1T2FA

Human b lactate dehydrogenase complexed with nad+ and 4-hydroxy-1,2,5-oxadiazole-3-carboxylic acid
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
332
structure length
332
Chain Sequence
ATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase B chain
publication title Identification and Activity of a Series of Azole-based Compounds with Lactate Dehydrogenase-directed Anti-malarial Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 94
structure length 332
sequence length 332
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1t2fA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1t2fA02
1LC3A 3V2HA 2RCYA 1DHTA 5JO9A 3TOZA 3ZWWA 3DEYX 5ER9A 2X6TA 1QV6A 1I3NA 3OJOA 5T8KA 1HETA 1ENOA 3KYCB 1ZZEA 3ZV3A 2PGLA 3ANNA 1A27A 4AJEA 2NACA 1B3RA 5AXCA 4CV2A 4MKZA 1QLJA 4KDEA 4N7RA 3RWBA 1PJBA 1G0OA 2GLXA 1PL8A 2WYUA 1R6DA 4WLOA 3ZNPA 2BF7A 1I3MA 2I3AA 3ZWAA 4AJKA 1QLHA 4FFPA 1U5AA 1U8XX 2ZB8A 3AY3A 3O03A 2C29D 2EP7A 3PIIA 1N2SA 2BRUA 2JFHA 2Q1SA 2D59A 1N1EA 5MDHA 3IS3A 1Q7BA 1VL0A 4R3NA 4DPKA 4ZJUA 5JDIC 2IDZA 3DHYA 3VH2A 2NV6A 1XELA 1DIAA 4E6PA 1LDBA 2QW8A 4XKJA 4AG3A 4BNWA 2Y1OA 5L51A 1W6UA 4XQEA 3FBGA 4EDFA 5I7SA 3N74A 3I9NA 4YACA 1AHHA 2DM6A 4WECA 3JSAA 4G5HA 3OF2A 5ILOA 1W73A 4PIVA 3JQGB 1N9GA 3NEPX 1HSOA 3JTMA 3NTQA 3UCEA 2P68A 3CMCO 1XWFA 1GYQA 1NHWA 4O5OA 4YJDA 4K9DA 5F5NA 3ZU5A 1DRUA 1E3LA 3OSUA 1PJ3A 3QVOA 1PGNA 3NRCA 1SC6A 3GVIA 4L4RA 1MLDA 4DREA 1KEPA 3DO5A 3OECA 3OMLA 4KUGA 3FWNA 4J2OA 4BNUA 4J4BA 5A3JA 2X0JA 4XYBA 4TRRA 5DP2A 1PGQA 1VC2A 1ID1A 2GF2A 1PJ2A 3B1KA 3ROPA 3TL2A 3P7MA 2EKQA 2VZ0A 1IHXA 3GC6A 4MDHA 4YJGB 2CF5A 1E1KA 2PZMA 2FWMX 2EKPA 2QYSA 3A14A 4Z0PA 3MEQA 5I9NA 3DHEA 2P9GA 4JJGA 4ILKA 1P1RA 3STHA 4BO7A 1LLUA 4NJMB 2C5EA 1HE2A 3JQDA 3QLJA 5CEFA 3GVHA 4J7CA 4E5NA 2I66A 5GZ3A 1U2DA 4LVUA 4HNHA 4RZHA 2PD6A 4D41A 4YT8A 1PZHA 5JYEA 3JD0A 3I9JA 3UW3A 1V3VA 4GKBA 2CVOA 3IP3A 1VKNA 5KJEA 3S1LA 3AWDA 4C7KA 4GKVA 5KCZA 3DB2A 3DMYA 2NVUB 1PJCA 3KYCA 1SEVA 3ASVA 2AEFA 3RKRA 5L7YA 2D1YA 4TMFA 3GHHA 2X0RA 3WJAA 4J49A 2ILTA 1UDBA 4CPDA 2JCYA 3GAFA 1NVGA 4XB1A 4I5DA 4XJTA 5IXSA 5KJ6A 3DONA 3MCVA 5A9TA 2X22A 1IOLA 4B7XA 1K6IA 2Q2WA 1JVSA 4RVGA 3BZUA 4CLHA 3TQHA 4W9NA 2HAEA 2BI7A 1BXKA 1T4DA 4J9VA 1P1FA 2BMAA 3ADPA 4D45A 4HFJA 4Y9DA 1ZK0A 3COSA 3DZGA 3BTVA 2PNFA 2C2YA 4IS3A 4Q3NA 2NVBA 3PHIA 4EEZA 3S2GA 4F6LA 2GSDA 3CZRA 4PRKA 1ENZA 1PGJA 4FGWA 1HDZA 3K6JA 4W7IA 2AG5A 4GSLA 4L9RA 5EESA 4XJSA 3I9OA 2G76A 4ZQEA 3ZCXA 3JQGA 1LDYA 4D3DA 3PGXA 4CODB 4OOEA 1LSUA 3OA0A 4NJOA 4W4TA 2VRCA 3TZQA 2WD7B 1VL6A 2CNBA 1IYZA 1V0JA 1NQ5A 4N5MA 1VKOA 4YCAA 1GV1A 4A73A 1IPEA 1VRWA 3LT1A 1PS0A 3ITKA 1JWAB 4R1NA 5FI5A 1B14A 4PLFA 2PD4A 3ZDFA 4E21A 3L6EA 4MOWA 1ONOA 1CEQA 4I5GA 2FP4A 2GN4A 2BELA 2FOIA 3WDSA 4BQPA 3OHSX 3VPFA 3PDJA 1EK6A 5ENDA 4YJGA 2GDZA 1E7MA 2DBVO 3G49A 4GAEA 5HRUA 4J1NA 4XWYA 3I52A 1PZEA 5AOVA 4PG6A 1Q2XA 2BFOA 4B3IA 4G65A 5B37A 2FZEA 4NJMA 3RFXA 1HLDA 2TMGA 3JCZA 3Q9UA 3BTUA 3OM9A 4J0EA 4F46A 4KUHA 5K0ZA 2G1UA 1WDLA 2WYWA 2Y1GA 1KVRA 3H9GA 4P22A 4LVCA 1R16A 4A5OA 2Y68A 3PIDA 2FSSA 4XX0A 3ONDA 4PVDA 2RAFA 2WE8A 1ZK2A 1AGNA 1NHGA 4AJPA 4DIOA 3WB9A 3ONFA 4BNIA 4GWGA 2NVUA 4EBFA 3LF1A 2PV7A 3GGGA 1K6JA 1VPDA 4LCEA 3SVTA 3JQFA 3W4KA 3Q11A 3M1AA 3ZHZA 3UXYA 3C7CB 2UUOA 4Y8VA 3H9EO 1EQUA 1S7CA 2F00A 1HYGA 3C1TA 4Q3DA 1YO6A 4BNNA 2Q45A 1YL7A 4JK3A 5TSDA 1LSOA 1DC3A 3GRPA 2EG9A 3HUDA 3MWEB 4C4OA 3ZN2A 3UH1A 1U8FO 4ZRMA 3VTZA 2Y0EA 2Y1EA 4FOSA 3K92A 3OICA 4H16A 1C3VA 1R0LA 4D3FA 3WSWA 1A9ZA 4FDAA 4MKRA 1X15A 1LQTA 2O3RA 4D43A 4QSMA 4Z9FA 4AJNA 1HYEA 1M75A 5HS6A 4CUKA 3VPHA 1PZFA 1KC3A 1KIFA 5CDTA 3F46A 5JAQA 2OUIA 1WWKA 2G17A 1UJMA 5G0WA 2DUUA 4KP7A 2FZWA 4ND3A 2FR8A 4PCVA 1BXGB 4INAA 5EPOA 5H82A 1YOVB 3LSYA 1EMDA 4MINA 3G17A 3K96A 1WMAA 4RVFA 4BO4A 5F1KA 3RJ5A 1UDCA 4GLOA 3DBVO 1UP7A 1RWBA 2WD7A 4BVAA 5T8KC 1YJ8A 5L3ZA 4Q39A 2IXAA 1GL3A 4Z0TA 3NV9A 3WGIA 1VJTA 4RVDA 5CHEA 2GPTA 3RU7A 4BO2A 3TRIA 1MV8A 3M2TA 3AUAA 1YL5A 1GADO 1RJWA 4CLDA 2JCVA 3ZU2A 3TSCA 5JFOA 3WFJA 2B36A 1J4AA 4XYGA 4CR8A 2I67A 1I5RA 1PEDA 1J49A 3OIGA 3KUXA 1B16A 3OBBA 5BNIA 1ULSA 3BMQB 4NK5A 4OXKA 1YONA 4RCVA 5I8WA 4PLVA 2FY8A 5A4DA 4RF2A 3WMWA 3WYCA 4BNMA 1GPDG 3CTMA 4IZIA 4S3MA 4CV1A 1HDYA 3MTGA 4N5NA 4BMNA 4OKNA 4RPLA 1HDXA 1VJ1A 3DTTA 4MVJI 1LU9A 5G4KB 2J5QA 5KVCA 5TLSA 3WR5A 5T67A 2D3TA 4A0SA 4E0BA 1EVZA 2Q50A 1BRMA 1PR3A 3R3SA 3RUIA 1YH3A 3WGQA 4FFOA 2JKVA 4WOJA 1P1HA 2DAPA 2O3UA 1T2DA 5GZ1A 3QRWA 2ZKLA 3T7CA 2OBNA 1HKUA 5JC1A 1DLIA 2NTVA 3GFGA 1DDOA 1CRWG 4RV9A 2HQ1A 1QYXA 5L7WA 4TRNA 2GASA 2VHVA 1H6DA 2GN8A 2I76A 3H3FA 3NAQA 5CDUA 2ZJ0A 5AYVA 1P1KA 5T64A 3PQDA 2AG8A 1WZEA 3D7LA 1BWSA 2E48A 2J8ZA 1V3UA 3WSVA 2WWRA 3PWZA 4HXYA 1H94A 2HDHA 3WIDA 4A27A 1E1LA 1XQ1A 1LX6A 1HL3A 2DFDA 3JD2A 5THKA 4AJLA 1E5QA 2YV2A 5KJFA 2VUTA 3DMTA 3KO8A 4K6FA 2AQ8A 1RM4A 1IE3A 3ZI0A 5FFFA 2UAGA 1WLYA 1PS8A 1ZCJA 1F0YA 1ISHA 5G0UA 1QYVA 3HFSA 3AUSA 2ZQZA 2XAAA 4LK3A 1BMDA 3DZBA 3IC5A 1DSSG 3FI9A 4MIEA 3GVCA 4ALLA 4C7JA 4II2A 1NQTA 3HDHA 4R41A 3EHEA 4YDRA 4NPCA 4EUHA 1YE3A 