 2ZSEA 1SUCA 1QAMA 1NN5A 1C8VB 3K0KA 4GPEA 4U2BA 1F14A 1WOMA 3MUFA 5ALOA 1I13A 3IHWA 4LKRA 1ILWA 2BM0A 1XXHA 2JBWA 3EDYA 2X1HA 5T64A 5IH7A 1EFKA 2YWGA 4TXNA 5BVHB 3NTOA 2XWSA 3O0TA 5JCJA 5ERGB 3N86A 3KXDA 3QX7A 3KPUA 4JJKA 4UDNA 4AUKA 4UBMA 2O2SA 1VPWA 4M1TA 1WY7A 3COSA 13PKA 4NIMA 4MV1A 3P9YA 4LYJA 4F2GA 1RE1A 5BWCA 4RD6A 5B3JA 4BP1A 2Q4RA 1QF9A 5MN6A 2D5CA 4QLBA 1P1KA 2OCKA 2GAOA 5T4FA 1Z4QA 4NCKA 3U4CA 1RM5A 2QENA 1BTOA 3S8YA 4XQGA 5EN4A 1Z5NA 3P1JA 1CQJB 2R4TA 1TIBA 2WLTA 2QVYX 1N5DA 1QF7A 2EGHA 1RQGA 1ZVJA 2YHSA 3ZOZA 1LQUA 1UXHA 1W4ZA 5GVRA 1SEPA 1Z0DA 2ETXA 3T0FA 5C1IA 2DLNA 4MQBA 2ZPTX 4U7FA 1WU7A 2EIHA 2ZR7A 3PHGA 2O2ZA 4HYEA 3NTVA 4GFDA 4NV3A 3UUFA 4BMXA 3IUMA 4MR7A 4DILA 1Q11A 2QBYA 1RWWA 1BCSA 1Q12A 3OOSA 4X7MA 3O4GA 5B1HA 4PAOA 2HJRA 1HTWA 1BKYA 1E7WA 1M2WA 2ZUCA 4UM9B 2A9OA 1WV0A 2BM1A 1ESZA 2JJ1D 1V4NA 1ABFA 2O1XA 1NXSA 2EU8A 4MVJA 1SC6A 3BRWA 1DPGA 3FPAA 5CYOA 2A0KA 2XYGA 4E21A 3IIJA 4EKNB 1N25A 1RU3A 2O07A 1Z7YA 2GTHA 4MAMA 1G60A 3IAUA 5A2GA 3BA1A 3GLVA 3EXEB 4TV9B 1GPNA 1PLJA 1U9ZA 2QTCA 1L7BA 3Q7PA 2O4UX 4JT8A 4PU0A 5E6UA 2Z5FA 5LN1A 4E6EA 2HQRA 2V0CA 2IOHA 4BP8A 1IYZA 2JZCA 3HPRA 4QHSA 3W4IA 2CWWA 4CQMD 3DE3X 4PGGA 3DTNA 3N8DA 4RW0A 1YK1A 4S0ZA 2FZVA 4ZDWA 4C4AA 4EK9A 4UAGA 4O0MA 3B1YA 1Q7GA 4JLNA 4QBHA 3I83A 1LF0A 4YQZA 1YU6A 3UOAB 3V3TA 1TVCA 3ANLA 4OXIA 5C4GB 1VHTA 3FZYA 3M8KA 5BW5A 1J1IA 3P9XA 4HLDA 4Y7CA 1LKZA 5EFOA 4RS3A 3RGWS 4GECA 3NTXA 4ESHA 1WUIS 4RACA 1U0LA 1A8PA 2YHUA 3G7NA 4YRJA 1K1EA 1W4BA 1WHSA 1NP6A 2B3TA 5CIYA 3C8UA 1MAHA 1B43A 2P40A 1I4LD 3LL7A 1GUYA 3LUBA 4LJ9A 1USGA 1R5OA 3AETA 4HMQA 4OYLA 5LA6F 2YS7A 2J6IA 3ROXA 5HZMA 4RULA 2ONZA 2HLNA 3KEOA 2BEKA 4IH4A 1N6RA 4J49A 1O96A 2BT4A 1Z13A 3S99A 5B3AA 3AGPA 1AD2A 2CLIB 3E82A 4Y1RA 1N7GA 2K2WA 3EHEA 1RWMA 3NVDA 1Q1NA 2PXHA 2YRFA 3M3PA 2AG1A 2G80A 5K0TA 3R0XA 3SHTA 1RP7A 3BFPA 1GZ6A 3EZNA 1P0PA 4YRNA 1NUPA 1QKJA 1KH3A 3MWKA 1EK6A 1T9HA 8ATCA 3DT9A 3WISA 