1T2FA

Human b lactate dehydrogenase complexed with nad+ and 4-hydroxy-1,2,5-oxadiazole-3-carboxylic acid
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
332
structure length
332
Chain Sequence
ATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and Activity of a Series of Azole-based Compounds with Lactate Dehydrogenase-directed Anti-malarial Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase B chain
total genus 94
structure length 332
sequence length 332
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1t2fA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1t2fA02
4R1TA 3PLNA 4B79A 5COBA 3K73O 4IQGA 2OORA 3ZWOA 4J0FA 4GGPA 4RF2A 4Q3AA 5F3RA 4YYZA 3GGGA 3V2GA 3KYDA 4FQ8A 7ADHA 2Z1NA 3GGOA 1OBFO 4EI2A 3U5TA 1CETA 3S55A 3A9WA 2UDPA 1MUUA 1YQDA 4IDAA 1U9JA 3B1FA 3JD2A 1TT5B 4YJGA 4I08A 3D4PA 3GHYA 4BKPA 2Y1EA 3NAQA 3CIFA 1OMOA 3NJ4A 5JAMA 1EEHA 4MIEA 1Q7GA 3PWSA 4AJ1A 3MJEA 1JVBA 2P9GA 3E6AA 2I99A 5IJZA 2VQ3A 1E5QA 2WTBA 3H5NA 4L0QA 1Z75A 4NQZA 3WGOA 3MTGA 4D43A 3JD1A 4CLDA 2D8AA 4DL9A 1JQBA 2Q2WA 1YO6A 3H8VA 3ITKA 4IPTA 4X54A 5JLAA 3NT4A 1JA9A 1ADFA 1ZMOA 4XCVA 3NDJA 1UXGA 3PIDA 4DQUA 2D59A 3WS7A 1E7QA 2IZ1A 2VT2A 1JLLA 3ITDA 4PLYA 4RCVA 4Q9NA 5I9LA 1Q1NA 2DBRA 3I1JA 2GZ3A 3AU8A 3OM9A 4W4TA 4DGSA 2ZYAA 1IOLA 4WCFB 3E9MA 2Y0CA 4FR5A 1NPDA 1LLDA 3RUHA 4MIOA 4ROSA 3RUEA 3V5NA 4MO2A 5G0SA 4QX6A 3H6KA 4BO7A 1CERA 3QW2A 3SVTA 1KEWA 2EHDA 2EF1A 2QRKA 5L40A 1C1XB 1XQ6A 4IIVA 4MVJP 3CKYA 1LDBA 5JAZA 1LX6A 1ZK3A 3TPCA 3VC7A 4R9SA 3TL2A 3K9QO 4CR7A 4CM4B 3F9IA 1W6UA 1M6WA 3CTMA 4WLUA 3FR7A 4BO6A 5DNAA 1DAPA 4XDYA 3CZMA 3DHYA 1DFHA 5LDGA 1NBOA 1QXSA 1P44A 2ZTUA 3HZZA 2Q49A 1F14A 3H2SA 3HDYA 3VKVA 1L7EA 4UULA 1PJCA 3I9NA 3DBVO 4J49A 3ASVA 2NUAA 3CPSA 4L73A 3VPSA 1N92A 4YT4A 2CZCA 1BXGB 1XLTA 3CE6A 2HSDA 1JN0A 1F12A 2NNLD 4RDIA 4RVGA 3IKTA 1WVGA 1YL6A 2AA3A 3LDHA 3R6DA 4Y6PA 3AFMA 3UF0A 1AN9A 1UXIA 2VYVA 1H93A 1GUFA 1YDWA 2EWMA 3OQ1A 2WM3A 3CMMA 5BT9A 3QVSA 3GC6A 2W2LA 2FN7A 1BSVA 1HDOA 1QLHA 1ZK0A 4WK6A 4XD2A 3ZV5A 5GZ3A 1HE4A 2Y1CA 3RC9A 4ZHSA 3UHAA 4HFNA 3NUGA 2C0CA 2FPGA 3PHLA 2WYWA 2CY0A 4YPOA 5T5QA 3HQ4O 4G81A 1XU7A 5TF4A 1I01A 2PGLA 2P91A 2EJWA 4BO0A 4JBIA 3EYWA 2YY7A 4Y9DA 4R54A 1Q2XA 1U7TA 3DXFA 2PY6A 4CMIB 2VRCD 2VNSA 4LRTB 1N5DA 2Q1TA 2X58A 2DFDA 2E49A 3GVPA 9LDTA 4UVDA 1E5LA 2V6BA 1IZ0A 1MB4A 2IYOA 2FZEA 3INGA 1YQGA 1DB3A 5T57A 3P19A 2HCTA 3WTBA 3W1VA 1FK8A 1E6EA 3TF5A 2NM0A 3EDMA 3DDNA 1S6YA 4AJJA 1HE5A 1WMAA 1N1GA 4CR8A 1B0AA 3W8FA 5A02A 2C5AA 2DLDA 4II2A 1T4DA 3GDFA 4II3A 1IE3A 4RPKA 3P7MA 3JTMA 2PKQO 2X5OA 5CAEA 2G0TA 4BMVA 1VKNA 3PLRA 1ISHA 2Y05A 4PG5A 3X2EA 3ZWWA 3JQGA 5C7OO 4FPXA 3W8EA 5C7IO 4MPDA 2BFMA 1ULSA 5K0ZA 1YS4A 1PGOA 4NJMA 3AUSA 4FBGA 1GFSA 1EQ2A 1K5HA 2XOXA 3DZGA 2J5QA 4I9HA 3GRKA 4IJKA 1NQOA 4XB2A 3FTPA 5DP1A 1NFRA 3V8BA 2X7HA 3ZWXA 1ONOA 3EVNA 1QYWA 3CSDA 4IS2A 4GWKA 4LVCA 5AXDA 3RC7A 3WTCA 4TVOA 5JC1A 4YBZA 4J7UA 4KWHA 3GT0A 4MVJI 1GTMA 1HL3A 2WJPA 3H5AA 4HNGA 4M87A 3SLGA 4EITA 5TIIA 4DLLA 1NASA 4MKRA 3S2FA 2NU7A 1PR3A 1UXHA 3ON5A 1Y81A 4XQGA 1R0LA 1XYGA 2B83A 4CM5A 3OIFA 1AE1A 4ID9A 2ZTMA 5EESA 1ZIDA 5T67A 2AMFA 5HTOA 5TT0A 4LSMA 1CEQA 3H9EO 4GH5A 1E1NA 2POQX 4C4OA 4CMKA 4N7RA 3Q9UA 1DAOA 4FJ1A 3LZ6A 3NDIA 4R1SA 4WCFA 3ZWPA 3K2EA 4ALMA 4W7IA 1E6WA 2JAPA 3R1IA 3ZHBA 4IBOA 5ER6A 2C59A 2G17A 1T1SA 1GY8A 1GEGA 3KTDA 4EZBA 1GCOA 1C1DA 4G2NA 4OM8A 3BMOA 5HA5A 1H5QA 5ILGA 1I36A 2Z5LA 1RM4A 2QRJA 1D8AA 4LMRA 2HJSA 3D0OA 2V6FA 4GX5A 4B4OA 1E3LA 4M8SA 1MFZA 1VKOA 1CF2O 4BKUA 3PGXA 4MVJG 4BNYA 3KHUA 4YAJA 4AL4A 4J1SA 2B5VA 4K9DA 1O6ZA 3D5TA 3AUUA 2BHLA 5U1PA 3SC6A 4YXFA 5I8WA 4YJFB 3H3JA 3PRJA 5FEUA 3TZKA 2PFGA 5G0UA 2ZTLA 1XG5A 3H9QA 3JQ7B 3UGKA 3E48A 1P0CA 2FY8A 3TFQA 5C7LO 5DN9A 4RZHA 4UUNA 4IDBA 1Q0LA 3G79A 1YXMA 2VWHA 4PG6A 4LMPA 3TQHA 1GUYA 2EKQA 3CUKA 3ZI0A 2WEKA 1QP8A 4ZQGA 2P5UA 2YQ4A 1NR7A 4D3SA 5B4VA 3PJEA 2BGMA 1X7GA 4NBWA 1VL0A 4YQZA 4FB5A 3KYCB 1GD1O 1JVSA 2D4AA 3TWOA 2DKNA 2NTJA 2Z95A 2FR8A 1TXGA 1LC3A 3DZIA 3VZSA 3IDSA 1AHHA 3B1JA 5EINA 3NRCA 4LK3A 3COSA 2EGGA 5KCZA 4Y6RA 1BXKA 1FXSA 1ONPA 4IXTA 3OECA 1E7MA 3PFWO 4MP6A 3L4BC 3FF4A 1R0KA 3OEWA 4Y67A 3U62A 1IPEA 4BNFA 1NNUA 2OFPA 2G82A 3ZWVA 1QSGA 4CQMD 1CQIA 2Q1SA 2VHXA 4HX5A 2BH9A 4BNKA 2DU8A 1LDNA 4RF5A 1BTOA 1LQTA 2AQHA 1JWAB 4UVEA 3ANLA 3DZJA 2Q45A 1HEUA 3EW7A 1DSSG 3PPIA 3AOGA 4H15A 1HKUA 3WGGA 3BMNA 2NVUA 1NFQA 4TRNA 2JFHA 3K92A 4Z0TA 1QYVA 4FFOA 5CG1A 4Z0HO 1R6DA 1MG5A 3KV3O 4WGGA 3UH1A 2CF5A 4BO2A 4I9NA 1N9GB 4ND2A 3N7UA 2VWPA 1DC5A 4TRMA 2V65A 3VDRA 3JCZA 4ND5A 4CV3A 4DYDA 5L7WA 1GYQA 3JQ8A 2QW8A 1AGNA 2OXIA 4LW8A 3CZRA 2GPTA 4EEZA 4B7CA 5I7SA 5IDXA 2C82A 2WYUA 1U7HA 4KMSA 3KB6A 4YEDA 1PJTA 4FDAA 1P9LA 1YB4A 1VLLA 2BF7A 1HTBA 2NQTA 4PG8A 3MJVA 4PZDA 3Q6IA 4PFJA 5EIOA 5CFZA 4HP8A 1E0DA 1CWUA 2EJVA 3IKVA 3PTZA 3RVDA 1U3TA 3BA1A 1CRWG 5EQFA 3NTRA 3ZNPA 5BNIA 3HE3A 4HBGA 1N7GA 4CMBA 1AXGA 1WZEA 2PNFA 3DHNA 3JQ6A 4ZN6A 1A4UA 4I5DA 1EE9A 3H65A 2ZB4A 2ZQYA 5JC8A 1WPQA 2NACA 3Q0EA 4AJPA 1VPDA 5HRUA 3FNEA 2O3SA 4TRJA 1ZK2A 4KZPA 2WSBA 