3NT5A 4RPHA 3GA0A 4QO8A 4WE3A 4ZRNA 4R51A 1NXQA 1V6AA 2P91A 4QFCA 4YEDA 1BXGA 3F3SA 3KV3O 3RC7A 1LSJA 1YOVA 3E5MA 4OOFA 4JP3A 1UUFA 3ZW9A 3BA1A 3C8MA 3ZV6A 4UULA 4DVJA 1N7GA 4NIMA 1WVGA 1Z73A 3ZH2A 4YAKA 1UZMA 4CMIB 1SEPA 4BNHA 5AVOA 4O59O 5DN9A 5G0TA 4XRGA 3L9WA 3V8BA 2POQX 1A7AA 4ZN6A 5IDYA 5A5FA 1E7QA 4FN4A 4L73A 1AXEA 4XIJA 3ZNOA 4R9RA 2Y67A 2RIRA 1NVTA 2VZ8A 4I08A 4UEJA 1ZW1A 2HLPA 4Z9XA 3GRKA 2G82A 4CQMB 4F45A 3GNSA 3PXXA 5A3VA 4BO6A 4HV4A 3ZWVA 3EYWA 3BYZA 4DYVA 2VN8A 4W9NC 4JJIA 3GN2A 3W4JA 1DOHA 4ALNA 3HN2A 1CYDA 3DTYA 1X7GA 3K9QO 1AN9A 3RSHA 8ADHA 4N5LA 2H9IA 4O1MA 5TJ9A 4W7HA 1XEAA 4PLCA 2RHRA 4Y6SA 4URFA 1QYWA 4NMHA 3PVZA 3OJLA 3QWIA 1EFKA 1P9LA 1YB4A 1ONPA 4L4XA 3K8ZA 4GX1A 4L0QA 3R1IA 1ZEJA 1ORRA 3DZHA 3TZCA 2FR1A 3NDJA 1NBOA 4ND5A 2HKIA 1AXGA 4GX2A 1DRWA 3I3OA 5DNAA 2JL1A 3GGOA 1SO8A 1IHYA 3ZU4A 4J6FA 2FPPA 4ROSA 3S2EA 4EGFA 3BIOA 2DPGA 1FDVA 5JAMA 4EJ0A 2NM0A 5JMPA 4UVGA 3QHAA 2GCGA 4ZQBA 1T2CA 1R12A 1Q0HA 3B1FA 3JQAD 2CUKA 5G0SA 2EJVA 2DQ4A 4CM3A 3DAFA 2DFVA 1T2FA 3INGA 3DBRB 3LLVA 2OXIA 3F1KA 4J1TA 2J3KA 1PQUA 1HDGO 1B8VA 1FDWA 1NFRA 1GUYA 1HTBA 2C82A 1UZLA 3GG2A 1Y5RA 2UYYA 2B4RO 2ZB3A 1NP3A 3QY9A 4BGVA 5EN4A 1KERA 2CDCA 3EUWA 4ND1A 1HDCA 3GPDG 3V5NA 6ADHA 1E77A 1NFQA 2Q2VA 3GF4A 3VKUA 2AHRA 2D4AA 2IYOA 3AFNA 5ITVA 1TVEA 2VHYA 4KOAA 1T1SA 1UAYA 1EFLA 2X86A 3TZ6A 4XQ9A 2PFGA 3NUGA 3Q2IA 4HADA 3L77A 1DPGA 3FWZA 4Z0HO 3GZ4A 2J3HA 3UUWA 5BT9A 4RVHA 4X54A 1M76A 3T4EA 1YB5A 3HADA 4JCOA 1PR9A 1EUZA 1YB1A 1YL6A 2QG4A 1PL6A 3L0DA 3U4HA 1K3TA 3AJRA 3JV7A 4CMIA 2PA3A 1DFHA 3JQFC 1EE2A 3BHIA 1YGYA 3JD1A 3FTPA 2QQ5A 3QIVA 3C1AA 4FJ2A 4OMUA 3TL3A 3VHRA 1X13A 4JBHA 1H6AA 4P4GA 3CPSA 4RL6A 4PRLA 3ORFA 4CQMA 3UHAA 4XRRA 4CLOA 1E5LA 3OQ1A 3QP9A 3DZKA 2BGKA 1LLDA 4IQGA 2I99A 3WGOA 4MVJH 1QMGA 4BB6A 3LLSA 1U28A 4R1TA 1EDOA 4AJIA 3F6YA 2Y1CA 1C0LA 4BB5A 2B83A 4MKXA 4KWHA 2NNLD 1SB8A 1GYRA 5C3MA 3DOCA 1VE9A 1UP6A 4BO9A 1TXGA 1D1SA 4QFDA 2HMWA 1PWZA 1MP0A 3I1JA 4ID9A 1O89A 1F17A 3RC1A 3F5QA 4BKQA 1H2HA 4AJOA 2W8ZA 2AMFA 4EEXA 3U09A 2HK8A 1I30A 3AI3A 1VJ0A 4UAGA 3ZV5A 2H1SA 5A9RA 4HFNA 4IGEA 3I4CA 3DBHB 4WCFB 1ADFA 5EMHA 3OH8A 4XDYA 5JY1A 1ZJZA 3AY6A 2FSVA 2C20A 3LT2A 3ASUA 2X9VA 4J1QA 2O7SA 5EQFA 1XQ6A 1ISIA 4XGNA 2XXBA 3DBRA 4JP2A 4ZGWA 4OXNA 3CKYA 3HZZA 3K2BA 5FWNA 3HHPA 1J6UA 4KUEA 2A9FA 4J9UE 2GN6A 2P5YA 1NFFA 2EW2A 1QORA 3RFVA 4PLHA 2X4GA 1U7HA 4DTIA 2ZATA 4U5QA 1E6EA 4BNXA 2QZZA 1E7YA 2E4AA 2D8AA 3KM0A 4K6CA 3I5MA 3KYBA 3JYNA 4IBOA 1H6CA 5L9AA 4BO3A 1PWXA 3FR7A 2BHLA 3AI1A 2AW5A 4OQYA 2QRKA 3JQEA 4FB5A 1YQXA 2HO5A 2O3TA 3HN7A 3PJFA 3SBOA 4RLHA 3FN4A 3MJVA 4KZPA 4TWRA 5I7EA 1TI7A 1TT7A 4ALIA 1PTJA 4EYEA 3OIFA 3Q1LA 4GQAA 2O2SA 2GN9A 4GL4A 5TC4A 1MXFA 3SLKA 2PK3A 1X1EA 3KZVA 2JHFA 3D3EA 3QWHA 4F6CA 5IFLA 5CDGA 2HMSA 5K9ZA 2Y1DA 1K89A 2PGJA 3AM5A 3ZWMA 3H5AA 4B4UA 2YQ4A 2C54A 1LRLA 4MPDA 3K30A 4FOOA 3VPXA 4FFNA 4QO7A 1GV0A 1XCBA 1BSVA 5IZCA 2BFAA 3DMTC 4BNKA 1Q0LA 1Y81A 4PG7A 1A71A 3AY7A 3WBFA 3B6ZA 4BOYA 1P1JA 3EZLA 5LCXA 3IUSA 4GH5A 1V9LA 2VHWA 3RJ9A 1HRDA 1QYDA 3ZWBA 1ZXLA 3ABIA 3NYWA 4M89A 5TQVA 4MVJM 2QYTA 2IZZA 2EERA 1KVQA 3U0BA 1JWBB 1A5ZA 4Q9NA 4ALKA 3GMSA 3TF5A 1XHLA 2HUNA 2VCYA 1HWYA 3PJEA 4CMHA 2VWGA 1O6ZA 4NBUA 1K5HA 3D3WA 3DBHA 1MUUA 1X0XA 4WCFA 4BHTA 4E5MA 3PDUA 1GQ2A 1Q0QA 1QSGA 3MJCA 4K28A 1KEVA 5HA5A 4DRYA 4NBTA 2J6IA 1OC2A 2O50A 1QR6A 2YDYA 1B2LA 4J16A 1GZ4A 4MP3A 1ISMA 4IJUA 4TKMA 4RORA 4YBZA 1JW9B 4DQUA 4KQXA 4MO2A 3KEOA 2IEBA 4JBIA 4BMVA 2XF8A 2V6GA 3UCXA 4B7UA 1U5CA 2P9CA 3C1OA 3VH1A 2DTDA 2X5OA 2B69A 5TT0A 3UAGA 1U3TA 3BTOA 1ZSNA 4EJ6A 1UXKA 4DMMA 1OFGA 1GTMA 4NHEA 1ZIDA 1P74A 2TMDA 1JLLA 5KJCA 4JGBA 3NDRA 1EDZA 3AOEA 4N54A 3WBBA 2B5WA 3OIDA 5BR7A 4WLFA 3GT0A 1U4SA 5COQA 4NFYA 1BTOA 2PGDA 1L7EA 4WLEA 3CSDA 4RJTA 5GY7A 2O4CA 5BSHA 3S2IA 1GPJA 4CM6A 2V6FA 3DAPA 2BGMA 3ICCA 4DLLA 3F5SA 3JYQA 4MVJF 5TGDA 1V3TA 4UREA 2C59A 4FFMA 2X8LA 4ALJA 1C0IA 3E18A 1HYHA 2IXBA 4WEQA 2GUGA 4NQZA 3H7AA 4ITUA 2Q2QA 4K26A 5H83A 3IJPA 1U3WA 3PHGA 4II3A 1KVUA 3C85A 3UVEA 4PG5A 2W4QA 1B8UA 1IZ9A 5DOZA 1LJ8A 1P77A 4LN1A 1UDAA 1HE4A 2YJZA 1E7WA 4RZIA 1GU7A 1ZFNA 3WX0A 3GAZA 3M2PA 1RYEA 3K73O 1EQ2A 1WNTA 3KSZO 1LDEA 1HSZA 1Y9AA 3QVWA 4ZICA 5FEUA 5BNFA 1XIVA 1P1IA 4RPGA 3GN1A 4Q3AA 3Q6IA 2P9EA 3PHHA 4Z3KA 3DOOA 2YQ5A 1ZJYA 4G2NA 4BGUA 3U9LA 3FSRA 2VNSA 1GR0A 2CZCA 1E3JA 4CM5A 2OP0A 3OQ6A 4DLBA 1H9BA 4HP8A 2EW8A 3EK2A 4IXTA 4RQTA 4YAJA 3WGGA 3VH4A 4BKOA 4Z6KA 4R1SA 3HWRA 1CQJA 3ZNNA 2AE2A 1GZ3A 2BI8A 1YRLA 4BKPA 1FDSA 3V2GA 1HEUA 3IMFA 3UOGA 2B35A 1NPYA 3GEDA 4D79A 1ARZA 3CZMA 1ML3A 3FNEA 4HY3A 1Y8RB 4J3FA 4JIGA 3WQQA 4DYDA 3ADOA 3RUAA 3ENNA 1WAMA 1LNQA 5FI3A 2W90A 2YY7A 1IL0A 1DJNA 3KRTA 3M6IA 1TLTA 1MX3A 3VZRA 2EGGA 5JYDA 2AQHA 4Z9YA 3MOIA 1DAOA 5B4VA 4MVJD 2JD2A 4J90A 2YFHA 2ZTUA 1E3WB 3OETA 4FJ1A 1HLPA 1QG6A 3RC9A 1WMBA 2NADA 1E3SA 3IDSA 2IRWA 2VWHA 1D8AA 4U6SA 2HMVA 4OSOA 1XU9A 5IDQA 1MA0A 5JXWA 5KJ1A 3O38A 1C14A 2RHCA 1RYDA 4CLXA 5KKCA 1U2GA 4B8ZA 4PG8A 4NDNE 4UUNA 1HF3A 3GUYA 3GDGA 5IDWA 5EQDA 1H6BA 1VL8A 5F1OA 4FCCA 4XYEA 3IKVA 