2JL1A

Structural insight into bioremediation of triphenylmethane dyes by citrobacter sp. triphenylmethane reductase
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
287
structure length
287
Chain Sequence
FSIAVTGATGQLGGLVIQHLLKKVPASQIIAIVRNVEKASTLADQGVEVRHGDYNQPESLQKAFAGVSKLLFISGPHYDNTLLIVQHANVVKAARDAGVKHIAYTGYAFAEESIIPLAHVHLATEYAIRTTNIPYTFLRNALYTDFFVNEGLRASTESGAIVTNAGSGIVNSVTRNELALAAATVLTEEGHENKTYNLVSNQPWTFDELAQILSEVSGKKVVHQPVSFEEEKNFLVNAGVPEPFTEITAAIYDAISKGEASKTSDDLQKLIGSLTPLKETVKQALKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords TRIPHENYLMETHANE REDUCTASE
publication title Structural Insight Into Bioremediation of Triphenylmethane Dyes by Citrobacter Sp. Triphenylmethane Reductase
pubmed doi rcsb
source organism Citrobacter sp. my-5
total genus 110
structure length 287
sequence length 287
ec nomenclature
pdb deposition date 2008-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2jl1A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2jl1A02
4JJFA 4LSWA 1U7TA 1XDWA 3GNSA 4XR9A 1LRLA 4YJFA 4EBFA 4DTIA 1WWKA 2IXBA 3FN4A 3OETA 1Z6ZA 4BNTA 4L9RA 1PIWA 1Y8RB 1YB5A 1PU2A 4WASA 3V1UA 5GZ3A 1YKFA 3DOJA 3ROKA 1A71A 2Q46A 3EZYA 3LF2A 8ADHA 5TLSA 1LDNA 2EERA 5A02A 1GY8A 3EGOA 5CFZA 2D2IA 1I01A 1C0KA 3PWSA 4OQZA 1UJMA 4CMIB 5CPFA 5CEEA 2SCUA 2H1SA 4ND5A 4IDBA 4RO0A 4BNNA 3IS3A 1E6UA 1GAEO 3PTZA 1J49A 1HE5A 3GN1A 1P0CA 4KQWA 1KVSA 3V2UA 3ZV5A 4CR7A 2JL1A 1MXHA 3IQDB 2NVBA 3O03A 2D0IA 1ZK4A 1WDKA 2C0CA 3HE3A 1LI4A 4Y6PA 3M2PA 4MKZA 5TQVA 4JK3A 2NQ8A 2G0TA 4R1NA 1TEHA 3QWIA 2HMSA 4IMPA 3Q9UA 4J4TA 5U4QA 3PLNA 3QVWA 3JSAA 4LVCA 4BNGA 3AUSA 3AOEC 4XYLA 3M1AA 4CM1A 4GI2A 3ONFA 1UXKA 1YWGO 2EKPA 3CEAA 2VZ0A 3JYPA 4TRNA 4BKOA 3JD0A 2IRWA 4L4SA 1HDYA 3LQFA 4DIFA 1R0SA 4GKBA 1VJ0A 5L3ZA 2HSDA 3VH3A 5TS3A 4QTZA 5AXCA 1TT5A 1IYZA 3KTDA 4KTTE 1QYVA 4CJXA 5C7IO 5B37A 1ULUA 4TROA 1IULA 1PR9A 2BHLA 3PK0A 4Z0TA 3RUFA 2WD8A 1WDMA 5JAIA 1HDRA 3QA9A 4MIYA 3WWZA 1T25A 2ZYGA 1DPGA 4ZA2A 3FWZA 3HDHA 3OJ0A 1NR7A 4RVHA 1OC4A 2EP7A 1MFZA 2FPGA 1PWXA 3IC5A 3GUCA 4H16A 1T4DA 4BNUA 1NVTA 3W8DA 1T2DA 2FY8A 4NMHA 4GPD1 4B4VA 5IZCC 2D5AA 4CM5A 1G6KA 2QYSA 4BQRA 4YPOA 3FBGA 1E7SA 5JO0A 2OOSA 2FOIA 2ZJ1A 4DC0A 4TRRA 4WOJA 2HLPA 1P77A 4EW6A 1ADFA 3U4IA 4BKRA 3RUEA 3U4HA 4PRKA 4H3VA 3AM4A 4ZQBA 1E6EA 1DFHA 1V35A 3D5TA 3WJ7A 2EXXA 1XSEA 1HDXA 4YDRA 3GZ4A 1K3TA 4AJEA 4P4NA 2Z1MA 2O50A 3KYDA 4R69A 1KVUA 1IE3A 4QX6A 1U2DA 3TOXA 1IHXA 4PFJA 2E4AA 3H2SA 3GA0A 1DDOA 3JCZA 4ID9A 5MDHA 5JCJD 3NTRA 2RIRA 3C8MA 2GRAA 1OBFO 1VL6A 1QYCA 4FGSA 4D3DA 3OIGA 5L45A 1E7WA 3UN1A 3WWYA 4BGIA 1FMCA 3OA2A 3DQPA 2H9IA 2NVUA 1Q7GA 4IBOA 1GUZA 1WVGA 1M76A 2Y1FA 4IGFA 2DPGA 1QP8A 3DOCA 3MWEB 2HK7A 3RUDA 5DDIP 4P38A 5H83A 2BFOA 4AG3A 1GEEA 1AXEA 1HETA 1R0KA 1Q0LA 2I65A 2WYUA 3IIEA 4I1IA 4IS2A 4AFNA 1EZ4A 1ZUD1 3BHJA 4BO5A 5JCJA 5TRTA 1E3LA 2DUWA 4PG5A 1HE2A 5LDHA 2Z95A 4NJOA 4ND2A 4ZQGA 5U1PA 5F5NA 3ZWAA 1W6UA 2YFQA 1Z73A 1LX6A 3MZ0A 1XYGA 2NACA 3F1LA 3PJGA 1BXZA 3V5NA 3ZNQA 4J1QA 3ADPA 4MP6A 1R66A 4KP7A 1NQTA 3UH1A 1ZNQO 1IPEA 3ZU3A 2OP1A 2QRLA 3DAPA 4FC6A 4AICA 1YOVA 1ENOA 3DHYA 2DBRA 3WYBA 1B8PA 5IDYA 3H9QA 3WJAA 4JXKA 3BMOA 6LDHA 4LCJA 3GHYA 1GDHA 5A4DA 2PGDA 2D8AA 3L4SO 4YJGB 5CG2A 2WM3A 2AG8A 3WOHA 2I6TA 3NJ8A 4U0JA 5CPBA 2Y1OA 4BV9A 1E1LA 1B8VA 4HFNA 5IF3A 1GTMA 4ZGWA 3EVTA 3DC2A 2FR0A 1B16A 4RVDA 1ENPA 1ISMA 1V3TA 4IGEA 1ZMTA 2GN9A 2VHXA 1K6JA 4G2NA 4MIOA 1E7MA 3IUPA 4MVJF 2GN4A 2X0JA 3DHNA 4DRYA 3JQ9C 5HWSA 1JQBA 3G1TA 4R54A 3G3EA 3P2YA 3VPSA 1LNQA 3ONDA 5DOVA 1C14A 1A7KA 1PJLA 1Z7EA 4A7PA 1PL8A 1ULSA 1H6BA 1HDZA 2DTXA 2VN8A 2XPCA 3QWAA 1X14A 1BXGA 3IL2A 4A26A 1ZSYA 1Q7CA 4PZEA 1BRMA 3HFGA 1NAHA 1PJ4A 2H6EA 4YBZA 3NDJA 2BKAA 1P31A 2CDAA 5TC4A 3HN2A 1ZXLA 5ENVA 2DFDA 1R4NA 4ZICA 2CVQA 2X9VA 4XIYA 5JMWA 4TWRA 2AXQA 1QRRA 4UUPA 2VWHA 4L0QA 2FR8A 3QP9A 2I3GA 3C7AA 3PQDA 3QWBA 5L4SA 5AXAA 5IDQA 3WG9A 1LSJA 5IJZA 4TRMA 3D7LA 4NR0A 1R6DA 3ENKA 4OKNA 3DBHA 3S2EA 1ZCJA 3EVNA 1J6UA 1ZJZA 4YAEA 3D0OA 2Q3EA 5COAA 1YONA 2O3UA 3PHGA 4XZ3A 3L9XA 4LK3A 1ARZA 3JQ7B 1ZK3A 4JGBA 5ER6A 1VI2A 1B3BA 3AUAA 5KVVA 1I36A 1JKFA 1XU7A 4JP2A 3OF2A 2HJRA 4MIEA 1B14A 2UVDA 4K6CA 5DBGA 1EVZA 3H9EO 1KVRA 3A9WA 3HFSA 3L4BC 2E6UX 2F1KA 1YJ8A 2EEZA 2EIHA 3KYCB 4CMBA 2BGMA 4DYVA 1CERA 1ZFNA 1S7CA 4J9VA 4NQZA 4QUKA 4YJHA 1T2FA 3WYEA 4Q39A 5CDGA 3C7DB 2WD7A 2JFHA 4RVUA 1YGYA 5CG1A 2JD0A 2Y66A 3BHIA 2NU8A 2VTDA 1XU9A 3DTTA 2C5EA 3DZFA 4YCAA 4NU6A 3LVFO 2D5CA 4BNVA 2ZTMA 1H9BA 3K8ZA 2EP5A 5L51A 1XG5A 5ITWA 3EZLA 1ZEJA 3E1KA 1NQOA 3KYBA 1P0FA 3GAZA 3UVEA 4YT2A 1Y5RA 2G17A 4RVFA 3T4XA 1YRLA 3UCFA 1B8UA 2PWZA 4YR9A 1KEPA 4IIVA 1CJCA 1PS9A 3KRTA 4EJMA 4AJOA 4GQAA 3OH8A 3JQ8B 4FBGA 1F17A 4C7KA 4IJUA 1BVUA 2OHXA 2WJPA 5G0VA 1QYWA 1X7DA 3BMQA 4Y67A 3B1JA 4NNJA 2IZ1A 2UAGA 1O0SA 4E30A 1A5ZA 5FEUA 3BMCB 2B37A 2X0NA 4MOWA 2X5JO 3RUHA 4KDEA 4RF3A 3WSVA 4D3FA 1BWSA 1FXSA 5JY1A 4GLOA 4Z6KA 2BD0A 1VKNA 4E2ZA 5DP2A 1MC5A 4CMKA 3I9JA 1P1KA 1N92A 3HSKA 4TZTA 5ITVA 3CMMA 4GVXA 1N1GA 3R0IA 1ZW1A 3C1OA 5COBA 2C7VA 4AJ2A 4ALIA 2FR1A 4N5NA 4XX0A 5I9MA 4CM9D 2EWMA 1V3UA 5BNFA 2TMGA 