2JL1A

Structural insight into bioremediation of triphenylmethane dyes by citrobacter sp. triphenylmethane reductase
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
287
structure length
287
Chain Sequence
FSIAVTGATGQLGGLVIQHLLKKVPASQIIAIVRNVEKASTLADQGVEVRHGDYNQPESLQKAFAGVSKLLFISGPHYDNTLLIVQHANVVKAARDAGVKHIAYTGYAFAEESIIPLAHVHLATEYAIRTTNIPYTFLRNALYTDFFVNEGLRASTESGAIVTNAGSGIVNSVTRNELALAAATVLTEEGHENKTYNLVSNQPWTFDELAQILSEVSGKKVVHQPVSFEEEKNFLVNAGVPEPFTEITAAIYDAISKGEASKTSDDLQKLIGSLTPLKETVKQALKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRIPHENYLMETHANE REDUCTASE
publication title Structural Insight Into Bioremediation of Triphenylmethane Dyes by Citrobacter Sp. Triphenylmethane Reductase
pubmed doi rcsb
source organism Citrobacter sp. my-5
molecule tags Oxidoreductase
total genus 110
structure length 287
sequence length 287
ec nomenclature
pdb deposition date 2008-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2jl1A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2jl1A02
1AGNA 3U5TA 4YJHB 4S3MA 5G0UA 2UDPA 3L0DA 4QSMA 3ZV3A 1GZ4A 1H9BA 4MVJI 4UUNA 2A4KA 1GV0A 3KLPX 3EZYA 4QUKA 2YJZA 1HDXA 4D7AA 1YWGO 4LVUA 4WCDA 1QV7A 5TX7A 3TSCA 5FFFA 1KVUA 4Y6SA 4EBFA 3U4CA 3DONA 1PJ3A 5C7IO 2O48X 1DRVA 4CODB 2ZCUA 3E03A 1PL7A 3LZ6A 3A1NA 5I9NA 4L75A 5DN9A 2X7HA 2FSSA 2WD7B 4IXWA 5CHEA 4BGUA 4XB2A 2XPCA 4OGWA 3P5SA 4N5LA 3RJ9A 2VYVA 1KVTA 3E5MA 5ICSA 3BMNB 3UW3A 2XAAA 2EGGA 2J8ZA 2CDBA 3QLJA 1HWYA 5BSFA 3RUIA 4MP6A 5TC4A 2OP1A 1C1DB 2IDZA 2ZJ0A 2OZPA 3ONFA 1NR7A 3ONDA 3FI9A 3SJUA 4ZGWA 4J2OA 2NVWA 1K5HA 3DO5A 4HXYA 3LC2O 4GGPA 4EJ6A 5L45A 3PQEA 5G0VA 5GZ3A 5A05A 1I24A 2ZQYA 4J91A 2NTVA 4Z0PA 2BELA 3FN4A 2FY8A 1WZEA 4J1QA 3R0IA 1PJ4A 4WK6A 4WJZA 3C7CB 1H6CA 1V3TA 1SBYA 5TNXA 1GZ6A 5ITVA 4GL4A 1QLHA 2E49A 4J7UA 3E6AA 1LDMA 3VH3A 5G0TA 4R68A 5CP8A 4D45A 3V2HA 3EMKA 3NUGA 1ORRA 1MXHA 2D1YA 3Q1LA 4J49A 4IDGA 3OEWA 5CPFA 3VPXA 3VVCA 2BGLA 1Z82A 2EWMA 4NFSA 2PY6A 2RH8A 3DZIA 3DB2A 2I66A 3V1TC 2B4QA 4BB5A 5IN4A 1C0IA 1P3DA 1V9LA 1LSUA 4AJJA 1H2HA 2X8LA 1HSOA 3HHPA 4Q3BA 1DC6A 4RL6A 4D44A 2VNSA 4CM4B 2YHUA 1PL8A 1NVMB 3ETGA 3DFZA 4IIUA 1VSVA 2VYND 3I4CA 5KKCA 4BKPA 3DMYA 4CLOB 3NT4A 4FPXA 1GYPA 4HKTA 5G0SA 3WG9A 1H6BA 1PWZA 4E33A 1H6DA 4UVEA 1M6WA 1ZMTA 5A1TA 3WOHA 2WDZA 3OH8A 1XHLA 1D4FA 1K6XA 3WGYA 1ISJA 4CQMB 4ROSA 2ZYDA 2BHLA 4KP7A 2JCXA 4QTZA 2BLLA 5A03A 3HDYA 2O3JA 1CQIA 3T7CA 1OC4A 3P2YA 4MKXA 4CMIB 3I23A 1K3TA 3ZNOA 3LC1O 5A9TA 4JP2A 3VZSA 1W4ZA 4ALLA 2P2SA 4F6LA 2AQKA 2AE1A 4XYEA 1U5AA 3G79A 1OBFO 5DCWA 2UUOA 4J9VA 1W73A 1XGKA 4RF3A 4FFNA 4O59O 4YAJA 2GDZA 3AFMA 1I32A 5IN5A 3TFQA 5TLSA 2EV9A 1RM4A 2PFGA 1N5DA 4AFNA 1YE3A 5JY1A 3CZRA 4P4NA 3NDJA 6LDHA 1GL3A 1U9JA 4IDBA 1SEPA 2F1KA 4NQZA 3ZU3A 4MVJG 3Q2IA 1M6HA 1T2CA 3NGXA 4BNHA 3TRIA 4J0EA 1XU7A 5A5EA 4BQPA 5CG2A 1OAAA 2Y05A 4Y98A 3IKVA 3CINA 4CV2A 4NK4A 2Y1OA 5I9LA 4EYEA 1PGQA 1PGNA 2H63A 2ZB8A 1W0CA 4PVDA 1H9AA 5CG1A 1ZFNA 1A4IA 5JY6A 3EYWA 3ZWOA 3LSYA 3AY3A 4FC6A 1O6ZA 2J5KA 2R2GA 4B7CA 2EW2A 3UHAA 1UZLA 1R0KA 3EK2A 3S2EA 2X5KO 3SEFA 3OQ1A 2IXAA 5CDGA 2GZ3A 2XF8A 1PQPA 2GRAA 3C7DB 1PIWA 4CQMD 2X6TA 3FWNA 4PLYA 4AICA 4XYLA 3PJDA 1BGVA 1ENZA 3AM3A 3RJ5A 2WYUA 4INAA 2Y0DA 1MGOA 2Q4BA 4CLHA 1CRWG 1Z75A 3V8BA 5JC1A 4JNKA 5G4KA 4BKRA 1XEAA 3H5NA 4DIOA 3F47A 3UCXA 5JDIA 1KVQA 5DNAA 3H7AA 1J4AA 4OO3A 4BNTA 4DPKA 1R15A 4D3FA 1IZ9A 4H3VA 1LJ8A 4DQXA 1GQ2A 1NQ5A 1EVIA 2WMDA 3D3EA 4I5EA 3GRPA 4CMEC 3N7UA 2W2LD 2YDXA 1Q0QA 3FR8A 4BMSA 1JQBA 1E7YA 1JU9A 3WWZA 2AEMA 2QX7A 1CQJA 3DR3A 3G17A 3FBTA 4ZA2A 3O8QB 4AJ2A 4CV3A 2HMWA 2X5OA 2P91A 4DLAA 4AJ1A 2NUAA 3E8XA 4ESOA 4G65A 3WTBA 2G76A 3BMOB 1SOWA 3GDOA 3OJFA 2RHCA 2YW9A 3DBLA 4BKUA 3QW2A 1MXFA 3BIOA 3PI7A 5BQFA 5T5QA 4JCOA 3HB4X 2YV2A 4DREA 1ML3A 4GAEA 3G0OA 3NV9A 5CEJA 4R3WA 2VHYA 3ZWBA 4D3SA 7ADHA 5ILGA 2V6FA 4ND4A 3DBRB 4CV1A 4PLWA 2EP5A 1E3WA 2ILTA 3W8FA 3DBHA 4KUHA 2CDAA 5C3MA 1Y8QA 1VC2A 4OM8A 3GVCA 4R1SA 2OHXA 1IHXA 1NNUA 2DTXA 2Y1EA 3JQBC 3CKYA 3K30A 1E3JA 1CYDA 3GNQA 3ROMA 1P1RA 4FJ0A 1YXMA 2QG4A 2XXJA 1BXGA 2WWRA 1B8UA 2IXBA 3PLNA 1X0XA 2YQ5A 4YPOA 4BKOA 2CVZA 1NX6A 2RBEA 1EDOA 3H5RA 2CFCA 3IAHA 4IIVA 4XQCA 4Y67A 3F4LA 1QMGA 4NNJA 4TSKA 4A27A 4M8SA 1JW9B 3QE3A 4PG7A 3C24A 3WS7A 1X0VA 1T24A 1FXSA 3C3XA 4BGVA 1IYZA 3WGIA 3GMSA 3CIFA 3NT2A 2E48A 4YJDA 5T57A 3RU9A 4L0QA 3VPHA 4ZU3A 4Z0HO 3B1JA 4TZTA 4GLLA 3T7EA 5GZ6A 2DFVA 4LW8A 1GCOA 9LDBA 1BW9A 5TT0A 5C37A 2NQTA 3EUWA 2OORA 3WMWA 3GUYA 4IUYA 1YB1A 4B7XA 1JDJA 1MFZA 4KTTE 4GLOA 3I9JA 3MJ4A 4HP8A 4LVCA 4E2WA 4DC1A 1MX3A 1VL6A 2PGLA 1R37A 3PQFA 3ZU4A 1GQQA 3B6ZA 3GVIA 2X1HA 4OSPA 5TF4A 1PQWA 1NAIA 3CEAA 4LSWA 4R1TA 3G1TA 3TZ6A 1BVRA 3KHUA 3IP1A 2Y99A 4PFJA 5DCUA 2VWHA 3NT5A 5EESA 3PJFA 4U0KA 1C14A 3IC5A 3QSGA 3B70A 4WPGA 3OEYA 3VPGA 1ULSA 2Y68A 3JD2A 4H7PA 4DPLA 4J0FA 3Q6IA 1ZCJA 4XGNA 3WBFA 1E3EA 1CETA 3VZQA 4MP8A 3BAZA 3V2UA 1E92A 4TRJA 4TVBA 4L4RA 2YZ7A 4C4OA 5U9CA 3FR7A 3H5AA 4JGBA 4DBZA 2DVMA 1P1IA 2WD8A 1ARZA 4IZHA 1DEHA 3VDQA 2AG8A 4MVJD 3ITDA 3G3EA 4E2ZA 4F3YA 2FPGA 4HFNA 4MDHA 4NR0A 3WFJA 5CDSA 1W8DA 1CEQA 2VCYA 1I3KA 4Z6KA 4JQCA 