1O5IA 2CFCA 1ZXBA 2X5KO 3BXXA 4FR5A 5EERA 3P5SA 4CJXA 4LISA 4NBRA 5TNXA 4DGSA 1GD1O 4EJMA 5ENVA 3O26A 1EVIA 5GZ6A 4AJ4A 1N8KA 3D4PA 3K5PA 4BL5A 4GGPA 4NNJA 7MDHA 3ROQA 3W1VA 2YW9A 4TSKA 5K6AA 4ALMA 5TRTA 4EI2A 2C7GA 1E3IA 1NM5A 4D7AA 4DPLA 1I3LA 1ZBQA 1P0CA 5A5EA 2EJWA 5L7TA 4MP6A 3FPLA 4GPD1 4IJKA 4U6QA 4LGVA 1XYGA 3L9XA 4L8VA 3RBVA 2O23A 1HE3A 5DOVA 1P31A 1AUPA 3OFSA 3P19A 3U49A 3VTFA 3PJDA 3HDQA 4Y67A 1N1GA 3RUDA 3SJ7A 2OO5A 1HT0A 1R66A 2D5CA 3GR6A 4IM7A 4XGIA 3TFQA 5ES3A 3LT4A 3NT2A 3OJEA 3IOYA 4DPMA 1DXYA 1R0SA 3TDKA 5TIIA 4BNLA 2ZYDA 4KMSA 1YDWA 5T57A 4OKIA 3JQ8B 1E6WA 4I9NA 3RUFA 3A9WA 4YT2A 3WWZA 4PN3A 4AJ1A 3NGXA 1YQDA 3H9UA 4XIYA 4A2CA 2ZYAA 3I6QA 1TEHA 4BNZA 1Y8RA 1ZKMA 3PYLA 1GEGA 1P45A 3INTA 4FBGA 2VYVD 4JROA 2YHIB 2O48X 3L6DA 6LDHA 1B26A 1JAXA 2PKQP 5DCUA 2B0JA 2QRJA 2E82A 1PJSA 1Z7EA 2I5PO 2UVDA 3QVTA 4PLPA 1YS4A 2NU7A 1M67A 1XR3A 2AEJA 5KVQA 1GDHA 2Q99A 2NU6A 2Z1MA 3E9MA 1E3WA 5IZCC 1OZAA 3RBXA 4RO0A 3F1LA 1H2BA 2I3GA 1SCUA 1EEHA 4FC7A 4U7WA 2FN7A 3ULKA 2WJPA 4ZA2A 2JD0A 4E31A 4XQGA 1R4MB 2Z95A 3H8VA 3IJRA 3JQAB 4YJHB 1O95A 3C7AA 1EBUA 1ADGA 2OFPA 3NDIA 4E12A 2ET6A 2XXJA 4FSHA 3R3JA 1S6YA 1JVBA 4O6VA 4EUFA 2GNAA 1DHRA 4MP8A 1EK5A 4PG4A 2X5JO 1MGOA 4PZCA 2R6JA 1PQPA 3ZU3A 2YV1A 4AVYA 2UV8A 1F06A 4IDEA 1CIVA 1P3DA 1NPDA 4PLYA 4IJVA 3C24A 4XEHA 4B8WA 1OMOA 4ND2A 2CMDA 4FGSA 2H6EA 1NNUA 4QXMA 3B1JA 4M54A 1RM5A 4WCFC 1BXZA 2J3JA 3ST7A 3S55A 3GH3A 5J23A 4HX5A 2NU9A 3P2OA 2ZIZA 5JMWA 4FJ0A 4GVLA 3FNFA 3QA9A 3H5NA 4L75A 5TS3A 5JCXA 5U4QA 3JYLA 4WUVA 2VNAA 3T7EA 3X2FA 3LU1A 1I32A 1FDUA 5HWSA 4WCDA 4JLWA 4R4JA 2O4UX 4KTTE 3VPGA 4CUZA 1SB9A 5L4NA 3A06A 3E5RA 1KY5A 1M6WA 4IDCA 5DULA 1GUFA 3RCBA 3WMXA 2A4KA 2W2LD 3WIEA 1OAAA 5DT9A 3L4SO 1DEHA 3W8EA 3FTNA 1ONNA 2HJRA 2Y93A 2EWMA 5F5LA 1Z74A 3BMOB 4XD2A 2NSDA 3AOEC 1QV7A 1Y6JA 2DBRA 3D1LA 4XYMA 4M8SA 3WXBA 4XGKA 3OJ0A 1EUCA 2RBEA 3JQ8A 5JDCA 2WD8A 2LDXA 2NQTA 3F4LA 4KWIA 3ONEA 2VT2A 3BMQA 3D5TA 2QX7A 4FS3A 3Q2KA 3VZPA 1I10A 2BD0A 3FHLA 2FPGA 1NWHA 3H5RA 3A4VA 4O0LA 4YT5A 4OYRA 3PJGA 3WYBA 2GZ3A 2YHIA 4FIZA 3RVDA 1DIRA 3AW9A 3QWAA 9LDBA 5G4KA 5A05A 1D1TA 1PJ4A 3MTJA 1QXSA 4WKGA 1RM0A 4BKUA 2PZJA 4W82A 4CR7A 4D0RA 4CMGA 4D3SA 5F21A 5B1YA 1DFGA 4ZVVA 4J43A 3SJUA 3MJTA 4DLAA 4R9SA 3R6DA 3IUPA 3GOHA 1G0NA 3U4IA 4YJFB 3GHYA 2JAPA 1P33A 2CDBA 2NVWA 3DZFA 3KYDB 4Y98A 3KLPX 1SOVA 2B37A 3N58A 4RLSA 1R4MA 4PZEA 3V1TC 3WQRA 3ZWXA 3H6KA 1PZGA 5A02A 3JQAA 4YJHA 3SEFA 3WNQA 1XU7A 2Q1TA 4R1UA 1X7HA 5CEEA 1LSSA 5I9LA 1G6KA 4HBGA 3CE6A 4YAIA 1LRKA 1PIWA 4DXHA 1I33A 4W99A 4YQYA 5JAIA 2AXQA 4H7PA 5TT1A 4H3VA 1L7DA 3EMKA 1MXHA 4CMEA 4IDDA 3TJRA 4E3ZA 3HB5X 4H15A 3ANLA 4XR9A 3ZWOA 2Q4BA 1BVUA 4AJJA 1K2WA 5AQ1A 1ZSVA 2X0NA 4XZ3A 4FPXA 5IJZA 1YWGO 4OQZA 2IZ0A 1Y9EA 3CIFA 2WM3A 3G1TA 4IJWA 3HE3A 2WSBA 2ZCUA 1NR7A 2EHDA 3AU8A 4FW8A 3NX4A 2C07A 5KNLA 4BNJA 1KETA 4Y6PA 3DL2A 1CF2O 3QVSA 2CVZA 3ZHXA 4BGIA 1H9AA 1I24A 3BTSA 5C5IA 5DBIA 5JCJA 5CG1A 3PRJA 5JCJD 3DBLB 4CV0A 4QUKA 4J4TA 5JC8A 4LMPA 2SCUA 5COAA 2Q46A 3IIEA 3DOJA 3G79A 5EJ2A 3PFFA 4NBVA 2GD1O 1E92A 1SZJG 5IN5A 4JNKA 1R4NB 1X7DA 4J91A 4J4HA 1UAGA 3U4CA 2BFPA 1OI7A 4NZ9A 3BMOA 3KXDA 2VWQA 5ICMA 4ZHSA 5C37A 1A4IA 3MOGA 3ZNQA 2BH9A 1NAHA 3EDMA 3ANMA 1D3AA 2HCTA 4YVFA 4PVCA 3GVXA 3L6OO 1IULA 4DBZA 2OMEA 2DUWA 2PKRA 3I4FA 3KLMX 4OSPA 4YWJA 4B3JA 1I2BA 1IY8A 1LDNA 1ZNQO 3VVCA 3G3EA 3LF2A 1B8PA 2XOXA 4PFJA 5G4LA 4AJHA 5A9SB 3DR3A 3GDOA 5K6AC 4QEDA 5KTKA 2X9GA 4B4OA 4R16A 4UEKA 2ZK7A 2DVMA 3PYXA 2JCXA 4RPJA 1T2EA 4U0KA 1B7GO 1T24A 2P4HX 1U9JA 1XG5A 2HRBA 5DCWA 3EW7A 3UF0A 4K1LA 5JBIA 1I2CA 2J3IA 3RD5A 3LYLA 3GUCA 5TF4A 3WJ7A 2WDZA 4JN6B 2PWZA 1KBZA 1WZIA 3ETDA 3D64A 3ZZNA 4CM8B 3RC2A 4FC6A 3KYDA 3JQ9A 4Y6RA 4R69A 4GX5A 2B4QA 4WNIA 1VSVA 2QZ9A 2B4TO 1DBVO 4AL4A 1PJTA 2YV3A 3MJSA 4IDFA 1C1XB 4CL8A 1ZH8A 3LC2O 2X58A 3SC6A 3VVBA 3SX2A 3ENKA 4LRSB 4U8GA 3U4DA 1KOLA 5DDIP 5JE8A 1YVEI 1RKXA 4P8RA 5CG2A 2AQKA 5DBFA 2GGSA 1PX0A 1HXHA 4P4LA 1R37A 5FF9A 2DTXA 3GQVA 2Q4EA 3UN1A 3F4BA 3D4NA 5C7IO 4A7PA 3KSDO 2EIHA 3IL2A 2O3JA 5HM8A 3EVNA 4UVDA 5KIAA 1AE1A 3CEAA 4CR6A 1UXGA 3D5QA 5LDGA 3W8DA 2ZB4A 3WTBA 4YA6A 3X2EA 2PD3A 2VOEA 2ZYGA 4RF4A 3KETA 3AM4A 1WDMA 2F1KA 3VDQA 3BAZA 3AFMA 3UICA 3GPIA 4DC0A 3JYPA 3H65A 5IAAA 5IN4A 1UZNA 2X7HA 3K2EA 4MVJG 4E2ZA 3DBLA 3HG7A 3DWFA 3IP1A 4KQWA 3JQ7B 3CUKA 1ZEMA 3HFGA 3KOUA 4ZU3A 1FF9A 4CMBA 2HMTA 1GYPA 2Q49A 3GFBA 4R5HA 1BVRA 4WLNA 1O8CA 4GVXA 1PGOA 1R4NA 4CL3A 1DIHA 4IDGA 2B5VA 2FPIA 4YTEA 3WNVA 4BNYA 4CUJA 5IF3A 3W4IA 3DZJA 2PZLA 4RGBA 3WS7A 1BG6A 1T2AA 5ILGA 2NTJA 4O63O 3FPCA 1GQQA 1Y8QB 2O3SA 5IXYA 4PLZA 3OEWA 1E1MA 4NFSA 4DUPA 3ZHBA 3RIHA 1U3VA 2D2IA 4OGWA 3L4BA 4MJLA 2GRAA 1HDOA 4NH4A 1DJQA 2CF6A 2DPHA 3WGYA 1MC4A 2PZKA 1DIBA 4IS2A 4R5MA 5A9SA 3U5TA 1V8BA 2GERA 4CM4B 2D0IA 1VI2A 2ZB7A 5EL0A 1ZMOA 4MIOA 4GSKA 3H2ZA 3KVOA 1U1IA 4BKRA 3AOGA 3D0OA 1NX6A 1YBMA 5I7FA 1T4BA 3DFZA 1EVJA 4MVJP 4CM8A 3H2SA 2NWQA 1LDMA 3MJ4A 2WMDA 4YT4A 2QIOA 1PJQA 3E8XA 3GDFA 1YBAA 4KDFA 3E03A 3T4XA 1UP4A 4E4YA 4J7XA 5DP1A 2EGHA 1EUDA 1C1XA 2PY6A 3WGZA 