1ZIDA 3F5SA 4XEHA 2Z5LA 4J16A 2PV7A 4PRLA 1NWCA 1I3NA 5L40A 1ORRA 2YJZA 1RJWA 4GX2A 5IZ4A 4CQLB 4QSMA 1RKXA 2EGGA 3JQBC 3RUIA 3ANLA 2OGUA 4UUOA 1NBOA 1F8GA 2PY6A 3JQ6A 2I9PA 4IJVA 1LTHR 3AY7A 3HDJA 1AE1A 4ZU3A 4ESOA 3IJRA 3BTUA 4BNWA 2UYYA 2AE2A 4MO2A 4DYDA 1LDBA 2YW9A 3L77A 1SB9A 1JWBB 2O3QA 3GVXA 3GEMA 4CQMB 3PDUA 3WBBA 3RD5A 3GC6A 2WTBA 4KQXA 2X9GA 2IZ0A 4DQUA 3TFQA 4E5KA 2QRKA 2G1UA 3WGIA 2EV9A 3RJ9A 2NLOA 1Y81A 4J91A 3BYZA 4MP3A 1NHWA 1E3WB 4WJZA 3INTA 2NVWA 2FPPA 2Q2QA 3CZRA 4QECA 1JA9A 4Q3DA 1BTOA 1YDEA 4DBVO 2OXIA 2JJYA 2PGLA 4RF5A 2ZK7A 4IZHA 3FHLA 3RFTA 3ZZNA 4FR5A 2YHIB 2BI7A 5JS6A 4OMUA 5K9ZA 1XIVA 4R4JA 3I1JA 1HL3A 3AI3A 3ZWCA 3D3WA 1O89A 1AHIA 1H6CA 4XYBA 4ZD6A 4N5LA 3G1UA 3KZVA 4NBTA 1HLPA 3WTCA 5JAZA 2DFVA 4M86A 2B4TO 4I9UA 4OGWA 1EUDA 3CE6A 2P5YA 4KUHA 4C4OA 2QG4A 1YH3A 4JJIA 5L9AA 4Q9NA 3X2FA 4F46A 4A73A 3O8QA 2B4QA 4NDNE 3MTJA 3SLGA 1WW8A 1LBEA 3P5SA 4NK5A 4WNIA 1IZ0A 2PA3A 3QV1A 5LDGA 4XJSA 1EEHA 3U62A 7MDHA 5I7FA 3U5TA 1NTOA 4N54A 1K6XA 2GPTA 1BSVA 4JJGA 2X58A 1ZZEA 3H3FA 2YHUA 2QRJA 2Q45A 4LGVA 1DFIA 3PJFA 3AWDA 4TMFA 4FJ2A 1ISFA 2O4CA 5A5FA 1FDUA 3P7MA 1K89A 1TI7A 4PLVA 2Q1WA 4B8WA 3H8VA 3VZSA 4URFA 4E3ZA 1B0AA 2P68A 3I9NA 4RQTA 1WXDA 4KUEA 3PEFA 3L6OO 3GLQA 4DMMA 4HADA 3UCEA 3PFFA 3BMNA 1E3SA 2Q1UA 1A27A 1EVIA 5FI5A 3W8EA 1IL0A 5G2OA 5GMOA 4XB2A 5BSGA 1LC3A 2NWQA 5TNXA 1WPQA 3CUKA 3GMDA 1SOWA 2C07A 1SC6A 2E37A 3FBTA 3TPCA 2CNBA 3CXRA 5J23A 2PH3A 3IP1A 4J0EA 2ZCVA 2PZKA 2HRBA 3Q0EA 3VTZA 1U3VA 2GZ1A 1G0NA 1Q0QA 4IMRA 2J3JA 3FNGA 5FF9A 1KETA 1BW9B 1PJQA 1NVMB 1PQWA 4LISA 3WLEA 4HNHA 4D46A 4FSHA 2VZ9A 3G0OA 5DBIA 3FD8A 1T1RA 2GZ2A 3UHAA 2Y1DA 2J5QA 4HKTA 3MJVA 4M87A 3RIHA 4L76A 3GGOA 3ZDFA 1C0LA 5JYDA 2B5VA 1DC6A 5ENDA 3JD1A 4DLBA 2VYVD 4YB8A 1I8TA 1IHYA 4J2OA 1KOLA 3RAJA 4BO0A 2IEBA 3W6UA 4C7JA 4DLAA 2YQ4A 3W4JA 5EPOA 5H82A 2P4HX 4Q3EA 1P9LA 3U49A 3RUCA 4DQVA 3VH4A 1PJSA 4BNLA 2GR9A 1UAYA 2DU8A 2QZ9A 1GU7A 2OFPA 1RWBA 3VVBA 4AJHA 2B36A 2O2YA 2Y05A 4E32A 3EW7A 3S1LA 4GMFA 5JNLA 4RCVA 1C1XB 1MX3A 2JCXA 1QLJA 2OBNA 2YV3A 4MVJI 1DLJA 1VPDA 4EUFA 1N1EA 1YQGA 4IJWA 4AJLA 2DT5A 3ZHBA 3ZHZA 1EMDA 2HO5A 2VYVA 1LU9A 3LC1O 4CUKA 1Z74A 1LLUA 5IG2A 4MKXA 4NFSA 1SCUA 3ROPA 2I66A 3MTGA 4INAA 3ZWWA 3MJSA 2HMTA 4FW8A 4CMCA 3DBVO 3DMTC 5EERA 1W4ZA 1F12A 4B4OA 5JBIA 4B8ZA 1Z45A 5L7WA 3ZU4A 3H3JA 1ZKMA 4GAEA 4ITUA 5EQDA 3S2GA 4CLDA 4Z3DA 2RCYA 3I9OA 5GZ1A 4CLHA 2FZEA 2DBQA 1J5PA 5DOZA 5TF4A 3ZV4A 4FJ1A 1SBYA 4YVFA 2GGSA 5ES3A 1NNUA 4B3JA 1QKIA 3GFBA 3WLFA 4F6LA 5HM8A 1LDMA 2IYPA 4XDZA 3V2HA 3LT0A 1EUCA 3S2IA 3SBOA 3FTPA 4BO8A 5A5EA 3LC2O 5H81A 1PJ2A 3HADA 2WE7A 4AJ4A 1HE3A 2FN7A 1UXJA 4FOSA 1HWYA 4HWKA 1GYQA 1K2WA 4HFRA 3H65A 3TZHA 2CD9A 4AJNA 3GR6A 5K6AC 1PJTA 4B3IA 2Q49A 4U6SA 2UV8A 3MCVA 3VZRA 4BB6A 2P9EA 4HP8A 1UP6A 1MLDA 3ASVA 1T4BA 4P4GA 1I2CA 4I9NA 3ITKA 3ITDA 4WCFB 4XGKA 5THQA 4JX8A 2XXJA 1WAMA 2DVMA 1A4UA 3VVCA 5K0ZA 3DBRA 3OEWA 4CMIA 4OIMA 4E2YA 1NFRA 1NQ5A 4BO4A 4FFNA 1AGNA 2ZATA 1RPNA 2BFPA 2CDCA 1K6IA 3KLMX 2V6MA 5LC1A 4A2CA 2VHWA 3I9LA 2ILTA 1I3MA 3ZU5A 1H2BA 1T2AA 2GN6A 4A03A 1Y7TA 2VRCD 3GNQA 4L8VA 3U4CA 2YZ7A 3LDHA 1VLLA 1NASA 2X0IA 3PHHA 1HYGA 4CM8B 2Z1NA 2W2KB 4YAKA 2ZYAA 4NJMB 3KO8A 2PH5A 4HFMA 3D4PA 4WK6A 4BNJA 5ICMA 4BV8A 5G0TA 3GZNA 3Q6IA 5I7VA 4O5OA 3L6DA 1NX6A 4TVBA 1WMAA 1ZK2A 2O3JA 3DAGA 3ST7A 2VRCA 1XQ6A 4HFJA 2Q99A 1H2HA 4M55A 1YB1A 1D1TA 3W6ZA 1PS8A 3OA0A 2D1YA 1D7OA 3ZCXA 4DWVA 2JAHA 3WYCA 4WKGA 2HMVA 2YFHA 2NSDA 2VHYA 1ZJYA 3JQCA 2C7GA 2YV1A 2O4UX 2Y1GA 1UDAA 2R00C 2UUOA 1KC3A 1DB3A 1W73A 1HEUA 4Z9YA 3X2EA 3JQGA 1ENZA 1QXSA 3JYOA 3B1KA 2Y68A 4K6FA 4CL3A 3INRA 1DJNA 4II2A 3SX2A 1BG6A 1KY5A 1KEUA 4IZIA 2EW8A 4KUGA 1DHTA 3QWHA 4BNMA 2WYWA 4PIVA 4YTEA 4P4LA 1PZGA 3T4EA 4CUJA 6ADHA 3PHIA 3GEGA 4WGGA 4XYEA 5A9RA 1CWUA 3IP3A 3S55A 4HNGA 4B79A 5JC8A 1YL7A 1YXMA 1P1RA 3AUTA 4PLYA 4E0BA 1M75A 4D7AA 4Y98A 2CUKA 3WX0A 5I7EA 3K2BA 3HB4X 5A06A 2DC1A 3HHPA 3UF0A 3JD4A 1V9LA 4II3A 5JE8A 2NTVA 1SOVA 3ZH2A 3NT5A 1TT5B 3RSHA 3CKYA 4E13A 4XDYA 1I33A 5DN9A 3WGTA 2X1HA 4FFRA 3G79A 4QFDA 1YVEI 4W9NC 5JSFA 3FNHA 3D5QA 5T67A 2BH9A 4NFHA 5IXSA 5CHEA 2Q4EA 2GUGA 4UVDA 1R12A 5BR7A 1V6AA 1VL0A 3ON5A 5JAQA 3OM9A 1H9AA 4XCVA 2FSSA 2CVZA 4OL9A 1ISGA 1MB4A 1YS4A 4M1QA 1P1JA 2BLLA 3ONEA 4R9RA 4RL6A 4W4TA 4CLRB 1JN0A 4A5OA 3VH1A 3RBVA 3V1TC 4AJIA 3GVIA 1F0YA 4DPLA 5A04A 1PX0A 5CEJA 2IYOA 4JBHA 2HQ1A 1ONNA 2EKLA 2HMUA 3PVZA 4Q3CA 4EUEA 3EAGA 2I76A 4NBUA 2EW2A 3ZW8A 1KEVA 4W6ZA 1R15A 3EUWA 4N5MA 4R68A 2AA3A 3LT2A 3JD2A 4Q3NA 4OQYA 1MXFA 3PQEA 5B4VA 5JC1A 5TIIA 1U4OA 3D3EA 5JDIC 2X8LA 3KYDB 5EQFA 1VM6A 3VPGA 5HS6A 4FN4A 3H9UA 4YQZA 2E48A 4E31A 4NBVA 1QV7A 1GYRA 4J49A 4RORA 4XGIA 3BTOA 4CM3A 1CQIA 4O1MA 3W1VA 4GX1A 3JQFA 1DAPA 1PJ3A 5GY7A 5TJHA 2IXAA 1O95A 3A4VA 4ALMA 4OSPA 2B69A 3O9ZA 3RU7A 5CAEA 2OUIA 1H6DA 2GNAA 4LSMA 4YWJA 1Z75A 3GUYA 3QQPA 4B4UA 5T8KA 4I8XA 3AOEA 4UAGA 3DHEA 2UDPA 3FPLA 1OI7A 2OORA 3VKVA 3KB6A 2V6FA 4U0KA 3DTYA 2FP4A 1I3KA 3ZWBA 1KY4A 4J2HA 1DRVA 2V65A 4WLNA 4B4WA 4UVIA 3WQRA 2HAEA 3EK2A 4CMHA 2VUTA 4BL5A 5DF1A 2F00A 3K31A 5IXYA 3OSUA 4Q3BA 3G17A 5B12A 5JXWA 3I9KA 