5JY1A 1NQAO 3C8MA 5JXWA 5DCYA 1HYEA 1GYRA 4BGEA 3ETGA 3TOZA 2EGHA 1H94A 4TROA 4BO1A 1NHGA 5KJFA 3JYPA 3JQ9A 3RU9A 4Q39A 2E82A 1RYEA 1R4NA 1SNYA 4K26A 3PQFA 3UCFA 2GF2A 4UEKA 3BXXA 1I10A 2AHRA 4CM4A 4MP8A 2Y99A 3VAZA 5L4LA 4FFPA 1HDRA 3ZGYA 3GOHA 1E3EA 2Q3EA 3HB4X 3D7LA 4BB5A 5I7FA 2BMAA 2AG5A 2FHSA 2PH3A 3LT1A 3QWAA 4AICA 4KWIA 3F46A 1ENZA 2PZMA 3HFSA 4YTEA 5JMPA 2RH8A 1GCUA 3C3XA 2Y0EA 2EG9A 2JD2A 2HMTA 3GPDG 4YJDA 4NI5A 5F21A 3ADPA 3FWZA 3JQFC 2V6MA 4PLVA 3KEQA 1MC4A 2PR2A 2ZTVA 5ILOA 3LLSA 3U4DA 4TSKA 1GYPA 1U4OA 2O3TA 2B35A 3HUDA 1BRMA 3VHRA 3K30A 1EVZA 4PG7A 5CPBA 1KC3A 1ZFNA 3SBOA 2CDBA 3RBXA 2A35A 4BHTA 3W6ZA 2W2KB 4AJHA 1PL7A 2GRAA 5JCJA 1G0NA 4D41A 1YDEA 2WYVA 2J5KA 3F4BA 3M2PA 5AXBA 3DZHA 2NSDA 2EXXA 3BTSA 5A9SA 2QX7A 4XR4A 2CSUA 5G0WA 1SB9A 3WIEA 3DFUA 4E2XA 3ONDA 1L1FA 1ZO8A 1QV7A 1T24A 1O89A 2Y1GA 4ZQBA 3WOHA 5TNXA 1P0FA 1WZIA 4H7PA 4HUJA 1I33A 1TT5A 4O5OA 3DO5A 5EL0A 1UDCA 1Y9EA 1UAYA 1EE2A 3U4HA 1WDLA 3H3FA 3WGYA 2OMEA 3I6IA 1RYDA 4ZQHA 4RVDA 4YCAA 3VOSA 4AG3A 5IZ4A 4GLOA 4E5PA 1ORRA 3E82A 1XDWA 2VUSA 2ZB3A 3UFXA 5CDGA 1SMKA 1NHWA 3RAJA 2PKQP 4DYVA 1PWZA 4M1QA 1EVYA 1Y8RB 3PDUA 3H7AA 4AJNA 4Q3EA 3MOGA 3QVOA 3VVCA 3WBFA 1PSDA 3FTNA 3GUCA 2OHXA 4CMEA 2NU9A 2YV3A 3DBRB 3FWNA 4I1IA 2YW9A 1F06A 3G17A 2HMUA 2GR9A 2EKLA 3ABIA 4RVHA 3G1TA 4GGOA 1RWBA 4LCEA 4PLTA 4LGVA 1QR6A 3GRPA 3D5QA 3LYLA 4M49A 1J6UA 2I65A 3C1OA 4GMFA 3SEFA 4CUJA 4OH1A 4Z9YA 1ENYA 4ALIA 1I3KA 2P9CA 3BMNB 2G1UA 2X9VA 4WLEA 1YQXA 3R3SA 1DRVA 5ADHA 4CQMA 4DREA 4D3DA 1OOEA 1GZ4A 3V2HA 1TA4A 5B4TA 1VM6A 4J4TA 3WGTA 3AJRA 1B2LA 3P2YA 4PLWA 3VDQA 4URFA 1T1RA 1H6DA 4QXMA 1W73A 2Y1OA 2RHRA 4D0RA 3S2GA 1UP7A 4QUKA 2DC1A 1BVUA 4NHEA 3DZKA 2O2YA 3JQ8B 1F8GA 2X5JO 4XKJA 1O94A 3IMFA 2GYYA 3WMWA 4LVUA 4DTIA 2R00A 1M67A 1VRWA 2NU6A 3I6QA 3K2BA 3IJRA 3AOEC 3RWBA 3SC4A 4B3IA 2Z1MA 3L4BA 3GVXA 4ND1A 1OC4A 4B4UA 3F1LA 1DDOA 1ADBA 1OI7A 1EDOA 1SEPA 3O26A 4XQCA 4CM3A 3HB5X 3WLEA 3V2UA 2WE8A 1PGJA 2GLXA 3WWYA 3EHEA 4BNGA 4XGIA 1JAYA 5FI5A 3KZVA 4IINA 1HRDA 1V9LA 3JD4A 3BTVA 3ZV3A 1C0IA 1KVTA 1O0SA 2FOIA 3H5RA 3I4FA 5DP2A 5C37A 1U8FO 2HK8A 2HO5A 4PG4A 5DBFA 2IRWA 1JKIA 1Z7BA 1UP6A 4MINA 4OSOA 3NYWA 4U6QA 3AK4A 3BHMA 3I23A 2ZQZA 4CMCA 2OBYA 4FJ0A 1D1SA 4YAGA 4JBGA 4AVYA 3TL3A 1K6JA 2JHFA 1SB8A 3JD3A 2PD6A 4IY1A 4C7JA 3QA9A 3OHSX 4WPGA 5JSFA 3GPIA 3OSUA 3RJ5A 4YJFA 4D45A 1M2WA 4ALJA 4BV8A 2BGLA 1P74A 5L4SA 3GZNB 2ZATA 3INTA 3NTOA 4EYEA 2H63A 4DBVO 5KWEA 2O2SA 3DMTA 3OJ0A 2W2KA 2NTVA 3GY0A 1K2WA 4QECA 1YKFA 4RVFA 3KYBA 5B37A 2NVWA 4U5QA 1TT7A 2QZ9A 4PZEA 1K3TA 4DIOA 4QQRA 3UXYA 2VTEA 3UOGA 5A05A 1A7KA 1M75A 3WYCA 4YAIA 1DLIA 1MLDA 3RUFA 3RSHA 4ZICA 3GUYA 1GQYA 1BHSA 4O1MA 2CFCA 1AHIA 4YT2A 1LNQA 2ET6A 4TMFA 4Z0PA 1DHRA 1EQUA 5HBRA 2YV2A 1H9AA 3R0IA 2HU2A 4L8VA 5L51A 3RUIA 3HSKA 4BO8A 3WQRA 3JQDA 4NFSA 5JE8A 4CPDA 4UVGA 2XPCA 1R37A 3E5RA 3D3EA 3WMXA 3LF2A 5H83A 3T4EA 3ZWAA 2B69A 3P2OA 1IPFA 1GEEA 3BMQB 4L9RA 1KS9A 5ITVA 4XRRA 3VKUA 2OGUA 4CLXA 2AE1A 2QIOA 1C1XA 3O8QA 5JCJD 5IFLA 1A72A 2QZZA 5CDYA 1LI4A 2B4TO 5T64A 3D4NA 3WBBA 4GQAA 1HWYA 1E7WA 3KBOA 3KEOA 3VVBA 2R2GA 1G6KA 2HJRA 5CEEA 5JBIA 1E77A 2O7QA 2NWQA 4GI2A 1RM3A 1E3WB 1SC6A 4CM9A 3EAGA 5IG2A 4AJ2A 3G3EA 3KLMX 1XCBA 4FOSA 3WGQA 4JP2A 3BYZA 4P8RA 1KYQA 1NYTA 1YGYA 1U3VA 1P1RA 4CUKA 4EJMA 4QSMA 4CODB 4NK4A 4J3FA 2ZYGA 4MVJA 3K5PA 4OXKA 5EN4A 2GASA 4I5EA 5KJCA 3FD8A 4N5MA 4CMGA 1QMGA 3JQEA 3BAZA 1DEHA 1MXFA 3F5QA 3KSDO 2YHUA 2B36A 4OOFA 4Y98A 1NFFA 2VUUA 2P5YA 5HM8A 5IDQA 4K1LA 3AI2A 2ZCUA 1KVQA 8ADHA 3JYOA 4HY3A 1LDGA 3LK7A 5TJ9A 3WR5A 1PWXA 1HZJA 1NP3A 4CM9D 2VZ8A 2E37A 3MCVA 4DMMA 3SJUA 4I5FA 5JNLA 4ALLA 3UVEA 2O4UX 3IJPA 2ZB8A 2OOSA 1BW9B 4HWKA 4YJGB 1TEHA 2R6JA 1OZAA 3K6JA 3RKUA 2IXAA 1V35A 4RL6A 3GLQA 3C24A 3W4JA 1XKQA 3DBLB 3UUWA 2VRCA 2UUOA 5DULA 4RLHA 4RVSA 1KY5A 2J3IA 4NBUA 4L4RA 1WW8A 3RFXA 1GUZA 4FFNA 5JDCA 5TRTA 1C0LA 3JYLA 1C0KA 3OIGA 1KVRA 4YJHA 4ESOA 3DMTC 3LT0A 1K6IA 2BFOA 3AY3A 5FWNA 2DM6A 3H2ZA 2RIRA 1U28A 3U4IA 3C1AA 2XAAA 3FBGA 3GG2A 4E6PA 2JCXA 3GGPA 4FN4A 5DDIP 4EJ6A 5J23A 3K96A 1SAYA 4P22A 2YUTA 1K89A 4NG5A 3GVIA 2H5LA 3O38A 4FD3A 4TKMA 1LA2A 5I8ZA 1BDMA 3HADA 3ZHZA 1BDBA 1ZSNA 2JJYA 4XYBA 2NVUB 4A26A 1Y8RA 3OJLA 3DOCA 1MV8A 3WYBA 3QY9A 2UAGA 3M1AA 1NVTA 1U5AA 3RCBA 2FSSA 1YBVA 1YVEI 1X0VA 1DRWA 1PGNA 3WG9A 1X13A 5IAAA 1LDEA 1X1TA 4IGFA 4Y6SA 4YDRA 2PLAA 2D5CA 4BVAA 5IZCA 3BTUA 3RFVA 1DOHA 4BQPA 4OOEA 3ZWBA 3W6UA 4CLEA 2X0IA 3NKLA 1UZMA 3ZZNA 4IJVA 1B15A 2X22A 4NJOA 4QFCA 3E9NA 2EEZA 1DRUA 3MTJA 1UP4A 2OBNA 2OO5A 2FPIA 4JJFA 4WCFC 3FN4A 4INAA 2AEMA 3PJDA 1NAIA 3DBHA 5JO0A 3V1YA 4J2HA 2BFAA 1GADO 4DPMA 1VSUA 1WNTA 3DTYA 3EK2A 1EZ4A 1RM0A 2NU8A 5JY6A 4OQZA 4R01A 4EDFA 1V3VA 1ZZEA 5DCWA 1VL8A 4GAEA 3U3XA 4CL3A 3L6OO 5L45A 3JQFA 1G1AA 3QQPA 4ZRNA 3SXPA 4FGSA 3STHA 3D1LA 4GLLA 1DFGA 1MC5A 3HNPA 4E21A 4O0LA 3BMCB 3OH8A 4NFYA 4YRBA 5IZCC 3IOYA 3JV7A 2ZB7A 4J6FA 4NH4A 3AM3A 4I5GA 1PR9A 3ETDA 4YRAA 3E18A 4DXHA 4GPD1 2Y68A 1EK6A 4L4SA 1YL7A 1ISGA 2VN8A 4BO3A 3C85A 2ZIZA 3KOUA 1J4AA 4GVLA 1DFIA 5IF3A 1BXZA 3TRIA 