4YT4A 4MINA 4U5QA 4IDEA 2O4UX 4ONEA 4Y9DA 5HM8A 1HSZA 4J43A 4ZQEA 3E9QA 5KJCA 2QIOA 4YDRA 1LLDA 2C54A 2VTEA 1KVSA 3MJSA 2CD9A 2DBVO 1DHRA 2QHXA 3BMCB 4GKBA 1YB4A 4IQ8A 2X22A 2H9IA 2C5EA 4UREA 1WW8A 3GQVA 3AUTA 1ADCA 4ZQBA 1HLDA 1YL6A 2ZTMA 1PJSA 3GF4A 1B0AA 1DIHA 2JFHA 3MJVA 1AN9A 4TRRA 1WZIA 3KYDA 3U4HA 2I3AA 3QVXA 4D0SA 1N9GB 1RM5A 4WLEA 1DLIA 3MEQA 1M66A 3UN1A 4Y6PA 3M2TA 4BNXA 1CJCA 2O23A 4MVJF 2AQ8A 1H2BA 1S6YA 2WM3A 3HFGA 4YRDA 4E4YA 2EHDA 5KVQA 4JLWA 3C1OA 1WNTA 2X58A 4J4BA 1YOVA 5HWSA 1QKIA 2JFGA 3PFWO 3Q2KA 4KDEA 4CM5A 2IZ1A 2Q49A 4Q3NA 2J5RA 1UUFA 4RQUA 3WDSA 1BVUA 2FSVA 4DQUA 1EUDA 2YY7A 3RUHA 3WNVA 4WCFB 3ICCA 2E82A 2DC1A 3TZKA 1XQ6A 4UUPA 1PEDA 3KLMX 2VNAA 1T2DA 4FC7A 4B3JA 3W4JA 1EQUA 3L9XA 4UVHA 4AJOA 5DF1A 5F21A 1ZK0A 2J6IA 2PLAA 3B20A 4GSLA 4RPKA 2EKQA 3Q3CA 4I9NA 3RUEA 1F0YA 4KTVE 1OC2A 2X0JA 3EVNA 2P9CA 5JFOA 1U4OA 3FSRA 4WUVA 3RKRA 4CM9D 1YBAA 3ZV6A 1FDVA 4P38A 5KOIA 2Z1MA 5G4LA 5EMHA 3JQ7A 2YV3A 5HTOA 1EK5A 5T64A 3C1AA 4GX5A 3E1KA 3H9GA 4I9HA 2RAFA 3ZN2A 2HMSA 3HWRA 3TZQA 2X86A 2C20A 3W1VA 3DMTC 4YRAA 5L7TA 3O03A 5CDTA 3AI1A 3ZWWA 1F14A 5EQFA 1I2BA 1DBVO 3BXXA 1MP0A 4KMSA 3LLSA 3ZW8A 1KEUA 5MDHA 2O7QA 2PZKA 3GGPA 4NI5A 1I5RA 3KEOA 1B14A 1KBZA 2E4AA 2NM0A 3HE3A 2HDHA 4FS3A 3JQ8B 3SBOA 4EJMA 1GU7A 3PZBA 5BR7A 4LRSB 2VZ0A 4GWGA 3DEYX 3HADA 4G81A 4DGSA 5HS4A 4CR6A 4OAQA 4CMBA 3O4RA 3OA2A 2V6BA 1U5CA 2NADA 1QSGA 2IODA 3S2GA 3ZDFA 1QYVA 1YO6A 3OBBA 3S55A 5DDIP 3KVOA 1U3UA 4YJGA 1I2ZA 2QRKA 1PU2A 4XGIA 4II3A 3ZU5A 2X0NA 4WLUA 2CMDA 5TJHA 5JDCA 4R51A 1F12A 4W99A 1K6IA 1MV8A 1EZ4A 4TROA 5FYDA 1FDTA 1UDAA 4BO8A 1X1EA 5IDQA 2JAPA 4O63O 1HE4A 3DZHA 2JFFA 2ZYAA 4KUEA 1PWXA 4B4OA 5ITWA 2OBNA 5LC1A 2AMFA 1F8FA 4UAGA 4BNNA 4AJEA 1TB4A 2QRJA 5CDYA 1CF2O 5L53A 3EZLA 3TQHA 5KNLA 1A7AA 4C7JA 1B2LA 3IJRA 3AI3A 1DAPA 2PZMA 5A5FA 1QORA 2HUNA 4OL9A 4PLHA 2AE2A 4U8GA 3RU7A 3UCFA 2BFOA 1I30A 1R4NB 2VZ8A 1O89A 3OHSX 4OXNA 5I9MA 5TRTA 2CVOA 3SX2A 2C29D 2GCGA 1VKNA 1XYGA 4ID9A 4BV9A 5DULA 1TLTA 3PP8A 5EN4A 4E32A 3MTJA 4XKJA 3TF5A 4CLDA 3ANMA 1PSDA 2IYPA 4CM1A 4R5HA 5IZ4A 3HDJA 1HZZA 3ZWPA 3VAZA 3CH6A 3U4DA 4CMCA 1VL8A 2PKQO 1DIGA 3W4KA 1YKFA 2GN8A 3CXRA 1LLQA 4FOSA 4I1IA 1U8XX 3DFUA 3OSUA 3PJGA 2JL1A 3VC7A 3OF2A 4I08A 1OZAA 1PJ2A 1TVEA 2HK8A 3C7AA 3MJTA 4IINA 3ORFA 4WKGA 3ZWYA 1HKUA 2B83A 2CY0A 2Z95A 2ZCVA 3UKOA 2I76A 4J7XA 4MVJM 1DIRA 3JQGA 1ZKMA 4J16A 4OH1A 2JJYA 3UAGA 3UXYA 1TA4A 1SOVA 1ZH8A 1VJ1A 4CQLA 5KWEA 2W4QA 3JQFC 4FR5A 4JJIA 4MJLA 4BO4A 3ADPA 5IFLA 4DBVO 4I9UA 5DOVA 5L51A 3R3JA 4OJNA 2QYTA 1GEGA 1TT7A 3K31A 5IAAA 4U6SA 1I01A 3QVTA 3NTOA 2VUSA 4XWYA 1I3LA 5KVVA 3BTVA 3GA0A 3SVTA 2SCUA 3RAJA 4RQTA 3K5PA 4M87A 2EW8A 4FGSA 5H81A 3WYBA 4KQWA 5LDGA 2VUTA 1NHWA 3HUDA 1JKFA 2NU8A 1U8FO 1DC4A 1EVJA 2WTBA 4QECA 4XDZA 5HS6A 4H15A 5TSDA 3CSDA 3PWSA 4HFRA 4Q9NA 2OOSA 3NTQA 4CLRB 1E7WA 3DZJA 3VKVA 2BRUA 2OXIA 4RVDA 2PZJA 3WQSB 4OHUA 2VHWA 3WGOA 1NVTA 2CZCA 2JD2A 2V6MA 1DJQA 2ZATA 4MVJP 4D79A 3RKUA 2D5AA 4X54A 4A5OA 3D1LA 4HFJA 1GTMA 3AUAA 4HFMA 4HY3A 3WWYA 1KEPA 4NFHA 4R5MA 2HJSA 4BNVA 4BB6A 3SC4A 4F46A 3WMXA 3GY0A 2O3TA 3ZNNA 3K9QO 4RZHA 2D4AA 3AK4A 2X9VA 4ND2A 1Z7BA 1GZ3A 1GYQA 2ZTVA 3AUUA 4BNGA 4EGFA 2Q2VA 4ZN6A 5F5LA 2UUPA 2EJWA 3JQAA 1ZMOA 3WX0A 4L4XA 4GMGA 8LDHA 1YONA 3DZKA 4IMPA 5JPIA 1P33A 1NAHA 4JBHA 5KJ1A 3UF0A 2NVBA 2VRBA 2CDCA 4R54A 1Q0LA 5T67A 4FW8A 1GEEA 1L7DA 4E0BA 4OXYA 3JQ6A 4BNMA 4ALIA 1TT5A 3K6JA 1E6EA 4DL9A 1YS4A 1NM5A 5JMPA 3UFXA 1QYDA 1FDWA 3I9LA 4D3DA 3D4NA 4RLHA 4XYGA 1IB6A 3IIEA 3UH1A 4J4HA 4OKNA 1B8PA 3F5SA 1R66A 4GGOA 3VPFA 3WGQA 3VHRA 5I8WA 1V6AA 4CL3A 2NTNA 1KC1A 4AL4A 5G4KB 5TT1A 2GZ1A 1A71A 1Q0HA 3FPLA 3A14A 3EHEA 1IUKA 4GMFA 1U2DA 2I6TA 1Y8RA 2PGJA 3MJEA 2YFHA 2QW8A 1XCBA 2FZEA 3HG7A 3AW9A 3K92A 1X1TA 4P4GA 1DJNA 4RPHA 4CM6A 1D3AA 1ISHA 2Z5LA 1GUYA 3WYCA 1D8AA 5A02A 1NFRA 1WXDA 5IXYA 1QG6A 3LK7A 4WECA 1JVSA 2HJRA 3TWOA 3EVTA 2G17A 4DUPA 1DPGA 4LISA 4O5OA 4MIYA 3UGKA 1KETA 4YT5A 4BMVA 4RVFA 2XOXA 1HF3A 1L7EA 4JIGA 1WVGA 3H9EO 4BKQA 5ADHA 2EIHA 3F1LA 3ASUA 1HDCA 3FBGA 3DHEA 1VJTA 4NG5A 3VPSA 2D2IA 1E3WB 2VRCA 2BFMA 2ZIZA 1X7GA 2DBQA 3DBHB 4I5GA 3FPCA 3S2IA 3MCVA 1YJQA 2D3TA 4QXMA 1B3BA 1GPJA 3BMQA 2HK9A 1ISIA 1C1XA 1KERA 1YRLA 4JP3A 4PCVA 1N92A 5DZSA 3LT4A 3RBXA 3I52A 1I2CA 3O26A 3TOXA 2JKVA 3JQEA 2Q1TA 5KIAA 2NACA 4K1LA 4D0RA 2Y1GA 1HYEA 5A3JA 5JSFA 2GNAA 3IS3A 4Y6RA 3ZWXA 4CM8A 4ZVVA 4UVGA 4P8RA 2J3IA 5JCJA 1LBEA 1GUFA 3T4XA 4W9NC 1PS0A 3BTUA 2Q1UA 4WGGA 3D5QA 4KQXA 2UVDA 1UZNA 4XA8A 4ZQGA 3D4PA 4FCCA 4YA6A 5JAIA 1ONPA 4YJHA 3RC9A 2P9EA 5IZCC 1YBMA 4NH4A 4BNJA 1BW9B 2HK7A 3GZNA 3RBZA 4AJ4A 2TMGA 1BDMA 4YJFA 4J2HA 4J90A 3JSAA 1J49A 4ALNA 5K6AC 5FF9A 1VKOA 1HDGO 1NASA 3PK0A 1AHIA 3PTZA 1PS9A 1ZUD1 2GZ2A 4QO7A 1AHHA 1N1GA 4ALKA 4C7KA 4PLFA 1ZK4A 4FFPA 1KC3A 3GZ4A 3GEMA 4W9NA 1U28A 4TRNA 4JN6B 4XYBA 2DUWA 1RJWA 2VYNA 2DT5A 1PQUA 1N2SA 1KY5A 3H2ZA 4E31A 3ZHXA 4RPJA 1ZO8A 1QR6A 1IHYA 3ZGYA 5IZCA 3I6QA 3BMNA 4RF5A 4HADA 1EUZA 2Q3EA 3FD8A 2H6EA 4M1QA 3WXBA 1VE9A 1DSSG 3ULKA 4U0JA 5K6AA 1PZGA 5I7VA 4DA9A 1E0DA 1LQUA 4PG8A 2D59A 4DYDA 1JA9A 3QVSA 5IDYA 3Q11A 2IYOA 3R3SA 4PZEA 