4Q3AA 3JD3A 3D4NA 4ALKA 3M6IA 1FF9A 1VKOA 5F3RA 2YDYA 4A0SA 3MOGA 4DPKA 1EDOA 5A03A 3DZHA 3H5AA 1LDYA 3NJ4A 4GWKA 2ZB7A 1LSOA 1DEHA 3TFOA 5GZ6A 1E3IA 2NQTA 1N9GB 1I5RA 1I0ZA 1X13A 3SEFA 4AJJA 1CEQA 3SC4A 3KV3O 3BMOB 3JYNA 5T5QA 1RM4A 4W99A 2GYYA 4ZVVA 3CTMA 1DIRA 1DLIA 1GZ3A 1ZH8A 2Q2WA 2FRDA 2YYYA 4J4BA 2GSDA 5IZCA 4N7RA 2Y0EA 4M54A 4E5NA 1LDGA 4FCCA 4RJTA 5F21A 3FCOA 5HRUA 4CLOA 4WCDA 1QORA 1PJBA 2O48X 3C1TA 2DBZA 3AJRA 3AY6A 3STHA 2DAPA 1QSGA 2X6TA 5F1KA 5JYEA 1GL3A 2WWRA 4MJLA 1NYTA 3BTVA 3ANMA 3D4OA 5EESA 4A27A 4A10A 2ZKLA 4KWHA 2EF1A 1AXGA 5KKAA 1J0XO 1D4FA 2GD1O 4BGVA 3ROMA 3B6ZA 2BFAA 1VJTA 4WLVA 1N5DA 1DJQA 1ZSNA 4RQUA 1JVSA 3JQ7A 4JCOA 1LLDA 3KOUA 4HBGA 2DKNA 3RC9A 3AFNA 1XKQA 5TT1A 1VJ1A 3RBXA 3GDOA 3ZWVA 1GCOA 4G81A 4OOFA 2Y0DA 1QG6A 2GCGA 4PLZA 1QR6A 4GBJA 4E12A 4B7UA 3TRIA 2VT2A 5KVQA 1K5HA 2JD2A 4DIOA 4O6VA 1E7RA 1BXGB 4BKPA 1X0XA 4ZN6A 1AHHA 3GAFA 4FFPA 1UDBA 5ILOA 3AUUA 1E6WA 3N58A 3QIVA 1X7HA 1Q2XA 3DOOA 3QJ5A 4Y6RA 3I4FA 4PLGA 3HDYA 3ABIA 3F9IA 1D3AA 4YACA 3TOZA 4YYZA 4FJ0A 3GF4A 2PGJA 4P8RA 1MG5A 4EJ0A 4BUCA 4BVAA 5C37A 3WFJA 2B4RO 4D79A 3VZQA 3BIOA 4GLLA 4WLUA 5JDCC 2ZTVA 1BDBA 3R3JA 4PVCA 3OICA 5C7OO 4E5YA 4R01A 3CIFA 2I67A 1U1IA 1E92A 2VWPA 4WECA 3VDQA 2O3SA 4I08A 2PZLA 3AK4A 1EBFA 4IQ8A 5F1OA 3I83A 5JCXA 2X23A 2Y93A 1DXYA 4BMNA 3HJAA 4MVJP 2O3RA 4IDFA 4EUHA 4OXYA 1X1TA 1ZK0A 3GG9A 2QZZA 2NUAA 3UUWA 5F1PA 1M67A 2IODA 4OHUA 1DAOA 1LRJA 3M1LA 2RBEA 3OJEA 3PDJA 4IIUA 1B2LA 2WD7B 3KM0A 5G4LA 3VDRA 4F6CA 2OO5A 4J3FA 1UR5A 1UXGA 2G5CA 1EQUA 3U0BA 1ML3A 5CEFA 3MEQA 4KWIA 1HT0A 1BVRA 4GVLA 1K0UA 4I5DA 4FGWA 3A14A 3NYWA 3PXXA 3PHJA 4D0RA 4JBGA 2QHXA 3E82A 2RHCA 3JQ9A 3AOGA 1ZK1A 4IJKA 3PRJA 1G1AA 1H93A 3HWRA 1NM5A 4CMEC 3ANNA 3ZWMA 2C20A 1DRUA 1TLTA 2JCVA 5L7YA 2C2YA 4H7PA 4OM8A 2B5WA 4D44A 1MV8A 4RPGA 4D45A 3SVTA 3RQSA 3HZZA 3PYLA 4WUVA 4Z9XA 4Y9DA 2VOJA 3BMQB 1E7YA 2C54A 3OECA 5KWEA 5FYDA 1E3EA 5G0UA 1EDZA 1UUFA 2W98A 5IDWA 1QMGA 1GYPA 4CM9A 3VPHA 1IZ9A 4XA8A 2XF8A 3ETDA 2PKQP 4LVUA 3LC7O 3TJRA 2VZ8A 1Q0HA 5EMHA 2OP0A 1PL6A 1PZHA 2WDZA 3KHUA 1AN9A 4MVJG 3R1IA 3OJFA 3DZJA 2VUUA 1UXIA 1FDTA 4R3NA 4AL4A 2QIOA 4I5GA 1I2BA 4BHTA 3GT0A 3QE3A 5B4TA 2YHIA 4UVHA 3AW9A 3NDIA 2OZPA 1EE9A 3L0DA 1EK5A 2VRBA 3INGA 5A05A 4ZHSA 4BS9A 4M8SA 4CLEA 5JO9A 1U8FO 2VQ3A 3WB9A 4K26A 4PLCA 3ASUA 5ER9A 3LT4A 2W2LD 4I9HA 4LMRA 5KJ1A 3DFUA 2B0JA 3F5QA 3GDFA 2BELA 3OMLA 1T1SA 2VOEA 3VHRA 1HTBA 1MA0A 4FIZA 3VOSA 1RM3A 1ID1A 4BGEA 4CODB 1P3DA 3HUDA 1AUPA 4XIJA 1Y8QA 3JV7A 3DZIA 3PP8A 3K9QO 5KNLA 4IY1A 3TZ6A 1YL5A 2AMFA 3DFZA 3E8XA 5DZSA 3UICA 1LC0A 4UREA 3TQHA 1XHLA 3E6AA 4E5MA 2W2LA 3FRJA 4GX5A 4OSOA 2QX7A 4CR8A 1O6ZA 3TZQA 3UCXA 2PD6A 1U5CA 4DBZA 5KTKA 3TF5A 5AYVA 1YE3A 2C2XA 2VNAA 3KXDA 5TSDA 4WCFC 4CLXA 5AQ1A 1DHRA 1R4MA 3KEOA 3T7CA 3WGHA 2Y1CA 3E9MA 3LZ6A 1PGJA 3DBLA 1XLTA 1MG0A 4RGBA 3ZNNA 4WLOA 5DP1A 5AXBA 1UZLA 3JYQA 4EEZA 4GKVA 1UXHA 3D3WB 1NHGA 3WICA 4QFCA 3GQVA 1I24A 3UFXA 1IUKA 1ZSVA 1J4AA 4PLTA 4OAQA 2CF6A 3FR7A 3KUXA 2DBVO 5BQFA 5A9TA 1ISHA 1SB8A 1DSSG 4RPLA 1EQ2A 4XD2A 3SC6A 3ENNA 4BQPA 3JQAD 3QHAA 3UOGA 4HY3A 1ISJA 3PIIA 3V1YA 3OQBA 2J5KA 3MJ4A 4CL8A 4RF4A 2J6IA 2ZQZA 3Q3CA 4WEOA 1CRWG 2R2GA 3RCBA 3RKUA 3WGYA 4BNFA 4J43A 3DZKA 2LDBA 4J0FA 3K5PA 2V6BA 1U8XX 1PWZA 3ICCA 4NU5A 4RDIA 4N18A 1PTJA 3UGKA 2CY0A 4P22A 3I52A 3SXPA 4PLWA 5FFFA 3WDSA 3JQAA 1D1SA 3GY0A 3R3SA 1LSSA 3HG7A 1VE9A 2VNSA 1CQJA 3HQ4O 2ZYDA 1YB4A 1LLQA 5JAMA 4PG4A 1TT7A 9LDTA 3UW3A 4CPDA 1NPTO 4UEKA 4CM4B 5BSFA 5KJ6A 2JHFA 3HNPA 4DIBA 3WQQA 1ISIA 2P9CA 1QLHA 4JBIA 1ZEMA 3ETGA 1M66A 4GWGA 4XB1A 1P45A 3H7AA 2AQ8A 3GNTA 4FOOA 3WMWA 2B83A 3C1AA 1XGKA 2VT3A 3K73O 3W4IA 2GZ3A 4YRDA 1WZIA 4YRBA 4PN3A 3DB2A 4XKJA 1MC4A 4M89A 2HJSA 3AU8A 2FPIA 3PWZA 4YA6A 1YBMA 3NDRA 3ZHXA 3F1KA 4I5FA 1PGQA 2X5OA 3GN2A 2NNLD 4YQYA 5EINA 3RU9A 5FWNA 2A9FA 3DDNA 1E1NA 1P1FA 2DTEA 3C7CB 2RH8A 5JMPA 4TSKA 3AU9A 3D1LA 3QVTA 3NTQA 5G0WA 4XJTA 3F3SA 3WNVA 4DMLA 1HLDA 3K6JA 1JLLA 1HE4A 5DCWA 4BNHA 2GERA 5A9SA 4NBRA 4E4YA 2GO1A 2BGLA 5C3MA 2NTNA 3ZNOA 4ZQFA 1F06A 1ONPA 3IMFA 2C5AA 5B4UA 2QYTA 4O59O 2DTDA 4G5HA 1CETA 4OOEA 3KETA 1RYDA 1VL8A 1BGVA 1U9JA 5I9NA 3DZGA 1M2WA 4XGNA 4LCEA 3ZHYA 2PTGA 3WFIA 5IN4A 1WDLA 3COSA 3HN7A 5ILGA 3V8BA 4IDCA 3MJCA 2PNFA 2CSUA 3C24A 3ZW9A 1GV0A 1T26A 3FTNA 1ZBQA 2V7PA 3L6EA 1P74A 1EE2A 4L4RA 5L4NA 1DC4A 4F45A 3SJ7A 5HTOA 3CH6A 1C0IA 3WBFA 1H5QA 1FJHA 1XCBA 1XWFA 4JROA 4LW8A 3BZUA 4GX0A 1M6WA 1U3WA 3Q2KA 4IQ0A 2JD1A 3K96A 1Y8RA 1XQ1A 1UZNA 3WGZA 3H4VA 4H15A 1OC2A 3EMKA 3BHMA 3F4LA 3MJTA 1YBVA 1EFLA 4G65A 3H5NA 4Z3KA 4RZIA 1ADBA 3OFSA 4EI2A 1E3JA 1P1HA 4CM8A 4CV2A 2W2KA 3OIDA 4DPMA 5IDXA 4NJMA 5G4KB 2NU7A 3RBZA 4RVSA 1X15A 1Z82A 1GQYA 4Y8VA 3LT1A 3FSRA 2HRZA 1LUAA 4WPGA 4BNZA 5HS4A 1CF2O 2PLAA 2ZCUA 4PLHA 3VH2A 1KBZA 4XQEA 4PZDA 1A7AA 4GSKA 3MJEA 3QRWA 1CDOA 2X4GA 3WXBA 3RJ5A 3EY4A 3NV9A 2IEDA 4JP3A 2X0RA 4M49A 4QXMA 1EUZA 1W0CA 4OXKA 3IDSA 1GQ2A 1C1DB 2NM0A 4CMGA 4MP8A 3E9QA 2DM6A 4RLHA 1YL6A 4BMVA 5T6BA 1MFPA 3HB5X 4MVJE 1VRWA 2V6GA 2A92A 2W4QA 2XAAA 3DBRB 4YJFB 4U7WA 1GZ4A 4QO8A 4U8GA 2GLXA 1NR1A 2RHRA 5BNTA 3LSYA 4WEQA 