2JL1A

Structural insight into bioremediation of triphenylmethane dyes by citrobacter sp. triphenylmethane reductase
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
287
structure length
287
Chain Sequence
b'FSIAVTGATGQLGGLVIQHLLKKVPASQIIAIVRNVEKASTLADQGVEVRHGDYNQPESLQKAFAGVSKLLFISGPHYDNTLLIVQHANVVKAARDAGVKHIAYTGYAFAEESIIPLAHVHLATEYAIRTTNIPYTFLRNALYTDFFVNEGLRASTESGAIVTNAGSGIVNSVTRNELALAAATVLTEEGHENKTYNLVSNQPWTFDELAQILSEVSGKKVVHQPVSFEEEKNFLVNAGVPEPFTEITAAIYDAISKGEASKTSDDLQKLIGSLTPLKETVKQALKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRIPHENYLMETHANE REDUCTASE
publication title Structural Insight Into Bioremediation of Triphenylmethane Dyes by Citrobacter Sp. Triphenylmethane Reductase
pubmed doi rcsb
source organism Citrobacter sp. my-5
molecule tags Oxidoreductase
total genus 110
structure length 287
sequence length 287
ec nomenclature
pdb deposition date 2008-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05368 NmrA NmrA-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2jl1A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2jl1A02
1MG5A 4CLRA 3KHUA 2HLPA 4ZU3A 1L7DA 2FWMX 1B8UA 1E5LA 4R5HA 2Q2WA 2NSDA 3ZU4A 1KVSA 3F1LA 1NVMB 5HRUA 3DOJA 3D4PA 1YB4A 4KTVE 3DZBA 1EK6A 1PZEA 3WNQA 2HK9A 4CM3A 3FPLA 1L7EA 2BFOA 2I3AA 1SPXA 1PGPA 4UVDA 2X0IA 3FPCA 4IS3A 2D1YA 2NVBA 1G6KA 4NG5A 3RSHA 3RUFA 2BMAA 2HUNA 4CMJA 4B4OA 4NK4A 3T4XA 3RWBA 4IDBA 5BR7A 2QRLA 1EUCA 2EKLA 1P0FA 3GOHA 1RWBA 1QXSA 2O48X 3MCVA 4TWRA 4GBJA 3I9NA 1X13A 3TOZA 4J4BA 3TPCA 3VZRA 1E3JA 1ZK1A 1NHGA 4OXYA 3ZHZA 1X14A 4BNIA 3H7AA 4AJNA 4XGNA 1N1GA 3JQBC 4XJSA 1VRWA 2X0NA 4WCFB 1Q0LA 1VKOA 3E9MA 2UYYA 3KXDA 1FDVA 3WDSA 2ZKLA 3PFWO 1IPEA 1SO8A 3SEFA 1IE3A 4UUMA 5C7LO 2JD1A 5MGBA 3DL2A 4P4GA 3IKVA 4QX6A 2VUUA 1BXGB 1GAEO 2O3JA 3MOGA 4HADA 3IOYA 2HO5A 4A0SA 1NQOA 3HNPA 4QQRA 4IXWA 4D79A 3JTMA 2O3RA 4NH4A 5L4SA 2ZK7A 3D0OA 3GT0A 1HF3A 4BV8A 2P91A 3JSAA 2VWPA 2O4UX 4GL4A 1H94A 3WIDA 3EMKA 4DC1A 4DUPA 1C1XB 2GDZA 2ZQZA 4MVJH 2X8LA 4ONEA 5DOVA 4PRLA 4Y6RA 5JCJA 3FBGA 3LZ6A 4OSPA 1D1TA 4WOJA 1DSSG 4XDYA 1ISGA 3PXXA 4FR5A 3VC7A 2FZWA 1IHXA 2YZ7A 4LVUA 2NTVA 3AU8A 4YAKA 1V3UA 3GFGA 2NUAA 2C2XA 2QZZA 1HSZA 1W8DA 5A5FA 4EGFA 5L7WA 2W2LA 3R0IA 3O8QA 4RQUA 5CEJA 1WNTA 1YXMA 4XWYA 1IPFA 3E6AA 1HE3A 1SEVA 4EUHA 2GR9A 1BXZA 1HEUA 1B16A 1MLDA 4LK3A 3UW3A 4R69A 3JQCA 3U5TA 4XEHA 1D8AA 4JNKA 5I8WA 1YVEI 5JAIA 3G1UA 1P74A 5ILGA 2JHFA 5B4VA 4MVJG 3FWNA 4OKNA 1CEQA 2H63A 3NJ4A 2CVOA 3H5RA 2XXJA 4YCAA 2JAHA 1VJTA 2OZPA 4KUHA 2Y99A 4RPLA 4UUPA 5TT0A 3S2FA 4X54A 3PYXA 2NWQA 3V1UA 1MX3A 1U4SA 1WDLA 3BTUA 2YV1A 4K6FA 4D46A 2G1UA 4BNUA 2X58A 4BO5A 1CQIA 5IF3A 1E1MA 1ONNA 4FFNA 4GAEA 1WMBA 3OIFA 1C0IA 1BVRA 1QLHA 2GGSA 3G3EA 4BS9A 4RLSA 1UXIA 2NQTA 3R1IA 4WCDA 4KQWA 2O3TA 1PS8A 3TZKA 5ADHA 5IXYA 1U3VA 1DAOA 5TS3A 4EW6A 1ADFA 5I9MA 2JD2A 4WLNA 3ZHYA 2D3TA 3B70A 2QZ9A 4UUOA 1ZJYA 3ITKA 4Q39A 3U4IA 1KERA 1X7HA 3RUEA 5HTOA 5T6BA 1IOLA 4FC6A 5BSEA 4E21A 1VL6A 4JCOA 2Q2VA 3VHRA 4E2ZA 1N2SA 4Y6PA 1MFZA 1Z75A 4XDZA 5TF4A 1EBFA 2ZCUA 1P1FA 3JYQA 2BFAA 1D1SA 4CMAA 1E7YA 2E49A 4DL9A 1PX0A 3KYDA 1FJHA 5JY1A 1YOVA 3CH6A 3D3WB 4N54A 3ZWMA 1JN0A 3MZ0A 2W90A 2C5AA 4JIGA 5I9LA 3WTBA 2PY6A 5EMHA 5A06A 2JHGA 3WJ7A 4BGUA 3CE6A 4GSLA 5GZ3A 3JQEA 4ZHSA 1Y5MA 1DXYA 3JQ8A 4CR6A 2VHWA 3FBTA 1I3NA 2JCYA 3GGPA 3JD0A 1HDZA 3KSZO 2C07A 3K73O 1XEAA 3P2YA 4B7UA 4S1VA 3GGOA 4CM4A 5BSHA 4UVEA 2ZIZA 4Y6SA 3JQAB 4FSHA 3UGKA 4BMVA 3IS3A 3I6IA 2XF8A 2DQ4A 3H2ZA 4MKXA 4R54A 3NEPX 5EERA 4AJOA 4JX8A 4IBOA 1U3UA 1R0KA 1Z6ZA 2PFGA 3H6KA 4YT8A 3I9OA 3I9LA 3DBRA 1PIWA 3PLRA 1YQDA 4HY3A 3KRTA 4ND5A 2QRKA 4OM8A 4HFNA 2FZEA 1HKUA 3LQFA 3VH2A 2WYVA 4BGIA 4CUZA 3W4JA 2W98A 2JFGA 2PZKA 4TRMA 1FF9A 1KEWA 2BI8A 3V1TC 2YQ5A 3ZZNA 4BNXA 2IRWA 5IAAA 3QWAA 3CTMA 3L6OO 4IIUA 4J9VA 1Q7GA 1PGNA 3DBLA 1ADGA 2QYSA 3S2EA 3HADA 1KEUA 5FI5A 4OXKA 1UXGA 4E5MA 3GNSA 1YH3A 3ZWYA 1EVIA 2CVZA 4J4HA 3BHMA 4IDCA 4IJWA 3ASVA 4AJEA 1ZEJA 4R51A 2JD0A 5DP1A 1DOHA 2H6EA 4RLHA 5JSFA 1LSUA 1XGKA 2YFHA 4FN4A 4R1NA 5C7OO 2X9VA 3H4VA 5L4LA 1EVZA 2P9GA 4IM7A 4UVHA 5G0TA 3UICA 3VH3A 1Y7TA 4FCCA 4U8GA 4CMIB 3TFQA 1IZ9A 4P4LA 2O50A 1C3VA 2PGDA 2ZJ1A 4DC0A 2HMUA 1HXHA 4GX0A 1NM5A 2DVMA 3OQBA 2DUUA 1ID1A 4LGVA 4Z9XA 2BLLA 5DN9A 5H81A 1PZFA 1U2DA 1SOWA 3BZUA 5F21A 4J3FA 1YKFA 1ZMTA 4YA6A 4O5OA 4YTEA 1LC0A 1U3WA 1ZVMA 3PQDA 4KMSA 1W0CA 1U2GA 2JFFA 2OMEA 1IY8A 5KIAA 1LU9A 4MVJD 3FSRA 1PWXA 4U0JA 3WYCA 3H5AA 3ZU5A 2LDBA 2IXAA 4NBUA 5T8KA 1OMOA 1YGYA 2CF5A 2GRAA 4OGWA 3QWHA 3D1LA 4C7KA 4P8RA 3Q3CA 2SCUA 3LLVA 3PYMA 4XYEA 1RPNA 3OH8A 3BA1A 1Y8QA 4ALKA 4NJMA 2QHXA 5L7TA 1QV7A 1H6CA 2D2IA 1A27A 1C1DA 2Z1NA 3K2BA 5BNTA 1ISMA 2ZYAA 2B0JA 4L74A 3E9NA 1DRUA 3SLKA 3KOUA 1PGJA 1LXCA 5HA5A 4OIMA 2AA3A 1MB4A 4JK3A 1NWCA 2EEZA 4CLHA 1H5QA 2VTEA 3JQDA 2QX7A 3VH4A 2YYYA 3VAZA 1ML3A 3AJRA 3UH1A 5IFLA 1NAIA 3UCEA 2W8ZA 2IZ1A 1HYEA 1B15A 4CMCA 4RCVA 4IQGA 3TZCA 4JLWA 5DOZA 4J1SA 3ANNA 4YJGA 1WLYA 5U1PA 4F6CA 4YBZA 3T7CA 2CSUA 2AXQA 4GH5A 1GU7A 4BKOA 4GPD1 3EVTA 1K6XA 2PZJA 1XSEA 4GMGA 4QSMA 5T8KC 4EJ0A 3RASA 4BO4A 1JAXA 5I8ZA 5LC1A 1Y9EA 1PS0A 3ZI0A 