5AJXA 2FW0A 4MVWA 2EP8A 4YECA 1FDUA 1WZIA 3WLLA 1F5SA 1Q74A 1ZOPA 3MPOA 2ZDGA 3N6XA 1P2FA 1PRYA 1DQSA 3HXOA 3INTA 4FSXA 3V1LA 3ZCQA 4GLBA 3LRXA 4LOKA 1CJSA 2FPKA 3NT5A 4U1RA 5M3BA 3UAOA 3UFBA 3VBCA 5K09A 5F2OA 4BO0A 3JTEA 2XITA 1ITZA 3EA5A 5EJEA 1KU6A 2E5LB 4KR6A 4MH0R 5JSZB 2JIOA 1Z25A 2JDIA 3UB4A 3CUVA 4HZUA 1DEKA 5BT9A 2X15A 1LS1A 1FTWA 4C3UA 2FPPB 2QRVB 4B9EA 3RAFC 2UUCB 1SKBA 4OLFA 5H16A 5LDHA 5T5QA 1H4TA 3IKMB 1IPFA 1JDSA 4IVPA 4UXJA 1FDVA 4JJ6A 3KTOA 4PX2A 1DKNA 4ZODA 3M6UA 1TVMA 3E3OA 3RC7A 1JIVA 5A9SB 3RU7A 2RGGA 4OQNA 3THXB 1ODTC 4JKOA 3AW8A 3N9IA 2R6JA 1BDHA 4Q47A 1FDIA 1LRJA 5C9ZA 1OFUA 4G5HA 2BHLA 2RGUA 3OQPA 4WX2B 4YMHA 5EA2A 5TY0A 1HNWB 1L4EA 4PYKA 4DN6A 1IBRA 1KERA 1QS0A 2RI1A 3QMVA 1JVBA 5A5EA 2L42A 4HLNA 4BE7B 2ZRLA 3NC1C 5TVGA 3OJFA 2HZBA 3AHJA 4UVIA 4HOYA 1JHVA 2CLEB 4HDKB 4IF6A 4N3NA 4O33A 4UHEA 2MSWA 4KQXA 3G85A 5A9TA 1KGDA 3T52A 3T6KA 3R8XA 1K8YB 4ID9A 1JWAB 2GPYA 4HH4A 2JAQA 4QU5A 2IZ6A 3PT5A 4CIXA 4EW6A 1UBRS 1LDBA 3IE1A 5HE9A 3L0BA 1DCKA 5FBZA 3ZZ1A 3U3JA 3WAJA 1B2LA 1XCPA 4I2VA 3ZCXA 2BEVA 2WIJA 3JD1A 3WZMA 3G79A 3WRYA 4QM7A 2PXXA 4RHCA 3O8QA 3ODGA 3DUWA 2FN9A 4PIMA 4RADA 4RZ2A 2IY8A 4PX9A 2Q5HA 1XJ5A 2QT9A 3ONDA 3VPHA 4DGSA 2WLSA 1N4AA 2I71A 2B34A 3ZHCA 5B2EA 4W5QA 4QICA 2LRHA 1NQAO 1V8ZA 1OLUA 2X40A 3SJAA 2OP1A 3QUSA 3LM8A 2QUKA 1JHAA 4POOA 1HR0B 2VTDA 2D1RA 4QWMA 4UZEA 3OFNA 5FULA 3ZGNA 1W19A 4ID3A 3TLZA 5H68A 2AW3A 1Z4MA 3DMPA 4N3BA 4RFSB 1YASA 4LVOA 5D3KA 2QSJA 1CY2A 4D9JA 4GYWA 4PLPA 1T4BA 2EEPA 4M8SA 1YAJA 4COOA 3QLEA 3TAUA 1XRPA 2JIQA 2F90A 3CRMA 3E9DA 1E62A 1ZKDA 5BMVF 2IV2X 4AFNA 4KIJA 4C0QC 2RD2A 4EB8A 1M5TA 4LDZA 1JEAA 1EP3B 1NV9A 2VQSA 1XCBA 4BX8A 1EBBA 1XDBA 3BMQB 3COJA 3DOIA 3P9RA 4OI0A 4LZNA 3BMOA 3OKCA 3HHPA 3DTTA 3JQGA 4R51A 4CDRA 1MRZA 1C1XA 1WUHS 2GPWA 1JIJA 5AKXA 4KQ6A 2Q3BA 2P9GA 3ZU4A 3UAVA 4YMWA 4DA9A 3WXMA 1CY4A 1KXZA 3NIDB 1U28C 3GQVA 3Q5EA 2ZYTX 3KTFA 4EPRA 4EVIA 4LHXA 4W5RA 3WGYA 