2Q4BA 1B3RA 3ULKA 1BXKA 4XRGA 4K28A 2Y0CA 2TMDA 3TSCA 2OMEA 4GGOA 2D4AA 3RKRA 3VAZA 1X0VA 3DWFA 5G0SA 5U9CA 5I7SA 3NRCA 3B20A 4CUZA 2NU6A 3JQFC 2HDHA 4OH1A 1NVGA 1PL7A 4FS3A 4YEDA 1TB4A 3U09A 2Y99A 4CV3A 4BKUA 4QEDA 5T8KC 3DO5A 1N7GA 4PVDA 3K92A 3QY9A 1HSZA 3DMTA 4BO6A 3GZNB 4BO7A 1L7EA 2JAPA 5JFOA 2IDZA 1E7QA 1Z7BA 2YV2A 2AG5A 4XQGA 1A4IA 2PKRA 3ZWXA 1R0LA 1SEPA 2P2SA 4J4HA 2ZIZA 4E2XA 1NXQA 1HF3A 4R16A 3ZV3A 4DXHA 3FI9A 5C5IA 2BRUA 1A9ZA 4Z0PA 1C0PA 1HXHA 1LSUA 4AJKA 3WTBA 1LRKA 5KIAA 1I32A 1B7GO 4E21A 1U7HA 4J9UE 1MP0A 3DL2A 3BAZA 4OO3A 3IKTA 1GUYA 3IKVA 1N8KA 3JQEA 4Z9FA 2HK8A 4XYGA 2FZWA 3E5RA 3DR3A 5B1YA 4NK4A 2JFGA 3FNFA 2H63A 2VWQA 4UUMA 7ADHA 4ZJUA 1Y9AA 4J1SA 3GVCA 4EZBA 4CLRA 4E5PA 3JQGB 4ZRMA 4EGFA 2ET6A 2CZCA 3DZBA 4LRTB 4YT5A 3ROQA 5K6AA 1VSVA 4WOKA 1L7DA 1QYDA 2PD4A 1O9BA 4HXYA 2HK9A 2J3IA 3WQSB 1UH5A 1GUFA 1HDGO 2BGKA 2P9GA 3ZWOA 2AQHA 4FQ8A 1F8FA 4FPXA 3DMYA 3I9MA 3Q9NA 4BO9A 5L53A 1S6YA 4TQGA 1GZ6A 2P4QA 1WLYA 1E5LA 2HU2A 4KDFA 4QO7A 3V2GA 1KVQA 3IJPA 3AM3A 2CDBA 2VYND 4R51A 4TZKA 3TWOA 5LCXA 3JQDA 1E5QA 5BSEA 3RUAA 3E48A 1E1MA 1SNYA 2G82A 3PZBA 3GGPA 5JY6A 1WNTA 3ETEA 4KTVE 4NHEA 3OP4A 4NBWA 3QVOA 2WMDA 4XR4A 1GADO 4YJGA 3WR5A 5L4LA 1XA0A 3RFXA 1RM0A 2NVUB 1R37A 4IPTA 2VYNA 3VPXA 3WNQA 4IDDA 1OAAA 2GDZA 5CDTA 5TX7A 3GEDA 5EN4A 1BHSA 4YT4A 2WE8A 3NGXA 3P2OA 3A1NA 2VWGA 4RVGA 2XOXA 1RM5A 3I3OA 5BNIA 5TT0A 1DC5A 4ALNA 3UKOA 2QQ5A 2O7QA 5HBRA 3Q11A 4ALLA 3FWNA 3LLVA 4L73A 1LLCA 2IE0A 4DUPA 1ENYA 1SO8A 2YQ5A 5EJ2A 1ONOA 3EDMA 3T7EA 1N9GA 1DBVO 4JLWA 1YO6A 1UP7A 4J7XA 3ZV6A 5KOIA 2R00A 3I6QA 2VHVA 2PKQO 1CYDA 5KVCA 3N74A 2FWMX 2XXBA 3GG2A 2J3KA 4BB5A 3DAFA 1PGOA 1UDCA 3RROA 1YOVB 4B3HA 2ZB8A 3ICPA 4MKRA 3LYLA 4XWYA 3IAHA 4UUNA 3VZPA 4GSLA 3C85A 4QQRA 2BMAA 3CMCO 3O38A 5BSHA 1FDVA 3RFVA 3VPFA 5KJCA 2A4KA 1NAIA 3U9LA 1LJ8A 2E49A 2ZTLA 3UXYA 5C7LO 1SMKA 1I10A 1Q7BA 4UULA 3N7UA 1I30A 4YAJA 3E9NA 5AXDA 2BF7A 1BMDA 3ADOA 1NFFA 2PFGA 3KLPX 5ICSA 1CIVA 3ZWPA 1BDMA 3U4DA 1A72A 2DLDA 1W8DA 2X86A 5COQA 5T57A 1PZEA 2X9NA 3OBBA 4ND4A 4W9NA 4S3MA 3FR8A 2RH4A 5A1TA 4D0SA 1DOHA 1U2GA 4I5EA 4ND1A 3WGOA 3RVDA 1JKJA 2JCYA 2O7SA 5ADHA 1GV1A 2HKIA 2POQX 4PG6A 4PG7A 3ZNPA 4BIIA 3I6IA 4WLEA 3KYCA 1EVJA 3DONA 3P19A 1L1FA 3AI1A 3OIFA 4R3WA 3EC7A 2BFMA 5DT9A 1LQTA 3GGGA 5I8WA 1E1KA 1PJCA 2GN8A 4MVJD 4O63O 1H94A 1V0JA 5A3VA 4WLFA 3ZGYA 2A35A 4CLOB 1HYHA 2AE1A 1IB6A 3GFGA 5DBFA 1R4NB 3OJLA 3PZRA 1NPDA 4J7CA 5IN5A 1U3UA 2G76A 1GPJA 4AJ1A 3K2EA 1LA2A 1U4SA 1DO8A 3GRPA 1JVBA 3GHHA 1MUUA 4DLLA 2NADA 3WGGA 4WE3A 1FDSA 4YAIA 5BT9A 4R41A 5JDIA 1JAXA 1PS0A 1SPXA 2AQKA 2E82A 3IOYA 4UEOA 2WSBA 4PG8A 1DIGA 2CFCA 3DBHB 3NT2A 1KIFA 2Y67A 3GH3A 3NT4A 2I3AA 4MVJA 5JW6A 1GPDG 1PQPA 2PK3A 5DCYA 4EJ6A 3JQ8A 4X54A 2AHRA 4XQ9A 5CDUA 1KS9A 4QT0A 1LEHA 1VSUA 3D64A 5EIOA 4E6PA 2EKQA 4GMGA 2Q1SA 1ZO8A 4OJNA 5CDSA 3GPDG 4CR6A 2RAFA 3BMCA 3GOHA 1DFGA 4RPJA 4BO3A 2H5LA 3IUSA 1FDWA 4NZ9A 3RI3A 3MWDB 3GMSA 1EK6A 3PPIA 4YJHB 3GPIA 2AEJA 3ZWNA 2HUNA 3KBOA 3O26A 1X7GA 8LDHA 3NKLA 4CM6A 1GQQA 4ZRNA 4MDHA 1X1EA 2Q2VA 1D8AA 4GL4A 4ROSA 5DNAA 2DPHA 3JYLA 1GCUA 3QLJA 2W90A 4TKMA 1DIBA 5KCZA 1LXCA 3PGJA 4MINA 5TJ9A 3K30A 3CSDA 3LK7A 4BO2A 2NTJA 4CQMD 4R1UA 1R16A 3LLSA 4EEXA 2D59A 4XYMA 4CQLA 2NV6A 1GFSA 1LQUA 2QW8A 2ZQYA 4RF2A 4GGPA 4J6FA 3PJDA 5THKA 2PZJA 4TKLA 4NPCA 4OKIA 2VHZA 2B35A 4O0LA 1SAYA 4K1LA 1JTVA 2YDXA 2GASA 3RC1A 4BNIA 3MOIA 3QW2A 3S8MA 2X7HA 3KSDO 4FFLA 4MPDA 4CQMA 1JDJA 4D41A 3UAGA 4FB5A 4D42A 3JTMA 4GH5A 4ILKA 3Q1LA 4ND3A 1HYEA 4IS3A 4IINA 3ZI0A 2AEFA 1KERA 4BNKA 1EVYA 2AEMA 1E3WA 1OMOA 1IY8A 1VC2A 2EG9A 1WMBA 4IUYA 1H6AA 4U5QA 2FSVA 4BMSA 4F3YA 1EBUA 4UVGA 1JWAB 3I23A 3M2TA 3SJUA 4W7IA 2ZTUA 3EYWA 1DIHA 4J90A 4B7XA 1NQAO 2C59A 4HX5A 1ADGA 3NAQA 1KEWA 4RDHA 1PGPA 4W7HA 3ZU2A 4E2WA 4ONEA 4PLFA 1XEAA 3EHEA 3QVSA 1JW9B 3TL2A 2PR2A 1Y5MA 3S2FA 3PWKA 3NGLA 4YAGA 3RASA 2CF5A 3L4BA 1O8CA 3E5MA 1YDWA 5IAAA 2X22A 1YBAA 3B1FA 2WYVA 1P44A 1PGNA 5I9LA 5KVSA 4DL9A 1EFKA 4ZQHA 2CMDA 1YQDA 2Y1EA 1C3VA 4L75A 4W82A 4HV4A 4JNKA 2Q50A 5JPIA 3GVPA 5JDCA 3QVXA 4HUJA 2D3TA 4DGSA 3PYMA 1Y1PA 4TVOA 4IXWA 1GD1O 4ZQEA 3PQFA 4XRRA 3I4CA 3U3XA 3WSWA 4L74A 4D3SA 1UZMA 1OOEA 1HKUA 3GVHA 3H2ZA 2C82A 1E0DA 2UUPA 3GK3A 5AVOA 4OXNA 3TZKA 1OZAA 4NH4A 2FHSA 5MGBA 4K9DA 4JN6B 4R1SA 4AJPA 4XQCA 1PSDA 4BKQA 4PCVA 2ZB4A 2VUSA 4LRSB 1OFGA 1XR3A 2PZMA 5EL0A 2AW5A 1PEDA 1QYXA 1SZJG 1NFQA 1Y8QB 1QV6A 2J3HA 2VCYA 3CPSA 1PQUA 1I3LA 2NU9A 4NIMA 4KOAA 4R5MA 1DC3A 3H9GA 1V3VA 3KSZO 2O2SA 3O8QB 1HRDA 3ORFA 1RYEA 5L7TA 4EITA 4R1TA 1BW9A 3H9JA 4DA9A 4LN1A 4PGFA 1XELA 3F4BA 1UP4A 3WIDA 3TNLA 3HDQA 4LMPA 3OEYA 4IDGA 4YJDA 3KSUA 3PLRA 1NP3A 3WIEA 4BGUA 4RLSA 4AVYA 1U3TA 3F46A 3NEPX 4L4XA 4CMJA 3H5RA 4WNCA 1ZVMA 1R4MB 1JAYA 2CVOA 4CMEA 3AFMA 3DBLB 1YQXA 3WMXA 4CM4A 4IDAA 2Q1TA 1M6HA 4J1TA 4S1VA 1HZZA 4YXFA 3F47A 4TRJA 5CP8A 3FPCA 4JQCA 2JKVA 4NG5A 5L95A 4Z0HO 3JQBA 1HDOA 3FF4A 4DQXA 3DXFA 2BI8A 3E18A 3AI2A 1F14A 2W8ZA 2EGHA 3NX4A 3BMNB 1C1XA 3R6DA 4BOYA 4KZPA 4ALJA 3PYXA 4E33A 4RV9A 4B7CA 3CINA 3KEQA 5KKCA 1SEVA 3NUGA 1U28A 1ADCA 4DREA 2O23A 1P1IA 2EJVA 1H0KA 1HDCA 1TXGA 