2JL1A

Structural insight into bioremediation of triphenylmethane dyes by citrobacter sp. triphenylmethane reductase
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
287
structure length
287
Chain Sequence
b'FSIAVTGATGQLGGLVIQHLLKKVPASQIIAIVRNVEKASTLADQGVEVRHGDYNQPESLQKAFAGVSKLLFISGPHYDNTLLIVQHANVVKAARDAGVKHIAYTGYAFAEESIIPLAHVHLATEYAIRTTNIPYTFLRNALYTDFFVNEGLRASTESGAIVTNAGSGIVNSVTRNELALAAATVLTEEGHENKTYNLVSNQPWTFDELAQILSEVSGKKVVHQPVSFEEEKNFLVNAGVPEPFTEITAAIYDAISKGEASKTSDDLQKLIGSLTPLKETVKQALKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRIPHENYLMETHANE REDUCTASE
publication title Structural Insight Into Bioremediation of Triphenylmethane Dyes by Citrobacter Sp. Triphenylmethane Reductase
pubmed doi rcsb
source organism Citrobacter sp. my-5
molecule tags Oxidoreductase
total genus 110
structure length 287
sequence length 287
ec nomenclature
pdb deposition date 2008-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2jl1A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2jl1A02
3RROA 4OM8A 1IZ0A 2AG8A 2JCYA 3DZHA 3MJ4A 5TNXA 3WFJA 4GGOA 1LQUA 1QYCA 2DQ4A 2HMWA 3H4VA 4R3NA 1ML3A 4J2HA 1NQAO 1VL0A 1ZH8A 2PV7A 4WEOA 1R4NA 1EVZA 1YWGO 1T1SA 2JKVA 4L8VA 4CLOB 4XIJA 3PLRA 1T2DA 1E1MA 1X14A 4K26A 4XDZA 4MKZA 4E2WA 4RLHA 5C3MA 3ZI0A 4E33A 1BG6A 1CETA 4J3FA 2OMEA 1DLJA 4R41A 3RUDA 8ADHA 3DFZA 3S2GA 4DPMA 3FCOA 2VYVD 1X7GA 2DUWA 4GX2A 3GRPA 3JQ8B 4J4BA 4XJSA 1P1JA 3VDRA 4NBRA 3SC6A 3RD5A 3LLSA 4YRAA 1H5QA 2C7GA 3OFSA 5JDCC 1FXSA 3BMOB 4L4XA 1YOVB 2FMUA 2EXXA 3GNSA 4CMIA 1OFGA 4CM1A 4K28A 2BGKA 3GHHA 3QVWA 4JQCA 4RZIA 3L07A 4CL3A 2O23A 3AOEA 3AM5A 1F12A 3L0DA 3G79A 2YFQA 1E7YA 1H6CA 4EUFA 3OJLA 2EHDA 1XA0A 3WQRA 1BVUA 2YHIA 1R0LA 3JYQA 3T7CA 4CQLA 3KSDO 1KERA 3MOIA 2F1KA 3PJEA 4OXNA 3VKVA 1NWCA 1Z7BA 1E3WA 3DZIA 3PDJA 2Y0EA 4RVSA 3AFNA 1CYDA 4RO0A 1YB4A 4TWRA 2JFFA 1W0CA 4TKMA 5JLAA 5CEJA 4M89A 4FSHA 3LSYA 4HUJA 1M67A 3WYEA 3C7CB 4NK5A 4BMNA 4Z9YA 5A1TA 1HSOA 3ZU4A 1S7CA 5JMWA 4MJLA 1T26A 5DCYA 3VZSA 4B8WA 4GSKA 4PLGA 4XQEA 5F1KA 2DBQA 1T4DA 2YFHA 3BZUA 4NQZA 4UVDA 1VSVA 4FDAA 4RVDA 4Z6KA 1Q7CA 2J3IA 3CXRA 2BGMA 4YYZA 1G0NA 1NPTO 4DLAA 1SNYA 4PCVA 5DBGA 3GK3A 2GNAA 3PK0A 2HU2A 5C7LO 5IZCC 1R4MA 4GKBA 2Y68A 3S55A 5KJFA 2YDYA 5IN5A 1P1IA 1Y5RA 3VH2A 3HDYA 3WGTA 1QYWA 3TZ6A 3ZU5A 2UVDA 2VHYA 3LC7O 3PTZA 1GCUA 2GZ1A 3OHSX 4OIMA 1BMDA 4U7WA 1Z82A 1GD1O 3AY3A 3GG2A 3OF2A 2PD3A 4MVJD 4XDYA 3JQGA 1U4SA 3E6AA 5G0VA 5I7FA 2SCUA 2YJZA 4BKOA 3JD2A 4FFNA 4O6VA 4ALIA 2QHXA 4MINA 4RDHA 3BA1A 3DMYA 3PJGA 1GZ6A 1OAAA 2PLAA 3GZNB 1PQPA 4GWGA 1JTVA 4CM4A 4J1QA 4OL9A 4BHTA 3I9JA 2GYYA 3G0OA 3OJFA 1EBFA 1ENYA 2A92A 4BV9A 5JO9A 1YQDA 1LDBA 4IDCA 2V6FA 2IYPA 2BKAA 1M76A 1A7AA 1M66A 1ZUD1 3NTRA 3ONEA 3ZW8A 4D45A 3ULKA 4TZKA 3VVCA 3W4IA 2POQX 3EC7A 4FC6A 4NU6A 4BUCA 4BNIA 1R0SA 2ZB4A 4NHEA 4IPTA 3GPDG 5JC8A 1NM5A 2J5KA 3QWAA 2VZ8A 4IDBA 3NAQA 2DVMA 1LLCA 3Q9UA 1I2ZA 3E5RA 4EUEA 1PX0A 1QR6A 4S1VA 5AXBA 4AJPA 1BSVA 5CEFA 3DMTC 3QVXA 1BHSA 5JNLA 2W8ZA 4DMLA 1A9YA 1GU7A 3OP4A 2AW5A 1KVSA 2YQ4A 1WXDA 1A4UA 1KVRA 4YAGA 1YBAA 5G4LA 3PHGA 1U3WA 1PJQA 3BMQB 2FPGA 3BTVA 5AQ1A 1X7DA 3RUCA 1XCBA 3OJEA 2EP7A 3T4EA 2DBVO 3K2EA 5I8WA 5K6AC 5IXSA 2Q1WA 3QVSA 2GPTA 3GF4A 3RJ9A 3FR8A 2QQ5A 3LLVA 4XYBA 1VSUA 2D8AA 4G65A 3OQBA 3R0IA 5JDIC 5JY6A 1Z74A 2ZTUA 4M87A 4IMPA 1CDOA 1Z6ZA 1NQ5A 4ALLA 1QLHA 2CVQA 1BXGB 3L77A 3RFXA 5ILOA 4CR7A 1WWKA 3RFTA 4LVUA 4Z0HO 1U8XX 3EYWA 4CJXA 4IIUA 1TT7A 4KWIA 1F8FA 3D4PA 3PGJA 3GHYA 4GBJA 1LNQA 5U9CA 3DEYX 1HT0A 4R5HA 4BNWA 3OBBA 4W9NA 4YEDA 1L1FA 3OEWA 1XQ1A 3ZWMA 4R01A 5K0ZA 1DC5A 4BNMA 4E5NA 3ZWYA 1ULSA 5IZ4A 1PL8A 1MA0A 2W2LD 2Q45A 4LCEA 1DRVA 5T67A 4DQXA 1GYQA 2QG4A 3CZRA 3CE6A 3HJAA 2UYYA 2VOJA 3MZ0A 1YE3A 4D42A 1N2SA 2GGSA 3LVFO 4ONEA 5A05A 1P1RA 1H9BA 3JQEA 4WLVA 1I01A 1BDBA 2CDAA 2X5OA 4TRJA 3PVZA 3L6DA 4L75A 3ZWCA 3ROQA 4B7XA 2P91A 4XQGA 4BNNA 2H5LA 2PD6A 5T5QA 4TRNA 4EI2A 2WSBA 1LU9A 1Y9AA 5G4KB 4ALMA 2EWMA 1SAYA 3D4NA 1HDZA 2HJSA 3PIIA 1XLTA 1XYGA 3QY9A 3CMMA 1NPDA 2PGDA 2PZJA 4Q3EA 4F3YA 3C7AA 4WLOA 3EY4A 3TZQA 3AUTA 4RDIA 2C2YA 3RCBA 3GY0A 1SCUA 4H3VA 4II3A 1EUZA 1YB1A 2GZ3A 4UVGA 1F17A 5A06A 1ZNQO 2Y1EA 3FR7A 5L7WA 4MVJP 3JD0A 4ND5A 3EVNA 1U5CA 2PZMA 3JYLA 3F46A 3Q6IA 2EGHA 5K9ZA 5KVCA 3S2FA 3QQPA 2A35A 1BGVA 4YT8A 2Q3EA 5ITVA 3NDJA 4AJ1A 1O89A 1GEEA 2Y1GA 2PTGA 1X1TA 3LU1A 1TVEA 5HM8A 2Q1SA 3OSUA 3U4IA 4INAA 2WYWA 5JE8A 3JQ9C 1PGJA 4EJMA 5COQA 3DBHA 5T8KC 3MJEA 2YUTA 3F9IA 3WMWA 2Y67A 4E6PA 4L0QA 4OMUA 3WBFA 3FNHA 1N1EA 4IGEA 4WE3A 1NPYA 3OA0A 4WLEA 2H1SA 1DIHA 1IY8A 4I9HA 1QYDA 1NXQA 4M54A 4BS9A 3RJ5A 3Q9NA 1ZKMA 3FSRA 4Y98A 4Q3NA 4H7PA 5BNIA 1F14A 5C5IA 4CPDA 1KYQA 2B0JA 2ZKLA 1D1SA 3QWHA 4UUNA 2G5CA 3HB4X 3INTA 3JD3A 4P22A 3BTSA 4D46A 3KV3O 3V2GA 1KC3A 4ITUA 4DVJA 5I8ZA 2HRZA 2VQ3A 4WLNA 4Y6RA 3HFGA 2VRCA 4CMBA 1AN9A 4PRLA 3SLGA 4RPLA 5IG2A 4GLOA 3N74A 2O7SA 3I4CA 2A94A 4AJEA 1E92A 4R1NA 3VPFA 4HFMA 1CJCA 1YQGA 1HTBA 2BHLA 1T24A 3IUPA 3ZNPA 5L51A 2BI8A 4CLEA 3K96A 1WP4A 1JN0A 3QE3A 3VTFA 1FJHA 3G1UA 1GPDG 4XQ9A 1X0XA 3GUYA 1HE5A 1ZJYA 3AUAA 3WGIA 4RVUA 4R1UA 3I9MA 1O95A 3B70A 