1T2FA

Human b lactate dehydrogenase complexed with nad+ and 4-hydroxy-1,2,5-oxadiazole-3-carboxylic acid
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
332
structure length
332
Chain Sequence
ATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase B chain
publication title Identification and Activity of a Series of Azole-based Compounds with Lactate Dehydrogenase-directed Anti-malarial Activity.
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 332
sequence length 332
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1t2fA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1t2fA02
3WSVA 3AI1A 2O48X 4R69A 3W6UA 4A7PA 4OXNA 4M87A 2GUGA 5TQVA 3EW7A 2OBYA 2V6GA 4L4SA 4D3DA 2Y1FA 2CMDA 4W7IA 5CDUA 3GNSA 3BAZA 1MC5A 4TVOA 4ALKA 1AGNA 4XKJA 3OF2A 3P19A 4RPKA 3RAJA 5I7EA 1FK8A 1YDWA 4WLFA 4H15A 5F3RA 4MVJE 3U5TA 5F1PA 1YL7A 3ZW9A 5L95A 2NQ8A 5I9MA 5A5FA 4BVAA 4GVLA 5L4SA 1ISHA 1Q1NA 2JCYA 1SOVA 2RCYA 2FY8A 3K2EA 5C3MA 1G1AA 1QR6A 2FZWA 2CDCA 1X1TA 2W2KB 3EMKA 4J91A 2E6UX 2GRAA 4E13A 2HMWA 4IIVA 3X2EA 1GQQA 3ZWWA 1UR5A 4BNYA 2NU6A 3QIVA 3ZWOA 4BNNA 4J7XA 5T6BA 4WOJA 4OMUA 5IG2A 1B15A 2CVQA 2G82A 4NMHA 4PZDA 1HKUA 4I5DA 3DOOA 2WJPA 1D1SA 4GH5A 4E33A 3C7DB 1R0SA 4PRKA 3V1UA 1DIGA 5KJ1A 3LU1A 4R1NA 1P0CA 3DOJA 2X22A 2HDHA 2Y0DA 1JN0A 5H83A 1B8VA 1PWXA 4G81A 4E5KA 1DO8A 1QSGA 3M2PA 3E82A 1GUFA 1A72A 4O59O 3RIHA 8ADHA 1LDNA 1LDMA 4BNLA 2Q1SA 1HDOA 1KVTA 2DPHA 3IUSA 5KKAA 1ZO8A 4G2NA 4YJGB 3WFIA 1B16A 4CUZA 1V3TA 4FW8A 1XQ6A 4MO2A 1QYCA 3D3WB 2GASA 4WASA 4XIJA 2A4KA 4J9VA 5KJEA 3UW3A 1ENZA 2WDZA 4Q3AA 4E2XA 1Y9AA 5AYVA 3LT0A 3GHHA 1C0KA 4E32A 5ENVA 3ZWXA 2CFCA 3DZIA 3VZRA 2X5KO 4GLLA 2Q4BA 4AJ2A 2ZQZA 1I2BA 2JAPA 1ULSA 2Q4EA 5JPIA 1DB3A 5H82A 5TSDA 3PLRA 1U1IA 1ZK4A 4CLDA 1RM5A 1Y81A 5G4KB 1D4FA 1YL6A 1LJ8A 2GSDA 2E48A 4QSMA 1LUAA 3RD5A 4MKRA 3S8MA 1HZZA 2NTNA 4LCEA 1KBZA 2Y1GA 3D7LA 3HDQA 3I3OA 1SC6A 1NVGA 1G0OA 3HDYA 3FBTA 2WTBA 1EE9A 1KEUA 1N7HA 3OIGA 3UICA 1BMDA 1C0PA 5TF4A 2C59A 5A9SA 5JAIA 1I32A 4ZQFA 3R6DA 3PLNA 2AMFA 1ONPA 2WD7B 5HTOA 4XQEA 1MGOA 1U9JA 2QRJA 3GC6A 3F6YA 2I65A 2WYVA 4FCCA 1H6AA 1LLQA 2PKRA 1VSUA 2YFQA 1PX0A 3BMQB 3D3EA 4FJ0A 4Y67A 2Y1CA 3ROMA 2DAPA 2EW2A 4B7UA 4AJ4A 2YUTA 1PR9A 3B1KA 3RC2A 3TFQA 2BELA 3PDUA 1ZMTA 4YA6A 1ZK1A 4DRYA 1NAHA 3GEMA 3ZWYA 2EGHA 5K6AC 4XWYA 1T2AA 3ZWCA 4Q9NA 1V3VA 1N8KA 2Y99A 4IIUA 4P4NA 4JP3A 4II2A 2W4QA 3QV1A 3SLKA 5I7VA 4ZGWA 1HETA 5TJ9A 1IZ0A 3LDHA 3IMFA 4NH4A 4DGSA 1FXSA 3DAPA 1U2GA 4EUFA 3RASA 4DIFA 1M67A 4PVDA 3A4VA 2FR8A 3U9LA 3V5NA 1PZHA 2YDXA 3INGA 1QV7A 3ROQA 3H5RA 3INTA 5K6AA 1U7TA 3W8DA 1OAAA 4AICA 4AJEA 2OO5A 3C7CB 3VTZA 4OXKA 1RKXA 2OFPA 4YRBA 5JBIA 4IPTA 1F12A 3ORFA 3ZWMA 2JHGA 1HE5A 4MVJF 1HL3A 4TMFA 5J23A 2GO1A 4ITUA 4NJMB 3PHHA 4BNFA 3JQCA 4LCJA 4I1IA 1C0LA 2X23A 2ZTUA 2YW9A 2YQ5A 3UKOA 1PGPA 1UXHA 1MV8A 4Z3DA 5ICMA 1R16A 1EFKA 2PH5A 3FTNA 4J2HA 2ZTVA 3JQ7B 3AUAA 3NDRA 4YTEA 1R0LA 3RCBA 2XXBA 3FNGA 3KTDA 3O8QA 4YB8A 1KEWA 2PV7A 4TSKA 2VOEA 1YQDA 2Q46A 4GWKA 5EQFA 1ZKMA 4JN6B 3NYWA 3QSGA 4L0QA 3N7UA 3P5SA 5KKCA 1Y8QB 1VL6A 1VI2A 2EEZA 4ZRNA 4B4WA 2X0JA 2C7VA 3WFJA 4IY1A 4CV3A 4DWVA 2AQKA 4CLOB 3CTMA 2QX7A 2YQ4A 4FC7A 4F3YA 1GZ6A 2JD1A 3A06A 4EYEA 1YQXA 4J4BA 5L40A 1UUFA 4BNKA 3DWFA 1MFZA 2HKIA 3KVOA 5COAA 4YBZA 1VL0A 4HKTA 5F1OA 3A28A 2OHXA 4OSPA 4KUHA 3OSUA 3EDMA 4X54A 2GNAA 1UZNA 5L7WA 1QG6A 4BO4A 1PU2A 4R9RA 1I2ZA 4TRNA 4YAJA 4HWKA 3TL2A 5K0ZA 2VT2A 2PD6A 3NRCA 3EK2A 4LSWA 4J49A 4WNIA 3RVDA 2AEFA 3F1LA 3O38A 2DTXA 1E5QA 4H7PA 4XQCA 2BLLA 3FCOA 3I52A 2ZKLA 3W4IA 3LQFA 5COBA 4L76A 2H9IA 3ZU5A 1XCBA 1D1TA 4J1NA 2NACA 1PL6A 5G4KA 5HS6A 4UAGA 3BMOA 1IUKA 1GYPA 4CMBA 3PQFA 4DVJA 5L45A 3JYNA 4QT0A 1VC2A 1BHSA 2Q1TA 4UVHA 1SEVA 3NT5A 4M89A 2PWZA 1KS9A 2ET6A 1WPQA 5ES3A 3ZW8A 1KEPA 5JSFA 1DPGA 1GCUA 1NVMB 3D4PA 3F4BA 3QVSA 4BNIA 2WWRA 1YO6A 5HM8A 4ILKA 4HV4A 1DLIA 3B1JA 5JAMA 3ABIA 4HFNA 2WD7A 1ZVMA 4ID9A 4XJTA 3TOXA 4GQAA 2IDZA 3E18A 4NBUA 3JD1A 1I8TA 1VKNA 3QJ5A 5KOIA 2HLPA 3BMQA 3UCXA 3W4JA 2DM6A 4FB5A 4EJ6A 4J90A 1LSSA 3GAZA 4ZICA 3G1UA 4KZPA 