2JL1A

Structural insight into bioremediation of triphenylmethane dyes by citrobacter sp. triphenylmethane reductase
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
287
structure length
287
Chain Sequence
FSIAVTGATGQLGGLVIQHLLKKVPASQIIAIVRNVEKASTLADQGVEVRHGDYNQPESLQKAFAGVSKLLFISGPHYDNTLLIVQHANVVKAARDAGVKHIAYTGYAFAEESIIPLAHVHLATEYAIRTTNIPYTFLRNALYTDFFVNEGLRASTESGAIVTNAGSGIVNSVTRNELALAAATVLTEEGHENKTYNLVSNQPWTFDELAQILSEVSGKKVVHQPVSFEEEKNFLVNAGVPEPFTEITAAIYDAISKGEASKTSDDLQKLIGSLTPLKETVKQALKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insight Into Bioremediation of Triphenylmethane Dyes by Citrobacter Sp. Triphenylmethane Reductase
pubmed doi rcsb
source organism Citrobacter sp. my-5
molecule tags Oxidoreductase
molecule keywords TRIPHENYLMETHANE REDUCTASE
total genus 110
structure length 287
sequence length 287
ec nomenclature
pdb deposition date 2008-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2jl1A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2jl1A02
1JKJA 1ID1A 1LU9A 1DC4A 1P77A 3MWDB 1UZNA 4Q9NA 3WSWA 1DLIA 4IM7A 1Y8RA 4J49A 2IRWA 4QSMA 4BO7A 1VKNA 3WQRA 4BKQA 1JKIA 2X86A 1B26A 2HCTA 3KLMX 2IDZA 4FGSA 1VJTA 2HMUA 4BS9A 3G1TA 3C3XA 2QW8A 3AU8A 3ZWOA 3I6QA 3C85A 1S7CA 4FN4A 3SX2A 1HZJA 4DQVA 3PTZA 2JD1A 2HSDA 1AXGA 3RC2A 1Y5RA 2Q1UA 3M1AA 4YACA 4FFNA 2GN4A 4JP3A 5DN9A 3G3EA 3KSZO 4MVJA 3NV9A 3PDUA 4R1NA 2VHYA 3Q11A 4F6LA 2VTDA 3QIVA 4R4JA 3DONA 4XDYA 4AJ4A 4MVJH 4WPGA 1CJCA 2WDZA 4OHUA 3CEAA 4Y98A 3AFMA 4KUHA 4OJNA 1BWSA 1N8KA 4N5LA 1T24A 4LMPA 4XYGA 4CQMD 2WE8A 3GRPA 2IYPA 1IPEA 3MEQA 4A10A 3DL2A 1U3VA 3VAZA 2B4QA 5A9RA 4GX0A 2D5CA 4DPKA 1O9BA 5I9MA 5DF1A 2DQ4A 4EJ6A 2VWHA 3QWAA 1MFZA 5BSFA 4XJSA 1BXZA 2J5RA 1OAAA 2D5AA 1DIRA 1SAYA 3DZIA 2DUUA 4CMKA 4CODB 3KETA 2VQ3A 4MIEA 1EFLA 3H6KA 5A04A 4O59O 1P31A 4MP3A 3PWKA 2DM6A 4ZA2A 4BGIA 1XYGA 4PRKA 4NBVA 4ND3A 4CQLA 1EE2A 1AHIA 3GN1A 3FWNA 3JQGB 5CG2A 2VZ9A 4ZN6A 1PJBA 4CM8A 3HB5X 1ZK3A 1Y8QA 3I1JA 3H3FA 5JW6A 3V2HA 4YT2A 1PS9A 4BV8A 5DDIP 5A02A 1YOVA 3N58A 4YA6A 3AM5A 4MVJG 5DOVA 5THQA 4I5GA 4MJLA 3RUHA 3EYWA 1YB4A 1UDBA 4YRDA 4DREA 5FWNA 4BVAA 1KEWA 4BNNA 3BTOA 1TB4A 2J8ZA 2AHRA 2WE7A 4OQYA 3JQFC 4J3FA 5LDHA 5MDHA 2DC1A 1UXJA 3HDQA 1EZ4A 3LT4A 2LDXA 4Y67A 5JC1A 4FOSA 3W6ZA 1ZXBA 4AJOA 1HDXA 1EDZA 3DZGA 4D0SA 1KEVA 1E1LA 4AJLA 3LYLA 4HV4A 2CVZA 2C7GA 1RWBA 2C2XA 3NTOA 3D4OA 5IF3A 2B36A 4OIMA 3BZUA 3BMOA 1JWBB 3F3SA 1T2AA 3JQFA 4OL9A 4RF4A 1HE3A 4ILKA 1NQTA 3I9OA 4I5FA 1PEDA 2BGMA 3GVIA 4BNMA 3L07A 4TKLA 4BMNA 4BNLA 4WK6A 2G82A 4Q3BA 5J23A 4UVGA 5JYDA 3LVFO 3PWSA 1Y6JA 4DLBA 1NM5A 4E2XA 3DAPA 1QV7A 3DOOA 2FN7A 3V1YA 1U1IA 1U8XX 3VKVA 3ZHYA 2DAPA 2DPHA 5EPOA 2ZIZA 2ZB4A 4QO8A 1R15A 4JBGA 4NK5A 1LSUA 1GAEO 2VZ0A 2CSUA 1A9ZA 2AE1A 4Z0TA 1R0SA 3OFSA 3MZ0A 3GVXA 2X9VA 1Z82A 5EQFA 1OFGA 3L77A 1VI2A 3L4BC 1D4FA 5G0TA 2G5CA 4WASA 4L73A 4JXKA 5G0VA 1KC1A 3W4KA 3QW2A 1HYHA 3E48A 4GSKA 3JD3A 1DBVO 3AJRA 3FNFA 3IP1A 5EINA 4PRLA 5G4KA 3OQ1A 4LVCA 4MVJI 4NFSA 2QRLA 4WEOA 4XA8A 3NGLA 1PZEA 3AK4A 4H16A 2ET6A 1YJQA 2B35A 2EEZA 5B4VA 5FEUA 1VL6A 3A1NA 3ZCXA 3MJCA 4E4YA 1IHYA 4E5PA 1KEPA 4TVOA 1EDOA 4RJTA 1LNQA 4OXKA 2C7VA 3ZZNA 4BNYA 2V6MA 3W4JA 1LI4A 3BTVA 3DMYA 4HBGA 3DWFA 3S2FA 1PQUA 4Z3DA 4KUGA 4ND2A 5HA5A 4DLLA 1SOVA 5B1YA 2P68A 4JJGA 2Y1OA 1WVGA 4J1SA 3L0DA 2O4CA 1JKFA 3QVWA 2NNLD 1I30A 3PGXA 1PR3A 4FC6A 5DULA 1N9GB 2F00A 3PZBA 5ILGA 5IZCA 3OQ6A 1R4MB 2O2SA 4O5OA 5HBRA 3VC7A 5BQFA 3U4HA 3DTTA 4PG6A 3DBRA 3RKRA 4RDHA 4B3IA 1S6YA 3RIHA 3E03A 4CLXA 1ULUA 3JD0A 3Q0EA 4O63O 1FDVA 1KBZA 4E21A 1YL7A 4DXHA 1AE1A 2NV6A 3INGA 1F8GA 2C29D 3WIEA 4GKBA 2PKQO 3AUUA 3O8QA 1C1XB 2ZQZA 4II2A 3PEFA 4L8VA 2W2KA 4BQPA 3VPXA 1NR1A 5G0WA 5CEEA 3NTQA 4JJIA 4J6FA 3ROPA 1VSUA 1U8FO 4DMLA 4HFMA 2NADA 2BELA 1GUZA 3NGXA 3H2SA 4W82A 2J3KA 5IXSA 1U4OA 4W4TA 1SB8A 3HADA 4E5KA 2P91A 3INTA 1PSDA 1QV6A 1I3LA 1R0KA 4H3VA 1BDBA 1LLDA 4E13A 3HDYA 2PTGA 4WGGA 2EG9A 2OOSA 1LDMA 3RQSA 3DAFA 3GEGA 1SEPA 4BO9A 2GZ2A 1YQDA 4B3JA 5CG1A 1PJSA 4RF5A 2Q4BA 3FPLA 3I4FA 4WNCA 4CMJA 4KQWA 3U5TA 2FMUA 5G0SA 3HFGA 1ADBA 5IAAA 2PZLA 4YDRA 4WLVA 3WMXA 2DTEA 1DRWA 3H5AA 3ON5A 5A06A 3E9QA 4LCJA 3G49A 4DUPA 2B0JA 4DL9A 4HY3A 4RVFA 1K2WA 1X1EA 2Q2VA 1RM5A 2Q3EA 7ADHA 5L40A 3Q3CA 4GKVA 4ZQFA 2NACA 3TZHA 2X0NA 4L4SA 1ZVMA 3AW9A 4PVCA 3JCZA 3FRJA 4L4XA 1UXKA 4XKJA 2Q4EA 2W2LD 4KUEA 4L4RA 2BLLA 1DIGA 4Y8VA 4CMAA 4G5HA 4BGUA 3CE6A 4YPOA 3O03A 4XB1A 5DOZA 3PVZA 1X7HA 4KTTE 1HT0A 4IJWA 4IZIA 2PZMA 5TRTA 3ZWPA 1X13A 4BO6A 4D46A 2ZB7A 3N7UA 4Y9DA 4PG8A 2I66A 3AY6A 4AJ1A 2QYTA 2O3RA 5DBGA 5KKAA 3QQPA 4JBIA 3IUSA 3D5TA 3FCOA 4PGFA 5I7VA 1I10A 2W2KB 4XZ3A 1NQAO 1ZXLA 2VUUA 3KV3O 4M1QA 3DZKA 3SXPA 2WD7A 1NBOA 2O2YA 1P74A 2PFGA 3PIIA 3U62A 2YUTA 1MLDA 4CLEA 1E7RA 3NJ4A 3DZJA 4YQYA 2OORA 4S1VA 5CDYA 4CV0A 2BGLA 2YJZA 5EESA 5JE8A 5IDQA 5JMWA 2A9FA 1VLLA 4ND1A 3ZU2A 4W7IA 3SLGA 4KP7A 3S2IA 1I3MA 3HHPA 5C7LO 1NWHA 1LX6A 3K31A 3N74A 3UCFA 3KHUA 3MCVA 3PYMA 3I9MA 2PD3A 4BO0A 1A71A 2VHXA 1WDLA 4NBTA 3NX4A 1ZSYA 3UGKA 2HJSA 3OA2A 3DAGA 1LDGA 3GPIA 1QLHA 3QJ5A 1MC5A 3VPGA 2X22A 3B1FA 2O3QA 2YHIB 2FP4A 