3FNFA 1QG6A 3AI1A 3WB9A 5IXSA 2AQIA 2C29D 1NWCA 2AXQA 2FZWA 2IZZA 1PTJA 1O8CA 3DZBA 4JJGA 2AE2A 1V6AA 1DIBA 4XIJA 5AXCA 4YR9A 4E0BA 1P3DA 2YDYA 4NBVA 3PHIA 4FIZA 1EK5A 1W4ZA 1NWHA 2EP5A 5DF1A 4CLRA 1N8KA 1NR1A 4OSPA 4EGFA 5IXYA 1C14A 5H81A 4KP7A 3E5MA 4DQXA 2VT3A 4OL9A 4R68A 2CDCA 1R4NB 4XX0A 5L7TA 1HE3A 2P2SA 1JDJA 5K6AC 2Q46A 5C3MA 3PWZA 1H6CA 3BTOA 3WNQA 3PEFA 1Y8QB 4U0JA 1JW9B 4ALNA 2IZ0A 2DQ4A 1Q0HA 4YQYA 3ICPA 4XIYA 4H16A 3PZBA 5BSEA 5CHEA 4GMGA 3HDQA 1LLUA 4MVJF 2DBZA 5GZ6A 4J90A 4CQLA 4KDEA 1U3WA 1K6XA 1ZVMA 4UEJA 3JQ7A 2DPGA 3KVOA 4UUOA 4WLFA 4LISA 2O3JA 5JO9A 2BD0A 2C54A 3GNTA 4I8XA 3GFGA 2Q99A 3NV9A 1PJ4A 4NU5A 4F6CA 1DIHA 1C0PA 1E3WA 3LT2A 2YYYA 1ZJZA 5EJ2A 5FFFA 3ZWYA 2GN6A 2FMUA 5A5EA 4UREA 5T8KC 4R1NA 1NQ5A 4M89A 4JN6B 3FPCA 2VWQA 5GZ1A 3EVTA 4PRKA 2HRZA 1LDMA 3AUAA 1Y5MA 3VH3A 1DHTA 3OETA 2C7VA 3DC2A 3QVWA 1ZH8A 4Q3CA 3LU1A 3WJAA 2FRDA 3FNHA 3WQSB 5JS6A 5BNFA 2P9EA 3Q11A 5U9CA 1M6HA 4GX0A 3JQAB 4BOYA 3DB2A 2X9GA 4A5OA 2O48X 1UXKA 1VI2A 1HSOA 1YJQA 3ENKA 1NXQA 3KYDB 1U1IA 5JDCC 1IZ9A 1PX0A 4CUZA 4J1NA 1Z6ZA 2W4QA 3MJCA 1CQJA 2UYYA 4FCCA 4BO9A 3L6DA 4KUEA 2P68A 1E3IA 3PHHA 3UN1A 3QIVA 4XB1A 5LCXA 3TFOA 1B8UA 1H0KA 3I3OA 4Z3KA 7MDHA 4MVJE 2HUNA 1PIWA 4MP3A 4IZHA 4J9UE 1H2BA 3GZNA 1EMDA 1YONA 2V6GA 4OKNA 5G0TA 5T8KA 1PZGA 3W4KA 5TT1A 1V8BA 1CJCA 4DLAA 1I2CA 4XYLA 1V0JA 4NZ9A 1S7CA 3VH4A 2H6EA 2C2YA 5ICSA 1PQPA 3EZLA 2A9FA 3ST7A 3RI3A 1XSEA 1YBMA 3O03A 4R9RA 2VZ9A 4UUMA 4A2CA 2EV9A 3MWEB 4WOKA 4UEOA 5AOVA 1DIGA 1Y9AA 5B1YA 1FMCA 2W90A 3WJ7A 3ZWMA 1DC6A 2PWZA 1LEHA 3A06A 5CEJA 4J43A 2ILTA 4PLZA 1N2SA 5JPIA 3D3WA 1V3TA 1E1KA 4IDCA 5F1OA 1WLYA 2CUKA 1ZEMA 3DTTA 3KRTA 4ONEA 4ITUA 3U0BA 1EFLA 1HXHA 3OJEA 4XQEA 3RQSA 1B7GO 4YACA 4XJTA 5BSHA 1LQUA 2G76A 2B4QA 4M55A 4AJOA 2O50A 2WD7A 2B4RO 4BGVA 1LRKA 5DOVA 4BMSA 4JGBA 1M76A 3DHEA 1P1JA 1KETA 1FJHA 2NV6A 4FJ2A 2A94A 4F3YA 4GVXA 2FP4A 2CVQA 1RKXA 1ZNQO 5DBIA 3H4VA 3Q2IA 4XYGA 2QQ5A 2YQ5A 1UJMA 4D46A 1PGQA 3C7AA 3ETEA 1MA0A 4IDGA 4OXYA 1R4MA 4CMJA 4CMIA 2UVDA 1LLQA 4U6SA 1OC2A 4BS9A 2E48A 3ZU4A 2GCGA 4RPJA 4KUGA 3T7CA 1KOLA 3VPHA 4ZVVA 4ILKA 3DAGA 2BGKA 4HXYA 4XQ9A 2EW8A 1GAEO 1ZW1A 2LDXA 2YV1A 1ZUD1 3ZWNA 4S1VA 1U2DA 1XHLA 2Y93A 4R1UA 5DOZA 1I0ZA 4PRLA 3PYLA 4DWVA 1FDTA 2Q50A 3F6YA 1GU7A 4P38A 4RZIA 5KJEA 1EBFA 4CM1A 1P77A 2Y1DA 2QHXA 2E6UX 4P4GA 1MXHA 4AFNA 3V1TC 1SO8A 2DVMA 3FNGA 1MFPA 4CLHA 3C1TA 1ENPA 1A27A 3B70A 4ZA2A 4JNKA 4C7KA 3ENNA 5IN4A 3DWFA 4I9UA 4A0SA 5G4LA 4F45A 2PTGA 1I8TA 3FCOA 4NJMB 4NU6A 1J0XO 1HDYA 4DIBA 4WEQA 3HFGA 3I9LA 4NDNE 1A9ZA 3MJTA 2EW2A 4BGUA 4CR6A 4BNLA 2VYND 5TX7A 4BNNA 1DLJA 1ZCJA 3SJ7A 3FPLA 3GDOA 3ZN2A 2B5WA 4E12A 3M2TA 3JQAD 3NT5A 1P1FA 3WNVA 1GZ3A 1WP4A 5TJHA 2O3UA 4WOJA 4B4VA 1I2BA 2CVOA 2JAHA 4OQYA 5A5FA 5CEFA 1T25A 2I76A 1ZJYA 3JYNA 2DT5A 2HMWA 3QWFA 4O63O 4IGEA 5KVQA 1PJQA 4NPCA 5COAA 2QYSA 4YAKA 1YWGO 4W9NA 4ZQEA 3S2IA 4D42A 1AXEA 1X1EA 1H6BA 1TLTA 3I9OA 5DT9A 3UCXA 1BGVA 3MOIA 1VL6A 3OA2A 4OHUA 5THKA 4K28A 3HN2A 4BKOA 2RHCA 1UXJA 4E5MA 4RPHA 5BNTA 1E7YA 3FRJA 2Y0DA 1K0UA 1HT0A 1U3UA 4E5KA 3N74A 4JCOA 4AJKA 2PZJA 2JCYA 4DVJA 5L3ZA 2J6IA 3FI9A 1GV1A 3S8MA 1B8PA 3A28A 5LDHA 4D0SA 4TRRA 1XR3A 1HDXA 3ROKA 1B8VA 2I66A 2NQ8A 1HYGA 1XIVA 4R69A 2VOEA 4ZGWA 3IUSA 1YL5A 1HDGO 1DC3A 1GDHA 1TI7A 1BXGA 1LJ8A 4IIUA 3TZ6A 1ZBQA 3ZW9A 2YFQA 2G5CA 4R3NA 4E13A 5BR7A 4OGWA 2D2IA 3DBLA 4XDZA 4J4HA 1I5RA 1A5ZA 2PGJA 4MKXA 4W9NC 4TQGA 3ICCA 3I9MA 4PN3A 4NBRA 4WKGA 1LDYA 1YB1A 2A92A 5F1KA 2RAFA 4CMAA 2GN9A 1ZSYA 3WQQA 2X6TA 5B4UA 4BNVA 1QV6A 1PEDA 4PCVA 4GBJA 5HWSA 3KUXA 5BSFA 3RC2A 4BB6A 1HYHA 4R41A 4EEXA 3OFSA 1ISFA 5L7YA 3TJRA 2DBVO 2FR0A 2HMVA 3E03A 3RROA 4BNZA 1E7RA 3GDGA 4EW6A 5ICMA 4E5YA 2J3HA 1ZKMA 1T2AA 4RORA 4K6FA 2IYPA 3SX2A 4DLBA 3IC5A 5G0VA 3PWKA 4RF3A 1GL3A 3WXBA 3WSVA 4AJLA 1W8DA 2IODA 3A1NA 2BI8A 4GWGA 4OKIA 3A14A 2GZ2A 4FW8A 1ZEJA 3EUWA 3NT2A 3ASUA 5EMHA 3HDHA 2JL1A 3OJFA 4CL8A 1ZXBA 1QYXA 4QO8A 4D79A 5KTKA 1OAAA 2I3GA 3IS3A 1EDZA 5JFOA 3DEYX 1HF3A 4J7XA 1ULUA 1PQWA 1FDSA 1A4IA 2J3JA 2W2LD 4MDHA 4Z9XA 5A1TA 2D3TA 5KNLA 2QRLA 3LC7O 1UH5A 5KOIA 5I7VA 3T4XA 4MJLA 4O59O 1PU2A 4B8ZA 1NVGA 3UCEA 1JTVA 4MIYA 1XQ1A 2I5PO 2EIHA 3E9QA 1Q7BA 1C1DB 4QT0A 5F1PA 5A04A 2VHVA 3ZU2A 1ENOA 1PS9A 2AQKA 3KSZO 4Z9FA 3HJAA 2BKAA 4WLOA 2LDBA 1UR5A 3F3SA 3OJOA 2GN4A 4HKTA 2XF8A 4UVHA 4BNJA 3GQVA 2DPHA 2JHGA 3GNQA 1T4BA 4AJEA 4E4YA 3S1LA 4PLPA 4U8GA 3ORFA 4GKBA 3T7EA 3ADOA 1ZSVA 3CINA 3VPGA 4DUPA 3HN7A 4YB8A 1LSUA 3WGZA 2CF6A 3TZCA 3D4OA 4TKLA 4BNXA 4PGFA 5DBGA 4CM8A 1ARZA 4MVJD 2Q4EA 2Q2QA 1P45A 4XR9A 1DPGA 3KO8A 4IQ8A 3P5SA 3PIIA 5CG2A 2X0JA 1PQUA 3Q1LA 1JAXA 4IDEA 3RFTA 4E2YA 1WMBA 4RJTA 1KEUA 2YFHA 4FFLA 4IM7A 3TN7A 3KETA 3L4SO 3H9GA 1EUZA 1UZLA 3BMOB 4JQCA 4B8WA 1UZNA 2SCUA 1RM5A 3PZRA 1U8XX 4Q3DA 3B20A 1GR0A 2Q1UA 3ROQA 4WNCA 1QRRA 2EERA 2Q1WA 2CD9A 2WD8A 3WGHA 4MVJM 4EUHA 1HETA 2NTNA 3B1KA 1ADGA 3CXRA 2CMDA 3UAGA 3EZYA 1KEPA 4ZRMA 3DAPA 1LSJA 5BQFA 4PIVA 4YT5A 3JYQA 4JJIA 1VJ1A 2X0RA 1PZHA 5ENDA 3R3JA 2DBQA 2GD1O 3M6IA 2V7PA 2FPPA 5MGBA 1PJLA 2VHYA 4DRYA 1H2HA 