3A28A 2C29D 3GRKA 3KVOA 3QSGA 3RC2A 5CDYA 3W8FA 3WS7A 4R9SA 1A9YA 2JHGA 3AM5A 2AQIA 1TVEA 1GR0A 2EJWA 4IM7A 4BNYA 3OHSX 2X5KO 4PZCA 1LDEA 3BTSA 4PLPA 2YY7A 4NFYA 2IZZA 3JQAB 1G0OA 4Y6SA 4J7UA 2I99A 3OQ1A 4RPKA 3OQ6A 4U6QA 3L07A 5DULA 3E03A 4CV1A 1Q1NA 2J5RA 1NWHA 4FFMA 2P91A 2ZJ0A 4UEJA 4FD3A 3WGQA 3PHLA 3ZWYA 5F5LA 5DCUA 3DEYX 2ZB3A 2P5UA 3NTOA 2PD3A 2DUUA 2J8ZA 1T2CA 2FMUA 4FDAA 1B26A 4NI5A 4MVJH 5KJEA 3L9WA 3RC7A 2HCTA 3PFWO 1T24A 3Q2IA 4IXTA 4MVJM 3TL3A 4CV0A 4DVJA 1IOLA 1UAGA 3PGXA 1I2ZA 2DQ4A 3VTFA 3GDGA 1ZMOA 1IPFA 4FC7A 3VKUA 3VC7A 4CMAA 5IFLA 4DC1A 3FNEA 4IDEA 1GEGA 1HZJA 1WP4A 3B70A 3LF1A 1V8BA 1MGOA 9LDBA 3C3XA 1U5AA 3I5MA 3ZN2A 4JIGA 5T64A 3QWFA 1JKIA 1NPYA 4WCFA 3TZCA 1O94A 1PZFA 5FI3A 4IQGA 3RWBA 4YT8A 4RPHA 3TN7A 2GF2A 3PI7A 3W4KA 5A9SB 1Y6JA 5A3JA 1DIAA 1KC1A 1Y9EA 3LU1A 5AOVA 4EDFA 5TGDA 4D43A 4KMSA 3F6YA 1P33A 2JFFA 5G4KA 3TDKA 1JU9A 1B15A 1HSOA 1ZXBA 4FFOA 2LDXA 1T2EA 4YRAA 4R5HA 2O3TA 1N2SA 1E77A 1TA4A 3AY3A 5HA5A 2HMWA 4BNXA 1WZEA 4CM7A 3PIDA 3O4RA 1KYQA 2WEKA 5I8ZA 4J1NA 1FK8A 1KVTA 2R6JA 3PJEA 3CZMA 1DRWA 3G49A 4UVEA 2VTEA 3SLKA 3A06A 4EYEA 4RZHA 1PR3A 1O5IA 3OJOA 2EHDA 4OYRA 1C1DA 2I5PO 5KJFA 3H6KA 5JLAA 2OBYA 3BA1A 1N7HA 2A94A 3BXXA 4BO1A 2YUTA 1YJQA 2OL4A
chains in the Genus database with same CATH superfamily
4JVNA 5CU7A 3HJNA 3ISTA 4AY4A 1IEQA 1MT3A 3GPCA 5DYGA 3C3MA 4UTXA 4YJFA 2I9KA 1PBNA 2G6BA 4K05A 4BWFB 3DDUA 3M6UA 4D3XA 1X1CA 2KB0A 1RRKA 4NNPA 3EEQA 4UTVA 2WU8A 1GGVA 5DE3A 3TXAA 1Q1AA 3U1BA 2Q46A 3EZYA 2RD2A 1QANA 1GY8A 1UK6A 3H1BA 3H17A 2H1CA 2MIIA 4P58A 2D2IA 4YV0A 1L6RA 5CFZA 1NY5A 2FWPA 1UJMA 3CVXA 2E3JA 4JUCA 1RIIA 1R18A 2ZANA 2BZSA 4FKMA 5BSUA 5T3UA 1K4KA 3EZFA 3STWA 1GAEO 1E0JA 4IRXA 3T1VA 1J49A 2NU7B 4MRAA 3NHJA 3PB3A 3V2UA 1P0CA 1DQPA 4EA6A 2JL1A 1MXHA 3HJGA 4TLAA 3ILHA 2GCEA 4WKCA 2NVBA 2PZGA 1EP1B 1HQDA 3G88A 4HGZA 4IDUB 3DZ8A 4RU1A 1ZK4A 4LJ9A 4L8FA 5AK0A 3UMGA 4CIVA 1IWBB 2C0CA 4HLUA 2V4ZA 4UNNA 3C97A 4R9NA 1EFVA 1U7OA 5JISA 3R5KA 3VJMA 4ZHQA 2G0TA 2WVJA 5MF6A 4WX2B 1TEHA 3T5CA 2IEGA 3Q9UA 5CYPA 5EMKA 1VB3A 4LVCA 2KBFA 3H86A 1XPOA 1BVHA 1MNAA 1BYUA 5H0IA 2JI4A 1TLLA 4GI2A 2OORC 1YWGO 3ELUA 3FIJA 2RGNA 3G2HA 3LX8A 1OLXB 4MB6A 2YC4C 4PQRA 1QE3A 2CLEB 4TRNA 3MUEA 3JD0A 3L7KA 1PKXA 4JV5B 3HU5A 1IQUA 3DMGA 3KV1A 4A2PA 2N47A 4Q1BA 5L3ZA 4U2DA 4GNRA 4JB0A 1GR1A 1M2HA 5DNEA 5HK8A 3CV3A 1HT2E 1W94A 4LXIA 5ETJA 3MRTA 4CKZA 3KTDA 1OFHA 2A1TR 1AU9A 2WM9B 4KTTE 1FSGA 1QYVA 3DTVB 3LOQA 4CJXA 1KRXA 5J43A 2CBXA 3UYLA 1YQQA 1K6MA 1KK0A 2PKYX 1AM4D 1PCXA 2R5NA 4TROA 2WD8A 1C8VB 3RT9A 4AB1A 4ZVOA 3FZQA 3JRWA 2BIFA 3NBFA 3NO4A 4JC5A 4A91A 2PLNA 4PFQA 2JGKA 2VTBB 4B3GA 1H66A 1JSRA 3AKEA 3GFOA 3EGWA 4RSGA 5AKKA 3SHOA 4RIGA 4A6DA 4UHDA 4RVHA 2DYKA 2EP7A 2FPGA 3MBIA 4EA8A 4HHEA 3KSAC 1NVTA 4NMHA 4MDFA 1B41A 1UK9A 2FRDC 2QM8A 4GPD1 1UZAA 2IIPA 4KYTA 4JY7A 4CM5A 4EFKA 2G1PA 1JXAA 2QYSA 2VATA 4AMVA 1KQPA 3NHYA 3QKIA 5JO0A 4WFJA 3RAEC 2J6CA 2AVDA 1SBCA 4B80A 4TRRA 4AZ0A 1ZUHA 2R2AA 3JXEA 4RHEA 2HLPA 2XB2A 1RJ9B 2IVZA 3U4HA 3AC0A 1KAEA 1JFSA 2Z58A 1K63A 1N1DA 1BJKA 1RW4A 2FB9A 2IX9A 1WBDA 3WJ7A 3D02A 1GDDA 1ISRA 1M0WA 3EJ6A 2ODNA 4Y1RA 5EJ7A 1YJBA 1QC5A 2AD1A 3L7OA 4XEUA 4P4NA 5E1MA 4DDMA 1TIKA 4RCZA 5JR3A 1KVUA 1U2PA 4GOXA 1CB0A 1U2DA 4ZVMA 3JVIA 4PFJA 2E4AA 1U1EA 4NABA 5ALVA 1ID8A 1E89A 4LNUA 5GTDA 2GRAA 4I1RA 2FTKE 3D31A 1BMTA 2NTEA 4XD7A 4BP8A 5FUMA 1VL6A 2ZJ4A 3ZVRA 1QYCA 4JMLA 4F91B 5IKEA 3TG8A 1JP7A 3FZEA 3I73A 2HU5A 2IIBA 3P97A 3OA2A 3Q6MA 3DQPA 4ZVSA 4YDQA 1M0EA 2RHMA 3HVHA 1Q7GA 1GUZA 3TPZA 2Y1FA 4RMNA 4A0GA 4NOJA 1QP8A 2HHCA 3UJNA 4JQOA 4BWYA 1QKJA 4PGGA 1OLSB 3W2IA 1V9SA 1XEWY 2HK7A 5EKDA 3OM8A 3COWA 4P38A 5EFOA 5DYYA 5H83A 1TAQA 2BFOA 4OFZA 3VNBA 3WLQA 3WAKA 1GEEA 1R0KA 4OXXA 2WYUA 4I1IA 2I4MA 3IIEA 3KG2A 4LTDA 5ALLA 1ZUD1 4BO5A 4E14A 2YY6A 5AI8A 3FFTA 4DNXA 5IYZB 2DUWA 1KQOA 4PY2A 1T1IA 4BE9A 2PMWB 1LVGA 3R5SA 4PWYA 1HKHA 3NALA 4DKJA 2VO1A 1TYAE 1SH7A 3F4KA 1UM9B 4K9LA 3K5WA 3TLKA 3WBJA 2IGBA 4ZQGA 4PS1A 5IC4A 5F5NA 3O94A 1Y7LA 2DOKA 2WHXA 4KITB 2BH2A 1AC5A 1DG3A 4JZKA 1LX6A 4KBGA 3IQFA 3ICEA 3K71B 2NACA 3L7AA 3V5NA 5FA5A 3U3MA 2HJVA 3ADPA 1QO0D 4EKGA 4BCBA 2BHNA 2WKRA 3FCXA 3K0AA 2O1EA 2QRLA 4BRSA 2W11A 1NG9A 2VDWB 2DKOA 3CLHA 3GT7A 4INOA 3DWIA 2EBUA 4FINA 1UZUA 1ORVA 1XXHA 2OM2A 2FEPA 6LDHA 2IS1A 2G3YA 1GTJ1 1V4BA 2L42A 2OC9A 3C3EA 3GRZA 4QAJA 1EFHA 2PGDA 3TNYA 4YJGB 1H2FA 3AV3A 2AG8A 4FYPA 3WOHA 2LIVA 3ONVA 3CCBA 3SSOA 4LF5B 1EKXA 2I6TA 1SQ0A 2GKOA 1XMJA 4U0JA 2GN1A 1QJCA 4DR7B 1SU6A 1E1LA 4RCYA 1B8VA 4RVNA 1D6MA 2W6MA 5HQTA 3OZIA 4J0KA 4NARA 3DC2A 3R5TA 5HCIA 4ZGWA 1I6LA 2GOYA 2JIQA 2YYZA 3BWYA 4IGEA 2GN9A 2IEYA 1VLMA 3C41J 1XZDA 3CLSD 4TQUS 5IBPA 4MMZB 4DZTA 1NDUA 1RRVA 1TKRA 2DR3A 3SXUB 1DS6A 2ZBRA 3GEBA 5HR5A 2P9QA 4FEGA 1U0BB 3C3DA 3JQ9C 1JQBA 1I4TD 2AZXA 4H27A 4MAFA 3ZDZB 4RTKA 3EXAA 1E2EA 3G1TA 4LJYA 4R54A 1YHZA 3G3EA 4F5DA 1LGYA 621PA 3T5AA 4RXMA 1N36B 2BM0A 4BATA 4BLUA 4TQAA 1Z5WA 2OENG 5DOVA 4OP2A 5HPYB 2YMLA 3RQIA 4B6PA 2H1WA 2WSSD 2VN8A 1ZZGA 4QNRA 4CIAA 3OM0A 1X14A 1BXGA 4UPEA 1O6GA 2Q5OA 3WRYA 1RYBA 1Q7CA 3LAWA 1HM5A 3I6ZA 2QW1A 