4UULA 3VZQA 3JQAA 5DOZA 1ARZA 3GDOA 3WQQA 3PIDA 4BNHA 5JBIA 1J0XO 2WE8A 3LDHA 4QXMA 4BGUA 3M2PA 3PLNA 4YAKA 3WFIA 3AI3A 2Q4BA 3RFVA 3KYCB 4FFMA 3DZFA 1KEPA 2IZZA 4YAEA 1PSDA 4BL5A 1NAIA 2O3SA 1NBOA 4DL9A 3KLPX 1EDZA 2QYSA 4NDNE 2OBNA 3TFQA 1ISFA 1GZ4A 2D0IA 3F4BA 2Y66A 5TQVA 5L9AA 5JYDA 1MFPA 3F3SA 2BFMA 3PHHA 3U4DA 5JW6A 1J49A 3RUAA 2LDXA 2I67A 3VZRA 3TOZA 3MJCA 4GVLA 3WLEA 2VNSA 3DO5A 5JAQA 4OAQA 5JMPA 3IKVA 4RL6A 4YPOA 3D3WA 2Q2WA 1HYGA 3DTTA 3TDKA 3NJ4A 1EDOA 2B69A 2ZJ0A 4WCDA 2I6TA 4XRRA 2NWQA 4CQMA 9LDTA 1K0UA 3WXBA 1EVYA 3IOYA 3KYBA 4NJMA 4WGGA 4ZQHA 1ZFNA 4DQVA 1YJ8A 3B1JA 3ORFA 4WOJA 2W2KB 2X1HA 3JSAA 1J4AA 5KCZA 2AEFA 5ENVA 3KTDA 3NDRA 2O3JA 1B16A 1JU9A 3EMKA 4BNTA 1N92A 4KOAA 3RUHA 4EDFA 3F1LA 2BF7A 4FR5A 1GY8A 3H9JA 4BNZA 4WCFB 1NR1A 1SPXA 3ANNA 2HK7A 1PZHA 2CFCA 5IJZA 4BO8A 3TSCA 4KZPA 1SEPA 3H3JA 3IAHA 3IP3A 2PKQO 3QSGA 4HNGA 4HXYA 4IJVA 1NQTA 4FW8A 4K1LA 1M75A 2DT5A 2DU8A 4P8RA 3KB6A 5B12A 4FJ1A 3PWKA 4IDAA 5B37A 5ENDA 2XXJA 2YV1A 3GAZA 1NFFA 1VI2A 1Y8RB 4GSLA 4YTEA 4IDFA 1U9JA 1P3DA 4OKNA 4JP2A 3QHAA 1HSZA 4XCVA 3RVDA 3U09A 1HWYA 1LX6A 3W1VA 3H6KA 2Y1CA 4YJDA 2B83A 1MG0A 2RHRA 3E18A 2HK8A 5BR7A 4RVGA 3DBLB 1VC2A 4TRMA 1MG5A 4U6SA 4Y6SA 1KVUA 3LZ6A 4CR6A 4JBGA 3FBTA 4LISA 4PLVA 1EVJA 4IDGA 1I5RA 3KYDA 4DBVO 3KEOA 4K9DA 1IYZA 1LRKA 3WGOA 4B3HA 1XSEA 2C5EA 2CF5A 3NKLA 3PYXA 4AJHA 4R16A 2X23A 4D3SA 5CG1A 3LC2O 3WMXA 1R6DA 4NMHA 1L7DA 2ZB7A 2WM3A 4L74A 4AJLA 4NR0A 3TZCA 5CPBA 1P0FA 2C0CA 3GOHA 3QRWA 4K6CA 4R68A 2B4QA 4HADA 1O0SA 1X15A 3GNQA 4Y6PA 4U5QA 3WS7A 1YVEI 1Z75A 4PLHA 1C1XB 5TS3A 4ESOA 2EP5A 4HY3A 1OC2A 1K3TA 4M1QA 1RPNA 2EG9A 4HV4A 3G17A 2OUIA 3PQEA 3DXFA 4IQ8A 3O38A 1ONOA 4WLFA 3OJOA 4YRDA 4OYRA 3UHAA 4BNUA 5IDWA 4QFDA 2C7VA 4JBHA 3QLJA 1IUKA 2PFGA 3WLFA 1NHGA 4JJGA 4C7JA 1T4BA 5A04A 5CDTA 1EMDA 1VJ0A 4E31A 4AL4A 2NSDA 1XHLA 5DZSA 1DIAA 3GC6A 3JQFA 3ZNQA 3GN2A 4FCCA 1HDCA 5EJ2A 5L7TA 3RWBA 2NU7A 1PQWA 2B4RO 3HDHA 4FJ0A 3RU9A 3EZYA 2Q49A 4O59O 4CR8A 4KUEA 4I08A 3UKOA 4BMSA 3K9QO 1E7RA 2HSDA 5HBRA 4FOOA 3U0BA 1QXSA 2GZ2A 5EIOA 1SO8A 1FK8A 1U4OA 2GLXA 1OOEA 2PY6A 4MIYA 4PG6A 3VPGA 2RHCA 3AUUA 1SMKA 2GCGA 1H9AA 2G76A 5G2OA 2C59A 1JVSA 5AXAA 4D79A 4CLXA 4ZICA 5TIIA 2DBZA 2IEBA 5FYDA 4DLLA 1IOLA 1YGYA 1RWBA 4UVIA 3GVHA 1WAMA 5F3RA 1LDYA 1DLIA 3LT2A 5LCXA 4FS3A 3W4KA 2X9VA 3FF4A 3RQSA 1O6ZA 4L76A 1Y8QB 1PU2A 2VUTA 4ALKA 4R9RA 2GSDA 2OP1A 4PG7A 2Z95A 2NVUB 1R37A 3WDSA 3D64A 1OI7A 3ZWPA 3V2UA 4F45A 9LDBA 4OOFA 2GN4A 3FPCA 2OXIA 3GG9A 2AEMA 4RPKA 1B8PA 3DWFA 1C1DB 2B4TO 2J6IA 4A73A 4PZDA 2XF8A 4J7CA 1KS9A 5KKAA 3TQHA 4EITA 4QECA 2FWMX 1Q7GA 2Y0DA 1BXKA 4R9SA 3TRIA 1V35A 3FTNA 5KIAA 4JK3A 3ZWNA 3C1OA 1UP7A 1O94A 4D44A 2AEJA 3KVOA 1GR0A 3IS3A 4CUZA 5JCJA 1FMCA 3G49A 3H65A 4BNYA 4Q9NA 4JX8A 3AY6A 3GMSA 4BQPA 2RBEA 5DT9A 4JXKA 2FSVA 1C0LA 3ZH2A 3ST7A 5COAA 4QX6A 3ZU2A 1R4NB 2Y99A 1N9GA 4N5NA 1H6AA 5A03A 3PHIA 2EJWA 3JQ6A 1PL7A 3OIGA 3WYBA 3F5SA 2AMFA 4WEQA 3WTCA 5JDCA 4W4TA 3ZZNA 1X0VA 3ZWOA 4UUPA 2XXBA 4NFYA 4TVBA 1VPDA 1H94A 1YJQA 2Q1TA 3SVTA 4FJ2A 4DPKA 4EYEA 4BGEA 1F0YA 2VUSA 2WMDA 4XX0A 2HKIA 1EK6A 2VT2A 3UGKA 5JS6A 1HKUA 3ONDA 4CMIB 2IYOA 3JCZA 4CM9D 3KOUA 3BHMA 2V6MA 4CM5A 3TZKA 2O50A 2D5CA 4I5EA 1RM4A 4BO0A 1XWFA 4O1MA 5GZ1A 2VRBA 4OGWA 1KC1A 4BOYA 2JFHA 1TXGA 1DJQA 3VTZA 2YHIB 1GV0A 1A72A 2EV9A 4CQLB 2BELA 3HB5X 1RM3A 2WD7A 3VPSA 3EZLA 3AI2A 1BRMA 3GGOA 5KOIA 4R1TA 1E3WB 1QP8A 4M49A 5L4LA 2CUKA 2JCVA 5ICMA 2X0JA 3E48A 2X9NA 3IL2A 1Q0LA 4PLYA 3P2OA 1IHXA 4M86A 3UUWA 4Z0TA 2NQTA 3EGOA 1D7OA 3SEFA 1CERA 3RU7A 1NVTA 3LC1O 3AOGA 1HETA 2DBRA 1DDOA 2P4QA 4GMFA 4Q39A 4KUGA 1NHWA 3MTJA 4B4UA 3AM4A 1PIWA 1G1AA 3DL2A 5TLSA 3RC9A 1DHRA 4E5KA 1UR5A 4NNJA 2JCXA 5FFFA 1P77A 5IZCA 4AFNA 3PEFA 2E82A 3ZV5A 4RQUA 3AU9A 4OKIA 1Y81A 4RVFA 4N7RA 3FWZA 3Q11A 1N8KA 3DAFA 4OOEA 3WG9A 4E21A 3ADOA 5F5NA 5IDYA 2ILTA 1R4MB 2GASA 2O3QA 2O3RA 4J4HA 4LRTB 3QJ5A 5A02A 4BKUA 2FZEA 1A4IA 2BH9A 2QYTA 4IZIA 3EAGA 3QP9A 4HKTA 4IDEA 2D59A 2UV8A 4TMFA 5DP2A 4OXKA 3NTQA 1T2FA 1P45A 4IY1A 3AUSA 3BTOA 3I1JA 5CDSA 3X2EA 1QRRA 4D43A 3JQGB 4C7KA 5JPIA 3H3FA 2NNLD 3W6UA 3V1TC 4E13A 3FNGA 3MCVA 1MP0A 2NV6A 1JDJA 1PJ2A 3JTMA 2BD0A 3UF0A 4AJKA 2C29D 5FF9A 3VPHA 4LSWA 1DAOA 4J1NA 4CM4B 2FHSA 3ZWBA 3RBVA 4A7PA 3LK7A 4XYMA 4Y67A 3VH1A 1YL5A 3SX2A 2X5KO 1K2WA 3AK4A 4WKGA 1YDEA 3AFMA 4A5OA 4B4OA 4CMEC 4E3ZA 2OBYA 1E7QA 1D3AA 1K5HA 3SJUA 5THQA 2GF2A 4R1SA 1E6UA 3SLKA 1U7TA 1EBUA 1JQBA 1HL3A 4BNKA 3E5MA 5JAMA 3WGYA 4CV2A 1JKFA 4NBUA 2W90A 3DMTA 1QSGA 4CMKA 5KJCA 3UN1A 4BQRA 4IQ0A 4MVJH 1D1TA 2EGGA 4YB8A 3VAZA 4AJNA 1YB5A 3GVXA 3AY7A 3D7LA 5U4QA 4UUMA 5L4NA 1I24A 3RI3A 2HDHA 3AI1A 5HWSA 1OZAA 1UDAA 1GUFA 1Y1PA 3GGPA 4PZCA 3H5NA 3DR3A 4FPXA 3N7UA 4GQAA 5K6AA 2OHXA 1MB4A 2EW8A 3F5QA 4LW8A 4TSKA 2AXQA 5DCWA 3ICPA 4EJ6A 2NACA 3GVPA 5HA5A 5TT1A 1YONA 4KTVE 2IXAA 5JDIA 1HDOA 1BW9A 5KVQA 1MC4A 5DULA 4KQWA 1E6WA 2P5UA 3WIEA 4MVJI 2VWGA 2QRLA 1UXIA 4GX0A 5U1PA 2XAAA 4WPGA 3WWYA 4BNGA 2VT3A 4DUPA 1PJTA 4DTIA 2VHXA 4R5MA 3C3XA 2Q1UA 1FDTA 1HE4A 2Q99A 2CDCA 3G1TA 3ANLA 4BO1A 1LDMA 1ZK3A 2EKPA 3ZV3A 3PFWO 4ND4A 3LYLA 4OJNA 3RKRA 3ANMA 