3GVXA 4L4RA 1QV6A 3PLNA 3QY9A 4OXNA 1PQWA 1JVBA 2DBVO 1K3TA 4XX0A 3ROPA 2VYND 4YT4A 1UZLA 1N5DA 5DBFA 3FD8A 3PGXA 1PJSA 4DLBA 1T25A 5DULA 2Y1OA 3P2OA 3U3XA 3AI2A 4B8ZA 5BSFA 1UJMA 1H2BA 1QLJA 4PLFA 5L3ZA 4YR9A 5G2OA 1KY4A 4CQMB 5LDGA 5KJEA 3GNQA 4FDAA 2FRDA 3TN7A 3FTPA 5L95A 2X22A 1HDOA 4HFRA 4TKLA 3FRJA 2JL1A 1P1IA 4EEXA 1GEEA 3U9LA 1J4AA 1D4FA 1A72A 3AY7A 3HDQA 3JV7A 4DA9A 2E37A 3QWIA 1I3MA 4RF5A 4XGKA 2G5CA 3L4BC 3OP4A 4Z0PA 1E77A 1SZJG 1DC3A 2Y67A 1NASA 5CDYA 1BTOA 3JQ9A 3FF4A 3ZWBA 3QQPA 3GDOA 5KVVA 4R4JA 2IEDA 4HUJA 3MOIA 1HZZA 3E03A 4D45A 4BNGA 1M67A 4W4TA 1NX6A 1ZJZA 1LDNA 1E3WB 3WGGA 1VPDA 5IDYA 1NTOA 3GY0A 1VSVA 4CM9D 4WJZA 4ROSA 3AI1A 2PV7A 1B14A 2AE1A 8LDHA 1B3RA 4YACA 3T4EA 4XIYA 1PU2A 3IQDB 3QWBA 2B5VA 3ANMA 1UDCA 3KTDA 4IMRA 1K89A 3HUDA 5TC4A 5L4NA 2FR0A 2UUOA 2X0RA 3FN4A 4RV9A 1A71A 1XWFA 5F1PA 4IGEA 1BXKA 5BQFA 4GKVA 5G0SA 3PWZA 3ONDA 4D3FA 6LDHA 1IULA 3TWOA 3IL2A 2HAEA 3E48A 1AN9A 3MJ4A 2YHIB 1ZO8A 3JQ9C 2B69A 2NTNA 2DPHA 3GG9A 4PG8A 1YQXA 4WNIA 4IXTA 1ADBA 3MJTA 4JP3A 4PLZA 2WYUA 1H9BA 1WAMA 2EJWA 3FR8A 2WJPA 1N8KA 2WD7B 1BRMA 2NV6A 4R16A 1IL0A 2Y1DA 3HDHA 4LVCA 2HMVA 4A10A 4D42A 4CQLA 4I9HA 4BNZA 5K6AC 5DDIP 4FBGA 3QVSA 3ZWNA 4Q9NA 1PR3A 1LSOA 3DTTA 5IDXA 1PL7A 1YO6A 3ZWWA 4A27A 3L77A 3AUAA 3WWYA 1NPDA 1KETA 3A4VA 5FI3A 3VZPA 4Z9YA 3S2GA 2YUTA 2W2LD 2NVUA 1Q7CA 4YVFA 2A92A 4E2XA 4E33A 1P9LA 1CJCA 2I66A 1BW9B 4J2HA 3WWZA 2X23A 4BKUA 1U4OA 2YY7A 4E13A 4PGFA 4ZQGA 5CHEA 4R1SA 3I83A 1C0PA 3RUDA 4GLOA 2NU6A 3PHGA 3VPXA 4N5MA 2H5LA 4U7WA 3VPHA 3N58A 4RPJA 1P45A 3TNLA 3BXXA 3HJAA 1LSJA 5GZ1A 2J5KA 4S3MA 4QO7A 5CEEA 3K2EA 4ND2A 4J6FA 2CMDA 4J43A 2VZ8A 1NVGA 2VZ9A 3PVZA 1T2AA 4MINA 4GGPA 4MVJA 4CLRB 5L40A 3MTGA 4OJNA 2DC1A 1E3SA 3NGLA 4LRSB 3CINA 3WSWA 5EPOA 2H9IA 4RVSA 2Z5LA 1MC5A 1ZW1A 3OJLA 2OXIA 4U6SA 5AXCA 1LDGA 2J3IA 3QV1A 4F46A 2Q50A 3DOOA 2VT2A 1VC2A 4BKRA 3JD2A 4DBVO 1CF2O 1BGVA 1LEHA 4GX5A 4D44A 3PZBA 4IZIA 3K6JA 3INGA 2JAPA 4XCVA 3RUCA 3CZMA 3TFOA 1IUKA 2BELA 5CP8A 3BMQA 3GAFA 1LJ8A 4R68A 4CMGA 3H9JA 3BIOA 3H9UA 1PTJA 1EK5A 1Q1NA 4CL8A 4QXMA 3GLQA 1UDBA 2C82A 3L6DA 3PRJA 3TJRA 1K5HA 1UXKA 2HRBA 5FYDA 5THKA 1P0CA 3PTZA 2NQ8A 2QQ5A 4XZ3A 1RM4A 4RVDA 5IG2A 1EZ4A 1T2CA 4MKRA 1HDCA 5EESA 3PJFA 3DZFA 1QKIA 4ZQHA 2ZTUA 1HYHA 4GVXA 5EIOA 2PLAA 1N7HA 5A9RA 2GLXA 1YBMA 1HYGA 3W6ZA 4BKQA 2UVDA 1LDYA 3V2UA 1MA0A 2AG5A 3PWKA 7MDHA 3PGJA 2WSBA 1PJ4A 3L4SO 1R12A 3ZCXA 1V8BA 1DIHA 1JWAB 1RJWA 2XXBA 3H9EO 4A2CA 3IP1A 3PDJA 1M6WA 2AQ8A 2J6IA 2VYNA 3GFBA 1PL8A 2VRBA 3QE3A 5JO9A 3DHEA 3IJRA 5ITVA 4L8VA 5DBGA 1LA2A 1XIVA 2VUTA 1Z45A 1ZFNA 4OQZA 2EP5A 5A9SA 4KDEA 3GAZA 4WK6A 2JKVA 4ILKA 2UV8A 2D5CA 4RF4A 1F06A 3PJEA 2P2SA 3RKRA 1YBAA 1WP4A 4XJTA 3LT1A 3DFUA 3NTRA 2B4QA 4KWHA 1ZK2A 2DT5A 1EQUA 1A9YA 2VUSA 4CM8A 3QWFA 5B4UA 3SBOA 2QG4A 3UOGA 1XYGA 4HFMA 3O8QB 4AJKA 1OZAA 1N92A 4RF3A 1JTVA 1OOEA 1MXFA 2X5OA 3ZDFA 4GI2A 4TMFA 2LDXA 4BO6A 1I2ZA 2C59A 5I7FA 1FDSA 4M55A 5JAMA 3F4BA 2AHRA 1LLCA 1RM0A 3PEFA 2O3SA 4TQGA 2C5EA 4DPKA 1V9LA 2Q4EA 1LRLA 2BRUA 3ANLA 2OL4A 2B37A 4J91A 1QYVA 2BKAA 1YL6A 3C7AA 3WNVA 1T4DA 1ZXBA 1UZMA 2PGJA 4UREA 4CM9A 4E3ZA 4A5OA 3GZ4A 3SC6A 2IZ0A 2AMFA 1NFRA 2YHUA 3VVBA 3KYBA 3ZNQA 1ULUA 2ZB7A 3X2EA 1I3KA 3MJSA 1I2CA 4ALJA 1UZNA 4NI5A 4AVYA 4HKTA 2PNFA 3GRKA 3F5SA 1G1AA 1ZSNA 3GUCA 4FW8A 4EDFA 3Q11A 1EVJA 4GLLA 2GN4A 3RC2A 2E4AA 4CM5A 1HT0A 2FSSA 2I99A 4A7PA 4B4UA 1NPTO 5IN5A 4XYGA 4Z0HO 1VJ0A 3OJEA 1GTMA 1GR0A 3KVOA 2Q1UA 1X15A 3DAFA 4QUKA 3NT4A 1ZKMA 4M8SA 4R9RA 3ZWAA 3ZW8A 3RBVA 1T2DA 3GF4A 1P31A 5B4TA 3EGOA 1EE2A 1PS9A 4B7XA 2BFPA 2R00C 3DTYA 3U4CA 3GZNA 4AJ4A 4XQ9A 2CDAA 4DQXA 3IMFA 2B35A 4MP3A 4DLLA 3QVXA 4Y8VA 2GSDA 1XA0A 4HWKA 4IDDA 4R3WA 1QYDA 5H82A 4U6QA 5KKCA 4E5PA 1QYCA 3KYDB 5A1TA 1YOVB 4OO3A 4EJMA 3PHIA 3WYBA 3F47A 1AXGA 1C0LA 1J5PA 1BVUA 2QRJA 1GPDG 1GQYA 4CLOA 1JW9B 1PJCA 1PR9A 1SMKA 4WNCA 1OFGA 2Q4BA 1MP0A 1AXEA 3O38A 5TJHA 3U4DA 2EWMA 4IGFA 3JQ8B 4BO0A 3CPSA 1LLUA 1VM6A 1ZEMA 3O03A 5CAEA 4MP6A 4Q3DA 1N7GA 1XKQA 4YQYA 2GN8A 2J8ZA 3KEOA 3RD5A 3GC6A 4CM4B 1PJ3A 3FNEA 5G0WA 3SXPA 2PD4A 2YV3A 4ZQBA 5HS4A 1XDWA 2BGMA 4MVJE 5A03A 1B0AA 3QW2A 1V35A 1ZNQO 3G17A 1PJ2A 4FJ1A 1RYEA 4O59O 4DIOA 5I7SA 4XB2A 3INTA 2XAAA 1HL3A 3OSUA 3I6QA 1Y6JA 3BTVA 4LRTB 3DBRB 3F4LA 2YDYA 3DMTC 1BHSA 4RL6A 2HU2A 4OAQA 1DJNA 3M1LA 3K30A 4C4OA 1U28A 3WICA 5KJFA 3PZRA 1DB3A 1JLLA 2OORA 3E8XA 4QO8A 3A28A 2Y93A 3OMLA 2PK3A 3ADOA 3NTQA 1WDKA 3VTZA 3IUPA 3V2HA 3F5QA 4FS3A 1M76A 3IJPA 3DBLB 1Z7BA 9LDTA 2Y1CA 1SBYA 3LDHA 4KQXA 3VVCA 4UULA 1L1FA 3EY4A 5IXSA 1E5QA 1W73A 7ADHA 4W9NC 3ZWOA 3VKVA 3AY3A 3JYPA 1T24A 1O0SA 1LLQA 2HJSA 4BNNA 3DZHA 3GVHA 2BGKA 5JPIA 2BHLA 3V8BA 2B83A 5A3JA 4PG5A 2C2YA 4DRYA 1ISHA 5TNXA 1BMDA 3OJOA 4RPGA 3GMDA 3C1TA 3I23A 2P68A 3VPFA 3IP3A 4AJPA 4RORA 1DAPA 2DBRA 3BMCB 3IAHA 1PWZA 3WQRA 2J3HA 2HJRA 2WDZA 4QTZA 4WLEA 4GWGA 4JBHA 3OF2A 5GZ6A 1LTHR 2OUIA 3VDQA 5IJZA 3GDGA 3VH1A 1G0OA 4FFRA 1DIRA 3OEYA 3ZNNA 1PSDA 5JDIA 2CZCA 2P9EA 4EITA 1ZH8A 4LCJA 1O89A 2DFDA 4HP8A 1TXGA 1GCOA 4BNYA 1JDJA 3FHLA 1RM5A 2J3KA 1WVGA 3GGGA 1P33A 2O7QA 3EZYA 5TRTA 3KSUA 4H15A 4G81A 1WWKA 3W1VA 4R41A 