4KITB 2ZM6B 1P81A 2F43B 2QEQA 1W30A 2VN8A 4K1LA 4WNYA 4ZO9A 2XD9A 1JMVA 3CJRA 2IDJA 1GY8A 1IQUA 3V4RA 4HWPA 1MJNA 4O4HB 1ZNZA 4YONB 3I3SR 1IVSA 4YRSA 2WWWA 1JE1A 1ORVA 3GRPA 2OM2A 3HXPA 1VE5A 1NRJB 5IHPA 4IZ6A 4BVAA 2E49A 3FSGD 3GDOA 4C7OA 5BN3A 3JWIA 1GCOA 3QI2A 2FCRA 5B7NA 1XJ0A 5DT9A 2Q27A 2TMKA 1TIPA 4FONA 4TYQA 1SPBS 1ZGBA 3GG2A 5KWEA 2D0OB 3IVAA 1A5ZA 3QIAA 4DPMA 1N75A 2C5GA 4I3GA 4MIEA 4PQRA 1P5FA 1M83A 1YR8A 2OAP1 2D7JA 2R6HA 4YRRA 3KHUA 3VYUB 3JQAD 4CW7A 3E18A 4G85A 3WYAA 2XOXA 4EIWA 1JJFA 8MHTA 1L5WA 3E03A 2FG7C 3A1VA 3DFKA 5B57C 1QNFA 3GJXC 4PBRA 5HEKA 5A3VA 3LCCA 3OU7A 3IBSA 4EZBA 1R0ZA 1RS0A 2C5HA 4IIEA 4J1TA 5EPOA 5IVPA 4JLBA 4RD1A 5AKGA 4D80A 2C98A 2FGJA 5D00A 4V0RA 1G5HA 4FMCF 3EW9A 2ZBVA 3TB6A 4UOEA 3PGKA 3BJZA 3G89A 3IYLW 5HF9A 5TVKA 4O8ZA 3UMGA 5DNYB 4IWYA 2CWDA 1I5OA 5DBOA 3AIMA 5F1KA 2QN2A 4BP9A 2AB0A 1GOTA 3G2JA 4EL0A 4AAYA 3PFKA 2AMYA 1M8PA 3ZWMA 2Q5JA 1UC8A 2JPDA 1IM5A 1BVRA 4FE3A 2DFKB 3FPFA 1PK8A 2JFXA 1KZ1A 3BFXA 4NBNA 3PC2A 4L8VA 5IBRA 2B1QA 4GKBA 4AP9A 1W4CA 5KNDA 3P0RA 1U9CA 1GITA 5FWXA 2VA8A 1G3RA 3M5WA 1D0VA 2VJDA 3STYA 2C2HA 4RF5A 3T3EA 5LP6C 3PDHA 3GFBA 5K8JB 1L4YA 4NZMA 1T5IA 1T5HX 2JK1A 1LC0A 3E5NA 4GQAA 1FFYA 3RAGA 4MUJA 3ZHRA 5KOJA 1RQ7A 1XAJA 2PD6A 4J3NA 4QTXA 2GBCA 3I04M 4C6HA 4D9EA 2FU5C 1SUEA 5HK8A 1RACA 2FXVA 5E3HA 1K5GA 5BURA 4R16A 3AZQA 5ANRB 1XTKA 3ZZMA 1BH6A 3HP1A 2BEJA 2P4QA 3IMKA 4J2OA 5CNJA 3RS5A 1ID8A 3I5YA 3BREA 4CM3A 2G9QA 1CZNA 3KZCA 1I0ZA 5KJFA 4JYAB 2WWIA 2C7GA 3DL0A 5TR9A 3B20A 5BQ3A 1N34B 1EWRA 5B6IA 1R5NA 2VRBA 1C9YA 4KGVA 1BROA 2FQXA 2HH9A 2QN8A 1R1DA 3DDUA 3H65A 1Z9BA 4JU9A 3T7KA 5F1YA 1V4BA 1MJGM 4FR0A 3DV0A 2NVUB 1E5LA 4XXHA 4XIGS 2I2WA 3D2AA 3FVQA 1G20B 1Q17A 1E99A 1PW7A 1QONA 1UCFA 2FUNB 4I1YA 4ZQEA 4Z0HO 5GONF 3GELA 4JBYA 4COKA 1KMNA 4XFKA 5LVAA 1V0JA 4QBGB 3IPLA 4EG8A 2BZ0A 1PJCA 4GPZA 3DE5X 3GEDA 1Z62A 4OXKA 3DVLA 3WMWA 4DQ0A 3TCKA 1IC6A 1R15A 1R27A 3U7FB 4U8GA 4GKJB 1BD3A 