1N7GA 1UP7A 1SMKA 4Q39A 2C07A 2PGDA 3UF0A 1NASA 4ZA2A 4ND1A 2DFVA 5DCYA 4CM9D 3WGHA 4QECA 1AUPA 3IDSA 4OKIA 4IDBA 1H2BA 3DHNA 4YDRA 1CF2O 5IXSA 4RVDA 2CVZA 3ASUA 4R9SA 4C4OA 1LDYA 1H0KA 4CLHA 2PR2A 2VZ9A 2Q49A 4ZU3A 3WS7A 4KOAA 2GZ1A 4DLAA 2O50A 2B35A 5AXDA 2D59A 1HE4A 5IN4A 3BMNB 3ONFA 1LTHR 2X0IA 3EC7A 4YEDA 1M75A 1ZFNA 2IYOA 3PWKA 3VC7A 3KYCA 4JJFA 1DSSG 1SCUA 3DZKA 3BXXA 4IZIA 3L6OO 3TZKA 5CEFA 3DTYA 4RVFA 5A3JA 4ND3A 3GVXA 4KQWA 4NNJA 1PJCA 1KERA 3JSAA 3GZ4A 3I4CA 2JCXA 3DO5A 1DOHA 4K6FA 4CQLB 2CSUA 2XF8A 4J2OA 2HQ1A 2UUPA 3ICCA 4D7AA 4E2WA 4S1VA 2AHRA 5JY1A 1QP8A 2R00C 1O6ZA 4ND2A 4FS3A 4XDZA 1PS8A 1YOVB 2FP4A 2CDAA 5A05A 1P1HA 3WJ7A 1H9BA 4A27A 1YL5A 3IOYA 3PFWO 3PPIA 3QLJA 4LSMA 4CLOA 1F06A 4WCFC 2NADA 3AY3A 3JD0A 1NYTA 4IDFA 1PL8A 3JQAB 1Y9EA 3PYLA 2XXJA 3HFSA 1T1SA 1YBMA 5JCJA 1NVTA 2R00A 2VWHA 2YJZA 4PRLA 5TX7A 4MOWA 3C7AA 4PZEA 3L6DA 2CDBA 3EUWA 5TIIA 1Y8RA 3H5NA 4FD3A 4BO0A 1W0CA 3RUHA 3GVCA 4W6ZA 4HBGA 4WCFA 4XA8A 5JO9A 1K6JA 3LF1A 1E0DA 3DDNA 1XU7A 1UDCA 1E7SA 4P8RA 4TRRA 1O5IA 1WLYA 1NX6A 4QX6A 4CMHA 4DC1A 4DMMA 5TJHA 1EVJA 1XU9A 3EY4A 3AM4A 3UUWA 2CUKA 1OBFO 1ONNA 3MWDB 1HWYA 1W4ZA 3BYZA 4BMVA 1PIWA 1TVEA 2OZPA 2VYNA 4U7WA 3GRPA 4DMLA 3ZZNA 3JCZA 3ANLA 4DIOA 5A9TA 5C7OO 2X1HA 4BUCA 1RM0A 3ZHBA 4FFNA 1FDTA 1P31A 3JV7A 2OUIA 4XB2A 4I08A 3KSZO 4IJKA 3KSUA 5G0VA 2YV2A 4MINA 4BO6A 3LVFO 4B4OA 5A1TA 4Q3EA 1LXCA 4XD2A 2G5CA 1OZAA 1T24A 3Q3CA 3KV3O 4LVCA 1E3IA 3OIFA 1U3TA 2PGLA 2FZEA 1LQTA 4RGBA 5G0SA 3L9WA 2DC1A 3IL2A 1WMBA 3F5QA 3PQEA 1SAYA 4NK4A 2UV8A 3Q1LA 3CSDA 2Z1MA 4N5NA 4CUJA 3UFXA 1E6WA 4J1SA 2ZB8A 4DPMA 1K89A 1PL7A 4YXFA 4GWGA 1ZZEA 2XPCA 4KTTE 4L4XA 1HDRA 1ZEJA 1E3LA 3K8ZA 4EJMA 2PD3A 4A26A 3RC9A 3VDQA 4BMSA 1JKFA 3A14A 3M1LA 3CINA 5IN5A 4NG5A 4XYBA 2VHVA 4FOOA 4TQGA 1LNQA 3MJVA 4UVGA 3BMCB 3G17A 4ALLA 3GH3A 4I9NA 2PKQO 5BR7A 4CM9A 4HFRA 3OEWA 4ZQBA 3CIFA 4WCDA 3AFMA 3NTOA 1R4MB 4XR9A 1NAIA 1XIVA 4GKVA 4IUYA 5JNLA 1SBYA 2HSDA 1P45A 4QO8A 4WECA 1UJMA 2QW8A 2E4AA 3RU9A 3Q2KA 3AU8A 2GDZA 2HCTA 4PVCA 3RFXA 4YQZA 1R15A 3BMNA 1ZK3A 1ZJZA 2A94A 1ZUD1 4IXWA 1CJCA 3G1TA 2UDPA 4NQZA 5B37A 1W6UA 3NDJA 4QTZA 3AUSA 3GVHA 1PJTA 4E5YA 1A5ZA 2O3RA 4J4HA 4RF5A 1Q0LA 3WNQA 1LDBA 3SBOA 3VHRA 5JFOA 1CETA 5TT1A 1LLUA 3S2EA 5CDTA 3HHPA 3WX0A 4CQLA 2ZCVA 4II3A 2QZ9A 4BNUA 2FSSA 3GZNA 2HO5A 1X7GA 3GPDG 2PZKA 4Y9DA 3FNHA 2YZ7A 2Q3EA 3I9MA 4BKRA 4O6VA 5IFLA 2HUNA 2DBVO 1MG0A 4CM7A 2X4GA 4DYVA 4CR7A 3NGXA 5JY6A 3Q2IA 1V9LA 1X13A 1YVEI 4MKXA 3LT1A 1TLTA 3ONDA 1P44A 1UZMA 1RJWA 3ZNOA 5IXYA 4TROA 1QLJA 2YHIA 3PFFA 4ALNA 3ZNPA 4WEQA 4YR9A 1PZGA 1NR1A 4EUHA 3FSRA 2OBNA 1ISFA 4IJVA 4QUKA 3GFBA 3PEFA 3WMWA 1T25A 4AJNA 1A71A 3JQFC 4RVGA 5COQA 4GX0A 3VH2A 3FI9A 3PP8A 2Y1EA 4RORA 5IDWA 5KVVA 1A7KA 4MIOA 4Q3CA 4DLBA 3LF2A 2DUUA 3MOGA 3GGPA 1QKIA 3C1AA 3I1JA 4D45A 3DBRA 3EZYA 1Y5MA 3QVOA 4JNKA 3F46A 1HEUA 1HYGA 3JQFA 5IF3A 3RUCA 4CMGA 3WYCA 2I67A 2ZIZA 4M8SA 4I5GA 1LI4A 1YWGO 3OA0A 1BXGB 1E3JA 5AVOA 3ITDA 1B0AA 4P38A 5B4VA 3GOHA 4MVJM 3OQBA 3RC1A 3VPHA 4E5NA 3NKLA 3D4NA 1XA0A 2EWMA 2BFMA 4RO0A 5H81A 3V1YA 4J4TA 3M6IA 2I9PA 1DBVO 1OMOA 5JMWA 1I24A 3PHJA 1UP6A 4DQXA 3RU7A 1KETA 1MLDA 3VOSA 5DBFA 1PQPA 5FWNA 1ZSVA 3NJ4A 2TMDA 5MGBA 1WWKA 4G5HA 5JDIC 1GU7A 4PG4A 1XG5A 1WVGA 3TZCA 1JKJA 5JXWA 5ICSA 3VZSA 2J6IA 4W82A 3R3JA 3V8BA 1EQUA 2G0TA 2PK3A 3RJ9A 3LYLA 3TZ6A 2D2IA 4U0KA 5THQA 3HB5X 4IQ0A 3NT2A 4R41A 4PN3A 2I76A 5LDGA 4P4LA 3MWEB 2VOJA 3PDJA 3SEFA 5IDQA 4E4YA 7ADHA 1CYDA 4J1QA 3WLEA 4BV9A 5JDIA 4RCVA 4NDNE 3ANNA 3DZGA 5HS4A 2ZYDA 4JP2A 3QVTA 3JQGB 3PTZA 4LVUA 1YB5A 3F3SA 2D4AA 4B7CA 4BO2A 4E5MA 1PZEA 1P9LA 2C54A 1GUZA 1J6UA 4U6QA 3GK3A 4NZ9A 3WB9A 3WBFA 1VL8A 1X15A 3OJ0A 2Y0CA 3WGZA 1BXKA 4JXKA 3HG7A 1ZSNA 3QW2A 2J3KA 4OM8A 4AFNA 2HJRA 2JFGA 1WAMA 1HDYA 1Q0HA 1ZJYA 3OJOA 1L1FA 4YJFB 1ZMOA 2AQHA 4Q3NA 5JDCC 1H6CA 1NBOA 1ARZA 3U09A 4M54A 3WMXA 1JTVA 3WGOA 3ETDA 2ZCUA 2NU9A 2W2LA 3E5RA 3INRA 4IDGA 3STHA 3Q11A 3TFOA 3KEQA 1XWFA 2EG9A 3E5MA 4AJKA 3GLQA 2DTDA 5AXAA 3KLMX 2QYTA 2V6BA 5JDCA 3IKTA 1SB8A 2GD1O 3ENKA 1PWZA 1ZCJA 2GGSA 3O03A 4TZKA 