4EJ6A 2O2YA 4MP8A 1E7MA 3HZZA 1H6BA 4CJXA 3B20A 3TOXA 5ES3A 1HETA 2ET6A 1M2WA 2YDXA 5CDSA 2VZ0A 2V6FA 3DMYA 4F45A 1NFFA 2EF1A 4XYMA 2O2SA 2X86A 1Y8QB 1EE9A 4NJMB 5DBIA 1R15A 4FFPA 4QECA 1LC3A 3UXYA 2EV9A 1C1DB 2X5JO 1HSOA 4JN6B 1E0DA 3RU9A 4E32A 1VKNA 5JFOA 4J16A 4GQAA 4LSMA 2HCTA 4WCFC 3H3FA 2PTGA 3MJEA 1EBUA 1VI2A 5JAQA 2I3GA 1W6UA 3G79A 4PG7A 4XD2A 4XRRA 3ETGA 3BMNA 4Z0TA 1TEHA 1F8FA 1Y81A 2WYWA 2X1HA 3E9QA 4GMFA 4DQUA 1P77A 3R6DA 4WLOA 4BNLA 5JDIC 1LQTA 1CETA 1F17A 3AUTA 3ULKA 2YJZA 1QSGA 3GR6A 2PD3A 1ZXLA 2OHXA 4YJGB 1ADCA 3L9WA 4FQ8A 1VE9A 3ZH2A 3WXBA 1YB1A 5I9NA 1JU9A 2X0JA 2WE8A 4ID9A 2RHRA 4BNKA 5KJ6A 5THQA 1MC4A 5DCUA 4IDAA 3EUWA 4BGVA 4OSOA 1YDEA 4BB6A 4AJ2A 2EHDA 4CM6A 1NQ5A 2DBQA 3BMCA 1MFPA 1LQUA 1NYTA 4IMPA 5JDCC 5AXBA 4CV0A 4DYDA 3UHAA 3LK7A 3ORFA 3DFZA 1YBVA 5AYVA 1R16A 3ZV3A 3K31A 3GPDG 4AG3A 1GQ2A 1KVRA 2P9CA 5JW6A 1AUPA 5TLSA 4DYVA 1JKJA 4YJFA 1V6AA 2X6TA 3M1AA 1QMGA 1P1HA 3EZLA 4CLEA 2IDZA 2PA3A 3PHJA 4CPDA 3WQSB 3LLSA 2VRCA 2Y0EA 4I9NA 4K6CA 4NPCA 4XIJA 3ZHBA 4M87A 4AL4A 1YDWA 4ZQEA 3JD3A 4I5GA 2EKQA 2B4RO 2BI7A 4L75A 2Y66A 5EN4A 4WPGA 3D3EA 1DDOA 2FPGA 4M89A 1DIGA 3NRCA 4BO1A 4YWJA 1U1IA 1DHTA 1UH5A 3E1KA 3JD1A 3W4KA 3B6ZA 2C54A 5BNIA 4TRNA 2D8AA 3WG9A 2Q1SA 3JYLA 4NBVA 3WBFA 3RFTA 1HDGO 2FPPA 4IUYA 1QYWA 5JLAA 1XQ1A 2PD6A 4MKZA 3DOCA 1HRDA 4WECA 4YEDA 3SLGA 3UF0A 1NR1A 1GUYA 2CDCA 5L45A 3L0DA 3Q2IA 4DPMA 3ZWVA 4DMLA 1E6EA 1XG5A 1LX6A 3FI9A 3M6IA 1G0NA 5LDHA 2AEJA 1MGOA 3L4BA 3ON5A 5G0VA 4NQZA 5ITWA 2X7HA 4NFHA 5DT9A 1WZIA 1O8CA 3W6UA 4K28A 2VWQA 4MIYA 5KVSA 5ENDA 4D43A 5A04A 3CMCO 2RH8A 5JS6A 4HBGA 3AM5A 1B8PA 3VZSA 5A02A 4Z9FA 3KV3O 3KBOA 3ITDA 4JGBA 4BL5A 3PIIA 2AW5A 3GEGA 2GZ2A 1I10A 2W2KA 3GN2A 3F6YA 3Q1LA 4CMEA 3B1KA 4YDRA 3GEDA 1MXHA 1YL5A 3ZNPA 4UEOA 5AQ1A 4CQLB 1GDHA 3GPIA 3OIGA 1C14A 3PQEA 4ALLA 2HSDA 1S7CA 4R9SA 2R2GA 3WGYA 2X4GA 3HB4X 2YW9A 4M49A 1QG6A 1LSSA 3OEWA 2AG8A 3ADPA 5KVCA 4O0LA 3SJ7A 1XU7A 2Q1TA 3P19A 4BHTA 3AOEC 2FY8A 4WASA 3VPSA 4LISA 3VOSA 1B7GO 3LF2A 4FB5A 4BGEA 4ZICA 3EYWA 4R3NA 3IKTA 3I5MA 2NVUB 4J2OA 4OL9A 5B12A 3GNTA 4YRAA 4CV1A 5C37A 3IUSA 2BGLA 4IDFA 3KZVA 2AEFA 3ENKA 1XCBA 5A05A 1U7HA 4M1QA 4E30A 1DFIA 2GPTA 2DPGA 3DZJA 5F1OA 2GNAA 2Z95A 1LLDA 3QIVA 4URFA 4PVDA 3Q0EA 2ZTMA 1GY8A 1A4UA 2EIHA 4CLXA 2CF6A 3ICCA 1FDUA 2BH9A 2XOXA 1J0XO 3MWDB 3WIEA 4CMEC 3P7MA 5JY6A 3TDKA 2Y68A 2AQKA 4RZIA 3SVTA 2CFCA 2OFPA 3O26A 3GRPA 1W4ZA 5FFFA 5K6AA 4J1NA 5TGDA 3T7EA 3JQGA 4RDHA 1KC1A 3NT2A 3KYCB 4DIFA 4R01A 2NM0A 3GG2A 4B3JA 4DPLA 3TF5A 3U0BA 2TMGA 5ILOA 3GEMA 4IIVA 5A5EA 2EP7A 1AE1A 1MUUA 4NBRA 3CZRA 4PLYA 5CG1A 3Q6IA 3ZNOA 4KOAA 4MIEA 4Z6KA 1QR6A 4J7CA 2RAFA 4FFMA 1AHIA 3ZWPA 2ZJ0A 4AJIA 3KETA 3BMQB 4ALNA 2W4QA 2FSVA 3PFFA 3HHPA 3GMSA 3O9ZA 2Q49A 4NFSA 3DBVO 9LDBA 4CV3A 5T5QA 1NR7A 1DJQA 4XR4A 4PLCA 4I5FA 5KKAA 1OC2A 2PKRA 4BNTA 4FFOA 4A73A 4CM7A 4OKIA 1QRRA 3F9IA 3UN1A 1OAAA 3EHEA 1WDMA 3ASUA 5T67A 2P5UA 3TSCA 4CODB 4OOEA 1XELA 3AOGA 4K9DA 1IYZA 1K6JA 1ZCJA 2OBNA 4PG6A 4RQTA 4N5LA 5T64A 3BMOA 5GMOA 2BF7A 3AUSA 3WBBA 1DO8A 2I76A 4ZRMA 1GZ4A 2JCXA 1ONPA 5EJ2A 4B4VA 3I52A 1I33A 2Q46A 2DUWA 4RVFA 1SAYA 4TRRA 1WPQA 1DLIA 4RPKA 4BMSA 5ICMA 3KLMX 5JCXA 2GO1A 4B3IA 5KOIA 5AOVA 5JMWA 4FGWA 1KVUA 1NAHA 4PZDA 3TZ6A 1O5IA 3OHSX 2Q45A 4YAGA 3NYWA 4FJ2A 3PDUA 2O3UA 3AFMA 5JYEA 3SX2A 1BG6A 3L07A 3CIFA 3CUKA 4E0BA 1VSUA 1SOVA 1TB4A 5A9SB 3KLPX 2VHYA 3Q9NA 1BSVA 4L4XA 1YE3A 3NGXA 1DC5A 1R4MA 3KSDO 5TIIA 1NPYA 2PZLA 4MVJF 4OQYA 4DXHA 4CUJA 3ZWXA 2ZTVA 3IC5A 4WE3A 4BMNA 3I9KA 3PHHA 3RKUA 2DTDA 1T1SA 4Q3EA 3LVFO 2ZB8A 2CNBA 5BNFA 3DWFA 1PZGA 1R6DA 4CM8B 3OJ0A 5KJ1A 5HBRA 2I67A 3WX0A 3KYCA 2VNAA 3K8ZA 3CKYA 4FOSA 4DTIA 1PQPA 4ZGWA 2RCYA 5TQVA 4FFLA 1UAYA 3ZU2A 4BNVA 4NJOA 2AEMA 3GVPA 5A3VA 3RFVA 5CG2A 3JQ6A 4GWKA 2HK8A 1P1KA 1X0VA 3ROMA 1ONOA 1UR5A 3RCBA 1F14A 5I7VA 4PG4A 4FOOA 4RPHA 5JC1A 2PH3A 2NU9A 1KIFA 4IINA 4L0QA 4I9UA 2X9GA 3AFNA 2J3JA 3PPIA 4P22A 1GPJA 1ZMOA 3RUIA 3BAZA 4D3DA 4INAA 2I65A 5JBIA 4JROA 4RVUA 4P38A 4WLFA 1Q0HA 2NU8A 1I8TA 3DXFA 5K0ZA 4L4SA 4BV9A 4MDHA 5KWEA 1J6UA 4JJGA 1GYRA 3RROA 2E6UX 3JD4A 1RKXA 5AXAA 1HE4A 4XRGA 3AI3A 3FCOA 4DREA 1GL3A 3ETDA 1FDWA 4BO7A 3EW7A 2CY0A 1SCUA 3WJAA 1PJQA 4U0KA 4Z3DA 3U09A 5KNLA 4YT5A 3BHJA 3C1OA 2HMSA 2ZB4A 2C7VA 4IS2A 1Y8RA 1I01A 4NHEA 4F6LA 3GA0A 3N7UA 3VTFA 2E82A 5ENVA 4RJTA 3DAGA 1R0SA 1WZEA 3WYEA 3GZNB 4YAIA 3NT5A 4AJJA 1HZJA 1M75A 1ZK0A 1DHRA 3A1NA 4J4TA 3CEAA 4GVLA 1RM3A 4WKGA 1CDOA 2IEBA 5B1YA 2EJVA 4R1TA 3OA2A 3WGZA 1DRVA 3I1JA 5BSGA 3PI7A 3V5NA 2Y1FA 4BNJA 2G76A 4CLOB 2IE0A 3LT0A 2VN8A 1ZZEA 4KWIA 1HE2A 4PZEA 4UVGA 1E7QA 5CPFA 1U3TA 4JXKA 3AM4A 4N7RA 4YRBA 1OC4A 4FC7A 4DLAA 4PZCA 3RC7A 1YRLA 3FWZA 1N9GA 4F3YA 3VKUA 1I3LA 5L51A 1FMCA 5L7YA 3DHNA 1EVYA 1HTBA 4Q3NA 3D4NA 4J49A 4NDNE 4RO0A 2R00A 3S2IA 2D5AA 3MEQA 4KP7A 4HFJA 5ER6A 2JJYA 3H5NA 4CMBA 3DQPA 3INRA 4HNHA 4WUVA 3WFJA 2P5YA 4JJFA 4P4NA 3QVWA 4JQCA 1GUFA 1OI7A 3BTSA 3D64A 4MVJI 3NTOA 1R4NA 4K26A 3D5TA 1SB8A 1SC6A 4IJUA 1D3AA 3OETA 3LU1A 4NNJA 2WE7A 3H9GA 4E12A 2VWGA 5JE8A 3TRIA 5KTKA 4H3VA 3A06A 4CUKA 4D3SA 3ZW9A 5FWNA 3A9WA 3JQ7A 4L73A 4CR7A 1YB5A 4A26A 