5JBIA 4R1UA 2HMTA 2EG9A 2VT2A 2JCYA 1Z45A 1X7HA 4TZKA 1Z7EA 3TZHA 5F1OA 3ABIA 2DTEA 1EEHA 3I9OA 3T4EA 2D0IA 1ISMA 1Y1PA 4YRBA 4EITA 3PLRA 3L6OO 1J6UA 1NR1A 1BSVA 5F5NA 4NJMB 2OBYA 3JD1A 4IJVA 4W4TA 3TOZA 7MDHA 3TL2A 3AOEC 2Q46A 3LC7O 1GQYA 3I4FA 3CPSA 5CPBA 2BMAA 1DFGA 3ZV5A 1LX6A 3FNGA 2I65A 4CMEA 1P9LA 3E5RA 1T2AA 3GAFA 1T4BA 4IDAA 5TS3A 1WMAA 4CM4A 1RYDA 1LC3A 1PJLA 2VOJA 1GCUA 3IJPA 1N8KA 4J9UE 2VT3A 4YQZA 4K6CA 5C7LO 1SPXA 3JQDA 4HNGA 1LRLA 1VPDA 3OQBA 2B0JA 2IEDA 4GI2A 1PJBA 4N7RA 4HWKA 4CQMA 3AOEA 3AJRA 1TI7A 1UJMA 1LDEA 1Q2XA 4PIVA 4XGKA 4ZD6A 2RIRA 4WLVA 4E12A 4JJGA 3LT0A 4R41A 5KJ6A 3A4VA 4CL8A 1BXKA 1KEVA 3PXXA 1FJHA 1ZNQO 2PTGA 3VOSA 5GY7A 2D5CA 4GPD1 2C82A 1DFHA 3INTA 1AE1A 1XELA 1XU9A 5TJ9A 3RCBA 5AVOA 3ZNPA 4RVGA 3JQBA 2GD1O 4DWVA 3LT2A 5JXWA 3F4BA 2W2LA 5THQA 4LRTB 5L95A 3DAFA 4NBRA 3N74A 5BSHA 3ZCXA 4GX2A 2IRWA 3GAZA 4YR9A 4YWJA 4J7CA 4IMRA 1HE2A 3JQ7B 4DXHA 1J5PA 2BGMA 1HYGA 5FI3A 4FFLA 2DU8A 3RROA 2BGKA 4GKVA 3O38A 4QQRA 3WJ7A 3WR5A 1SMKA 4B3IA 5JNLA 2DQ4A 4Z9XA 1M75A 1JKIA 4NU5A 4WASA 3TDKA 3BHJA 4UEJA 3C1TA 3IDSA 2C59A 4R9RA 4YB8A 1PJCA 3S8MA 1MC4A 4LMPA 4MPDA 4XDYA 2HLPA 2WEKA 2BFPA 3QIVA 1LRKA 1E7RA 5TGDA 3QWHA 5THKA 1EQ2A 3UCEA 1NPYA 3GN1A 4IGFA 1LRJA 3E48A 2HMUA 3FNHA 1NQTA 3DBVO 3SJ7A 3M1AA 2JD0A 2A92A 1BMDA 1P1HA 1GD1O 1LQTA 2GR9A 5AXDA 1LLCA 2D8AA 4MVJH 1ZK2A 2WSBA 3K2BA 4TKMA 3LQFA 1DB3A 5FWNA 1XA0A 1NQAO 3MWEB 4L74A 3G1UA 5FI5A 1VJ0A 4QT0A 3NKLA 4YJGB 1OFGA 3RD5A 4BNYA 1ZJYA 2J3JA 1ZEJA 2F00A 1AXGA 2FR0A 4H16A 3QRWA 1LEHA 3UVEA 3NYWA 1PJTA 2LDBA 1UP7A 4R1NA 2C7GA 4QO8A 5KCZA 4N5MA 1NYTA 3V1UA 2Y93A 4S1VA 3TZCA 1H0KA 5GMOA 1FDSA 4DIBA 1I10A 1UR5A 4MIEA 3GFBA 2O2YA 4YAEA 1BXZA 1JWBB 1BTOA 3KYCB 1GADO 1FMCA 4FBGA 4QFDA 4BO3A 5C7OO 3HDQA 4AJHA 2GYYA 1ADBA 5EL0A 3ZHZA 4YVFA 5JE8A 2WYVA 3PHHA 4YTEA 3ZWAA 3VZPA 4MOWA 1GAEO 1YJ8A 4B3HA 3BMOA 4GSKA 1HXHA 2B69A 4FFMA 2VHXA 4KUGA 5BT9A 4LGVA 1LU9A 1HTBA 3JCZA 4TKLA 2Q45A 1HE3A 3GK3A 1F8GA 1WAMA 1NQOA 4FDAA 3I3OA 3FRJA 1ISGA 1YQDA 3DBRA 4IS2A 3FTNA 1E1LA 5A04A 1EFKA 3PEFA 4FN4A 2Y1DA 2Y67A 1PJQA 4XJTA 3INGA 2J3KA 2CNBA 3HN7A 1B15A 1E1NA 3QQPA 4HX5A 1SB8A 3PHIA 4OYRA 1ID1A 3GVHA 1IPEA 1RKXA 4MKZA 1V0JA 5L4SA 3ANNA 4D41A 4G2NA 3STHA 4E3ZA 2ZTUA 4OSOA 3LF1A 2Q2QA 1I3NA 4MVJA 4IZIA 5L4NA 3PYLA 1RWBA 5BNFA 5A06A 1ZXBA 4BO1A 3QJ5A 1ZSYA 1EVYA 3M6IA 4UEKA 1RM3A 4D46A 1ZXLA 2VHVA 5KKAA 4Q3EA 4G5HA 3KXDA 3RFXA 3ZWVA 1T2EA 5L7WA 1Y9EA 1P0CA 2O3QA 2HQ1A 5AXAA 3NAQA 1WDMA 4BNKA 4MVJE 4XQGA 4CQLB 3COSA 4GH5A 5A9SB 2HKIA 3D7LA 1EDZA 1QP8A 2EEZA 1BHSA 4J1SA 1ZJZA 4O0LA 3RC1A 3KSUA 3R6DA 3BZUA 1BRMA 1DC3A 5ER9A 4A73A 4B8WA 5JAMA 1E6WA 4PG4A 2WJPA 1LSSA 4UEOA 1GDHA 1QYCA 4I5FA 2DPHA 1UP6A 3LF2A 4PLGA 2QZ9A 1XDWA 4YT2A 4BO0A 4CUKA 4I5DA 4RV9A 3PFFA 4RORA 2YHIB 3D4OA 4BGIA 3VH4A 3NRCA 1TXGA 5F1PA 1RM0A 1HLPA 4KDFA 3S2FA 3GEDA 1EBFA 2C2XA 3CUKA 4LK3A 1D1SA 3DMTA 4J6FA 4KOAA 1LDNA 1Z73A 3D3WB 2FN7A 1XKQA 2UYYA 3FNEA 2PNFA 1LI4A 4PZDA 2NLOA 1A5ZA 1MA0A 1M67A 3F3SA 4HBGA 4W7HA 4A7PA 5KVSA 2LDXA 2O7SA 4II2A 5H83A 2OL4A 2W2KB 2W90A 4FFOA 3X2EA 1E1MA 2PZLA 3P19A 1SB9A 3U49A 1U7TA 2CF6A 4IPTA 4N18A 4WEQA 5EIOA 4B7UA 1CERA 4JBIA 1JWAB 3JYLA 1SC6A 2FP4A 5EINA 1H5QA 2GN4A 3L6DA 5TQVA 3E18A 1QYWA 1SO8A 1NXQA 3CZMA 3I9NA 1UP4A 4IM7A 4CMGA 1O9BA 5ENDA 4NPCA 2PH3A 4OMUA 4CM9A 3RVDA 2VN8A 3RASA 3GUCA 3K2EA 1BG6A 4YACA 1LC0A 1LSJA 2TMDA 3FF4A 3W6ZA 1E1KA 5CEEA 3JQAB 1H6AA 4BOYA 2EKPA 3GPDG 3MOIA 2V65A 5EJ2A 1T2FA 1WLYA 2GASA 3EW7A 3GOHA 1V3VA 1YDWA 5JLAA 4J1NA 4E5MA 3DAPA 3IQDB 2UV8A 3S1LA 3WFIA 1R4MA 2OO5A 2H1SA 4CUJA 1NHGA 3HDHA 4WCFC 2BF7A 2P4HX 1IOLA 4D42A 4YXFA 4IDDA 1N9GA 3OIDA 1DAOA 1JTVA 4OIMA 4NBTA 5DP2A 2GO1A 4EUEA 1HDRA 3D5TA 1X15A 4J1TA 4L8VA 1B3RA 8ADHA 1PS8A 3JQCA 4GBJA 1CIVA 2NSDA 1K89A 3VZRA 4TRMA 3GGGA 2O4CA 3VH1A 4PLTA 3WGHA 3H8VA 2BKAA 4RZIA 3OIGA 2FR1A 3OJEA 2NWQA 1U7HA 4CMHA 1UXGA 2VWGA 2YYYA 1I8TA 3WB9A 3ST7A 4E6PA 3OP4A 1MG5A 3ASVA 3GR6A 4LN1A 1C0KA 2EJVA 3ZHBA 4UVDA 2OGUA 5KJFA 3JYPA 2VTDA 4NBVA 3H3JA 4NJOA 3IUPA 5KTKA 2YFQA 1YB5A 4DMLA 1XSEA 2R00C 3H4VA 4FSHA 3QHAA 3ITKA 4Q3DA 4O6VA 4ZRMA 1X13A 5U1PA 2PWZA 4M54A 5DOZA 1QXSA 3L4SO 5KVCA 3SLKA 4ALMA 3PYXA 3E82A 5I8ZA 3FCOA 2J5QA 3F6YA 1BDBA 1Q1NA 3WLFA 5CFZA 3C85A 1DRWA 4LMRA 3GVXA 3M2PA 5B1YA 3U3XA 3W4IA 4CPDA 4CMKA 2VYVD 2O50A 1P74A 2ZKLA 1Y6JA 4ND5A 4CMAA 3JQFA 3H65A 1V35A 3RWBA 3KYBA 1UXJA 2R00A 5DBFA 5AXCA 1YL5A 5JO0A 1IPFA 2E37A 4GVLA 2AQHA 3BMQB 5LDHA 5AQ1A 3FTPA 3INRA 4F6CA 4GX0A 1ZSNA 4E30A 5COQA 4ZICA 3GVPA 4I8XA 3V5NA 4DTIA 4A03A 1VI2A 2E6UX 4KWHA 2DAPA 3PJEA 3RBVA 4FJ2A 1R0LA 4BO9A 1I3MA 2YV1A 3AY6A 4AJKA 1DHTA 1T4DA 2Y1CA 3AM4A 5JAZA 3GPIA 3L9WA 2IZ0A 1MG0A 2NV6A 3HFSA 1VSUA 3DQPA 2A35A 2X4GA 2DLDA 4CLXA 3ZNQA 1HETA 1HL3A 3PIIA 4ILKA 1A27A 4IDCA 4RF2A 1PX0A 4WLOA 2P9GA 3PGJA 1DRUA 3H6KA 4TVOA 4XRGA 5DCYA 1G0OA 4ZHSA 1PZFA 2DUUA 1JLLA 3QP9A 2BI7A 1NBOA 3GZNB 3OIFA 3OJ0A 4L9RA 2GSDA 4PVCA 3U09A 4YJFB 2OUIA 3KBOA 2HU2A 4OXKA 2FPIA 1DOHA 4MIOA 3FHLA 3WSWA 5I7FA 3L77A 1XR3A 1Q7BA 3HJAA 4Z3KA 1GV1A 1U3VA 4WOKA 1JN0A 3AU8A 3GGOA 4RCVA 4M55A 3UOGA 4RPLA 3QWFA 1D7OA 3P2OA 