1B15A 1LJ8A 3JD4A 1AHHA 3IJPA 5L95A 3NTOA 1RM5A 2VCYA 4H15A 2E4AA 2OP0A 3AJRA 4ZN6A 3MTGA 3PHLA 1TI7A 1UXHA 3CH6A 4J6FA 3MJSA 2CZCA 1DB3A 4TKLA 3AWDA 1OC4A 5BNFA 3DZJA 1DIGA 2FPPA 3D5TA 2FR1A 3IJRA 4I5GA 4J1SA 1PJCA 5G0TA 2FY8A 3KRTA 3A06A 4IJKA 5JYEA 4QQRA 1DJNA 1PWZA 5C7OO 1Z73A 3WNQA 2X4GA 3MWDB 4YACA 3RC7A 3ZU3A 2PH5A 5A3VA 1KEVA 1YBVA 2VTEA 1HYEA 2IDZA 3NT5A 5DF1A 4Y8VA 3E9NA 1JAYA 3NDIA 3OETA 3ICCA 3ENNA 4JNKA 1ZXLA 2NADA 3E9QA 3I3OA 1ID1A 3M6IA 1P1KA 5L3ZA 3TF5A 5JO0A 4JROA 1YL7A 4JJFA 1N7HA 5A9TA 2HAEA 1OMOA 4B8ZA 2C07A 4N54A 1U3UA 3I5MA 2D5AA 3R6DA 4XYGA 2NUAA 1I3LA 4DBZA 2JD1A 1JVBA 4B79A 4PN3A 1EFKA 2G0TA 1SC6A 1E1NA 1EZ4A 4MO2A 2O7QA 3H2ZA 4N5MA 4ND1A 3HQ4O 3PFFA 1U2GA 4OHUA 5B4TA 3KEQA 4RVHA 4A03A 4IQGA 1KOLA 3ZV4A 3OICA 4I9NA 4DMMA 3QA9A 4IBOA 1HF3A 5L45A 2Y0CA 3SBOA 1GL3A 2V7PA 1F06A 3I6QA 1ONNA 4E5YA 2PGJA 1NWHA 4YR9A 2A4KA 1NASA 3TL2A 2WD8A 3OIDA 1JWAB 4CMAA 4Y9DA 4HFNA 1CRWG 1E7WA 1HRDA 3EK2A 2CNBA 3JQ9A 3RIHA 3HSKA 2GN6A 3H9EO 1B3BA 4A10A 4YJGB 4XZ3A 3E03A 5T8KA 1EUDA 1DO8A 5KKCA 1H6BA 3DHNA 4YT5A 4BIIA 3ROKA 2C20A 4MVJE 4A2CA 5JXWA 4RPGA 4OH1A 3DBHB 4ZA2A 3H9QA 2YV2A 2WWRA 4GX1A 4YT4A 3B1KA 1G6KA 5EL0A 4DPLA 3PQFA 2I76A 4QTZA 2GN9A 4FGWA 3U4HA 3IC5A 3LF1A 5I9MA 2PKRA 5CG2A 1PJ3A 3INRA 3K2BA 4J90A 4DC0A 1Y6JA 5I9LA 3F4LA 1B8VA 3SXPA 4J9VA 3ZHXA 4YJHA 2NVWA 2EF1A 4OQZA 2C2XA 1GCOA 4P4NA 3QIVA 3MOGA 1GYRA 4BNFA 1XQ6A 4YWJA 4AJOA 5BNTA 1GQYA 4F6LA 4KMSA 4BGVA 1W8DA 2LDBA 2O2SA 5IDQA 2J5RA 4J2OA 1ONPA 3P5SA 2PZLA 3GPIA 3PQDA 3AW9A 1UP4A 4FN4A 3GVCA 4NI5A 4Q3CA 2Q2QA 3GMDA 4GPD1 3WTBA 1J5PA 4PVDA 2HMSA 1P74A 3C8MA 3IP1A 4J16A 3W8FA 1ZSVA 3P19A 3TN7A 4BNLA 1O8CA 2AA3A 1R0KA 1P44A 1DBVO 4FBGA 3TFOA 5H82A 1K6JA 4BNJA 5G0UA 1PR3A 2G1UA 1E3SA 4UREA 2ZTVA 3D0OA 3WNVA 1WW8A 1DFGA 2GERA 4GX5A 5CP8A 3U5TA 1UUFA 1DAPA 3BHIA 3JQ7A 3ABIA 2DPGA 3JQAB 2UAGA 1ADBA 1ADCA 1LRLA 4CM6A 5ILGA 4LN1A 2RAFA 4BO7A 1MXHA 3K5PA 3G3EA 1I3NA 3D5QA 4L4SA 1NFRA 3ZHZA 3C1TA 3DZKA 1I36A 5BT9A 5CDUA 1ZK4A 3FNEA 3NYWA 3H7AA 3D1LA 1E0DA 3KM0A 3R3SA 3LF2A 5THKA 3EW7A 3R3JA 4IZHA 3HN7A 5TT0A 5CDYA 1VKOA 1LRJA 2ZB8A 2VWQA 1PJSA 1MLDA 2PNFA 4A27A 1PL6A 4L73A 3BTUA 5I7VA 1HEUA 1TLTA 2W4QA 1DRUA 4FGSA 5KJEA 3KETA 2QX7A 2Z5LA 1NNUA 4GMGA 4QFCA 4BO6A 5ICSA 1PGQA 2W98A 3OM9A 1TT5A 2OOSA 3INGA 4RGBA 2B5VA 3TOXA 3GNTA 3VDQA 2OFPA 5DN9A 1WVGA 4CQMB 1GDHA 4RJTA 4IS2A 4MVJF 1QKIA 4NJMB 1E77A 2ZYAA 4UEOA 2GUGA 1WDMA 1DOHA 5DBIA 4NIMA 2H63A 3I23A 5AXCA 1KBZA 4Z0PA 3MWEB 4E32A 2VYND 2FN7A 4HFRA 1PTJA 3FN4A 2WYUA 2FOIA 3HHPA 1I3MA 1H0KA 1VE9A 4RCVA 4PLWA 4BO3A 2PA3A 2DKNA 3ASVA 3S2IA 1KETA 1ISMA 2OORA 1JLLA 1I10A 2RH8A 2X0IA 3DFUA 1B26A 2AHRA 4NH4A 4W99A 5JAIA 4Q3DA 4D41A 4N5LA 4ZQGA 4YXFA 4L4RA 4RPHA 3PJFA 2X8LA 1JA9A 2I66A 4MP3A 4Z3KA 1C3VA 2NU6A 1EFLA 2YHUA 3BMNA 5F21A 1PZFA 2B36A 1HDXA 3RBZA 1PJBA 3EDMA 3BMCA 3DOJA 4CLDA 3U49A 2E37A 3O4RA 3V1YA 4OSOA 3ZWXA 1ZSYA 3UAGA 1WPQA 1QYVA 1WNTA 3LT1A 1KVTA 4MIEA 5TX7A 2GD1O 1M2WA 1UXGA 4DYVA 5FWNA 1V3UA 5BSGA 5KNLA 2ZJ1A 2ZK7A 3JYPA 2B35A 2X0RA 4XR9A 2X7HA 1T2AA 5EN4A 2CY0A 3FHLA 3SJ7A 3KYDB 2PK3A 4CLRA 3I9KA 4J7UA 1DFHA 1JKIA 5J23A 4XEHA 4AJJA 3I9LA 1RKXA 1B14A 1A9ZA 1G0OA 4QUKA 4RORA 4Z9FA 4LRSB 4ID9A 4WCFC 3GR6A 1RM0A 5A9SA 2C54A 4YJFA 4BV8A 1ZMTA 1I33A 4PRKA 1I8TA 2EEZA 1QV6A 3QW2A 2VYVA 3BXXA 8LDHA 4O5OA 4D3DA 5TC4A 4E12A 1MXFA 3MJVA 3RUFA 2EKQA 4LK3A 3U3XA 2P9GA 1GFSA 1EE2A 2NTVA 1AGNA 1LSSA 4EEXA 3N58A 3L9WA 3IIEA 2NVBA 3IQDB 2R00C 4PLZA 3UW3A 3HDQA 3DHEA 3GEDA 1X1EA 2VRCD 3OA2A 4XGKA 5GZ6A 1UZMA 2UDPA 4IMRA 5ES3A 1PEDA 3V8BA 5KWEA 1C0PA 4LCJA 4PLCA 4FFRA 5ER9A 1DFIA 3UXYA 4HWKA 4R51A 5DNAA 2VHZA 5CEEA 3UICA 1ENZA 1A71A 1NR7A 2CVZA 2E48A 3IUSA 1H6DA 3TZHA 4CV0A 2HQ1A 5DBFA 2HK9A 1VM6A 2X22A 4G81A 3KO8A 3QVTA 2ZTLA 3NT4A 3RC2A 3HZZA 4CMHA 4BMVA 1QORA 4D3FA 4H16A 4PG4A 1HYHA 1Q7BA 4YA6A 2FSSA 2GRAA 3OIFA 4IUYA 1ISIA 3JQAD 3DONA 1CIVA 2JD2A 4RF5A 4A26A 2DTDA 2RIRA 3ITKA 2JHGA 1K89A 2O3UA 4J1TA 1GUZA 4YRBA 1A5ZA 3GQVA 4CUJA 4B4WA 4NU5A 3H5AA 4GGPA 4D0SA 2CD9A 3WJ7A 3JQDA 1K6XA 1A27A 4F6CA 1NAHA 3L4BC 4J91A 1LSOA 4KWHA 1RYEA 2Y93A 3WGGA 1VLLA 2YY7A 3T4XA 4RQTA 1WLYA 1TA4A 2PR2A 4BO9A 5IDXA 2ZTMA 2WTBA 1UDCA 3Q2IA 4B3IA 1XU9A 1B7GO 1QLJA 1MUUA 3GDGA 4KDFA 2O2YA 4IIVA 1PGPA 4MVJA 4RV9A 1GZ3A 1PQUA 2B5WA 4KUHA 2H9IA 4CQMD 3CINA 1GV1A 2FZWA 3DHYA 3DBRA 2D4AA 5ER6A 2Y1FA 1U3TA 4AICA 4CMGA 4WECA 5KJ6A 4UUOA 4FD3A 1UJMA 4XB2A 3ON5A 4A0SA 4DIBA 2AQHA 3I4FA 2YV3A 4B7UA 4BNXA 5HTOA 1YKFA 3O8QB 3CPSA 4XRGA 1B3RA 1MC5A 5FI5A 2AE1A 2VHVA 4WNIA 3A1NA 5EMHA 5CFZA 4E5MA 2O4UX 1I2CA 3EVTA 2NU8A 3ZHYA 1N9GB 3CSDA 4ZVVA 1ORRA 4BO4A 3A9WA 3OQ6A 1XIVA 2IZ0A 2QZZA 1U2DA 2EIHA 4QSMA 4TROA 4XWYA 3JQBC 2DC1A 2GDZA 3FBGA 3PXXA 3W6ZA 4CM8A 1ZBQA 4B3JA 4GWKA 3KLMX 1CF2O 1UH5A 3TPCA 1LDEA 4MP8A 1Y5MA 2Y05A 1Y7TA 2GN8A 1S6YA 1WMAA 2HCTA 4XD2A 1GQQA 4RF2A 1ISJA 4QEDA 4S3MA 2AE2A 5L4SA 1O5IA 1AE1A 4OSPA 2Y1DA 4W6ZA 5CDGA 5FEUA 3VZPA 1ZXBA 4E0BA 3OJ0A 1R66A 2DTEA 3B20A 4AVYA 3JYNA 2BLLA 4R4JA 4DLBA 2DTXA 2PZKA 4B7CA 2Z1NA 1P1HA 1NFQA 4CLOA 1SOVA 2WD7B 3GRKA 1Q0QA 2JAPA 2PD4A 2XOXA 3ADPA 3PPIA 1EVIA 1ZEJA 4ZU3A 