1JQBA 1LUAA 3CSDA 2FR1A 3GH3A 2ZQYA 1GFSA 1A9ZA 4FJ0A 1UUFA 1MV8A 1LBEA 3RFXA 3OFSA 1E3LA 4KUGA 4IJVA 4WGGA 4BOYA 1ZSVA 4ITUA 1XLTA 5EQDA 1XU9A 3RJ9A 1YJQA 1BDBA 2NU7A 3DONA 3RUHA 2OP0A 4E2WA 4YT2A 3UFXA 4G5HA 1Z73A 1UP7A 4L76A 2VRCD 2F1KA 3WB9A 3FNGA 2RIRA 1FDTA 5DNAA 3DMTA 1TT5A 4UVIA 4H16A 5L9AA 4XQCA 2G82A 1X7DA 3L6EA 1KVQA 4HXYA 2RHCA 1V3TA 2DM6A 3Q9UA 3HN2A 3RBZA 4EBFA 2D4AA 4ND3A 4J0EA 3UCXA 3DHYA 1H93A 1QORA 2DFVA 4PRKA 1HWYA 3RI3A 1LI4A 4YJHA 3HDJA 1C0KA 2DTEA 5JXWA 2DLDA 1YL7A 4DWVA 1KC3A 3GN1A 4LMRA 4YPOA 1WXDA 1FXSA 3DZIA 4NK5A 4YJDA 3I3OA 4PIVA 3UCFA 2ZTLA 4BQPA 1P1RA 4MVJM 4W9NA 3JQAD 3C85A 4BO9A 1EQ2A 1A4IA 1GV1A 1WW8A 2WWRA 2GYYA 1GUZA 2HQ1A 2QIOA 2BD0A 4J7XA 1V3VA 3STHA 3WMWA 4BB5A 4E2YA 1TVEA 3ICPA 1RYDA 3OECA 3UAGA 1CRWG 4Q3BA 1EFLA 3GDFA 1U5AA 3IIEA 3DBHA 4ZVVA 1EDZA 2GERA 4G2NA 5DCWA 1HDYA 2VCYA 3AM3A 3QLJA 5EQFA 5I7EA 3AK4A 4EYEA 1NWHA 4O6VA 4N5NA 2EGGA 3LT4A 2C0CA 2JFHA 4O1MA 1OBFO 2OO5A 2X9NA 3BMNB 3L9XA 5CPBA 1B8VA 5HS6A 1UXHA 4YXFA 3M2TA 2XPCA 4D0SA 3H3JA 4GX1A 4MIOA 1XR3A 2I6TA 3U49A 4ALIA 3OBBA 4GSKA 4H7PA 1JKFA 4ZA2A 2E48A 1B26A 1HLPA 3IDSA 4CMHA 2D59A 4LN1A 2GZ3A 2IYOA 1H6DA 3A14A 1DRWA 1QYXA 3LT2A 2JCVA 5BT9A 2YFQA 1BWSA 3NDJA 5J23A 1H6AA 4W7IA 3WGOA 2EW8A 4LCEA 1V0JA 1YS4A 2J5RA 3BTOA 3AY6A 1NBOA 3PWSA 1HDRA 4IZHA 1DEHA 4WCFA 3GUYA 4M54A 4ND4A 3FNFA 3EAGA 3ONFA 2V6MA 4UEKA 1KOLA 5CDGA 4D7AA 4Y9DA 5IDQA 2OBYA 1I2BA 1Q7BA 1T1RA 2G0TA 1R66A 1BXGA 3GHHA 4WLUA 2Y0CA 3OIDA 1PJTA 4YJFB 1ULSA 1YJ8A 1ENYA 4OHUA 4AJLA 1YONA 1DBVO 5MDHA 4CR8A 3K92A 1U7TA 1VL0A 1ZK4A 3WS7A 5B37A 1R0LA 1C1XA 2UAGA 4KZPA 4TVOA 4CL3A 1KS9A 1E92A 1VLLA 4I5EA 2B4TO 1CQJA 3S1LA 3PHLA 1LNQA 1QP8A 3NV9A 2I5PO 3WGHA 3RC1A 4BNFA 1FK8A 1PJLA 1SB9A 5C5IA 2IODA 3I9JA 2Q3EA 5JDCA 3ZV5A 2AQHA 3QSGA 2NACA 5DZSA 2V65A 3ST7A 3DAPA 2UDPA 4R5MA 4TVBA 5KVQA 5COAA 2UUPA 1E7RA 2FOIA 1EUZA 1DC4A 4CM1A 4UAGA 1T2EA 4DQVA 3TZHA 3BHIA 1U9JA 2BFMA 4OH1A 5F5LA 4PLHA 3EC7A 5JC8A 2VYVD 4W7HA 5F5NA 1NFQA 2ZYGA 5JNLA 3VPGA 4LW8A 3HDYA 4EUFA 3ZGYA 2TMDA 4II3A 1NXQA 5IZCA 3FTNA 4B3HA 4NBWA 3C7CB 3DC2A 2Q99A 5H83A 3UUWA 3ABIA 3B1FA 5ER9A 4IJKA 3KO8A 4E31A 3LC2O 5U9CA 1O9BA 1ENZA 2X5KO 3C24A 4OMUA 3TL2A 4LMPA 5COQA 4B79A 1CIVA 3QHAA 5GY7A 3MJCA 1B3BA 3NAQA 1CERA 1DIAA 4IPTA 3QJ5A 1JA9A 2CDBA 2O7SA 2WEKA 2RH4A 4BNWA 4CQMD 2W2KB 3HWRA 4BQRA 4FIZA 4YYZA 5COBA 3WSVA 3PK0A 1X1EA 3Q2KA 1E3EA 3KM0A 3W8DA 4I5DA 3QRWA 4WOKA 4CMKA 4ND1A 5G0UA 2DBZA 1LDEA 2FHSA 4G65A 1H9AA 4JBGA 5JO0A 4FPXA 3C8MA 1GADO 4J9UE 3RC9A 4Q3CA 1A5ZA 3G0OA 4JBIA 4NMHA 5IZCC 3R3JA 3ETEA 4NR0A 2Y0DA 5A9TA 1HE5A 1HDXA 5U4QA 4IQ0A 4J1QA 4RGBA 1SNYA 3N74A 4PLPA 4E5NA 1F12A 3S55A 4D41A 2HRZA 3VZQA 3D4OA 3D3WA 2DKNA 4WLVA 5AVOA 1KY5A 3LYLA 4YQZA 1MG0A 4GGOA 5L53A 4LSWA 2VOJA 1DIBA 1E3IA 1EFKA 2OP1A 1E6UA 1P44A 2ZB3A 1K2WA 5DCYA 3X2FA 1A7AA 4Z3KA 2A94A 5TSDA 2WTBA 4BIIA 3TZQA 3RVDA 3OM9A 4ALMA 1T26A 4B7CA 4PLGA 1NNUA 2ZATA 1GYPA 2NADA 3NDIA 5HM8A 3ZV4A 5A4DA 2WMDA 4J0FA 3JQGB 2VQ3A 5ICSA 3LSYA 1Z74A 5JYDA 1EUDA 5CFZA 1IZ0A 3JQAA 4R1UA 4TKMA 3ZV6A 1H2HA 3QVTA 4XB1A 4HV4A 1ENOA 3DEYX 3AOEA 1F0YA 4UUNA 4XGIA 2PZMA 4BO8A 4CLDA 4DIBA 1Z82A 4QFCA 3ZWCA 3G49A 1TT7A 1P1JA 5JAZA 2O23A 3M2PA 4RF2A 4PFJA 1XQ6A 4BO3A 3PJDA 1M6HA 3W4IA 4GX2A 1JKIA 1Q0QA 4ZN6A 4J90A 2FMUA 4YB8A 4EEZA 4NBTA 4AICA 3ENNA 2GN6A 3EVNA 4JJIA 5T57A 2EXXA 2GZ1A 2VNSA 4M86A 3TL3A 2YQ4A 4JP2A 4TZTA 2Q2QA 3KEQA 4U5QA 1GYQA 3E18A 4QT0A 3SJUA 3ZN2A 3FR7A 4ZRNA 5FF9A 3MTJA 4DGSA 1ISFA 4MOWA 1D7OA 4IQ8A 3GHYA 4W82A 3WMXA 2GF2A 5TT1A 3H65A 1TLTA 4I8XA 1SEPA 3BMOB 1E1LA 4KDFA 4EZBA 4PVCA 3D5QA 4DMMA 4HX5A 3RBXA 1DC6A 2FR8A 4HNGA 1NQAO 3AW9A 3C3XA 1ZK3A 4FGSA 2R6JA 2CD9A 2C20A 3I9MA 4CMIA 4O63O 4YAJA 1Y1PA 4YAEA 3RUAA 5F1KA 4QFDA 3S8MA 4ZD6A 1ORRA 3COSA 3ZU3A 3AUUA 3H2SA 4XQGA 3GQVA 2O4CA 3PJGA 4D0RA 4IDEA 3UKOA 5FEUA 2D0IA 4IDGA 2HMTA 4I08A 4KUEA 4Y67A 3E5MA 4J7UA 3C1AA 1PGOA 3OJFA 3SC4A 4NIMA 2NVWA 1I32A 3OQ6A 4PCVA 3TQHA 1E1NA 1R4MB 4J1TA 3PIDA 4NU6A 1KEVA 3HB5X 3K5PA 3KUXA 2O3QA 1M66A 1E7WA 2ZCVA 5JMPA 8ADHA 5EL0A 4MO2A 4NZ9A 4K1LA 1VJ1A 3RU7A 3W8FA 4RVGA 3WQQA 3RAJA 4BO2A 3DDNA 3JCZA 3WLFA 3LC1O 5TX7A 5TJ9A 2Q1WA 2Z1MA 4EI2A 1X7GA 2HDHA 2P4HX 3EDMA 2VHVA 4OOFA 1O95A 2PR2A 3U4HA 2Y1EA 3HQ4O 2VOEA 3HE3A 1ISJA 2B5WA 2H1SA 4AFNA 1LDMA 2IXBA 3RIHA 4NFYA 2FP4A 2AQIA 4Q3AA 4AJHA 3PYLA 1CWUA 3WOHA 1B2LA 4BVAA 2PWZA 3DZGA 1I24A 4PLWA 1IB6A 5HWSA 1DFHA 1UAGA 4A03A 1I5RA 1JWBB 1XHLA 1ZSYA 4QEDA 3PQFA 2VYVA 3E5RA 3NX4A 1KBZA 1WMAA 3NUGA 1O6ZA 2GN9A 3GVCA 1Z7EA 3W8EA 3OICA 2I9PA 2NNLD 5G4LA 4UEJA 1BDMA 2P4QA 2VHZA 2FPIA 2A4KA 2EG9A 5DF1A 4MJLA 1EEHA 3C7DB 1UXJA 1S6YA 2WM3A 5F3RA 1NHWA 3CXRA 3H8VA 4RDIA 4TZKA 1Y8RB 3WGTA 1LRJA 3V1YA 1LDBA 4PLTA 3OA0A 4W6ZA 4WEQA 3V2GA 1Q2XA 2PGLA 2NTJA 1UP6A 2QYTA 4B4WA 5KCZA 1IHYA 4CQMA 2OGUA 4KTTE 1ARZA 2EERA 1NQTA 2OOSA 3UVEA 4CV2A 5KJCA 3DO5A 3ONEA 5JCJD 2V7PA 4WEOA 2V6BA 3ZHXA 5LCXA 1KEPA 4GKBA 1N1EA 1Y9AA 3JYNA 4FD3A 1T4BA 5IZ4A 2ILTA 3WGQA 3O4RA 1PQUA 3K96A 1PJBA 2ZYDA 3ROQA 4AJ1A 4I1IA 1UDAA 2CUKA 5DP2A 1PGQA 3F46A 3HFGA 3WGIA 2WD8A 2HKIA 3D7LA 1E6WA 1N9GB 3DB2A 4RVHA 3QP9A 1ZUD1 