4IXTA 4JJFA 2PH5A 2VWQA 2VRCD 4DVJA 2WE7A 1R4NA 4R9SA 5A3VA 1PTJA 4BNUA 2RHRA 2RCYA 1U4SA 1NPDA 1U3TA 1Q7GA 3OETA 1HDYA 3P7MA 5IDXA 2VOEA 3DZFA 4GX1A 3BYZA 1GPDG 1I33A 3PDJA 4GWKA 4BMNA 3GT0A 2DKNA 2NVUA 2O3RA 2DFDA 3OM9A 4Q3CA 1R6DA 1KY4A 4W7IA 1WDKA 5JCJD 4PN3A 3LLVA 4DLLA 1AUPA 4LCJA 3UUWA 3OQ6A 2PV7A 5ER6A 5H82A 1L1FA 5TIIA 4AJNA 3DAGA 4A2CA 5LCXA 3UICA 4J4TA 1EUCA 3DBLB 1HDOA 1E7SA 4YCAA 4MP3A 4IBOA 2PGDA 4QEDA 4TQGA 4NBWA 3QA9A 3F5QA 4CV0A 2ZB3A 1JVBA 1C0LA 3OJOA 1XQ1A 1P0FA 4JBGA 2B36A 3TJRA 3GH3A 1GY8A 1Y8QB 4AVYA 1HEUA 3EC7A 1PGJA 3O9ZA 3Q0EA 3GG2A 4ITUA 3QWIA 4EUHA 3GNTA 1S7CA 2G0TA 4RVHA 2YQ4A 5FEUA 1C0PA 3DXFA 5T8KC 1BXGB 2X9NA 3TNLA 4YYZA 3QY9A 1Y5RA 1LA2A 1P45A 3PIDA 3PWZA 1DC5A 1NFQA 4FGWA 3RUDA 2P4QA 1MB4A 1E3IA 1E3SA 2GN6A 1YBVA 2Y1FA 4CLRA 4Z9YA 3WQRA 2C5AA 4WEOA 4RDIA 3KEQA 5AXBA 4Q39A 4PG6A 3H9QA 3AWDA 3VVBA 4ND3A 3KOUA 2FRDA 3WYEA 4D43A 4FIZA 1DFIA 1R12A 2X5JO 4WOJA 5AOVA 1KYQA 1N1EA 2FMUA 5T8KA 1QRRA 4BL5A 4RPGA 3KV3O 4Y8VA 5IJZA 1IY8A 4UUMA 4XX0A 1SZJG 3PGXA 4Z9FA 2EF1A 4BUCA 1Y7TA 4EJ0A 1T26A 4KWIA 2AA3A 3MWDB 2VZ9A 3NDIA 1I36A 2HSDA 1VM6A 4RF4A 2GN9A 4WNCA 2AXQA 1UZMA 1SEVA 3GDGA 3OJLA 1MLDA 4XRRA 2WD7A 4YT8A 1FK8A 4BO6A 3WIEA 4E5KA 3JTMA 3GFGA 1SNYA 3H9UA 2C2YA 5JDIC 1PGPA 3RQSA 1LSOA 6ADHA 1LNQA 3HZZA 3ROQA 3H9JA 3PQDA 2PA3A 2NU6A 1E6UA 1C1DA 1ONNA 1PR9A 1PZEA 2FR8A 4RVSA 3L07A 4JK3A 1ZEMA 2P5YA 4BS9A 3I6IA 2OP0A 5L4LA 2VQ3A 1P1FA 4IQ0A 2I5PO 3R1IA 4BVAA 1LLUA 3VH2A 1Y9AA 2HRZA 4DYVA 2YUTA 3AFNA 4FB5A 2W8ZA 4CM3A 2B37A 4XIJA 3VTZA 5JYEA 1LDBA 1ZBQA 3A9WA 1M76A 1UDCA 2JAHA 4B79A 1O0SA 2BH9A 2ZTLA 3DTTA 4AJIA 3M1LA 4IS3A 1HT0A 4E5YA 1PR3A 2EGHA 3D64A 4IJKA 5COBA 3GN2A 3GMDA 1E7QA 3DOJA 3GLQA 5B4VA 1RYEA 1JAXA 1LUAA 3KSZO 2ZK7A 5JMWA 3PPIA 3U62A 4PG5A 3KUXA 4IY1A 1ULUA 1F06A 1ZZEA 2EP7A 3DTYA 3NTRA 4E13A 3TFOA 4EI2A 2B5VA 3KYDB 3F46A 1YQXA 1DIAA 4ZQHA 1NTOA 1P44A 2FZWA 3F1KA 1P1JA 1LXCA 1PZHA 3X2FA 4XCVA 1IZ0A 2G1UA 2POQX 4DIFA 1JAYA 4CLOA 2Q50A 2JD1A 3JD3A 5CDUA 3IUSA 4EEZA 2HRBA 4XIYA 5F3RA 1T1RA 1DO8A 1KS9A 1B16A 4OOFA 5EQDA 1DIBA 4E5PA 3IMFA 1Y5MA 1R0SA 2C07A 3FWZA 2V6GA 1YOVB 4E2YA 4B4VA 5L7YA 2EKLA 1O94A 1Z6ZA 4BHTA 3BTSA 1VL0A 5K0ZA 4DRYA 4TMFA 2NU9A 4ZQFA 4R01A 3A06A 1W6UA 2X0IA 3ZI0A 4CMIA 3ROKA 3KO8A 2HO5A 4KZPA 1HDZA 2GPTA 3B1KA 2OFPA 1JKJA 3PHGA 1E7MA 4TWRA 4W6ZA 3L4BC 4XR9A 2EERA 4A26A 4FJ1A 5C5IA 1XWFA 2G5CA 3GNSA 4EW6A 3QWBA 4N5NA 5HA5A 3TPCA 5JCXA 1QV6A 1CDOA 1UAYA 4AG3A 3E9MA 4WE3A 4BNFA 4HV4A 2ZB4A 3WNQA 3K73O 3ON5A 2OMEA 1WMBA 5L40A 3G49A 4NK5A 3RI3A 5BNIA 5I7SA 1IULA 2DBRA 2GLXA 3LYLA 5JS6A 4NDNE 3I5MA 4A10A 3GC6A 4CUZA 4OQZA 1O8CA 3DHNA 4J3FA 1KOLA 1NP3A 2CVQA 2I67A 4XQEA 3B1FA 1T1SA 3ZHYA 4EZBA 1ZW1A 3ZU2A 1OMOA 2ZB7A 3L4BA 1IE3A 2A94A 4E2XA 5DBGA 4BQRA 4BGEA 1XLTA 3GHYA 4JXKA 4B4UA 2AEJA 1EE9A 5J23A 3NGLA 5HRUA 1FDUA 4M89A 5L9AA 5IG2A 4M86A 1K6JA 3RUFA 3TL3A 5EPOA 1A4UA 4LSMA 1KVRA 4DPMA 1F17A 3U0BA 1LDGA 1G6KA 4M49A 2B4TO 4XR4A 1U2GA 4NU6A 3ENKA 2HAEA 4CR8A 2WYWA 4XEHA 4WLNA 1ENPA 3GEGA 5JW6A 1SCUA 3AOGA 5B37A 4PLCA 3PZRA 2Q4EA 4FQ8A 4L4SA 3ENNA 4PZCA 2BI8A 2PD6A 1B8VA 4UUOA 3K96A 1P77A 4XD2A 2NNLD 1N7GA 4QX6A 3ICPA 3A28A 1YVEI 5ES3A 2Q99A 2I9PA 4YEDA 1YGYA 2HCTA 3OICA 2XXBA 4OQYA 2NTJA 1XG5A 3RUAA 3O8QA 5GZ1A 3CE6A 4BO2A 4A0SA 3RIHA 5MGBA 2JHGA 5JYDA 1OOEA 4PLPA 3I9MA 3KRTA 4NJMA 2QRLA 2QQ5A 1E3LA 4IDFA 4PRLA 3KETA 1ENYA 2P5UA 4FFRA 1Y81A 4BNWA 1ZK3A 3PWKA 4GVXA 2H5LA 3F9IA 4RO0A 2ZYGA 1K0UA 2Q1SA 1EFLA 2Q1WA 4FD3A 2VWPA 1R4MB 3LDHA 3MTGA 4E5NA 3DC2A 2QZZA 3OECA 2PD3A 1P1KA 1ENOA 4PLZA 3WGGA 3WJAA 3VTFA 3ETEA 4P22A 3SLGA 1ZSVA 2DPGA 5IF3A 2P68A 3QV1A 3I9KA 4NIMA 5JC8A 1CWUA 5JAQA 1D1TA 4Z0TA 1QYXA 1V3UA 3LT1A 3OA0A 4ZRNA 1G1AA 2BFAA 3IOYA 1UAGA 2Y66A 2ET6A 2I99A 1TEHA 1A7KA 1Z74A 4NBUA 4YAIA 5B12A 3AM5A 2WE8A 1XIVA 3V1YA 3BHIA 3MZ0A 1OI7A 4F45A 3WTCA 1ZK1A 1UXKA 4U7WA 1HZJA 2AHRA 4XYMA 2JHFA 3ZW9A 1V8BA 4L76A 1A72A 1GUZA 3WGTA 3ZWNA 3JQGB 2FHSA 1DXYA 3WQQA 4K28A 3RSHA 1VLLA 3V2GA 1U1IA 3ZH2A 3U4IA 3WGZA 5DBIA 4NHEA 3NX4A 1B7GO 4N54A 2FWMX 1ZIDA 3N58A 3WSVA 1K2WA 3W8EA 5B4UA 2Z1NA 3HNPA 2W98A 1MFPA 4PRKA 4EEXA 5A9RA 3CMCO 4Z3DA 4ALJA 1H93A 3IL2A 3RFVA 3BTOA 1T25A 3HSKA 1GYRA 3QVOA 2X23A 3L6EA 3HB5X 2PK3A 5BNTA 1QLJA 4YQYA 2VUUA 3W8DA 3C8MA 1HRDA 2PKRA 1MUUA 5HBRA 1YDEA 3AI2A 3DZGA 3QWAA 2AG5A 4IQGA 2O2SA 3PRJA 3E9NA 3ZZNA 4L73A 3HQ4O 2RH4A 5CAEA 5JDCC 1A9YA 2NU7A 2O3UA 3WICA 2B35A 4W82A 4OOEA 1EK6A 1KIFA 4LCEA 3JYOA 3ROPA 1DLJA 3MOGA 4DC0A 1R16A 3KM0A 4AJPA 1PL6A 3JD4A 3CMMA 4UULA 2J3HA 3HN2A 1P31A 3MJCA 1UH5A 2A9FA 3IP3A 1BWSA 4NMHA 3JQ9C 3OMLA 1A9ZA 3GRKA 2GF2A 5ENVA 1NPTO 2Y0EA 4XQ9A 4BNLA 3AU9A 3DDNA 1ONOA 3JV7A 3DHYA 1E77A 4CMJA 3H2SA 4OKIA 4JX8A 3ZWMA 3CTMA 3DWFA 9LDTA 3BMCA 4U6QA 5DT9A 1NWCA 4RVUA 1UDBA 2B4RO 4RGBA 5COAA 3I83A 2R6JA 3LVFO 2O3SA 5G0WA 5EERA 3NEPX 3NJ4A 3RC7A 3KYCA 4BV8A 4YAKA 3Q9NA 1PGOA 2FPPA 4K26A 3DZBA 5AYVA 2GERA 3KSDO 1ISFA 1TT5B 3JQ9A 4IGEA 4R4JA 5A4DA 1KEWA 3BHMA 1GR0A 2G82A 1HYHA 3VDRA 2YDYA 1RPNA 1YL7A 2C7VA 4R69A 4AJLA 3RUCA 5K9ZA 4QFCA 3RFTA 4K6FA 2I3GA 4EUFA 1X14A 5KJEA 4YBZA 3EDMA 1WWKA 4JROA 3AY7A 