4R3WA 3S8MA 1XKQA 4YRBA 4CMJA 3E48A 4M1QA 1LTHR 2P2SA 1KVSA 4BS9A 2BFMA 3PQFA 5A04A 3TNLA 2PTGA 5JO0A 1GCOA 2BLLA 4S1VA 1B0AA 5JDCC 2WEKA 1HDRA 4W6ZA 1UXIA 2A92A 4UUMA 5I9MA 3H9QA 3FR8A 3PLRA 3ZWCA 1KY4A 4R68A 2V6MA 3PQEA 4TROA 1ULUA 4GMGA 3GGPA 3LT0A 3PHLA 1JKIA 5L45A 2PH3A 3M1LA 4DA9A 4OXYA 4E5KA 2E37A 2ZTLA 5CDYA 3Q9NA 3G0OA 3H9JA 1I3KA 3CINA 1F14A 4B4VA 4IQ8A 3AUUA 1JQBA 3HDJA 3JQ7A 1JN0A 3I9LA 4Z3DA 4BNTA 4FFRA 2VQ3A 2ZJ1A 3E9QA 3Q0EA 2C5AA 4I9UA 5EIOA 3KSUA 1R15A 4WJZA 1ADCA 4E13A 1YQGA 4A03A 4QQRA 2YYYA 5DZSA 5G2OA 1F8GA 5BNTA 3JQCA 3NKLA 1QP8A 1KEUA 2YDXA 4ONEA 4BMSA 3OA2A 4E2XA 1EZ4A 1LI4A 4GI2A 2VHZA 4JX8A 1UXHA 4RDIA 4WLVA 4R54A 1Y8QA 2Y99A 5JLAA 1VM6A 1E3EA 3NTRA 4YYZA 2OHXA 4CMEC 2Y1FA 4I8XA 4CLEA 5JAZA 5HTOA 1NVMB 4J1SA 3PZRA 4XYLA 2W98A 2DU8A 3F9IA 4NG5A 5L4SA 2A94A 4ZQHA 4IGFA 4L74A 3R0IA 3FRJA 1MFZA 2CDAA 5ITWA 1KYQA 1IB6A 4TVOA 3V1UA 5MGBA 4CM4A 2AQIA 4NK4A 1ISFA 2EP5A 5COBA 4F3YA 1SAYA 5FYDA 1Z82A 3TWOA 3UKOA 4BUCA 3O4RA 5CAEA 1SBYA 5ADHA 4TVBA 5CDSA 3ZHYA 4RPKA 4DL9A 4TKLA 5BSGA 1ZK1A 3ZW8A 4AICA 1CQIA 4G81A 3ROMA 3IQDB 5CEJA 4ZQGA 2CSUA 3S2FA 1UXJA 3I9KA 1ISJA 1GCUA 1MG0A 2UUPA 3RAJA 3DC2A 1C0KA 3A28A 4R01A 1PSDA 3OJFA 5LC1A 5T5QA 5CPBA 4CLRB 5L53A 4AJ2A 5LDHA 1A72A 1WXDA 2VRCD 2X9NA 3EGOA 1EVYA 2IYPA 3NTOA 3PWKA 3LC7O 3MWDB 1ZUD1 1A7KA 5JW6A 3QV1A 2YUTA 2VYNA 4DIFA 4PLTA 3RASA 2VYND 3ICPA 4MVJA 2V6BA 4IZHA 3PWSA 5BSEA 2X1HA 1BHSA 4IPTA 1Q7CA 1QKIA 4EW6A 4WEOA 4B7CA 1VSUA 1IPFA 3RROA 4BIIA 4XDZA 4E5PA 1WP4A 5A03A 1KS9A 1E0DA 1KVTA 3NGLA 3ROKA 3V2UA 5JNLA 2V7PA 3QJ5A 3QSGA 3HJAA 1DLJA 1FXSA 4PZDA 1DB3A 5G0VA 5AXAA 4PLGA 2D5AA 1WDKA 3LK7A 3A1NA 5JY6A 1G1AA 2FMUA 2AEMA 4I5EA 4CMAA 1ENPA 2Y66A 4CQLB 3JQ9C 1O0SA 2HJSA 4RQUA 4UVEA 1DRVA 1PL7A 4I9HA 2UDPA 4E30A 1OC4A 5JPIA 2YHUA 4P38A 3U3XA 4ZD6A 3GZNB 3EY4A 3I83A 4WK6A 5L95A 4EITA 2C0CA 3W6ZA 1I2ZA 1I0ZA 3PLNA 5AXBA 1WW8A 1NQOA 3PHJA 4M49A 2IEDA 2AE1A 1GY8A 1WPQA 2I65A 2Q1UA 4XCVA 3UFXA 4YAGA 4CMKA 4YQZA 5ICSA 1DC6A 1JDJA 4XA8A 1P0FA 4RDHA 3DAGA 3IKTA 3O9ZA 3BMCB 5H81A 4RVSA 3B70A 2C7VA 4IINA 5T6BA 1NYTA 4CV3A 1JKJA 4WOKA 1GZ6A 3WFIA 1KC1A 1ADBA 4WNCA 3GEMA 4BV9A 4IIUA 4GX0A 2OOSA 4YRDA 5KKAA 1T26A 3WICA 3N7UA 1LBEA 1Z7BA 3EAGA 2EXXA 2WE7A 2R00A 1M66A 5I8ZA 2V65A 4LSMA 2ZQYA 5TJHA 1E7SA 5JS6A 4OL9A 4OIMA 2VRBA 1ZSYA 3SLGA 3VDRA 3OQBA 1GEEA 3KBOA 3VAZA 4I1IA 2GZ2A 4E2YA 5B4TA 8LDHA 2XPCA 1NASA 1I36A 1I8TA 1GFSA 3EC7A 3LC1O 3ZV4A 4LMRA 2HU2A 4UUPA 3TN7A 1TB4A 2AA3A 4CLRA 2RH4A 1UH5A 2W2KB 2O3QA 1CDOA 3F47A 3JQBA 4EZBA 5JSFA 3RUCA 2VYVA 1JA9A 1SPXA 3RU9A 3QW2A 4TQGA 1Z6ZA 4LSWA 4YRAA 5CPFA 5F1PA 3ON5A 2EV9A 5DF1A 1CWUA 1Y7TA 1JU9A 2RH8A 2JFGA 3E82A 4BO5A 1FJHA 2YFQA 3LQFA 2PH5A 2I6TA 3ZGYA 3EVTA 3NJ8A 1F8FA 5IG2A 1C0PA 3IAHA 5THQA 3GLQA 3WQSB 5IDXA 5IZ4A 1W8DA 2Y05A 3L4BC 1FK8A 3AM3A 4M55A 5I7VA 2WTBA 2X23A 1YXMA 4WPGA 3GNQA 4HKTA 1X0VA 3PPIA 3AI2A 4ND4A 1ZO8A 1ZK3A 3KB6A 2CY0A 3DQPA 3DZIA 4FFLA 3WG9A 4A10A 4OH1A 2O2YA 1XLTA 2HMUA 2Q3EA 4D42A 3JD3A 1LC0A 2NLOA 3WLEA 1ENYA 4Q3EA 1CERA 2R2GA 4MVJE 5F3RA 3HDYA 4LW8A 3FNHA 1HZZA 3RKUA 3I6IA 2JFFA 2NU8A 2LDBA 3LVFO 2VUUA 4WLUA 4CQLA 3HQ4O 2PKQO 4J7UA 1H5QA 3QQPA 1Y5MA 4YR9A 3P2YA 1X1TA 4DMLA 1X14A 5JDIA 3GEGA 1E7RA 4DIBA 3HNPA 3GZNA 1Z75A 3WWYA 3LZ6A 2PLAA 3RBZA 1SMKA 2BGLA 4KTVE 2P4QA 4JBGA 4J2HA 3OEYA 4IUYA 3FF4A 1R0KA 3ETEA 4CM7A 3MZ0A 4HWKA 4L4SA 1LXCA 3FD8A 5CFZA 1EBFA 3CMMA 4DBVO 3KHUA 2IODA 2ZTVA 3D4OA 2DTEA 1DAPA 1QRRA 3BMCA 1ZK4A 2DBZA 5KWEA 1TT5B 1YDEA 3AK4A 4IMPA 2DC1A 2W2LA 1QYCA 1B15A 3E9NA 3MJEA 3C3XA 1I01A 4XB2A 2E49A 2EF1A 1ZVMA 1H93A 1T1RA 1XDWA 3BHMA 3H4VA 5EINA 1LQUA 4IY1A 2HK9A 3JD4A 5DCYA 4GLLA 5L4LA 2Q1WA 4IQ0A 2E6UX 3GY0A 1NAIA 1Q1NA 1BW9B 4ZQFA 2HRZA 4QT0A 1A9YA 2EEZA 1Z45A 1LUAA 4NU6A 3TZKA 1MB4A 3RI3A 9LDTA 3I23A 2Y0CA 3ZWYA 4TZKA 4IDAA 2VT3A 3VH3A 2I9PA 4YPOA 1IZ0A 2IE0A 4LCJA 1D4FA 3UCFA 4CM9A 1LLCA 2W2KA 5U1PA 3DFUA 3FBTA 2OP1A 3V1YA 4CM9D 1CJCA 1O9BA 2JAHA 4NBWA 5A06A 2PR2A 4WGGA 3WYEA 4I5FA 3WTCA 4CMCA 3FNGA 4P4NA 5AXDA 2BKAA 2H63A 3GMDA 5A1TA 2VTDA 3WOHA 4XR4A 4CLOB 4ESOA 3ZWNA 1YKFA 2G0TA 1LDGA 2WYVA 4NR0A 4OAQA 3BMNB 4GGOA 1GAEO 4PLWA 4BO8A 3ETGA 3EZYA 3VPSA 1Y1PA 1E1NA 4DWVA 1T25A 2CD9A 4HFMA 4HUJA 1C1DB 5CP8A 1N7HA 5GMOA 2VTEA 2JHGA 1E6UA 3VOSA 5L40A 3GG9A 1U4OA 4GBJA 1FMCA 1LLQA 3DXFA 4UEOA 1N92A 1DC5A 4L76A 4OJNA 4IMRA 4YXFA 3SC4A 4BO1A 5C7LO 3WGTA 1V35A 4RF5A 2VOJA 2NTNA 4D44A 1XA0A 4XQCA 4LRTB 3TOXA 3TFOA 2VWPA 1JTVA 1W4ZA 2OORA 3RQSA 1XGKA 4M87A 4IXWA 4D46A 2GYYA 3PK0A 3QVXA 2GZ1A 4TZTA 1DIGA 1N5DA 3K31A 3PFWO 3W8FA 4AFNA 3I9MA 2QRLA 1SNYA 1CETA 1YBVA 3TZHA 2P5UA 4BNGA 1RM3A 1J0XO 3NJ4A 1K6XA 1NQAO 2OBYA 2VZ9A 4HFRA 4TRMA 1BDMA 4A26A 4B3HA 4FQ8A 3JQ6A 4JJFA 3O8QB 3Q3CA 4CM1A 1H0KA 3WLFA 1KEWA 1TA4A 2JJYA 1MC5A 2OGUA 1LA2A 5DBGA 1BGVA 4BNVA 2A35A 2DT5A 2X0IA 4IIVA 3QWFA 1NR1A 1TT5A 2HK7A 2NUAA 1SOWA 5BQFA 1M6HA 3PGJA 5TX7A 4IDBA 4OM8A 4OHUA 3PTZA 4FD3A 3ZWPA 4DQVA 3WGHA 1MG5A 2NQ8A 1PJLA 3QE3A 4N18A 1DC4A 3SXPA 4YB8A 5B4UA 1BW9A 4MIYA 1U7TA 2FHSA 1A4UA 1XSEA 4QECA 3G1UA 4YAEA 3RFTA 