4WE3A 4XQEA 3DB2A 4AJ2A 5L4SA 1Z74A 5GZ3A 1NHWA 3GC6A 4OM8A 4U8GA 4CM1A 1B8PA 1C3VA 4XJTA 3KB6A 4Z3KA 1FDUA 1P45A 1PZGA 1KVUA 4EGFA 4J7XA 2VOEA 3JQCA 2I3AA 1GZ4A 1F14A 2GGSA 5F3RA 5LDGA 3JYOA 3K30A 1CETA 1HF3A 1BSVA 3GDGA 5DBIA 1RKXA 2C54A 1LLUA 3CUKA 3EZLA 3JQ7A 3WLEA 1NFRA 1YH3A 3WQQA 3ZWNA 3OETA 1ENOA 2DTXA 3EY4A 4WLNA 3ONDA 1SMKA 1ZBQA 1N7HA 2H5LA 3JYLA 1ENYA 2D0IA 1UP4A 2E82A 1ARZA 2ZB3A 3RFXA 5BSGA 1GYQA 1LSSA 2VRCA 2P9EA 4NDNE 1T1SA 2Y1GA 3PLNA 4S3MA 1HTBA 2NU6A 2EXXA 3DQPA 3PZRA 3ZWVA 4I9UA 2GDZA 3VPHA 1JVSA 4CM4B 4E2ZA 4BNTA 3BHJA 2ZYDA 1ADFA 3F1KA 4FFOA 4WKGA 1E77A 3QY9A 2XXBA 3V5NA 3PHLA 5COQA 5JAIA 4A5OA 1BDMA 1T4DA 3HE3A 1H9BA 1GR0A 1O5IA 1EE9A 1YBAA 1GYRA 2RAFA 4EITA 3QHAA 4RL6A 4FB5A 2VTEA 4J7CA 1QYXA 2AQ8A 4ZD6A 5KCZA 4PLWA 1MFPA 2HO5A 1P0CA 3LT1A 3GF4A 3U49A 3HZZA 3UW3A 2HMSA 2CDAA 1I0ZA 1JVBA 2FY8A 4YJFB 1Y1PA 5TT1A 1OOEA 5TQVA 2FPPA 3MJ4A 1TXGA 2X5KO 3AOEA 5IZCC 3DXFA 2B5WA 2FSSA 4PLPA 3EVNA 4CLRB 5HTOA 4BHTA 2Y1FA 1QSGA 3DZFA 2BFPA 1P1KA 3E5MA 1CIVA 4R1SA 4WJZA 3DBLA 3NDRA 3NDJA 2PV7A 1UUFA 5I9LA 4BIIA 2IEBA 1D1SA 1GPDG 3ZHBA 4RV9A 4Q39A 5AQ1A 1R4NA 2OHXA 1GYPA 1H6BA 4NFYA 3GR6A 2DTDA 3L4BA 4NJOA 2VHVA 5L53A 4HXYA 3E18A 4OO3A 3ENNA 4CPDA 4QTZA 1PJQA 4UVIA 1EUZA 4CL8A 4GX2A 3WGOA 1RM4A 1XU7A 4J90A 1P0FA 1PJ2A 2X58A 1M75A 2AEFA 3UN1A 3ZW9A 4OSOA 4XRRA 3HDHA 4P8RA 2BI8A 4IS2A 1H93A 5CAEA 3JQ8B 3FNGA 4II3A 4LVUA 1VL8A 5FFFA 2GASA 4CJXA 1P1HA 2IZ0A 1TA4A 3M1LA 3QWIA 1BG6A 2AMFA 2P4HX 4FGWA 3HB4X 4MVJD 1EK5A 4O6VA 2ZTLA 4XQGA 5FYDA 3UCXA 5JO0A 1LC3A 4W9NC 3RBZA 1M67A 4KWHA 4XB2A 2NVUB 5K6AC 4TRRA 3A28A 1QP8A 2IZ1A 3GHHA 1D1TA 3B70A 2PLAA 3KUXA 1BVRA 4ID9A 1GCOA 5GMOA 3VZRA 3H9QA 2R2GA 4XEHA 1TLTA 1KC3A 4NH4A 2HAEA 1D8AA 1P1FA 1QYDA 2YW9A 3GAFA 2AE2A 4PLHA 2PNFA 3IOYA 2VNAA 1GQQA 4ZJUA 1P33A 3DFUA 4ALJA 3UF0A 4Y6RA 1T2FA 1P44A 3U4CA 1CDOA 4IPTA 2X0JA 4FJ1A 2QZZA 3JSAA 2JKVA 3WGYA 2Q49A 1ZCJA 4WLUA 1LBEA 5MGBA 5AXBA 4E0BA 5G2OA 2DUWA 3GVPA 4A27A 3GN2A 2WTBA 3RC9A 4XQ9A 1A5ZA 4OOEA 4CLDA 3HFSA 4CV1A 4K1LA 4MIYA 1C0LA 3KBOA 2GR9A 3GGOA 1BHSA 1ISIA 1VRWA 3KSDO 1MG0A 4FPXA 3RBXA 3RI3A 1I3NA 2PGDA 4YEDA 4FFPA 1UAGA 4HNHA 3IJPA 5JY1A 4URFA 4PG5A 4WLEA 2NTNA 1LQTA 2CNBA 4NNJA 3DHEA 2FPIA 3U3XA 3O4RA 1V3VA 3WWZA 1V0JA 2EHDA 2V6FA 3IP3A 2NQ8A 4Z9FA 4BNUA 4D44A 1I24A 3RWBA 2C20A 4DBVO 2SCUA 1G0NA 2NSDA 3AY7A 4TZTA 4FFRA 4E31A 1LC0A 5ICSA 4RZIA 4Z0PA 4IGEA 1E7MA 1ZK0A 3GNSA 4J1TA 4JROA 4FIZA 4M49A 3TFQA 4GGPA 4JX8A 1N5DA 3ZV6A 5KOIA 1VE9A 1T4BA 4OSPA 4YBZA 3KEQA 3PGJA 1LQUA 1HDZA 3BA1A 3M2PA 4HUJA 1T26A 1LRKA 4AL4A 2B83A 4B4UA 4EI2A 2WSBA 1CEQA 4BNWA 2GNAA 3H5RA 4NG5A 5TT0A 4B3HA 3C1TA 3D1LA 4MVJE 1K89A 4GVXA 4CUKA 2H1SA 1G6KA 5EMHA 4JP2A 3BIOA 4OQZA 1EUCA 3BMCA 2G1UA 2QX7A 3LU1A 1HLDA 3OSUA 4K9DA 3F5SA 3FN4A 4RVSA 4A2CA 4BKOA 4J0EA 3JQGA 4DC0A 1SCUA 4YAIA 3WGHA 4IQGA 1E1NA 4C7JA 4M54A 3GDOA 3BMQB 2EW2A 1MXHA 3OQBA 2NUAA 3DBVO 1GV0A 4CMHA 1C0IA 1PS8A 2FWMX 3W8FA 5F1PA 4XYBA 1EUDA 3C24A 1B8VA 4IIVA 3TOZA 3NEPX 1PU2A 1U3WA 1LTHR 3WYCA 2GSDA 3VVCA 3JQAA 4AJEA 4QT0A 1XHLA 3ONFA 3ZWCA 3IUPA 1GZ6A 1UDCA 2PH3A 3DMTC 3UH1A 3WGZA 2RH8A 1ZEMA 3C7DB 3GHYA 3JYQA 4J43A 2O50A 3ZWAA 1YL5A 2AQKA 5ENVA 2J5QA 3QWFA 4XDZA 3ITKA 2YFQA 4JLWA 5JDCA 3TZQA 2ZB8A 1L1FA 1U2DA 2UV8A 3OM9A 4BMSA 5BT9A 3QE3A 2GO1A 4DPMA 4E33A 3G1UA 2CFCA 3H5NA 1B14A 1PJ4A 3ZNQA 5CFZA 3K92A 5JY6A 4GL4A 5CPFA 5L9AA 5JAMA 2AG8A 1UXHA 1PQPA 3PWZA 3HQ4O 3W6UA 2UDPA 2D8AA 4GGOA 1CERA 5JC8A 3JYPA 3DEYX 3MJTA 3FD8A 4FJ0A 4DBZA 2IXBA 3TFOA 1PGPA 1E3LA 4J7UA 1XDWA 3WFJA 3ZWXA 1Q7BA 1LUAA 1Z7BA 5JBIA 1LJ8A 5BR7A 1HKUA 5DCWA 4R54A 4YQZA 3DOCA 3TWOA 4AJHA 1O94A 4YT8A 2O7QA 3K5PA 3I4CA 3O9ZA 3GVCA 3HJAA 5AVOA 2Q99A 4AJKA 2Y66A 2C0CA 3AI3A 2ZCVA 4D43A 3WYBA 1EQUA 1C14A 2JCXA 1EVJA 4R5MA 4ALNA 1QYWA 1ONPA 4FFMA 4FQ8A 3WX0A 3PHIA 3H9UA 1SBYA 9LDBA 4NPCA 5C3MA 1JW9B 2DBZA 1QG6A 2PY6A 3D3EA 4MP6A 3U4DA 3PRJA 5IG2A 4NJMA 5U4QA 1RPNA 1UH5A 2O23A 1XIVA 1NASA 4CQLB 3R3JA 6ADHA 2FHSA 1LLCA 3IAHA 4QFDA 5A9SA 5TLSA 3VHRA 9LDTA 1XG5A 3VZQA 1Z45A 4XIYA 1YBMA 2LDBA 3T7EA 4D42A 1PGNA 2RHRA 4OKNA 2Y1EA 4C7KA 1YGYA 4TRNA 1KYQA 4E5NA 1ULSA 3S1LA 1HZZA 1E7YA 5ER9A 3MTGA 4WECA 2FPGA 5JAZA 3FWZA 3WR5A 1K6IA 1R4MA 3ZGYA 1WMBA 4GX1A 3SC4A 1ZK1A 4BO4A 5JNLA 1J4AA 5HM8A 3LC2O 4UVDA 1NFQA 5EL0A 1I32A 3RUEA 3VH3A 2P5YA 3P2OA 3VTZA 4EDFA 1XCBA 3D4NA 4ROSA 1U2GA 3KTDA 4J1NA 4DIOA 1ZNQO 3ONEA 1RM0A 5I9NA 3K73O 1I01A 1WZEA 2W4QA 3NDIA 4XIJA 5TJHA 5ILOA 1N2SA 1Y7TA 3GGPA 3LK7A 3BMNA 2HKIA 4E5YA 1JTVA 1MA0A 3A9WA 3RUIA 2W98A 3ENKA 4ZRMA 5COBA 2PK3A 1PJLA 1HYEA 3UXYA 1X15A 1V8BA 2V6GA 4RO0A 5CEFA 4JBHA 4XYLA 4R3NA 2OP0A 4ZQBA 3BAZA 5COAA 3F4BA 3L6OO 4DQUA 2D3TA 5C37A 3R0IA 4W6ZA 4JIGA 4YJGB 1Y9EA 3WNQA 3ICCA 4IY1A 3CXRA 3WIDA 4CQMB 1B0AA 4E12A 1QYVA 4WCFB 4TRMA 1DFIA 3ROKA 4YYZA 1WNTA 2ZKLA 1P9LA 2X23A 2AA3A 2C5EA 3HSKA 3RSHA 4YWJA 3WGGA 2V65A 4ZU3A 4ESOA 5K0ZA 4MKZA 3H9JA 3WNVA 2Q45A 3GZNA 5T67A 1DIAA 3UVEA 1QLJA 5IXYA 3WGIA 1Y8RB 1UJMA 4BO2A 3C1OA 1YKFA 3AWDA 1K3TA 2EWMA 4IDAA 3G17A 2P2SA 5B4UA 5BSEA 4LRTB 3K2BA 4M8SA 1NYTA 3RAJA 2HMTA 4E5MA 1DJQA 1BMDA 1V35A 4GMGA 1ZZEA 