3KTDA 1YH3A 3GHHA 1DDOA 3PHLA 4CM7A 4CR7A 1EE2A 4B8ZA 1UXHA 2IEBA 5I7EA 5IDWA 1ADGA 3SC6A 4ND1A 4XJSA 1UXIA 3SXPA 2GUGA 5F1KA 4IJWA 3ANLA 1U3WA 2BD0A 4K9DA 4R16A 5ILOA 1O95A 3JYNA 3WLEA 3U9LA 4WCFA 1I0ZA 4HNHA 3Q9UA 4WNIA 2IZZA 1M2WA 2VHZA 2FOIA 4PGFA 1LDYA 1Y8RB 2DBZA 5T6BA 3WBBA 3WIDA 4B4WA 3BA1A 2NVUB 3AUSA 2DM6A 1Q7CA 1IL0A 4IJUA 1MC5A 2EXXA 3NJ8A 5DP1A 4BNZA 1NFFA 5L3ZA 3DL2A 1J0XO 3PDUA 2PKQP 3H3FA 3W6UA 3ADOA 4EDFA 1WP4A 4R3NA 1NVGA 2UAGA 3KZVA 1AXEA 4O1MA 3PVZA 1E5QA 2X9GA 4E21A 4PLVA 4WLFA 3ETDA 1YQGA 1WDLA 3JQAD 2CF5A 1H94A 3ZWCA 1EVZA 1FF9A 1WPQA 3RC2A 2AW5A 4XB1A 2B5WA 4BO7A 3OFSA 1EBUA 1G0NA 1SAYA 3NDRA 5A9SA 4MKRA 5BSEA 3FNFA 2AQIA 2DTDA 1E5LA 1ZVMA 4UVIA 4BIIA 4CJXA 1N7HA 2PD4A 4XZ3A 2GGSA 2HMVA 3JD0A 3GG9A 1EMDA 4DQVA 1LTHR 1C3VA 1NWHA 4FOOA 3PYMA 3JQ8A 2NQ8A 2ZQZA 3PHJA 2V7PA 4ZJUA 3TN7A 3QVWA 1C1XB 2C0CA 5G2OA 4DMMA 2CSUA 3EY4A 5IXSA 1B26A 4DLBA 1X7DA 4BNIA 3DOCA 3IKTA 4HUJA 4NFYA 5ICMA 2YHIA 3ONEA 4YAGA 2IE0A 4RDHA 1HE5A 3KB6A 5U4QA 3EAGA 2AEFA 3JYQA 1O5IA 1ADFA 4RLSA 2X0RA 3K8ZA 2JCVA 1VRWA 2QYSA 4P4LA 3D3WA 2PR2A 1GFSA 3DOOA 3LU1A 4CM8B 5BSGA 4RJTA 5JO9A 3ZV4A 3D0OA 4Q3AA 3GDFA 2Q2WA 3I1JA 4GQAA 4NZ9A 4MO2A 4CLEA 2ZJ1A 5CEFA 2Y0CA 2CUKA 5B4TA 4URFA 4BO5A 3EGOA 3VKUA 2W2KA
chains in the Genus database with same CATH superfamily
3U5TA 3KX2A 5FCDA 3O90A 5FBHA 3PF9A 2C5HA 3L0DA 4TTRA 2KMLA 2QJWA 2YHAA 4KXLA 1MO6A 1EWQA 1H9BA 4EI8A 1NQUA 4UUNA 5LXTB 1EDBA 5DXFA 1PQ4A 2H65A 4M8LA 3ZKWA 1LK5A 4RK6A 2ACKA 3H87A 2ZSIA 1R9JA 5DO9A 2N75A 2QPLA 3S28A 2HMAA 5AKLA 3E61A 3TIXB 5TX7A 1S3FA 3DFIA 1UFQA 3ZIDA 2C9ZA 5CM2Z 4WNAB 2HF2A 1W96A 4RD3A 3U4CA 5C5CA 4GM1A 1R8XA 4DFDA 4FDVA 1DRVA 1H4VB 3R5FA 4FDUA 4IIJB 2ZCUA 3OAAD 4NHOA 5CUQA 1P19A 3L1HA 2AUNA 3O74A 5I9NA 3DR5A 5KNBA 4KW7A 2P75A 2JAQA 2GTHA 1Y4UA 2X7HA 4KKXB 2FSSA 4B46A 3HJCA 4RY0A 1QWSA 2CZQA 2X8JA 1EHCA 1I7PA 1X1BA 3LQ1A 3OT1B 5SZJA 2FEXA 4N5LA 1YIDA 3E5MA 4UASA 1K3FA 2P3QA 2OCXA 1RI2A 3CM0A 4M6WA 2CDBA 3B82A 1HWYA 1AO0A 2ZAYA 4PSUA 3RUIA 4MP6A 2CEKA 3CURA 1CQXA 1C1DB 4O8ZA 4DDKA 1PW7A 1W5SA 2A84A 2PLWA 4PO9A 1E2UA 2J3EA 4RMNA 4BQEA 3HDVA 3HYNA 4ZO7A 4J2OA 5DBHX 1OU0A 2NVWA 1OLOA 2RJ3A 1YIOA 2ZWAA 4BKMA 4DBLC 1K7CA 1TO2E 2ZTHA 3FLMA 1EIZA 1YQTA 2R25B 3HY6A 1JSZA 1QVRA 4QYWA 5H4GA 2FW8A 3PXEA 5A05A 2ZQYA 2X7JA 2NTVA 1SH7A 2BELA 3L7BA 5ALXA 3RT1A 1WZEA 1MO4A 1XD2A 5DBEX 4PNEA 4BX2A 3P9IA 3A70A 2R47A 2PGXA 2RE8A 3VTKA 1SUSA 2GD6A 4U7GA 2QJOA 3PCTA 1H6CA 5FOTA 2FUKA 1V3TA 2OKCA 1SBYA 3KQKA 2WHPA 4KO8A 1GZ6A 2A5GA 4GT1A 1OYWA 2AK3A 1KK1A 1ZONA 2TS1A 2GETA 3E6AA 3LBNA 4J7UA 5G0TA 2HEGA 2XWSA 3Q98A 3M3HA 4LXXA 2RHGB 3EMKA 1LPAB 1G2IA 2YTZA 4J49A 4KWEA 3H2JA 5CB6A 3UAYA 1UBFA 2QVXX 4IDGA 1ZVQA 4OP2A 5H3HA 1SBIA 1WJGA 3W79A 1N5KA 4JSTA 1AQUA 2I4MA 1GG2A 4JMPA 3V1TC 4URHA 3BWCA 4U7TB 2P2DA 1LSUA 4HDRB 5HJ5A 2Q4DA 1E62A 2UZAA 3OLQA 4R2JA 2ZIUB 5EHQA 3VDMA 1GUBA 1ZJJA 3LA6A 4Q3BA 3ZBPA 5CFNA 4RL6A 4D44A 2VBCA 2PS1A 4IIUA 1J2UA 4D80A 3HI4A 4KPYA 2PL1A 5DK4A 3CH5A 4BKPA 2CVHA 4CLOB 2NZVG 2A14A 1GYPA 4FPXA 4HKTA 4OHWA 5ECWA 3C3CA 1H6BA 4LG1A 3ZJYA 5LZ4A 1E5TA 2XUQA 4HGOA 1M6WA 2N3ZA 3K9NA 2XA9A 5AM0A 1WMDA 1D4FA 1K6XA 1QIMA 1T3ZA 1NURA 2BHTA 2CL0X 1U99A 2D2FA 2GMWA 2QD4A 1G1MA 4QTZA 2WKQA 4F93B 2QR5A 4XWGA 5A3QA 1BKDR 1NF9A 2ODBA 3QPUA 3THYB 2NUPB 3K1AA 1R74A 3KUKA 4IHAA 4PYMA 2R48A 1S2GA 1TUBB 3ZNOA 4BP3A 3C4VA 4GPIB 5SYMA 1KO7A 2XTNA 3QA3E 4JP2A 2KHZA 2J4CA 2P2SA 4EG6A 3PEWA 1RRFA 2AQKA 3E9CA 2AE1A 3IILA 3LS2A 4LY3A 4O4LF 3A9UA 4PIPA 4S24A 5I4BA 1OBFO 3HSYA 4N01A 3CO0S 4FFNA 3AR3A 5KWVA 3CF0A 1IY2A 1Y89A 3AFMA 1I32A 1UC9A 5EZ6B 4BFLA 2EV9A 3TW0A 2W2VA 1N5DA 3TCNA 2VPXA 4LE2A 1H69A 2HXSA 3CZRA 3HVUA 1B4DA 2CJPA 2HV8A 1PQYA 3AO0B 3NDJA 4IFBA 2ZEJA 3M9XA 4UPDA 1K7XB 4D25A 4U9IS 1LGYA 2OC9A 2GRUA 3Q2IA 3BIJA 4M0PA 5EOVA 5LMUB 3NGXA 4UBKA 3M3PA 1FS6A 4FX2A 4MS4B 1HG1A 3RT7A 1YJCA 4OX9Y 5I48A 5C5EA 4MEBA 1VHQA 3A10A 5ARBA 4I81A 1T1EA 1A9QA 3CINA 4CV2A 4DMHA 3MBOA 1TTPB 2ZI4A 3KZXA 3EGWA 4PGMA 5FL7A 1T9CA 3IA7A 5BYJA 4X8LA 2XCTB 1RI3A 3T7KA 1PGNA 1RWVA 2Y1XA 3L4EA 2H63A 2ZB8A 5HIJA 3AVWA 5JY6A 2G72A 1UEIA 3ZWOA 4CTMA 2WF5A 1JX6A 3U48A 4TYNA 2R2GA 2PIDA 4AKIA 5DNDA 3U19A 2CXRA 4FOPA 4ITRC 3EK2A 4R3UC 1BO6A 3T4UA 3S2EA 1BHJA 1PHRA 1N4DA 4TMXA 1YR6A 3ENZA 3OQ1A 2IXAA 5CDGA 4IICA 3HB0A 2D0DA 5DGIA 3OZ7A 3OY2A 4CQMD 4XYLA 1HNXB 2ZWPA 4YBRA 1BGVA 4CGZA 3ZZ1A 3DVQX 3UPTA 4GE3A 4INAA 3E81A 2HXGA 2JHCA 4PYOA 4NE9A 1JHOA 5C8YF 1KZ4A 2ISQA 4INOA 3EF1A 1Z75A 3U7RA 3ZE0B 1T9KA 3F47A 1LBIA 5KCMA 3UCXA 3D6TB 1KVQA 3PG5A 2XEXA 4UARA 2L69A 2Z3VA 3BICA 3OKCA 1II9A 1XQYA 4D3FA 2XT0A 4P3KA 1MBZA 4L8FA 3AR8A 5J9FA 1EVIA 2Z58A 2WMDA 1ND6A 3EAFA 5J43A 4ABTA 3OCYA 1RP7A 3O9VA 1YS9A 2VTVA 5INTA 1Y33E 4KEAA 1J42A 4TMZA 4RIIA 2AEMA 3UMJA 4N40A 3G17A 1YJBA 3T38A 3R9XB 3O8QB 2FZ5A 1JL3A 5ITZA 3G7UA 2HMWA 3OTOB 1ECPA 3FPGA 1E0AA 3U9TA 2OAEA 1Q15A 1HTWA 2J67A 1PNVA 1ZVJA 4AJ1A 4BAUA 3F6RA 3E8XA 3H0CA 3SJAA 1AHNA 2OYSA 4G65A 1H8ED 3UUEA 4F2GA 2KS6A 4TKUB 3BMOB 2WJZB 5D8DA 2CFTA 3JQQA 3ZDBA 5BW8A 9LDBA 3DBLA 4GLFA 2N46A 5CIWA 1Z5NA 1MXFA 3PI7A 4W1SA 5JZ9A 3NWEA 2IH4A 1JG4A 1FNCA 