1EZZA 1NE7A 1BVHA 4TXJA 4RTPA 1NOKA 2PT7A 2Y9PB 3L6UA 1XFAA 1Y5MA 4PZDA 3V2IA 1YONA 3NKVA 5ICGA 2WQ6A 3WBFA 4ARUA 4FIZA 3TKYA 1R16A 3O8BA 4MGEA 1WD5A 4NJMA 1AXRA 5B58T 1CC1S 2C0CA 2NLOA 3S40A 3Q7RA 1FU4A 2X5JO 2AJCA 4CQNA 1SFRA 2PT5A 1QX4A 3WV4A 3FOEC 2E3JA 2AG0A 1GG8A 2R8EA 3DONA 4JT9A 1YB6A 3WKDA 1PV2A 4EO9A 1OAOC 1A8HA 4RTKA 3D6NB 1QM5A 2ZRNA 2FP4B 4ZU6X 2OR3A 1XX6A 5FB3A 4K6KA 4DG9A 3BMXA 4DEVA 1C3OB 1NAIA 2A9VA 5EAIA 3A25A 2B4TO 5JROA 2SCUA 1BXGA 4P93A 4LCBA 1QU2A 4PR0A 4L4RA 3AV0B 4KPGA 3VHXB 1GKIA 1COWD 3H1FA 4EB3A 5JQGA 2YUTA 3TMAA 4GZ6A 1Y98A 2G7MC 1ZM3A 3IQFA 4NOMA 2VSOA 3S2EA 3LCJA 5K4AA 1ZJYA 3HI4A 3D9QX 4FFVA 1W581 4KXUA 4NEGA 1DE0A 4UE6A 3V9PA 1D8TA 3VR4H 4V1CI 3QVJA 3GLGE 4FFSA 3KB2A 3PZRA 4BAZA 1TCAA 4IKPA 5G40A 2BMFA 3TVTA 3HJNA 2VPIA 3DVAA 2XZLA 3A4VA 2N0SA 2P3SA 3LXUX 1Z88A 5EP1A 2XHZA 4HDSA 4EEKA 3BK7A 4CBVA 3PE6A 2Z2JA 1HH4A 5FA8A 3E7WA 2IY7A 4HWGA 4PLVA 4GOOD 1EG7A 1NVVR 3IEIA 3MN1A 3F4BA 2QS9A 5DHAA 3RABA 1GDHA 2VSFA 3TXAA 3SIPA 2BFFA 2H18A 4I9UA 5EXEA 5G0SA 4WXYB 3VISA 2QMOA 3F8WA 1J2UA 4PHCA 1VLLA 3NH6A 2CNWD 3GGDA 3PRKE 2AN3A 3IDAA 4R84A 3FROA 4WEQA 5HJ5A 4L5IA 3G2HA 2YW9A 5HCUA 5FR1A 3W8RA 4DLVA 3WNZA 2BH9A 1E9BA 1UZNA 4CFYA 3MMNA 1R0SA 3KZNA 3W5DA 3SQMA 1Z47A 1AQYA 4AZWA 1T3LA 2NAPA 2GHRA 1K68A 5IUJC 2Z30A 3WGNA 1UZUA 3HV0A 3DGEC 2HA4A 2GFHA 4MWSA 1VB5A 2E82A 4TKUA 4DJTA 2JS7A 3AI1A 4NYIR 5JT1A 1NWCA 1E96A 4NSNA 4RPKA 4AN4A 5HKOA 2H59A 4L9RA 4Q21A 5CK4A 2GKGA 2VSQA 2KMLA 4MJLA 3IGFA 2BMVA 2RARA 2W43A 2E5WA 2B25A 1K8QA 2EDAA 4MVJH 3ESYA 4LYEA 1HQDA 4AURA 3FLMA 1QHFA 4D26A 1D4ZA 1W0KA 1ECFA 1HWYA 2GO1A 4G37A 4U7TB 3NUGA 1NLUA 3PXXA 4Z54A 4E4YA 5TLSA 3PXBA 4J6EA 1EIZA 1VL1A 3VTKA 2O8CB 1QYRA 1R4ZA 5CLLA 3KDPA 1C4XA 1RWOA 3SQOA 3IKTA 1BHO1 4FINA 4I4CA 1OBHA 4ZCIA 1ZBDA 2ZAGA 3EQ7A 3T9EA 2ZJAA 3NM6B 5TXGA 4LHYA 3O47A 1NVEA 2YNMA 2ZT8A 4F93B 2ODAA 2IS4A 3AGQA 1SHUX 2COUA 2D13A 3D5EA 2R5FA 1J1UA 1OXVA 4DLRA 4LCEA 