3WJ7A 5DT9A 1DIHA 3L4SO 2GZ3A 1NPYA 3AUSA 4IJKA 1H0KA 5G0UA 2I76A 2HK9A 2JHGA 3KOUA 4B4VA 2OL4A 5ENDA 4J9VA 3P2YA 1ZK4A 2Y93A 3GEMA 5I8WA 2OBNA 4J2HA 3JQAD 4QO7A 3F5QA 5TS3A 1EK6A 3ROQA 2Y67A 4GLOA 5U1PA 4PLYA 4MOWA 3I3OA 1IY8A 3ULKA 1HDYA 4P4LA 3EK2A 3LT2A 2PR2A 2O3UA 4B8WA 1HWYA 4PLTA 5U9CA 4N7RA 3OIFA 4MKXA 1U4SA 2FZEA 4NFHA 2VYVA 2ZATA 1AN9A 1UXIA 1GEGA 2E49A 2ZCUA 1HDOA 3GH3A 1GY8A 2JHFA 1HSZA 1NQOA 2AEJA 1MGOA 3CSDA 4MP8A 1ZW1A 3D7LA 5C7OO 4CQMA 1F12A 2D4AA 5HRUA 5C7IO 4PZDA 4UEKA 2RBEA 1ZJZA 1OZAA 1P3DA 3JYNA 4I5EA 1WWKA 3OIGA 1WMAA 1WXDA 3I52A 5CHEA 1JDJA 4NBUA 1H9AA 1FF9A 3SBOA 4R01A 2QQ5A 1DRUA 2PD6A 2FR8A 1SEVA 2POQX 1DC6A 1XGKA 4YRAA 5ES3A 2EP7A 1NVTA 3KSUA 2BGKA 5KVCA 2PKQP 4BNVA 4I5DA 3IIEA 5T64A 6LDHA 4KWIA 3PHHA 4CM9D 1HLPA 2W8ZA 1E0DA 5L7YA 2VNSA 5AXDA 3AUTA 3RFVA 1KEUA 3FI9A 1PX0A 1X0XA 1HSOA 4A26A 1R66A 2ZJ1A 1I2CA 3VTFA 5B12A 3NAQA 2JFGA 4PIVA 1J0XO 2YZ7A 4U6QA 1E7WA 3W1VA 2BI7A 3TZKA 5EERA 4CM6A 1XELA 3S2GA 2OBYA 1Y8QB 3LF1A 4BKRA 1U7HA 5KWEA 1B7GO 2GZ1A 4YAEA 1BVUA 2NU9A 3F46A 3W8DA 3LZ6A 3ZV5A 3L6EA 2CVOA 7MDHA 2HQ1A 2FOIA 4H15A 2H6EA 2CMDA 4PN3A 5FI3A 5DCYA 3HN7A 4CMIB 1DAPA 2B4RO 3FTPA 1N92A 4N5MA 2Q50A 1X14A 3CH6A 4D0RA 4CMEC 3OJOA 3GAZA 3MTJA 1P1JA 1M76A 5KJ1A 5FI5A 5F5LA 1DRVA 1KERA 2H63A 4BKPA 4YRBA 2Z1NA 3I9KA 2IEDA 1AXEA 3EAGA 2Q1WA 3T4EA 4CM4A 5JDIC 3QVXA 2NQTA 5A4DA 2CF5A 3AFNA 3DZBA 1DLJA 5JYEA 2CUKA 4HKTA 3P7MA 4GWGA 3Q2IA 1JQBA 1ML3A 3TZ6A 5ICMA 3DOJA 3SEFA 3KYDA 4K26A 2X9NA 3DHYA 3BMQA 5DP2A 3WBBA 1A72A 4U0JA 5H81A 1BRMA 3WQSB 3KYBA 5KJEA 4IXTA 4JQCA 2AXQA 4N5NA 2CY0A 1Q0LA 1H6DA 3I9JA 4J9UE 1VJ0A 1YL6A 1NR7A 2G17A 4YJFA 5H83A 5JPIA 3RU9A 4K28A 3IMFA 3P19A 1LRJA 2VYVD 3WWYA 4BUCA 2YYYA 3ANNA 3E1KA 3NRCA 4LK3A 4R69A 1IE3A 2RH4A 3QVOA 5KTKA 3OICA 2XF8A 2EKLA 2R6JA 3JQAB 3KVOA 3T7CA 1NAHA 3LC7O 3G79A 3AM4A 1OC2A 4KMSA 3NJ8A 3FPCA 2DT5A 4GSLA 4MVJF 1B16A 1YB1A 1SOWA 2EJWA 4O0LA 3RFTA 2WYVA 1C1DA 1V3TA 4TQGA 4LRSB 3B1KA 2BFOA 3DC2A 1PTJA 4YJDA 2P9GA 1K0UA 3PYLA 4BOYA 4RORA 4UEOA 5T8KA 3OEWA 1PGOA 4BNIA 1ZK2A 3GGGA 1GADO 3ZU5A 2EF1A 4D3FA 1GL3A 2YQ4A 2DBQA 3NUGA 4CLOA 2E6UX 4B79A 1C0PA 1YE3A 5G4LA 2UYYA 4NZ9A 5IDWA 3PK0A 3H3JA 4NQZA 1YRLA 4XYEA 1DFHA 4XD2A 4ND5A 5CDGA 4NR0A 3CINA 4D3SA 3OH8A 2NVWA 2W90A 2C5AA 3GFBA 2J6IA 4L75A 1YJ8A 3VH4A 1LDEA 2HJRA 4KDEA 1ZO8A 4Q3CA 4W99A 4CMIA 3KM0A 2JD0A 3QRWA 4R5HA 4C4OA 4YAKA 4BNXA 2GN9A 1B15A 3QVSA 4NK4A 1NP3A 1I33A 1YVEI 4I08A 3JQ9A 3JQEA 1I8TA 4LGVA 4P4GA 2DBRA 1YQXA 2JAPA 2P9CA 5TIIA 1XQ6A 4XR4A 1PWZA 1RYEA 2BH9A 1C0KA 3OP4A 4FSHA 4R3WA 4FR5A 5KNLA 1L7EA 3WBFA 2X4GA 1Q0HA 3B6ZA 4GAEA 1YQGA 5AYVA 4LMRA 1IUKA 4RZHA 3NTRA 3OJ0A 3EZYA 3KYDB 1KVRA 4FOOA 4CM3A 4KDFA 3U9LA 1BXGB 3DBHA 5L7TA 1O6ZA 4MKRA 1A27A 3E82A 4RQUA 3F9IA 5KVSA 2X5JO 3LLVA 5JMPA 1I2ZA 4PZCA 1F06A 2GUGA 5KVQA 1FK8A 1EVYA 4ALLA 1VJ1A 1YBVA 1ZH8A 2CDBA 3I9LA 3KZVA 1IB6A 3H2ZA 3KYCA 1E5LA 4WCDA 5LC1A 3OEYA 4JCOA 4CLRA 5JS6A 4RPLA 4BB6A 1PZFA 4RPGA 4PFJA 3P5SA 4EZBA 3JQ6A 1OC4A 2E37A 3C7AA 3GG2A 1NQ5A 4YT5A 2I5PO 8LDHA 1FDTA 2DKNA 4NMHA 3SJUA 4IMPA 2I9PA 3WYEA 4UUOA 4ALKA 4GMFA 2P5UA 4J1QA 3AI1A 3GNQA 5HS6A 1JAXA 4UUMA 1GD1O 2Y1DA 1CQJA 4MDHA 4CLOB 1EFKA 1XEAA 4PG4A 2Y99A 2FSVA 2I99A 1X7DA 2HK8A 1ISHA 5F1KA 3S55A 3PPIA 1QYCA 2GRAA 4MVJP 5IDXA 3X2EA 4CUZA 5EN4A 3Q9NA 4J4HA 4AFNA 3RUFA 4DIBA 4U7WA 4RDIA 1E6WA 3HUDA 4BGVA 2NVUA 3GQVA 3VKUA 2D59A 4CM5A 2YV2A 4RLHA 1PL6A 1DPGA 2G0TA 4CMCA 4AJNA 1KVQA 1Q2XA 1WPQA 3EUWA 2EW8A 1E3EA 3EGOA 4GLLA 1XA0A 4GPD1 4P22A 4RVHA 1NVMB 4I9NA 4WCFA 3TPCA 1ISFA 1G1AA 1Z7EA 3Q9UA 5B37A 3WMWA 1YO6A 1EQ2A 3C7CB 2QYSA 3WS7A 3JD1A 5I7SA 5TX7A 3I9NA 5T57A 1XLTA 4QQRA 3ZWWA 1F8FA 2C82A 2CF6A 1HE4A 3RJ5A 2NTVA 1YDWA 3OJEA 2J3HA 1BGVA 4NIMA 4OXNA 3OIDA 2OXIA 2HMWA 4H7PA 3FBTA 4CM8B 1ONOA 4I1IA 4PLGA 4F3YA 4IDGA 1MC4A 1O0SA 3GUCA 4MINA 1QKIA 1GQYA 1E3SA 2AQIA 4R9RA 4RVGA 1FDWA 3V2UA 3ZNOA 4NHEA 4QEDA 3R6DA 4BO1A 1LXCA 4M86A 5KJFA 4R1UA 1E3IA 1WLYA 3E9NA 2WMDA 2B37A 1H2BA 3JV7A 4J0FA 4FD3A 3GY0A 3PJDA 4CMEA 1HETA 1ENZA 3AOGA 3OHSX 3OMLA 1UZMA 4IZHA 1MV8A 1I2BA 2X1HA 2OGUA 3BMOB 5JO9A 3WTBA 1UP7A 1ZJYA 3RROA 5TC4A 4BNZA 1PL7A 2JL1A 5GY7A 5CDSA 4CL3A 3JQ7B 1I3KA 3Q1LA 3ZU4A 1MP0A 3WICA 2C59A 4ITUA 4XCVA 4FS3A 1DHRA 1MX3A 1ADCA 2H9IA 2PWZA 3PIDA 2QG4A 1IHXA 2DFDA 4RPJA 3PQEA 1SZJG 2O48X 1GV1A 3NYWA 4R51A 3GFGA 1H94A 4G65A 5L3ZA 3D0OA 3VDQA 1ZEJA 3TL2A 1QR6A 4IXWA 2YV3A 1ZIDA 1Z6ZA 1KIFA 3K96A 4UUPA 2BFMA 2JJYA 2RHCA 1BTOA 2AG5A 2Y68A 5T6BA 2X6TA 3BXXA 5ITWA 4YJHB 2EIHA 3E9MA 3FR8A 3ETGA 5JFOA 3H65A 4IDEA 3AOEC 3ZNNA 2QIOA 3BTUA 3I5MA 5G4KB 4Y6PA 2VRCD 1E92A 3BMCB 2VZ8A 4EJMA 4Q3EA 1ISGA 5LCXA 5TJ9A 4D41A 5AXCA 3VPFA 4Q3NA 3B1JA 1IL0A 4IQ0A 3PFWO 3F1LA 2NTJA 1DXYA 4KOAA 1GCUA 2X0IA 2YHUA 3H9EO 3KEOA 1L7DA 3JD4A 3CTMA 4IJVA 3HWRA 2VRBA 4R41A 5F1OA 1OI7A 2EERA 1W73A 4A03A 1O89A 3IS3A 4PZEA 3ZU3A 4BB5A 4IBOA 3TRIA 4BNGA 1DFGA 2GLXA 3WDSA 8ADHA 1T2DA 5AOVA 2HRZA 2EP5A 3JQBC 1RJWA 3SVTA 2E48A 3PP8A 2ZTUA 1LEHA 3BYZA 2NVBA 4DA9A 4J4TA 2OUIA 2A94A 3V1UA 3B20A 5IZ4A 4OYRA 4P4NA 2GD1O 2Q1TA 2ZJ0A 4LSWA 1YXMA 2PGJA 1W6UA 4BQRA 1Y9AA 3LT0A 3ITDA 