2FPGA 1FF9A 4GMFA 4R4JA 1GFSA 1DFHA 3UCFA 1ENPA 4IQGA 1Q7CA 4LRTB 3RSHA 1ONOA 3WWYA 2R2GA 1GTMA 1P1KA 3D1LA 4LISA 1NWHA 4RL6A 2GR9A 2B69A 1UAYA 2HK8A 3HJAA 4IZHA 5IAAA 4NU6A 3OP4A 3VPGA 4DBZA 3I9OA 3TOZA 3WBBA 2HJSA 4Y8VA 3AW9A 1VJ1A 1Q7BA 3ZDFA 3FR8A 3G79A 3IJPA 3MOIA 4OOEA 5GZ6A 1U28A 5BNTA 3H3JA 3B70A 1WMAA 5I8WA 1Z73A 3RKRA 2PA3A 3QVWA 3JQDA 2EXXA 5DP2A 5DOVA 1P1FA 4FBGA 1B3BA 1J49A 1PQWA 3CMMA 1YE3A 4ZQHA 3EYWA 3GUYA 4OSOA 4CM4A 4S3MA 2VWGA 3W8EA 2NNLD 3QY9A 3S55A 1YH3A 4K1LA 4AL4A 2B4TO 4MIEA 1CERA 5EN4A 3ETEA 1PGNA 2OP1A 5F5LA 4R5HA 2JKVA 2IODA 3E9NA 1LDGA 5FI3A 1M6HA 4EBFA 4RZIA 4XGNA 3WWZA 3PI7A 4LRSB 3RUIA 4L9RA 3VVCA 3OJEA 4E6PA 5ILGA 4FGWA 4RLHA 3TDKA 4A03A 3HDHA 5TC4A 1R4NA 2WYWA 4MVJI 4ND4A 1U4OA 1U8FO 2O3JA 1B8PA 3PJEA 3OETA 3ZNQA 2H63A 2VHYA 2VUSA 3PGJA 2VT3A 1WDKA 4XQGA 5B4UA 1QLHA 1S7CA 3FNEA 2C5EA 3KB6A 2QRKA 3BTSA 2IXAA 3V2UA 3RFVA 4A73A 2O23A 1E3WA 5B4TA 2HRBA 3OECA 5DP1A 3UCEA 4CMKA 5LC1A 3RROA 1QRRA 3B1FA 4CQMB 1V6AA 2W98A 3OA2A 1PS9A 3CE6A 4YAEA 1LRKA 1B8UA 1MG5A 2XOXA 2ZJ0A 3JQGA 1MXHA 3NUGA 2C82A 2GERA 5TNXA 2J5KA 4PLZA 4CPDA 2D0IA 4D43A 3DONA 1EVIA 4CR6A 1K6IA 4YPOA 4BGUA 6ADHA 3H3FA 1BW9B 2HMTA 5DNAA 3K2BA 4PLTA 5A4DA 9LDBA 1DHTA 4BQPA 1O94A 1UXKA 1V35A 4RPGA 2RH4A 5ER6A 5HWSA 4UUPA 2W2KA 3SJ7A 3PQDA 1OOEA 5TGDA 3ETGA 3AWDA 3K5PA 4RZHA 3S1LA 3PJDA 3OEYA 1F17A 4CR8A 4EUEA 3PJGA 3GUCA 3HB4X 2BI7A 1GV1A 4I5FA 4YACA 1DRUA 5KJ6A 4GAEA 3IJRA 4ZJUA 4PG5A 4DC0A 1M76A 3RUDA 5CG2A 5JCJD 1DRVA 3VAZA 2VTEA 2YV3A 1BTOA 4ZHSA 2FN7A 3CZMA 1I33A 3DMTC 3VZQA 3DBHB 2EKQA 5EQDA 3WQSB 4NIMA 4R3NA 1WZEA 4B3JA 2PNFA 3AJRA 4RQUA 3BTOA 1NHGA 3BZUA 3PVZA 2NVUB 1U5AA 4WLNA 2NU7A 4PFJA 1HE2A 4YJGA 1XELA 5FEUA 4E2ZA 5TT0A 2OXIA 4W99A 1LC0A 2GN6A 3D3WA 4ZQGA 4AG3A 3DEYX 3OFSA 2QQ5A 4JGBA 3DMTA 4GX5A 2WD8A 1XKQA 4K28A 4O0LA 4B7XA 3SLGA 2IZZA 1P77A 4KUEA 4HFMA 4DPKA 3CXRA 1NQAO 5DCWA 4NBRA 5C7IO 5LCXA 4RLSA 1DC5A 4Y6RA 1ISIA 2VYND 3JYPA 1R6DA 1NNUA 4MP3A 4BO5A 1ZK2A 2JCVA 1EDZA 3WDSA 1PGQA 4WGGA 4J6FA 1SB9A 2R6JA 5HRUA 3H8VA 4D0SA 2EV9A 5G0TA 2IEBA 2FPIA 1PGJA 3FR7A 4E31A 1A9YA 5JCXA 2OOSA 1E1LA 1YBVA 4FPXA 4H3VA 2QHXA 4IMPA 4NFYA 2VZ8A 2B0JA 3R3SA 3UVEA 4BIIA 5GMOA 5A06A 1GPJA 5L51A 1YJ8A 3S2FA 3R0IA 4FFOA 3MEQA 1UXGA 2X0NA 3FPLA 3OQ6A 4AJHA 4KQXA 4NFHA 1DHRA 2UVDA 3JQ8B 4UUOA 4OO3A 1KEVA 3AM5A 2VHXA 3Q9UA 3IUPA 3KLPX 5IZ4A 4IS3A 2O7QA 1N2SA 3G3EA 4TZTA 1YBAA 3DC2A 1E7RA 3E6AA 3HDJA 4LMPA 4DA9A 2QZZA 4CQMA 4Z9YA 4GI2A 4YT8A 3NTQA 3ZWPA 5BSEA 2PZMA 3CMCO 4PLVA 1BVUA 4KDFA 4ZQEA 4PLPA 3WNVA 5KNLA 4KTVE 3O4RA 3CH6A 4BNVA 3FWZA 4FSHA 4WK6A 4DYDA 4P4GA 5T57A 1N92A 1F0YA 3ZWVA 3JYOA 4NJMA 3RJ5A 1JDJA 1SPXA 1FDVA 1PGOA 4IM7A 2OORA 3GAFA 5B1YA 1GY8A 4W4TA 3QRWA 3GDOA 1NXQA 5GY7A 3WGIA 4N54A 4OH1A 2BHLA 3JQ7A 1PJQA 2NTVA 3HADA 5CHEA 3FRJA 3B20A 1DRWA 1GL3A 5CDGA 3LK7A 5A04A 4JLWA 1Q2XA 3EVTA 2VHWA 3X2FA 2RHCA 1T1RA 3JD3A 3BTUA 5TRTA 1KVRA 3ZV3A 1Y8QA 2FR1A 2IE0A 3GMDA 4RPHA 3P2OA 1UP4A 3JD4A 4TWRA 5DBIA 3PHGA 3HNPA 3JQAD 4FJ1A 2Y1OA 5JO0A 1JWBB 3DFZA 5C7LO 2G76A 5L53A 3WGQA 1C14A 2DPGA 2X6TA 4I9UA 5JC8A 1AE1A 3I83A 4HX5A 4BGEA 3F5SA 1T26A 1O8CA 5DT9A 1G6KA 2J3IA 4ZN6A 2BGMA 3BIOA 3IP3A 1QV6A 2G17A 3W6ZA 2V6FA 5BSFA 1Y6JA 1E6EA 1EK6A 1MXFA 4J7UA 1IZ9A 4BGVA 3KOUA 2PGJA 1N1GA 4BMNA 4YAGA 1R37A 2J5QA 3Q6IA 1A7AA 4D79A 1UZLA 2JHFA 2V65A 1KC1A 1H6BA 2WE7A 4BNHA 4CM8B 2PKQP 4D41A 4RPJA 3VDRA 2Y0EA 3GDGA 1D8AA 3H9EO 3OMLA 4NBVA 2NWQA 1HTBA 3ZGYA 4BNZA 3PIDA 4PGFA 1EVYA 3DB2A 5CPBA 2C2XA 1IPFA 3K73O 3PXXA 1DDOA 3QE3A 4IJWA 4B3IA 4NI5A 4OKNA 2C5AA 1O89A 3OQ1A 1CQIA 4MPDA 3IC5A 1KC3A 1GPDG 1TT5B 2GN4A 4DQVA 4B4UA 1HXHA 4MP8A 3DBVO 3KZVA 1JAXA 3CPSA 4UREA 5IDXA 2BFPA 2P9CA 3GNQA 3L07A 1JKIA 4I5EA 3Q9NA 3DMYA 2B36A 1AXGA 3VKUA 4CMJA 3SX2A 3UN1A 5ADHA 1MP0A 1PJ3A 2F00A 4BO1A 3TL3A 3DZFA 4BO3A 1HSOA 3F1KA 2RIRA 1J0XO 1PQUA 3ZV4A 5EPOA 1HYEA 4ND5A 1I01A 3QHAA 2AE1A 3KRTA 5L7TA 4IBOA 1YJQA 4F46A 4FFMA 2NUAA 3FBGA 1SOWA 2GPTA 4IJUA 1O9BA 5I9LA 1HLDA 4GLOA 3L6EA 2Z1NA 4XX0A 4BS9A 3BTVA 1K0UA 1DAPA 3NAQA 3K30A 2H1SA 4GGPA 3H6KA 1EUDA 2VN8A 