4NBTA 9LDBA 1YB5A 1G0OA 1KC1A 3BHJA 2P4QA 1P31A 2GGSA 2ZYDA 2PA3A 5LC1A 2F00A 1YBAA 5G2OA 5TS3A 1U5CA 4JXKA 4KDFA 4JBHA 4U0KA 3AI3A 5B12A 1TVEA 4ZD6A 1BMDA 3TZQA 1HLPA 2A4KA 3O4RA 1BWSA 3QWBA 5TLSA 1LRJA 2AW5A 3VZPA 2X8LA 2YJZA 3DR3A 1P1IA 3AW9A 2XXJA 1XEAA 1DJQA 1Z7EA 4IXWA 4JP3A 4RO0A 4P4LA 4OIMA 1R15A 1F8FA 2OP1A 1FF9A 4NMHA 3W4IA 2UV8A 4TZKA 2PGDA 3IQDB 3JQAA 1VJ0A 2I6TA 3BZUA 1IHXA 1X14A 1GZ6A 4B4WA 1ID1A 1QKIA 4XJSA 2YHIB 2PD3A 1R16A 2ZJ0A 4QFDA 4BV9A 1QORA 2RH4A 3EGOA 2BRUA 4ZQFA 2NADA 3ANNA 3LF1A 1OFGA 1BG6A 2VHZA 3GR6A 1R12A 5KVVA 2BLLA 1I24A 1LUAA 2WE7A 4KQXA 3IAHA 4GX1A 4WJZA 3RBVA 1D4FA 6ADHA 3VTZA 4E2WA 3MJ4A 4DBZA 1RJWA 3GVHA 2UUPA 3N58A 2BELA 2H9IA 3L9XA 4BGIA 5BSGA 4RVUA 2HMSA 4FFRA 1T2DA 5COQA 3D3WB 4KUHA 3X2FA 3Q3CA 1KBZA 3GH3A 4J9VA 4FGWA 1D1TA 1T2CA 2HK7A 5T6BA 3AOEA 1ADCA 3LQFA 2X86A 3GAZA 4IZIA 2YHIA 3JQ9C 3ANMA 4PLCA 3RC1A 1LTHR 2FSVA 3NDRA 3QLJA 1TB4A 3QSGA 3I52A 3OA0A 3I4CA 2DTDA 1DJNA 2NLOA 5C5IA 4DA9A 5TSDA 1WDKA 1ZXLA 4WEOA 5CDSA 3IIEA 2YDXA 1BW9A 1KEVA 1P1KA 4QEDA 4Y8VA 4F6LA 1SCUA 2X4GA 1V3UA 3PJGA 4PLFA 5JAQA 4OYRA 1T26A 5HS4A 3Q9NA 3OBBA 4QO7A 1HZZA 3QWIA 4E32A 4XA8A 5I7EA 1KERA 4DQVA 4CMHA 1EUDA 4FC7A 4M54A 5L53A 4ZJUA 3PHGA 4A27A 1CDOA 4JROA 1I3NA 2PKRA 5A9TA 4F46A 2O4CA 3EC7A 5IDWA 4YJHB 2X0NA 4DC1A 4R16A 4L75A 2X9NA 4NIMA 3KSUA 1EUCA 2C20A 3WSWA 1XA0A 4S3MA 2HKIA 3HDJA 2PK3A 4J1QA 4HFRA 1SPXA 4J0EA 3QVXA 3L9WA 2X1HA 3IP3A 3PXXA 3GEDA 3GEGA 4YVFA 4BNWA 1CYDA 1IULA 4WUVA 4YT8A 3FR8A 4BIIA 4K6CA 4QTZA 4BNMA 2QYTA 3O9ZA 4NK5A 3GA0A 4J2OA 5GY7A 2FR1A 5CDTA 4RLSA 1E3SA 2HRBA 1MP0A 3F1KA 4JX8A 2R00C 2FWMX 3GF4A 5A9SB 2JKVA 2IEBA 3RUAA 2B0JA 2X5KO 4XZ3A 4EBFA 3JQBC 1O5IA 3G49A 3JQCA 3RIHA 2VNAA 3QE3A 4WECA 3DAFA 1SEVA 4HNHA 1PZEA 5EERA 1HSZA 5ER9A 4BL5A 5IN5A 1Z45A 2GZ1A 4J4BA 2GUGA 1U2GA 1E1LA 1SZJG 3WICA 1HDZA 3TNLA 4GSLA 4JLWA 3U9LA 3WLFA 3VZRA 3QVTA 1Z73A 2VRBA 1NVMB 5CP8A 3ZHXA 4CQLB 2Y1FA 4B3JA 1D7OA 3KXDA 3ZV4A 4JK3A 1PJSA 3PYMA 4W82A 1FDWA 1I2ZA 3LT4A 1MX3A 2VYVD 3LC1O 3L77A 3PYXA 3DOJA 3Q2KA 3EY4A 3DONA 2E4AA 3QP9A 2OL4A 2IDZA 3KLPX 4RPGA 3MWDB 4U7WA 4YAEA 1YOVB 2DTXA 2RCYA 3FSRA 4IUYA 4AJ4A 4E33A 5JAIA 1X0XA 3BMCA 3JQBA 3L0DA 1RPNA 5THQA 2VWGA 1PJ2A 3DOOA 4CMEC 4N18A 3ZDFA 1E92A 2ZCVA 4CLRB 4KTTE 4BKRA 4OXNA 3RU7A 3OEYA 4GSKA 4IJWA 5KVSA 3DFZA 4BMNA 3AM4A 1JKFA 3OICA 1DIRA 3F4LA 2O7SA 2C5EA 3M1LA 4D7AA 4XRGA 3VH1A 3RJ9A 3TDKA 1NPYA 1YRLA 3BHIA 3ONEA 4WCDA 5KIAA 1VSVA 1I3MA 2WDZA 1KVUA 4KOAA 1ZK1A 4FOOA 4ND4A 1LLCA 4PVDA 2P4HX 3WFJA 1PL6A 3NEPX 5EQDA 4MVJH 1Z82A 1A71A 2B37A 4J1TA 3V1UA 2AG8A 4PLHA 1PS0A 2JFGA 4WE3A 4PVCA 3PDJA 3VZQA 1YH3A 3WFIA 1LRLA 1ZK4A 3AUTA 3KM0A 4CV0A 3VTFA 3RKRA 3QV1A 1LBEA 2Y66A 2J8ZA 5KKCA 2GN8A 4BUCA 5GMOA 4D3FA 5ES3A 1DO8A 1EBUA 4RGBA 3ZW8A 2GNAA 2JCVA 1R66A 3RBZA 5A03A 2AEJA 1J5PA 1E7SA 2IE0A 3DBHB 3NTQA 2HLPA 1NAHA 4IQ0A 3LLVA 3GHHA 1B3RA 4DPLA 1WWKA 2PZLA 5KJ1A 2D5AA 3GZ4A 2Q2VA 3ULKA 1WDMA 2OZPA 1JKJA 1HE2A 2IXBA 5KKAA 5A3VA 3QHAA 5DZSA 5K9ZA 2XXBA 1UDBA 1B16A 1L7DA 4WASA 3DMYA 5ITWA 5TC4A 4W99A 4CM7A 1I30A 4W7HA 4DC0A 1AUPA 3PHJA 3ZNQA 3CEAA 4J7CA 2YZ7A 5JCXA 1Q0QA 4PZCA 3WYEA 4G65A 5ENVA 3WIDA 2DAPA 3HHPA 4XGKA 3I9JA 2W98A 3F47A 1WXDA 3ROPA 2WWRA 4WLNA 4GKVA 3DQPA 3PVZA 4RF4A 1H6AA 3DBRA 4R51A 4L4XA 3NX4A 1T2FA 3OQBA 1XU9A 3OP4A 3RUCA 4E5NA 5AQ1A 1PZFA 2HAEA 2VCYA 1JU9A 3RD5A 3FHLA 4FS3A 3B6ZA 5JDIC 4IJUA 5KVCA 1B26A 4GX2A 1QYCA 1XWFA 1IYZA 1T2EA 3JD0A 4MOWA 1I3LA 4Z3DA 1UUFA 3AWDA 4UAGA 4R4JA 3PJFA 4NFHA 2O23A 4XEHA 3E1KA 3AY6A 2TMDA 1YJ8A 3TSCA 5JYEA 1KIFA 2HK9A 3GNSA 4A73A 3ZNNA 3GFBA 4XWYA 3UW3A 5AXAA 2VYNA 1PL8A 2HDHA 1WAMA 1R0SA 1E3JA 3PQEA 5JMWA 4TWRA 3O8QB 1A7AA 2DFVA 3AFNA 1PGPA 1GPJA 1PS8A 1E1MA 2OP0A 4EUEA 3KYCA 4FC6A 3ZHYA 3PP8A 2PH5A 1IUKA 2GERA 4TZTA 4BNIA 4ZU3A 3AM5A 2ZKLA 2BFPA 4R5MA 5DCUA 3D64A 4R3WA 4PLGA 4A7PA 5CDUA 8LDHA 2GDZA 5JDIA 1VC2A 1O95A 4N54A 4B7XA 4JIGA 3UKOA 3U09A 4XYEA 1H9BA 1NX6A 1ISIA 1XGKA 1EVJA 1GV0A 2RBEA 4WNIA 5HS6A 1E6UA 3GG9A 2VTDA 2BI7A 2O3QA 1NPTO 3ONFA 4RQTA 3NGXA 3GMSA 3CMCO 3BIOA 2IEDA 3GK3A 4HV4A 2NVBA 1LSSA 4CJXA 1MGOA 5A9RA 3INRA 3GN2A 4J16A 1IY8A 3QWHA 1JWBB 1PJ3A 2I67A 5I9MA 4CLOA 4OO3A 1VJTA 4FSHA 4AJIA 4E3ZA 2CVZA 4IS3A 5F5NA 3WGIA 5JYDA 2C7GA 4NNJA 4Q3BA 1Y7TA 4J91A 3WWZA 4YA6A 4A03A 3ZCXA 5A3JA 1Y6JA 2H1SA 3ZH2A 3DL2A 5JW6A 4UUPA 2Y67A 4EJ0A 3H9JA 1N9GA 1ISJA 3NGLA 1CIVA 3GAFA 4LN1A 1P33A 1O9BA 3C7CB 4W6ZA 1R4MB 3TOXA 5L9AA 1Q7CA 3VPFA 3EMKA 5FI3A 1MG0A 1X15A 5L95A 1F17A 3FBTA 5F5LA 2X23A 5H82A 1GPDG 1GQQA 3GMDA 4D44A 2EKPA 2J3KA 1J49A 1YOVA 1GQ2A 4E31A 3IP1A 3A4VA 4RQUA 4E30A 3G0OA 2AQ8A 3ZWCA 3L6EA 4OJNA 1ML3A 3ZU5A 4KQWA 1N1EA 1Y1PA 5A06A 2D0IA 2QG4A 1M66A 4P4NA 1P1HA 2GO1A 3WX0A 2TMGA 3PK0A 3MZ0A 1SBYA 3I83A 1NTOA 4L74A 4UVIA 5G4KA 4TVBA 2CNBA 4XGNA 3UICA 2JD0A 2DTEA 1NM5A 1LSOA 2OUIA 1SOVA 3U49A 3F5SA 1PJBA 3MEQA 3IL2A 2Q4BA 1IB6A 3LC2O 3ZV6A 4LRSB 3PGJA 3BMQA 2WMDA 3VH2A 3RASA 4DIFA 3K31A 5K6AA 5AYVA 4A10A 1B3BA 3GEMA 3SLKA 1UAGA 4N5NA 4DMLA 5TQVA 3GVCA 3PQDA 1SOWA 2I3AA 4LCJA 3CH6A 1ZMTA 2O3RA 3E8XA 