1WPGA 2ZT6A 1D9XA 1KPHA 1CR0A 3I61A 2XRZA 5AW4A 3ES9A 5MGNA 1VDZA 2H48A 4OAPA 4QJ5A 4R4JA 5IEBA 4OHRA 4M21A 5JWRA 1TF2A 3JQCA 1E9EA 1P18A 4BAUA 2BKEA 3RK1A 5KTOA 4QUAA 4HDAA 3KWMA 1E6WA 1ECLA 3DMTA 1DG1G 1J33A 2A7QA 1YTLA 4LDPA 4L57A 1TK2A 3EXHB 3DQQA 1P17A 4U2GA 4AK9A 2GN6A 3I3OA 4HJXA 1JUDA 2Z8ZA 1RBZA 1V8BA 1SXQA 4L22A 2JIZD 1DX6A 1U2PA 2PZBA 4RC9A 2IUUA 1HQYE 2REOA 4DA8A 3R24A 4LOJA 5JY1A 1GPWB 2WZBA 4XUCA 5CM8B 4CTJA 3TGPA 3SC2A 4OO3A 2YUIA 2V3VA 1JQJC 2E6UX 4E2FA 1C7RA 3A6KA 4Y7DA 4OYYA 2WEKA 3T5GA 1UT5A 1S7CA 4JEMA 2GM9A 4WJZA 4IDPA 4QYIA 1VOTA 2BEWA 5CR9A 1T0PA 3TL3A 1QHGA 1W0JD 1AGPA 2AX3A 3W6PA 3A6FA 2AKEA 4BFWA 5ARDA 1RM4A 3OOEA 1YHZA 4NH4A 4QDKA 4ZVRA 3EQ6A 3WVNA 1GZUA 1KOJA 2IOFK 1IWBB 3AESA 1FJGB 4LDNA 1MVOA 4QDJA 5BV1A 1TUGA 2PUGA 2VTBB 4QC2A 4YIKA 1VGQA 2G28A 4QL3A 1U94A 5D1HA 3NGLA 5C1PA 4PZYA 3D8TA 2VATA 3WNQA 5LB2A 3Q5GA 4BLTA 4BPBA 3OZIA 5JARA 3GFGA 1N78A 4F9GA 1VTKA 4ASUA 1G5FA 1X80A 3V8VA 2PLFA 3EFOA 1QV6A 1HE1C 1ZOOA 2QZSA 4AF6A 3Q3EA 2ICAA 1Q1BA 3GVCA 1VGRA 4UVEA 2I8CA 1NXPA 1OU0A 4HI0E 3RI3A 3RUAA 1E4YA 3KBOA 2PX3A 3MVEA 2B37A 3Q7QA 2ZJ1A 3AR2A 5LZ2A 2ZGVA 3EZLA 3V6MA 5BPFA 3NBYC 1HF3A 1ZN9A 1SBTA 2XKBA 3AYZB 3GEBA 3VJLA 2AEMA 3U9SA 4U00A 2FK8A 3PUZA 1ZH6A 3EVTA 4PLFA 3RSCA 1G3UA 5IXJA 3EB9A 2UXCB 1IDN1 4UFPA 4OHMA 3R7NA 1A8QA 4INAA 3ZHVA 4B17A 8LDHA 1WEHA 4D57A 1TTQB 3JD2A 4PZUA 5AK0A 2WVJA 1GT6A 1ZD2P 2DETA 3G9ZA 2VP3A 2RC6A 3M7IA 1FDRA 1OBFO 1K63A 3PUIA 2QN1A 3M6LA 2HIAA 3L8EA 4C0LA 4KPEC 2AN4A 2O3SA 2I9PA 2PV7A 2YJGA 4JLSA 1T5SA 3N2GA 1WABA 4X8LA 4B85A 1DBPA 1G7TA 1JQ3A 1UQUA 2EFDB 3VNVA 3TAHA 5LLDA 4XB6B 2YXEA 3IUPA 3ICWA 3O1JC 5D8DA 5FI1B 3FHCB 2BGRA 2OB2A 5A3QA 1ZFNA 1CP3A 4MK4A 5HUQA 1CR4A 4P7FA 3T3DA 3UUWA 4KXNA 3RM3A 2ZSKA 1M2VB 3EGWA 2ZVPX 3Q2OA 1MQ8B 1NLFA 4QPDA 3U7GA 2JGEA 2D1SA 4DCVA 1YQUA 2PRJA 1RFLA 1QCDA 1C7ZA 3ZW7A 1R6UA 5EIEA 3TOXA 1JIIA 2YYZA 1VMEA 4RZHA 5GPBA 1GTVA 1H6BA 1NPTO 2O8DA 1I4EB 