2IXBA 3ROPA 5BSFA 1E3EA 4XR4A 3OEYA 3DTYA 3WGZA 5KVSA 3UCEA 1I2BA 3NGXA 6LDHA 4LSMA 3JQ8A 4KDEA 4YCAA 1HXHA 1ZEMA 2X86A 4IJUA 1GEGA 3IKTA 3BMOA 5AYVA 3JQCA 5DP1A 1YOVA 3C7DB 3QWBA 4JBIA 3CZMA 5EERA 2DUUA 4WASA 3H8VA 1LSUA 3DB2A 4IJWA 5AVOA 4AG3A 3PI7A 3GFGA 4FIZA 4BVAA 3WIDA 2JAHA 3BAZA 4WOKA 2TMDA 2J3JA 4II2A 3VKUA 1T2CA 4JLWA 1SOWA 2W2LA 4CMCA 1PWXA 1E3LA 4P38A 3CUKA 3FTPA 4XKJA 3AOEC 1X13A 3ETEA 4I1IA 5F1OA 2OL4A 5T6BA 2IODA 5KJ1A 4N18A 3RUEA 3FRJA 5IF3A 4TQGA 1PZGA 3X2FA 3AM3A 4K6FA 2Q4EA 3I6IA 4E2YA 4XJTA 3ASUA 4ND2A 3FD8A 4O63O 5TJHA 4OXYA 4BKQA 2X58A 1AUPA 1NP3A 4JP3A 1U28A 2D3TA 5JFOA 3ZHBA 1LLUA 1UAGA 3CTMA 4YQYA 3UCFA 4MKXA 3IDSA 3HWRA 1RJWA 1C0IA 2TMGA 3GN1A 4WUVA 1ADFA 1P9LA 3Q1LA 1ZW1A 5CPFA 1VL8A 4HP8A 4MVJG 4JCOA 3OECA 3PWZA 2NLOA 1SEVA 3PGXA 1YS4A 3CIFA 4CMEA 4DIOA 3DQPA 4LVCA 2ZYGA 1YRLA 2CSUA 3HDJA 1XR3A 3OH8A 4R3WA 1KVQA 2HRBA 2ZQYA 3KSUA 4CL8A 7MDHA 4QT0A 3V1UA 5MDHA 2CF6A 1HE3A 3RASA 3PZRA 4NJOA 3DZBA 3L4SO 1UXJA 3Q0EA 3ONFA 4XA8A 4YBZA 4U0KA 4XYLA 3DC2A 1I0ZA 2NTJA 3K8ZA 3RBXA 1XKQA 4FFOA 1HZZA 2I3GA 2OZPA 1B8UA 4I5FA 4LMRA 4Q3BA 2J3KA 3NV9A 3GZ4A 2AQIA 1P33A 2DPHA 4OO3A 1A7KA 1N1GA 4CUKA 5L40A 4YDRA 1YQXA 3GZNA 3GEMA 1DEHA 3MJTA 2FRDA 1T25A 2JD0A 1V9LA 2IRWA 3NX4A 4PLTA 5JCJD 4W82A 3PRJA 3ROMA 5GY7A 3DOCA 3BYZA 1BVRA 1ZZEA 3COSA 4ZQEA 4EBFA 3ZCXA 4DRYA 1BW9B 4J9UE 4RF4A 3OQ1A 1ISGA 1V3TA 4XYEA 1CQIA 1YXMA 3JV7A 4IGFA 5A4DA 2BRUA 1R15A 2IZ1A 4EW6A 1IHYA 1XGKA 1Z45A 5TF4A 4M8SA 1N5DA 4J43A 2XPCA 3W8DA 2O4CA 3BIOA 3E9MA 4M55A 4U0JA 4IXWA 1E6EA 1H93A 3K73O 1E1LA 1UDBA 3DZGA 2GO1A 2QW8A 3M1AA 5BSEA 4W7IA 2DFVA 3U9LA 3PDUA 3P2YA 4GI2A 1B2LA 3DBVO 1BWSA 3BMQA 4DIFA 2AQ8A 4MVJM 1ISHA 4GVXA 1IPFA 4TRRA 3C85A 3HADA 4CM3A 3HE3A 2NU9A 1XG5A 2R2GA 3GUCA 5G0WA 3TL3A 1P1FA 1EE9A 1DPGA 2UUOA 1WDLA 3H2SA 1VKNA 2FP4A 1IL0A 4QO8A 3WSWA 3PJDA 1U8FO 2ZIZA 3H9GA 2I99A 5EPOA 2EW2A 1PS0A 3PP8A 1E5LA 5B4VA 1LA2A 1DHTA 1EUCA 4YQZA 4AJ4A 4C4OA 1LBEA 4UVHA 3H9UA 3Q2KA 5B4UA 4WK6A 1BXGA 1XU7A 1HLDA 2JJYA 4NBWA 3STHA 4IM7A 5A9RA 1E3JA 3NRCA 1PZEA 4UVEA 4ZJUA 2YW9A 3WJAA 2HUNA 2QRKA 4CLHA 4IINA 4TVOA 5CAEA 3VH4A 2ZB3A 4GH5A 4J49A 4GL4A 2ZYDA 2QIOA 5ADHA 1V8BA 2BMAA 5BQFA 4BB6A 1EQUA 2VHWA 2Q50A 1SBYA 3ZW9A 1H2HA 4MPDA 3ZWVA 1V0JA 4NBTA 1LLQA 4WLUA 3OMLA 1PS8A 1FDUA 3E82A 1BDMA 4IXTA 2P9EA 3U62A 3KBOA 4W9NC 1BTOA 2PGLA 1FDWA 2VYNA 3TJRA 4EUHA 4ROSA 1XELA 3F1KA 4TZTA 3WWZA 1WZIA 4W7HA 2J3HA 1JAXA 3QVOA 1FF9A 3VC7A 5T57A 2AG5A 4YAIA 3ENKA 4HFJA 1I30A 1X7HA 4RZHA 3JYOA 5ITWA 3LT4A 4MIOA 1EK5A 3BHJA 1V3VA 5G4KA 4MKRA 4I8XA 4E2ZA 3K30A 3K31A 1ADGA 3ITDA 4Z3DA 4XGIA 2V6GA 2BI7A 4BO2A 1C0KA 4J0EA 1GAEO 5KTKA 3QWIA 1FDSA 1Y9EA 2DM6A 4XB1A 1FDVA 2FR0A 2BFOA 3DOOA 3WGHA 3L6EA 1NYTA 4D0RA 4MOWA 4YJHB 1IPEA 2VNAA 3Q3CA 4UAGA 3T7EA 4IDDA 2EKLA 5I7EA 1VRWA 3PYLA 4YJGA 2I5PO 4Q3AA 1ZK0A 2P5YA 4E30A 1SZJG 3O26A 4DC1A 5FI3A 4EGFA 5EQDA 1DIBA 2EJVA 5DDIP 3K92A 4FB5A 2X9GA 1AXGA 3VVBA 4CMJA 3W8EA 3F6YA 2FPIA 1TB4A 2WJPA 1NQOA 1E5QA 4FC7A 4PIVA 3B6ZA 2I3AA 4RF3A 5BSHA 1B0AA 5TRTA 3E8XA 5KVVA 2PKQP 4XGNA 3HG7A 1CQJA 2C5AA 5AOVA 4B4VA 2D2IA 1R12A 3PWSA 3U4CA 3FNFA 5IN4A 3HUDA 5DOVA 4GKVA 3JQ7B 3VPXA 2VWPA 4GLLA 1LDGA 1L7EA 3TWOA 3WSVA 4DGSA 5T64A 1E1KA 3UFXA 4EJ0A 3ZDFA 5A5FA 3RUIA 4DREA 2WYVA 4NZ9A 2ZATA 1YL6A 3UH1A 5F1PA 4BO5A 2A9FA 1KEWA 5COBA 3E1KA 1EQ2A 3HNPA 4ALNA 1PGOA 2QZ9A 1QYXA 2HLPA 4ZQBA 1I3KA 4L9RA 3KZVA 5L53A 3W4JA 4E4YA 2H6EA 2HO5A 4OQYA 4DXHA 1BXZA 3S8MA 3H5RA 4DA9A 2NM0A 3VOSA 2CVOA 1KIFA 5EESA 1H2BA 1PS9A 2C82A 5G0SA 3GFBA 1ENPA 4KTTE 3CKYA 1PJ4A 1ZK2A 2BFPA 3UCXA 1JWBB 2BGLA 4FFPA 1J6UA 5JAZA 4G5HA 4ALJA 4BNVA 4F46A 1TT5B 1ZIDA 1NVGA 1T1RA 4URFA 1XEAA 4Z9XA 1Z7EA 1LSJA 1YBMA 3D3WB 3GDFA 3NEPX 4NPCA 4NFSA 1ENOA 2VUUA 4R69A 3NJ8A 1LDNA 4PGFA 3M2TA 3P7MA 3ZWWA 5AXDA 1AHIA 5A5EA 2VWHA 2R6JA 2V6BA 3KYCA 1HDYA 2OO5A 2RH4A 4XIYA 3FWNA 1LXCA 3F47A 1GQ2A 4HBGA 5H81A 3HFSA 4O0LA 1IE3A 2PH3A 4ND3A 4ZD6A 5GMOA 3WR5A 1NX6A 4E2XA 5HS4A 2YDXA 2B37A 2YYYA 1ZO8A 3B1FA 4UEJA 1IZ9A 4NFHA 1GUYA 1LEHA 1YDWA 1RYDA 1P31A 3I52A 1KY4A 4ZRMA 3WBBA 4ZHSA 1U5AA 4GAEA 1UAYA 1AXEA 4J7XA 3WYCA 1QMGA 3R1IA 3KSZO 1Q0HA 1LUAA 3BMNB 4RLSA 3TNLA 2VZ9A 3ETGA 1PR9A 3BMCB 1DC6A 3JD1A 2J8ZA 1CEQA 1C14A 5GZ3A 2W2KA 1DXYA 1UZNA 1UP6A 4R54A 5I7SA 3C24A 3GA0A 1EEHA 1KY5A 1E7MA 1VJ1A 3DAGA 3GGGA 1ZJZA 3CEAA 2Q2VA 1LC3A 4KQXA 3MEQA 4FOSA 1M6WA 3SC4A 4BKPA 1ZK1A 3GAFA 4WCFA 5JY1A 2VN8A 1Q1NA 4CLRB 1JKJA 1T2EA 3EHEA 1W73A 2CDBA 4KP7A 3L6OO 1U7HA 4DQUA 5IXYA 3LT0A 2G17A 3DAPA 1LTHR 1V6AA 3ZN2A 5A9SB 3GH3A 1ZMOA 4G2NA 1ZCJA 4YJFB 3RSHA 1DRWA 4XQCA 1P0CA 4J4TA 1YO6A 4BGIA 1Y8RA 3M1LA 1MGOA 5EINA 5EQFA 1GTMA 2O48X 4ZGWA 2NTNA 2YZ7A 3C1AA 5C7IO 2F00A 2R00A 4D7AA 1D4FA 1VJTA 4HX5A 4CM7A 4CM9A 1YH3A 2ZCUA 3NGLA 1LLDA 1QG6A 3ETDA 3V2HA 1PJLA 5CHEA 2PWZA 4JGBA 1F8GA 3DBLA 2E6UX 1HDGO 3NUGA 2X5JO 3K6JA 4YVFA 5TGDA 1D8AA 3A28A 2X6TA 4WNCA 2WDZA 5TSDA 2E49A 1N7GA 1DC3A 6ADHA 3AU8A 4HNHA 5LDHA 7ADHA 3RC1A 4AJIA 1GPJA 3WB9A 4E5PA 2JL1A 4IS3A 4PVCA 3A4VA 4U6QA 3GT0A 3D3EA 4ZRNA 1IULA 2QRJA 2VOEA 2VTDA 5MGBA 1DIRA 3V5NA 3PYMA 4ZQFA 4U8GA 1C1XA 4LMPA 1U1IA 