2Z95A 1U5AA 3PI7A 4DYVA 3DHNA 4F45A 3E5RA 3TN7A 4TVBA 1DC5A 3QWHA 4Y6SA 1PS0A 3WXBA 3ZW8A 3M2TA 5L51A 3ZV3A 2WJPA 4BKUA 1Q7GA 2Q1SA 1VSVA 3VH1A 4D3DA 2TMDA 2Q2QA 4D7AA 4ZGWA 4QX6A 1N7GA 1B2LA 3ICPA 4WLOA 4BO3A 3TDKA 1MB4A 5CP8A 1CQIA 2ZTMA 5ADHA 1U3UA 4RPHA 3CIFA 3IJRA 1KY5A 3WG9A 3RC7A 3JD2A 2Z1MA 1DEHA 3LF2A 4R9SA 5A5FA 5HS4A 4CR6A 1B3RA 1NPTO 1R16A 3PFFA 3S8MA 1CRWG 5T8KC 2RIRA 2I6TA 3CZMA 3EHEA 3PJEA 2BHLA 4JN6B 4RVUA 4KZPA 5L95A 1F17A 4U0KA 3OJLA 4IDCA 2WYWA 4YR9A 3ETEA 3ORFA 2YY7A 3PYXA 1U7TA 2OO5A 1DB3A 3M6IA 4Z9YA 4E32A 5I8ZA 4EEXA 1GUFA 4D79A 3FSRA 4WOKA 1UAYA 5TF4A 4B7UA 4NJMB 1BW9B 2X7HA 3RC1A 4CR7A 2JFFA 4J2OA 2I65A 1VL0A 1HDCA 1N1GA 3SLKA 4HWKA 3MOIA 4PG7A 1HDGO 2CD9A 2UUPA 4X54A 4GX5A 3GPDG 3IKVA 3GEDA 4RF3A 5A5EA 1Q0QA 1UP6A 1QXSA 3ZWYA 2VT2A 3GMDA 3ZDFA 4HNGA 3JQBA 3GZ4A 5BNFA 2YDYA 1MG5A 1E7SA 4RF2A 1E7QA 4RGBA 3RUDA 1O95A 3V1TC 4E2YA 1BXKA 1FXSA 3FNEA 5EQDA 1PGQA 5AXAA 3ZHZA 1OBFO 3TOXA 3WJAA 4AJIA 1E3JA 1NNUA 2EGHA 4OH1A 1D7OA 2R00A 2RCYA 1IULA 3QV1A 1RM3A 1R6DA 4Z9XA 1W4ZA 2HLPA 3GMSA 2YV1A 4ND4A 4G2NA 4GH5A 4DIFA 3U09A 5IN4A 4XGIA 2HRBA 5A03A 3BHIA 2VN8A 2NU7A 4JK3A 3RD5A 4YAJA 5ER6A 4BL5A 5FF9A 5EIOA 1H2HA 1CF2O 1E5QA 1TVEA 3UKOA 2EKQA 4HP8A 3PJFA 4OKIA 2VOJA 3ABIA 3BMNB 1JAYA 1M6WA 3GA0A 4FC7A 3LQFA 3LDHA 5JXWA 4FFLA 3RU7A 1PIWA 3ZHXA 3UUWA 4UREA 1GU7A 5KJCA 4ZQHA 1ENPA 4IS3A 1R12A 1DDOA 2VHWA 4NBRA 4UAGA 4RPKA 4L76A 4QFCA 3ROMA 3QA9A 3R1IA 1BXGA 3DBHB 1KOLA 2VCYA 1VM6A 5CDUA 4PLVA 1NWCA 5IN5A 2O4UX 3GLQA 5KVVA 4IIUA 5C5IA 4JJFA 3I6IA 5TSDA 1A7AA 3PJGA 4R16A 4AJPA 2Y0EA 2B5VA 1JLLA 5JAQA 3KYCB 5JCXA 3MOGA 2XXJA 2IXAA 3UCEA 3NT4A 1NXQA 2C2YA 4YCAA 4YJGA 1NAIA 1HDRA 3TZCA 4A73A 1JU9A 3FF4A 1N9GA 4J16A 4RLSA 4WNIA 1PQWA 1TT5A 2Z5LA 4I9HA 5BNIA 1PL8A 2X5OA 2ZYGA 3GNTA 1KS9A 4FBGA 3WGQA 4L74A 5T5QA 3GRKA 3UHAA 3IQDB 4YAGA 3RVDA 2OFPA 3KLPX 4LCEA 4DVJA 2UAGA 3SJ7A 3PXXA 4P38A 1C1XA 4GVLA 4WUVA 1KY4A 3ZWBA 2O3JA 1KVSA 3K8ZA 4RVDA 2BF7A 2DBVO 4AG3A 5DNAA 4FJ2A 1H6CA 2VYNA 2Y0CA 3VZPA 1XQ1A 1MXFA 4JGBA 4D45A 1ZMOA 4MO2A 4DMMA 1NTOA 1ZFNA 3V8BA 3TNLA 2BMAA 4CM9A 5JDIA 3Q2KA 2EKPA 1X7GA 2NWQA 4Q3DA 3A4VA 4DQXA 4UULA 3QP9A 3FNHA 3NT2A 1ZUD1 3ADOA 4HADA 1EMDA 3SC6A 3OECA 3FHLA 2BKAA 1SC6A 3E8XA 3OF2A 4XR9A 3KRTA 1Q1NA 4L9RA 1U9JA 4FW8A 4EUHA 1MUUA 1QORA 1U5CA 4UVEA 3S2EA 1CYDA 1DC3A 4NU6A 3KO8A 2D1YA 5K6AA 1AGNA 4ZQEA 2WYUA 3A14A 5BNTA 1E6UA 2B69A 1GZ3A 2PD4A 1WW8A 4L0QA 2O3TA 4UEJA 3ST7A 1XU9A 3C8MA 4ALMA 4B8ZA 4RCVA 3FBGA 1LDBA 3ANMA 4IINA 4DGSA 1DSSG 4DPLA 3JTMA 1E3WB 4BNKA 4IGFA 3CKYA 1PZHA 1R0LA 2I3GA 4O1MA 5DBFA 2VWQA 5GZ6A 2IZZA 1O8CA 1IYZA 4CMBA 3TF5A 4B4WA 4RQTA 4OXYA 4M55A 1LLQA 4IQ8A 2IYOA 4PLCA 1B8UA 3RUCA 1HL3A 1YS4A 2Y1CA 3IDSA 1WZIA 1PWXA 2TMGA 1N1EA 4I8XA 3U4IA 3RKUA 3EVTA 3HG7A 4M89A 2GN8A 5F21A 5IJZA 1R4NB 4XWYA 4HX5A 1E6EA 5THKA 1GTMA 1AHHA 3ASVA 1FMCA 3MJEA 3D3WA 5L4LA 2VYND 4TKMA 1VC2A 1M66A 1R37A 4WCFC 4U5QA 1OMOA 2XOXA 4EUEA 4GBJA 1T25A 2GN6A 4NU5A 1ONNA 2ZYAA 4B4OA 2R00C 3KXDA 5L45A 1I36A 3HNPA 1YB5A 4E3ZA 3BHMA 3WFIA 3INRA 4HFNA 2ZQYA 3A06A 3LLSA 2A92A 2BRUA 4LN1A 1ISMA 1J6UA 1JA9A 2W2LA 1A4IA 3EDMA 3K6JA 4MIOA 1PGJA 4N54A 3LSYA 1A4UA 1IPFA 5L4NA 1V6AA 2B4TO 2XAAA 1YDEA 3EC7A 4J4BA 3IKTA 2QRKA 3HN2A 5DCUA 1XR3A 4U6SA 1NVGA 2O3SA 2YHIA 5IFLA 1T2EA 1E3WA 2VT3A 5A3JA 3C1AA 1ZKMA 4KTVE 1LSJA 1HYGA 4MPDA 2DVMA 3O38A 3QWBA 4OOFA 1ISJA 4XQCA 3GT0A 4LISA 4Q3AA 1DIBA 2V7PA 4HFRA 3DDNA 4TZKA 1FJHA 1KVTA 4WLFA 1NHGA 1XWFA 1UDAA 2YQ5A 1W8DA 2QHXA 3GZNB 1PR9A 4N18A 4DWVA 3DTYA 4EEZA 4YXFA 4ZICA 1EBUA 3CPSA 3GVHA 1RYDA 1HRDA 2WWRA 3OBBA 1C1DB 4XGKA 4B7XA 2UVDA 4TSKA 1FDSA 2CZCA 3ZV4A 1F0YA 1PJ3A 3AY3A 5KIAA 1YOVB 2O7SA 3WGTA 5DP1A 4TROA 3GK3A 4DC1A 2A35A 2IE0A 1H6AA 3ADPA 1QMGA 2BFAA 1T1RA 3D3WB 3H7AA 4BNJA 2DFVA 1HXHA 4IDDA 5JSFA 3AI2A 1Y5MA 5CPBA 3VH2A 3GOHA 3ZI0A 4B7CA 4IDBA 4CM7A 4IJUA 1WDMA 4A7PA 1KETA 4ZHSA 1NPDA 1DO8A 3PHJA 4DRYA 4BGEA 3D5QA 2PZKA 4DLAA 4R68A 5F5NA 3TJRA 3F6YA 3UAGA 3PQDA 1A9YA 4TMFA 4Z6KA 5ITVA 3STHA 4WEQA 2J3IA 3UICA 1TT7A 4XRGA 4ALIA 3K9QO 3RBVA 5JLAA 4XYMA 5CDTA 2X8LA 5A9TA 1IOLA 1AUPA 2PKRA 2EV9A 1DAOA 2PH5A 3CMMA 2HDHA 2WM3A 2AEMA 4XX0A 5KKCA 5L7WA 3UOGA 4GQAA 1UR5A 2DU8A 1IZ0A 5I7EA 2X0RA 5A05A 1P1IA 4CMGA 2I67A 4PLZA 4ZQGA 4J91A 1VPDA 1UZLA 1U28A 2OZPA 1ZMTA 2E4AA 1Q7CA 3D4PA 3PHGA 1Z75A 4E2WA 1ZSVA 5I7FA 3PQFA 5JCJA 4AVYA 3CZRA 1DJNA 5BSHA 1BW9A 3QVTA 4TWRA 4G81A 4LW8A 3U0BA 1V3UA 5DZSA 5KJ6A 1LRLA 1H5QA 1JN0A 3ZN2A 1VKOA 2HK7A 3COSA 5IDYA 4BMVA 4BV9A 4BO8A 5GZ1A 1CWUA 2HU2A 1LA2A 3Q6IA 3WTCA 4BNFA 1PJCA 3FR7A 4HFJA 2YFHA 4M87A 4IMRA 1HE2A 1JWAB 2Q46A 3NKLA 3VDRA 4YT4A 1HEUA 2Y05A 3MWEB 2JAHA 4E6PA 4GI2A 5A3VA 3GG9A 2AW5A 1NFFA 4IUYA 3CMCO 2YDXA 4CUJA 1XSEA 3GUYA 3I23A 3W4IA 1LDNA 1M2WA 2NM0A 2VHZA 3AUAA 3IC5A 4K6CA 3OJFA 3IL2A 3MJSA 1TI7A 3EMKA 4CR8A 3O26A 1GEEA 1E1MA 4PCVA 4QUKA 3LC1O 3VPSA 1SPXA 3WB9A 3G0OA 3BTSA 1U3TA 3EW7A 2XPCA 3RUAA 1UXGA 4EUFA 2WEKA 4UUNA 2Y0DA 1WP4A 4F6CA 5TGDA 4ONEA 2NLOA 2VUTA 3E6AA 1G0OA 2CVQA 3JQ8A 3TQHA 3PLRA 3DMTA 1T2CA 2D2IA 4WOJA 3DBRB 1GPJA 2VWPA 5A1TA 4W7HA 1K5HA 3K2EA 3ANLA 3TL3A 4Z0HO 2HUNA 