1IUKA 1MFPA 3W6UA 5ER6A 3INRA 1U3UA 3KEQA 3ITDA 3VC7A 4BQRA 4UVHA 1AHIA 5C7OO 5BSFA 2J5KA 4NI5A 1EE9A 3LDHA 3C7DB 1DO8A 1ZMTA 3PEFA 1NWCA 4OO3A 4UVIA 1FDTA 4GWKA 4HNGA 1LEHA 4WASA 5B12A 3DHNA 4M86A 4E32A 7ADHA 4E33A 4UUOA 2CVQA 3RUEA 4QX6A 4DQXA 1PQWA 2Z1NA 4CQMD 4NFHA 2EKLA 3BMNA 2G5CA 1D7OA 1ISGA 3GK3A 4Q3CA 2DKNA 3B20A 4YJFA 3HB4X 4J0FA 1N9GB 1C1DA 1OBFO 1UR5A 2Z5LA 3VKVA 2O7QA 4BNFA 3PI7A 1GUZA 2IZ1A 2OL4A 1J5PA 3E6AA 3FCOA 2Y0DA 2ZTMA 2R00C 1PGPA 3VZSA 2JD1A 1P44A 3GVPA 3HSKA 3BHJA 5HS4A 1HE5A 5U9CA 4NU5A 3AUTA 3QWBA 1B3BA 1Q7GA 1LRJA 4U0JA 1PS9A 1K0UA 3CH6A 3E1KA 4JQCA 1JAYA 3JYOA 4QTZA 4E5YA 2ZCVA 4RVUA 4PGFA 2GO1A 3GNTA 4E2WA 2J5RA 3JQBC 1PU2A 4Q3BA 1W0CA 4B4WA 3D3WB 3KTDA 2DLDA 1GQYA 4TRJA 1OOEA 1YJQA 2C2XA 4DC1A 2OZPA 1RPNA 3OP4A 3DDNA 4BGEA 4BO0A 3PYMA 1VLLA 1NPTO 2VHXA 4JXKA 4D0SA 2VUSA 2H5LA 5HBRA 1DFIA 3L07A 2QHXA 1O94A 4B79A 3VZQA 2FRDA 2DBQA 3RUHA 4GMFA 3TPCA 3H3JA 3O8QA 1BDBA 4BV8A 1NTOA 5KVSA 3UGKA 1HZJA 2YZ7A 1JKFA 3U62A 1F12A 5KVVA 4EUEA 2GR9A 1L1FA 1M2WA 4RF3A 2HSDA 3NT4A 2FR0A 3CXRA 3PP8A 3PZBA 3AU9A 5KOIA
chains in the Genus database with same CATH superfamily
3UYLA 3A37A 5JO9A 4C4PA 1YNSA 3A3PA 3DEYX 5F4BA 1VFPA 3QVLA 1QV6A 2WSYB 3MNFA 6CHYA 4FHZA 4NOMA 5T8KA 2P1RA 3OQMA 3BEDA 1HETA 4TLDA 4AG5A 2M1ZA 3COZA 3KYCB 5BYJA 1KQOA 3AFHA 3MVEA 3WLTA 1ZZEA 1TJ4A 1T3SA 1RQGA 1JDUA 1ULTA 3A58B 3FKSA 4IICA 4B44A 4DJFC 1AUVA 4TQUS 4HNAB 4C0QC 5EIFA 4P33A 4AJEA 4UHEA 1NSYA 4DN6A 1AUQA 4G25A 3CNQS 4H18A 1NKVA 1PJBA 3DTVD 1RRMA 2GLXA 2FRXA 2QMZA 1DDGA 1PFYA 2I03A 2I3AA 1P4SA 4OUDA 4Y6OA 4ZVUA 4BEJA 5I45A 2UUBB 1F3OA 2F3RA 4IXNA 3TSZA 3AY3A 3O03A 4YGYA 3VGJA 5CFPA 3LNCA 5DN6A 1A1VA 4AM8A 1I7PA 2VJYA 3JW8A 2AOTB 4XIGS 3PEEA 4DLRA 4BLSA 2JFHA 2JJQA 2Q1SA 2HLHA 2Z2KA 3FNQA 3ZLVA 2IL1A 5JDIC 1NVBA 2IDZA 3O9MA 3DHYA 2PQ0A 2WVAA 4QARA 1HNXB 3L41A 3WRXC 5KSZA 3CV3A 3AF3A 1DIAA 3WK4A 4C22A 1USUA 3G1WA 1PBNA 3N5KA 1UPFA 1RE0A 2QW8A 5KYYB 1X1SA 1Y5IA 3TJMA 1J00A 1W6UA 4ZIRB 3Q15C 4XQEA 1SQ5A 2BN4A 3DTNA 3S7TA 4YV1A 5I7SA 2ONKA 1JIVA 2V7QD 3N74A 5ALRA 3I9NA 2DM6A 3KKLA 1W2HA 1IATA 5EE3A 3I2GA 1D8TA 5ILOA 4CFSA 1H0HA 3V6MA 3RSFA 3JQGB 5JTUA 1CEEA 3SYNA 5DWVA 4DXAA 4X8MA 1N78A 3DVQX 2ZRPA 2TECE 4KPFC 1K97A 3CMCO 1XWFA 1H8HD 2P3LA 2PKXA 5T4FA 1FNBA 3DE0X 3NC0C 4AURA 4DZTA 4GZLA 4LG1A 4GRAA 2D4HA 4KR7A 4U63A 3LDUA 1EWKA 1PGNA 4HDKA 3CEJA 3DKKA 1SC6A 3SZRA 5C5EA 3CZCA 2Z98A 1UQRA 4DSAA 1MLDA 4DREA 3QF4B 2PGIA 1KEPA 3OECA 3OMLA 2A30A 3DDSA 2VP9A 3VJRA 3OZGA 4J2OA 3OTIA 4HRAA 2D7CA 2JFBA 3TW6A 2WKRA 4MLDA 1O9GA 4A8PA 5A3JA 1PGQA 1VC2A 2FAXA 3ROPA 2UYCA 1NRXA 5FXMA 1N2OA 3E7FA 2VZ0A 2VDRB 3AJEA 1B42A 3GC6A 4LKOA 1FMJA 4P4SB 3UT5A 5FUYA 3DKRA 5JQWA 2A1UA 2CMKA 1I7QB 3V9PA 3ZQ4A 4C04A 3MEQA 2OSBA 1RC8A 5KKNB 3AKYA 3R7WB 1KMMA 4JJGA 1ECPA 4RIHA 5HUHA 4JI4B 3STHA 3FW1A 1W88B 3PA8A 1VG8A 3JQDA 3K9LA 2PSSA 1JECA 2JARA 1N4AA 1LVUA 5CEFA 1DZIA 5GIOE 1KZHA 3T7KA 5JYCA 4RZHA 4D41A 3EVBA 1S9DA 2PO7A 3G89A 2Q28A 4M4SA 5FL7D 3EXEA 5HPYB 1V26A 4I3FA 3DLAA 1UJ6A 2JBHA 1YE5A 3I9JA 1LY1A 3UW3A 3G2IA 3L4KA 1V3VA 2PSEA 1ZAKA 4XX0B 5AI8A 4DFDA 4Z4GA 4DDUA 3R3HA 5KJEA 4CXMA 4C6TA 1FVFA 2P2YA 4R1OA 4GKVA 3DA8A 2UVPB 2QVCA 3HACA 3NC4A 3R7NA 2H31A 5YASA 5AJZA 3VOTA 2NVUB 1KO8A 5B2ZA 2GZAA 1ML4A 4YRGA 4ER3A 1VIDA 4QGBA 5CBPA 2WWHA 2DWQA 3GRAA 1EFVA 5DNVA 3W1EA 1E2JA 4Q9DA 1FFEA 1ZRMA 1FUYB 3GHHA 2AOWA 1BVYF 3HJGA 4E15A 4ABTA 4B2YA 1UDBA 1C50A 2WJWA 4CPDA 4UTOA 1PKEA 4XJTA 2ADMA 3F7OA 1AS2A 2MIIA 4IMJB 3BWVA 5CH8A 1IOLA 1Y6GA 1V11B 3FUUA 1L7NA 5E4FA 1K6IA 3WA6A 4RVGA 1JVSA 1LZKA 1KDTA 2ODTX 3CE9A 1NOJA 1VIVA 1I0IA 4TVKA 3TQHA 3VISA 5DYIA 4J9VA 4DT1B 1KEKA 2BMAA 2XMSA 1SOMA 2A67A 2OORC 2ZR7A 3K09C 5JRJA 2J3QA 2OLJA 4EFNA 1GG8A 4IGAA 4QTTB 3LKVA 4ZVPA 1K98A 1QB7A 4QFBA 3ADKA 1V71A 2QV0A 5KTOA 1ZH6A 3UPDA 3WA7A 3DZGA 3BTVA 2GWHA 1CYEA 2Z2IA 4KAXA 5AVKA 3ZH9B 1Z2NX 4EZIA 3K9GA 3PHIA 3LGAA 3UA4A 3UG7A 2P78A 2D1RA 2V8OA 1AT1A 2GSDA 2G36A 3CZRA 1CUGA 4PRKA 4TV9A 2B30A 2ZIUB 2AFIA 4F8JA 3NHSA 1PW5A 4JGIA 2VDPB 3IAFA 3I32A 2P27A 4W7IA 2D0OB 3EUEA 4P3XA 5A0TA 2JRLA 1EGAA 3I9OA 2G76A 3JR7A 4XJSA 4DC9A 4DILA 4GLBA 4JJZA 3ZU6A 3AVYA 1KH3A 4LYDA 2BC9A 2HU7A 3ET5A 2JIZA 1M72A 3ABOB 4EARA 1VL6A 5BR4A 4LJ6A 2GFIA 2A5LA 2OV3A 4YCAA 1BKSB 2HA4A 4A73A 3EA5A 3PRKE 4O25A 5FPHA 5JS8A 3NU1A 4ZDKA 3M89A 5FI5A 1B14A 4MOWA 1XYVA 1AB5A 1ONOA 4ZU1X 2HDOA 3AHHA 4I5GA 4L4ZA 5DXAA 4X92A 3V4LA 4U7TB 2Q2NA 2BELA 3QNMA 4P82A 3WDSA 4BQPA 4CHGA 3VPFA 4IKEA 3PDJA 3CBGA 1WF6A 3H6HA 1JAZA 5ENDA 1Z5ZA 3CF2A 4YJGA 1QO0D 5FOVA 4FMDB 3THOA 3TLGB 3ZK8A 1PYGA 3B89A 3G49A 5HRUA 3E7PA 1SXHA 3UJBA 1KZGB 1MOSA 5L3SB 1WUHS 2Q3FA 3RS5A 2OM6A 2QEQA 5AOVA 4MKGA 1FNSA 3QQ5A 4L15A 1P6UA 4PG6A 2LVBA 4E1AA 2XBMA 3H86A 1MKYA 4QUDA 1EFDN 5IK2A 2Y0BA 2PDAA 4N3GA 3RFXA 1GRRA 1HLDA 1GPNA 2JJMA 2NTEA 2ES4A 2GWRA 4DCCA 4HWRA 5BQPA 4F46A 4M1EA 3HCNA 5CVCA 1B0PA 5K0ZA 4WW0A 2P9ZA 2Y1GA 1DE0A 4P22A 2G77B 3FSJX 4BPRA 1R16A 5A5DA 5BUSA 1FFYA 2BEVA 2Y68A 1MAAA 2Y77A 3PIDA 3T3NA 5IC6A 2CYBA 1DKNA 2BM0A 3HVIA 4Q1VA 5FPTA 3F6RA 1TA9A 4FVTA 