2JFFA 3OF2A 2PZKA 1LU9A 5TGDA 2J5RA 2PV7A 3PFFA 4CM6A 1VE9A 4DPKA 1QLJA 1C3VA 2DUWA 3U4CA 1HDCA 1YE3A 5FF9A 1KY4A 3QRWA 1Y8QA 5I9NA 2ZJ1A 1UDAA 4FFMA 1LXCA 2VUTA 3HWRA 4BNUA 4IDDA 1D3AA 4OAQA 4NR0A 3JQGB 2EP7A 5FYDA 3LVFO 4BNHA 5MDHA 4G5HA 4BO4A 1HLDA 4HFMA 4YWJA 2JD1A 3HG7A 5CPFA 3ZU3A 4CV2A 2C07A 4L76A 5U4QA 3ZNOA 1DC4A 2WD7B 3OMLA 4ALKA 1FDVA 4RV9A 4Z6KA 1F0YA 3G1UA 4O6VA 1X7DA 1N7HA 1ISMA 3AY7A 4BKQA 4KTVE 4BQRA 1Y5RA 3DZFA 2F1KA 1X7HA 4CLOB 4IMRA 3RUDA 2C2XA 1QYDA 3OQ6A 2GSDA 4YRDA 1XELA 1KVSA 4H3VA 4RPLA 3S2EA 3L07A 4N5LA 4CM8B 4E2ZA 2HQ1A 3IUPA 4GL4A 4R5HA 4XYMA 5G4KB 4BNTA 4WLVA 4B3HA 2VHWA 3C7DB 3I9KA 4CV1A 3AU9A 1IL0A 5IDYA 4CQMB 3H9UA 3NJ8A 4Q3NA 2D1YA 1DIAA 1ONNA 3WDSA 1IHYA 2DUUA 2VZ0A 4LSWA 4IMPA 3QJ5A 4BO5A 4B7UA 3K8ZA 1W0CA 6LDHA 2I9PA 3I5MA 3JSAA 3ROMA 2AEFA 1A9YA 5EPOA 2PD4A 1LC0A 4HADA 1I32A 4M86A 1B14A 3LSYA 4ND3A 3W8DA 3TZHA 5L4NA 1EVIA 3GN1A 4HFJA 4EUFA 4OMUA 1DBVO 3MJSA 3VPXA 2ZK7A 1NQTA 1U4SA 1FDUA 2CDAA 2VOJA 4RDHA 4IDFA 3PI7A 1Z74A 1BVRA 5KJ6A 2W8ZA 1EFKA 4MKZA 5AVOA 1DXYA 3OIDA 5A4DA
chains in the Genus database with same CATH superfamily
2QAJA 5ED0A 2F3TA 1RWKA 1QHHA 4OFWA 1KO1A 3JPWA 4B79A 5I47A 4PNEA 4DXAA 2RGNC 1JMKC 4HYTA 3SCZA 4RF2A 4YYZA 5F3RA 5CITA 2GVZC 5FQOA 4B75A 1O94C 4ITRC 4K86A 5CNJA 3L8GA 3GGOA 2HJGA 2V45A 3A9WA 1X1CA 5JAUA 1Z88A 3E0XA 3HP7A 2FOXA 2PZGA 1D2MA 1M2OB 2OM2A 1QB7A 2X0KA 3JD2A 3ER6A 1X1DA 3KTOA 4G97A 2PZFA 4GOJA 4I08A 1DV2A 3ZWXA 5BR4A 2Y1EA 1OSNA 3RHTA 2CLFB 1HTTA 3LPAA 4A0FA 1G17A 4CIYA 5EWMB 3IUEA 4NZNA 1GPMA 1T9AA 1WU7A 4WI1A 4D02A 3KQPA 1JVBA 5D6OA 4CL0A 2VQ3A 1E5QA 3H5NA 2PZAA 3WVNA 4BJ6A 2YHAA 4LXTA 3ZY2A 1XDUA 3A3YA 1JH8A 3KUCA 3WGOA 2ZUFA 2TSYB 5E95A 5DYWA 1MH9A 3MWYW 3Q87B 1BC5A 1CW2B 1CRLA 1GWNA 1T4MA 1T5OA 2D8AA 1RHMA 3NIWA 5LQJA 4MDEA 2Q2WA 3ANSA 3AR6A 4IPTA 4X54A 2FFQA 1CCWA 3GJTA 5DYIA 1ZMOA 2X8JA 4YP0A 1SU4A 4X24A 2MSDB 3FDJA 3K5IA 1K7EB 5I9LA 1PLJA 1RCFA 4K9LA 3B5JA 4W4TA 1NRWA 3D7KA 3GROA 3PNVA 1G2IA 1VYHA 4XSHA 4KOEC 1KMNA 5JXJA 3KJHA 4R8MA 4DA7A 1LLDA 1EAMA 2VPWA 2EQBA 2Z2ZA 2Z8YA 3I0ZA 1CYEA 3T3OA 2ZRMA 2ZANA 3AZQA 2V4UA 3RUEA 4MO2A 1YB6A 1F2TA 5G0SA 5TMPA 2VTBB 4QX6A 3RRYA 2Q1YA 2BFFA 2HA0A 1O6CA 2WLTA 3RU2A 2EF1A 2B7BA 4I36A 5L40A 4MVJP 1DKOA 3CKYA 1H4SA 1LDBA 3EDRA 3U4GA 2A88A 2PX2A 1KH1A 4WOBA 1XB2A 2JJ2A 2OCDA 4QU5A 1WR8A 2EFJA 3H83A 5ADVA 5KNCA 3K9QO 4CRWB 2F8TA 4ADSG 1BA3A 3MGKA 5G1OA 3N8KA 2QTLA 3RREA 3DV0B 1Z17A 5AK6A 3FR7A 4BO6A 3FB1A 2CHFA 2WK1A 5LOVF 3DHYA 1ZOIA 4L3OA 4DG8A 1II9A 3QLVA 4WK0B 1NBOA 3VKVA 1P44A 3HZZA 3L7NA 5LVAA 3H2IA 4JKOA 4AF7A 1K8XB 2IY9A 2ZRGA 2Q0XA 3CX7A 1Q0RA 1NE7A 4L73A 5JPDA 1A95A 3IQFA 4HAOA 1FDIA 1QDEA 2K2WA 1FBNA 3C5WP 1OXTA 4I55A 4UPEA 5LD2B 2PBFA 1ZIOA 5EXPA 2VSNA 4HX2A 3ZCRA 1GZVA 4MXDA 5BMVA 2AA3A 1EFCA 4MSUA 3IBFA 4S1TA 3GPBA 5DK4A 1M6EX 2EWMA 3PFKA 1KSGA 3WXMA 5A5DA 2HWYA 2WM3A 4FYMA 1UEJA 2C84A 3O2SB 4IHJF 4OP3A 1DMRA 2XTAA 3WLNA 3QVSA 4Z53A 3GC6A 4ZCQA 2B1RA 3L0CA 4I8IA 3PDWA 1W34A 1K5DA 1ZK0A 1Z26A 1IOVA 4WK6A 4ZT2A 5FWDA 5GZ3A 1HE4A 2XCUA 1QKKA 2Y1CA 3IPXA 5EP1A 5JZOA 2DH6A 2HX1A 1S0UA 1H2FA 3UHAA 5JNVA 3M6XA 3TTTA 2AUMA 1AGXA 1YTLA 3CLKA 2PVPA 3ADDA 4G81A 3VSEA 3ENZA 2VATA 1XU7A 4BFWA 2C5LA 3W7VA 3WDMA 2AX4A 2P91A 2VP5A 4XXHA 4JBIA 1JHQA 1PT8A 1T9KA 4CGYA 3O4GA 3BGSA 1Z2AA 3WQHA 3I2YX 4ZAGA 1Y3IA 4B2IA 4ZZIA 2XADA 4U7GA 1T5SA 1G5TA 1Z36A 2Q1TA 3A4YA 2ZSUA 5BSMA 2X58A 2Y1LA 1UPFA 2ISCA 3HZOA 9LDTA 1DWPA 3CLVA 2GM4A 2QS9A 2V6BA 4GLFA 4CEJA 1GPNA 1IZ0A 2PBZA 3A8TA 2GTPA 4RFVA 1P2VA 3DA8A 1DB3A 4QC2A 2C9BA 3ASZA 2PGAA 3KKLA 3TD2A 3O8OA 5LOVB 3CBQA 4RSGA 1FK8A 1E6EA 1SXJE 1PLKA 2A1IA 2EL7A 4JR2A 5F7JA 2D1QA 2NM0A 3TF5A 2HEIA 4UEWA 4IXDA 1KQ3A 3TQRA 1B0AA 2HSWA 5ESWA 2FFRA 5A02A 4AECA 2ZIFA 2C5AA 4XPZA 2ZR9A 1T4DA 3GDFA 4II3A 1IE3A 1JXOA 2VNIA 4PBRA 1SUIA 1H0RA 1VQ1A 3P7MA 5F3DA 2HT6A 1VDMA 3DKVA 1OBOA 2IYRA 2X5OA 4PS1A 4TTQA 1JQ5A 2WZBA 4JLMA 3U60B 5IM5A 5DWVA 4DUYB 4ZOBA 3OOHA 3KDPA 1J7JA 1YBHA 1ISHA 1YZYA 2ZDGA 2ZLBA 4PG5A 2CK3A 3I2GA 3NEAA 3WLSA 3U1BA 2CJFA 2EBUA 2P3OA 1ULSA 3BGDA 3KKEA 4P7GA 3U0VA 4WNYA 3W5SA 1GCIA 3KOOA 4G07A 1A1VA 1J25A 4FNGA 4BLOA 2FEMA 3ZBUA 4C7XA 1GFSA 4BDSA 4Z7OB 5ITZB 2VF7A 1IUPA 1K5HA 1N9KA 2XOXA 5A3QA 3N59A 3BJEA 1BYIA 3AB3A 2J5QA 2MR6A 2AJBA 2F4NA 3FUUA 4TMWA 1V8OA 4I9HA 3PDHA 4IJKA 4XH9B 3D0KA 2CWWA 4YMGA 4P5PA 2DQYA 4RD6A 4TYMA 1XZKA 2WB4A 3RK1A 3V8BA 3VJRA 2XUDA 4MR7A 1VXRA 3HJUA 3IQXA 1SU8A 3EVNA 1QYWA 3CSDA 1J0AA 5EZ5A 2N1BA 3W6PA 3WTCA 5LWQA 1XKLA 2KHZA 4J7UA 4YBZA 3PX7A 1GAJA 1U81A 2INGX 2Q9AA 2V0NA 2WJPA 5H3HA 4M87A 5DWDA 3M6LA 3T54A 1W29A 4DWWA 2R86A 1NU8A 2W2PA 2JLRA 2NU7A 2ZVPX 1UXHA 2IUUA 4G84A 1Y81A 5JNUA 4RABA 4CWAA 4WX2B 3HUFA 4KAFA 1ESMA 5EXEA 1WCIA 4XGRA 5HG0A 2JCBA 1FRVA 2B83A 3CVUA 3OIFA 2PA0A 1AE1A 1QZUA 1QTRA 3R6WA 4BAUA 2ZBRA 1PFGA 3UTDA 4F12A 1U8EA 4LZAA 2AMFA 2C58A 2ZFUA 1REQB 3PCTA 4FDVA 3MRSA 4X60A 4LSMA 4HPWA 4CTMA 2A5YB 3N8HA 1Z83A 4QPCA 4GH5A 2POQX 4KFSA 1B0ZA 3CIOA 1FMFA 3VRHA 3LZ6A 1W59A 1QH8A 1ZUHA 2ZUBA 3E3MA 3HWSA 3NDIA 4R1SA 3ZWPA 4EUKA 5FA6A 