2YV1A 5FF9A 3P7MA 1U3UA 1GYRA 1C1DB 3M1AA 1M2WA 3FWNA 4J7CA 4OXYA 5FFFA 1ZW1A 3F9IA 1SEPA 4Z0TA 1NR7A 3W8FA 1DFIA 1I30A 2Q2VA 2UUOA 3V2HA 3AOGA 1ORRA 5ILOA 2LDXA 1N9GB 2EJWA 5BNFA 3GGGA 2DVMA 1JWAB 4EDFA 5L4LA 2B4QA 2EKPA 2ZATA 4J0FA 1B3RA 3AUTA 2WE8A 1IHYA 4UUMA 4XEHA 2O2YA 4WEOA 1R66A 1O95A 5EESA 3KYDB 2JD0A 1SZJG 3QP9A 1YKFA 1I3NA 4KWHA 1F14A 1C1XB 4OYRA 4JIGA 1UDBA 1ML3A 2Q1WA 1TI7A 3QWHA 3MJEA 2HU2A 2W2LD 3LT4A 2BD0A 3KHUA 3L9XA 3UGKA 1KIFA 5EINA 1S6YA 5G2OA 1LC3A 3WIDA 1PJLA 3C3XA 2P9GA 8LDHA 1DC4A 1YOVA 4HFJA 1H5QA 3IQDB 4YT4A 4IDCA 3GG9A 3NT4A 4CODB 4TVBA 2DBZA 4LGVA 3D5TA 1DJQA 2VCYA 3KXDA 4Y98A 3VPXA 2I3GA 2ZJ1A 1KYQA 1N1EA 1CRWG 3GA0A 1E7YA 3JQAA 4DBVO 4QEDA 5KVQA 3WLFA 3KBOA 2J5RA 2VNAA 4L8VA 2O4CA 4UVEA 1GD1O 1ZXLA 4GX2A 3K96A 2HMUA 1JU9A 1E1MA 4RF2A 2ZYGA 4PLCA 4M1QA 4O1MA 1KOLA 4BV8A 5T64A 4YQYA 2POQX 1GEEA 2O3SA 2NQTA 4R1SA 1XLTA 4JJGA 2B5WA 3E48A 2Z95A 4XYMA 4DLLA 4DREA 1CDOA 5TLSA 4GMGA 1NM5A 3GVPA 3BHIA 4CM8A 1W8DA 2WEKA 1T2CA 3K92A 1NPYA 2AA3A 1H9AA 4F45A 4XYGA 1N5DA 4BNGA 3GR6A 2I66A 4WNCA 3F4LA 1ZK0A 5C5IA 1FDWA 1WW8A 6LDHA 1EQ2A 1TA4A 1H6DA 2DQ4A 5A5EA 1ZH8A 2I5PO 3HN7A 1LSOA 3TSCA 3ROPA 3I23A 2IXBA 1TT5A 3WGGA 5AQ1A 3KO8A 2O7SA 1Z7BA 5EL0A 4ROSA 2JFHA 4AJLA 3T7CA 1EBUA 1OC4A 1DIRA 3H9UA 5JW6A 5MDHA 2BF7A 4YVFA 4FC6A 5KTKA 1A4IA 1A9ZA 4QFCA 3JD2A 5EIOA 1ZIDA 1KVUA 4EZBA 1IB6A 1L7EA 1MX3A 5G4LA 3NDIA 4CM6A 1MFPA 1X7DA 4ESOA 1X7HA 4UEOA 3VTFA 5T67A 3WYEA 4JBGA 1DIBA 3PHIA 2RHRA 1MC4A 4YRDA 5JYEA 1B2LA 3ULKA 2X58A 1EBFA 1I2CA 5A9SB 2Q50A 2JAHA 1IL0A 1E1NA 4F6CA 1KVQA 1Z74A 2BGKA 4XJSA 2VZ0A 4TKMA 1QORA 2AG8A 1HRDA 2I6TA 3BMCA 1X1EA 4CUKA 2Q99A 4RV9A 3ZU2A 2DUWA 1XDWA 5THKA 3HUDA 3ADOA 2HK7A 3DQPA 2P9EA 2PLAA 5IDYA 1M66A 3TQHA 3NEPX 4CM5A 1R4MA 1LLCA 4JX8A 3F47A 5JS6A 4E3ZA 1MA0A 1Z7EA 4Z9FA 3GGOA 4TKLA 4XDYA 4HNGA 4DTIA 4YT2A 1U4SA 3K6JA 4ALJA 4XGKA 5U9CA 4CMAA 1D7OA 2P4HX 3QA9A 4IS2A 4UEKA 4GKBA 2EJVA 4B8WA 3WJAA 2W8ZA 2EW8A 1D3AA 1JAYA 1UH5A 3AI2A 4CV2A 2UYYA 2VHZA 1GQYA 2NSDA 5G0UA 2X5OA 3KSDO 1I5RA 2B4RO 4JROA 3KYBA 4PG8A 4Q3BA 1P3DA 2X86A 5CEEA 1C1XA 2GCGA 4PLYA 3LC7O 2X9VA 4MVJD 1XR3A 4BGIA 3E9QA 5C37A 2F1KA 2V6MA 2D3TA 5JE8A 1Q7GA 2IRWA 4R3WA 3WIEA 1V3UA 1KVSA 2CD9A 1J5PA 2QG4A 3DFUA 4A2CA 2P68A 1U8XX 4FR5A 1HDCA 5ENDA 5FI5A 4NK5A 1PEDA 4CLEA 5U4QA 4DUPA 1FJHA 4RPLA 4Q3DA 3FF4A 3O8QB 2O4UX 3G49A 2EGGA 3JYQA 4G65A 3DAGA 3EAGA 2Y66A 3L77A 1U7HA 5A3VA 2FRDA 1Q0QA 5JAQA 3ZHYA 2RAFA 4YJHB 3WGTA 2X9NA 4ALMA 4E30A 3UAGA 4YJDA 4YAIA 4OL9A 1YDEA 4CJXA 4D44A 3UHAA 1X0VA 4O63O 5AXBA 4FFLA 4EEZA 5IZCC 5DBGA 2JJYA 3C1TA 4DQUA 2FSVA 4AVYA 3KETA 1E3SA 4M49A 5I9NA 4PLHA 3WTBA 3FN4A 5ER9A 1Y1PA 4Y6PA 1WP4A 1RPNA 1ISMA 1HDGO 5L4NA 1EUCA 2Q2WA 3VPFA 2VRBA 4MDHA 3DBLB 3NX4A 4EITA 2E37A 1X14A 3DAFA 1RYEA 4R1TA 4PIVA 2PD4A 3WXBA 4GSKA 4RDIA 4D42A 4HXYA 4XR4A 3TPCA 5IZCA 3GQVA 2PZLA 1JQBA 3S2GA 2Y1DA 2C7GA 4CM1A 1WXDA 4CL8A 3ZV5A 3OHSX 3TN7A 4BKUA 1QYVA 5ITVA 2NLOA 7MDHA 4Z6KA 1F8FA 1NFQA 2X7HA 4MVJG 3LSYA 3VH1A 2LDBA 3D5QA 1CIVA 4FQ8A 5A9RA 1BXGA 4IGFA 5A02A 4YWJA 5IJZA 4L73A 2Q45A 4AJJA 4B3HA 3E1KA 1EE2A 4URFA 3GG2A 3GPIA 3DL2A 3MJCA 2A9FA 2D8AA 3BMOB 1LEHA 4UVDA 1WZIA 1T2EA 1AHIA 2GN8A 4MVJH 1UDAA 2PH3A 3EVNA 3ZU4A 3VH4A 4IDAA 3RBXA 1ZSYA 4K6CA 4WUVA 4WJZA 4F6LA 2YY7A 3DR3A 2SCUA 3ONEA 1KY4A 4XZ3A 1J4AA 1GZ4A 2Y05A 3ZH2A 1K3TA 4N5MA 2C29D 1OC2A 3U0BA 1TT7A 2OGUA 1V8BA 1GDHA 3E8XA 3HQ4O 4JBHA 3GEDA 3U4IA 3JQ9C 4FN4A 4CQMD 1PJBA 1B26A 1VKOA 3PYXA 3AU9A 4R01A 2OMEA 4RQTA 1RM3A 1IULA 4OQZA 4L75A 2AW5A 4N7RA 3C8MA 4EW6A 1EZ4A 1IOLA 3WG9A 4BKOA 3B6ZA 2ZTMA 3AM3A 4D3SA 5LDHA 3BA1A 4FJ2A 2AEMA 1EFLA 1C3VA 3JQ9A 1L7DA 3K31A 4Z9XA 1AN9A 2VYVD 2VWQA 3JYLA 1PZFA 2VQ3A 4NR0A 4XYEA 1PS0A 5CDSA 1W73A 3E9MA 3C24A 3JQEA 1E6UA 2PFGA 4A10A 2B83A 4E21A 3LC2O 4YJFA 5L3ZA 3GVIA 4XGIA 1ZEMA 2GF2A 2HAEA 2ZB4A 1GZ3A 4N18A 2DFDA 4HP8A 4LMRA 1EEHA 1DC3A 1WNTA 4QO7A 2H5LA 1YONA 4J1TA 1RWBA 4MVJA 3GMSA 1ZNQO 3EHEA 3I9JA 3PIIA 4D46A 1TXGA 1DLJA 4ZD6A 1LQUA 3KYCB 4B79A 2O3QA 1DFGA 5JAZA 3U4CA 1XQ1A 2EF1A 1H93A 1G0NA 2BFAA 2BMAA 2WM3A 