1NAHA 3ZY4A 4HSEA 1ZI8A 2AXNA 3NHLA 3ZIUA 3MM4A 4YBZA 9ABPA 1P0PA 2A78A 4IH1A 5TC4A 1Z34A 1ZXLA 4AJ9A 1XYYA 1QH1A 2J3LA 2JAUA 4MR8A 4XIYA 5JMWA 2IBTA 2YN0A 5TGTA 5KNBA 3C6KA 3ZL9A 2FR8A 3AF4A 1K9VF 5KMGB 3C6BA 3OE4A 3C7AA 5L4SA 1M83A 1DEXA 1ZUNA 3C48A 3P4XA 2ZGVA 4QOHA 1QS0A 3CZPA 1KYXA 2NZ8A 3WG9A 1UKVY 2WSSA 1FLNA 5CNIA 1IEVA 5IASA 5IJZA 5IP5A 1QVWA 3ENKA 1GNSA 3E81A 4ZREA 1WD7A 4WINA 5EVCA 1F3LA 2LD4A 3EX7C 1PYOA 5IBQA 2Q3EA 4EAAA 5EG5A 1NNI1 1YONA 2GYWA 2O3UA 4B3DA 4BZPA 3P1JA 2GBGA 5GPBA 5LKRA 3LQKA 4MW1A 3UANA 2HF9A 2ARKA 4LK3A 3WK8A 1ARZA 4EF5A 3I0MA 5ER6A 5AWFC 4NZZA 1AB6A 1JF8A 5C3UA 2AOWA 3NRBA 3EPKA 2F43A 2BCJQ 4F21A 4OY3A 5CA0F 5ADUS 2HHLA 1CIJA 2PSEA 3FE2A 4K6CA 5DBGA 3CNNA 4YXWD 5KB3A 3H9EO 1KVRA 1THMA 4B1FA 1TMKA 2ZAGA 1XLUA 3KYCB 3IDFA 2GEKA 2DP4E 3RK0A 4J9VA 4QUKA 4F9EA 1VHLA 1T2FA 3WYEA 5LQJA 5LQMA 3OPYB 3REOA 1D0IA 2A67A 1ES9A 3CX4A 3LA6A 3ORQA 4RVUA 3T0FA 1IATA 1GSOA 1YGYA 4FMBB 2IVFA 4E7OA 1AMNA 5EJ9A 3G2QA 4Q4AA 2NU8A 3AIMA 1ZCZA 3GGSA 1XU9A 2JNWA 1OVMA 1YBFA 3OAAD 4DW8A 1SWVA 1K3UB 4G2TA 3EASA 3NDPA 2FK8A 2PNJA 1FQKA 3F8WA 3NHPA 3TE7A 1N7JA 4LOLA 2ZTMA 1TD9A 4HNRA 3K8ZA 2A5LA 1OTYA 5K3FA 4ZCSA 1EGQA 3EZLA 3D7KA 1XX6A 4YXWA 6GPBA 3PEEA 1JLMA 1AKYA 1H05A 3L8EA 1MJFA 6ABPA 1WRBA 4WKNA 3B78A 5E2IA 1Y5RA 2QXTA 3S2SA 3WL6A 3T4XA 1AUXA 4JEIA 4O3MA 1H3EA 3UGQA 4GQBA 2V7VA 2ZZKA 1MHPA 1FVXA 1X19A 3A9CA 4S12A 5CM8B 5CT8A 4RYDA 4BP3A 3KRTA 1AKTA 3DR5A 4EJMA 5BMOA 2EGUA 3OH8A 1Q1BA 3FLAA 3HCOA 3CTPA 3LUAA 4FHGA 3VRHA 2QRVA 4B9EA 5HIJA 1G16A 3ERCA 1PJAA 2ADFA 1TVKA 3DW1X 5G0VA 1QYWA 3W06A 3D4LA 4MS4A 1AHPA 1ECJA 4Y67A 5GV8A 4DMCA 1YVUA 1QZZA 2UAGA 1O0SA 1NU8A 1V5EA 2QVCA 2VH5R 2WIGA 1KR5A 3BMCB 3GFFA 4NWIA 4D9EA 1HK7A 4U3JB 4RF3A 3WSVA 1VIMA 4ZYXA 5JY1A 5ED0A 5B3KA 5CBPA 2Q3CA 1D0VA 2WUEA 4GLOA 1AQNA 5DP2A 1T9GS 1J9GA 1DZIA 1GGEA 1NI5A 1P1KA 1PUJA 2B94A 2R4QA 3HSKA 3I9JA 1CUAA 4GVXA 5FPHA 5JJLA 1XK6A 1FXUA 5COBA 3K6SA 4ALIA 1A04A 2Q3HA 3OZWA 4EUKA 1AO3A 3OZSA 4CNQA 1N2EA 2JEOA 2XI4A 2WRZA 3MPUA 4GT1A 4PBRA 5BNFA 1NMSA 1ZIDA 4I8IA 2A88A 1X1RA 1EA5A 1XRSB 4HRXA 4G8DA 2ZRFA 2XV1A 3MMZA 1KMIY 3QLEA 4FDMA 4J16A 1NWCA 2F4NA 5BYBA 4QELA 1I3NA 5AKYA 1TM3E 2VP6A 2YJZA 3GFPA 3WA7A 5IZ4A 2IF2A 3I32A 4FP9A 1JV2B 3BH0A 5HGJA 4DV7B 2G6TA 4JELA 3T41A 1KY2A 3NM5A 1ZLYA 2WPNA 4J94A 1Q7EA 4HK4A 4M9RA 4QBFA 1HR0B 3FRHA 3MCUA 3BREA 1M8PA 4BFSA 2MDTA 2WKPA 1NBOA 2C9YA 1VXOA 3OEED 5EJMA 3C3BA 3I1YA 1N2BA 4BQOA 3JSXA 5DKFA 3AY7A 1RWKA 2XUDA 2XADA 1OGYA 4QFMA 4YMWA 4ZOCA 4ZDWA 4B81A 2DR0A 1Z0AA 3BJMA 3BTUA 3VTKA 3PV0A 1SK8A 3N2IA 2YW9A 2VSFA 3B48A 4BX0A 5CB8A 5FH9A 1P2DA 2W5UA 2OZEA 2IYEA 4P0TA 3GH1A 4PZLA 3RD5A 3UWSA 2X9GA 3SYNA 4DQUA 3TFQA 3HCFA 2HF2A 3H9CA 2O0KA 1CZHA 2NLOA 1ISSA 1Y81A 1FU4A 3O3CA 5KTPA 4I4TF 3BYZA 2B98A 1TK9A 2PZEA 4MP3A 2BJVA 3PCRB 1MAHA 3INTA 4Q7JB 4WVFA 1OUMA 1QHIA 4Q4JA 4V0SA 4B3XA 4JJAA 1NX9A 3AKDA 3T7KA 3V7YA 3V9PA 2OYCA 1TQDA 3X1ZA 4Q3DA 1M54A 2X4IA 1ZKDA 1GUDA 2PKWA 3CYFA 2QAGA 3KPVA 4UBOA 4Y1FA 5HDQA 4RF5A 5K3SA 4CDMA 5K6TA 1E9BA 3FHLA 2ZIXA 4R8SA 2P9JA 4AZSA 4CTJA 5E38A 1V4NA 3L7CA 2C78A 4AY5A 2P8JA 1YA6A 1XIVA 4BTLA 4PIMA 1HL3A 1A76A 3EC2A 4KX3A 4EMSA 2HDOA 4YRIA 5DYTA 3K1JA 4L15A 3AHIA 1O89A 1ZN2A 1V96A 1UBUS 3SC2A 5KQMA 3JR7A 1RC8A 1PZNA 4I9UA 5KU7A 3H16A 5D3ZA 2UZ4A 3SZMA 2F8SA 4JJIA 2EX4A 5L9AA 4UFOA 3ZJTA 2VJDA 4LBYA 1C81A 2PL9A 3O8QA 1E8DA 3DDZX 4NDNE 3GJ8A 5EXPA 1KTVA 3T94A 1R6VA 5CCDA 1KIAA 1JI3A 1LBEA 5AQEA 2JRCA 4UUQA 4DLWA 4XJSA 2VTVA 1NTOA 4P35A 3FF1A 4TYPA 4WDQA 2CDNA 2AG1A 4IEIA 4PX5A 4R2JA 3NIWA 4EG4A 3UENA 4WKBA 1GZ7A 1YR6A 2O2GA 4RMGA 2R7KA 4B82A 2Q45A 3SLRA 4U39A 3T5GA 1ISFA 1IJBA 1EFUA 3CPJB 3IMKA 2XRFA 3F9CA 1VYHA 2R60A 1NL3A 3LO5A 4DMHA 4Q05A 2XQFA 2Q1WA 3OMWA 4C7OA 1WB4A 2CK3D 4EGJA 3GLIA 1GQFA 4URFA 3ZZ1A 3TYXA 1RJFA 3BB3A 3I9NA 1L5HA 3AESB 1WXDA 4U2EA 4YJ2B 1JR3E 3L6OO 3GLQA 4IHJA 5DK4A 2NYVA 3UCEA 5C5EA 1FLAA 1E64A 5CIWA 1E3SA 4HH0A 4KR9A 1BCSB 2JS7A 1A27A 5L3SB 3CLTD 1IL0A 3JPYA 4I19A 2IZ6A 2JGJA 1ZVJA 4A16A 1I3CA 1MORA 1LC3A 3D2LA 3Q87B 4J0HA 4EY3A 3PE4A 1WPQA 2G8LA 1NUSA 4ZAFA 1DWUA 1SXPA 4TYNA 2HSWA 4FHFA 1UPBA 2C07A 3LUGA 5CHYA 1FE8A 1JR4A 2XCQA 3CXRA 3NUZA 4HPWA 1TE2A 2PH3A 3IP1A 5F51A 4F8JA 3Q0EA 4PAMA 4W5RA 2CK3A 1G5HA 3MTEA 3HBAA 2Z43A 4ZTBA 1Q0QA 3TLGA 3UMVA 4IMRA 4LXGA 1K98A 3U13A 3D7MA 5FF9A 1KETA 1BW9B 2MR6A 521PA 3C4QA 5EJEA 2HQOA 4ZDIA 3PHCA 5TVKA 1XDBA 1YZHA 2C96A 2WU1A 2G09A 4ZJPA 5LP6F 1SUSA 2EBFX 2WT8A 1OZGA 3DVRX 4DWWA 5BN4B 2Y1DA 1Z08A 4C0QC 1K2VN 5HVNA 2DQZA 3LD9A 1P1CA 4KAFA 2QUJA 3II6X 4HN2A 2AFHA 2ZSJA 1YQTA 2QM7A 3FCUB 1DJLA 3JD1A 4S1OA 5LMUB 3THYB 1I8TA 1YQEA 4IIYA 1KOLA 4C08A 3VH1A 2IEBA 3NATA 3RH0A 4JYMA 5F35A 4C7JA 2QX6A 3DHVA 5H82A 4OHYA 3GXBA 1XL1A 3KZXA 4KQJA 4DQVA 2W6PA 1RRCA 2VJLA 4X6UA 4Y2XA 4MKFA 3ODPA 1KI2A 2IYXA 2JFNA 2GR9A 3OU2A 3D6JA 4HXEB 1T3GA 4PC1A 5TEVA 2ZI6A 4CEIB 2OFPA 1SIWA 2CBGA 2J9FA 2BLNA 2DCMA 2HDWA 2B36A 3I8XA 4K2HA 1CF4A 5LWHA 2QN6A 3EW7A 4RFVA 3S1LA 5JNLA 1QWSA 2JCXA 1QLJA 3NIFB 4MVJI 4EY4A 1M34A 1YQGA 1ZQ9A 4XUGB 1I4LD 3FGZA 2DT5A 3BFJA 1TYEB 3HC7A 5BSRA 1LK7A 2HO5A 4ZT4A 3LM8A 5K1ZA 