3SHFA 1U6KA 2PT6A 4UBJA 1EWYA 2EW1A 2WBLC 3W8FA 4OEHA 3AEQB 3UW1A 2OGTA 1GZ3A 1RBMA 1E8NA 3LYUA 4YAUA 1K3UB 2HU5A 1F3LA 3R74A 1P2DA 3U37A 1OLOA 2BR3A 3F78A 3M1LA 5A7HA 3IVXA 3MT8A 4L0CA 4K9MA 4JI0B 1KY2A 4D3FA 1QRUA 1QK5A 4NV0A 4P38A 3Q7TA 4X8MA 4KR9A 3X1JA 5DNCA 3BJIC 4OTZA 4WINA 1VFPA 2QJFA 5DYWA 3KTDA 3H4IA 4NH0A 1KYZA 1N6HA 4ZA2A 3KAKA 2ENWA 4XKJA 1ZN8A 4EF4A 3B5IA 5CIWA 4E33A 4YT4A 3ZHQA 1XDDA 1OPXA 2Y1XA 1ZWLA 2P5YA 3I52A 3PITA 4MDHA 4YGXB 5T41A 4IQGA 4JQCA 4OHUA 3HUUA 3NHBA 5EZYF 4ZAYA 1BHJA 2GEDA 4KFSA 3EXFB 4YK7A 5B4UA 2V58A 1XK6A 3NHRA 2I7XA 4OLHA 3UG6A 2OBNA 2Q8NA 1JP7A 1R4MB 1LWNA 4GX2A 3VPAA 4EKIA 4N3CA 4AD8A 3LC2O 2TMGA 2VCEA 4OP3A 2P2YA 3WYEA 4EL5A 1QYCA 3OG9A 3R23A 4QTTB 4B8ZA 3C48A 4LY3A 5LQAA 4LKOA 3E8MA 1FSPA 3NOXA 3OMXA 4D9MA 3FDZB 5F1PA 1RLUA 3RRJA 3HI6A 3KWLA 3ZIDA 5HZHA 4TXLA 3TUZC 3BQMB 2WP8J 3CVOA 2PJDA 1TKRA 3DMDA 1MO3A 5COQA 3QUBA 2YBEA 4ND4A 3BS4A 4Y6PA 5FA6A 5LPNA 3FUWA 3L4SO 1S6YA 2B82A 4MVCA 4R6WA 3DZ8A 2A9KA 3F74A 3PRYA 4R9UC 2JFZA 3O91A 5JE8A 2NZWA 2VO1A 2VP0A 1P19A 2XTNA 2RH5A 2DJIA 3F97A 3O84A 2VCHA 4OJYA 4WZ6A 3STTA 4EG5A 4ENSA 4IBOA 3O82A 1QB8A 3DPIA 1GPLA 4CVNA 4BKUA 2CVQA 5KOIA 4GBJA 4N01A 2HOQA 2XUGA 3U7JA 1F7VA 3GXBA 3C7AA 3KPWA 1FNBA 1RHQA 2PGJA 3RHSA 4U7DA 1KOFA 3IEVA 5AHOA 2XDQB 3OLZA 1KEEB 2APJA 3TLMA 1YRWA 4YCLA 3MINB 1L5VA 3WLRA 3V2GA 4ITRC 1KAGA 1ZQ9A 3PGA1 4GWLA 2ABWA 1QP0A 3T8YA 1G59A 1NVDA 3P2KA 4ZMBA 2W71A 2X9VA 3K8OE 1PFWA 2WKPA 1NR1A 2F1OA 1O0SA 2LXNA 3DXFA 1GA1A 1QKKA 1QLJA 2WF6A 4JP3A 4PV7A 5DGXA 3EXAA 3KUKA 3RNLA 2WRZA 3FRHA 2X2OA 1PD1A 1YQ9A 3Q7IA 4LVUA 3P5BA 1GGVA 2R97A 5B1EA 4FUQA 1E9AA 3QUAA 1Z74A 2PEYA 1YULA 3AM5A 1DELA 1Q44A 3ZZNA 4ATNA 4B44A 4ZCRA 2BBSA 1KSJA 2EQ5A 1L4KA 4RVCA 3ETJA 3C3MA 1T2UA 3ITDA 1EXDA 1C9JA 1TL7C 1UP4A 3VX3A 4GLOA 3V46A 1Z2AA 5AVZA 5J2TA 1E2GA 4E07A 5HRCA 4WJLA 1QHXA 1AKEA 2PUHA 4KK3A 3DJYA 1QP4A 3K6KA 1L9KA 3L0DA 1MC5A 2HK9A 3RVLA 1NUSA 4YAJA 4YT5A 