4JIGA 2WEKA 5DCUA 3GLQA 3VH3A 3KHUA 3RAJA 2BFAA 1SB9A 3D4OA 1E3IA 1LC0A 1MFZA 4NBVA 3WOHA 1GYPA 3L4BA 3IMFA 5C37A 1VL6A 1W4ZA 4P4GA 3A14A 4BKRA 2EERA 2FR8A 2Z1MA 1NTOA 4PG5A 2ZCVA 4X54A 3ZNNA 4NG5A 2ZQZA 4RPJA 4LGVA 3FPLA 1MX3A 4QO7A 1IB6A 1UZLA 3KXDA 5L7YA 1JW9B 4NK4A 1DSSG 5I9NA 4PLPA 1WMBA 5B1YA 1LQTA 3JQFC 5IFLA 4CV1A 2I9PA 1WDKA 3GVIA 2HMVA 3FI9A 1E7SA 4MP6A 3S2EA 3NT2A 2HJRA 2CMDA 3PZBA 1UXKA 4EEZA 1R16A 2DFDA 2JFGA 2G82A 2HMUA 1TEHA 3WGQA 2IEDA 3EUWA 3WQSB 3ZWAA 2NQ8A 4PG8A 2DAPA 3PHJA 2AQKA 4PZEA 2IE0A 2P2SA 2P68A 4AJ2A 2Q46A 1M6HA 1CWUA 1W6UA 2DLDA 3L9XA 2I65A 1U3VA 5H83A 4DWVA 1XDWA 4CODB 1SB8A 3DBRB 2JHFA 1NVMB 3QV1A 3I83A 4WJZA 5HS6A 1HZJA 5LDGA 1QV7A 3KUXA 3ZV6A 4PLFA 5A3JA 1LI4A 1HE2A 4YAJA 1HDRA 3WX0A 2YQ5A 2X0NA 2WE7A 1PGNA 3QWFA 3I9OA 1OBFO 2P4HX 3CMCO 3JQBA 1Y8QA 2Y1OA 3WICA 1Q2XA 3LQFA 4EZBA 2V65A 5JCXA 4BB5A 4DYDA 3S1LA 4ILKA 2ET6A 3DDNA 5TJ9A 2P9CA 2NVUA 4MDHA 4I5DA 1WZEA 2VZ0A 3ZNOA 5JSFA 2J5QA 1ZVMA 2GR9A 5JC1A 3GEGA 4I9UA 4CM8B 1C1DA 5F5LA 4YT2A 1HLPA 2HMTA 2RCYA 1I32A 2D1YA 1ZSNA 3RKUA 2OGUA 3I9NA 1KEUA 4JJIA 2O3TA 4FQ8A 1O9BA 4FFLA 1DC4A 1MV8A 3O9ZA 4J0FA 3UOGA 3HN2A 5HRUA 3O03A 3ZGYA 4CV3A 3O8QA 1ULUA 1GADO 4PFJA 4UEKA 4JN6B 4P4LA 5LC1A 3UVEA 2UUPA 3VHRA 5IAAA 1K6IA
chains in the Genus database with same CATH superfamily
5GV8A 3RROA 5BP7A 5AUNB 4L95C 2V7GA 5D87A 1RQRA 1EPUA 3DZHA 3VU3A 3WFJA 1JH9A 3H4VA 2TS1A 2GNOA 3DMNA 2G7ZA 1NQAO 4J2HA 4TL7A 4EFLA 5C8VA 1RRCA 2OGSA 2VFAA 1OWLA 1R4NA 2KMLA 2SKCA 3KAJA 2BMDA 3PLRA 3WGJA 4OHFA 4XDZA 2CMGA 5JQGB 1KI3A 2FSVC 1QUEA 1TL7C 3K6KA 3QNUA 5I45A 3QMVA 4TTVA 3K9NA 4BEBA 1YE5A 5DHSA 5C4MA 2ZW9A 5CB8A 2C9BA 2CBXA 2QU7A 4OFWA 4UU1A 8ADHA 4RHYA 4TSFA 3FCOA 3DBIA 2VYVD 2R7MA 5IDVA 2DUWA 3BIFA 3V55A 3W5VA 2HIGA 2YOGA 3GJ4A 3VDRA 2JJ2A 1Z0AA 5FBWB 1L7VC 3TINA 2QR5A 3OFSA 3P1JA 4HTFB 1U3CA 1YOVB 1H2EA 4QIHA 3U9TA 5C7OO 5KQGA 1UBJS 4WQMA 5AKKA 1UQTA 3QVWA 1V71A 4JQCA 4Y2SA 4Z4QA 3NBZC 3SYNA 2V7UA 2ZR8A 3EC2A 1Q11A 1YAJA 3RIGA 4HYEA 1WU7A 1A7JA 3RG8A 4DM4A 2BM9A 2IHTA 2IYRA 3I30X 2OZEA 2IY8A 2YHIA 4JVOA 1QIDA 2AKEA 4DA8A 1EESA 5HGJA 3T7CA 2AXPA 2FMHA 2AMYA 3K8YA 1L2TA 2PWBA 3QUTA 4PC7A 3MTIA 2QAJA 5ALRA 2JFNA 2Z2XA 4JR2A 4TTIA 4XAQA 2WIDA 5A5DA 2JI6A 3X1DA 4CF5A 3VKVA 1SUSA 1E3WA 5HILA 4G8JA 2Y0EA 4H6VA 4RVSA 2FPXA 1CYDA 3PS9A 3E23A 3W9YA 4F3NA 3RFFA 2JFFA 5JLAA 1TC2A 4JLNA 2IIBA 4HS4A 1RYNA 1Z3CA 4FEYA 4M89A 1FP6A 2JEOA 3H0EA 4L6IA 4F9EA 4HUJA 3ZKAA 1M67A 4XWOA 3MSXA 3Q8LA 2IH2A 1LBIA 1UOQA 1Z8HA 3C7CB 3D2CA 4JC5A 1YVPA 1LVHA 2PPVA 4RNCA 4X1IA 1PNTA 2H1LA 4Z9YA 2QOEA 1N8TA 2X1LA 3LL7A 1J42A 4WUTA 4HS9A 1S7CA 5IXJA 2GESA 3TLYA 1E2HA 2P67A 4FD2A 4IIJA 2YJ5A 1G42A 3EXG1 1JP7A 4GSKA 4MVXA 3DEAA 1N0WA 4PLGA 4XQEA 4HDNB 1OYOA 4MIKA 2OZVA 3DUFB 1NMSA 1MA3A 5ELMA 5DYNA 3V4SA 4KFCA 2N46A 1ND5A 2HQSA 3NM6B 1XFDA 1LWNA 5IAEA 5F23A 1QZXA 4GNRA 5F98A 4FDAA 4BZWA 1BHO1 4Z6KA 3NOOA 4OMDA 3WISA 2J3IA 5HK8A 4YYZA 5A3RA 2DBYA 3PPVA 2BVNA 2AMJA 3OF3A 5DBGA 2WFZA 5FR2A 3B1WA 4MQFA 5JSQA 4BFSA 2BPOA 2DPMA 4H7EA 4IH9A 2PX6A 4IKOA 5KJFA 2QKYA 4O3FA 4CNQA 1EWYA 1X92A 3IE1A 2ZTSA 1UKYA 1KP2A 1XK7A 1XCMA 2IDKA 2UVDA 3ETJA 2M2IA 3AT1A 1K97A 3LFHA 1BMDA 1ESMA 2J4CA 2QM7A 3QPVA 5TQ2B 4B35A 3SJBA 1PO7A 1Z82A 1GD1O 1GRRA 1L4LA 1OFVA 2EU8A 2IPMA 2OG1A 3BIWA 3MWKA 2PD3A 3OF2A 4IEIA 3RT9A 3TTVA 2NVOA 1PFUA 1ZICA 2ZWVA 1SULA 3JQGA 3GZTB 3ME5A 3N6VA 4M0EA 5G0VA 3A10A 4JFRA 5JV5A 4FFNA 4O6VA 1AMOA 4C4SA 1LBQA 4CDRA 4MINA 3DMYA 2WZDA 3ZS9A 1OAAA 2PLAA 3GZNB 4H0FA 1PQPA 2JB9A 4JYBA 4GWGA 4NX2A 1UKCA 3UXMA 3BF7A 1EZ1A 4OL9A 4BHTA 1ZH6A 5CA1A 3HCFA 2A92A 1Z0DA 4MUMA 5IC6A 1D6MA 2ASVA 5JO9A 5KDLA 1YQDA 3HZOA 4J75A 3AR5A 2IYPA 2G0AA 1L3BA 2BKAA 4NYMR 4RPIA 4AYTA 3AR7A 3DWGA 1O5TA 2CVFA 3NTRA 3VYRB 3QKUA 2Q5JA 3T4UA 4IDNA 2W6OA 3R24A 3PNBA 2PM8A 4QRIA 1R64A 1MZVA 4TZKA 5HRCA 4GM0A 4FC6A 1R0SA 1WHSA 2KLHA 1QANA 3NM4A 1E2GA 2O8VA 2ZU0C 1U81A 1SUCA 4FMCB 4IDBA 4F3TA 3E5RA 4C22A 3JRNA 4OXQA 2BUBA 4AJPA 2G5GX 5FOQA 3ADCA 1E2NA 5JJKA 4I66A 4OY3A 5DSTA 2AW5A 2CD7A 3ILHA 1LK0A 2IS2A 4YAGA 2P65A 5K3EA 1YR9A 2HUPA 2NZUG 3DKPA 3X1ZA 1D03A 4P0QB 1JIKA 1ZESA 2PIDA 3BMQB 3G1WA 1KJNA 3JATA 3G5AA 5CDFA 4M1KA 3NPAA 3EPLA 4DR6B 4QZVA 2JARA 4WT7A 5JIBA 1EVLA 1NJ2A 1BS2A 4P82A 4HDQB 2ONKA 3EMDA 4YJ2F 5A4MS 1E62A 2GPTA 2QR3A 3GF4A 1M34A 2CLKB 1NDUA 2DKFA 4H3SA 5T41A 4RY0A 1RKQA 3RJ9A 3WNZA 4B0OA 4MS4B 3LLVA 3HY6A 4G25A 4OV6B 3HJNA 4EHJA 1YIDA 2X2EA 2IZ7A 4WOCA 3O0TA 3BFVA 5HG0A 2AB0A 4G65A 5JDIC 4LJKA 4NE7A 4J0QA 3OZSA 4M87A 1Z0FA 3ZKWA 1B0PA 1CDOA 3NZEA 4M9QA 2C7RA 5KYVA 3TRDA 2CVQA 3L77A 4JT8A 4R1MA 4DRZA 2IKQA 3RFXA 5KWVA 2X77A 2HADA 4CR7A 1GRNA 1FRVA 2YZKA 2WBLC 3IEXA 4ND7A 1R10A 3A7DA 5AW2A 2GZSA 4Z0HO 1U8XX 4S1WA 5GGXA 4CJXA 3OWOA 4FOPA 3BDIA 1C50A 2M6KA 2G5PA 3X0DA 4EKEA 4G56A 5U9CA 1HFEL 1CE8B 1HT0A 1F0NA 1D2EA 3IIJA 3KG2A 4R5HA 2NOAA 2P40A 3D8HA 2VZLA 1QAQA 4W9NA 5CVDA 2RGCA 1UBLS 1ECJA 5K0ZA 1DC5A 3R76A 1VMKA 1JDBC 5JJLA 2V1XA 2KS6A 2LKDA 3GD7A 1GKYA 2Q45A 3OI7A 4LCEA 2FFHA 1E0JA 2R8RA 1QAOA 1GYQA 1SVLA 1QLWA 1ZGHA 3ILSA 3MWDA 4RXUA 4TQUS 5IT0A 3MZ0A 4D42A 2BTEA 2PH7A 1CJVC 3AFIA 