1OX5A 3IIMA 3LKVA 4LXHA 1L6IA 4MKXA 5IG2A 2GZDA 4EGQA 1SCUA 5AJUA 1XZNA 2ZUDA 2JAXA 2I66A 3A6HA 3MTGA 3PUHA 5IXJA 4LQLA 3EQ2A 4EG6A 1UMKA 2GAJA 3DAYA 4ARCA 1C41A 4FW8A 5HIAA 1J21A 1WHTB 3QPUA 4EO4A 3HBJA 1QRTA 3TZEA 1FFXB 4B8ZA 5JJKA 2B1RA 3ZXUB 4UNSA 1QOPB 1KI6B 2NSLA 3ZU4A 4YPVA 2WD9A 2C8JA 3EQZA 1ZKMA 3LNTA 1ECGA 4ITUA 3TEMA 3ED5A 5IS2A 5EQDA 2G28A 4P7FA 2HJWA 4KV9A 5B5SA 2CLFB 3JY6A 2WZDA 1DJMA 1IZYA 1OTHA 2PUAA 4CLHA 2FZEA 5DOZA 2IPOA 4GEGA 1XXLA 3ZJ5A 2AX3A 2GO7A 2PMKA 3EA5A 1EQAA 2JLQA 3CW9A 3G1WA 1SBYA 4FJ1A 2WV7A 3T3MB 1B6RA 3NANA 2C9OA 1IPHA 5CX4A 4TVSA 1X8LA 3G82C 3CEPB 1QKIA 4P84A 3VR5H 4B3JA 4DV1B 5H02A 1E4OA 2ID7A 4PPYA 3LT0A 1SA0B 2CXRA 2ZJBA 4YFYA 3S2IA 4F04A 4BO8A 5H81A 2OXTA 1PJ2A 4REOA 2JVKA 5E8RA 2HSJA 1YIDA 4J07A 2GYVA 4FOSA 2FSGA 4LPKA 4KR2A 1K2WA 2PM8A 2J67A 3WXBA 5JSYA 1N2XA 2CD9A 3KXLA 4AJNA 2R6ZA 1HQYE 1N2IA 1SOAA 5TV2A 4KPYA 4GLJA 3QXSA 2IC5A 2YHSA 2Q49A 4MDEA 1N6IA 4BB6A 5ALNA 5AHRA 4CI9A 5C53B 3QQ5A 3KU1A 1C9YA 1GA4A 2NSYA 2ZI4A 2C61A 3B2EA 3HEMA 4HDNB 4V03A 3L8YA 5AK4A 1MEEA 1KH3A 1V5WA 2C2ZA 3FKSD 4BYGA 4PW0A 4XGKA 4JX8A 1H4TA 1QKKA 1WAMA 2DVMA 2QT9A 1NVDA 2F1OA 2JCSA 1RXYA 1A4UA 3IXMA 5DLEA 5CGQB 2K7FA 3OEWA 2I4TA 1BX3A 2WKSA 5AK3A 1FMLA 3LWBA 2R7NA 3ND7A 4RQAA 3H1TA 2XR1A 3RVPA 1CR0A 3IOBA 4FFNA 1AGNA 1UEXC 4GQIA 3WLIA 1BKDR 1CD5A 4HTFB 4Y2YA 4QPNA 2I3DA 2I22A 3KLMX 3FHOA 3WYFA 5LC1A 3JWGA 1GRRA 5K4HA 3WBKA 2FUG6 2ILTA 2IUFA 1IEXA 4U5XA 3T7SA 5BW6B 1ZL2A 2WHPB 4A03A 3TMAA 2V8OA 2VRCD 4YCJA 4ZVPA 2P4EA 4C22A 3FKSA 1MB2A 1GPBA 1FP4B 4OFWA 1NASA 3IQZA 3O2JA 4S2UA 3UK7A 4N3BA 1A9PA 3COPA 2Z1NA 2ZUBA 3UIEA 3BQNB 4GDMA 2XUHA 2F9LA 2OBBA 1IIBA 2ERXA 1PE0A 2VK2A 3D4PA 4G8BA 3GIWA 1H2AS 4HVTA 4GMHA 2JJ1D 4WK6A 4ZOQI 3DCNA 3D3KA 3P9CA 2FW7A 2NV0A 4L8GA 4TTTS 3V6MA 3UKDA 5FUBA 3K0EA 1E4VA 3Q6IA 4PM4A 5I7VA 1ODFA 1HI9A 4GUAA 3AZQA 1OXTA 4U6NA 2GHQA 5AHWA 3E7XA 2VNHA 2IU3A 1BE6A 1VE5A 1ZK2A 5K8VA 2VIIA 1E1QD 4UM9B 2VRCA 1XQ6A 4HFJA 5I9IA 3WLHA 4RWZA 4OMDA 4WXRA 3VO9A 3GP8A 1M2VA 2ZAIA 2GCPA 1SUAA 3KYIB 4NJEB 1W36D 2OMKA 3L4JA 4MYUA 4PF1A 1TQ2A 2JFYA 1QH0A 2CV1A 4U9HS 2JIRA 1RHRA 3M33A 1WPRA 1D6SA 1IRXA 4LJ5A 3WYCA 2C9BA 1YZNA 2GD6A 2JJ1A 3F71A 4RADA 1OI2A 4QDTA 4WKGA 5E3JA 1FRQA 1N3IA 2IHKA 2YFHA 2WYHA 1QRAA 1ZJYA 3QG5A 3H19A 5TT1A 1KI1A 2VRNA 4KAJA 1GL7A 3K1AB 1UDAA 1NJ8A 2QLLA 5E6UA 4XWWA 1E1QA 2BEUB 4OGFA 4MRSA 2X2PA 4AZ3A 4HH3C 3MS7A 3UUGA 2Y68A 4K6FA 5CNMA 3WGKA 1DJNA 1YI1A 2Z3VA 4N40A 1SCDA 2ZYIA 5AVXA 3GA5A 4KJZA 1U0NA 1KEUA 1P61B 2AJTA 4M7PA 4PRYA 3QWHA 5FOTA 1CCWA 5E2AA 4LWPA 4ER6A 1EZZA 2FOLA 2EZ8A 1CY1A 2OM6A 1ZMRA 3FPBA 4EG0A 6ADHA 3R8FA 2V4MA 1P17A 2J46A 4E88A 3IP3A 5A9RA 1NVEA 4LWQA 1C7FA 1YL7A 3M9LA 1P1RA 3OQMA 1P2FA 2EATA 2VR1A 4E0BA 1SBQA 3HCAA 3CRRA 5I7EA 1UIMA 5DYNA 4EI7A 4P81A 4KLCA 1P18A 3O8CA 2DC1A 3HHPA 4HH4A 5IKOA 4DWJA 4ZJZA 4AXXA 1V9LA 4II3A 2A9VA 2WTNA 3GD7A 4LK2A 5B6IA 3K4QA 1EK0A 3C3CA 4HZIA 4KMRA 1EB9A 4FFRA 3WGTA 1VL5A 1I0IA 3OWOA 1LPNA 1G5RA 4NFHA 5CHEA 4R0VA 2ADOA 1KJYA 3R5FA 4OK5A 4UVDA 1XWIA 4EL5A 4F4IA 2R79A 5DJ5A 4LDJA 3IR6A 3OM9A 5LIPA 2XQKA 1IIRA 4Y2PA 2ANCA 5ERGB 2K4MA 5CB4B 1ISGA 4RL6A 3TD6A 4EDHA 3HUUA 4DG5A 4W4TA 1GFZA 1Y4AE 1JN0A 4YCDA 4ZOAA 3RBVA 2EX1A 2WJAA 3GVIA 1F0YA 4FLEA 1Y9DA 3R20A 4U7JA 4KPFC 1K7FB 1RRFA 2XDWA 4HO1X 3ZZUA 3QU9A 3C43A 1ONNA 1DVRA 5JXIA 3PVZA 4B4DA 2Q1XA 3I01A 3JQQA 4EUEA 3LHIA 2I76A 2VQDA 1X7WB 3JASB 1WB5A 4NBUA 2A7QA 2R8RA 2QX9A 3GLFA 4I6JA 1IUPA 4W6ZA 1DKOA 5GONF 2PFSA 2JKYA 4MGEA 1V5GA 3EUWA 4N5MA 4Q1DA 4DUZB 4Z4HA 4A5SA 2QLBA 3SDBA 1MXFA 1JZQA 1I7QB 1GPNA 1MO6A 4ZARA 2XGMA 1IZ7A 3U7RA 4AUKA 2O8DA 5FWYA 1ZN8A 4JSRA 5K09A 3VSBA 2BVNA 2IHYA 5J5AA 3R6TA 1ZUIA 2CGEA 2H2IA 3CR8A 2C7QA 3OIUA 1IHDA 1XZIA 3D8BA 2Z5FA 4A15A 1RRPA 4E31A 5C8XA 1KSJA 1KI8A 1QV7A 1GYRA 1SD1A 2XCUA 3K53A 4UNIA 4M46A 4RORA 4XGIA 3ZKWA 1LK0A 2A86A 1NQXA 2P6UA 1CQIA 1XTPA 4I3FA 3ACDA 3V3TA 4YAUA 3SHVA 5ELXA 4MGKR 4CEJB 1DAPA 3Q3JB 2Q4TA 3A4VA 1ZW6A 4M36A 4OSPA 3O9ZA 2AGVA 3Q0TA 3RU7A 4JBYA 1NN3A 1A4RA 1VBMA 1JBEA 4B4UA 5T8KA 1JDBC 5KQLA 3DEAA 2O5CA 3FPLA 3K9LA 2IZOA 5I6DA 1OI7A 1GSAA 1AJEA 2OAGA 3A36A 3EZNA 2ISCA 1KJQA 3GXOA 3CVWA 1FRZA 2C83A 3DTYA 1PF7E 3U44A 1Y7HA 2D0DA 3LUPA 3MTQA 4CHTA 5KDOA 1TA0A 1AMUA 1DRVA 3U56A 4WLNA 5FJIA 3CN7A 2YMMA 4CMHA 3ZQUA 3GLHA 1RBQA 2ONYA 2P4SA 3EEIA 3WA6A 4X00A 3ZHSA 4JJ4A 5DYIA 2ZVJA 1NF2A 3CG0A 3LX6A 4ALKA 4TXHA 3EVZA 1P2GA 4PINA 1MTOA 3G0GA 1NRXA 3TRFA 4DPKA 1L8XA 1Z0KA 4PPNA 1UBLS 3P9XA 2Z30A 1LDYA 4PRZA 5HIIA 1DBWA 2ZB7A 3VM6A 5HGXA 2XGOA 2JB9A 4Q66C 4B5KA 1E3IA 1KKMA 1NF9A 4HH1A 3DYIA 3BRCA 1N9GB 3RSOA 1GTVA 5IJXA 2ZZMA 3KV3O 2GEDA 3L3BA 4MUHA 3JYNA 4IFEA 1SXJB 5T5QA 3OUUA 3R3HA 3NTLA 3T0IA 1W5FA 3ER8A 1GZ3A 2YYYA 4WWHA 1GJRA 2GSDA 4ZXFA 3PFHA 3EWSA 4M54A 1S3FA 2YH2A 5M04A 1XWWA 4FCCA 4LBZA 4RJTA 5F21A 5F9MA 2R9VA 3K0FA 1MC1A 3NYIA 1U9IA 3ITEA 1OX4B 3K09A 5T4FA 3ZE9A 3STHA 2C4NA 2CFSA 1QPGA 5BUSA 5M7EA 5CT6A 4DMGA 1ZR2A 5JYEA 5DHRA 1NYTA 4OI2A 3ZXYA 4CTOA 1AURA 3ZY3A 4LDNA 1EVLA 4PICA 3UMCA 1J0XO 2OHVA 2ZJ2A 1QGOA 2PGXA 3ESAA 3LPMA 1U2QA 3R3YA 3ROMA 1BROA 1UC4B 1VSBA 1AQYA 2BFAA 4OP1A 