2WE8A 2HCBA 1ZGJA 1ZK2A 3WL5A 4LRXA 3SVLA 3CT6A 1IQPA 2GM3A 4C2UA 4RH0A 2RH9B 3C8DA 4HNVA 1B1CA 4NL4H 1KTIA 4JJ4A 3VAYA 4GWGA 1AA6A 2H9AA 4MRMB 2W2NA 2WR8A 3CIOA 2V8BA 1W9HA 5DGTA 4BYMA 1NVFA 3MSCA 2C9BA 1Y7HA 2PL3A 2O0LA 3FVTA 4RL4A 3UXYA 1Z4LA 5IJXA 3QOYA 3C7CB 4X63A 3DFKA 5BSTA 4DWJA 3HO1A 3B38A 1E62A 2HNAA 3C1TA 4Q3DA 1XZPA 1YO6A 1YR2A 1COZA 1M2OB 4DJEC 1UAAA 5E9AA 2FWNA 2XZPA 4JQOA 3GRPA 1Z83A 4GICA 3U4QB 2EG9A 5DLPA 2WRZA 4QBIA 3OEHD 2ZT7A 3DW1X 4CCSA 4P32A 4DMGA 1EFHA 3ZD8A 2BW0A 1NBWB 4ZRMA 3VTZA 1UMBB 3QZUA 3RF6A 4FOSA 1IVSA 1M2VA 3DZDA 4QPPA 1UPCA 4IIJA 1R0LA 5CCEA 2ZJZA 2XWQA 4QBKA 3STYA 2LCFA 1U0EA 4FDAA 1AC5A 1LQTA 3KJGA 4UBLA 4XVHA 5F4ZA 3RKSA 4EA6A 4N5DA 1Q21A 4N3CA 4Z9FA 4FMBB 4AJNA 5HZGA 1CZLA 5AVYA 1HYEA 1M75A 4LSGA 2QI9F 1RPZA 3NONA 3CKKA 4IKOA 3A70A 4OJMX 2Y8EA 4NMWA 3BVPA 4KLZA 4EQZA 5H8WA 2G17A 2VAWA 2WJVA 1SY7A 2FRDC 2P7IA 4PBTA 4I1PA 1F5NA 2FZWA 4LF7B 1XAIA 3CURA 1H42A 4PCVA 4EG1A 4PXSA 4FCWA 5TGTA 3T52A 3BE6A 4POOA 1T9ZA 4MINA 4V0OA 3G17A 3SZ3A 3ZD9A 1NXPA 5M29A 4ZZIA 3HVHA 4YR7A 1FW8A 3UJAA 2QAGC 3A1UA 3O7MA 1RYFA 1RWBA 3V3KA 1X9GA 1N4DA 1ZCFA 1YJ8A 2ZWIA 3ESQA 4M9UA 3H5WA 3IP8A 4UEWA 5L3ZA 3HJHA 2M2IA 4Z0TA 1HOTA 2V54A 4RVDA 4YCCA 2R7KA 4GF5A 4MUFA 1CUHA 5KYGA 3OCWA 4PYKA 2C8KA 4J76A 1Y1QA 2HRQA 2IBMA 3F7TA 1XRNA 4ZOBA 3ZU2A 3TEJA 3TSCA 3WFJA 3P94A 1NQXA 4BZQA 1X7YB 2HIHA 3TRDA 2GEUA 2W5UA 1DCTA 1LPPA 3R7DA 2JI7A 1YA6A 3EIFA 4B9EA 2V3VA 2G0AA 3NEYA 4NK5A 4OXKA 5BVGB 5I8WA 2FY8A 3C3KA 3WMWA 1T4MA 3T9FA 4CV1A 2X5XA 1WZUA 1P39A 1SUWA 1AH2A 4N5NA 2DQZA 4AIIA 3DTTA 4MVJI 2YZGA 1K8YB 3DZ8A 2Z09A 3EQ6A 3LECA 5G4KB 3T7TA 1XZLA 3WR5A 1WOMA 2H2DA 5KVCA 2FG7C 1VKHA 1WU7A 5DV9A 4QGHA 1E4YA 1UPXA 1QNLA 3LBIA 3PUXA 4HWPA 3STVA 4CKXA 4E0BA 1BRMA 5E4TA 3R3SA 2P8SA 3ZK7A 1AUOA 4UZSA 2XE6A 3N53A 1P1HA 4C06A 3HSYA 3O0TA 3AF0A 2OBNA 2OG2A 4B6JA 1YU9A 3KJFA 4TKZA 1GTVA 1G63A 4TLBA 3L46A 2HQ1A 1SUPA 5TGZA 1FMFA 2HK6A 3TVDA 2A0KA 4P5DA 2H17A 2NW6A 3N6XA 2IYZA 4UAVA 3TG2A 3H3FA 1U6KA 4Y6GB 4G67A 5CIYA 5JJCA 2XE8A 3NHUA 4RANA 1T9GS 5T64A 3RAPR 4D4IA 4E03A 3PQDA 1EWTA 2SKCA 4H59A 3D7LA 2YL2A 4J8PA 3DO8A 3PGKA 4TS1A 3C5CA 3H19A 1UPBA 5FO0A 1RLUA 1BWSA 4ZI7A 5JZBA 1O95D 1OFIA 3I09A 3HI4A 5KHLB 1D4OA 4E09A 2FEMA 4U7FA 5JS1A 4HXYA 4PNZA 4ESVA 4MW7A 2D00A 3K6RA 5HW0A 1SHTX 3HWX1 5BQ5A 2UUCB 3A26A 5AW9A 1R6AA 4TXLA 2OO3A 5THKA 4BMOB 3I0ZA 3HR4A 4YMHA 4MWDA 5KJFA 5HF8A 3T5CA 3V1UA 1QWSA 2VUTA 3DMTA 4Y2UA 2BKUA 4PRZA 1TIPA 1VMDA 5FFFA 1QH9A 2QSZA 3S8YA 1JA1A 1ZCJA 1X7WB 2DETA 4ZO9A 5DVZA 1J0CA 1Z34A 3QYJA 3BDAA 2E9SA 2O59A 2QT9A 3R6TA 1DSSG 4QDZA 3COVA 1JQ5A 4HSEA 3QU5A 4Y2VA 4WOBA 1U9CA 3T9DA 1U2DC 3HDHA 5JHHB 1XMJA 5TB5A 4ZI2A 3BXGA 1NBHA 1YE3A 4V0MA 1XF1A 2Q29A 3GA0A 3GFVA 4R51A 1EDEA 1ZOOA 3OWOA 1G60A 4WOPA 5BUCA 1NN5A 3LHDA 3NHRA 4QFCA 3GLHE 1BXGA 4GOMD 3RC7A 2DFPA 3HXPA 2ZT5A 4FYIA 5ERGB 2VLIA 4UUQA 5L8VA 4RZSA 1J2YA 4U1RA 3U7FB 1MJNA 3LVRE 3C8MA 4C1BA 3L0YA 1UXOA 3W06A 4UULA 1CVRA 3M6MD 4B1FA 2Y2VA 2J1LA 2ZT6A 1V4VA 1AV6A 2FW8A 2YNMA 3EOAI 2MINA 4MB0A 2FSHA 2FDRA 2WTUA 1UWVA 4O33A 5F73A 4O59O 5DN9A 3OD5A 5K05A 1KR2A 3B9QA 3V8BA 2POQX 1VLQA 4O4IB 4ZN6A 4BBPA 4E2FA 3P9ZA 1LB1B 4MARA 3OCJA 2XECA 4LNHA 2FX3A 3ZNOA 4AYWA 5BPHA 2Y67A 2RIRA 1ZD5A 2BFWA 2VZ8A 4HDCA 4CQMB 4YMWA 2FYTA 3EZGA 2E5FA 4FSXA 2JH9A 2H85A 4RAQA 5AVJA 4FKBA 4BO6A 1F9AA 1KMNA 3EYWA 3BYZA 5C80A 4YN3A 1DOHA 1USKA 1KORA 5DI3A 4HDSA 1ESCA 1X7GA 2HFJA 1IHPA 2PEZA 4A3SA 1P5FA 4IDPA 5TJ9A 3OCZA 1FU4A 1EP2B 1ZXXA 3B3GA 4ZAZA 4URFA 1ICEA 4JEMA 4DLNA 4L16A 4FEEA 1BROA 4LE2A 3UJ6A 2FSUA 4F2DA 4FR0A 5IEJA 2YHSA 1ONPA 5I9SA 1N6HA 1E2MA 2D54A 2G9ZA 5IASA 1MZVA 4GX1A 5JAUA 1ZEJA 3PTLA 1B6RA 3PA6A 1KEEB 4MV0A 3NDJA 1JV2B 3DM5A 3U19A 1GZDA 1I5EA 3KJEA 5EJEA 1HRKA 1IHYA 2RC6A 1NVUQ 3T1TA 1H05A 3ZU4A 3THWB 3O0DA 2FPPA 4GD3Q 4EGFA 3A32A 3BIOA 3N86A 2V7EA 1YDFA 2DPGA 2XBLA 3NTUA 4B83A 4Y2RA 5LQAA 4KU4A 3QEBZ 2ZZMA 1ISRA 4I1RA 4EJ0A 4EY6A 1CE8B 3HM9A 2GCGA 4ZQBA 1R12A 3FWYA 3B1FA 4RDXA 2ZP1A 4E46A 1ODTC 4G07A 3BSSA 1LI5A 4WDRA 5G0SA 1ES9A 1GNTA 2AMVA 2DQ4A 5CRIA 3DAFA 2DFVA 2BFCB 1ID8A 3EFBA 4ZOLB 2W71A 4W7SA 3DBRB 2OXIA 3BMXA 2J3KA 4OQDA 4FMPA 4E4RA 5HZKA 3NATA 3GLIE 2FNAA 3BXEA 1YBFA 1GUYA 5EUCA 3W34A 2HQOA 5JQGB 3B6JA 3ITEA 4HH0A 3I6YA 2ZB3A 3CEPB 3B1VA 1HL7A 2RGXA 4JVNA 1K8RA 2AJBA 1MTZA 4UZEA 1UBHS 2CDCA 3LVQE 3EUWA 4ND1A 3V5NA 1QH8B 3TUZC 3BQNB 1KJNA 2YWRA 1QV9A 3AL3A 4FNMA 4LCBA 5EIHA 4N03A 1U1EA 5AJXA 1QTRA 2AHRA 3AFNA 4GNRA 5IULC 5ITVA 1TVEA 1FW6A 2FTKE 3G85A 4RWEA 3KFVA 4B76A 1ESEA 1RWVA 1RWKA 2PMWB 2QRVB 3X1WA 4ZJZA 4XQ9A 1BH6A 2H5EA 5LOVA 2QVXX 4R9NA 5CIWA 5BUQA 4KH0A 5TQ0A 3DV9A 3L77A 3DEIA 4GM4A 1R0RE 4RBNA 3S1AB 4L6CA 2RGUA 4O1IA 4WFKA 3SR3A 4OFZA 3UUWA 5BT9A 4C05A 2V96A 3QHPA 4X54A 4YMUA 4NTZA 5EJ5A 3MRSA 2CNWA 1RWMA 4WBSA 4JI1B 3EA4A 1PR9A 1XUOA 1K3TA 2IUTA 3EQ7A 5M04A 4OBEA 2PIDA 1U7DA 3IT3A 3JV7A 2PA3A 1DFHA 2R1VB 3JQFC 4BFLA 4TZ6A 2KHZA 2Z30A 3N75A 1QIEA 5ITZA 2QQ5A 2RJ3A 2YMMA 3G23A 2FQXA 4B7ZA 1F0KA 1H6AA 2I1LA 2C4UA 3RIGA 1Z5UA 3CPSA 3CSUA 3OU7A 2NP6A 3D7RA 3ORFA 