4W7IA 4Z86A 1E6WA 3ZY6A 2HRDA 3ECCA 4QBTA 1K86A 4AQ7A 1OX5A 5C4IA 5AW0A 3TL6A 4N7JA 4JBWA 2KI5A 3OX4A 1T1SA 1GY8A 2H1LA 2OE2A 4GRAA 4OQ4A 3KPYA 1GEGA 4J75A 4OHKA 2Q3DA 3DUFB 3EBOA 5EHIA 1NDUA 1U9ZA 1XEFA 2F3SA 4H31A 4OYYA 4OM8A 4MLCA 2WDPA 3TDMA 5KEIA 1YK0A 4MUXA 2G9ZA 2E4UA 5ILGA 1DO2A 2YXBA 4J1TC 1PE0A 1QOZA 1EIZA 3TW8A 3GWZA 1AJEA 2HJSA 4F2WA 3QU7A 3GJ0A 4LCBA 1E3LA 2CBGA 3OAAD 1L2TA 5FR1A 1U9IA 1VKOA 2AZDA 5FQNA 4IIGA 5JBNA 1R8SA 1VYVA 3DNPA 5BV0A 3NBZC 2AFRA 2Y0BA 5EIFA 4F21A 1G8MA 5BYAA 1AKMA 3K8QA 1SXJA 1SCBA 3KU4A 5I8WA 2BKVA 4HNRA 3C5HA 3C6BA 4YJFB 2O8FA 3PRJA 6REQB 5I01A 3R44A 1M1YE 2HF7A 2EX1A 2OXRA 3DMFA 3EIUA 2Q7XA 1Y1QA 2GNOA 4I4TB 5G0UA 5A2GA 3TOSA 3OKAA 3TR5A 4B2PA 3H9QA 5B7PA 5A3RA 1XUOA 3UGKA 1JSLA 2NZYA 4XM1A 3VC2A 4IGAA 5BN4B 5C7LO 5GINE 4RZHA 3BD9A 4UUNA 2X3UA 1QDUA 3BF8A 3ETLA 1UFRA 1NOIA 3LHSA 1KFCB 3M83A 4PG6A 4LMPA 2BHNA 5YASA 3TQHA 4FVTA 3AUXA 5HPYB 3WLLA 4FYVA 3EUAA 4LXIA 2YVQA 4ZQGA 3ICVA 2YQ4A 3K2QA 1NR7A 2QX8A 2YJ4A 3JWGA 3F90A 3TAXA 3NXSA 4RE5A 5BSVA 1SWWA 4DDKA 1FXWA 1FQOA 2DUJA 4J0GA 4OBEA 3O4IA 2D4AA 2DKNA 1EWTA 4B6QA 3ILSA 2NTJA 3N2NA 3R4VA 5AVJA 3ZHTA 1TXGA 1LC3A 3F71A 4BX3A 3B48A 3BA6A 1U2DC 3EQ7A 2MMCA 3O1IC 3QU2A 4OHBA 4QASA 4CG3A 3NRCA 1M2FA 5EIXA 5FB3A 4CE6A 2EGGA 2WG2A 1UKBA 1BXKA 4Y6RA 3O0TA 1NN5A 1ONPA 4EX7A 5LQAA 4IXTA 4MCAA 1Y7HA 3L4BC 2Z4SA 1NNUA 3BHNA 1QTQA 4XSGA 3FX2A 3AVPA 4FT4A 4IVPA 1VPWA 1U2RA 2JIMA 4QBGB 2OXTA 3JRWA 4BNKA 1UXOA 2BH9A 2JZOA 3SJAA 4TVSA 4A8PA 4L0MA 4G9EA 2DU8A 4IG9A 2AQHA 1JWAB 1QF6A 5JQWA 3LOUA 1P73A 2OR3A 4FBMA 5DGXA 4BMPB 1T29A 1WUJS 4H59A 5DXJA 4H15A 1HKUA 4ER5A 1Q1ZA 3BWXA 3KWFA 4HH4A 4YAUA 3BMNA 2ZI9A 4CFYA 2NVUA 5BV2P 3R5TA 4TRNA 4LC9A 3K92A 2PRZA 2QTVB 4LV6A 1H1LB 1ICIA 2VIIA 3UC5A 5CFPA 621PA 1GG8A 1W88B 2JLUA 3EA5A 1PRYA 4WGGA 3UUGA 4ZC1A 3TKYA 3HCBA 4FYWA 4UMVA 3ESBA 1GGEA 4KGVA 2I1WA 4K9OA 4LUCA 1MO2A 4B4KA 3L1HA 2BTQA 4TRMA 3S70A 2G4LA 4JVNA 4C01A 3QVGA 3CLTC 2R48A 4L4UA 1JT2A 2CNWA 2IWRA 1JJVA 2QUBA 1GYQA 4C89A 4DYDA 5MGNA 3X2SA 2R87A 5AUQA 2XQVA 2OXIA 4DV5B 5E2IA 1MC8A 1YVRA 4LW8A 3SIXA 2WM8A 4C7OA 4LRUA 3O2QB 1NI4A 3DEKA 4M8IA 5FA5A 3WRXA 5KB3A 1OFVA 1T6YA 1TZJA 1D6SA 1FX0A 2ZIUB 4W5QA 1J0DA 3VJKA 4YEDA 2JJMA 1PNRA 1PJTA 3I5AA 2O8BB 1KZ1A 2PWYA 1HTBA 4OGFA 4P5EA 2O8BA 1MAHA 3LGSA 2ETXA 4AZTA 5HZMA 5IAOA 5JZVA 1GZ5A 3V80A 1RPAA 4TL7A 2GK6A 5CRIA 5CFZA 1E0AA 1KE1A 4HP8A 4UUBA 4ZEOA 3ZDDA 1HT1E 2CUTA 3AR7A 4YRLA 3A1WA 1GL9B 4TQUS 1QHNA 2CHEA 2CE7A 5EQFA 1SZPA 1GGKA 4ZKEA 4KO2S 1O58A 4DANA 5BNIA 3V4SA 4BXOA 2H4JA 3SJBA 4UBJA 1AXGA 1T0PA 1U0RA 3JYHA 1V4BA 2PNFA 2WU8A 2ZPAA 3KR9A 3ZJUA 4I5DA 1Z4PX 1ODTC 2NO4A 5FAKA 3DMGA 1EDDA 1KJYA 4FLFA 4U2DA 3D2BA 3NEYA 2IIBA 2J32A 2VZLA 4K88A 2XA2A 4AJPA 2YOHA 1ZITA 3R0XA 5CMLA 4ZP1A 4HT3B 4RKWA 1GCAA 4KZPA 2DOKA 2XMSA 4QJIA 1NQAO 1N5IA 2CYBA 2ZAIA 3WLHA 2P2NA 2CK3D 5B1EA 3RS7A 3MTEA 4G4JA 4B17A 1W85B 4X41A 2AF4C 1CB0A 2R11A 3H7IA 3IMEA 2EGHA 1H94A 1XAJA 3NASA 4TROA 1NHGA 4QNNA 5KJFA 2AX3A 5G3YA 1RIFA 5DEIA 4RFSB 1XRQA 1K9SA 3G6WA 5C1PA 4Q39A 4HR7A 4LG1A 4TN5A 4L2IB 2H1CA 2FZGA 3SS7X 1CFZA 3L41A 4K26A 4EBBA 5FTLA 1TD1A 4P84A 4UEKA 3IHTA 4BP9A 1I10A 1P4GA 2LP4Y 1XTRA 3LBNA 3SZOA 5JI3E 4MS3B 4HRAA 2O2ZA 1HNNA 3SD7A 5C34B 3AJDA 5FHQA 2X0EA 3HUEA 2PRKA 3P2KA 4FHFA 4N82A 2FLVA 2NX2A 1NUPA 3D7LA 3DYBA 5EZSA 4BB5A 1OYYA 5SV2A 2I9KA 1IOWA 2YX1A 3UNXA 4MV4A 3L0OA 3AVOA 1KO8A 3LT1A 4L6CA 4PEVA 3CKKA 2OXFA 1G42A 3FNRA 4EVIA 3I04M 1FP6A 2JI7A 4UASA 4TM7A 2WSMA 4LC0A 2XDYA 5JMPA 1WBJB 4AF6A 5BV8A 1M3SA 4RY9A 4E1BA 4NE9A 3CNQS 4F11A 5B3JC 2EG9A 1ZJWA 2Z0MA 1CUGA 4NOJA 1XTUA 3HA5A 3CEMA 4IZ6A 4I3FA 4HN2A 2GN2A 4G5OA 2V6MA 3T1VA 4G24A 3KEQA 4PLVA 4XWAA 4ML3A 1QBGA 4BLPA 2WM9B 4GNRA 4L7VA 1FW6A 2C9DA 3UENA 3LLSA 3U4DA 5D87A 2VNKA 2O9JA 1GYPA 2MJLA 2O3TA 3TTXA 1CUIA 1BRMA 3W5IA 1EXVA 4WGFA 3KV1A 3E4CA 4PZLA 1EUCB 1RD4A 2I55A 2OG2A 4PG7A 3H2YA 5CPBA 5F64A 3ZD8A 4D74A 2VEDA 4MS1B 4IIDA 2EBWA 3FNBA 2VDJA 1FL9A 1N0HA 3G2OA 5GOZA 4BHTA 1M2JA 2GLUA 3W6ZA 3Q12A 1VG0B 4C0LA 1KOFA 4ECAA 3CNOA 2GRAA 1ZGJA 2FWNA 3B82A 1UMDA 2NSHA 2XJ9A 2WJZB 4JA0A 3RSOA 4D41A 4V0ME 4AN4A 3DZHA 1FB5A 3REFA 1USVA 1GLVA 2IV7A 4P1ZA 4XR4A 5G0WA 3KQWA 5FBLB 2DWOA 3NP9A 1FMLA 5D5QA 1AU9A 3ZJ4A 3L7AA 3ONDA 2Q0SA 4DN6A 3EPJA 1W4AA 4ZQBA 5JCPA 1OLSB 2JIDA 2Q7OE 1JVNA 2BFEB 4CIAA 1YU9A 4MA5A 3BB3A 3L7KA 1YMUA 3L82B 4O5OA 5DI3B 1D6NA 3OLWA 3GRZA 1R5OA 4HTFA 5FP0A 3UK0A 3H3FA 5SICE 3OU6A 3FIJA 4G8BA 3BX1A 3QYPA 2OMEA 4PSUA 5F3WB 3I76A 4RVDA 4YCAA 2VC2B 1NDHA 4R9VA 4W5JA 1G7CA 5DE3A 3COPA 1DOAA 1RS0A 1GQSA 1Z0ZA 3RTCA 1YR3A 3UTCA 4L9AA 3I4LA 3RAJA 2PKQP 4AY4A 4BQQA 2BGTA 4QGSA 1E9CA 1MPXA 1Y8RB 2H4YA 2V5UA 3P20A 3MOGA 4QDXA 2H2WA 2WFAA 5EZYF 3VVCA 4JXJA 3LPNA 1OKKD 3FTNA 3LRXA 2OHXA 3V3KA 4Z4CA 2NU9A 4Z4GA 1L7NA 3K1AB 1P8AA 2QIPA 2YW9A 4UHBA 3M3PA 1B23P 1F06A 1IMOA 2FQ1A 1JDSA 3CF4A 4YASA 3I62A 3SHVA 4U39A 3KDAA 4G5YA 5G02A 1UKVY 5DXAA 3T5MA 2QD1A 2GS9A 2Y4NA 3NOVA 4YUWA 4ARVA 3KKQA 4F06A 2I65A 3WV4A 4EHFA 4GMFA 3AH8A 4U6NA 3SEFA 4DSTA 4H1UA 1EX9A 4OH1A 5LDDC 1I6KA 1E0JA 