3MJVA 3P5SA 4RZHA 3RJ5A 5IDWA 1GZ6A 4DVJA 2A35A 1ENPA 2DAPA 3PP8A 3JQFA 1TI7A 4C7JA 4DBZA 1KVTA 3AU9A 2VTDA 4XA8A 1NP3A 4IY1A 1PEDA 2GUGA 3JYOA 5AXDA 1VL8A 1DLJA 1K0UA 1E3WA 1X1TA 2VHXA 3GK3A 4NU5A 1ZIDA 4MPDA 1AGNA 3MWEB 1GV0A 2DTXA 3KB6A 3K9QO 1Y5RA 2V6GA 3RQSA 5G4KB 1K6IA 2YV2A 4ZQFA 2A9FA 3I4FA 3BYZA 2EGHA 2POQX 4XYLA 2IYPA 1JAYA 4TROA 4PN3A 1EDOA 1R4NB 1PL6A 4XR9A 2FN7A 3WR5A 5CDUA 1ISIA 3F3SA 1AHHA 3R3SA 1GZ3A 1NVTA 4EUEA 2NLOA 4BNMA 1E1KA 4YRDA 1JVSA 3E82A 3JQ7B 2VWHA 3NDRA 2GASA 1DPGA 2HMWA 3LF1A 3AWDA 3VDRA 3CMMA 3HFSA 1GEGA 4OYRA 1HLDA 2PH5A 2PKQO 1GQQA 4W99A 1F8GA 2YHIA 1I30A 3WFIA 4B8WA 2J5QA 1YQGA 4E6PA 1I0ZA 2F00A 2Y05A 3QA9A 3HG7A 2HK7A 1ZBQA 3JQFC 1KYQA 2GD1O 6ADHA 3EK2A 4TRJA 2WD7A 1J49A 1LRKA 3WTCA 2Y1GA 3OQ1A 1PZHA 4E5YA 3DR3A 3NJ8A 2VT3A 3ROKA 4BKPA 1E7SA 4N18A 2B36A 1UP4A 1TT5B 2IZZA 4Y98A 1H0KA 3F1KA 4XQEA 4E5KA 3GVIA 2GCGA 2C7GA 1A7KA 4BNHA 1X0XA 2EW2A 4ZJUA 1YWGO 3HN7A 3U62A 2RBEA 3B1JA 2G17A 3G1TA 3LC7O 5C3MA 4YJHB 3FNHA 1T2FA 4MVJP 4BUCA 4L9RA 2AE2A 4E4YA 2QW8A 4XYBA 1BW9A 3DZKA 1EMDA 1I36A 3H9QA 3I4CA 3NKLA 4ESOA 5IN4A 1DFGA 1GD1O 5C7IO 5K9ZA 1U8FO 2PKQP 4XKJA 1CYDA 3HSKA 3QVOA 4PLVA 2DU8A 5CEFA 5EINA 2C29D 1P3DA 4II2A 2CVQA 1U8XX 2EKPA 4TSKA 5CDTA 1R37A 5G4KA 1U5CA 1O94A 3WLEA 3JQBA 1TA4A 1GCUA 3DBHB
chains in the Genus database with same CATH superfamily
1MG5A 2FLVA 4BVEA 4CLRA 1VG9B 4GEGA 3IAS6 1PR5A 1RI1A 4RDCA 4UD6A 1KPHA 2AWNA 2WIAA 1B8UA 1CUBA 1E5LA 1SIWA 2Q2WA 1OX5A 4KO4S 3U7QA 2G7MC 1P2GA 3O82A 3T3PB 1NNSA 4TM7A 5LUBA 2OQIA 3ZU4A 2NUTB 2VJNA 2XYHA 1KVSA 3VHQA 4E1VA 3I9FA 5MFZA 2JKZA 1Z39A 1VBNA 1YB4A 3R5SA 4GW3A 4HZIA 1JIQA 2HDNB 1KAGA 3NORA 1EK6A 3QF7A 1SG0A 1BNCA 1K9VF 1ZDMA 4MW5A 1XD2A 3QOXA 1WDWB 2BFOA 2I3AA 4JENA 4R1LA 4D82A 3FUXA 3TQQA 1R0RE 1PV4A 3ZHQA 4GLJA 1FUIA 4W5QA 1FIUA 4RY9A 3CWCA 3FPCA 4GS5A 2PKXA 2WOJA 2Y1XA 3CZCA 1XD8A 2I2BA 3ZQ4A 1W30A 5INTA 3KQKA 4L02A 1N2OA 3ZH2A 4BBPA 2YXEA 4NK4A 3TIFA 2FMIA 4IDBA 3RWBA 1ML4A 1E2MA 2YR0A 1VLHA 1MO5A 4LDPA 1ZA2A 1P0FA 3PE3A 3DVSX 1QNFA 3GOHA 1AQJA 1RWBA 5JSYA 1QXSA 2O48X 2UVPB 1VMKA 3MCVA 1DAEA 3NAZA 1X13A 3VR2A 2YV5A 4KNYA 3TOZA 2WSLA 3TPCA 1U2PA 2VNKA 1JR4A 3DMPA 3LW7A 3MQFA 5HOQA 1VBKA 3W0LB 1WKCA 2YUIA 1MJHA 2F7SA 4COKA 4YXWD 3K70B 1GT6A 2R6ZA 4XGNA 5JATA 2VSOA 1VRWA 3KZ1E 3MS7A 3RHSA 3PFIA 4XSGA 1BYIA 4I2VA 2OXCA 2JGIA 1RHMA 3KXDA 4FX2A 4OFZA 5HTKA 3TZBA 4OM7A 3WDSA 2OBXA 1Y4SA 3P32A 1C9MA 1J22A 3VDMA 3DL2A 2H00A 4P4GA 1IUPA 3EB9A 3IKVA 3VHLB 1GAEO 4HADA 2UZ3A 2DF8A 4IILA 3RS9A 3SHQA 5CFNA 4QPDA 1FBNA 3QVGA 2CL0X 4N8DA 5HUHA 5CA0A 3RFUA 1ILWA 5DNYB 1AGXA 4YHHB 2R8YA 1X7YB 4Y6GB 3KR9A 4V0QA 1K63A 1N4AA 3DDHA 1H94A 3NWOA 3EMKA 4RAQA 5D3ZA 4IDPA 3SM3A 2XMDA 1JFLA 3CF0A 2CFRA 4GOOD 4MVJH 2ERCA 2C9OA 2X8LA 2FVXA 3GPLA 3RADC 3VYWA 1G1MA 4QULA 4EHNA 5FJIA 4Y6RA 1NVEA 2HL6A 3D0KA 3GWGA 4IGKA 4LECA 5TB5A 4AX8A 4DA8A 3WAKA 3C1UA 3FBGA 4MYSA 1W75A 2AUTA 4WOJA 1MCZA 4L4ZA 2NTVA 3R6TA 2W6MA 4KXVA 4WL0A 4ZZ0A 3A9SA 2C2XA 1HSZA 5FV4A 4BB9A 3EMDA 2P4EA 4BYGA 1W8DA 1JJAA 3QEMA 4MWDA 4KXNA 4I55F 4O2LA 4P7GA 3GCWA 1N25A 1WNTA 2ORYA 3JR7A 3HJUA 2GR9A 1HBJA 3OZSA 1HEUA 1BO6A 5M2QA 1BHQ1 3H5LA 5G1NA 2O1WA 2B0CA 3UW3A 3VR5A 4BU0A 4Q7EA 3A6JA 1FFXA 1OZFA 1V7PC 3DKRA 3KE8A 4Y2HA 5LA6F 4AKSA 3P97A 1HNXB 4TKVA 2FZCA 4GPZA 3MTEA 1F2TB 4Z9AA 4MJXA 4UOZA 1G4HA 1ESEA 2P1RA 2MSWA 4KMOA 1DKLA 3F67A 2IOQA 3NJ4A 4F4DA 3H5RA 2XXJA 4MA4A 4OMDA 5MHTA 4G1UC 1M2HA 2FVYA 4UUPA 4OQPA 4LXYA 2JDID 1MQSA 2FRXA 2QDXA 3V1UA 4D46A 3THWB 2YV1A 4BNUA 2W7TA 3KB1A 2AKAB 2GZMA 3FKQA 4F2GA 4BMYA 1D2NA 1G3QA 1NATA 4KFUA 2OGZA 2QQFA 3IOMA 4UD2A 4NZMA 1ZHOA 2FN4A 5DHUA 3O2NA 4LE2A 4KLAA 2X2OA 2O14A 5F4BA 2FWBA 1YQQA 3FUCA 4P3YA 1UXIA 2NQTA 3V6LA 3EXFA 4KIJA 5D5HA 2O3TA 4ZOQI 1KR5A 4XWKA 1M2JA 1DAOA 2IITA 2LRHA 1Q0SA 1ADFA 5I9MA 5LB2A 2QRGA 4DG5A 1UM9A 3ZHYA 4FZ3A 2BFEB 1NXPA 4X1YA 3B70A 3FFXA 2QZ9A 3ZCRA 2XDAA 1PG0A 1TCAA 1AO0A 3FLAA 4Q39A 3C41J 3U4IA 1KERA 4LHWA 4QGFA 3RUEA 5ERGB 3OWXA 4LQ4A 1WP9A 2HNKA 3VR0A 1E20A 5CFPA 1G64A 3ADCA 3FTQA 1U9ZA 3QFTA 4JCOA 3SFTA 4INJA 4UFPA 4LJLA 4V0MA 4D5EA 3H19A 4Y6PA 2AJCA 2QTGA 4XDZA 2O8CB 2CEAA 1EBFA 1NNEA 2QENA 5FAKA 1R6XA 3JYQA 2XNJA 1I7LA 1PX0A 3IERA 3KYDA 3O8RA 4HWGA 1FTWA 4ZCTA 1YOVA 4H1HA 2DWUA 1ZL0A 3K9WA 2GZRA 1EU1A 1W34A 3FMGA 3WLQA 1JN0A 4ZAFA 2GH1A 1HI9A 2D1FA 2C2ZA 1X9IA 2OV8A 5DYIA 4C01A 3WGYA 3K6KA 3CURA 4QPNA 5F9MA 4F5DA 2VBCA 1CQPA 4HMPA 3T38A 4EVSA 1S2OA 3UBMA 1NW9B 1JAHA 5J1SB 1MZPA 1P1BA 1FMJA 1UPAA 3NDPA 1DXYA 2HV9A 3I28A 2JCYA 5AW3A 2JLUA 4WGFA 1X6VA 3KSZO 3OQOA 2VYFA 1SK9A 3IEVA 4NMXB 1XEAA 2FEKA 5DB4A 4UEQA 5AQEA 1X19A 4KQJA 5EKDA 3GZTB 2QYOA 3TBHA 3KOXA 4Y6SA 3JQAB 1GGVA 4G67A 3TI9A 4DKXA 5F23A 5TIIA 2X7JA 2IY8A 4KW7A 1W0KA 2P27A 2V97A 3ESZA 1F5NA 1N6IA 2L19A 4RK5A 5F77A 2QN3A 4ZCMA 1XJQA 2AJ8A 4WMLA 4EZEA 1G55A 1Z0ZA 1Z6ZA 1A7UA 2VHTA 4JBNA 4KH0A 5CCEA 3NVKI 3I9LA 3DBRA 3JAKB 4EK9A 1YQDA 5DNWA 3NPAA 4FR2A 4ND5A 5JS7A 1A2OA 1TQ4A 2CLSA 2QRKA 4RLFA 1GQFA 3UQZA 3T0FA 5K8VA 2MTBA 1T36B 1XTSA 3DEAA 2WYVA 3MGAA 3OG9A 4N49A 3V7YA 4ENPA 3UH0A 2A2ZA 3CW2A 4KQKA 5LZ4A 2ZBPA 1PW5A 2PZKA 2W98A 4DC9A 1FF9A 