1XSEA 3T4EA 3NTRA 1B7GO 3L4BC 3U49A 4D3FA 3VKVA 5AXCA 1NP3A 2J3JA 3QVXA 3HE3A 4WKGA 4AJIA 3RBVA 2JL1A 1NHWA 3WQQA 2EP7A 1JLLA 1T2FA 2DLDA 3ON5A 4B4VA 4CMIB 2FPPA 3GRKA 1O0SA 1Y7TA 4BNWA 3N58A 4WLUA 4YJHA 4QQRA 2XAAA 4JBIA 2J3HA 1UAGA 3L4BA 3DTTA 3SJUA 1LRJA 3VH3A 4JJIA 3LC1O 3WYBA 2VTDA 3P2YA 3HWRA 1NWCA 3H2ZA 4OJNA 1MB4A 4RDHA 5CDYA 1TEHA 1IE3A 1U2DA 3EZLA 1PJ2A 2WYUA 3D64A 2NVWA 2Q1UA 3H9QA 3FNFA 1VE9A 3DBLA 5HBRA 2BFOA 1Y8RB 3A9WA 2C0CA 4O5OA 2VNSA 4NBWA 1LBEA 3AOEC 2WSBA 3WGYA 5KCZA 4AJPA 4WCFB 2CNBA 3MCVA 1HF3A 3LZ6A 4XCVA 5KJCA 4FDAA 2A92A 3N74A 1H94A 5GZ1A 2NTJA 4UVIA 4QXMA 3SVTA 3LLSA 3LT2A 2ZK7A 3E03A 4MJLA 3HFGA 1JA9A 5F1KA 1BG6A 1CQJA 3L0DA 1E7WA 1JW9B 2I99A 1I3LA 5BSGA 3AOEA 3SXPA 3OM9A 2CVOA 1GUYA 2BKAA 3PJFA 1XYGA 1LRLA 1NFFA 1I10A 5I7SA 3I9NA 4LK3A 4RF3A 5TS3A 3ENNA 4BO8A 3GN1A 1SNYA 3QWFA 4LW8A 1M6WA 1YXMA 2A35A 4H16A 2VUTA 3ZWBA 2NVBA 4PLFA 3U3XA 2VUUA 3IAHA 1LDEA 3D4OA 3U4HA 3DZHA 1IY8A 3ITKA 3RKUA 4YAKA 4NHEA 2I3AA 3BHMA 4RVHA 3L4SO 1ENOA 3K9QO 3Q0EA 3UH1A 2AG5A 3MJSA 2EERA 1R12A 3COSA 3JQBC 4MIYA 1XGKA 5L7YA 5BNIA 2X0RA 4JQCA 4J0EA 1U3VA 4BB5A 2DKNA 2D5CA 1GYQA 2YFHA 2CF5A 2JD2A 3FHLA 2B5VA 3RBZA 3MTGA 3PHLA 3IKVA 5CPFA 1A4UA 4XIYA 4HY3A 5CP8A 4ONEA 3UOGA 1MUUA 5KVSA 1E1KA 4UUNA 3JQBA 4BNXA 4CM3A 3AK4A 5I8ZA 1PR3A 3OBBA 1K5HA 3ZHZA 4NBTA 1BXZA 2BRUA 1GV0A 3OJLA 1RM4A 1TB4A 1P33A 2DT5A 4D0RA 2VYVA 3W1VA 1VSVA 3OH8A 2ZB7A 4E0BA 1ID1A 5DN9A 3WQRA 4EGFA 1BW9A 2O2SA 1PJ4A 4FFRA 4BL5A 3H9JA 2Q2QA 3WSWA 4BNJA 4DPLA 4GGOA 4GL4A 3UXYA 4BNMA 5EJ2A 3G0OA 1OFGA 4PG6A 5DOZA 2X8LA 3OJFA 1YQGA 3ZCXA 1E7QA 5EMHA 4BO7A 4BHTA 4R54A 3C1OA 3DHEA 1X0XA 1ULUA 1DJNA 4OOFA 4FFPA 1IYZA 3DZJA 2X9GA 4N5LA 3TJRA 1BDBA 1K2WA 5GZ3A 3WICA 1ISGA 4J9UE 1VRWA 1E5LA 2NU8A 4PG7A 4CMCA 5DULA 2Y93A 4OAQA 3CZRA 4BOYA 1ADFA 3ZV6A 4NPCA 2EP5A 1NQOA 4IINA 3H4VA 2W90A 1UXJA 3V1TC 1E92A 9LDTA 4Z0HO 3GZNB 3ASVA 4CMIA 1Y5RA 3KEOA 3DBHA 3I4FA 1P74A 2O3TA 4KMSA 1I0ZA 4WOKA 3ZNNA 1XEAA 3AI3A 3QWAA 3NGLA 2NVUA 4FGSA 2ZTLA 1HDXA 1P0FA 1ISJA 3PK0A 4IQ8A 4GX1A 4J16A 5I7FA 1GQ2A 3GNTA 5BQFA 2GLXA 2AXQA 2VRCD 3FD8A 4P22A 3S2IA 1BVRA 1HDZA 1OI7A 2Y67A 5B12A 2AQIA 3AFNA 1Z6ZA 3D0OA 5L9AA 1BWSA 2CF6A 4LN1A 2YHIB 1ADBA 3ROKA 1WDMA 2NM0A 2TMGA 3PRJA 4YT5A 4ZRMA 4IDDA 4RVSA 3OIDA 3H7AA 2P4QA 4XRRA 3W4KA 3WTCA 3KUXA 3GHYA 3ZHXA 3I6IA 3ZI0A 4U5QA 1P1IA 1YS4A 1Z45A 3RFTA 3DOCA 2C20A 5HA5A 1E7MA 3PYMA 3ZN2A 1HT0A 1IPEA 3ADPA 3GN2A 3CEAA 4IDEA 4A0SA 1LSUA 4IGEA 4KDEA 3WOHA 1GAEO 4A5OA 2NV6A 3OICA 4FOSA 4PLGA 4MKZA 1FMCA 1DXYA 3TNLA 3DBRB 4BQRA 4DXHA 1HSZA 1P1RA 4CLRB 4E5PA 5JYDA 2E82A 2YDYA 4CL3A 1GCOA 3QWBA 4WPGA 4RJTA 4MP6A 4PLWA 2DTEA 2JFFA 1NFRA 1V0JA 1QXSA 5BT9A 5U1PA 4WE3A 2FOIA 5A03A 2P5UA 3RQSA 1NQTA 3CUKA 3DHYA 3PZBA 4NFSA 1ENYA 4PZCA 4R68A 3GF4A 2FWMX 4J43A 1LU9A 3PWSA 2RH8A 2FMUA 3QQPA 1IHXA 2ZB3A 5EERA 4CV1A 1I36A 3JQ8A 3U4DA 2BGLA 2EKLA 1PTJA 3ST7A 3IIEA 2P5YA 3MJ4A 4YRAA 3RUEA 1VJ0A 2AEJA 1UXIA 3TWOA 2EHDA 1DEHA 2FR0A 5T8KC 1HYHA 1QYXA 3AY7A 3VZPA 5KIAA 2CZCA 2HMSA 4JK3A 3VPSA 4GPD1 2GN9A 1I3KA 3GY0A 2G1UA 3JTMA 4KUGA 4B8ZA 4GBJA 1DC6A 1DIHA 5CFZA 1HLPA 3GDFA 5T5QA 4EI2A 1E77A 4WLVA 1RYDA 4EEXA 4JCOA 1JVSA 3NJ8A 3HZZA 3MTJA 3PWZA 1T4DA 4IMRA 1B14A 2HMVA 4Z3KA 4HNHA 2X5JO 1NQ5A 5T8KA 4RVUA 4U8GA 1NPDA 1A27A 3I9KA 3ZWNA 4E12A 1FDSA 3TRIA 2Y68A 3WR5A 3QWIA 4KWIA 3TF5A 5JLAA 2P91A 4EJ0A 2YYYA 3H2SA 4Z0PA 1BGVA 2OP0A 1Z75A 2D1YA 2IZ0A 2IZ1A 3GEGA 4GVXA 4U0JA 1K6XA 4OQYA 4HADA 2GZ2A 4BKQA 1EK5A 3H5AA 4WLEA 3TZQA 5F21A 1KY5A 1WDLA 3GT0A 1H2HA 3H65A 4XB1A 4ZVVA 1PJSA 5KVCA 4I8XA 3JQ6A 3PZRA 4R5MA 2YHUA 4QFDA 3AY6A 1CEQA 5JMPA 4DL9A 5DF1A 2WMDA 3I5MA 4Y6SA 4FIZA 4GSLA 4M86A 3V2GA 2PZJA 1NPTO 4J3FA 3FPCA 3FTPA 1PSDA 1YRLA 4L4RA 1ZBQA 2Z5LA 2ZQYA 2FHSA 2OL4A 4R1UA 1U5CA 1BRMA 4C7JA 4L74A 1EUZA 4TRMA 4XQ9A 5FYDA 4TRJA 4HUJA 2QYSA 5KJFA 1YGYA 4PCVA 3U62A 3O9ZA 1CWUA 3LLVA 1XHLA 4K9DA 3ZWAA 4I9HA 4C7KA 3CKYA 1QYDA 5DZSA 1F8GA 3M2TA 3EGOA 2IEDA 2VRCA 3RC7A 4YYZA 1LLDA 3HN2A 3I9LA 3HSKA 4R16A 4AJ1A 2RBEA 2B37A 4CMEC 5JC1A 1EMDA 4MVJP 5ITWA 1U3WA 1T2DA 5CEJA 3BHJA 