2R7MA 2CXUA 1E5LA 3LUDA 3OQ1A 1UFOA 3QP9A 2DKOA 4L1KA 4F96A 2E1RA 4OFXA 1LLDA 1LNZA 3M5DA 3UKDA 1FSFA 1XZBA 2JBWA 4OQPA 4RH1A 2GF9A 4M0LA 2KX7A 4JP8A 3QFFA 3HVKA 4XSVA 4F5WA 1Y7IA 1X7ZA 4R1TA 1FXWA 4FYHA 4AJIA 1UBUS 1Y48E 3DP9A 3F6YA 2OFWA 4R8MA 1XT6A 2B83A 1J7KA 2QVLA 3BN3A 3RHTA 1MGPA 5A4KA 2HU8A 3PPWA 1SB8A 3W2HA 5EP1A 1FMTA 3V7NA 4H2DA 1VE9A 1UP6A 3OC6A 3VR6H 1JILA 2EKBA 5M5BA 4QFDA 1OPRA 2HMWA 3WADA 2IZ5A 3GBSA 4KACA 3WLKX 2DF8A 5FHQA 3NG1A 2BSAA 2G8LA 3CNBA 3S44A 4BKQA 4YRCA 2ZBPA 5EMMA 3SC2A 4GPZA 4Q3OA 1PFQA 4UM9B 3AR5A 1I30A 1LWNA 2FJPA 2GK4A 3HU5A 4ILEA 1R0YA 4OMDA 4UAGA 2IT1A 3KU4A 3TLKA 3FDFA 4BN4A 3AI7A 4F4CA 3OOSA 5F2KA 1FDIA 1KZ4A 1YS9A 1KAHA 2I4OA 1WQ1R 1QIGA 2CKDA 5EMHA 4XDYA 1ZJZA 3OOWA 3AY6A 2BM8A 2C20A 1FUEA 1LTQA 4J1QA 4KXVA 3TRKA 1XQ6A 4GUDA 4RM3A 1ISIA 2Z3ZA 3P9QA 1Z0KA 4G23A 4I7EA 3L1HA 3DWGA 4UE3S 5DCLA 1DBQA 3CKYA 3HUEA 5FIUA 3IOMA 1U8YA 1J6UA 4KUEA 3HR8A 5DBEX 2O2IA 1V8OA 2P5YA 1NFFA 1WE2A 1XJ5A 3HP4A 1JYFA 3RFVA 2WFMA 3PUIA 3O7WA 5BVHA 5JD5A 3FAKA 3FGNA 4U5QA 5AJWA 1W36D 4OK3A 5B7PA 2J41A 2QZZA 2M6KA 1JDBC 4RSGA 2GUWA 3LUHA 4NOJA 4W5TA 2ECFA 3QPWA 4K6CA 5CM8B 2CMFA 4QNRA 4TKUB 2XYPA 2APJA 1WY7A 3FYCA 4QJIA 2OPHA 1O96B 2IHKA 2HL6A 2JLQA 4OQYA 3AI1A 5ALVA 1K3UB 3JQEA 3SX0A 3HN7A 5DKFA 5HK9A 3HCOA 4IVRA 4V0SA 5L6MB 1ZQ1A 2FKNA 3FN4A 4TWRA 3MG9A 3E9RA 2JAOA 3L1UA 3KOXA 1VL5A 3W2IA 5SZHB 4ALIA 3OFNA 4EYEA 4TTIA 2EJCA 4UQPA 3RIEA 3Q1LA 3NZEA 3WL4A 4GL4A 3KIPA 3MCAA 5CLGA 1OD6A 2BH2A 4EL5A 3LPMA 3SLKA 4BE7B 4HDNA 3X1ZA 2JKYA 3QWHA 1AZLA 4NE2A 1N57A 3HB0A 4OX9B 1MVNA 4EYKA 3IQGX 2LWIA 1DMSA 3ICVA 2HMSA 5K9ZA 2Y1DA 4FR2A 4XDHA 2I3DA 5F7ZA 5AK4A 5B55A 4UTNA 4U39A 2V3CC 4MPDA 2X0FA 3PQCA 1L4MA 4HDMB 3RFFA 1GV0A 4Z4FA 1RCTE 1Z8DA 4WESB 4QBFA 4D8UA 1OTHA 2BFAA 4BNKA 3RQIA 1Q0LA 1Y81A 4FYKA 4PG7A 3B6ZA 3UAOA 3JAWB 3HHEA 2WSLA 3EZLA 2C57A 5FUVA 1DJPA 3HYNA 2PRZA 3ZGVA 1C5KA 3F67A 5IU6A 1QYDA 1U2TA 1Z39A 2ST1A 3AP3A 2LUOA 3KVYA 2JASA 3NYWA 3PE6A 2GLTA 2R8OA 1I13A 4M89A 4G24A 2WWGA 3BFPA 4RMIA 1IQ0A 4NZOA 1U0HC 4C4XA 3K16A 2QN8A 5LB4A 3SIRA 3ZOZA 1M1NB 3ELYA 5C3UA 1JNYA 2X9QA 3IGFA 3JWHA 2JLCA 2ENUA 1A5BB 3DL0A 3VU9A 4AY3A 3VC2A 2ZAMA 4RUKA 421PA 4ALKA 4WBNF 5CIQA 1PLKA 2HUNA 1Z3IX 2VCYA 1V43A 3B2NA 4BQEA 1CU1A 4JR1A 4J6EA 4KVAA 5JH7B 1A8UA 1O6ZA 1VBFA 4NBUA 1N2EA 5K0CA 1M6VB 5CX4A 2HJVA 1GQ2A 1U7ZA 4FQ5A 1FZTA 4N7BA 4CGZA 1L5QA 3QUCA 1QRAA 1OC2A 5IS2A 2FUCA 4J16A 5EWMB 2E4WA 2W2OA 3E8MA 3W79A 4TKMA 3WP1B 1VXOA 2O8NA 1NBME 4NHOA 5ALDA 2WMNB 4AY5A 1R0XA 5IJWA 2W42A 1CRQA 4B7UA 4EVIA 4NYIR 5ALZA 1PTKA 5A0VA 1ZLXA 4ITVA 4ZCPA 2W0MA 2DWOA 1Z25A 2DTDA 4UHCA 3IKMB 1ZU4A 4WH0A 4S1PA 3GJXC 2OB2A 4ZO7A 1NF3A 2I1VB 2O1EA 2Q9UA 2X5OA 4JB2A 5TY0A 3ZCPA 2FK7A 4HYQA 1JE1A 1U3TA 3U2QA 3ND8A 4M0UA 4YC7A 1O58A 3OJWA 1HLGA 1TF2A 4HQFA 3VZBA 5AQEA 2FSGA 4J0IA 4LY3A 3ZE7A 4JGBA 1W30A 3NDRA 1EDZA 4ZAFA 2LNDA 1SHUX 2BGIA 4WMLA 2PKEA 5IMBA 3ZY3A 3CUVA 4HAWA 4WLFA 3VVLA 3PXAA 2XKJE 4M1MA 1QHNA 3PNPA 1U4SA 5JH7F 3AR4A 3FNRA 1I51A 1BTOA 4MYCA 1HNZB 2JCBA 4W5QA 4FFBB 4KQKA 5IDVA 1F51E 2C4MA 2J9FA 3S2IA 1MEJA 5E7JA 3OMWA 4E22A 2C7QA 3P0HA 2BGMA 1X3LA 4LDQA 2FEOA 3ICCA 3F5SA 1PT6A 4XOUA 3GPLA 4MVJF 5JFTA 1GKIA 3L7DA 4UREA 2WTAA 4IIGA 4QT4A 5TVKA 3E18A 2IXBA 2J6CA 4WEQA 5DGCA 2GETA 4CEHB 4ITUA 3IPXA 2Q2QA 2FZ4A 4IQ4A 1SVOA 2CL6X 3KQUA 1CUJA 2C9MA 2IIVA 3B7PA 3NBAA 4II3A 4MLZA 3LDGA 4ZCQA 3L79A 3RH0A 4J1TC 4PG5A 4TS4A 4DHWA 3GWZA 2DSNA 3V8PA 1LJ8A 3NHLA 3RS0A 4KR2A 1E1CA 4N0PA 1HE4A 2A14A 4DNXA 4LS3A 2O52A 5B36A 4QM7A 4IAOA 2EEPA 3GAZA 3LO5A 2GEKA 3M2PA 1EQ2A 4D1YA 1JZSA 3TLBA 3O83A 1QP7A 3PDIB 4K87A 4ZICA 5FEUA 5BNFA 1S2DA 1P1IA 4BFUA 2FZ5A 2JGNA 3U5ZB 5K0EA 4Z3KA 2H2HA 3AERB 1C1YA 1OFUX 2PUHA 2YN2A 3GLFA 3U9LA 3UMFA 1D0IA 1RU3A 4I1OA 1E3JA 1YD7A 2XNHA 3N8DA 3NBYC 4L9WA 3N0WA 2EW8A 3FYUB 3F71A 1QIMA 1KSJA 3G5UA 3Q8XB 2E5WA 3D0RA 4IXTA 4RQTA 2FFHA 3VH4A 4Z6KA 3C6BA 1NU6A 2HZ7A 3ZDXB 1IN7A 4QGFA 3ZNNA 1TMYA 1UCFA 2VAVA 2YJTD 3DLBA 5IT5A 5L6LB 4Q4HB 3IMFA 1T1GA 4X84A 1FX0A 4JI5B 3UOGA 1ZCZA 1Z36A 1NPYA 1Z4KA 3BPSA 3GEDA 4DA0A 2O8DB 4RY0A 1ML3A 1VHQA 2J9YB 1Q1GA 4HY3A 1A9XB 1I4TD 1Y8RB 4J3FA 1EP1B 4PC3A 1P7CA 2VPIA 3WRYA 3ADOA 5IUKC 5M7EA 4JH0A 1AX9A 5I5EA 1WAMA 1LNQA 3IUQA 2AOUB 5TDHA 5FI3A 3TRHA 4DIKA 2F1HA 4PY2A 2YY7A 1IL0A 4UCQA 5EFZA 1YS7A 1K3FA 2DHRA 5K0NA 4KQ9A 3E05A 2NU7B 2NG1A 4RJKA 3VR5A 1HY3A 5JYDA 1Q17A 2FV8A 3G88A 1E60A 3MOIA 3SM9A 2JD2A 2ZXUA 4J90A 2VYCA 2HV9A 4MYUA 1Z16A 4XUGB 5J59A 3ZDQA 4JKYA 4C7XA 5ADVA 1HLPA 3AF2A 2NADA 1ZGBA 2B2XA 2CUNA 3U7IA 3QPBA 3NDBB 2IRWA 3O2NA 2XV1A 2P6RA 1Z0FA 4RV5A 1IUNA 2QZSA 3IAS6 4HUQB 2O5CA 3VR6D 3GFTA 5E6UB 4FOPA 4CLXA 1GA6A 4UBNA 3O3MB 4PC6A 4RCZA 4MQUA 5FKJA 4B8ZA 4C3VA 4NDNE 3O92A 1HF3A 3GUYA 4AS3A 3Q40A 3IOCA 1K4MA 4U5XA 4KV7A 4Y6QA 1H6BA 1JTEA 4Y0AA 4QRHA 3NIBA 2CYCA 3QKRB 1C7JA 3A6ZA 4RGYA 5AOAA 4FCCA 5HQ3B 4XYEA 4IDQA 2GQ0A 5E2AA 2CFCA 3BXXA 4JODA 1QO9A 4Q4AA 5I9BA 4ZK6A 4JLUA 3MWYW 3OO1A 3OWXA 4ZV7A 5HILA 3TXYA 1J0DA 2ZRBA 1FJXA 3DE4X 5ENVA 1MENA 4EGQA 4UBKA 4O4JB 1D9ZA 1UMDB 4FEAA 4EFKA 1BE0A 2PT9A 