1KEWA 2BI8A 2XV1A 2YQ5A 3WK7A 1VYTA 1E9FA 1XAIA 4ZIRB 3FHTA 3FGZA 4B73A 4OI4A 4Q6BA 4Q0MA 1KO7A 1Q7GA 3BUSA 3KQMA 4OJQA 3S2EA 3WK9A 5CBPA 3L43A 1F9AA 1TQDA 2DECA 1IEQA 5FI5A 3RGWS 4B44A 5BMVB 1UXGA 3STYA 3ZJ4A 1B74A 1T8SA 4MW9A 1PT8A 2C3OA 3IMEA 5SZHB 4PONA 5IKXA 2G1KA 4JLDA 3HL4A 2XDYA 2GZDA 2PT7A 2VT7A 4EPRA 3V00A 4CHTA 3C6YA 1UFKA 1LSUA 1XGKA 3NTVA 1IM5A 4LF8B 1FNMA 1T5TA 2GBLC 1O6FA 2RE8A 1YUMA 3RSQA 1JLSA 4AP5A 3UICA 3HFRA 3VH3A 1Q19A 1Y7TA 2FWNA 3Q7RA 4U8GA 3TFQA 1IZ9A 3FYTA 1TLLA 3JRXA 4P4LA 1BD4A 1AUVA 2PANA 3I04A 1AKNA 3KK0A 4KCGA 3UJHA 4YMWA 4HRYA 1TKCA 3BFVA 4OQNA 1N32B 2O07A 1FNSA 4J16C 2BE9A 4GX0A 4YXWA 1RBMA 3C3WA 3ZXXA 4YX9A 2Y2VA 3I45A 3PXAA 4LGVA 1OW3B 5LYYA 2BLLA 3LPAA 1YB6A 4OHRA 5KDDA 3F7MA 1OX4A 3G23A 5EIBC 1IHDA 1XDDA 3BZUA 4KQHA 4B3TB 3HWSA 1P6UA 4B6EA 4YA6A 2J09A 1LC0A 1ZVMA 3MILA 3PQDA 3F73A 1W0CA 4M7PA 2JFFA 3N1UA 4A92A 1RFLA 4TXHA 4W8HA 3HTXA 1DBSA 4OFWA 3ZU5A 4N0PA 4FE7A 1DCFA 3QU2A 3TL6A 3I58A 5BVGA 4QDOA 1A9XB 1ZCZA 2NZYA 3HDTA 2CF5A 3JALB 3U1VA 1JDTA 3VX3A 2Q4DA 3L40A 1I5OA 4WZBE 4R1MA 2PUTA 3V46A 4C7KA 1XZDA 5AKZA 5LQUA 4MW4A 3UMVA 1P18A 2SCUA 3LLVA 2FEOA 4QBKA 2CYBA 2PT5A 3KD2A 5H9WA 2UYCA 3GLVA 1RPNA 3OH8A 1YRYE 1GTZA 3O3NB 1Y8QA 4IOJA 5TVGA 1NUPA 2OBFA 2I03A 2WA2A 2BFDB 1C1DA 1RBYA 2GAAA 2YYZA 4K2HA 4PBSA 2KSQA 1QGED 3LS2A 5DO9A 4DWWA 3NBUA 3V4RA 2B0JA 1IQRA 2P1DA 3SC2B 2J0SA 4IIEA 1A7JA 3VQTA 4HXEB 1NM5C 1UKZA 3CR7A 1QIJA 1K68A 3VH4A 2BP7B 2K2QB 1Y7IA 2H2FA 1NAIA 3R24A 1L5SA 4IIJA 1N0IA 4IRUB 5JH7F 2EFYA 2XD9A 3QE4A 2HPZA 4WTOA 3T4PA 2IOFK 5LP6A 1B15A 3DLPX 4R2IA 3TQRA 3NRJA 5EIWA 2EF0A 1CUFA 3LLUA 4JSTA 2R84A 3T1QA 1J42A 4Z7NB 4RADA 2QTWB 3TQFA 2ZSKA 3T7CA 1CF9A 2CSUA 3DNFA 5DN6D 1UK7A 4MRMA 2PZJA 1NV9A 4BO4A 4EYQA 5E6RB 1JQEA 2F1IA 2RK6A 3KXIA 4K3VA 4ODIA 3E2PA 4GGMX 5I8ZA 3SDSA 2XUFA 5CDFA 1R1DA 2JDIA 5JISA 1JPUA 3U3OA 1W87A 4I9GA 4P58A 1T0HB 1JVBA 5AVRA 3ROPA 2AX4A 2CXRA 2O0JA 5FNVB 3IA2A 1CUDA 4U7TB 5IKOA 1RKVA 4JBYA 4P93A 2XVZA 2YWEA 3CH7A 3IBTA 3M9XA 3LQ2A 3AI2A 1ESMA 1CR2A 3P2OA 4KE8A 1H2BA 4PLFA 3E8MA 4QYWA 2ECQA 2ZS9A 3KAQA 1QS0A 1DKUA 3ILYA 4CQMB 4L57A 1RPAA 4OBBA 5LDGA 4UTZA 4YR9A 2ZPUA 3LW8A 3TN7A 2E4ZA 2FX3A 5L95A 1UBUS 1EIZA 1HDOA 3JZDA 2IKSA 3OOWA 1Q17A 4LXQA 1GP2A 4PHTA 4TKLA 3RTCA 1TYCA 2VTKA 3PKZA 1YVUA 4EEXA 1P1IA 3E61A 4O29A 4XIFA 3SJCA 4FWTA 4NZYA 3U9LA 2I4MA 4JMPA 4HXFB 4XGRA 1Q21A 3QWIA 3L1KA 3L41A 3CF4A 4XGKA 1OASA 1CUEA 1ZQ9A 2XUJA 4TV8F 1Z28A 4OB6A 1TYDE 3REOA 4KHZA 4LWPA 5EE0A 4TT3D 3N2KA 4Z0PA 2OC9A 4FDUA 4MB2A 1CZHA 1H2RS 5HJ5A 1GPNA 3GT7A 1AD2A 1SXJE 4G8BA 2JGNA 4KQEA 2Z3WA 4QLAA 4A8PA 3CV3A 5CDYA 2FWPA 1TM2A 3L0PA 4MXDA 3ELDA 5JYCA 4MSUA 2FV8A 4DRXB 4R4JA 4NCIA 1B1CA 1O97D 3N75A 3H7IA 3WMRA 4D45A 4S04A 4BNGA 1W5EA 3V4FA 1I80A 3UHPA 3BPSA 3FVWA 3NR2A 3LY8A 4D8TA 1T9AA 3WK4A 5IDYA 2G25A 3U16A 1XQWA 1ZH0A 1NTOA 3DVRX 3TSOA 3ZHVA 5CB4B 1VSVA 5LSAA 4U00A 1U3GA 3ZY6A 1SCDA 1QF7A 1YAJA 3LT5A 4HSGA 4XVHA 4OEHA 1LK5A 8LDHA 1U1EA 3A70A 4MYCA 1A1VA 4W5NA 4XIYA 3ZC3A 2B8TA 1FX0A 2I80A 2H54A 4B3GA 1X92A 2CUZA 2IZ5A 1W35A 2Z57A 4ZVNA 1K89A 3HUDA 2NUPB 4M83A 1AMOA 2GM4A 2ZYHA 3P96A 5TC4A 1ZN9A 3NATA 2Z9BA 2X0RA 5K3CA 3FN4A 1SG9A 1SQGA 5JAHA 1SKAA 5L4NA 1A71A 1O58A 1XWFA 2DX7A 3BH6A 1NLFA 1BXKA 1VXOA 4UNIA 5BQFA 1F6BA 2ZJ5A 2D1TA 3B53X 3LVQE 3PWZA 5EXEA 2C3MA 5GGXA 4CN8A 3R9XA 1ULAA 2MOKA 3C97A 4CDNA 3NDBB 2HWWA 3A36A 3UJ9A 2N1MA 3QIAA 5HKBA 1G291 2ZULA 3V8NA 3SBEA 4V1CA 1QFMA 1TJNA 3PTLA 1YQXA 4WNIA 3WQHA 1ADBA 3AXTA 5TF0A 5AJVB 1HZZC 4I50F 1A5SB 4FDMA 2WYUA 2NAFA 4GOND 4RTOA 2ZUSA 1WETA 1WAMA 1MJ5A 4B87A 2R5NA 3M4JA 3T7SA 1NU6A 3VGJA 4TVSA 1BRMA 3FNBA 1A76A 2RHBA 3G6KA 1T6BY 4IJMA 4B46A 2B3TA 3B5JA 3HDHA 3VUFA 4JGGA 4DHEA 1KAMA 1V1MA 2XITA 1KZHA 2FLWA 3K4QA 4AG6A 4D42A 1DXHA 3PE6A 3O8OA 3JWIA 1WXQA 1TCBA 1PFGA 3QVSA 3BS4A 1KO5A 2XWBF 4EF5A 1C4XA 5BV0A 1M5RA 2CN1A 4Z7QB 5IM5A 2FDCA 2H1IA 5TPWA 1TIPA 2XKJE 5FI0B 4Z99A 3ZWWA 2VDQB 1UBFA 3AUAA 2FLKA 4RVNA 4QRHA 3KC2A 3NJRA 1JAZA 2VLBA 4Z9YA 4XUDA 4Q47A 2DB3A 2YUTA 1B0UA 1F4VA 1NOKA 2OD7A 2A92A 3PB3A 1P9LA 2G1JA 3AEQA 2I66A 3LH5A 1QHIA 4Q1DA 5C9ZA 1BW9B 2IYXA 3T41A 1U4OA 2YY7A 5FQNA 4PGFA 1YK0A 4G85A 3PQ2A 3R8CA 4E13A 1YCFA 4XI9A 4EOGA 2Y6VA 4R1SA 3OHPA 1DTEA 4O2AA 1Z0IA 5CGZA 5CNKA 3RUDA 1T1JA 3T3HA 3VSEA 4F06A 1N6RA 1RAHA 3DPUA 4HQ0A 3MB8A 4I4CA 1YS6A 4U7WA 1U8CB 3VPHA 2C4HA 4RPJA 1DX6A 1TDJA 2A3RA 1NKTA 1CFJA 1OWPA 3L3BA 4EMSA 2R4TA 2HREA 4NAUA 1JNYA 5CFQA 3TG2A 2QL5A 1HRKA 4RPIA 2VZ8A 4L4YA 3UG6A 3KFLA 2ID4A 5JCPA 3OLVA 1E4OA 2ZAYA 4MA5A 4Q9KA 3H0CA 5L40A 2DR0A 1GAQA 3MTGA 1RABA 2RFLA 2DC1A 2W2OA 4F6RA 5EPOA 4ER3A 1L4BA 2FKAA 3GLSA 2ACVA 4RVSA 5ANRB 4ZMRA 1ZM9A 3TECE 4FYWA 2QMOA 2H59A 2GEUA 1LDGA 4M6WB 4BMCA 2LE0A 2Q50A 2QN2A 4LHEA 1ECBA 2VT2A 1UDXA 2ZAOA 4BKRA 1NVVR 4DBLC 4DBVO 10MHA 2WIKA 4C7OB 2Y4OA 2X9LA 3ZWQA 4D44A 4UJ5A 1CDEA 1T8WA 3INGA 3C74A 3RUCA 4BMOB 4EPVA 2BELA 1NYLA 1QH8B 3BMQA 4I1SA 2Y4NA 2RDMA 3H9JA 5EMLA 5EPEA 1Q1NA 3FDJA 3L7IA 4NV3A 1F48A 2PCJA 4K9LA 1GAJA 3GGCA 2C82A 3ZV7A 1EUCB 4HYYA 3ZX5A 5DM4A 1K5HA 5THKA 3MK31 1Y8CA 1V95A 1XHEA 5EWJB 4CKCA 5KYUB 2H18A 3NBZC 5P8WA 1BFUA 