4E2YA 4XRGA 3T7EA 1SO8A 4OHUA 3TZHA 2BH9A 3KM0A 1EDOA 3ICPA 2E49A 4U6SA 1JVBA 2BI8A 3RUFA 3AUUA 4WLOA 1AXEA 1VM6A 4R51A 2ZYAA 1NTOA 3VVBA 4ALIA 2AQ8A 4IXTA 3MZ0A 4CMEA 4NU5A 5F5NA 5K9ZA 4W7HA 1VLLA 2IYPA 4UEJA 3IP1A 1ZXBA 2DU8A 2D5AA 1AHHA 2GYYA 4BO9A 2PTGA 3C85A 2EIHA 1YB4A 3SC6A 3T4XA 1YB1A 2QRLA 4CV0A 1C0IA 3RUAA 1VJTA 4CM4B 4CLRA 4K26A 1VPDA 5AOVA 4YCAA 2VWPA 1BDMA 1GR0A 1HZJA 1I3MA 4DIBA 1EVZA 2DBQA 2AE2A 2UAGA 4RF4A 5CG1A 1GADO 4NJOA 4KP7A 2V7PA 4W9NC 1QYWA 2PY6A 1DAOA 5DDIP 3O26A 3H9GA 2HRZA 2QIOA 2GZ3A 1DIAA 1LX6A 5G0WA 1GEGA 4BB6A 4BNTA 1LSJA 4OGWA 2J8ZA 3RWBA 1HE3A 1C1DA 1R4NB 5DCUA 2P2SA 4OIMA 3R1IA 2ILTA 4UULA 1QMGA 3RI3A 3GFGA 3ANMA 1T4BA 4W9NA 3MJTA 4AJOA 2O3UA 1LA2A 4INAA 1ADCA 2H6EA 3ZU3A 1N9GA 5CAEA 1BSVA 1ADGA 3NV9A 3PGXA 4CLXA 3DZBA 1E3WB 2CY0A 2C2YA 5BSHA 5KWEA 2DBRA 3A1NA 4BKPA 1P1JA 3DXFA 1Z82A 3SC4A 1E3EA 1R0KA 2HK9A 1FDUA 3KYDA 3IS3A 4XYLA 4M55A 3I6QA
chains in the Genus database with same CATH superfamily
2JVIA 2A86A 2EW1A 2Z4RA 4J07A 5A7FA 2E85A 2P7HA 1C8BA 4R40A 3USES 9ABPA 3KU4A 2GUGA 2ID8A 2X6RA 2H06A 2Q9BA 5E2AA 4AJ9A 4AX8A 5CCEA 3BWXA 4XWWA 1XRRA 1F5SA 2QY9A 3FOAA 4BLPA 4C89A 2IS2A 4DRZA 1PTKA 2NXJA 4NPAA 2AWOA 3BAZA 3GNSA 1R0CA 4Y2SA 5CDUA 1AGNA 3DLAA 3QVMA 4LHVA 4NCIA 1Q1AA 4BCBA 3AVXA 1RP7A 4HRYA 2J9RA 1LNSA 1Y8CA 4W63A 4H15A 3TW0A 3H86A 2W11A 3PQ5A 4MAAA 1VP9A 3K16A 4QOHA 3KJIA 2RKWA 2NQ8A 3K3PA 5I9MA 5A5FA 1Q1NA 3FUXA 4INOA 3E2MA 1J09A 5EFZA 1RVV1 4JVSB 4NRDA 2LE0A 3H83A 1N2GA 2IEGA 1NSYA 3TNYA 2E6UX 2GRAA 1T10A 2HMWA 3L82B 4FWIB 1DJPA 1GQQA 1UR5A 4E6EA 2ZVDA 4LSZA 3QIVA 3ZWOA 5T6BA 2GPNA 2WUWE 2Y8EA 3VBCA 5B7GA 2HCRA 4OMUA 1ORDA 1KAHA 1B15A 2CVQA 5HIKA 5IG2A 2YJNA 3TEMA 1T5LA 4PZDA 1HKUA 4UFOA 5CT5A 5REQB 2WJPA 1AQ6A 4P31A 4E33A 4QOEA 1U7UA 2CLLB 3F6BX 3ILVA 4R1OA 4YPVA 1RYMA 1LBHA 3C2QA 5EHIA 5HFAA 4HJRA 3UHFA 5JXGA 4AX4A 1G9SA 1CUUA 1GGHA 2R1UA 4OQFA 4C78A 2P6RA 1I51A 3CN9A 4JB3A 4NEQA 1UMDA 5CB4F 1TC2A 2BFEA 3E82A 2LCIA 3B13B 4BB9A 1RZ3A 1ECCA 4O59O 5FKJA 1CK4A 2R751 3N05A 3NAMA 1VG9B 1BWQA 1YJCA 1K9VF 2VZEA 1KVTA 3NHWA 2NU7B 4GXQA 4Y6LA 1ZO8A 2QW1A 3SP1A 4G2NA 1SVWA 2QN7A 4WY5A 2O0KA 3CZQA 4P54A 3T54A 3KR1A 3TK1A 3ZBPA 4CUZA 3D3WB 4OJKA 1LLFA 2G25A 3BSFA 1B23P 1ENZA 3GGCA 4E2XA 1Y9AA 3WLOA 2V55B 2YR0A 2ZJ6A 2CFCA 3VZRA 3HYTA 1WIWA 2X5KO 1QM5A 2P2DA 3JAKA 3FKSA 1V9SA 5A5DA 2ZQZA 1HX7A 2HPHA 3A6LA 2JAPA 2Q4EA 1NU8A 4ECEA 5KB3A 3TIXB 5H82A 3QBVA 4PPQA 4W8OA 1NRIA 1Y1LA 2OKGA 1EFVA 1RM5A 1Y81A 3DZ8A 1R6BX 1YL6A 1W6RA 3I0ZA 3VHLB 2E48A 2PUBA 2JLVA 3RD5A 3RPEA 5EGNA 4BZPA 2Q5CA 3AVQA 3KKZA 4DG9A 3CVWA 3CQ9A 3U7FB 4LCEA 5K0JA 1TX4B 3HDQA 1UBJS 1G63A 1GNSA 3I3OA 3VR4D 1S3GA 1U0HC 2XW6A 1NVGA 3RRZA 4DR4B 1QRAA 3RS7A 1OWMA 2WTBA 3BCRA 3G2QA 1KEUA 1Q3HA 2XOKD 1BJKA 3OIGA 2FGJA 1ESNA 2XKKA 3L7MA 3LSTA 3I01M 3A10A 3LQ1A 5A9SA 1CZKA 4ZCRA 5B6PA 1I32A 5JAIA 3AF4A 1M72A 3OQMA 1SKYE 1FFEA 3ND7A 5LLSA 2AMFA 1ONPA 5CH3A 4YMVA 3VU0A 1U9JA 2QRJA 3I4LA 4DLPA 4JC5A 2FUG1 3RRXA 4GZ6A 5AKKA 3ZY4A 2YYSA 1L4NA 4ZZIA 1NE7A 2PKRA 3VX4A 4TV8F 2YFQA 2VLBA 3Q7RA 1EWYA 2B2XA 1ZX1A 2EW2A 3KDPA 5JQGA 1R6VA 2XUPA 1KH3A 4FWTA 1PR9A 5IHXA 1L5VA 2J6BA 4MYHA 3RC2A 3RSLA 3TFQA 3GBPA 3PDUA 5ES4B 4YA6A 4DRYA 4RWZA 2IU3A 3UGQA 2HLDA 1XTQA 1VZ2A 3MINA 3OKAA 3ZZ0A 1V6CA 5ALXA 2V8OA 2GAIA 3BQ9A 4Q9NA 5AVZA 4LXIA 4V0ME 5K8CA 2A14A 5FB3A 4JEIA 5FR1A 1CY8A 4JYZA 1NI4B 2ZRNA 1C4WA 3BGIA 1HETA 1ESEA 4Z1MD 1XL1A 4EUFA 3E3LA 3DAPA 3ZH9B 5ALNA 4HXFB 1RZVA 1OI2A 1TVKA 3A3OA 5DPMA 3EVAA 5DSTA 3LOUA 4RCYA 4TMXA 3V5NA 5GONB 2IYRA 2FQQA 5HEKA 3KOZA 3LIIA 2G9QA 1P5JA 3NHLA 1ONSA 3RS5A 2OD9A 2JIBA 3WMEA 2WJHA 1H2XA 1KO8A 3SWWA 2GZAA 2MSLA 4AYXA 5K6AA 2LPMA 3EA5A 2ROQA 3LVRE 4DZZA 1MDFA 2OO5A 4R2KA 3AEKB 1RKXA 2OFPA 3AF0A 4OXKA 4EHIA 5CA1A 5HRCA 5JBIA 5JNVA 4BY9E 3ZWMA 3WRXA 1J8MF 1ZRHA 1HL3A 3RIMA 4E7OA 4ITUA 1UOOA 3U40A 4AC9A 1DU4A 1TJNA 3PHHA 4NJMB 5AVXA 3ZBTA 1C9DB 3JQCA 3Q88A 1XHFA 4ZODA 2YW9A 5FUYA 3UKOA 5K8IA 1I7SB 4OQ4A 1PGPA 2OQ2A 5JZVA 3BB3A 4LWQA 1MH1A 2I3DA 5ALIA 4Z3DA 1R16A 3FX2A 5CYOA 4J2HA 4MJXA 1SCQA 3JQ7B 2W2OA 3AUAA 