1IBCA 1Y9DA 3ENVA 3OEHA 3TTXA 4X97A 3TW4A 1ML3A 4GAEA 4HVLA 1C9NA 2UZ4A 3DC7A 4R3WA 2VHYA 1C4KA 3EGVA 4ND4A 4YMVA 2EP5A 3PDIA 3ZQ6A 2GZRA 1UMCB 1BFDA 3I62A 1DAEA 4IVQA 1FCJA 1Z4IA 1VMDA 4XVHA 3DE2X 3QLUA 1Y8QA 1B1CA 4FOTA 4RK0A 3MCUA 4FOLA 1PF7E 3QKIA 2GLTA 1T9BA 2OHXA 1NNUA 3LGXA 4R1SA 3WA6A 4B7ZA 2WFLA 3TLMA 2E3JA 1E0KA 1P1RA 2FVXA 1KI6B 1UPUA 1YXMA 3KEGA 4IIHA 2QG4A 1JQEA 4FYKA 3TE7A 2WWRA 1B8UA 2IXBA 1KI7A 4HQRA 4LKRA 4MQ6A 3WDMA 1G60A 1YK0A 2CVZA 2XWJI 3CRZA 5EFOA 4AK9A 1BX3A 5JAUA 3QIAA 4GPTA 3H5RA 3I0ZA 3I6YA 4IIVA 5EGNA 4AQ7A 1LWOA 1V95A 5JAHA 1KO5A 4PR0A 4R6XA 3PVCA 1Z2CA 3EXHC 4ZVPA 4KDCA 1JW9B 2HQBA 4JEIA 3C24A 3EBOA 3BJIC 3M82A 4TOIA 3NS7A 2O1EA 4A8TA 2YX1A 3CIFA 1L9KA 3FI0A 4P4UA 2QLLA 3HR4A 1L5OA 4GBED 4IKOA 4Z0HO 4EJ6A 4NOKA 5B58C 3U4MA 1MJGM 3WV4A 4EYSA 5JBQA 3CZAA 3LYHA 1GZSA 5G41A 1Z6AA 3TE6A 4QTYA 5GZ6A 2BFCB 2K7FA 2A5LA 1BW9A 5TT0A 5A6SB 3ZCQA 3C8ZA 5JCZA 2G88A 2JI6A 4EGJA 3GUYA 1JEYB 3ELWA 2JANA 1H2AS 1AG9A 1K66A 4G8CA 3N0WA 4JX9A 3V4LA 5K05A 1JDJA 1MFZA 5AW0A 3IXMA 4LSZA 1CIJA 3DULA 3HHEA 3I9JA 3MJ4A 5FULA 3HC7A 4B0PA 3VKGA 1CUEA 1RPTA 2R8BA 2XUGA 1VCMA 2CLDX 3I1IA 1GQQA 4KGVA 4EMUA 4YRLA 3UJCA 4DRXB 3B6ZA 5KQLA 4OSPA 1GP2A 4GXQA 1YI1A 1KMCA 2PUFA 5K3DA 3N0XA 3UHFA 3PKIA 4OFZA 2DX7A 5H68A 3U40A 4H31A 1W49A 3SK0A 4Y2SA 3QEBZ 1T0HB 2XYHA 3O7WA 3RU3A 1U9IA 4U0KA 1A5SB 3QSGA 4G41A 2W22A 4PAQA 2Q07A 2IYAA 5K2OA 4HDSB 4DCSA 1D2CA 1ULSA 4H7PA 4DPLA 1BU5A 5HFJA 2NPFA 2GI4A 1Z08A 3Q6IA 3OPXA 1OLXB 1ZCJA 4JA2A 2EDAA 4YJ2F 2GPJA 4YRMA 4HG2A 3PNQA 3CRNA 2NU7B 4JODA 4MP8A 3SXJA 5IKXA 3EBLA 4DZZA 1NBME 4UMVA 4Q7LA 4L5IA 1KL7A 4MSUA 5C8DA 2DVMA 3HMKA 2RGAA 3TKAA 2DY0A 2RHTA 5F23A 1ARZA 2F8TA 2NP7A 1WXEA 3P9CA 5CH8A 3WWCA 5FP0A 4DTCA 2OB1A 1FIUA 1P7VA 1NVWQ 5A4KA 3U7EB 3GEPA 5B1EA 2DH5A 2QGZA 3D6JA 3G3EA 4RMGA 1AKWA 4HFNA 1G98A 2XRFA 3WFJA 3E8MA 1CEQA 2V0CA 1YRQA 2GAIA 3GYBA 5EA2A 4AW9A 3IQZA 3ZBQA 2PUAA 4V3BA 1IHPA 4Q1EA 5HP4A 1FLAA 2O8CA 2PEYA 1AO3A 2XVYA 1C29B 4BLVA 4ZQEA 2QIOA 1Y3AA 2X3YA 3EG9B 5FUBA 3V34A 5EJAA 1IWOA 5EEGA 721PA 1UPTA 1D2AA 2H9IA 3LA8A 1R6UA 4RIGA 4UQOA 1U2EA 1ODKA 1T35A 1UM9A 1WW8A 1MQ9A 1Z37A 2RCNA 3GQVA 4G4SO 2QV7A 3QFTA 4P83A 5GVRA 5TPZA 1QQTA 2EP8A 2RMKA 4KYIB 4EUKA 2VTBA 1PJSA 5GIPE 1CTQA 3CNEA 1WZNA 3GF4A 3M6AA 4JR2A 4CI9A 1DIHA 1QB7A 3G8CA 1G8JA 3L79A 4M2LA 4KGZA 1IN8A 4KXVA 3AL3A 5DB4A 1EFVB 4W5TA 1A95A 1N9GB 1GNTA 3NM4A 1OBHA 1RM5A 1U7ZA 3MEQA 4C0BA 4EY8A 2B8NA 1CJCA 1MOSA 2DPMA 4CT0A 3ZJUA 4HAWA 5FTLA 2I2AA 2O0KA 3BZBA 3W04A 4KFTA 4DCVA 3CNBA 1JI0A 2WM3A 3ILSA 2ZRCA 4YRDA 2O6LA 4IGIA 1E8DA 1BHQ1 2VH5R 3EIOA 1WNTA 2X58A 4BCCA 4N9WA 1FU8A 5FBWB 4YUZA 1N4AA 3UXMA 1Y80A 5CLIA 1H66A 2IEZA 2IZ1A 1O6BA 1DP4A 2J5RA 2O06A 1M1UA 4UATA 2N1BA 3RR2A 1KFCB 1P60A 4BCDA 4DB4A 1NATA 2XB6A 2HWYA 3FWHA 1WXWA 3GH1A 3L1JA 5D2CA 3WNVA 1NMYA 2Z8XA 1U7WA 3N3AC 1M6VA 3AUKA 5B6PA 4UUPA 5D01A 1JKXA 1I1QB 3KLMX 1WBDA 1TGYA 1T2DA 4R2HA 3TTSA 3UAOA 2HHHB 3GEBA 3ZXYA 3WLIA 2A0XA 2J6IA 2PLAA 4G9EA 3IVGA 4LMAA 5CFPA 4AQDA 5JECA 1QQ7A 1XPOA 2Q3JA 3HK2A 1H9CA 1TU3A 2YXEA 2QTVA 4RTQA 2ISSD 1WXFA 2QIPA 2QX6A 5JNTA 2MYUA 3OKPA 2X6RA 4M0FA 3A6JA 5AI8A 2P9CA 3LWDA 4QXOA 4K9KA 1E1CA 4IGKA 3NNDA 1H2ZA 3RKRA 2V9CA 2QT0A 2XYQA 1A9TA 5G4LA 2PJDA 2ZS9A 4PRYA 1EK5A 4C5AA 3C1AA 2QI9C 3EJ6A 4ECAA 5IAOA 2OWDA 5P8WA 3T1TA 3ZN2A 2ATXA 5BPHA 4DVGA 2HMSA 2I7VA 3DA8A 3HWRA 3W1VA 5B2FA 1ZGAA 2WJVA 3OE5A 1HTTA 5CDTA 3E4DA 3OX3A 3FPEA 5EQFA 3Q0TA 1XPRA 3GLIA 2BEWB 3JASA 2FWRA 5LBTA 4BV2A 5MFPA 3GGPA 2ATVA 4JB8A 3K0CA 1HR0B 3KEOA 1DQPA 1XFAA 2NM0A 3FJ1A 1UKAA 3AG6A 3LP6A 5EIBD 3QEKA 5BWOA 4RKWA 2QN7A 4GQBA 1UJCA 3ZWDA 4OB8A 5E9AA 4S1NA 5JBIA 3OM0A 4F4FA 3NHSA 4GI1A 5JROA 1KKLA 3UNXA 4AY3A 1FUEA 3I9V6 3VDXA 1Z0JA 2H18A 2RI1A 5EJ9A 4KRYA 3ZC3A 3RYFB 2B3DA 4QICA 3AV0B 4XEUA 3ZDFA 3FKSD 3Q4GA 3GCXA 4EHJA 3QE4A 1I2ZA 2P3SA 1G291 5C8XA 2QRKA 2ZDQA 5DFAA 1C9YA 4RIEA 3OPNA 4FR2A 4YRZA 3HP7A 1GKLA 4JIMA 4K0RA 3ZU5A 1MABA 4EAAA 3GEIA 5HK8A 4BMOB 2HU7A 2CMDA 5T6MA 3PGA1 4GEKA 4KNVA 4R8SA 2TECE 2OUKA 3CX4A 3P0HA 1NW5A 1F12A 2JW5A 2DE0X 1K6IA 1MV8A 1PEYA 2XGMA 3HUTA 2HPAA 2OV8A 4WWHA 2VH1A 2NUBA 1N3YA 5IT5A 2WV7A 2I55A 2JFFA 4OBBA 1FW6A 2Y92A 2R6HA 2YJ4A 4CDGA 2AMFA 3FUVA 1CP2A 2C96A 4CQJA 4UAGA 4E88A 5C8VA 4BNNA 4PNZA 1CY6A 3SICE 3V8QA 3B3QA 1OZFA 3G2PA 3REFA 4QQ8A 4X71A 4NONA 5DASA 3VR4A 4URYR 1W30A 1KI1A 1L9XA 2R5WA 1KPIA 1TL7C 1WXQA 3ADKA 2ID4A 3PUHA 4FUQA 3G88A 3KJFA 5BT8A 2CV2A 1NVFA 3P9SA 2FPUA 3TOCA 2YCBA 2WSIA 3OOWA 1A8HA 1WTCA 3A4IA 4MKGA 5LP6B 4X8MA 5HGXA 5EG5A 2AVNA 4HVAA 3P2IA 1GLGA 5AW2A 1H4QA 1JBQA 4LZZA 3TLZA 4PSKA 4MUKA 4RUKA 4K9QA 4OL9A 4DUZB 3RNLA 2O0MA 2JLBA 2GD0A 1JLSA 3B8EA 3AF6A 2IL1A 2PSSA 3BBPA 2VYQA 1BQ4A 4OXNA 3SS8A 2HQOA 4J16C 3BK1A 1CZKA 3DV0B 3JAKA 4ZZ0A 4QASA 3ETJA 3D7KA 4REMA 3UK0A 3HBNA 1P72A 1KEEA 1P7ZA 1X38A 2GJ4A 3QOWA 3UYLA 1PFGA 2ODPA 4J0JA 3P0IA 2OCPA 1NMSA 1CZOA 3R40A 4MMYB 3ZWPA 1U1FA 3VAZA 2HCFA 3U4DA 4C7OB 1K98A 1XAIA 2PRZA 4WA8A 1ZI6A 2F3QA 2Y0BA 1GPNA 2BFBB 3CXRA 3JSXA 1CUUA 2OC4A 3SE0A 3DFUA 1L4BA 3PJGA 2JL1A 1JDNA 1XTBA 4QIHA 4NEGA 1PWEA 1PJ2A 1RAAA 4N6NA 1TVEA 3FVWA 