4BVKA 5IG2A 2XUIA 1UMDB 2X5XA 3IAS1 3Q5EA 3W2FA 3AVQA 1GSHA 3H84A 2XMQA 4WERA 3PJFA 4A5SA 2I87A 3DZFA 4M1KA 4TTTS 5DBEX 4HRXA 3CKMA 1B1AA 3GDHA 3N2YA 4TV9F 4AYXA 1NRIA 2Q3MA 5DN6A 3QG1A 4J0HA 1HYGA 2X9QA 4LS3A 3GBPA 4M0PA 2UVDA 4P82A 2XJ9A 2W4MA 4ZCSA 3W6ZA 2B99A 4TMVA 1JT2A 1Z25A 2VP0A 1E5VA 2ZS7A 1JKXA 3ETNA 3M8KA 3PWKA 2D2FA 5D6NA 1YZ3A 3UIEA 2UUBB 2DHQA 1KDPA 1R12A 5EVCA 3ZCXA 1V8BA 2XXBA 3DTVD 1R6VA 1RJWA 2WG0A 1U2QA 3H9EO 4H1TA 2F9MA 2FSIA 3IP1A 3PDJA 2AQ8A 3WL5A 2CNKA 2VRBA 4QTXA 4MV3A 1MPXA 1L5RA 2K7ZA 4P5DA 3LNTA 3W9SA 2RH5A 1A95A 1JT9A 1N5LA 3CLRD 2LVBA 3MUFA 4YJ2F 4BQFA 1FZTA 4TS4A 4BHHB 4EHKA 3OZRA 1GTG1 1RYZA 4Y9RA 3HKBA 3HR8A 3FX2A 4KDEA 1FP6A 4ILKA 3Q5GA 3U17A 4ZP1A 3H18A 2A84A 2WI8A 3PEEA 3PJEA 4G9GA 2FAXA 4GM1A 4MMYB 2QJFA 3C3KA 2B9VA 3RNLA 2FPMA 1LPOA 3DFUA 1FZQA 4MQEB 4RGQA 5BV8A 8ATCA 4Z53A 1NI4A 2P9YA 1CJKC 2ZBDA 3AXSA 2CSXA 1WSBA 1XKXA 1IRIA 1A9YA 1DAIA 3N8NA 3QWFA 2DSTA 4CM8A 5B4UA 2IP4A 1TRKA 1BOFA 2QG4A 3OCXA 3Q7SA 4TT3A 4JT4A 3ZCVA 5IFKA 4REQB 4AJKA 1JTVA 3S5UA 1MXFA 3UYKA 4C89A 3ZDFA 3EXAA 2R0QC 3GJYA 3GLTA 2ZQ5A 1RCTE 2P9FA 1R50A 4RY0A 4AURA 1F1JA 3BHNA 4KPUA 3WZMA 4YJ3A 2C59A 5I7FA 1PQ4A 1SHUX 1ORDA 1X2EA 3H2IA 2J0UA 2HK6A 3AKYA 1E2QA 1GQRA 1QE3A 1C29B 1KY2A 1QANA 2IJGX 3SYTA 2BKAA 3C7AA 4OXQA 4TL8A 2QSJA 1C3JA 2XEXA 1ZXBA 4RBNA 5EJFA 3CA8A 4UREA 4EGQA 4EYKA 3AIIA 4A5OA 1URPA 1NMEA 1H2AS 2Z4TA 3IT3A 3MUEA 3OX1A 4B75A 1ULUA 2ZB7A 2VI5A 1FFSA 3UV7A 3X2EA 1V71A 2ZIFA 1I2CA 1QJ4A 1YU6A 3I61A 2X41A 4NI5A 4AVYA 1OU0A 2P67A 2PNFA 1CQIB 3B1VA 1T2NA 2YL2A 3F5SA 3FMOB 4RJLA 3PDHA 5J5VA 3GUCA 1TQ8A 1WHSB 3IDZA 4GLLA 1EVJA 4CM5A 1E79D 2FSSA 3B85A 2JVIA 1BA3A 1IJKA 4R83A 1IJFA 3AR8A 1K5DA 1VJ0A 4QNNA 4WQMA 5B5SA 3JASA 1FQKA 1GTMA 4O4HB 8GPBA 3KVOA 3PUVA 3JYHA 1JJBA 3KX2A 1X15A 4YAWA 5JASA 1M8FA 2YHSA 5CVVA 2C77A 4QUKA 4JC8A 1FP4A 2OAQ1 4HDSB 4TX1A 4BYMA 3GCZA 4HH4A 4R9RA 4D9CA 4NU8X 4BMPB 1D2HA 4Z8XA 3ZW8A 2HYDA 3DKVA 1VIYA 3GF4A 3KEGA 3NEJA 4D81A 3ED1A 3PITA 3UWSA 1U7ZA 3KHTA 3UENA 2QN6A 1PS9A 1QOZA 2BFPA 5EA2A 3U4CA 4IWYA 5EKXA 4HNVA 3FOFC 4WV3A 4EX6A 2P4SA 5CW1A 4BJ6A 2BRUC 3GP8A 3AKEA 2F55A 4ZT5A 5JSZB 4Y8VA 5KQRA 4LE0A 4U6QA 5KKCA 3KQUA 1JU4A 5A1TA 1L6RA 4OO3A 3AR6A 3OKAA 4HZUB 4EJMA 4PC3A 1HORA 1C0LA 5LKAA 3REFA 4HMOA 4IV0A 1D9XA 2AL7A 4EHFA 1JW9B 4POAA 1PJCA 1J90A 1GGNA 2Z2XA 3RRZA 1PR9A 1U90A 3OTOB 5JJIA 4FOTA 1OFGA 2ZZKA 3LSTA 1J1UA 5TJHA 1XC7A 2X14A 1F38A 5A6VA 3J7TA 1N5JA 3U6KA 4D4MA 5K0NA 4BEVA 5HFJA 1JA0A 2HQRA 3IA7A 3PCRB 5EZYA 1LLUA 3JWGA 1ZEMA 1DUIA 5ALDA 4DM7A 2VJOA 4B76A 2FMTA 4GDFA 1A8UA 2ATXA 4MP6A 4G1CA 3QYAA 2QBYB 3WLOA 3L8ZA 2C9CA 4NDZA 3RD5A 3GC6A 4CM4B 1PJ3A 5A4MS 1ST2A 2YV3A 4TMTA 5D1NA 1X38A 4TYYA 3TKAA 1CY8A 3OC6A 1KKMA 3G82C 3W5BA 2VAWA 3RTAA 3LKVA 5A03A 4Z4HA 1NDUA 3PRKE 1B8OA 4FJ1A 1PJ2A 3N5KA 3SXUB 4P0PB 1RYEA 1NVDA 1MA3A 2QGZA 2VHUA 3MM4A 3AVXA 2RHDA 1PV1A 3UUFA 2HBRA 2A88A 5D6OA 2XAAA 4DIUA 3KS9A 1HL3A 3HRHA 5HMMA 3AY0A 5FO0A 1EXDA 3LUDA 2JFOA 2JJ2D 3GX1A 2P9HA 3EXG1 4OQDA 1TTHA 4FKZA 3RQIA 3WNZA 2GJSA 2X8JA 4NPHA 4BUZA 3EXEB 1BDJA 4N5IX 1DJNA 1NQXA 4HDNB 1RW4A 5EHIA 1Z6PA 2ZWAA 3AHIA 4I4TA 5IH3A 2QN7A 3IO3A 5KJFA 4EHLA 4ER0A 1M1YE 4PBRA 1DB3A 1FTNA 1NF8A 2XGSA 2Z0MA 4QO8A 5CH3A 3COVA 3KSBC 2PK3A 3VTZA 2I34A 5JQGB 2BM0A 3V2HA 1KEZA 1ZXXA 3F5QA 1FSSA 1M76A 1E2PA 3DBLB 3L49A 2W8BB 3L8FA 4FS3A 4HHEA 1PN3A 3WK6A 1V26A 1XFAA 3FVVA 3SX4A 2OMKA 4B7ZA 2W93A 4H0CA 4H7FA 5CFOA 1D2AA 1W73A 2A57A 2C84A 1EFPB 3G2MA 3MN1A 4H18A 4Q9AA 1OLXA 4W9NC 5I9SA 1DNPA 3JYPA 3QITA 5B53A 3VKVA 3I32A 4M7RA 3V8BA 2BGKA 2PLFA 4DLYA 2IELA 4PG5A 1KNQA 4BRUA 4PO8A 4RPGA 2WTNA 4O4JF 4PPYA 1XVLA 2WUFA 3EZ6A 5KREA 5M04A 2JH8A 3I23A 2JLYA 2IBMA 5CT9A 4DNXA 1EB9A 4YNBA 4BLVA 5HSGA 3PNLA 1FJ2A 821PA 1PWZA 2J3HA 1CZNA 4H1WA 2Z3VA 4WBNA 2XUAA 3F7TA 4WRRA 3JY6A 4R8KA 4BFTA 3ZQJA 1QIEA 4R31A 4JI2B 1NF2A 2FPXA 1HEIA 5GZ6A 2O8FA 1EM6A 5AVUA 2OUIA 3AUFA 3IEUA 5IJZA 3OTQA 2C7RA 2XYPA 3PGA1 2OFFA 3A3NA 3LG2A 4BX9A 4QGGA 1TMGE 1IXYA 1DIRA 3M4YA 3OEYA 4J7AA 1AB6A 2OYRA 3RB8A 4UNPA 4JIMA 1UKEA 1MF7A 2DFDA 5D84A 2QVLA 4BNYA 1AB5A 4MPPA 3SSAA 1BDHA 1AS3A 2J3KA 2B1QA 1UODA 1P33A 3DTVA 4QHSA 4AMYA 3FH0A 5KWJA 3HCWA 4M3NA 5DK4A 2O7QA 4LBVA 2A7QA 1N2CA 2P69A 3RV4A 1WWKA 2R7AA 1OKKD 4KC0A 2CXTA 1EIWA 4EJ6A 2K2WA 1MGPA 5HQ3A 2CD7A 4MP8A 4C30A 3TLJA 4AZVA 1O9GA 4BQSA 2M6LA 5I7HA 4CJXA 3B20A 1NRWA 1ZJWA 4YBRA 3A11A 2YDXA 3BJIC 4LDZA 4F45A 1A5BB 2NO6A 5BV1A 4YY3B 2CL5A 1OXTA 3B9QA 3O1LA 4M1OA 3BRCA 2ACWA 2X86A 4MYRA 4XIGS 1TJ3A 1R15A 1FFCA 2IT1A 4FFPA 3D8TA 5EIXA 2EV9A 1T5LA 3N70A 5BRNA 1SK8A 5EJGA 1PDVA 4JN6B 3TNYA 1W88A 1E0DA 1EJBA 1CFZA 2CUTA 3FRIA 4KXWA 4ZVKA 4GQAA 5KTPA 2ODEA 3L2OB 4TLCA 4WIAA 1M2OA 1ZUIA 4WCFC 3WIDA 5AW7A 3H3FA 2PTGA 1Z36A 3D7SA 3ONNA 4OB8A 2ZSJA 4WKCA 1W36C 3VMMA 3DO6A 3ETGA 2ZPTX 5FUQA 4Z0TA 2WYWA 1I7QB 1HO3A 1DXOA 4DQUA 1NVXQ 4WLOA 4CDMA 4BNLA 1RQRA 5LIRA 1F60A 3EAQA 3L0ZA 2OV3A 2QNBA 5HPYB 1V7ZA 3EQZA 4JJ7A 4NYIR 2VQFB 3GR6A 2OHXA 4WK4B 4QGHA 4DW8A 2UYHA 3S8YA 3LE8A 1I51A 4ZOAA 1YFLA 2VYCA 4S1PA 3QXHA 1H2WA 1L4NA 1D04A 1L7PA 2OLEA 3JZFA 3LBHA 4M9SA 2AR7A 2C88A 4EG1A 4DIDA 3QVJA 