1I3KA 2BFCB 2P9CA 3DVAA 5L6MB 2PUCA 3BMNB 2YFKA 2X9VA 4G8JA 4ZVNA 3SQXA 2XZOA 1DRVA 1ZRSA 2HLHA 3HP4A 3PCRB 4DREA 5ADHA 2H18A 4TMTA 3O9VA 4JGGA 4UVDA 3QUTA 4D3DA 2C4MA 1FNNA 2R6AA 4FR0A 1XZDA 4JT2A 3VOBA 5KYYB 1ZRMA 3PKJA 5M2QA 3A1EA 2QZPA 3W04A 1G291 1UC8A 2IELA 2ZJ5A 2GPBA 4W1SA 4ZDIA 1K7CA 3Q7QA 5K6RA 5IF9A 1KMQA 1T1RA 5J58A 1H6DA 2DQSA 3P9RA 5K6TA 4EPXA 2Q29A 1KP9A 4NC9A 1BCRB 4WUTA 4G0NA 1F0NA 3S2GA 3CLTD 1BVUA 3EZ7A 2IHBA 3ANYB 2X5JO 3H4IA 4XKJA 4YO8A 2GYYA 4MYUA 2VSQA 1IC6A 5D7BA 3R3UA 4K40A 1NRXA 2RAUA 4CCYB 2X40A 4EK9A 3WA7A 3RWBA 3O93A 5K8JB 5EGNA 2L19A 3E7XA 4WL0A 4IDQA 1F60A 1EGAA 3HB5X 3V2UA 1BMTA 3LP5A 4N6OA 5ICFA 2CXSA 3SHTA 1AKWA 1QHSA 2QRHA 2OO5C 1ULTA 4UCXA 1RLIA 3RJTA 3DCIA 3WWYA 4TYWA 3KZVA 4NATA 2R1VA 3V34A 1HRDA 3I64A 4DLWA 4QVGA 1C0IA 4QG7A 5SY9A 1I7PA 2QVLA 4MGKR 3ZCVA 1MQAA 5C37A 1ZC4A 3HUUA 4C2UA 2HF2A 2HO5A 2QTGA 4G09A 1NNSA 2PU7A 4JITA 2IRWA 5FO0A 1A9PA 1JKIA 1Z7BA 3M81A 4V0NA 3DMHA 3Q0IA 1UMKA 1O5TA 4CF5A 1BCSB 4U1RA 3BUSA 5J47A 1KBQA 4P32A 2O06A 3H3XA 1D1SA 3BF7A 1A2BA 1U2QA 4ND6A 1K6JA 3IPLA 4Q1CA 5A0TA 2P4EA 2IPXA 2PD6A 3MINA 1S2GA 4IY1A 1BE0A 3MOSA 3OAAA 3WLAA 4DM3A 3QA9A 2AK2A 1U7ZA 4WKCA 2QMHA 3ONNA 4I1RA 5H70A 1O7JA 2FN3A 2Z3ZA 3AESB 1KE2A 3KB8A 3UOWA 1Y89A 1UDRA 4UTVA 5L4SA 4ZYXA 3QFFA 5JS8A 1DDIA 4EYEA 2J7KA 8AT1A 4DBVO 4K87A 3ZZ1A 1P2SA 2O2SA 3A70A 3OT5A 1EJBA 4KQCA 4QPJC 1KI1A 2W2KA 5EZ6B 5C8XA 3RTBA 3RFFA 2D7DA 1K2WA 2BFDA 3GLGB 4RVFA 2H85A 3PGMA 4ESVA 3O7WA 3R77A 2G8NA 3D8UA 4MWSA 4ZAZA 3KB2A 1XCPA 2Q5IA 1IIRA 3RYHA 1A8IA 4QQRA 2P62A 1J07A 1I9GA 5JD3A 5B6IA 3V33A 3KQHA 2BM1A 1M75A 1IMJA 4QGGA 4XCXA 3DHVA 3REOA 3WYCA 4ZMRA 3H19A 2CN1A 4F7WA 1GQYA 5EKUA 5KDDA 2ATVA 5KX5A 3IO5A 4Q1FA 3BRCA 2FI1A 3BXHA 4G1CA 1H3FA 1C9KA 5AH0A 4PSKA 1AHIA 1KXZA 2ONKA 4XASA 4TMFA 1PYDA 4Z0PA 1DHRA 1DX4A 2COUA 2YV2A 3D3QA 2UZ1B 5DM2A 1LZLA 5JJBA 4LXQA 3GYGA 4JNCA 2XUPA 3HSKA 4BO8A 2ZYIA 4IDOA 4NFSA 3RVMA 2V98A 4CPDA 4UVGA 1YS9A 3SE0A 4XTRA 3SWWA 4BFYA 4RNDB 3WMXA 3QUQA 4DG9A 4QTYA 3KUDA 3VO8A 1R9JA 4C78A 3COJA 3LF2A 4K9SA 4Y6QA 2IVFA 1X9IA 3MRXA 4S0XA 4WXMA 1HE1C 3FTCA 4XQ0A 3BMQB 3DFFA 3NETA 2QP3A 4L9RA 4ZALA 3T61A 3ICWA 4RA9B 3VKUA 1O6GA 4GPIB 4KNYA 2AE1A 2XB2A 4O4HA 3O8QA 3BEDA 1A72A 2QRGA 2E85A 1JFLA 5AW6A 1CZOA 2B4TO 3IE2A 1JEYA 1KO7A 4OI1A 1JYSA 3QXSA 2J3EA 4V0MA 2R2GA 1G6KA 2HJRA 3HRHA 1D0IA 4P08A 2GAAA 4YCMA 2NWQA 4UBOA 3MQ2A 1SC6A 2PZBA 3WC4A 4AJ2A 4YRNA 4Q3KA 3KLMX 4AO7A 4EMTA 3BSWA 4LX8A 4ZOQI 3AEUA 2NUAB 4R2LA 2J3MA 3ESZA 4FNOA 4QSMA 4CODB 4QU8A 2ZYGA 3J80A 1C4KA 4MVJA 3VYUB 1RACA 3ADBA 3LYUA 5KJCA 1BAPA 2QMOA 3FD8A 2O20A 1AHPA 2W6NA 5ALOA 2EZ8A 4M2LA 3PC3A 3DH0A 1V5GA 1D2GA 1E6KA 4OXIA 1M5RA 4Y98A 4DM4A 2QE7A 1N57A 5CGQB 1OFTA 4PC1A 3GJ7A 3C45A 4K1LA 1YZHA 1N6IA 1G60A 3AI2A 1JNYA 4K05A 1UZUA 2FZCA 3FMFA 3QJYA 2IYYA 3TBKA 5C4MA 1MB0A 2C4WA 3NYQA 2FAXA 3LK7A 2ZDHA 4MR8B 1KMIY 5C4GB 2J9GA 1YQUA 3TPFA 5ALXA 3WR5A 4AMYA 4F71A 5IK2D 1NP3A 1EA5A 1GFZA 3P8ZA 4JDUA 5F76A 2VZ8A 2E37A 3NEJA 4DMMA 3PDIA 4I5FA 3U44A 3L0ZA 3LX8A 5ALSA 3AUFA 4C88A 7GPBA 4E22A 1HFKA 4AZ0A 4X00A 2WYHA 4YJGB 1TEHA 4L6AA 2BI4A 2QU7A 4I19A 5INTA 4GI1A 4ND7A 4RL6A 1JHVA 1SUWA 1XZJA 1QBKC 1SFRA 2F43A 1NA5A 2UUOA 2G0AA 1YK1A 1W1UA 3Q10A 2A0XA 3FSEA 1HM5A 2A5DA 2J3IA 2VPTA 2AWOA 3PFIA 3R6LA 4TL6A 3R7BA 3KQKA 2RGGA 2OORC 5TRTA 4WKBA 3KR0A 2GOYA 3WMEA 1KJJA 4YJHA 1DU4A 2H1WA 3LT0A 4IKOA 2BFOA 2HY7A 2PGOA 1QO7A 4KXUA 4N3GA 2E6KA 1YJBA 2R8BA 3QVGB 4X8MA 3OPNA 2AG6A 2IYVA 2LGJA 2OENG 1ZQ1A 4FWBA 4BRSA 3OPYA 2JCXA 5JUWA 2OB2A 3KQMA 4FN4A 3IAEA 1GGNA 5DDIP 2APJA 3QTTA 5HQTA 2NO9A 5JATA 2ADMA 2XBMA 4R1QA 1T3ZA 2G4CA 4YAOA 2JIBA 1J56A 5I5EA 2HRCA 5T41A 5ALUA 5I8ZA 2VJKA 2WR8A 3ZY3A 1BDMA 2FG7C 3HADA 4PU0A 1BDBA 1TA9A 1Y6GA 2J67A 4POOA 1RP1A 2HIMA 1N2XA 3JAWB 3M1AA 4WN9A 4TTIA 7AT1A 1NVTA 2PQ0A 2FSSA 2P8SA 1YBVA 4D80A 5H9VA 2NYAA 3WIUA 4R2WA 3EFOB 1RHJA 4YRZA 2FUEA 2NO6A 1LDEA 2EBFX 3I58A 3I12A 2EEPA 4BVAA 3U9SA 4LOKA 5AVRA 2H29A 4BQPA 2N75A 2OY0A 4OOEA 1JLMA 4CLEA 3Q3VA 3WYFA 5I8PA 1RTKA 1RIIA 5KYGA 3ZTYA 3J7AC 2PMBA 3U4MA 1G4HA 2X9LA 3COVA 4X64B 3MTJA 3SXUB 2B82A 3ZGOA 4WCFC 4I9GA 1JXQA 2GEKA 1A88A 2JJ2D 2QUAA 1L4FA 4JASB 4BMZA 4G86A 3IP7A 2ZJFA 1M6VB 2WFLB 3FOEC 1ODSA 1EWVA 1HNWB 2RGYA 3N8DA 3PJDA 2ISQA 1NAIA 4FYHA 1KJIA 1PUJA 4J2HA 4P36A 4LS3A 1GADO 2O2JA 1WNTA 3DTYA 2E4YA 2JFWA 2NU8A 5JY6A 4IOKA 4IFEA 4OQZA 1QE5A 4P3XA 1V3VA 1HL7A 5AI6A 1VL8A 4EDFA 4EEKA 4CL3A 4PYMA 1RQRA 3SXPA 1SXHA 1E32A 1H2WA 4FGSA 4RTRA 4GLLA 3HNPA 3GT7A 5FTJA 4O0LA 3BMCB 4KEAA 5EXTA 4YRBA 1CZRA 3RC1A 1JUDA 5LOVA 3MYYA 2WAYA 3AM3A 5J9FA 3C70A 3WK6A 4EFDA 3TGPA 2G25A 1VCHA 2FPSA 4I5GA 5LBTA 1G6HA 4OHYA 2OCBA 2Q4DA 3E18A 3N53A 2Y68A 1LWNA 1EK6A 4L4SA 1Y80A 3AEUB 1EGQA 1CULC 3HO8A 5AVVA 5IUJC 1JHXA 3C85A 3NHSA 4QDKA 1J4AA 3UHFA 4R8RA 3LOQA 1GDDA 5IF3A 2VFAA 2FCRA 4CQNA 2ZEJA 4LF7B 2HJWA 4FE3A 4KXXA 4F93B 5FCDA 5IXSA 2JLVA 4FN5A 3F98A 3LCJA 3QA3E 2IZZA 1PTJA 1O8CA 3UH0A 3H0EA 2F2TA 4FBLA 3EULA 1A7UA 1X87A 4KQJA 2QYOA 4F4FA 4DILA 2AE2A 1C0EA 5K3DA 4U2GA 1OBCA 4URHA 4BKMA 4NTZA 