3NDRA 2C2BA 1Q6YA 4B2IA 1F6DA 5KNBD 3KQVA 3RCBA 5E3HA 3KTDA 4Y7CA 1KEWA 1CUWA 1ECPA 4OHFA 3R7FA 1YQDA 2WNSA 4QYTA 3EH1A 1IN8A 1OFUX 3KE9A 3NYWA 3Q3EA 1FUKA 3P5SA 3AVPA 3WK4A 1RWVA 2W6JA 3ET4A 4INPA 1VL6A 4KGVA 2KS6A 3ADKA 4RL4A 4ZRNA 2JZCA 4HDKA 3VOTA 5TMEA 1TM1E 2C7VA 2CCJA 3UBTA 1EFDN 4GT1A 4Q9LA 2AQKA 3OEEA 4P3KA 3UT0A 3CN7A 3WK6A 1NW6A 2D5BA 4GS5A 2YQ4A 1FE8A 3VI4B 5CVCA 4EYEA 1YQXA 5L40A 1H4TA 1M1YA 3EDYA 3ELBA 4YBZA 3KVOA 2LR0A 1FMLA 2G1AA 2R6DA 4HC4A 5HDBB 4FK8A 4K8RB 2OCAA 4YJKA 3OSUA 4WFIA 1CJMA 1NBWB 1NQWA 1V7PC 2ZJFA 3EDMA 1YVPA 2ECFA 1DT3A 4N5IX 5DCLA 1X87A 3AO0B 3AXSA 3RNLA 2XNJA 3TZBA 1SKMA 4TRNA 1IJFA 3SHFA 3RTGA 2G0NA 4GPEA 2VPQA 2Q3CA 2VT2A 2PD6A 4KGZA 1J25A 3UT5B 5CLJA 5IJ0A 2F67A 3FCAA 1Z5ZA 4C6TA 3C5EA 6GPBA 4WNIA 5B1IA 3RVDA 1OF1A 3AUJB 4GPZA 3FTFA 1M6EX 3CCBA 3EF1A 1E4VA 1U31A 5JFTA 2M6LA 3LUDA 3Q7PA 4HQNA 3FCOA 4N12A 5A4MS 4EOGA 5EWLB 3W4IA 5KYWB 1WKBA 2DKFA 3KB1A 4GZ5A 3E7WA 4L76A 5COBA 4RTRA 3LMKA 5BOSA 1K06A 1XCBA 2HV9A 2ZI6A 4JLJA 4FNMA 3QU4A 4J1NA 1ZM7A 1F3LA 2WV9A 2VUHB 3R4CA 4Q9JA 2ZAIA 3GGJA 4F84A 5HS6A 1CQIB 1J97A 2GD2A 5UKDA 4P6VF 1IUKA 2UVPA 3GV0A 3LZDA 2JI4A 4ZYXA 3P9QA 1E9DA 3HY4A 3PRKE 1BHSA 3DW3X 1AKWA 3IQGX 4RM3A 5F78A 1GZUA 2XUJA 3MAGA 4F5WA 2F64A 4GC5A 3X1YA 1T1EA 3T34A 4CF5A 5H1YA 3K6SA 1WPQA 3S70A 5ALGA 4OK6A 1RC8A 1NVMB 3D4PA 5H3CA 2WWRA 3EZXA 1PZXA 3H9CA 5DSXA 4EI7A 2EVWX 5JAMA 4D8YA 3P5BA 3WLNA 1X7XB 1AUVA 1DAGA 2Z2YA 3ABIA 1YK0A 4X9XA 4ENPA 2WD7A 2NUAB 1YVRA 2R6R1 4ID9A 2QMEA 3BXPA 1XNGA 4PYQA 3GUZA 4UTPA 3E18A 2WSSD 3JD1A 3V3TA 1I8TA 1OXUA 3I64A 3QJ5A 5DTIA 3ZD7A 2JW5A 2VDMB 3LUGA 5LIPA 3JPWA 3WLSA 4M0FA 1DG1G 2VBCA 4MQBA 1T3ZA 1XPOA 4KBFA 2JLCA 1ZNWA 3UWDA 3QM1A 1R9MA 3GDWA 1VPLA 2ZYVX 4FGLA 4INJA 1I9GA 4J90A 3UAWA 3V1MA 3RJMA 3WB2A 5BR1A 2LGJA 5IWCA 3B2EA 2XJ9A 1UBUS 1ZGHA 2PGDA 1ECGA 1VYTA 3GU3A 1NASA 2XWSA 3PBKA 4ZVNA 5TPWB 4KOEC 3S4YA 2H0RA 3GRUA 3NTLA 4CM9D 13PKA 1CDEA 3LWDA 4GBED 1CNMA 4ZC1A 4GI5A 4BRZA 3S8YA 3H2BA 3WBJA 4AMBA 4KQEA 4IDBA 5HW0A 3DHNA 1S1MA 4G01B 1GPBA 1FCJA 2ZUBA 2CVZA 4M0KA 1L0BA 3ASUA 3OT4A 2BHNA 4R9SA 1LDYA 5I47A 1NXOA 2VZ9A 2ZULA 2JI7A 1Z5PA 2EFGA 4ZU3A 5AJHA 4G89A 5FTNA 1M2EA 1D9XA 2HEGA 2QAJA 3H4MA 1AIPA 3K1JA 4HGPA 4RXUA 4DLAA 1PEYA 1EM8A 2P1RA 5AXDA 1ZL0A 1ZRNA 1HE4A 2QRNA 2WKSA 3N5CA 5AKHA 5FTMA 2W37A 2C9YA 4YEDA 2V03A 3L49A 1SXPA 3N6RA 2JZNA 3VC7A 4KDRA 4EI8A 1Z7GA 3Q3GE 4BJ1A 1DSSG 5ERYA 1EWVA 2V6JA 1HFWA 1SHZA 3DZKA 3O31A 4BLTA 5J43A 1ZGGA 3MIZA 4KPUB 3M3PA 4B84A 1YIDA 4G0PA 5A3JA 1RKQA 3MTQA 5IARA 4KQWA 2YKGA 1PJCA 4MWTA 1KERA 3JSAA 3GZ4A 3KVYA 3DYVA 4MQUA 1TF5A 5EZ5A 3RWOA 2FDCA 1EAMA 2YIVX 3CV3A 1RJEA 5ANRB 2CSUA 4J2OA 2FVXA 4PPYA 4L3VA 4REOA 1O9HA 2QVBA 1O6ZA 3KWLA 4FS3A 4XDZA 4NMLA 3UUFA 4C6SA 4XOUA 1P1HA 3FOBA 3IILA 1Z4KA 1H9BA 3BL8A 1NKSA 3GPCA 3R20A 3QLJA 3NBZC 1K8ZB 1G3UA 3I39X 3EZGA 5KMGB 1AM4D 1BYUA 5IBRA 3N6XA 1HEIA 1PL8A 1XMPA 2XECA 3JQAB 3MB5A 1XUOA 2CHEA 2I2XB 2WG2A 2ZBQA 3GIWA 3PYLA 5D5QA 5JCJA 3TLCA 3MILA 3PC4A 1MMFB 2R00A 4PYIA 2IY8A 2JF0A 3P9NA 4MS1A 1BE6A 4I66A 1LPNA 2CDBA 3EUWA 3L6DA 1Y8RA 2ZUSA 3D6AA 1RYZA 5AW5A 3LTNC 4BO0A 1W0CA 1FS5A 2DH6A 1P2UA 1G8MA 4YC7A 4YDSA 1ST2A 1KYYA 1A76A 4KLNA 4WCFA 4PHGA 1HQCA 3EVEA 4KXVA 1LGYA 3GGDA 4JJAA 1II0A 4IJ5A 4UHKA 3HCWA 4MVWA 4WUTA 2VHUA 4TRRA 2QN2A 1O5IA 1Q74A 2EQBA 4YUVA 5DHRA 5CK5A 3T5DA 1WLYA 3JZAA 2C7RA 2Y0BA 1O6GA 3BWBA 4GNRA 1UDRA 3LRTA 4X60A 4CMHA 4ZI7B 2NTYC 4LYHA 5TJHA 3CT4A 1XU9A 2QTBA 4OHXA 1X1RA 3C39A 3ZJ5A 3BGOS 1E3DA 2Z2JA 3UAYA 2CC2A 1CY1A 3EAFA 3FIUA 1AKMA 4A0FA 1U5BA 4XWOA 2MSNA 4E94A 4RM2A 3BYZA 4U7WA 3GRPA 2CJWB 1GKYA 2QJFA 4TWIA 1MQAA 2X1HA 2G67A 1RM0A 3CLKA 5DGHA 1FDTA 2CNLA 1T6NA 2OENG 3JV7A 4UOEA 4NBNA 1EQAA 3KSZO 4I08A 1FRVA 5G0VA 1ZDMA 4O4IA 4BO6A 2DH5A 1JFSA 4CIXA 1KFKB 4Q3EA 2J30A 4BMDA 1RKUA 1E3IA 3RRJA 5E9AA 5G0SA 2O2EA 3L9WA 3DE4X 4ZMRA 1TQDA 3OFJA 3QEJA 3ZUPA 3PQ3A 1P62B 2JGFA 4MUNA 1TNDA 4J3JA 4KE6A 2BM0A 3O0TA 1USKA 2UV8A 1IRIA 3OCJA 4HQLA 4G8DA 3A9RA 1E6WA 4LFBB 4XDGA 1AKUA 1XAGA 5LMUB 5E1DA 4DPMA 1JR4A 1PL7A 2PVCA 4IYRA 1ACLA 4R05A 