1J49A 2J3JA 2C07A 2VWGA 3AU9A 4XGNA 3V2GA 4JNKA 2ILTA 4AICA 5K9ZA 2ZTVA 3AM3A 3O8QB 1YONA 2CDCA 4F46A 4EBFA 4E30A 4CLHA 1D3AA 3X2FA 5A9SB 1DOHA 3TSCA 3L6DA 1I5RA 2PA3A 4INAA 4OGWA 1XKQA 5JCJD 1GUYA 3NT5A 4BO5A 1PJTA 2Q2WA 4TRJA 5HWSA 3R3SA 4ZRNA 4KQXA 3ASUA 3WOHA 3GDFA 3L9XA 1V9LA 4NI5A 3L9WA 2JCVA 5TNXA 4GWKA 5EJ2A 2GYYA 2QRJA 2EGGA 2NU8A 1TT5B 3ZH2A 2ZK7A 2EJVA 1W0CA 3D64A 2HMVA 1EEHA 3DO5A 1B3BA 1TEHA 4YB8A 4FCCA 3H9GA 3MJVA 3H8VA 1WDKA 3I83A 3WLFA 1ADGA 4EW6A 1EVIA 2QZ9A 2DPGA 4LSMA 1A7KA 1P1RA 3H4VA 4QXMA 2V6BA 1WAMA 4MVJM 1SB9A 2DLDA 1HE5A 1QRRA 3VZSA 3F4LA 4NBWA 3PDJA 1SO8A 2FZWA 3DBLB 2PGLA 4K6FA 2WD8A 4AJJA 4EYEA 2BD0A 1EBFA 2AQHA 5JDCC 4DYDA 3FTNA 2GF2A 3RCBA 3HDJA 4DTIA 3QLJA 3OA0A 2F1KA 2UUOA 4UVHA 2JD2A 5H82A 4CV2A 3QSGA 1LDYA 2GCGA 1SNYA 2G76A 2P4QA 1Y81A 2A4KA 3DR3A 4OAQA 3ZWMA 2J5KA 2FR0A 3W8EA 2PZJA 1J5PA 3VOSA 1X1TA 3WSVA 1GFSA 1E1KA 1K6JA 1YWGO 2WD7B 4CV3A 3RASA 4OMUA 1EVZA 4FDAA 3ETDA 1GQ2A 4ZVVA 3F47A 1GDHA 4YJHA 1Z73A 4W9NA 2OP1A 2OMEA 5B4TA 4PLFA 2FRDA 1LSOA 1X0VA 3JQ9C 2JFHA 2X9GA 4A0SA 3T4XA 4PVDA 1NX6A 3VVBA 1DHTA 4BNHA 1IZ9A 4YVFA 3DFZA 2JCYA 4R1TA 1M6HA 1K6XA 3RJ9A 4QECA 5CEJA 3UFXA 1ZSNA 4IDFA 2IODA 3DZHA 3JQDA 2VUSA 4EJ0A 2FR1A 2GERA 4YTEA 2GPTA 1ORRA 3ZNPA
chains in the Genus database with same CATH superfamily
4WJKB 1LU9A 1Y1RA 4Y1RA 1UZNA 3FJOA 3A4IA 3WK8A 4PBSA 1DLIA 2AXEA 5JU6A 4ZOLA 3OPMA 1Y8RA 4IIEA 3WDKA 4NXNB 4NZMA 1VKNA 4AUEA 2QN3A 2OXTA 2X86A 2AX4A 5C80A 1MNAA 1A69A 2E4YA 1UK7A 1GPKA 1JDBB 1VJTA 4BS9A 4H9GA 3STTA 5KTOA 3NC1C 3G2HA 5JSZB 3C3XA 1BNCA 2FFQA 2QW8A 3ZWOA 5HF6A 3C85A 1XMOB 3SX2A 1OFTA 3P20A 1QU2A 2I8AA 4US2R 2RC5A 1T15A 1AXGA 1JE1A 3RC2A 1Y5RA 2O7RA 4YROA 2ODEA 2Q1UA 2Q6KA 2G40A 3H2KA 1KEEA 2WWXA 3RFFA 3COJA 4D1YA 3A1DA 1ZI6A 4JP3A 1H2AS 2RHLA 1BU5A 1FYWA 1ZPDA 3KSZO 3C8ZA 2YXEA 3PDUA 5ESWA 3TW4A 5AKGA 3T9DA 1GG9A 1KQ3A 1EFAA 3QIVA 5FXMA 4EG8A 4P3XA 3DONA 4AJ4A 2ZZKA 4WPGA 5CVEA 3M83A 4OHUA 1F3OA 1ODLA 1OREA 4Y98A 2JGNA 1XQVA 5AP9A 3RUPA 4DCOA 4ARBA 5HFNA 4J1TC 4NAUA 2X1LA 2VBIA 3O4HA 1CQIB 2H85A 2YN2A 3N2EA 3OZXA 4FEGA 4WXHA 2BSQA 5TXGA 5KHOC 3ESBA 1G2OA 2WE8A 3FB4A 3SYRA 1FMLA 2IYPA 2RGEA 1ACJA 2AN3A 1FQOA 3TRIA 1U3VA 2C2WA 3VAZA 4HGYA 4RK5A 1J07A 5FBVB 4EJSB 2D5CA 1T5TA 2O59A 4DCMA 3DFMA 3AESA 1O9BA 3VPCA 4QLBA 3MT0A 1SVMA 3X1DA 2RBKA 2ANBA 4DDUA 5I45A 5IJ0A 2H7XA 1L4YA 1PE0A 5H4GA 2XZOA 4AZVA 4JOCA 4TV8F 1TQHA 2D5AA 3B9BA 5SY4A 3OHSX 4LZOA 2JK1A 4JJ7A 4UZFA 3TLMA 3HH8A 2W6ID 2VQ3A 5HQ3A 1JEQB 1I14A 3M8KA 2ZI6A 5IH7A 3A1EA 4NJEA 2QX6A 4L3WA 4P35A 5KYKA 1KRXA 5H3LA 1YC5A 2D3WA 2HEIA 2C42A 4NBVA 4ND3A 4NOMA 1IRXA 3A0RB 1UEJA 3BKWA 1ZK3A 3BEOA 3HB5X 5EZ6B 5BO5A 1TPZA 4W1SA 3M5WA 4GE3A 4OX9B 1C7ZA 3H3FA 3D02A 3SE0A 2FDXA 1CRLA 1KKMA 2KX7A 3IEIA 5IT5A 4GEGA 2QVBA 4YA6A 1V8ZA 1ZD3A 3AM5A 1MR3F 5DOVA 3V48A 4DCJA 4I5GA 1ULTA 2YYZA 1SVNA 2X0KA 4YV1A 3I53A 2OBMA 3FMVA 5JXHA 4Z7OB 2GXAA 1JXQA 3WKEA 1TB4A 3HI4A 3CLTC 4KK3A 4MV4A 3K6KA 3T5PA 1E0AA 4J3FA 3ZQ4A 4DFDA 2DC1A 2R68A 4MGKR 1IJBA 5BUSA 5MDHA 5BWCA 5C51B 4O4JA 4XTCS 3UO8B 4FOSA 5EHIA 2VH1A 2NO4A 1EDZA 5I7OA 1J2JA 3TVYA 1BWPA 4D0SA 1XLVA 3M4JA 4X1OA 1PWEA 4P92A 5I4IA 2AYYA 2HY7A 4KCGA 1RWBA 2DX7A 3NTOA 2OC4A 1LPPA 3D4OA 3DCJA 4BX0A 10MHA 3J80A 2GAIA 1VLHA 3WMGA 4GMKA 1Z06A 5BUZA 4JT4A 3ZHUA 1KO5A 4OIMA 3A4YA 2O8DB 2ZUUA 1X74A 3I9OA 4Q9LA 4BNDB 4MLDA 4TKLA 2G82A 4MLPA 4Q3BA 4B4DA 2OHHA 5JNTA 5JYDA 2IU4A 5GV7A 3P4YA 2JLXA 2VHQA 3DKKA 2OSVA 4ZI3A 4X97A 2QLBA 4FT2A 4YHBA 1F1JA 2KMLA 1MHPA 1P9WA 4XIGS 5F78A 2XSZA 3QNWA 5DO9A 4GPZA 2DAPA 5P21A 3KTAB 3CH4B 2XIJA 3VNAA 3DWEX 1IN8A 4OHFA 1R15A 4NK5A 4JI7B 5JSYA 1B6SA 1GAEO 3E3MA 4EECA 2JH8A 4I4TA 2AE1A 2FB9A 3R0ZA 4Z0TA 4F8EA 1BJKA 4C0AC 1CJTC 2DEUA 4ZEVA 1NMQA 1NI5A 4M0PA 4IWXA 1VMAA 2F9FA 3NG1A 1ISPA 1KNXA 1BQ4A 2HSWA 2X9VA 1Z82A 3TIFA 1RJFA 1OFGA 3SP1A 3L4BC 4MKFA 3ZHRA 3VVMA 5G0TA 1VIDA 3SAJA 4XAQA 5BXYA 5DXFA 4Q12A 1SULA 1K5PA 4QBHA 3WLTA 1KYTA 4V1CB 5CXSA 1UBCA 2W11A 1JHZA 4GSKA 5LZ8A 1DTEA 2FJ0A 4EFDA 4KHZA 1M7BA 3JD3A 4TYQA 2ON6A 3LHKA 2OCBA 3RTAA 1DBVO 4TSFA 1Q0TA 3OMXA 1OCEA 4LVCA 2HRDA 3CLUD 4MVJI 1QOZA 4WZBE 3PXAA 3SZ3A 2Y8EA 4E5DA 2C7RA 3L7OA 3REGA 1XXHE 3LDGA 5KSYA 1U8AA 2EEZA 1XNJA 5AM5A 1VL6A 5B4VA 2XNJA 5EVCA 2QRMA 2WKQA 1T9BA 1LNQA 1BOOA 2C7VA 1W94A 2R6AA 2V7UA 3W4JA 4M3NA 3BTVA 3DMYA 4K9QA 1ATZA 5SV2A 3QUAA 1XMQB 4JNCA 1YKSA 3DWFA 2OGZA 2KQUA 2QQGA 5B1YA 1SOVA 2BGJA 1NN3A 5DTQA 1GG2A 1HA3A 1NBMD 2PMDA 5FBHA 1WIWA 1VLZA 2Z0MA 3E1SA 4MSUA 4ANFA 4C7XA 1J9GA 3CPJB 5E95A 2WUDA 4P53A 1P2SA 4XARA 3WLMA 3PGXA 3AKCA 5DULA 2UXBB 1A77A 1SKYE 3D6MA 2PBRA 1MEOA 2BKUA 1M2KA 5HBRA 6NULA 4CKBB 5IPFA 3DTTA 4LYFA 4PG6A 2DULA 4MWOA 3RKRA 3SCZA 3WHLA 5EHXA 4ENUA 3LNCA 3T38A 3WXMA 3P9XA 4B3IA 4CLXA 5ARBA 4NCBA 2FAXA 3Q0EA 1Z25A 1CT9A 1KBZA 1T9DA 3D6UA 2CVHA 3BXHA 1G8SA 1E9CA 1ZOLA 4TMXA 2P90A 2W2QA 2NV6A 3HJTA 3AF4A 1F8GA 2ROQA 4JYMA 3I58A 2CCJA 3FZNA 4LZLA 2IOYA 4L15A 4TKVB 4WZBB 1L7QA 5KBYA 3D4BA 3U61B 3AUUA 4BLPA 1C1XB 1G17A 3GMTA 5ALEA 4II2A 4KOEC 1XX6A 3PEFA 1P7VA 3BCRA 1DQSA 3CLVA 4FOTA 4HAYA 1WD5A 1FYFA 5ALMA 1D5WA 3SSOA 4EHIA 1NV9A 3ICQB 