3LVFO 3X44A 4H4DA 4DADA 1E32A 4ER0A 1B76A 2CWWA 3R44A 2QSYA 1Z2CA 1UPFA 2ZIUB 4WLVA 3GB9A 1ZCBA 4NOKA 4F60A 2OPBA 1RD4A 4ZYLA 3L6DA 4L75A 5FEMA 5I4BA 4P1ZA 4KN5A 4XTCS 4XQGA 1CY2A 4BIMA 1K0FA 3LI2A 5HKKA 4E09A 1YE8A 2YFKA 3F90A 2RK3A 1PLJA 4WESB 1EHIA 4ALMA 4X7PA 4YXWD 4KGXA 1HDZA 1THMA 2BEVB 2HJSA 3LA8A 3PIIA 4MCAA 4P3OA 2P41A 2HREA 2IEAA 3CMMA 1VKRA 4XPZA 3OX3A 3ONNA 4IV5A 4K8OA 3TG8A 3FNQA 4YP7A 3PQ5A 2P4EA 3D7KA 4QC2A 5CD1A 4LQ4A 5FV4A 4A6PA 2DKOA 2I4TA 5KB3A 3I12A 3AUTA 3B2NA 3LY5A 4X20B 3EA0A 1CUSA 3TZQA 3GY0A 4K2HA 1YB1A 2E87A 3V97A 4EA8A 1ZNQO 3DMFA 4QWWA 2PT5A 3VGPA 1UPAA 1EM8A 3WB2A 3FOWA 3I6MA 3JYHA 2A0XA 2FZ4A 3P45A 4NCBA 4JB0A 3V9PA 2PZMA 4KLCA 4WAUA 3I8OA 5K3FA 3RVRA 4Z53A 3BL8A 2F8MA 2D7DA 3HYSA 1YR8A 3IULA 1NZFA 4D9IA 3QJYA 2IOFK 1HFJA 4YT8A 3LP8A 1FDOA 2IITA 3UK1A 3BE4A 2QDKA 4DS3A 1E2MA 1O89A 5J1TB 5K0FA 3BGVA 4XUEA 3QEOA 1L5ZA 2VCEA 4IG4A 1P4JA 1Z4JA 2KM1A 1WPXA 2ZUSA 5JCZA 4ZYZA 3LU1A 1VMAA 4HNSA 1O96A 5HM8A 4P7KA 4INAA 4OBWA 1PGJA 4BNFA 4EJMA 5COQA 3C5WP 4LC0A 1XJWA 1W8IA 1WE2A 4BGPA 4AMVA 1W47A 4XLZA 4E6PA 1WMSA 3EXIB 3ZJ5A 1T8YA 4MUGA 4IGEA 3FRIA 4FHEA 2Q3FA 4AK9A 4DNOA 1Y3CE 2H1SA 2HDWA 4U1RA 3ZCTA 2GD0A 3GLGA 3GLFB 1CQJB 1M0WA 1QYDA 2PG3A 2VTBB 1UJ4A 3RJ5A 1TVKB 2HQOA 2O2DA 2ZUVA 5EZSA 3RYFB 1ZKMA 1DV2A 2O05A 4CXMA 4Y98A 4B3RB 5C5IA 3I2YX 3AIOA 4CPDA 1KYQA 3K6SA 3ZK9A 1I7NA 3QWHA 4I2VA 4NNOA 3HB4X 2BHSA 4DC9A 2Q3DA 1XHEA 2M9MA 5BWNA 1NU6A 1QRSA 3CB4A 3THWA 1ZHOA 2XNDA 1KGSA 3GRYA 3RW9A 1EZZA 3ZTTA 4Z54A 2Q29A 3IO3A 2HV8A 2G4LA 2F3PA 2OCLA 5C52B 2BISA 3T3GA 4U00A 1FRNA 2VQ3A 2IOHA 3FH0A 3ISVA 4X00A 4WVLA 2KLBA 3R75A 1MOPA 2R7LA 2I1VB 4S12A 3QXJA 2VRCA 3W9UA 4PYNA 3I2JA 4D9MA 3TG2A 4X66B 4OFBA 2M6LA 4FI3C 3SLGA 4H9GA 4RPLA 1YQEA 4N49A 4KR3A 2QJWA 2DB3A 4F4UA 2A94A 4AJEA 2JLQA 2X0EA 3VPFA 4S35A 3HCEA 3VSAA 1YQGA 2QTVB 5JI2E 4RM3A 1HTBA 2QE6A 3LJKA 4X24A 4PTYA 3PCXA 3KFLA 1OLXA 1E98A 4E2FA 1TJPB 5L51A 3NDPA 4GHWA 3LLMA 5JZBA 2IEZA 3IAS1 1P4GA 3F6BX 3F3YA 4FKBA 3QE3A 2F43A 1D04A 2JASA 4F97A 1USKA 3ESCA 1R9MA 3URKA 1V95A 1RRKA 4R1UA 4RVUA 5LKRA 1U9ZA 1PT9A 3I9MA 4Y2XA 3WHLA 3AR8A 4IXMA 4N8EA 1HUQA 2Q6IA 1VL1A 4X1OA 2C61A 4RMIA 4GVPA 3V8VA 1KS2A 2F8TA 3AIIA 5D00A 2E85A 1XXLA 4PO3X 3I9FA 2Y8EA 4US0R 4WK2B 4QJ3A 5FTKA 2RGEA 2UVPA 4EJSA 4YAKA 3R6LA 4NMXB 2ZRDA 2Q4BA 3RRJA 3VPDA 3RFVA 5KHLB 1E1RA 2G36A 3IHKA 4ZWNA 1F6DA 3JAKB 3DZFA 3ILXA 2QAGA 5CVCA 2IZZA 5I01A 1KOFA 2GCPA 1VFNA 1Z0JA 4BL5A 3GEIA 3TSYA 1NBOA 3X1WA 4TUYF 1RRGA 4EYOA 1YBHA 2QYSA 4ZANA 1Z17A 3W5DA 5KZMB 1GZ4A 1JR3D 2Y66A 4NKRA 1SCJA 4YECA 5L9AA 1X8JA 5JYDA 1QTQA 1X7WA 2QNIA 1J49A 1Y1TA 3DT8A 5A2GA 1JHQA 4HNVA 5JW6A 3VZRA 3ABSB 1YASA 4RY2A 2VNSA 1ND6A 3DO5A 3IQZA 3MRXA 5JAQA 4YPOA 2ALJA 1RNLA 4QEKA 2DFKB 3TDKA 4YDHB 3NJ4A 2GXAA 3KQUA 2B69A 2BM1A 5JVDF 2QJOA 3IBGA 3B8HA 1JQJC 3R3WA 1J0EA 3B5JA 3H16A 3HABA 3WGNA 5C8XA 2AH5A 4CWAA 2WAXA 1J8FA 3B1JA 3IQHX 3ORFA 3HL0A 2X1HA 4REMA 3JSAA 1V41E 1X6VA 3FOZA 5IULC 4NESA 3CX3A 3U6BA 1F2TA 3JSXA 4JXZA 4NLLA 4K87A 3EY9A 1JU9A 1GNRA 3A9CA 2FTKE 1UMCA 1R4AA 2XDQA 4MR9A 4AKEA 3DP9A 1V96A 1U2EA 1F4PA 1MT0A 3NVKI 2HJGA 2RHJA 3ANNA 1OTYA 5IUNC 2W2NA 1PZHA 4ANFA 1OYVA 3G2PA 4ZRDA 1BKSB 3IDQA 1USGA 3NIDB 2VDKB 5DM60 1SEPA 1GG2A 3H3JA 3IAHA 4LHEA 2ZJ6A 1A2KC 2WFLA 3TSOA 3QSGA 5DB4A 3RHFA 1CQZA 3EXFB 4Z2AA 5HPYB 2MR6A 3GLHA 1Z4NA 1OZ0A 1OZGA 3USZA 2PXAA 1UM9B 3DPIA 4Z7QB 3L8MA 3LT5A 1H42A 1K9SA 3WLSA 1PW7A 5GPBA 1KY2A 3RV4A 1OLUA 5BMOA 3PUKA 3JZIA 4MKHA 1KPGA 2L42A 4GSLA 1YDHA 2IHZA 1QB8A 4YTEA 3LKZA 2B1GA 1P3DA 3ZZTA 4TYYA 4OKNA 3WLQA 4RL4A 1XVIA 3QHAA 2PBRA 4MDEA 2HCFA 3RVDA 5LD2C 3U09A 1PFKA 2C0PA 2XGSA 4ENWA 5DIZA 5EXEA 4B6FA 3KIPA 4YJDA 1Q1BA 2W22A 1COWD 2IGTA 3OFJA 2B83A 5TQ0A 4TN1A 2ZRCA 3K0HA 3UA3A 4AO6A 2H18A 2HK8A 1OX4B 4ETWA 5BR7A 3DBLB 4PYJA 2AYZA 1WIWA 3DOEA 1NMZA 3FJYA 4TRMA 1UK6A 1J25A 3Q5GA 1QGAA 2FMIA 3E53A 1GGNA 1EVJA 4NC9A 3STYA 1IEXA 4AAYA 2H2HA 4DBVO 1FP4A 3IQFA 3LDFA 4X94A 4K9DA 1IYZA 4F4DA 2IHKA 5G1NA 1IM8A 2CF5A 1PLKA 4Y1EA 3PYXA 4QTUB 4R16A 3W5JA 4KH1A 1IM5A 2NW6A 1YK1A 4YMGA 2PXCA 2IH4A 1LNZA 3LY7A 4WXMA 1RABA 3WMXA 1L7DA 1NQUA 1SQGA 2G3YA 2V3WA 3O21A 4HZIA 4A1OA 5IWAB 4O4JB 3WP0A 5CPBA 2FQWA 2C0CA 4Y9SA 4WJKB 1SXGA 3AEQB 4K6CA 3A9RA 4UCFA 5E2IA 3GNQA 5JROA 3L6CA 3GT4A 5FR1A 3WS7A 3HRIA 2DR0A 3IOCA 1U2QA 5G3ZA 3WZLA 1JJIA 2IXFA 1Z75A 4PLHA 1C1XB 4ESOA 4EWLA 2EP5A 1JBKA 1OC2A 4D57A 1RPNA 2ZAIA 4HV4A 3PXBA 3G17A 2C9OA 2R4TA 3DQZA 1XTUA 1L7PA 3CVXA 5F76A 2GZMA 2YHAA 1F51E 3SM3A 2PUJA 1GGMA 1IUKA 2LUOA 3LP6A 2R79A 1SVIA 1DKNA 1NHGA 4MNTA 3TK1A 2I4NA 4JOQA 4B8YA 4EGAA 4JJGA 1P5FA 5A04A 5CDTA 5SZKB 1X9IA 1K3UB 3ZWKA 1SCNE 1XZMA 5LNK1 3GC6A 4B84A 3S5UA 2BFFA 3GFQA 4LV5B 1PUXA 4ZOQI 1TM2A 2FN3A 5EJ2A 3KTAB 1U8ZA 1SZCA 3RDPA 1VCIA 2C3PA 3E27A 3A9VA 4PXSA 5FPYA 3ZLJA 3MCTA 3EQ7A 4FJ0A 2I8LA 2XY4A 3RU2A 1O9HA 3KKPA 5EIBC 2BR3A 3AEYA 3CLKA 1CB7A 4I08A 4QHTA 3U4AA 5J2TB 4BLRA 1IN4A 3D9QX 3IVCA 4FFBA 5A71A 3FZYA 4RMJA 2WIGA 4FOOA 3UV3A 1FBNA 5GIPE 1QXSA 4EHFA 1SO8A 2QUJA 3VISA 4FXOA 1FFAA 2PY6A 2XWJI 4RNDB 2GDJA 2XVYA 3M4ZA 3OOEA 5EEGA 4BU0A 4C5CA 3LV8A 4BTVA 2VP2A 4B73A 