1C7JA 3AW9A 4D4MA 4DMRA 3A6ZA 4YJHB 4U9HS 3RSHA 2GPJA 2P69A 3OEHD 1HMYA 4BE4A 4EQ6B 3BPSA 1SC3A 4BQIA 1OF1A 3VU3A 5DEOA 5LWHA 4KXFB 3IO3A 4QARA 5BWBA 3LT1A 1UK6A 4LZZA 2BGTA 5LUBA 2XVAA 1CETA 1MO4A 2BFBA 4L27A 1DWPA 5AJTA 4LC1A 3SPXA 1XKQA 4MPTA 3CF2A 2QYOA 1F51E 4C0XA 3W2HA 4G1BA 2FR8C 2CCJA 6PFKA 3OQIB 4A6EA 4DSAA 3OF3A 3RVNA 3UOGA 1BQ3A 4LTMA 2OQ2A 3FMPB 3JXEA 4Z86A 3EPKA 4RKWA 1G8KA 4WY2A 3AVYA 3ZXSA 3ESQA 3SZMA 3S3TA 8AT1A 4CL2A 1Z5UA 4UNPA 5TS3A 1LTQA 1I6LA 1KMCA 1IL0A 5IP5A 5JAZA 3BBLA 1S5PA 4IIYA 1VKHA 2WMNB 1YS4A 3ZXYA 4ESEA 2R62A 3O7WA 4KQWA 3TLXA 3RDPA 5BQFA 3A9SA 1MR3F 3FD8A 2J9FA 2FW7A 2H4WA 2NWQA 3GFPA 3L49A 4FHCA 4FFLA 4NXMB 3W6NA 1JSXA 4JLOA 1MH9A 1YL6A 1L6IA 3Q8WA 4RD0A 2HWWA 3LC0A 2PTGA 4TL7A 2HWYA 3KJHA 1UDXA 3EMDA 1H3NA 4KSYA 4NESA 3V55A 3F73A 4FQ7A 1S2MA 1RYMA 1RWVA 1L3CA 2C4HA 2DULA 3DJFA 5BQPA 2PBLA 1PR1A 4JB0A 1OSNA 3Q0EA 4WLOA 3OFJA 1TZMA 4OQEA 4AWXA 1G98A 1MUUA 1UBLS 2NYAA 1MC4A 3DMHA 3EUFA 3WGLA 4BFLA 2IBSA 2R7NA 1Q1EA 3JQAA 2BGJA 3P94A 4V3CA 3BXPA 2IWHA 5BV0A 4NQZA 4YUWA 5TQ0A 1OMOA 4J0EA 4O4JA 4BZWA 2DMRA 4U02A 2H4JA 2R1VB 3VOBA 3WYNA 1NATA 3H6GA 1NX6A 2AOWA 3B38A 7REQA 5T67A 2QU8A 3M4ZA 1PGNA 3ADOA 2PZLA 5JXJA 2DPLA 4EJSA 4E46A 4IDHA 2D62A 2QVXX 4DY6A 2IEAA 2NZJA 2AIRA 4MS1B 4E5MA 2G07A 3KOMA 1DEOA 1U04A 4G2TA 2PZKA 4ZIRA 3COZA 3A1FA 3J80A 4LFBB 3I9KA 4GXNA 2JCVA 4H3HB 3AC0A 4GX0A 4K9PA 1U1IA 4HAWA 4NE2A 1KK3A 5J2UA 2LIVA 2IUTA 3WMXA 4Q9NA 2P9ZA 3OZBA 1LXCA 3K1AA 4C1NA 2OO7A 1L7PA 1ONSA 1JDNA 2O8BA 2ERXA 1U3UA 1ZXBA 3GLTA 5FQOA 3THRA 5JD5A 2GGSA 2RHHA 1A1VA 3TH5A 4P82A 3TQRA 3DCIA 4CQLA 2H4YA 3CH4B 3VH4A 2EL7A 5EWLA 3GA0A 3VZCA 2Q2QA 2P90A 2G1JA 3KLPX 5AIBA 2CKMA 5TPZD 1GGNA 1YNSA 2EBFX 2V8BA 5DGTA 4UUOA 5L8VA 3FJ1A 3RK0A 2ZSUA 4FGSA 5DYNA 2ACVA 3QF4A 1Y3AA 2GNAA 1CVRA 4N8DA 4ENQA 4EA6A 3A04A 2W2LD 1V8PA 3DOUA 1JIUA 3TG2A 1WF6A 1B8UA 4P8RA 1QOZA 1RC8A 1XVUA 3DHVA 4GMGA 4L95C 3PEYA 4R1TA 1FYVA 2EQAA 1FMFA 1WB5A 