1G2QA 4J6FA 2ZE6A 4DRZA 1U8FO 4G9EA 4HFMA 4ZHQB 4S12A 2HQBA 4G5GA 2Y1KA 2YH2A 1I2MA 3VC2A 4HGOA 3H2SA 4W82A 5IXSA 1KMNA 1QO0D 4ZMBA 3RNLA 2TMYA 4H3VA 1UPCA 1E63A 1KPIA 2HA6A 5TS2A 2PTGA 4NS4A 3BILA 5IJAA 1G4AE 1U0HC 1RYNA 1Y4DE 2OOSA 3NS7A 5SYNA 1ZHOA 3EXEA 1TF7A 4B6RA 2BDTA 1OZFA 3M1YA 5K0BA 1PG5A 1MBZA 3D8HA 1OH6A 5K8CA 4YWHA 2GKGA 3NVDA 1OILA 4IDPA 5CH8A 2FVYA 4EPWA 4FDVA 4KQWA 3U5TA 5IVHA 4DUYB 5IHPA 1G4HA 1QDLB 2I7CA 1FYXA 1ADBA 1RRGA 4YDRA 2PQ6A 1RU3A 1ZINA 4EF4A 1VGRA 4PCLA 3ONWA 1MIHA 1JL3A 3K4HA 4LCJA 4MV7A 4PSVA 3I09A 4DUPA 4BTEA 1L5RA 4V1CI 2XVMA 2OHOA 3L7AA 1PF7E 4YJ3A 2ZDHA 4EUKA 1K2WA 4GKVA 1I1NA 2J9RA 2NACA 3QKIA 1EYZA 2FZLA 2RGWA 4ZMSA 3V1LA 1IM5A 3EQZA 3FYCA 4LOAA 4B6GA 3UBMA 4LHWA 5LD2B 4JD5A 2RHMA 2BLLA 3Q8XB 4CMAA 1G3MA 2R7MA 3SM9A 1NBIA 3W90A 2RHHA 2F9MA 5BWOA 1DBIA 2H31A 3IT3A 1OT3A 3PVZA 1KI7A 1X7HA 4NTZA 4DYHA 5HQTA 1JRLA 4IJWA 1IOZA 4MNTA 4KQEA 4LBYA 1X13A 5LA6A 3HYNA 3ZWPA 1K7YA 4D46A 1KK3A 5SZJA 5BW8A 2Y1LA 4Y9DA 3A6DA 1JPNA 2NN3C 3FFAA 3UJ3X 1U2TA 1J0AA 3ZXYA 1HL7A 1VBMA 5JIBA 4HS4A 2QYTA 1E2QA 5IEJA 3PKIA 1O94C 3S27A 4JP5A 5KKAA 3FCUB 2RK6A 2RKOA 4G5SA 2C58A 1GRRA 3D5TA 3ZDYB 1I10A 1OX4A 1M5TA 3NDPA 3KV3O 2QY9A 1ZH4A 2PCLA 2VUUA 3DZKA 4QUAA 3SXPA 5JECA 1EGMB 4FMPA 3CVWA 2WD7A 4REOA 1P74A 2FX3A 3EBPA 2YUTA 4DT1B 2QG9A 4HZGA 4QUGA 3C3DA 3N7AA 1JDNA 5CDYA 2NO0A 2XF2A 2YJZA 2JFOA 3AR9A 1E1DA 1XZMA 2ZULA 5JE8A 3T1VA 4JP8A 3OURA 1NKVA 4O4LF 3FPSA 3PUVA 2A0UA 3D5EA 4PZAA 3ZU2A 2O52A 3R7BA 4V0RA 6REQA 4P9NA 2ISCA 3H2GA 4HMPA 5C7LO 5K2MA 5A5GA 3K31A 3KHUA 2VPWA 5CHYA 2ZS9A 2H8KA 5AVRA 2PD3A 1A5SB 3JQQA 1JB9A 1TQ4A 1GUDA 2GLTA 2VEOA 4NBTA 4ECAA 1QFJA 4U2FA 3IKLA 2LTAA 4OAPA 2I2WA 1HNWB 1JHMA 2GSWA 3QJ5A 3WLIA 1MC5A 3MCAA 4L7VA 5FD8A 1IWPB 2QTVB 3B1FA 3TD2A 4CKCA 5I01A 3OX4A 2PE5A 3R7DA 3ZUGA 3QYJA 4A0GA 2FP4A 4DE5A 3B48A 1N57A 1GNLA 5L4SA 1Z74A 3T41A 5EJ9A 4BE4A 1NHWA 1HEIA 3DCYA 1T6ZA 4U8GA 1CEXA 3SQXA 1B8PA 1C3VA 4XJTA 4YRTA 4MQUA 2LCIA 3FUTA 5FLEX 2X40A 1P45A 4OPMA 5E4YA 1KVUA 1ZISA 3BX1A 4UDOA 4J7XA 5DNEA 1E1QA 2JLYA 4JKYA 1ISSA 3BFXA 2QXTA 1WMFA 1QK5A 2B61A 1UKZA 2GGSA 1GGMA 3G7NA 4MWCA 3PQ3A 2XSZD 5TGZA 2XVYA 1T5BA 2W6PA 1YASA 5AVYA 3JYOA 1ZR4A 5C4GB 4GI7A 2V7TA 3W7AA 4OX9Y 1CETA 1RKXA 2C54A 1TKRA 3JQ7A 3EODA 3QTTA 4EY4A 1A8SA 2BDUA 3WLEA 1KK2A 4BBAA 3ZWNA 1BKDR 4C7VA 1JLMA 3OVMA 1QTIA 1MA3A 1TVKB 2XGSA 4X64B 1EDBA 1UT8A 1A9QA 1UC5B 4K9NA 4AZ0A 1OLSB 3QFCA 2AHOA 2YXLA 1RXSA 2J87A 4EF6A 3ABSB 1FSSA 1EAMA 1R8XA 2AN9A 2C4UA 1E18A 1M2VA 2V9CA 3JYLA 3I01A 4GPEA 3UC9A 3W2GA 4R8RA 4R0MA 5KYWA 4L5CA 2UZ1A 4GHWA 4E5UA 2D0IA 2PVSA 3DO6A 2BWJA 3CQ9A 2B1IA 2WU4A 4MQFB 3H2BA 1NM5C 2FV8A 4G0PA 5ALHA 3HB0A 1SVKA 3N28A 2HRQA 1KYIA 4CIDA 4QG3A 5C53B 3KQOA 1SCQA 1OU0A 3KR1A 2PT5A 5BSGA 2VRCA 1GG5A 4QOIA 5IAEA 4B0PA 4IGAA 1S2GA 4N0EA 4AYWA 1T1SA 4OXIA 4S3MA 4H7IA 3IBTA 5KWVA 5ALKA 3E7PA 4WY2A 5CK5A 1NVFA 2C5SA 2NU6A 4YLGA 3DQPA 5CM9C 1ND6A 4YRLA 1HLFA 2YJGA 4MCHA 4RU1A 5KC8A 4CT0A 2EX0A 2QR2A 5EMMA 1SA0B 3PUWA 1P60A 2PNJA 2RI1A 4UHHA 2W4IA 3DW1X 1ADFA 2C00A 2REXB 1FX0B 1A8HA 3X0DA 3V5NA 1DTWB 2D54A 1I7SB 1BDMA 3SJZA 3W05A 1Y3BE 5AUNB 5KS2A 2CEKA 1GYRA 4HGZA 3UTCA 3TFWA 4RL6A 3V4LA 4WKNA 4FB5A 3JVEA 2VTEA 1ZD4A 1UBGA 1I1QB 1BMFA 4Y2YA 5KCZA 1THTA 2AG6A 3RHFA 2RK4A 3TXAA 4HOYA 1OI3A 1Z34A 2NT3A 3P97A 3GLHE 5LJIA 1MJGA 1W5SA 1WTCA 3OC0A 2IPAB 1WEKA 5TT1A 4F60A 3ZBUA 3CR8A 3MJ4A 1TXGA 1RR6A 2OCPA 3ZH9B 2B5WA 5CFNA 4YMGA 2DOKA 2LBPA 5HKBA 1KZYC 1VKRA 4DRXA 5EEGA 4GRAA 4BHTA 3E5MA 5JOQA 4HAUA 2JAOA 3F4KA 1Z12A 4G0ZA 4PYOA 4F1WA 3NATA 3NDJA 1P3JA 1P7PA 3SNKA 1G5RA 1VHWA 3D8SA 1UUFA 2G9QA 4Y2HA 1DTSA 2OAQ1 3SC2A 2SCUB 4BIIA 3OX1A 5AHOA 1O54A 4JZKA 2RGUA 2QN1A 3TJZA 5FO1A 3W78A 4NFYA 1GYPA 2BHRA 5SYMA 3FLBA 5JARA 4RJ2A 2DTDA 3L4BA 3QVLA 1NVBA 4NJOA 2AJTA 4YUWA 4JJEA 4NEHB 3E18A 4FP9A 4F1JA 1PJQA 1QHEA 3OOEA 4UVIA 1T5LA 5DHFA 4JVMA 3PFBA 2F8MA 4ZVTA 4F11A 2GRJA 3G2IA 3IESA 1PJ2A 4Y2PA 2X58A 1IBCA 1EFHA 2AEFA 1DINA 1HDIA 1QVRA 3HDHA 3ME5A 1H93A 1Q3KA 3FNGA 4II3A 5LVAA 4OBWA 5ECYA 2VNHA 3JALB 2DUMA 1J56A 2GASA 4AIIA 1RRPA 3VUFA 1F0NA 3DXYA 1XVUA 3KZ1E 4K3UA 3AO0B 1PO7A 1EWQA 3E22A 2Z98A 1NQUA 2OE2A 4CF4A 4XQGA 1S3IA 4TV9F 3IIKA 4W5JA 1M2JA 2QU7A 3LP5A 3V6MA 3N9IA 2ZR9A 3F5MA 1EUCB 5K6AC 2NVUB 1U7DA 3A28A 1QP8A 3RC3A 3A1FA 2PLAA 1YRWA 2H16A 4G89A 3KUXA 1YJXA 5AKIA 3AKYA 3VZRA 4P86A 4XEHA 3DV0B 2EYQA 1GN8A 1U9YA 2PSFA 4XQ0A 1SCDA 2VJMB 3X1ZA 4BKMA 3GAFA 2MJLA 4WN9A 3WLOA 3W5AA 3WGNA 2PNFA 2WP0A 4C3OB 2PGIA 3TKLA 1FY2A 4Y6RA 3U4CA 2N1BA 1BHQ1 2X0JA 4GBMA 4IPTA 1X3SA 3G2KA 3BULA 1PG0A 4HVTA 4NG4A 5DI3B 5IDVA 1ZCJA 2FW8A 1JEJA 1RWPA 2D0PB 4NULA 4RFLA 1MW9X 3UHJA 5MGBA 1AQUA 4JEIA 3QVKA 1PZXA 5G2OA 3HYCA 5CURA 2X9QA 2OD2A 5K51A 1JTEA 4H6PA 4HJRA 2XA9A 3U7EB 3B2NA 1A5ZA 1XJQA 1S3GA 2R47A 4CV1A 4UOEA 4L4ZA 1W87A 1RJ9A 4K81B 2VDWB 4MIYA 4EGCB 2AIRA 2CNLA 3B5EA 3EFBA 2GR9A 3Q15C 4RSHA 4BDTA 2V1UA 2E4VA 1ISIA 3KSDO 4FPXA 4MTCA 3Q4GA 4A8TA 2WZQA 1NF8A 3I05A 4ZCQA 4YEDA 3I39X 2EZ4A 4HB4A 2GS9A 1W30A 3L6BA 1DBWA 5JD3A 4CNBA 5HW0A 2I33A 3U4AA 2PUJA 1U2SA 4PG5A 3C6YA 1CUUA 4UBOA 1UK6A 2CNBA 1N3YA 4XI9A 