1LB1B 4MAAA 1NDHA 5JCJD 3ORFA 3IQFA 4MV0A 5CFRA 2B83A 2A9KA 2CY0A 2Y1LA 4JVOA 4HR7A 2I76A 4J7XA 3UKOA 4TTTS 2OQIA 4OPMA 4JC4A 1ZKMA 1C8LA 3H86A 2JJYA 3UXYA 5KWEA 3OUUA 1YDGA 4LOAA 5FFMA 4CQLA 1GA1A 2W4QA 4ER7A 2AIRA 4AY6A 3KWMA 3LQRA 2JKZA 3FSGA 3TEJA 1L6RA 5LNK6 1AA6A 4BO4A 3P4UA 4RJKA 3JY6A 2YY6A 4G8JA 1IEVA 2P6MA 1TQ4A 2O2JA 1W59A 1ZM4A 4OJNA 1GEGA 4MEAA 4X65B 5IAAA 2ZAOA 1NI4B 1MT0A 1QK5A 1M2OA 2Z8YA 1QV9A 2LZ0A 4U6SA 4Y6GB 5FTJA 2XCLA 1A88A 3EXAA 4EPRA 2O8FA 4XWYA 1WB4A 1PRYA 1R9MA 5ALLA 5JS7A 1OT3A 1AZTA 5KNBD 4RQTA 4YRQA 4M87A 1KJ8A 1CBUA 5FI0B 1W36B 4RHXA 1MIHA 2EW8A 4FGSA 4JKIA 4AWAA 3ZZMA 2VP9A 5CT9A 5CXUA 3PU6A 4QAJA 1WSWA 3R8XA 3NIDB 5I7HA 3TYXA 2JVKA 1ZIXA 3OPYI 3HKDB 5I3CA 4DMGA 1JPNA 2KM1A 3PBKA 5L6MB 4H15A 5TSDA 2F64A 1TC2A 3PWSA 4A9AA 1ABBA 1R8QA 4HFRA 3PUWA 4IOLA 1IBKB 4O4JA 4R1PA 4LDZA 3GLTA 3NTQA 5LYYA 5J2TF 2JBAB 1M1YA 1SXJE 4TXMA 4U7PB 2J3MA 2W6MA 2QLNA 3B8HA 3Q3GE 2NUTA 2PVPA 2BRUA 2IXFA 1JG2A 4FLMA 4UTXA 3TSYA 4O2BF 2OXIA 1QDEA 3C6KA 2PX2A 2QG6A 1KYYA 1VZ2A 3OOEA 1C4WA 4IW3B 3EFOB 4L02A 4LAFA 1H2YA 1J7JA 2D5AA 3EGDA 4A92A 3T3IA 4YI5A 1L4NA 3TTVA 3OLZA 4HY3A 4JJ7A 1KEPA 4EWLA 2BEVB 2V7WA 4KSYA 4BNVA 2PMFA 1AOXA 4Q47A 4Q4HB 1TF7A 1JIQA 1L4HA 4CG3A 1FP7A 3MWYW 3WMXA 4B4DA 4B33A 2O3TA 3KWFA 3A4NA 3K9QO 4KV7A 3K9LA 1NW9B 3PKZA 4RZHA 3S68A 2D4AA 3FIUA 1CUFA 4JUBA 3RYTC 3C8DA 3LRXA 4OJYA 5DHSA 1GYQA 2FQXA 4WZBE 4CG1A 3AUUA 4UPVA 1O0CA 1A50B 1J07A 3RVMA 4EGFA 2GQ0A 1K06A 3ECAA 5F5LA 3VZBA 1RLTA 3WX0A 5IABA 2GO7A 2G8LA 3PL5A 2ZM6B 4IMPA 3DZKA 3WSTA 4M1YA 3FE2A 4US0R 3N07A 1S8NA 2FE4A 2FEWB 3TDNA 4B80A 1IVSA 3SHQA 1L7OA 3GWZA 3FCYA 4COKA 5ISMA 1YRAA 3QXXA 1Q0LA 5T67A 5K6RA 4FW8A 3AGQA 3HXOA 3SYLA 3ZXSA 2RGUA 5AKGA 3BULA 5JSZA 4ALIA 2A5DA 3VR3D 1GTVA 3AFOA 1CD5A 3K20A 4DL9A 3CVVA 4HYTA 5FLXA 5HTKA 2XTZA 4NNOA 1XTRA 2W00A 2IWRA 5GJCA 2AS0A 3ZBUA 3W2EA 2GKOA 2PX3A 1PT7A 3D4NA 4XYGA 4G26A 1UMKA 3GIWA 3OCVA 1IVNA 3UH1A 1O0BA 4C6SA 1KARA 1P7CA 3F5SA 3GUUA 3IQGX 1SKAA 1YZ3A 1VIYA 1R18A 1IUNA 2AF3C 3DYBA 2F1RA 3TQSA 1DQNA 4QU9A 3WYDA 4NJEB 3VHRA 5LQUA 5C1PA 1T10A 1KC1A 4AL4A 5G4KB 5TT1A 5H1YA 3LHKA 3WJ2A 2VK8A 3FPLA 4YUYA 1P8JA 3TLAA 3FMFA 2PRSA 2BN4A 2JFYA 4DZTA 4TS4A 3EHEA 2O57A 2R8RA 1UKVY 2ZYHA 3H8JA 4GMFA 4W5HA 1R0CA 2PGJA 1UAAA 4RH0A 4NWIA 2VEOA 5KO2A 5TQ0A 3JX9A 2CYBA 3K0FB 4DMKA 3VA7A 2HJVA 3QVJA 4P4GA 3VZCA 4AN1A 4ZHQA 4LV6A 4H6VA 2WWFA 4AG6A 1D3AA 4E14A 1U6KA 4MLZA 2IT1A 5EMJA 1GUYA 4L27A 3QY0A 4KIWA 2FFRA 4Y1EA 1EGHA 1QDUA 3P5BA 1ZNYA 4QXAA 4KE6A 4TPKA 3QG1A 4OQPA 3IVXA 1EM8B 3LK7A 4BLPA 1JVSA 1RWOA 2ZUDA 3A1UA 3EVTA 4H1HA 3QYAA 4HH4A 2KSQA 1OILA 2GAAA 4FLFA 5KYKA 3A37A 1J0CA 1QNFA 1QRDA 2F9MA 4MIYA 1RHUA 5TARA 5KOHA 1KETA 2DHQA 3PR3A 3R7WB 1IATA 2EHJA 4AP9A 2XKJE 1QHHB 1G5FA 4N39A 1QIHA 4QUBA 2DXIA 2ZSUA 1VCNA 2EU8A 3DG9A 3EE6A 3DHEA 2J9ZB 2R86A 3N76A 2VJCA 3H2BA 1M2VB 3JZAA 4HGRA 2GS9A 5FWYB 4C14A 4EI7A 4DDTA 4X93A 3VR5H 3DBHB 1WULS 2D3TA 3TUZC 1UC5B 1GRVA 3LBHA 1B3BA 3BMQA 3EVDA 5U4QA 1KERA 5FNVB 5LXTF 4PCVA 4D0LB 3HCAA 1E2NA 3LT4A 3LLCA 3U1TA 4M1KA 3TOXA 3IQHX 2NACA 5IT4A 2OXFA 4IH4A 4D0RA 4BY9E 3IHLA 2ZRBA 2Y1GA 5TGZA 5JSFA 2JLYA 2GNAA 3W0LB 1SU4A 3E7FA 4FB4A 4IIJF 5F9MA 4KBFA 5TY0A 4M36A 1RJ9B 2J3IA 3F6PA 1K0FA 4P8RA 4ZT7A 2R68A 4N0MA 5FA5A 5JCJA 2QRVB 3VU9A 1RQ2A 3DVAA 4Z1MA 1E2JA 4TYMA 3EWIA 2J9FA 2SKEA 1RZRD 1CC1S 2LRHA 1U3FA 2OHOA 2UVDA 3K3PA 4XA8A 5KSWB 5I3ZA 3GBSA 2OV4A 4ZQGA 2ZAMA 1JQKA 1BROA 4YA6A 1N34B 2QLFA 1ONPA 4YJHA 4LBWA 3H84A 3UJNA 1KP9A 3RC9A 5IZCC 4L8LA 4M38A 3A2LA 4TWJA 4IL5A 5ALIA 4Q1VA 3TEFA 3AVOA 3KHSA 2PFSA 2AFHB 2HK7A 3GZNA 3R6GA 3U7JA 1QZZA 3L7NA 3VO1A 2BHNA 4BNDB 4YJFA 4ALNA 1DG1G 4FNOA 4R0MA 2E4VA 3DYVA 1HDGO 1ZUNA 3PK0A 4LC9A 2DT8A 4QO7A 1N1GA 2QQFA 2AOTB 3ME5A 4MGEA 3TUJC 3RSZA 4ZTBA 4CI0B 2A1UA 4G24A 5H80A 4D8VA 3GZ4A 3AEZA 3KVRA 3LRPA 3EZNA 3MXTA 4MS1B 2Z2ZA 4TRNA 3VO9A 1ZLXA 3OEHD 2JAUA 1RYYA 2DT5A 4OGGA 1N2SA 2R96A 13PKA 1P17A 2WJ3A 3H13A 4TN1A 3K9BA 3VU0A 5JAPA 3EPRA 4CEJB 1KOGA 2BTOA 4OJMX 1QR6A 1DOZA 1KFJB 3EC2A 1OIVA 3UPUA 5BMVB 2JLRA 1SCUB 4U7DA 1SHJA 3KOMA 3FYCA 3RYIA 3ULKA 4U0JA 3ISVA 5CFQA 5K6AA 2BEUB 2G25A 4IIEA 5ESXA 1E0DA 3CN7A 4EB3A 2QK4A 2D59A 1U9ZA 1XTIA 3I2HA 3NDBB 1YJ5A 1XXHB 2CXQA 2PZ8A 3R3SA 4KIGA 1J8MF 2QM3A 4R1UA 4DE5A 5LPNA 2AI3A 3OZRA 3AJ9A 4H08A 2QNRA 4IDNA 1WDWB 1X7HA 2N42A 3P0EA 4TZKA 3W34A 4DRZA 3ODPA 3TZHA 3W5DA 5F1OA 2GOYA 2DTEA 3O1LA 1FRFS 5DGCA 1T0UA 3K8QA 4OQDA 3HGTA 3I9OA 4N4AA 2FJPA 4PC7A 3UH0A 4CKBB 2D0IA 5FWXB 1Y1PA 1Y5LA 1RAGA 2GN1A 1E2IA 1AVTA 1SIUA 5D86A 3PTLA 5F5NA 1U7OA 4IJVA 4YV1A 5C7YA 5D3MA 3TOZA 4WT7A 4OFXA 3KT3A 7MDHA 1QPBA 5B2ZA 1CB7A 4C88A 3LC7O 1US8B 3A31A 3HBAA 1GGHA 1MJHA 3ZE6A 2NV0A 3TXYA 4U02A 4XVUA 4UDOA 2A5FA 2ONYA 4P31A 1ZR2A 1Q50A 2C8LA 4CMEA 1C7QA 2CE7A 4I4TA 4CE6A 3CUUA 4MS3A 4AU1A 1T2AA 3GAFA 3Q8WA 1DCFA 4FTWA 1APBA 4CM4A 3PNSA 1II0A 1LC3A 1PJLA 1GCUA 2NO1A 2NYVA 2A0WA 1X87A 3DJFA 3DOUA 3FCXA 4LDJA 4N9QA 4YQZA 2XBUA 3RK4A 3SF8A 3O91A 4KXMA 2IEAA 1XBTA 1PWHA 2OD9A 4HNGA 1BGXT 1DJLA 4A23A 1LRLA 1VPDA 5JXHA 1OF1A 4KHPB 2DFTA 4GI2A 4GOKA 4N7RA 1NSYA 1H0HA 1PBTA 2F67A 2QDXA 