3OPYI 1R64A 2W2XA 5HDBB 1AKVA 1I7NA 3O94A 4WTOA 5IBRA 1TUBB 4EW2A 3B2NA 5IXYA 4DQXA 1G66A 1H2ZA 2XMZA 1E4EB 3E5MA 4UOZA 4RXTA 3S7ZA 2CDCA 1R4NB 4I14A 5L7TA 4KK3A 4MZXA 3RRJA 3ZY4A 1UBRS 4WESB 4UC0A 1H6CA 2DR3A 2BPOA 1LS1A 2QM0A 3IAM6 3W2IA 1CP2A 2IZ0A 3I37X 1WF6A 4URWR 4GMKA 2H1RA 2RHJA 1Q0HA 1XZPA 5BMVB 2EF0A 2NZ2A 4H16A 1Y63A 4JJZA 1CUVA 2POCA 4AY6A 4GMGA 1E9RA 2DBZA 1E6CA 1BS1A 1TYZA 1NI5A 3KKNA 3RE1A 4CQLA 1VLMA 5J4KA 5KOYA 4AS1A 1K6XA 1CR6A 1IAQA 1YI0A 3JQ7A 1BO6A 3LXXA 4I4TF 1R4AA 3KVOA 5GV8A 3SG0A 4MPTA 4LISA 1Y1TA 2J1LA 2O3JA 2ORYA 1HO3A 1K1EA 2BD0A 3CNBA 3BWYA 4I8XA 4N4AA 4MHSA 4OLJA 5F4BA 2HTEA 4NU5A 1C9NA 4ZT4A 4IIBA 2VDUE 3H5OA 4TOIA 1E3WA 1WY5A 2W0MA 3ZWYA 3W3ZB 3EEQA 1EXDA 2FMUA 5FDFA 4EOGA 4UREA 1P7PA 1E1CA 3ZDCA 2BW0A 2XB4A 4R1NA 1RE1A 1RLJA 3KAQA 3FZQA 4L6IA 2JLCA 2VP3A 2XD4A 2ZE6A 4G8CA 4JN6B 4Q4HB 4M83A 4ER0A 2VWQA 4Z4HA 2VHEA 6CHYA 1MHTA 3D6FA 4MWBA 3D8TA 2R8RA 2J31A 4FGJA 4KFCA 3CM0A 3VH3A 5EIEA 3D8SA 3DC2A 3NONA 1ZH8A 2XCQA 3LU1A 3WJAA 3WLMA 1KZ4A 7REQB 2P9EA 2R85A 3NH6A 4YJ2A 2VF5X 1GQOA 3MAAC 5DNWA 4BOYA 2UVPA 4BPBA 4TMKA 2X9GA 4G1UC 2CJPA 4L95C 2OXEA 4V03A 3LFUA 1UXKA 2RHLA 2W0SA 4HXFB 4XWKA 3ZGLA 1HSOA 4INZA 1L5VA 1NXQA 2DY1A 4RADA 4N48A 1NSYA 4G4SO 4GXTA 5JDCC 1YAJA 1Z6ZA 2W4QA 3MJCA 3EXFA 5GJWC 5EJGA 3S1AB 4FCCA 1PFYA 1N3LA 1E3IA 5FR2A 2EFGA 3IBCA 4K0KB 2GF9A 3N76A 1GTVA 1L7BA 1ZGBA 3EHDA 4XB1A 5LCXA 3WO0A 3UT6A 1B8UA 1W5TA 1FDOA 5SYMA 4Z3KA 3AF3A 4NCBA 2JVIA 3GPLA 2HUNA 1PIWA 4MP3A 3L1UA 1NBHA 2FEOA 2Y76A 3VYVA 5HKKA 4J9UE 8OHMA 4QVKA 3GLVA 1E20A 1V5EA 2IPNA 4MRNA 3RWMB 1E2JA 3TTVA 2HHJA 1G3RA 4CNBA 4QLBA 1T9BA 3OIUA 1K66A 3IQGX 3MELA 4AKTA 3ZQJA 3S81A 3TRJA 4H4DA 1G8SA 1CJCA 3E05A 4EPYA 3QHPA 3WL6A 5MFPA 1I2CA 4CW7A 4NZ9A 2X14A 1M8GA 1W8IA 3K8OE 1Z8FA 2A1TS 5ICSA 3O8NA 5D00A 1CZUA 2VNJA 2ZSKA 1FP4A 4KNWA 4AWAA 1FNCA 5BMOA 2QN3A 2V7GA 5BYBA 3M9XA 1YBMA 5JMTA 3AKCA 3GARA 1XBTA 2XMQA 4UUMA 1K7YA 4A2CA 1PQ4A 3SEZA 2ASEA 2WSSA 2GEDA 3BDAA 4XVHA 4D4HA 4Y2PA 1NNLA 2YMMA 5BP7A 5BNWA 1SQGA 3CKMA 3V6MA 1Z9BA 1QH0A 4AZWA 2V3VA 2W90A 4V38A 5B1YA 1N2CE 3GI1A 4UU8A 1VHDA 1DC6A 2PWZA 2OEPA 1G8PA 2XVMA 2EZ9A 2ZRKA 1VLVA 1JB9A 3EDCA 4NZYA 3B3JA 1E1KA 3BJMA 4IDCA 1RPZA 3AUJB 1QK3A 3A32A 4ITUA 3L49A 1O97D 1HXHA 5BSHA 3NWPA 2D0PB 2C3OA 1LQUA 4JUAA 3JU3A 4Y1EA 2BZ1A 1PTKA 2LBPA 2W2OA 5L3SA 2HQBA 1MO4A 2B4QA 4RA9A 3TQFA 1K4YA 5HRAA 1LRKA 1SG6A 1NUAA 2QSUA 3GEPA 5TVGA 4YO7A 4DR6B 4JV5B 1EGHA 1JTFA 4BMSA 1IXRC 4KLCA 1U0SY 1QDLB 3M8KA 3DHEA 2J3LA 4RD3A 5J4LA 1FRQA 2I6XA 1DJOA 4LZNA 1J8YF 1ZR2A 1D5CA 1FJHA 2QTVA 4OB6A 3TE7A 2DLCX 4MWCA 2A94A 2VKTA 2PMCA 3D1JA 3IDZA 4FFBB 3RYFA 3Q2IA 1AK9A 4AY3A 3Q88A 4D46A 4QNMA 2GARA 3ZD7A 4CF3A 3X1XA 3OOYA 4DR3B 1MA0A 2FLKA 4M1WA 1ZAYA 3DMPA 4YHHB 4DMGA 3EAQA 2UVDA 4BS9A 1OC2A 4MK4A 3M34A 4JZYA 3ZU4A 1KNXA 2R84A 1XI2A 3IB6A 4IGKA 3VPHA 5BN3B 3A6PC 1J2YA 2YRXA 1JEQA 3DAGA 1DWQA 1LPSA 1YFKA 5EWJA 4PZPA 5B7NA 3EUEA 4XQ9A 2C7OA 1ZW1A 2LDXA 2UVQA 3K71B 1R3DA 1XTPA 1WJGA 3GDHA 5HDQA 2QD2A 1NLFA 4FP9A 3QOYA 4Q4HA 4E5SA 4DB2A 4BYGA 3JALA 3ZWNA 2B98A 5KNDD 4HAZA 2EVWX 2MOKA 3R5SA 4M0KA 4YCJA 1W36C 1XHLA 2Y93A 5DOZA 1NVVR 1UF9A 3PYLA 1UADA 4MH0R 4NCHA 4CCWA 2F9FA 4DWVA 3T1TA 4V2UA 4P38A 1Y1LA 4RZIA 3SS9X 4B6GA 2QHXA 4IH1A 1MXHA 5KI6A 3V1TC 5AO9A 1XZFA 2ZRBA 1SBNE 3E61A 1NW6A 3EEOA 3GFOA 4QLOA 1Q92A 5EWLB 1NR5A 1ENPA 1A27A 2CEAA 2WU1A 4JNKA 4DQDA 1YE5A 3A1TA 3DWFA 5IN4A 4I9UA 5DGDA 1G20B 3VV2A 5AJZA 4EYSA 4F45A 1EESA 1EWYA 4GICA 2EBHX 2PTGA 1AKUA 2J0UA 3G23A 3NBAA 1H69A 3QI7A 4NU6A 4PM4A 5DHQA 2ORED 1J0XO 1CTQA 2ZRFA 1N4AA 4RH0A 4DA4A 1LCIA 1ZY2A 1KYZA 3I9LA 3A1SA 2GKSA 4NDNE 2WY2D 3SR3A 4DG5A 4B43A 5JCOC 5KTNA 3Q2OA 1P9WA 5B1DA 4BGUA 2I4RA 2R4UA 2XKKA 5DKFA 3FPLA 3D81A 1QHYA 4HLNA 4V3CA 3E9YA 4I50B 4HGPA 3SF8B 4CZ2A 4IRMA 4F4UA 3W3AH 1MZPA 2XV1A 4D2IA 3LA6A 2JGFA 1WP4A 3F6PA 2O3UA 4FXOA 5G40A 4GO1A 3RTDA 3TLEA 4PAWA 3C6MA 1QVRA 2VJDA 4W7SA 2BM9A 4B8YA 4B4VA 2JAHA 3CWZA 1EXNA 2C5FA 4RLFA 2CL6X 2E5LB 3P0FA 5CEFA 1N0VC 5AVTA 4RMIA 1T25A 2XGGA 5LQUA 4UU1A 5GOTA 3UK2A 3T9AA 1WA5A 1C7ZA 4GRDA 3JYNA 3OZAA 3GFVA 1X80A 3M4ZA 3JZDA 4FOTA 3KELA 3X1MA 2WAXA 4QYMA 1FYVA 2X19A 3GLFA 1XMPA 5COAA 1Z62A 5HP4A 4KJXA 5AVSA 3E7FA 4H1VA 1BD3A 4R84A 5BUCA 2CLSA 2WJ3A 1NQVA 5J2TA 2WMNB 3OF5A 3HY3A 1TX4B 2OILA 2RH5A 3HB7A 2YJNA 4M99A 1ECLA 1TLTA 4DCMA 4DLXA 3UCXA 2Y77A 3MOIA 4JOSA 1OH5A 4U3JA 2PO5A 4K28A 1YZFA 3HN2A 4M9XA 5KWVA 5JSYA 5TARA 2VPZA 1E3QA 1OI3A 1UXJA 4D82A 1E58A 2YHSA 2VHJA 2WU0A 3VHXB 1V5IA 3HCNA 2OD2A 4FDTA 5JQGA 1S2MA 2P2YA 4CDNA 2Y0DA 5EJEA 5HEKA 1Q95A 4KQ1A 4G0OA 2CLCX 4MQUA 1U63A 1A9SA 3AF4A 2C57A 1A4RA 1SKAA 1U4NA 2YCLA 1N8TA 3N2LA 3GJ3A 5EP3A 2J6IA 2GA8A 3FUCA 1GV1A 1HQDA 3QF4B 3B7PA 1P6UA 4G89A 1B8PA 4TWZA 1ODCA 5LDHA 1Q44A 1UL1X 3COWA 3OM0A 4TRRA 2H5JA 3OZUA 1HDXA 3HLTA 4DLKA 1OX4A 1HYGA 5FJJA 1XIVA 5KSYA 3HJFA 2VOEA 4KX5A 3IEKA 3IUSA 2O52A 4ZGWA 1ZIYA 1YL5A 1P60A 4N8SA 1TI7A 5E4YA 2FG6C 3Q3IA 1NM5C 1IUOA 4GXQA 1ZBQA 3ZW9A 5JEEA 2EZUA 1P5FA 2YFQA 4NEHB 5JH7F 5BR7A 5FLKA 3IOMA 5IJAA 4BVEA 2UYCA 3DBLA