1O5TA 4J0HA 2OCGA 2HD4A 3E8SA 2FPIA 2XQIA 4AX4A 3WWZA 5H16A 1V26A 2EHDA 2O2HA 1F5NA 4REMA 1G7CA 4H59A 5EWLA 3F6CA 4MUAA 5FL7D 3RWBA 2YNMA 5DNWA 1UMCB 3RVKA 1UWKA 1KAGA 1OVMA 1XZ8A 2LD4A 2R7AA 2ZJ8A 4LDNA 4DOMA 4YRSA 5DISB 1EXMA 3HSYA 3KU1A 2BSAA 1RLIA 2Z5GA 4MS3A 3M9LA 4UHCA 5B3KA 2Z58A 1W49A 1AVTA 1E7MA 1R50A 1ZK0A 3BGIA 2IEIA 3N0WA 3GNSA 2NPOA 4JROA 4M49A 2II6A 3RK1A 4C4YA 4AK9A 2MR6A 2JEZA 4NENB 5B7GA 3HCDA 3IVAA 3RK4A 4IHJB 4KQMA 1VE9A 1T4BA 1VFNA 1UC4B 3LFTA 5KOIA 3ZWQA 2JVKA 2J45A 2J7KA 1DU4A 4HD8A 3WBJA 1I4TD 1VRCA 4EHBA 3KEQA 2WT8A 3PGJA 1LQUA 5K4HA 2AI2A 3PEEA 3J7TA 4WGFA 4HRYA 4FZ5A 2X8AA 2WYIA 3KJEA 7ABPA 2BM1A 2W71A 3FSGA 1E9BA 3I45A 2GNAA 3DL7A 5TT0A 2HA5A 1K7EB 1KFEB 5IM4A 1BWQA 3LK6A 1W88A 1JQ3A 3GIDA 3OIVA 1G6KA 3GUVA 5FIUA 1UPBA 4OQZA 4CKEB 1OKKD 1YQQA 3BMCA 3T0GA 1COZA 2V6IA 4BP8A 4PX3A 3QPUA 3RVJA 5TMEA 5BNWA 2FWJA 3IGFA 3OSUA 3A2NA 3F5SA 5DW0A 1EM6A 2XJ4A 3T3IA 3W8NA 3I32A 2GUWA 3NHJA 4HSGA 4J0EA 1R3DA 3BWBA 2ZZMA 2JA1A 4OB7A 4YAIA 2HDNB 2DMRA 3DKRA 4YHHB 4FBMA 3PDWA 3QXCA 5IYZF 2CHQA 1LKZA 2XE8A 5JFTA 4PR0A 3OQBA 1V1RA 4HWOA 3P9ZA 4NLLA 5LP6B 3DBVO 5EIHA 5BRNA 5HOEA 2ZUSA 2ZJ3A 1GV0A 2XCIA 4CMHA 1RLOA 3L5KA 4ARZB 4A4DA 2GAOA 3A26A 2O8BA 3QI7A 4XYBA 4ZU6X 4B8YA 5BSRA 4YY3B 2WV9A 2R5WA 1U3WA 2ONCA 3BJEA 1XHLA 3ZGOA 1AD2A 4NMXB 5IUJC 4HZUB 4REQA 4FGJA 4EY6A 1ABFA 2ADFA 3QPBA 3GPLA 3PPYA 4WXPA 5G02A 3DMTC 3JYQA 3K0SA 1GXSB 2ZT6A 3ZVMA 4NBSA 2VTBB 1NLMA 3LY8A 2J5QA 2YINC 4WL0A 5DJ5A 4UZEA 4US0R 3C14C 4XDZA 1R6BX 1Y80A 2EEPA 1A8QA 1R3UA 1YZQA 2IYZA 4MV0A 2G06A 4ZVMA 5KTPA 1EHIA 2ZU0C 3OD5A 3PENA 2ZB8A 3TZQA 5AOAA 4AF6A 2ASVA 1H1TA 1OAKA 1Q3TA 1XTTA 3I0MA 1VYTA 5GPBA 5FEMA 3L1KA 4PXAA 4OXXA 3K1ZA 3PU6A 4E33A 3SFTA 4IKEA 1Y37A 5K3AA 4EW3A 3OCVA 1B14A 4EY7A 4P1ZA 4DWJA 2PUFA 3MSCA 5JY6A 1T9CA 3UA3A 4YCNA 4GL4A 5L9AA 1PQPA 5HDBB 2UDPA 4CTOA 1QKKA 2IVFA 2VJDA 2ZG6A 3OHMA 3H42B 4B45A 2JHPA 2YOGA 3DEYX 4NZYA 2EQ5A 2XDQB 4FJ0A 3T5TA 3SMQA 4J7UA 3WFJA 5ALWA 1XZLA 2ZYUX 4ZVRA 4IHKA 5TMDA 1NP7A 3T9BA 5BR7A 1HKUA 1YD7A 7MHTA 3DJYA 2BFWA 4M36A 4UOQA 3DOCA 4MS4B 3GEBA 4C7MA 1DZ3A 1NXVA 1O94A 2PA0A 2R3SA 3HJAA 1RHRA 3LBAA 4LY9A 4AJKA 1LWNA 4GT1A 3DE3X 2E0IA 4XM2A 2XUFA 2C0CA 3AI3A 2ZCVA 4G3XA 3WYBA 1ZICA 2EKBA 2CLSA 4R5MA 2D7DA 1QYWA 4HB2A 4UDXX 3SIPA 2EL7A 2WJYA 3H9UA 3U81A 3MBKA 3WGJA 1SBYA 5IXJA 3DMRA 1JW9B 4PO1A 3D3EA 4DV2B 2VO1A 4MPPA 5CD1A 1Q6ZA 3TVTA 2FKNA 3DE5X 1SVOA 3PRJA 1WEHA 3N8HA 5HOQA 3KB8A 1CR6A 4COOA 4ZV9A 1JMYA 2W6MA 2WU0A 3UYLA 3AFGA 2IY9A 2N47A 2O23A 4P5EA 2AUNA 4WBSA 1YZKA 1K27A 3R3JA 4MO9A 1ADJA 1VHDA 3G9TA 4DANA 3NMUF 3UMVA 3BGVA 1VECA 4M7OA 4BMOB 3H5OA 1D2GA 2ODBA 3G2NA 4FONA 4MR7B 3VU8A 5A4KA 3ZD6A 2QJWA 1U90A 3A10A 5HF9A 5HIAA 2FZVA 3GCXA 4I1RA 5SZIA 1XVVA 4LVOA 3ZJTA 2CXRA 1G60A 4GC9A 1KYQA 3G6WA 5KQLA 5BN4A 5K5EA 1N1DA 1HZZA 2TS1A 5KOHA 3ZDQA 1VBKA 5ER9A 4NONA 2X8JB 4F2DA 1QS0A 2J4FA 1K1EA 3FWZA 1K6IA 3F6EX 4HN4B 4QXPA 4BQNA 2LE0A 1C8BA 2CLIB 2EBHX 3ZGYA 2LGJA 2AX3A 1C3LA 2IDMA 5LP6C 2XGMA 1IFXA 3GJ0A 2CXXA 3I1FA 4KQKA 2O2IA 3C3AA 3ZDEA 3ZTWA 3DO8A 3FMPB 1KF0A 3X3HA 1G8PA 4JI3B 4ETNA 3MN1A 2VLIA 4RHYA 1J4AA 1UWVA 2HQSA 4M2LA 5LA6F 3S7ZA 1X9GA 1XZDA 1NFQA 4UVDA 1D0IA 1J09A 2GPAA 3JWGA 3MIZA 3X1JA 1C3OB 5IK2A 2OM6A 3M6VA 3P2OA 3VH3A 3VI3B 4EDFA 3D4NA 5IBQA 3WLQA 4EMSA 3D4LA 1SCNE 2JFXA 3ONEA 1RM0A 4RSGA 1K5GA 4C1NA 5I9NA 5KVAA 3DVSX 3RSCA 2FU5C 3NDIA 5TJHA 4BECA 1KYVA 1CEYA 1TZJA 2W58A 3KK0A 3QF4B 2QP4A 2MTBA 4B87A 3RC8A 3OD1A 1O95D 2KJQA 2HKIA 1KK1A 4RHUA 4FYVA 3RUIA 3FKQA 3ENKA 1WMSA 2NZJA 5JADA 5KSZA 3GMIA 4AURA 1E5TA 2PK3A 1XLTC 3HVJA 3D7NA 1HYEA 2VP6A 1OIXA 3CISA 1V8BA 5KI6A 3UXYA 5CEFA 3W77A 2FI1A 1JKMA 4IDHA 3KP1A 4IIJA 4JB2A 3L6OO 1DOAA 4DQUA 2J5BA 4IV8A 3LPNA 4K5QA 4ZI2A 3X43A 1J9EA 3VKGA 1F48A 1A2KC 3D1JA 3OZSA 1P29A 3VI4B 3ZXSA 4IY1A 4TM8A 2I7VA 4TTPA 3ZTTA 2HJHA 1M8PA 1MRZA 2ZR8A 3PUKA 5C31A 3OM1A 3TZBA 1QYVA 4EI9A 3HV0A 4WCFB 5EJIA 2ZKLA 3HSKA 2FWPA 1JHOA 1W47A 2Q5JA 2VDRB 3VPAA 5G1OA 1WOMA 1WBDA 4XGRA 3TLGA 2OYSA 3K09A 5K0ZA 3H9JA 5J63A 3R74A 4H0FA 4WTOA 3V46A 5JZSA 2DFLA 2H5IA 1L7NA 1T5DX 3VR5A 2JI9A 5K4GA 3IQEA 4K6HA 5EWJB 1K3TA 2VNKA 2EWMA 4EQZA 1J25A 1P2FA 3G17A 1IN7A 1ZN7A 4EY3A 3BXOA 2VTKA 3RAFC 4NECA 3R0QA 1ZIPA 4GMGA 4BX8A 1DIHA 3L4SO 2GEKA 2GZ3A 3AUSA 4IJKA 4LJ4A 4AM8A 5I4BA 1AMUA 1QO0A 2JGFA 2HLHA 1GO2A 2IPXA 5G0UA 4LBZA 2ZUTA 1TU3A 2YJ6A 3OE4A 1LK5A 4C07A 5FTLA 3TRFA 4YCJA 3EVEA 2DWUA 7REQA 3HKDA 1NQVA 2QYOA 3WMFA 3OX2A 4W5HA 3FOEC 2OL4A 5EKUA 5EPUA 5LM3A 2Y93A 3OIYA 4Y6GB 2QK4A 2VAVA 4Q4JA 3GELA 2KYRA 4BZZA 4BVKA 3F5QA 2ZJAA 2QTCA 3LM8A 5IT4A 5A0TA 1NRJB 1UK8A 2OHJA 3KELA 2H07A 4RJIA 5U1PA 4ARAA 1O6BA 4PLYA 4U7PB 3ZXXA 4QU9A 1JSXA 3A3OA 3I3OA 3IEKA 5FUVA 3ULKA 5KNBH 3R8FA 1EFPB 3OLQA 1V9SA 3EEFA 3OCCA 3MELA 1TJPB 4E5SA 5DHSA 5M04A 1U7XA 2Q0HA 1SU7A 2C97A 5AI8A 4S2EA 5A7HA 3ZHVA 2Z6UA 3OIFA 4MKXA 2FUG6 1NNSA 3IAXA 5ALUA 1EXNA 2A88A 2QSYA 2ZCUA 2DR0A 3KV1A 1HDOA 4Q4DA 4XW2A 4RZUA 1GY8A 1HSZA 4V03A 3TAXA 1XQXA 2ZI4A 1F12A 1PX2A 2D4AA 3LPCA 1GA4A 5FBRB 5C7IO 5HRUA 2C2GA 4PZDA 3AEQB 2LV8A 3GU3A 5B1HA 1OZAA 4D82A 4I5EA 2QI9F 2QN7A 1D6JA 4DM7A 