4HWKA 4IUCS 3I1YA 3AJRA 3A6PC 1WUYA 1XN1A 4KWTA 1QIGA 5HQTA 5HOQA 3RS8A 3LT0A 3P71T 3ICWA 4NF2A 1BWRA 3JVEA 1XCMA 4YJ3B 5EIXA 2WVGA 2LBPA 4AZ0A 2C61A 2Q8QA 1E2HA 3OUZA 1VB5A 1XTVA 4IJ5A 4XPIB 1XU9A 2Q4RA 3F3MA 1XJQA 2HSWA 5AVOA 4RVGA 1UPXA 3RCBA 3JQBA 1H1DA 3HPRA 1D2HA 6PFKA 3PXAA 3LT2A 1MRSA 1L0BA 1GGVA 1V39A 2XMPA 3H04A 3I8OA 4LRTB 3DAFA 1S8AA 4XASA 5CRIA 5HQJA 1GCIA 2ACEA 3D54D 4FT4A 4UTOA 5IUJC 3EDRA 3QE9Y 3HKBA 2JRLA 4RKYA 5EXSA 2IRWA 3GAZA 4XARA 1WXXA 3A9VA 3I64A 2B7CA 1CXZA 2PGNA 3MLEA 1XF1A 3Q3HA 3QF7A 4IMRA 4LCBA 4WH0A 1KQNA 4ETIA 3VGPA 4C20A 1KRXA 2WNHA 3CCCA 4WZ6A 4QUDA 1HYGA 4ZYXA 3L4JA 2UVPB 5CBKA 521PA 3DM9B 5KEIA 4JI7B 4JNCA 3WR5A 1DX9A 5TPZD 3WK6A 5JNLA 1NBMA 5BOVA 3KE8A 5E6SB 4UFPA 1TD9A 2ZXFA 1JKIA 1E94E 2PXAA 3F6CA 5E4JA 3TDKA 3K94A 4J0GA 3AY0A 3EDYA 3C1TA 1PL0A 4ZAZA 2ZJOA 5K3FB 3F9CA 5BSUA 3AYXB 4QVIA 3IAS1 4YB8A 1PJCA 3D0RA 4FMPA 4DIKA 2B8WA 3NASA 1GG9A 1NU6A 3A1FA 2WP8J 3QIVA 1E7RA 2HHCA 4G97A 4K6HA 4MYTA 4OEHA 3QWHA 1QRSA 2VDJA 3GJTA 1CUWA 1JZTA 5DRTA 3R9KA 1EINA 1FDOA 1L2TA 1SCKA 3FNHA 1JF8A 1T5TA 2DECA 2II6A 2IW3A 3GPBA 2BHSA 3O73A 4HEA6 1SBQA 3SJ7A 4A3SA 3V9AA 2A92A 2PMCA 4L6IA 4D9HA 1BMDA 2C3YA 3HLYA 5AXDA 3O93A 2Q6LA 1LLCA 1E3QA 2D8AA 3WBJA 3UBTA 1ZK2A 4EARA 4O4IA 1L3CA 2IHUA 1DB3A 1POWA 3D8SA 3DCIA 3LQFA 4HGQA 4ZVOA 3GWGA 5JPCA 3GZTB 5HZGA 1ZWLA 2AHOA 5FI5A 3K09C 1EDDA 1KDRA 2A8YA 2QU8A 3WRVA 4QT0A 3NKLA 3CNLA 3RD5A 1ZJYA 1SBNE 2VUIB 4BEWA 1NSTA 3AEQA 2FR0A 2RIPA 1BVYF 5EHNA 3N6VA 1JIVA 4B45A 1X1AA 2VQ6A 1FSPA 3F8SA 4DHWA 4BHHB 3AR4A 3EA5A 1D4AA 1G6Q1 1Z6PA 1NXWA 2NSYA 1O9HA 1XRSB 5FL3A 3PCXA 1QF9A 2YOGA 4DMUB 5KCZA 2XNKA 4IDHA 2Y93A 4H77A 2LUOA 1H0KA 3W2IA 2EFGA 2F9FA 1FDSA 3GCZA 3D9QX 4S1OA 1JFTA 5SYNA 2X1LA 3UV3A 2R1ZA 4TZ6A 2O2YA 3R7FA 1BXZA 3KYCB 1BTOA 1M8JA 1C8VB 2O1WA 5BP7A 4CEIB 3BORA 4D56A 3HDQA 1KDYA 2H9YA 5TGTA 3U80A 4FFSA 1Z88A 4B6RA 1T9ZA 3ZHZA 5M34A 1J99A 2PH1A 4ISCA 1IXRC 3KVYA 1TF2A 2B82A 3BKXA 1HXHA 5CLJA 4BLOA 4B6GA 2WB2A 4FFMA 2VHXA 2HSGA 5BT9A 4O8CA 1EJ2A 1DO0A 1SC3A 1C3XA 1M2JA 1QE3A 2FLVA 3ZK7A 4CTJA 2QVCA 1WAMA 3GJ6A 2O8BB 1MW8X 4FDAA 3ZLVA 3W05A 4KN8A 1ISGA 2CDRA 3RAGA 1KMIY 4B2IA 2H59A 2WHEA 1EFKA 1Z83A 4C29A 4M21A 1JT9A 3H1FA 2OBMA 4GMDA 2OCDA 3O8OB 4P86A 4R31A 4Y9SA 2J3KA 4M0DA 5H59A 1B15A 1E1NA 3RS2A 3E22A 3FXAA 2JLZA 1ATIA 4OYRA 1UBTS 1ID1A 3SS9X 2IX3A 3GVHA 3LG2A 2WP0A 2D00A 5L4SA 2GN2A 3AQIA 2P9TA 1E9DA 5T41A 1USWA 4C89A 1V43A 3GD7A 2YWBA 4YMTA 1I3NA 4YV2A 5FHQA 2AL7A 4HDQB 1CULC 2ZE5A 1JYFA 3AR9A 3NAZA 3RK1A 4CU2A 1EAMA 3BE4A 4E11A 5CDFA 1KI2A 1QHGA 3AG5A 5CB4F 2UVQA 4F4CA 2IV7A 3QJ5A 1ZMRA 1R0BA 1EVYA 3HN6A 2X0FA 5JQGB 1VRCA 4QBFA 4HLDA 4JL6A 2VHVA 1SG0A 3COVA 2N0SA 4Q3EA 4G5HA 1M8KA 2MHCA 5J63A 2IYWA 2CHGA 1SULA 3M49A 3NAQA 4C22A 1WDMA 1KRWA 4BNKA 2W2QA 1VL2A 5F12A 4BGPA 1EX1A 1UADA 3P2EA 1TYAE 1Y3DE 2CYAA 3D7LA 2EEZA 4ILEA 3FRHA 3I05A 4F7WA 4O0LA 3CLKA 5FO0A 4A2WA 3U6KA 2QXYA 3R6DA 2OG2A 2C97A 5IKPA 4QPDA 3THXB 2XB9A 1VIDA 3L7LA 4POAA 1S3IA 2ZSAA 2VDWA 3MBIA 3NETA 2HY7A 4PLGA 1RZ3A 1Z4MA 5LWQA 3MWJA 2GZAA 4QOEA 1QHSA 3FZNA 3A8TA 2O59A 5I7RA 3PXGA 3GD5A 3QEMA 3WYAA 1DAIA 4FVTA 4CWAA 1VE1A 4JBXA 1XJ0A 1JP7A 4O29A 1W52X 3QGMA 3UATA 1KPGA 4ARUA 1Q7EA 2B1GA 3AB8A 3I2YX 4JQOA 8AT1A 3IXLA 5CCBA 3S2FA 2IOHA 4WHMA 2EJBA 4PINA 1COZA 3BL5A 1Z6XA 3MLBA 3AEKB 4R1MA 4AG5A 1KI4A 1RSZA 3D3WB 3UJBA 1EFDN 1U8ZA 4RGVA 1A9PA 3IALA 4WVFA 1O7JA 5M5BA 1QFYA 2O52A 1A5ZA 3V33A 2GPYA 1CZNA 3F3SA 4P33A 1IVYA 1MGPA 4HBGA 4JEMA 3WGKA 3CVUA 5H02A 2O7SA 3AHCA 3DLIA 2OL4A 3QX9A 2W2KB 2YIMA 3OFJA 2W90A 3KYIB 4FFOA 1ODJA 4R0VA 4YROA 3QV2A 5E1OA 3SHOA 2E6KA 1DCTA 3U49A 2XDYA 1SC6A 2FP4A 4X24A 3UTCA 2CMGA 4PGHA 3IP8A 4H18A 1GVNB 3C5WP 4ZT3A 1Y7HA 1QYWA 1SO8A 3KZCA 1NXQA 3I9NA 5EIBC 4FBLA 3VR1A 1JIUA 1XZDA 2H4HA 4IM7A 4X63A 3ZK8A 4CMGA 1W34A 1ZOPA 3ZU6A 3K1ZA 5JRDS 2VN8A 3FCCA 3OOYA 4JWTA 2NT4A 2QVBA 1LSJA 1HGXA 4ZAFA 3GPDG 3MOIA 5CT6A 2V65A 1S9HA 3BRSA 1L7BA 3UWKA 5AM1A 2D7CA 3GOHA 2ZP1A 4X90A 1DAFA 5JLAA 4M1SA 1GPMA 2X8JB 3R4VA 4WERA 4JLSA 2UV8A 3S1LA 3TTUA 4D9KA 5IJWA 5FORA 2C7RA 2QDKA 4FNMA 3R7BA 1WVIA 3HDHA 2NXJA 5E9QA 1EBBA 1WKCA 1IOLA 2P4HX 4M6WB 5NLLA 3L7DA 1RAIA 4AY5A 2VKTA 4IDDA 1XZLA 3TD2A 1EG2A 3OIDA 5DM4A 1JTVA 1ZI9A 3MT0A 3VJKA 3UFXB 4CF5A 4K5QA 4PHHA 4TTIA 1RMYA 3ROZA 4EOGA 3GEHA 3PEEA 3BG5A 3FPFA 4WZAE 4GBJA 1E2BA 3AKZA 3N8HA 3T61A 3KS9A 2J33A 2HIHA 4QPJC 3GGGA 2O4CA 2W6JD 4BEVA 4M9XA 4N0PA 4RTJA 2BKAA 1XD2B 5EY5B 1B73A 1Q0PA 1UXGA 2PS3A 3ZI7A 3SR3A 4CMHA 2YYYA 1I8TA 3ICEA 4NXNB 1VECA 3UWMA 4AJIA 1N25A 4ENPA 2ANCA 2WHPB 3P0FA 4RDCA 4RHCA 3TX6A 3WKAA 4CIDA 1FEZA 4FDMA 2OGUA 4UNSA 2E1RA 3JYPA 4JLVA 4NBKA 2IUUA 3G8AA 2VTDA 1L5SA 1PR5A 1HQDA 3S81A 3REQA 1RQLA 3H3JA 5ALNA 4JC0A 1FTNA 4NJOA 4FINA 3O3CA 4MMZB 5JSKA 2YFQA 3PPXA 3ZDZB 1YB5A 4BVLA 4F8EA 4ZCLA 4F96A 2R00C 1QNLA 4JYCA 3X1XA 2DQKA 3S4YA 1CEYA 1MJFA 3FY4A 3K05A 4Q3DA 1L7RA 2PWZA 4JYPA 3HY4A 1HOXA 2R6GA 3L4SO 5KNBH 1W9HA 5I8ZA 5IJXA 4V3CA 2BH2A 1EP9A 2J5QA 3VNQA 2XQIA 4GW3A 1Q1NA 1WLSA 2HSJA 1H8HA 2ZXEA 5IVPA 2A6PA 2PQ6A 4EJSA 4GBGA 2H31A 1EFCA 3QMWA 1CJUC 1XD9A 2O50A 4IH9A 1NQWA 1Y6JA 2BE9A