4C20A 1SMKA 3P2KA 2PRSA 1H9AA 2W2XA 2QUZA 5BW8A 4CLXA 5EIAA 1SFRA 5DGTA 3ZQJA 2IEBA 2ODQA 2PR7A 4V1CB 1JLHA 2GD6A 2QN3A 3GVHA 2FR8C 3NFYA 1KHTA 1BD3A 2H4FA 3RBAA 3ESZA 4X1YB 2SBTA 4FS3A 2XDAA 1SU8A 3HVJA 2X9VA 1MABB 3FF4A 3SZGA 2VQDA 4W5WA 1PFQA 2LV8A 3WQBA 1Y8QB 2BFEB 4ALKA 2O5CA 3FYUA 5A6SA 1KSJA 3TZLA 2Z95A 4H18A 2WSSA 2AJLI 2FFJA 2FOXA 2W5UA 4L9AA 1R37A 4TS4A 2NVUB 3D64A 3H2YA 2FUCA 1OI7A 1Z62A 1E9VA 9LDBA 2AF3C 2GN4A 3GYBA 2ZJZA 3DWFA 4KSCA 1PBTA 2W6MA 2DFNA 3MVEA 1V39A 2J6IA 4A73A 5B7GA 2B61A 1A4XA 2Q5QA 3NBMA 4OF4A 3TQHA 3A2MA 4EITA 4Q4AB 1QDLB 1Q7GA 4CIVA 4AZTA 2J4DA 4MI3A 4R9SA 2AXNA 5TPWB 1PR4A 3UPDA 4V0RA 3HKEA 1MOZA 4JK3A 5HIMA 3C1OA 3ZWNA 3R7BA 3HH8A 2V7TA 2GVDC 5E1OA 5IWCA 4JEHA 1MNQA 1VZ2A 5JCJA 1J39A 3G49A 3EDQA 3G02A 1W48A 3H65A 3HDVA 3OAAA 5HJ7A 2Z1DA 2YWCA 3N8DA 4JI5B 4ZYTA 3GLIA 3GMSA 1Q95A 3A4NA 5KWJA 5EP1A 2FSVA 2I0FA 3KXKA 3JWJA 3AEKB 4D8WA 5E4TA 1I2AA 1N6NA 2Y99A 3ZU2A 4OBEA 5J40A 5A03A 1U1DA 1DP4A 1TUGA 3JQ6A 1VSQA 3OQHA 4FHFA 5AJYA 3VR4A 4BX2A 1RWXA 3F5SA 2AMFA 1EXDA 1F0PA 1M5UA 4MK4A 1T2UA 2YZMA 5REQB 4C9BA 1UK9A 3NWJA 1PZMA 2GPBA 4MGKR 3JQRA 4IWNA 3KELA 2XXBA 3IEUA 1VPDA 2XUKA 1YJQA 2Q1TA 3BERA 4EGSA 3SVTA 5IJ0A 3AHCA 1O6CA 2IX9A 3H9BA 3I2KA 2HGSA 3T35A 4XX0A 3UGKA 1E6KA 2VT2A 2XUOA 2MIIA 2HHLA 3KJEA 3L0ZA 5JS6A 3KSMA 4CMIB 3JCZA 2CHEA 4CM9D 1JMYA 1SQ6A 5LA6B 4AP6A 3UNXA 3W7AA 3TZKA 4Y1RA 4EF6A 2O5EA 3KQNA 4HPWA 1O6GA 3SXUA 5B2FA 5GZ1A 1K2VN 2M6SA 4AN0A 4BOYA 2Y27A 2CXOA 4CNBA 3VTZA 1UEXC 1A72A 1W88A 2JIQA 3C5CA 3UWOA 2JANA 2BYTA 1XBTA 3C3WA 3CZAA 4CQLB 4H7DA 3Q9LA 3GUHA 3TCXB 1ODIA 1IHPA 1DTSA 1V8DA 2R66A 4KWCA 3MJDA 2EJBA 3AI2A 3H4TA 1XZHA 4DR3B 4R1TA 4NECA 3D7RA 4YK7A 3K6RA 1JFLA 3NPMA 3R23A 5JISA 5L4LA 4CCWA 2JCVA 1CG6A 2F1IA 2JZNA 2IV3A 1W4AA 1X1CA 3E48A 2GZDA 3LDUA 4OK3A 3LQ1A 1DQYA 3UUWA 2Q2OA 4Z0TA 2UYOA 3H5IA 5IKPA 4F2PA 3EGOA 4OTZA 1D7OA 4LOKA 3OLCX 1XA3A 3QV2A 2C5HA 1JDNA 1CERA 4XX1A 3ZCVA 1EWTA 3LC1O 1HETA 2DBRA 4HI0E 5CFQA 3TECE 4MWCA 1RIFA 1ZMRA 2FEAA 1OFIA 2O14A 2PEZA 2M6RA 2RCNA 4UUQA 5KMGB 1CRZA 3KJZA 4KUGA 2ID4A 4JASB 1NHWA 4TV9F 5CA0F 1ABFA 2YY6A 4XE5A 2QTWB 4HOYA 1NZDA 2FDCA 1PIWA 5TLSA 4HQLA 2BR4A 1QTIA 1BX1A 1NW7A 2CHGA 2B3TA 1UR5A 4M99A 4TZ0A 3G0DA 4N6NA 3PEFA 4AFNA 5AHOA 4KMMA 1X1RA 3OD5A 4RQUA 4OKIA 2W71A 3ZV5A 4E1BA 3FWZA 3PNSA 1GKKA 1US8A 3DAFA 2EYQA 3MD0A 1W76A 3W5BA 2PFKA 4K5QA 2OO3A 2J4FA 2JEZA 3ADOA 5KSYA 2CV1A 5IDYA 1A69A 4HQ0A 1WM1A 4DY4A 1R4MB 2GASA 4BYGA 2O3RA 1UKVY 1VE1A 4GOKA 4LRTB 3BX1A 5A02A 4B6GA 4BQEA 1QO0D 1D2RA 1KJ9A 1I4TD 2BR5A 2V4UA 4D9GA 5JPCA 2IHUA 3CZQA 3DCIA 5EZ6B 3K0SA 5IFKA 1BNCA 2FMXA 4IDEA 2UV8A 1R0WA 2C8LA 2RG1A 4OXKA 4QPPA 4YXWA 3I04M 3BTOA 1JHDA 1UOPA 2H51A 3BE8A 1HE8B 3PA8A 1WCV1 5C5DA 4Q3OA 1EK1A 1QRRA 1PN3A 2IW3A 4EFDA 1TUBA 1TYAE 2GUWA 2B92A 3A32A 3D8NA 2ZUFA 2X1MA 4CKBB 4P7FA 1MQ9A 2A5JA 3DUFA 3QPWA 3ZOZA 4EA6A 2FE4A 3ERCA 4KR6A 1ETUA 3NHJA 1N36B 1MP0A 2JLYA 3Q8KA 2AJDA 4M83A 1JDJA 1PJ2A 1U28C 2Z0MA 1E0AA 3G0IA 1HX7A 5FF9A 3VPHA 4LSWA 3G8AA 3J7TA 3JVEA 3P20A 3PCTA 4CM4B 3KPUA 3LY8A 4DV7B 3L8ZA 1R18A 4X7BA 4FVTA 3FUVA 5GVRA 3UO8B 2WAYA 3EGEA 2P30A 3OG9A 3RFUA 1K2WA 4R3UC 3OEHA 4I3FA 2ZIXA 4B4OA 4V02A 3HP1A 1NC3A 1U2TA 2ESRA 3OY7A 5CB4F 4YCJA 3CX4A 2BFDA 3CNOA 4LJLA 5KOYA 3IR6A 1IBLB 4P4SA 4R1SA 2HHHB 1K4MA 5EIFA 1JQBA 5ALYA 1L1EA 5JAMA 2RE8A 4DJJA 1E6LA 4EUSA 1RXVA 1JKFA 3HN6A 4F5EA 2P11A 1FFWA 4CMKA 3IAM1 4YMWA 4ZVSA 4DCGA 3E9ZA 4CTJA 2EGGA 5FULA 4B75A 4IHKA 5JS7A 4XFDA 3H05A 3VAZA 2VJQA 4UAVA 1YB5A 3GVXA 3U6KA 2QA5A 2F90A 2JS7A 1Y5IA 4U2KA 4R84A 4WERA 2UYHA 1EGHA 5HE9A 3HUTA 4FKZA 4OQDA 4UMVA 1JEYB 3EH1A 1GNVA 3AO0B 1G7CA 4EF5A 1DCMA 4YJ3A 1W4CA 2KBEA 2CXXA 4LZPA 3L8HA 3CQ9A 3E7FA 3W2EA 1JHOA 2H1RA 3PXEA 4Z4HA 5KX5A 1XMVA 3GFFA 3DR3A 3N7UA 1OHHA 5D51S 2FPGB 4HDOB 4LW8A 3YASA 4R8SA 1W1WA 4WSOA 1SBNE 2EX4A 1UT8A 5M04A 5DASA 3N9IA 2RDMA 2NACA 3GVPA 5AP9A 4P7BA 1ECCA 1GN9A 2C98A 2R8OA 4B45A 4YS6A 5JDIA 2FVYA 1MC4A 1P5JA 2DY0A 2EATA 3EJ6A 4B2LA 3FUWA 1DOAA 5TGZA 3WIEA 4C0WA 1H2XA 2P9BA 2Q6KA 4MVJI 3W2GA 2INGX 2HQRA 2RI0A 5JBQA 2F1OA 1WB6A 2PUWA 3GEHA 5MF6A 2XUFA 3PWTA 2ZPAA 1TC1A 3IERA 1IATA 2L17A 4RS4A 4HWTA 1FDTA 4DEYA 4U9IS 1KNXA 2Q99A 4IFTA 4YASA 3TAUA 5LMZA 5CJ2A 2EKPA 4FMDB 5CVUA 2OD2A 4XH9B 4AKSA 4WZAA 1A3CA 2P8JA 3HM2A 3LYLA 1OH5A 3I6BA 4LFAB 1Q5PA 2QTHA 2AJ8A 4I50B 4WZZA 3PQCA 3OTGA 1KO5A 1GKUB 1WHTB 5G41A 1CS4C 3AH8A 2WJIA 3IJPA 3NTOA 1RM5A 2VHEA 3H42B 4H15A 3VBEA 4JX9A 3AJRA 2HJVA 2RAPA 4ZN6A 5FTLA 2VPYA 3SMVA 1CUDA 1ZJ5A 3CH6A 2K2WA 3UJ9A 2IZ6A 2CUZA 1GPWB 3CYFA 2GN0A 4MWGA 5IT9A 4JNGA 2XYQA 3RVLA 2W43A 4MLCA 2J9XB 3NMUF 1PDOA 3DZJA 1Y63A 4J1SA 4I5GA 1JQAA 3UM9A 3KRTA 3A06A 3KV1A 4IJKA 4X92A 3AIMA 5EZYB 5HMMA 4IIEA 4IFBA 3L40A 4TLEA 3SQOA 3WNQA 4XB6B 4E1AA 2CJXA 3RC7A 2R1VA 3FCUB 1V8PA 4ZI3A 1VGVA 1YBVA 1HYEA 3NT5A 3ZDBA 3SGLA 2IUYA 3ABRB 2NYRA 4E7PA 2DQYA 2LBPA 3ICCA 2BMFA 3R77A 4TS3A 4WXPA 1VMIA 3E9QA 3N28A 4MS3B 1TQDA 4PXYA 5FPKA 2OBFA 2H4YA 3M6IA 4MYDA 5BW5A 2E18A 1RFLA 4LF4B 4QSHA 3F2VA 5JO0A 3PC8C 3BUSA 5IP5A 2ARKA 4B8ZA 1ZGGA 2C07A 4JT4A 2YZNA 2D5AA 3R6DA 4UZEA 4YAFA 2GHTA 1I3LA 