1ZD2P 2GMWA 1DX9A 3RGGA 3RSZA 3KSBC 4GXQA 2Q4RA 2QUHA 4B33A 4JLJA 3SBOA 4J8PA 5KU1A 3V4RA 4HXGA 2GM4A 1AT1A 1XGKA 3H19A 1B93A 3WWPA 1UBMS 5ES3A 3U44B 4JUAA 2HHLA 3ZNNA 1TK3A 3QXJA 4ZT2A 3NHRA 1B8OA 3AZOA 3QKRA 5J1TB 1OHHD 2PKQP 3K71B 2A9KA 5DHAA 1R4ZA 2W70A 3G8CA 3IIEA 5AK4A 4D3YA 4KWIA 1WKBA 2W8ZA 4IIBA 2AMVA 3FFBA 4KB5A 4INOA 5LYYA 4TPKA 5CIWA 1OFUX 3QE0A 3AB7A 3QA3E 3MWEA 3MS4A 1PUJA 4GYKA 2I1LA 3IO5A 3LNTA 4MUFA 1KEUA 4FUQA 4BATA 3LJKA 3TNFA 2YXBA 4M0LA 3VTFA 1YF3A 1PLJA 1U63A 2BFNA 5T4FA 2WZCA 3UHPA 4FMDB 1YDHA 1H22A 1TQ6A 4PIVA 1OI2A 2C84A 1FU8A 2BGTA 2XR1A 3BZBA 2OAEA 4RIGA 3AHIA 5EERA 3DGEC 3V7FA 4CM6A 1P8JA 3LF1A 2OFWA 2FSVC 3CRW1 1B7GO 3AGQA 3F6BX 3LE8A 1V3QE 2GZ1A 4V38A 4DIDA 4HZIA 4DNQA 3N8IA 4URYR 1JG1A 1HM5A 1Z0SA 2QRQA 3LZ6A 1E3DA 1RHMA 1MAHA 2KM1A 2PZAA 2VJNA 3FOBA 3L6EA 4UEQA 1X8KA 2HQ1A 1O03A 2FOIA 3KTOA 3S8YA 3W3AA 2XUJA 1EIWA 3RW9A 4DV7B 1TCAA 2N46A 2XNKA 5A3QA 2LXNA 1WB5A 1LCIA 4AU1A 1GHTA 2J09A 1JB1A 3CH6A 4CMEC 3OJOA 1TJYA 1P1JA 1M76A 2VDPB 1E32A 4QFBA 1N0HA 1CY1A 3DDCA 1NZFA 2C9OA 4IFTA 3NPAA 4ZWNA 1DRVA 1XNHA 4OJQA 1N75A 3BH6A 5K6TA 3I9KA 1PWHA 2J67A 3MB5A 4FK8A 4HEJA 3ZLAA 4EQ6A 3L8YA 2Q1WA 3O5AA 3OHPA 3QVXA 1U98A 4N6GA 1QAOA 3D59A 4NQRA 3DZBA 3IRVA 2PQ0A 3PNLA 4I50B 4BAUA 3LKBA 5K45A 1WF3A 1TM1E 1IC6A 1OF1A 2V8BA 3HO6A 3Q0IA 5CT8A 5CVVA 1ORWA 2QL9A 4HKTA 2BOVA 4MUKA 1K7SN 1ML3A 2RKWA 3KVNA 4IVQA 3LW7A 3T54A 5ICMA 2ZUBA 2AOXA 3JRXA 4OJMX 3KYDA 1QF7A 2R8XA 4JP1A 3DHYA 1BA3A 3BMQA 4PGGA 4Q7KA 1A72A 4U0JA 2UYGA 3WBBA 4PGMA 5C8DA 5LQDA 4IXTA 2G6TA 3EA0A 1Z6TA 1Q0LA 2HFJA 3DF9A 3I9JA 4UHDA 4ABTA 1AF7A 5E9JA 4B3FX 3H18A 4KFUA 3RU9A 4QPJC 1RCUA 4Z1MD 3FVRA 4EHFA 1EUDB 2YYYA 4YJ3F 2PX6A 4I14A 4DUGA 3QELB 1TK2A 3V7WA 3KVOA 1NAHA 3HBMA 4JSTA 3KOXA 3VHLB 1OC2A 1O4WA 1JG6A 4KMSA 1QRTA 1EK1A 2P2YA 1O8BA 4EM6A 1MMFB 4WH0A 3T7RA 5LWHA 2JI4A 3C5WP 4GSLA 3AETB 1NZJA 3IEUA 4A8PA 1USKA 4INZA 1SOWA 4LYGA 3RHSA 3WGLA 3B78A 1EWKA 1Z62A 2AV6A 2QQ0A 4TQGA 5IYZA 3ADBA 1Z07A 1S0UA 1ZA1A 3VYSB 3DC2A 3IAEA 4P83A 4PQRA 4UNNA 3A6GA 1VKZA 5ECGC 5K0JA 4BOYA 5LZ5A 1WUJS 2PAFA 3H8WA 1ZGJA 5DVZA 4C6TA 3G5TA 5D51S 5ED4A 1MO2A 3I6MA 1I13A 3ZU5A 1JPJA 2HPHA 4AG6A 5LMCA 1GNVA 1W1UA 3F74A 1XL1A 5KSOA 2QG6A 2YQ4A 5DNYB 1B00A 3NALA 2OWDA 4IDNA 1VE5A 2W0SA 2ZYRA 5J4VA 2E6UX 1NT2A 2P2DA 1YE3A 2G9UA 2PT6A 4G37A 2UYYA 3FUCA 4JAVC 4HEHA 5JNSA 5EUQB 5IDWA 5D5PA 3RTDA 3II6X 3HNOA 4OQQA 4XYEA 3DAYA 1DFHA 4EX7A 4PYJA 5CDGA 2OESA 1SU6A 4RD6A 3WKBA 1NVAA 2JK0A 2PT7A 1NI4B 4LKOA 4D3SA 1V11A 3GWZA 1OXSC 1PRYA 3GFBA 5D1NA 1F2UA 3VH4A 4CEHB 4I8IA 3RSLA 1LDEA 1WXQA 3GXOA 3LSTA 2JCGA 3JAWB 4XIIA 4YFYA 1LGYA 1N2HA 3OTQA 2FDRA 3W9SA 3L06A 4B81A 5GIPE 1HQCA 3E4CA 1CSEE 1NP3A 1I33A 3LCJA 3JQ9A 1I8TA 3FYTA 1DG1G 5FR2A 4BLVA 1YQXA 4AZ3A 1YNOA 2IL1A 2Z5FA 1AKRA 2WLTA 1IJKA 1CUGA 2Z4RA 1PWZA 5BP7A 4UTXA 5AJTA 5D3MA 1T5OA 4KNWA 1QIKA 1T1IA 4GVPA 1SIWA 2XUZA 2WAYA 2IWHA 1Q0HA 4LRYA 3CB4A 3LQYA 4QZVA 1YQGA 3KR2A 3UATA 1IUKA 2W2NA 1FFSA 4RZHA 1U2PA 1CP2A 3A9UA 3N53A 2NXWA 2YWXA 3DTVB 4QREA 5KCMA 4DM3A 4FOOA 3L0PA 4B73A 1QE0A 3WWDA 3U9LA 4RH3A 5LQKA 2CK3D 1VL1A 3EISA 1DC8A 1MX5A 3NBKA 2TECE 2XE4A 3QMPA 4PNZA 1L8AA 4BLQA 1FDIA 3CS3A 2DR2A 3W1WA 3DM9B 2P67A 3F9IA 2BH2A 1R10A 3CR3C 2R86A 2X3UA 1XD8A 2C2MA 4PZCA 1RYFA 1A7JA 4X20B 2QW1A 3V42A 5IMSA 2O2EA 1VJ1A 1G21A 1ZH8A 2IZOA 2ZBUA 3H86A 1FQJA 2PN1A 3O4GA 1CUXA 1GKIA 4HDSB 4WI1A 3SSAA 2HA3A 3LW8A 1E5LA 2I62A 4DEYA 4EKGA 5JJ5A 1C30B 4WBXC 1SD1A 5LC1A 3R9XB 2JIRA 5HK8A 4YUAA 1NF9A 2Q1YA 3IBFA 4BB6A 3AY0A 4BP3A 5BPHA 2ZAIA 1SR8A 3P5SA 4KXNA 1FUKA 3Q0TA 3RLIA 4WBNB 3JQ6A 4LWOA 4DM4A 4WUTA 3T7TA 2BCJQ 4DLZA 1OPXA 3OKCA 4YT5A 2P4SA 1BHJA 4MW5A 5BYBA 2DZDA 2A1UA 5K0CA 1I6WA 5H4HA 2DKNA 4PBTA 4NMHA 3UT5A 4ER3A 4GUDA 1P6UA 3GLFE 4P33A 2RK3A 2YUIA 1TK9A 3AGPA 1ZJ6A 4YYEA 5G40A 1AKQA 3IP6A 4FHCA 1I9GA 4WDRA 5D01A 3HKEA 2V3CC 3ZTYA 3IEXA 4JOBA 4PONA 4UUMA 2Y1DA 1NYLA 4DMKA 1GNRA 3K0HA 3WNDA 5BXQC 4WK4B 2ZIUB 2W83A 3DF7A 3FUVA 1R8QA 2K5UA 1T6BY 1FIUA 1X7DA 2HK8A 2JLWA 2HJWA 4PICA 3G7SA 3TQOA 4CDGA 2XWSA 4KSBA 3SXUB 1QNLA 3T7DA 4EK9A 1N78A 4MCIA 2IV7A 2ZAYA 1TA0A 2GRAA 4HI0E 5JCOA 4ZARA 3X2EA 3H2JA 4A8JA 1T0IA 4EKYA 3BD7A 1K0FA 2BZ1A 4L0MA 3KXLA 3F90A 3Q9NA 4LPSA 5EN4A 2PX3A 4AFNA 5HCUA 3KQLA 4BGVA 3GQVA 1JBQA 3W9BA 2GF9A 4F3NA 1L3BA 2YV2A 4HNRA 1A9RA 4RLHA 1K06A 3EUAA 3PC6A 2ECKA 1Q2XA 3EVAA 1I9CA 4UARA 4TXMA 1WPQA 4E6EA 3QNMA 2A1IA 3ZJYA 3VKFA 4EB6B 3CG0A 1UKYA 2QE7D 2G0AA 5JQGA 3B3AA 3PXCX 4GPD1 2J59A 3Q2OA 4H3SA 1HORA 5DASA 3VRHA 4YQFA 1Z18A 3RV4A 1G1AA 1Z7EA 2Q3CA 1MF7A 3G2PA 3WS7A 4MQLA 2QVXX 3JD1A 3S28A 4BRUA 1XLTA 4QQRA 4G1CA 2QPLA 3WL6A 4E2FA 3BDAA 1N0WA 1YDWA 2FJUA 3D6NB 2J3HA 3AG5A 4I3GA 4Y2VA 5FBZA 3SHQA 5FL3A 1BGVA 1TKCA 1Z4KA 2YV4A 2YXDA 4C6SA 3HRHA 2OXIA 4CM8B 4H7PA 4O2BB 1ONOA 1P3Y1 4HQKA 1MC4A 3BFPA 1V7PC 1THZA 1HE1C 3ZNOA 3GGCA 5BW4A 3QSYA 1X94A 3PRKE 2VSNA 4QEDA 2O07A 3AV3A 1LXCA 4M86A 1LZLA 4FQ7A 4MQ4A 1QB8A 1E3IA 2IYLD 3HO1A 4B31A 4RABA 2YIMA 3OQJA 5EAIA 3HB7A 1DUIA 4F56A 4CMEA 1KQGA 2JHAA 1ENZA 3AOGA 3ET4A 2FLVA 1GAJA 1WSWA 1R0WA 1MV8A 2H7VA 3LCUA 2OHIA 5IABA 3BMOB 4L2IB