2DBRA 5DZSA 2GN0A 3VR3D 4W9NA 1C8LA 4Q3EA 1QP7A 3TW8B 3GK3A 1EK0A 1S2DA 2LE0A 4G1VA 3KLMX 3NBFA 1OE0A 3GH1A 3KKEA 3MGAA 4PTZA 3TZHA 2H00A 1DAHA 1JS1X 2QMHA 2QZ9A 3QP9A 4G67A 4J4HA 4ZN6A 1FTSA 2DG2A 1VSVA 2BMWA 4J7CA 2L0XA 4KQ9A 3SC6A 1DZ3A 4D0NA 5FUQA 4NENB 5LU9A 1SK8A 4H7DA 4ZHQA 2P3OA 1UMBB 4P53A 4AJJA 1B0PA 1Z0AA 2FPSA 3WLQA 3B7PA 4JT4A 2PN1A 1DC5A 3TD6A 3ADDA 3TQSA 4CFSA 2IS1A 3BX1A 2BBWA 1NJ1A 2B1RA 4P35A 4XGKA 1ZR4A 1CY6A 3ISJA 2Q1TA 5ALTA 2I1WA 1P2GA 3I9OA 4CF3A 1Q7BA 2V45A 3GI1A 1BJTA 2X86A 1V48A 4XARA 2W0SA 3JU3A 1Z4NA 1F8GA 3PPIA 3H8JA 3KVRA 3PT9A 1HKUA 3JQ9C 4RQUA 1GR1A 5G4KB 4CR8A 4CIBA 1G9TA 4AF8A 5KTYA 4R3NA 2ZZNA 1Y81A 2VJOA 3WRVA 2DERA 2EBHX 4FYWA 3T1VA 2YWEA 1WV1A 2B4KA 1B6TA 4MVJM 4D44A 4DLUA 4AY2A 4O2AB 1PQYA 2DT5A 4I6EA 3FOWA 3BXEA 1WW3A 4EGJA 1PT7A 4RPGA 5CA0F 4G56A 5H83A 1DIAA 3RQSA 3TD2A 2ODPA 4JJGA 3W5BA 1E6KA 3FFBA 3U4IA 4PSVA 1I33A 4NBTA 4ICIA 2P3QA 3UXEA 2IW1A 3CW9A 5F23A 3J81A 1COWA 5LZ9A 5BNTA 4DJAA 1D1PA 1SRRA 2XRFA 3EARA 3NVKI 1DAEA 2V5UA 2G08A 3H8WA 3KETA 8GPBA 1F06A 4V0KA 1FXWA 5D3MB 2OHHA 4INZA 3SD7A 3I37X 4TSFD 4D4LA 2WSSD 1FP1D 1PEYA 1CK4A 1GU1A 3CRW1 3G49A 1UPFA 3EMVA 4N0DA 5E8JA 1C9NA 1FS6A 1AQ6A 3E5HA 2R87A 1H1DA 5IKPA 3PX3A 1M8JA 1XAHA 4IXNA 4BLPA 4C4TA 5LDDC 2JLXA 3G17A 4Y6SA 4C9BA 1U65A 2VHVA 3TTSA 1GA4A 2WFLB 3ZHYA 1HZZA 3U3ZA 1E7MA 2HHLA 2MR5A 3PYLA 3R6WA 2J0VA 2ONCA 1L5RA 3EBLA 5A1JA 3UEOA 2AFIE 4ZICA 4KC0A 4XE5A 4WZAB 3UJ8A 3ZN2A 2YRWA 2V9PA 3N70A 3BGDA 4OHBA 4LXGA 5CDSA 4RK4A 1JKFA 3OQ6A 3PUJA 5GTDA 1O5IA 3H2JA 1YS7A 1NONA 1ND6A 2CNWA 2FW1A 1PK9A 4OIMA 5SY9A 2WHPA 2J3EA 2BKUA 2JLYA 1QYIA 3U9LA 1W85A 1QRAA 3RU2A 3LCVB 4YJ2F 1WXDA 5AI0A 4E1BA 2G9RA 5C32A 3ETHA 4EAQA 1POXA 2AFRA 3MJDA 3CQ9A 4KW7A 1Z83A 1MORA 2XYPA 3VOSA 2HT6A 2P8SA 3KUXA 3ZJ5A 1E1NA 5F2KA 1M8GA 4L4ZA 4DRXA 1YOVB 4EO4A 3O8NA 3O94A 3GZTB 1YJAA 2RHDA 3R9IA 4CYMA 3AH8A 4FE4A 5JWOA 5IKOA 2HMWA 1YR3A 1EFVB 4TYYA 3PC7A 1RT9A 3KQUA