4YUAA 2FEMA 3V4FA 2O6LA 3AEXA 4QOFA 1WSAA 1U7ZA 3TLJA 3WLPA 5BXQC 2JGAA 2HU7A 2ZSDA 4HBGA 4TV9B 1KZ6A 2HJ9A 1NN5A 4P5EA 4UAUA 3RC9A 3UWOA 4X65B 4N48A 2YXBA 4HAYA 3TW6A 1HFKA 3BAFA 1AG9A 1M0TA 2QUBA 2XVYA 2W6JA 3QMMA 4G81A 3EWNA 1NURA 2GCGA 3FYHA 5JSKA 3ZWVA 5KNCH 3JZAA 4AO8A 2ON6A 4DCGA 5AMXA 4UCWA 4MDYA 5D5HA 2FA9A 4HNAA 2X6RA 1E7RA 2FH5B 1TM4E 4BKPA 3CCCA 2G5TA 3OZTA 2I78A 3M1YA 1LV7A 4BJ6A 2ZWAA 3L8MA 3D6NB 1LB1B 3QIVA 1X7HA 4DHWA 3Q9SA 4ER0A 3V00A 5D00A 1DO0A 1TDJA 1IVSA 5IULC 2QRUA 3GF4A 5EP2A 2BTOA 2FZLA 5A62A 1BS1A 5EKXA 4B43A 1PYGA 2FSUA 1V43A 3EXHB 2B4RO 4C9BA 5BN3A 4YIKA 3WWOA 1TK3A 4OQNA 4DY6A 1GG5A 1U81A 4YLGA 2OCGA 4WLUA 4KQKA 3W7VA 4B76A 3P94A 3BN3A 4RL4A 1Q57A 2AMVA 2IBMA 3CIFA 5DPMA 3OKAA 1GPMA 3ETCA 2V0CA 3FOWA 1PNOA 1DX4A 2VTKA 1M6YA 1QTIA 1A8QA 5F1OA 2GDJA 3SCZA 1SC3A 4YNBA 2JLWA 2P69A 1TTHA 1P7PA 1TKBA 2O3RA 2X8JA 2XGGA 3LUHA 1DOZA 4OXYA 1S2GA 4C43A 2CJFA 5DXAA 4X1OA 5LBTA 3GI1A 5HOQA 3EQ9A 2IV2X 5F1PA 2IODA 4K6OA 2PS1A 2CNNA 1LRJA 2HRRA 5FWAA 4UNPA 5KEIA 3JVUA 3PEWA 4MR7A 2OWEA 3PDJA 4AZTA 3NIDB 5L6LB 3GIDA 2WD7B 5ESWA 2X0DA 1JQ5A 3IHLA 1FFYA 4CT5A 1HEIA 2WQZA 2VXYA 4TT3D 3GELA 2EYQA 1TAGA 3HUTA 2G5CA 4RE6A 3BCRA 5AM0A 4DV3B 2B61A 1U02A 1G8PA 3MEQA 3OWXA 3W2TA 1HT0A 4IOLA 1K0UA 4I5DA 5CDFE 2PKXA 1IC6A 1RC0A 3MLBA 4KC0A 2BGJA 3A14A 1CQZA 1T91A 1SUDA 3IPAA 4FGWA 4TZ0A 4GZ3A 3M9WA 3B85A 1AZSC 2CHGA 4C04A 2ACKA 2QHXA 2XMQA 4OM7A 5AOCA 3AVWA 2X14A 4N65A 4MUIA 4XFDA 5PGMA 3AOGA 3I9V6 1ZK1A 2PXAA 3EGVA 3PC7A 4IJKA 4BMCA 2QTCA 3M5DA 1G1AA 2ST1A 3LSTA 3NC4A 4LV5B 3DM5A 1NM5A 4MQUA 2X76A 3ANNA 4YUXA 2CZGA 3B12A 1DRUA 2AN5A 4J0QA 4YO7A 3LHSA 3DAOA 3RTBA 3TTTA 3G9TA 5CK5A 2QBYB 4OM8A 5H7XA 4YPFA 1PG0A 3SVTA 3RQSA 3F6BX 3EZGA 1G9SA 2WFLA 3HZZA 1X2BA 1X94A 2OCPA 2ZRJA 3K15A 5AHXA 1E0SA 5G0UA 1EA7A 5JG7A 1W7AA 5IDWA 3ANXA 1IEWA 4KQ6A 3H5TA 2QY6A 4M7RA 3O8DA 2X19A 1G55A 4CM9A 1XU4A 3ETDA 3TQQA 9MHTA 3AUXA 1G2OA 5EMHA 1F2UB 1M1NA 1SBNE 2OP0A 3A1WA 4X64B 4ARBA 2BEWA 3I28A 3KWMA 1CLUA 1U28C 3KHUA 1SBIA 4LJLA 2ZVQX 3R1IA 3C8UA 1ORDA 1DUIA 4ZI7B 1NNLA 4TTPA 1ZGBA 5EMLA 1RPJA 4QWWA 3HKCA 5LOVA 1YNOA 4I5GA 1I2BA 5DGDA 3GT0A 2YHIA 3ML1A 4Q1FA 4U7FA 2L0XA 4UVHA 3AW9A 5HZGA 1K88A 1EE9A 1QQTA 4DXDA 5KDDA 2FPOA 1T1GA 5IT5A 1DX6A 1T8UA 2VRBA 2JBHA 1BC5A 4KE9A 4AY3A 4M8SA 4RGVA 1Q19A 3TLYA 4C14A 1F0PA 1GTL1 1U8AA 1GTG1 1X2EA 2G4LA 3FGOA 1UBOS 4JUBA 4QQFA 1TIBA 3ID6C 5D3KA 1R27A 1SQGA 3I01M 3OU6A 3RC3A 1VZ3A 4Q4CA 1T0BA 3GT4A 4EB6A 1V2HE 3UGTA 4L5AA 3A2KA 4WFKA 3LCVB 2PWAA 3F5QA 4TPKA 3KU4A 1T1SA 3OMLA 4DB4A 4MQBA 4Q47A 1RACA 4WESA 1ID1A 3WO1A 2CE7A 1PLKA 3HUDA 2E4XA 1AUPA 1C4WA 1PR6A 1XF9A 3EQ7A 3M3DA 3IAM6 2CUNA 1OFVA 3PP8A 4Y3UA 5KNLA 1CEEA 4IY1A 3TZ6A 3K9FC 2AMFA 1K08A 1I4EB 2CLLB 3E8XA 2I4IA 4QDJA 3DEHA 4UREA 1O0CA 3IUNA 4ZZ3A 2AI3A 4GX5A 4BVLA 1T8TA 4CR8A 4HVAA 1RLIA 4DBZA 1HV8A 2E7ZA 1C7QA 5JATA 4B85A 3RVJA 2XUGA 2QTVB 5UKDA 4UOZA 3N2NA 3Q8XB 1YE3A 1W25A 1UMDB 3EZ7A 5AJHA 4BDSA 1AN0A 5JOQA 3DFFA 4CLXA 3FWPA 1MB9A 3KAQA 3WGHA 5CVEA 3DBIA 4OQQA 5G1PA 3DBLA 2YWGA 3DLAA 1Y3DE 2P67A 4AUNA 4D9FA 3K2IA 2ODPA 3A9RA 3DLBA 1DAHA 2FVYA 2M2IA 4JI3B 3CO0S 1YFLA 3WICA 3MCAA 4JJ8A 1D2GA 4F4JA 2RK4A 2WINI 1H4QA 1WG8A 1BQ3A 5ILQA 2IV7A 2D1RA 5M5BA 1IUKA 4OAQA 2XUPA 3IAS6 4QATA 1JKXA 3FR7A 4HDKA 2P41A 3DE5X 1VLHA 4V1CA 4MQEB 3HB7A 4X8LA 1WEKA 2BFEA 4XD2A 4BQPA 3CUUA 2XQVA 3KYJB 5EKTA 1LFAA 1KMMA 3JQAD 5LQUA 4HY3A 1EHCA 3PIIA 4QU5A 1QTQA 4O1IA 1ULBA 1TJ5A 3IP6A 4BDTA 1JDNA 5FL7A 4F1KA 1SUIA 1G2PA 3EJWA 2N3ZA 4RF4A 2J6IA 2ZQZA 1SCJA 1CRWG 1X7ZB 2R2GA 5KQPA 3RKUA 1SG6A 4BNFA 4J43A 5CA1B 2W22A 1XZQA 1Z2NX 2LDBA 3L92A 4J0FA 1Y1LA 1E62A 4FOLA 4ARZB 4BLSA 1GL9B 4XFKA 2JLRA 2ONCA 5FWXA 1PTJA 2XUQA 1LS6A 1D6JA 1GILA 2CFIA 4G0OA 4EO7A 5LUAA 5IKXA 4BBJA 1Y48E 5IVKA 5F33A 3VAAA 4EHLA 1Q16A 4JQYA 3PNMA 1W0JD 4IHAA 5KHAA 3JQAA 3EDCA 5ESRA 1VE9A 4RZQA 1PFWA 5JAMA 5E6SA 4PG4A 3GUUA 2QNBA 2ZBVA 3TPFA 3UW3A 2PUEA 3P9SA 1NPTO 2QL9A 4C7XA 3S2ZA 5ULLA 5EHZA 3A11A 5JPCA 2CNKA 2VJPA 1XD9A 3AEKB 3K6KA 1QLHA 3N70A 4JBIA 1C2TA 1TCAA 2H0QA 3ETGA 2JJQA 4RA6A 3U7QB 2OZLB 3AY0A 2AQ8A 3H7AA 1IRIA 4JVOA 4MUXA 2B83A 3C1AA 4PCLA 1QGUA 2BDUA 4W8OA 4CG2A 3U4QA 4G07A 2YCBA 2SHKA 3PRYA 4JENA 4XWAA 3ZPXA 5B30A 4PN3A 3DB2A 3W9SA 3QNUA 5BNZA 2HJSA 1XCJA 3IJEB 1RU3A 3AU8A 1W0JA 2EFYA 4FZ5A 1WHSA 2GKGA 1GZDA 2GZSA 3MRVA 3DBOB 4QHTA 1JBKA 1G21E 2YFKA 1J0BA 1F38A 2QQFA 4YQYA 1B4DA 1P0MA 1UBMS 3PQ7A 2R8BA 1E1NA 3E9YA 4GFDA 1P1FA 2BP7A 2DTEA 3C3WA 2Q6VA 4P54A 5EXXA 4P31A 4BX9A 2XJ9A 2JFVA 2BFDB 3I2FA 1KS2A 3F3SA 4LHXA 1AX9A 4HX2A 4KR7A 1BFUA 4DMLA 3K6JA 2Y9MB 5BXYA 1P39A 3L0IB 2DWUA 5DCWA 2GERA 3VBEA 4ENSA 3GB9A 4G9EA 3IAAA 4EMUA 4O25A 3CUSA 3ZNOA 1KR2A 3W5CA 2VA8A 4H60A 2F48A 3IMFA 4RC9A 5EGNA 1DARA 1HBJA 4ZDJA 5B4UA 2GSWA 3P26A 4O59O 1FPQA 4HLNA 3IEIA 4M0MA 4TKZA 2QR3A 2BZGA 1VL8A 1Y1RA 2BKUA 1U9JA 1NW5A 3D6FA 1WXIA 3GDWA 4OHKA 4UMDA 4EGSA 5I9NA 5IN4A 4K8RB 1MABA 1GPYA 1WDLA 3ME5A 4QNNA 3HVJA 4IDCA 2WWFA 2P65A 3MJCA 2PNFA 4O2BB 3RJZA 3C24A 4EUNA 5EWMB 5JJBA 4A36A 1R0XA 4TYQA 1IBLB 1JT9A 2J0VA 3FTNA 4L4UA 2Q5QA 5CFQA 1IQRA 1ZBQA 1ZVVA 1EE2A 5EJ5A