1ZLXA 4XFKA 5DHPA 1CRQA 4PGMA 1THMA 2ZRCA 4C0AC 4EY3A 5BW5A 1ECJA 3EX7C 4XX0B 3O9VA 1YDEA 1O4VA 2VTBB 2CK3D 4G0YA 4CM6A 4U9UA 1G9XA 3BMCA 3H16A 4RWZA 4EA7A 4CV0A 2P8JA 3ZDEA 1QP0A 5ALPA 1FS4A 3UHAA 2UZ0A 3DFZA 3JQQA 3C5VA 5JMTA 1YBVA 3I1YA 5AYVA 3K31A 1CHNA 4MR8A 1P3JA 1O08A 3D8RA 3V34A 5CXUA 2AR9A 3ME5A 4YJFA 3BCSA 3PQ3A 5HK8A 1U0LA 3BWDD 2PA3A 1TK9A 2REBA 2YMMA 4CPDA 4E4TA 4EVRA 2YZKA 4DCMA 4BWGA 3JVEA 5C8YA 4JMLA 1BMQA 3LUAA 4WN9B 4K6CA 4C6TB 5BW6B 4NPCA 2WC1A 1S0UA 3NONA 3RVSA 1C41A 5JFTA 3CCCA 4EENA 3CTPA 3HEBA 4B0PA 4AYTA 4ZQCB 4YFVA 4MQFA 1QQBA 5EN4A 1BAPA 3TOVA 3SQNA 3GEBA 4HS4A 1Z5WA 2WT8A 3B7GA 1YI1A 5HW0A 4LGCA 2ACKA 4ZGGA 1TEZA 2N75A 2FOXA 3JD1A 3B6ZA 2QGNA 2GAFA 5IKPA 2Q5CA 2H3EA 5EUBA 5H4HA 3CJQA 3OURA 1EHYA 3WG9A 3JYLA 3GCDA 2GXUA 3AB7A 1K27A 4QVIA 3NRBA 1HDGO 2JHPA 2IV3A 1QTIA 1P3Y1 4X92A 2VXBA 3WDMA 3G0BA 4L0CA 3WVNA 4HEA6 2BHNA 3WNCA 2GMWA 4DJTA 4TGLA 1I0IA 2Z2YA 1J0AA 2VSNA 1YS1X 4EUNA 3E81A 2QUIA 3Q2IA 1VP9A 1KARA 4KVZA 2Q0SA 4DMLA 5JBQA 1B23P 4IIGA 1HEYA 1QCDA 5TQ0A 1J39A 5E6UA 4HAWA 2ZLBA 1K7CA 1YT5A 1MABA 1GFWA 5LDHA 1MGOA 5LM3A 2HN9A 2ANBA 1C2YA 2NZVG 5ALIA 3HR4A 5G0VA 4F12A 3IKMB 3FZGA 4XPIA 4NFHA 5FWXA 4YIHA 1PLLA 1VA5A 1WZIA 1J9ZA 3ZGNA 4C04A 4LV6A 4UXJA 2AKEA 5IABA 4TMZA 1C2TA 3HM2A 2JJ2A 3CMCO 3WLRA 1I6WA 2BKUA 2NP6A 4HBGA 5PGMA 3TX6A 1RSZA 4Z9FA 4F8YA 3VR1A 2Q5OA 3BXOA 5JECA 1SHTX 3HB9A 4YUYA 1B93A 3PIIA 1ESCA 2CMHA 4YECA 2AW5A 4IDQA 4PTZA 1I10A 2HZBA 1L8OA 3GN2A 3LLMA 1OTHA 5L8VA 2GJ8A 1YUBA 2M98A 2XTNA 4L9SA 5K3SA 5WRFA 4AF6A 4DCGA 4JWKA 3CBQA 3ZNPA 4UEOA 5ALGA 5AQ1A 2SECE 3SFZA 1TKRA 1V39A 5IPFA 3GPIA 2FW1A 1C14A 1CY6A 2HSDA 1XXHB 1ZVJA 2R2GA 3W7VA 5JLJA 3L7MA 4IP0A 1MN6A 2GHRA 1YQWA 2NZ8A 1QG6A 3UEOA 5IJ0A 1LSSA 4BRZA 2W2VA 3MCUA 4Q15A 4B80A 1J09A 3DEKA 1MV5A 5J3JA 3TQCA 1JBQA 4M1TA 3C4JA 3M81A 3AOEC 1VI6A 1ZNZA 2FY8A 3TD2A 2ZYSA 3W5AA 3VPSA 1ZGAA 4PZ0A 3A10A 5BN5B 3VOSA 4FB5A 2C4TA 3FSEA 3JU3A 4R3NA 1WSAA 4J2OA 4NCHA 4OL9A 3GNTA 5HQTA 1VCHA 3T9DA 1EXNA 2EDAA 2ZJYA 3GMTA 2BGLA 1U2SA 1GFIA 4FNMA 4ZCPA 2AEFA 2XCUA 3ENKA 4N3AA 4YUVA 3RJMA 3N86A 2A59A 2QTTA 3FYUC 4GYKA 3A25A 4HB3A 5FLXA 1QVRA 1ZM2A 2NU6B 3KL4A 3DZJA 3FTDA 2Z95A 4L1KA 1LLDA 3QIVA 1PFWA 1X77A 3ICVA 5B7GA 4PYIA 5I4KA 3D8SA 1JFFB 1L5YA 2JAOA 3A1CA 1PG2A 3C3EA 2IYVA 4XUCA 3HA3A 4YP5A 4H4CA 3ZYCA 1TU0A 4YWHA 4OQLA 2OCBA 3MWDB 3P7MA 1A5TA 2AOTA 3HGTA 1DIOB 3S99A 2OFPA 3GRPA 2R66A 1Y3BE 1W4ZA 5FFFA 4AMVA 4MULA 4JODA 2PN1A 1KP9A 3R77A 4A82A 4ZYWA 4EJSC 3L7KA 2FUEA 4DJDC 1O4WA 3HU1A 3KYCB 2AK2A 2P1ZA 3GT4A 1V9SA 3OBIA 1OKKA 3R6GA 3UA4A 1XLUA 3DNMA 4Y3UA 1EP3B 1WVIA 1T8TA 1X7XB 2R1UA 3DCNA 2IOHA 3FDZB 4XEUA 5DLQC 1SIBE 1SWWA 2WFAA 4HSEA 4G1VA 1HQKA 3E5NA 3TF5A 5FUYA 3OOHA 3GEMA 2OCDA 4IIVA 4RHUA 4UZFA 4MQLA 5ILOA 2V3CC 2VCHA 1JV2B 4NBRA 1GVHA 3V4ZA 1Z2NX 2NG1A 3OUTA 1FX1A 1GKKA 3RSZA 1KK1A 2JA2A 1NE7A 2PLWA 1UOOA 3NBAA 3T5TA 4V0NA 1KIMA 2ORED 2PUAA 1YDFA 2C5LA 2XVYA 3BERA 4FFMA 4JLMA 3TNFA 3ZWPA 5AVQA 3KETA 2NV0A 4ALNA 2CHUA 4MROA 3UPUA 2RARA 5JNWA 4FIDA 3QE0A 2HHAA 4KQ2A 3JVVA 2PE5A 1HK7A 1KS2A 1NR7A 4RE6A 5BWMA 2PX4A 4I5FA 1XZFA 2EJTA 2J6BA 2PZEA 4JSRA 4PLCA 4W1PA 1FU8A 5KKAA 3REQB 4LF9B 3AF1A 2RAUA 2QX9A 2B9EA 1P60A 4J29A 4Q4HA 4QAQA 3FETA 2XNSA 1T9GR 4A73A 4MEJA 1XZBA 2QV7A 4LNUA 3LJKA 1GG8A 1UF9A 1OAAA 2N1BA 2CZQA 3D6FA 3E3OA 3L7NA 4FX5A 1GPKA 3G0GA 3TSCA 2XWJI 3H4IA 2B7BA 2RAVA 2D7JA 1T5SA 4LRXA 3FGOA 1HT3A 1Z0FA 1SHJA 1H5UA 1OTXA 2O2EA 1WA5A 4G0XA 1YI0A 3BMOA 4NJEB 5GMOA 2OXEA 3AUSA 3KSRA 3DOUA 1Y7PA 2EVWX 3R7SA 2IWHA 5JJCA 4TMWA 2XUKA 1JE0A 5AK0A 3HH8A 1ONPA 4B4VA 3VKWA 3EH1A 1ZS9A 1ETUA 2VRNA 1G21E 5B7PA 1SAYA 3AP2A 5IANA 5IUJC 2PJZA 5ICMA 3TLCA 5KU7A 3B5EA 3E53A 4Q19A 4G07A 4MX8A 1O5IA 2BOVA 5IJ9A 2P2ZA 3OHSX 1L5FA 3D6VA 3ZE7A 2CK3A 2Q45A 3CG0A 3T1TA 1QX4A 4EELA 3NYWA 2AOUB 2O3UA 1EZ1A 4DYHA 3LPCA 5JYEA 3SX2A 3VI4B 4AWXA 5K0FA 3OHMA 3P9IA 2FSVC 4UHBA 1NBWB 5ITZA 3R8FA 3IIKA 3OZEA 1XQYA 3BQNB 1KI8A 2IQ5A 4L4XA 3UT5B 3TEFA 2FEAA 2QZPA 1CUZA 2WZDA 1P5ZB 1TKBA 4KLCA 2COKA 3CRRA 1NQVA 3D4BA 2PZLA 2HMAA 1TJ4A 3CR8A 4U39A 3FLMA 1F3LA 4DXHA 2ON6A 1TYAE 4WE3A 4BMNA 3RKUA 1XV5A 4X8OA 4M0KA 1E9EA 1L7QA 1T1SA 3LVFO 4YUWA 3DV2A 1OI3A 2DPYA 2CNBA 4D4LA 1PZGA 3M9LA 3IT2A 4U7DA 1E4EA 3CEJA 4RD4A 5KJ1A 4PTLA 3AR2A 5JC1A 4HQNA 5HBRA 1HG1A 1NVKA 1ZD3A 4GXTA 5ADVA 4JLPA 5JADA 3CKYA 5KKNB 1GUDA 2DFTA 1PQPA 1USUA 1Y6FA 2HBQA 4UBMA 3TKLA 4TTJA 3ZU2A 2ZBVA 3MT7A 4P7FA 3PNOA 2AEMA 4FDLA 4OHYA 2M2IA 3Q5DA 1BKDR 3GVPA 2G07A 5D1HA 2YMLA 2Z8XA 3ENQA 4GWKA 4EQ6A 1Z3CA 2F3RA 5GQSA 1X0VA 4B6OA 3T5BA 1NXTA 4K6HA 2NSLA 3NASA 1F14A 2QGFA 2R1VA 2WRZA 3FY4A 1PO7A 2BDTA 2FJUA 4NESA 4UHJA 4B83A 2PH3A 2I2FA 1KIFA 4FYYA 1IM8A 4JUBA 3FYHA 2QS9A 3AFNA 3G6WA 4L0QA 4L0DA 4O4IF 2FE1A 2XZOA 4C20A 2XRZA 3RUIA 3V2IA 2RGYA 5CBKA 1KO1A 2PS9A 3H3XA 1PR0A 1USKA 2XKBA 3ZDQA 4P38A 1F1BA 3P9NA 5A7HA 1QAMA 2TYSB 2GHQA 1GPLA 3UMMA 4OUDB 3EPJA 5F52A 1I8TA 2VPPA 3DZDA 2CZGA 5KWEA 3K70D 5K3AA 5JNRA 3SKYA 5J2TB 2H85A 1SIOA 1AVTA 3V8PA 3ZCUA 2J9ZB 3W90A 4J3NA 3KWLA 3DBOB 1JB9A 1QGAA 2R62A 3G9UA 1HE4A 4IAOA 5AJXA 1E2EA 1NMZA 3MAGA 3AI3A 3MWLA 5EFZA 4TWBA 1XDU