3VTKA 3F5DA 5FCDA 3W1VA 4C5BA 1AQNA 2A84A 2VJNA 2PYDA 3IBYA 3MBOA 4F9EA 1E4EA 1RJGA 3MRTA 3OE7D 2FSVC 4OU4A 5GADl 1GKLA 2VCHA 4BE9A 2WIJA 1NA5A 3QUAA 3BH7A 1QRDA 5D1HA 2NU9B 1CV2A 4BRWA 4D7AA 1YR7A 4DV2B 1GR1A 4DPLA 1JSXA 1I3LA 1YQWA 4IH1A 1VJ5A 2WA2A 3K0FA 1F0PA 1UANA 2ID9A 1DOAA 3AUXA 4IJKA 5BW8A 2C3UA 4F4HA 2BM1A 3G2HA 4U7GA 4EHKA 2O23A 4MDYA 5F35A 4ARSA 1P31A 1AUPA 1ISSA 4DLPA 4ZI5A 1NNSA 1M74A 4BQFA 5EIWA 5J2TF 4EGAA 1N1GA 1B0ZA 5KAPA 4TT3D 2OO5A 5IAGA 3RUDA 1HT0A 2A57A 3AR9A 4PAOA 2D5CA 3SHQA 1NW9B 2OCAA 3IBTA 1CJBA 4PCLA 4A6DA 4CIWA 3O8OA 3IBFA 2XDWA 4ZAVA 5ES3A 2IE8A 3TFQA 2PGXA 3IOYA 2OVFA 3SSNA 4EKIA 4UM7A 1R0SA 2TYSB 5INTA 1Q7EA 2P1DA 4URUR 2XVYA 4XXHA 1KDZA 2P30A 4RGQA 2ISSD 1OX5A 4OKIA 2PRSA 4A0HA 5EMLA 3JQ8B 1AF4A 2FW0A 2BZ1A 4O4JF 3K70B 3GGCA 5AOCA 4DV6B 3JZIA 1WRBA 2RGNC 4PN3A 3LLMA 3RREA 1ZH0A 1PTJC 3R0JA 3H1EA 4K9LA 4LV6A 3UBMA 2QGZA 4A2CA 3FWKA 3HCWA 1XTBA 3I6QA 5CMLA 4BNZA 1UPTA 1ZKMA 4DV3B 1P45A 5CVDA 1ZD2P 1KH2A 3F9CA 3EFEA 2VYVD 4I6GA 3I5YA 1L2TA 1L7VC 1Y8AA 1YR3A 3L6DA 2OWDA 5BURA 1I3OA 2AI3A 6LDHA 5DCUA 2JGEA 2BZ0A 4AMGA 3OF5A 2DP4E 3PCXA 4N6GA 4EG7A 1ZPDA 1AY0A 1P18A 2A7QA 1NF8A 2HUPA 3FPEA 3A2KA 3DDHA 4ZVMA 1Y6ZA 4XWWA 1RBYA 5H3CA 1XR3A 2AEJA 1QCDA 5ALXA 5KVQA 5J4HA 2ETVA 3ICEA 2AD5A 3SJBA 4F91B 2PMEA 2Q99A 4PZLA 3BFVA 5DIFA 4IV5A 2C5GA 1EG7A 1G8MA 1PR1A 1OZAA 2C83A 2QR3A 3DE7X 4Y18A 1WCV1 5D7BA 4KITB 4MEJA 5GJCA 2PMCA 3N3AC 1H2BA 3L43A 2I3GA 5EOVA 2W22A 1EEHA 1BYIA 1IBRA 1NVAA 1QG0A 1KAOA 2Q5QA 1BWRA 2WYIA 3EWIA 2CXRA 1TCAA 4JKIA 4ZA2A 2EBHX 2X4LA 3D4BA 3ULKA 4EO7A 3H8VA 2Z95A 1AZWA 4R2XA 4R7GA 1RMQA 2DXIA 4LNUB 3ND6A 3C7AA 1EBUA 4MQ6A 1ZVVA 2C03A 1N6IA 1A8IA 3NDIA 3NAMA 1SULA 4FSHA 2D5LA 4ZGBA 1FDOA 2H1CA 2WP8J 3AEYA 4FP9A 4EY4A 5JS7A 1GPBA 5H3LA 4NAHA 2G40A 3GGSA 3PKJA 4DG8A 1JLSA 2H4XA 1MGOA 4PZCA 1P0IA 3OZDA 2YV1A 5HKBA 1F4VA 3NNDA 5EKDA 4ZT4A 2DHQA 5CA0A 5JWOA 3L05A 2FB9A 4PLYA 4D6PA 1LJUA 1M0TA 4BFSA 4MPPA 3PV0A 1ECJA 1C9YA 3LZDA 2XCQA 1D03A 1VIMA 1NN0A 1KYIA 1Y4UA 3CO0S 3L82B 2NO5A 4M54A 4XLZA 3C4QA 4ARIA 2BBOA 2JH8A 2WWIA 3E27A 3PBKA 4Y9TA 1ST2A 3G2OA 5HSGA 2OCLA 3ORSA 3ST7A 4F56A 3DPIA 2V45A 5LZ2A 3P2OA 3HNRA 2FN3A 4XD7A 3QK7A 5JMWA 1J06A 2WB4A 3FNFA 3QA9A 1LPNA 1QS0B 3H5NA 2HREA 3JATA 4UBMA 4UFNA 3B3FA 2HWXA 3M49A 1V95A 4H6VA 5K3BA 4BB9A 1CZHA 4EYOA 5ALJA 1C7EA 1ZUNA 5KWIA 4H7JA 2GJAA 2O4UX 5CUQA 1XZQA 3LOPA 4FUTA 2JANA 2GBCA 4DF3A 1M6WA 1HMYA 4TS3A 4P3KA 1N25A 3RU3A 3E15A 5IANA 3RRZA 2XZTA 2B92A 3WMXA 1YDMA 4KJZA 4LRWA 2BFBA 2X5NA 1K68A 1DEHA 2W6MA 3GIWA 3H1TA 3L4SO 2XB2A 2VXBA 3FXAA 5FI1B 1O6FA 3BMOB 1T9AA 2KE5A 3OI7A 2OXTA 2H4ZA 2ZOSA 4JJ8A 2QLBA 1I80A 3D1LA 2DBRA 3EMDA 3K3PA 3WXBA 2Z6AA 2O2ZA 3KPJA 4H31A 2XGMA 3OJ0A 3WK6A 5F3WB 3AT1A 1AQYA 3QTBA 5CLJA 1U80A 1UPAA 3KQVA 2VH1A 4ZZ3A 5ELXA 3C1UA 4XGRA 2ZUTA 1EM8B 2NPFA 1RXCA 2SICE 3OTWA 4BFCA 2RBGA 2BD0A 2BDEA 3SBXA 5KC9A 2XVMA 2Q0SA 3QNWA 3H5RA 4R05A 4I1VA 3N1UA 1CFJA 1Z6XA 3DD1A 3BSWA 3OZFA 1NLYA 3PC4A 2R8PA 3PJGA 4L8LA 4YT5A 3SKYA 2YHIA 3WYBA 4KQGA 3QX7A 1IMJA 1SBQA 5K0LA 9LDBA 3KE8A 1JJ7A 3HRIA 3MBIA 2H7CA 5D85A 2WQ7A 3K70C 1QXSA 4WKGA 4G4SO 3PICA 4CHTA 3R5HA 5JMTA 2RGCA 2ODEA 4GZ6A 4CMGA 4D0RA 2WD9A 3M5WA 1TVMA 1XN4A 4JUIA 5ED0A 5AVUA 4ZO8A 5F76A 4PQEA 2IEYA 2J30A 4OI0A 3CVYA 5LNK6 1TADA 3AJDA 5F51A 5LNK1 1G0NA 2B61A 1MQ8B 3IAEA 5CJPA 3CLTC 1KRWA 3N3BC 4LPSA 2Q6IA 3KYDB 4A6XA 3TZLA 5TQ2B 2CV2A 2WF8A 1OBOA 5JAPA 1GQFA 4Q4CA 4FZVA 2B37A 3GNLA 1EM6A 3OZAA 4A1OA 1R4MA 1WF3A 3V1TC 2PUCA 1I4DD 5E1BA 2NO4A 3H6KA 1ODFA 3ZWXA 1PZGA 4CKCA 1AJEA 3SEFA 3WB1A 3WNQA 3RIMA 5HOEA 1L6RA 2COKA 1H65A 4HPXB 5IARA 4E1VA 5I9LA 2B1QA 2JBAB 2WUFA 3DKVA 4OYLA 4PYJA 1KO1A 2B94A 3LX8A 4C6RA 3UAVA 1NJ2A 1AS0A 1XEWY 3OLVA 3RYTC 2AXQA 1WY5A 2NOAA 4HYYA 4DCSA 3EMKA 3TTVA 1AURA 1N5KA 2O8CB 4IDDA 2QXUA 4IEEA 4JC4A 1Y9DA 4H15A 4K7JA 5D2CA 4DNFA 1EZZA 1GHTA 4YJ2A 3HTXA 2OBXA 3P4YA 4TYNA 1K2WA 2JNWA 2ZI3A 1ZSVA 1WP9A 3IKJA 5AQ1A 1QDLB 1W36B 4OQZA 5CDFA 1H5UA 1Y9EA 5K3DA 1KEZA 1OXVA 2PRYA 3ZHUA 1EAMA 5SICE 1L4KA 3BZBA 4LXQA 1Z29A 2IXGA 4IJWA 2DLNA 3HE3A 1SHJA 3ENWA 1PDVA 5AVSA 1ZI8A 2WSBA 4DY4A 4AKEA 3AU8A 1A9PA 2B8TA 2OD2A 4N8SA 5C18A 4BXOA 5JJBA 1G3RA 1KETA 2REQB 5K2OA 4WZAB 3V48A 3ZHXA 4KO4S 2ZIFA 2JW5A 1EP9A 1ZUHA 3BTSA 2J5BA 3WK8A 5AUNB 5K8LA 5DBIA 5JSKA 4JSRA 4PQFA 5CG1A 1NE7A 2WJHA 1SBHA 3LFTA 4HI0E 3DNFA 1GL9B 4LMPA 1ACLA 1FYEA 3N2KA 4IKPA 1Z8NA 5EHGA 4YLYA 3C3BA 4G8BA 4JZKA 1I6MA 2Z4RA 4X62B 2WPDD 4DRZA 2IYWA 3T12A 2RAUA 3DZCA 2CGEA 2PM8A 2ZFUA 3PDHA 4JI7B 4J91A 5A62A 1UAGA 2GPAA 1YQEA 3ODPA 3KOYA 1OI7A 1U2GC 4NZ9A 4LHSA 3DLCA 2PG3A 5HJEA 3QG5A 4XASA 1RKBA 3TINA 1S3IA 4ZHSA 5C37A 1TQ8A 3AJ8A 5IBCA 4UARA 1X70A 4YVFA 3PQ2A 1FVHA 2HCTA 2P65A 4PVCA 1F2TB 1IULA 3G02A 2OMEA 4R83A 2DUWA 4Q4DA 3UK6A 4NCIA 3DEKA 2AS0A 4CCYA 1IOZA 4Q1AA 3VU3A 2QT1A 4NENB 1I2BA 4PTYA 1LDNA 1VJRA 1ZNQO 2FMHA 2ODBA 2P2GA 1RKVA 4I5IA 1KJWA 4QHTA 3VZDA 3G3EA 3LPNA 2QROA 3WE7A 4CR8A 1PLLA 4AJHA 4LF5B 1K4YA 4BRUA 4QEDA 5K6AC 1XMOB 3H8JA 5BNWA 4Z4QA 1LBTA 3FLAA 4UEKA 4DCVA 3AKEA 3TYXA 1B7GO 1T24A