2VEDA 4DBZA 2OHJA 4PN3A 2A9VA 5JS8A 2BC9A 2FETA 4KQ6A 4Q7EA 1DS6A 1IZ7A 1E1NA 1E5DA 1EZ4A 1SC6A 2O7QA 4MROA 5CLLA 1G6Q1 5E6UB 4B44A 2L0XA 2ANCA 3P71T 2Z2JA 3TLKA 5B4TA 3AYZB 2XE6A 2RGDA 4RVHA 1OASA 1CZUA 4A03A 5HUQA 4FFDA 4KK4A 2SHKA 2QBYB 3KQLA 2IYTA 3AYXB 3L49A 1HF3A 3B7WA 1GFWA 1TAUA 4ZT2A 4JZYA 3AB7A 1APBA 4BP1A 1SCUB 5D5HA 3E3LA 5JHHB 2GEDA 4NJEB 5BPFA 1WCWA 2ECPA 2QLMA 4KX3A 3DM5A 3ITNA 2A4KA 4CGYA 4ZDIA 1BJRE 1T0IA 1XT6A 2QNBA 3DV2A 1Y82A 3PGVA 4RSMA 4CMAA 1RR6A 4Y9DA 3PDCA 5K0TA 5KOJA 3CR3C 2CNBA 4RWZA 3AEUB 4C08A 3NHAA 2GN6A 3H9EO 4MUNA 1LF0A 1WNFA 1X80B 4XZ3A 5T4EA 1VGRA 4PQEA 1EH5A 3DHNA 2G63A 2J48A 4JOBA 3MTBA 4HEA6 1H8EA 5BW4A 3WADA 1VGQA 2QZPA 2CMHA 3KKLA 1KQFA 4REOA 4RPGA 3R8FA 3SEAA 1C2YA 2Z2KA 4L5JA 3DJFA 4YWHA 5I7AA 5KOHB 1TQ4A 4MLDA 2G70A 1AKRA 1ZOLA 2QK4A 4YT4A 2FYTA 5ALMA 1B00A 3QMPA 1TVMA 5EL0A 4W5QA 1IBRA 3PGA1 4L57A 5D86A 2R87A 3U4HA 1JLKA 1Z4QA 5CB4A 3S6JA 4LSGA 5K45A 5KTSA 2E5LB 4F6RB 3INRA 4DCSA 4IKPA 4J90A 4KW7A 4AJ9A 3DLCA 4ASUD 4EF4A 3HO6A 4F5ZA 5B30A 1Y9ZA 5LBUA 1R00A 1XEFA 3R3HA 3ZIAA 4JP5A 2GPYA 3LYHA 5LQRA 1J90A 1TF2A 3EG9B 2AOUB 1BMQA 3OU2A 1GCOA 2WT8A 2CLLB 4P4NA 4JH0A 1IY2A 3QKTA 4K46A 4MA5A 2OXCA 5K3DA 2P9HA 3ZE7A 5CX4A 1D4ZA 3UC9A 1AK2A 1BFKA 4DLRA 5CB0A 1QC5B 1E8MA 5TV2A 1XQ9A 3QITA 4ZAGA 2IXDA 1L7MA 1ONPA 3QI7A 3RVKA 4C3ZA 3DE4X 5EOVA 3G8BA 3GPIA 3GWZA 2IEGA 1QF6A 1O5OA 4IWXA 1Z4PX 1SCDA 2E5WA 4Q3CA 2Q2QA 3GMDA 3QYPA 4GPD1 3IXQA 1XN1A 5LSAA 1J5PA 1YZVA 1NVWQ 3W8FA 5A4FS 4TLBA 2XZTA 3IEMA 4BNLA 1OFTA 4LQLA 4LX8A 4EW1A 1E8DA 1K08A 5K51A 2EKBA 3LP5A 4GYYA 3W3AD 2PZBA 3WV4A 5INTA 5H82A 3A11A 2G72A 1FSSA 2WUEA 1W9HA 2C5GA 1UDWA 2D1FA 2XZDA 4IIHA 4TKVB 4BNJA 1PR3A 2YXPX 4HX2A 4K9PA 4DJFC 2ZTVA 1I80A 5B1YA 3VU1A 1YUMA 3WY9A 5IPFA 5B58C 5JYBA 3BHIA 1IC6A 2DPGA 4GIBA 3OU7A 3S0JA 3GPCA 1KAQA 1GZHB 2XE7A 3E9EA 1SXPA 1D5WA 2CFRA 5AI6A 1NLFA 2QJRA 1K06A 5E0KB 2G9NA 4CM6A 1P0MA 1PI3A 3ETNA 2K6GA 3O9MA 4LN1A 3E8MA 3TX6A 1MXHA 2D6FA 4WWHA 4QG3A 1AB5A 4LYHA 1JE0A 4ZT3A 3EF3A 1EXWA 2DUJA 2R6HA 3TIVA 1CZRA 1W85A 3TXAA 3KQHA 1QP7A 1LS1A 2JAXA 2WHEA 3HY4A 3H7AA 4P2GA 3BWBA 3R3SA 3GT7A 3LF2A 1T8SA 3T15A 3EGVA 3R3JA 4IZHA 4UASA 4FEGA 2O5RA 4BBZA 3A1VA 1VKOA 2G8LA 2H17A 4XIFA 5ARCA 5FQOA 3IX7A 4CI9A 5B1EA 2ID8A 2WIKA 4G07A 1HEUA 2FNAA 4JVLA 1TLTA 3V3KA 2UZ1A 5JXIA 1SVSA 1XZ8A 5ALDA 4EI9A 1U1EA 2ZLBA 5CYFA 3OQIA 2WB4A 3VZDA 1D6NA 3GH1A 1THZA 1NNUA 3ZXXA 1UPTA 4TMWA 1XMPA 3CN7A 3CONA 1PGQA 2IP4A 1N2OA 2D8MA 3K0AB 3OM9A 2OOSA 1GTVA 1Q77A 2PYZA 2RB4A 3VU0A 3WLNA 4EPXA 3TOXA 3GNTA 3VDQA 3P2IA 3IIIA 1WVGA 4MVJF 4R8MA 1W581 2AFIA 2BZ1A 1E77A 4NJMB 3UJ6A 1LFAA 5HF8A 3EF1A 3L41A 4I1PA 3EFOA 2FXIA 1CULC 1L4MA 2H63A 2MINB 3I23A 4M1ZA 4RAOA 3V3TA 4K9OA 4Z0PA 1FMLA 2EWWA 4B87A 2VDLB 4LJ7A 2VYND 4X63A 2C7PA 4Z3OA 4F12A 2Y4NA 3G2IA 4L5IA 5EUQB 1U7DA 4IR7A 3EEQA 2XGOA 2PA3A 4N48A 2RI1A 4MKFA 3JALA 4XJXA 3RAEC 1I10A 1RJFA 2RH8A 2QRVA 3C3JA 3EASA 4JLVA 3DFUA 4UAUA 3U48A 1P2GA 4DLNA 3VSCA 2AHRA 3KYJB 2DJIA 1VYHA 16PKA 5H1YA 1N77A 4TLAA 4ZQGA 3TOCA 4LXYA 4BECA 4RPHA 4JHXA 4MQ5A 3PJFA 3R0JA 2I66A 2YHUA 1EFLA 3RBZA 1PZFA 2F59A 1PJBA 2VH1A 3HCDA 3STUA 4QULA 1D0VA 2NUPB 3DOJA 3R7LA 4CLDA 2WTMA 3U16A 4RSHA 2UYCA 1W75A 2J6HA 4OSOA 3DD5A 3D6AA 4LHYA 3ZWXA 3RC8A 1ZSYA 2IU3A 3UAGA 2NYAA 2IXTA 1HPLA 1QYVA 3AJ9A 4MIEA 1Q6YA 4X8OA 1TLLA 1J07A 2GD1O 1M2WA 2QX4A 4DA7A 2B4YA 1B8OA 1FVXA 1IBSA 2QEQA 3CPEA 4G1FA 4R7GA 4NFLA 3C3BA 4FN5A 5FD8A 3ZS8A 5EJ6A 2ZK7A 3JWIA 2JGIA 4RTJA 1TJ4A 2HLDA 2PCJA 2X9LA 4URYR 5KYGA 2O8BA 1K8XB 1PK9A 4RK4A 2XMCA 2CHQA 3MT0A 3FHLA 2FN9A 2PK3A 2ZSUA 4CLRA 1MPTA 1ZLXA 5EJEA 4DF3A 1FRFS 5EJ5A 5A0TA 2Z6QA 4GC5A 5ED0A 1A9ZA 1G0OA 2QG6A 2QM0A 3PPXA 4DDVA 5E6SB 2BKVA 2ONZA 1W5BA 4DBLC 1GG9A 4YJFA 3OZDA 1N5RA 5AIBA 4LBYA 4V0MA 2J7PA 3QW2A 3TVDA 1XMXA 3BXXA 5ALKA 4O5OA 8LDHA 2QVYX 3D43A 1UFQA 1MXFA 4CIDA 1M74A 2EKQA 4KV9A 5E0OA 3VKFA 5BWMA 1EFVA 2P6PA 3VR6A 1FS6A 2J31A 3M9LA 4KIJA 4B7ZA 4XWGA 3D2LA 1EE2A 1OH6A 1UMBA 5DGIA 5BNZA 4A23A 4WKBA 2MSKA 2YVAA 2RGNA 3L9WA 3N58A 5CM9C 2NVBA 1CFJA 2JKYA 3ZBUA 4O08A 3AV0B 5BY2A 1KH2A 3IQDB 4ETMA 5BVHB 1SUEA 1DELA 1A4RA 1S96A 4OHKA 3GEDA 1QJCA 1R0RE 2OBBA 2EYUA 3AJAA 3GLKA 5IYZA 3K1AB 1ZONA 1UZMA 3HA5A 3ONVA 3QOXA 4HVAA 5GZ6A 4LYYA 4D6YA 3R4VA 4QTTB 3NRBA 3V8BA 4DJ5X 1C0PA 1NMYA 3PQ7A 3TR0A 4HL6A 1KPHA 1TQ2A 3EEFA 2FPRA 3B82A 3HP7A 5JEDA 3C70A 1A71A 3E35A 3HJUA 3JTEA 3TZHA 2Q0HA 5DBFA 5IVKA 2HK9A 2X22A 1HORA 4IUCS 4S2EA 3VYWA 4QWMA 4CKCA 1L4FA 3ES9A 4G23A 1QORA 4D4GA 2V4ZA 1H2ZA 1KI6B 4ZOLA 4O25A 4PZPA 3RE1A 1HR0B 1P1CA 3TQCA 5F7XA 2EZ9A 3LHSA 4YAWA 1KO7A 1LPMA 1DNPA 4YA6A 1E4EB 1UPCA 4IUYA 1QPBA 3GJ7A 3R9KA 1O4WA 3DONA 3GQBB 4IH4A 1NW6A 5KNBA 2XT0A 2JD2A 1LV8A 1M2OA 1NN3A 2AOTB 4G2TA 3UEOA 4HXEB 2HA0A 2VAVA 1S2MA 2O3UA 3AV3A 4LVNA 2OG2A 4UHDA 1UKZA 4GM1A 5EMKA 3GQVA 4E51A 3A9TA 4B4WA 1QQ6A 1PYGA 1RU3A 2LZ0A 4DB4A 2VSXA 3UJ8A 4WFKA 1WRBA 2TSYB 2CD9A 3RK0A 4BP9A 2IV2X 4F6CA 1A27A 3CT4A 4L3WA 3B3FA 4L78A 1TCVA 2WHQA 1G291 1G8HA 2H29A 1XCPA 4QICA 4OAPA 1OXBB 1WLYA 2NO1A 2PR2A 4JSYA 4A2QA 4BO9A 1AZTA 1KDPA 5ECWA 4MGZR 2JAWA 2FQYA 1JR3E 1UDCA 3D6TB 4MV7