2I2WA 4KTTE 2H65A 1RKVA 1Y48E 1Z4QA 1OUMA 1CP3A 1IUPA 3FXAA 4PGHA 1JE1A 1SQ5A 4G8CA 1E2LA 3EZNA 5TY0A 3EXIB 3H6HA 3N59A 2PD3A 3RC9A 1RQ2A 4FGKA 4W8GA 1JKFA 3A14A 3HVIA 5E9WA 2X3FA 2UYQA 4QRIA 4MA4A 1I7NA 1KGDA 2VHVA 5DIFA 2LKCA 5F12A 1LNQA 1SG0A 3SKYA 4EW1A 3PGLA 3IEIA 4I9NA 3PGMA 4QUDA 4DW8A 1Q17A 2NO0A 2BJHA 3DEKA 5JD3A 4AZ0B 3SGLA 1YAJA 4ARAA 4C20A 2COKA 3GEBA 3GLGE 1UMCB 1V7CA 3AJDA 2IFTA 3TD6A 4ZQBA 1E1DA 2PN1A 5I7WA 4W1QA 3IMEA 2BAGA 3DL0A 1CJVC 3F0TA 3ND8A 3FAKA 3NTOA 1INLA 3QPCA 4TV9B 2ZFUA 3ZQKA 1BN7A 1NAIA 2ZJAA 4LGYA 5EXPA 2EQAA 1TCUA 3R5HA 4IUYA 1SBYA 2GF0A 1NW8A 5D51S 5B36A 4I3GA 4ARZA 3ER6A 2XE6A 4OK5A 1ODIA 1UJMA 2QW8A 3C98A 3T7JA 3ERCA 4QLOA 1TTQB 1Q15A 4S04A 4BQFA 3Q2KA 2V4MA 3AU8A 3RFXA 1OILA 4O4LA 1HG1A 1JTFA 3QLUC 1PDOA 1QANA 3BMNA 1ZK3A 4F7WA 1CUXA 1Z83A 1TD9A 1ZJZA 5A4FS 1ZUD1 421PA 1CJCA 4RK5A 3G1TA 4UZSA 1A8IA 1YJ5A 3AUSA 1PJ8A 3M6VA 3G5AA 1SRRA 4H6XA 4HGYA 4IGAA 3WNBA 2C3UA 3DFFA 3EDQA 1CVLA 4HMOA 5CLIA 4TPKA 1Q0LA 5T41A 3KQUA 2IH5A 3O94A 3PNVA 4DMKA 1UPXA 2F1JA 1XZGA 3KEGA 3L2OB 4OJTA 3VHRA 4QG3A 1YULA 1ZI9A 1VMKA 2WA2A 3VXKA 5JQWA 1U65A 3IVCA 1LLUA 2QZJA 2WJAA 5F33A 2YJTD 4JUBA 3S2EA 4F4DA 5CDTA 5LOVA 4CQLA 2R62A 1NURA 4JBLA 1B74A 2QZ9A 4FYMA 1XYYA 3GZNA 2HO5A 3NM4A 1UK8A 4PONA 4KGDA 3GPDG 4HDCA 2BOVA 4K6KA 5FWDA 4Y9DA 4QBHA 3HCFA 2YZ7A 3G8BA 4WH0A 2C4KA 5IFLA 3KPJA 3FIJA 1MG0A 1TM3E 1VIVA 2X4GA 3DDWA 4CM7A 4TMTA 3UMVA 4CR7A 2H3HA 1U0JA 1GTZA 3DF7A 4MKXA 3LT1A 1TLTA 3FGOA 1X2BA 3UPUA 3ZNOA 5IXYA 3HJFA 4TROA 3QHQA 4ALNA 4ZI3A 4IMJB 3UK2A 4MWDA 3OO1A 4EUHA 2NO6A 3TDMA 1XEWX 1UIMA 4NEGA 2UYCA 4I1SA 3EF0A 1ISFA 2P5SA 4K6HA 2XMPA 5CM2Z 1OTHA 4K8OA 3HP1A 2R60A 3MJFA 2Q27A 2YHSA 2ZUTA 5HBGA 4ZZ0A 1RYHA 1T25A 5BN5A 1OJ7A 3G2KA 3NC1C 3EPHA 1HOTA 4NYMQ 3JQFC 4PC7A 1JG1A 3HU3A 3PRYA 4GX0A 1EUCB 3VH2A 2IX9A 2PYIA 4QQ8A 5K9ZA 4UBKA 3L6RA 4BP3A 4Z4EA 3WIUA 5F2NA 1EUQA 2Q3JA 5IDWA 5KVVA 4GUDA 1NVVQ 5HJEA 1EXMA 1N2EA 3L8FA 5C8YB 1WMFA 3A4LA 3MOGA 3PR1A 1T35A 2XQJA 4EMBA 4HNVA 1L4YA 1Y5MA 1RAEA 1J90A 2NSJA 1HEUA 1HYGA 1F60A 1BWPA 4I9GA 2CFOA 3U81A 5IF3A 1FL9A 2VJQA 4CGZA 3A6FA 4HL6A 1VFPA 4MYSA 2C1XA 4Z0NA 4ZO4A 4I5GA 4DJFC 4PE5B 4C2UA 1BXGB 4O3FA 5I9TA 4ZGBA 1KAQA 5J3JA 4P38A 4DHWA 5ITZB 5IM4A 1VXRA 1EGHA 5BMVB 2HSEA 1ZBDA 4X85A 4AUMA 2HIGA 5FNVA 3NKLA 3ZK9A 1E2MA 2REQA 5H7XA 3UWMA 5I45A 1E3TA 5BXQC 1YQ9A 1ZD4A 2EWMA 4RW0A 1JEEA 4LYEA 3O93A 3O4VA 1P1BA 2I9PA 3IEVA 4NHOA 3PDWA 2JGNA 3PPVA 4D92A 2P2CA 3DDOA 3CRRA 3RU7A 3SLRA 1DKMA 5SZIA 1U94A 4K2HA 3KDSE 2DQYA 3E3OA 2XUOA 5ALDA 3HXLA 2TMDA 1VKZA 1DC8A 1W48A 1M3SA 1GCIA 1H1LB 1X7YB 4G09A 4G5HA 4Q4JB 1XG5A 2KM1A 3HYSA 4IRMA 4KN9S 5JXWA 5EP4A 1SBZA 2ZR8A 3WK8A 4B0PA 4N41A 4ZOBA 3DFKA 2O0LA 3FPJA 3R7NA 3R3JA 3V8BA 5G41A 1FJXA 2R3SA 3SHVA 5KYXB 1A7UA 1PVOA 2G0TA 1Y0BA 3H9BA 5LZ7A 3KYJB 4DDUA 2WU1A 3CWCA 1GGKA 4MX8A 4WXYB 4PN3A 4I7EA 4EUSA 1IN1A 1XXHE 4RVNA 4YUYA 1Y4AE 4DMRA 3PDJA 2EZUA 5IDQA 7ADHA 1R7RA 3CGWA 3WLEA 4BV9A 4YIHA 3RS8A 1I6WA 1XTZA 3I2JA 1IDOA 4RCVA 3ZTWA 1CTQA 4B82A 4H59A 3UB2A 2ZYDA 3QVTA 3JQGB 5DNCA 5AVYA 2VHEA 5AW6A 3AF3A 3PTZA 4JLUA 2D4AA 4ZIRA 4BO2A 4D98A 4EVSA 5MFZA 2PLRA 3WL7A 5IAOA 1P9OA 1FS6A 4K40A 4U6QA 3GK3A 4NZ9A 3WB9A 3SIPA 4AWXA 4KU4A 1X15A 3LCUA 4HAOA 1TUGA 3HG7A 4JXKA 4B7ZA 5J4LA 1IM5A 1Y9DA 4XX1A 3GFTA 3OWHA 3SXUB 3WRVA 1WAMA 5H3LA 1ZJYA 2CUZA 2FMFA 1G2IA 1EIZA 1C29B 2R5WA 4JGIA 3OZUA 1PJRA 3KOOA 3M4NA 1L1FA 4ZO9A 1GGEA 4II7A 4Q3NA 4AU1A 5JDCC 2FPRA 4RKYA 3UTCA 1N6LA 2YVLA 1SZDA 1H6CA 4D9EA 1NBOA 2ONZA 2G5PA 4M54A 1JTVA 4E5SA 5JRZA 2QENA 1ZN8A 5D86A 1CJUC 1KJNA 1PFVA 1QCDA 2WF8A 3L0IB 1DKPA 3OZ7A 1GDDA 2VPZA 4MV9A 3CLRC 2XCQA 1ACMA 2ZXFA 3ZGLA 4BJ5A 1XWFA 5AW0A 4WJKB 2G1KA 4MB2A 1YCFA 2PSSA 2QEQA 4LMBA 5EE9A 4C7BA 4AJKA 4NXNB 2QYTA 4K9LA 2YWEA 3T1TA 1VCMA 2X7JA 2PIAA 1PWZA 3ENKA 3NGMA 4AG6A 4DM4A 4YAFA 3L1KA 4GMFA 1KTVA 1TEXA 2XA9A 3BXHA 4TS3A 4C0QC 2CBXA 4YY3B 3IQFA 4Q7EA 2VF8A 4F7DA 3OCUA 6REQB 5J4VA 5IHPA 4IFEA 4IQ4A 4EQ6A 5JI3E 1C0EA 4JI2B 1JLLB 3F6EX 4IQGA 4AIIA 3ZE6A 1YAHA 4PNEA 5K09A 4W5TA 4AKHA 2ZDHA 3X1DA 1P1KA 4L5BA 8AT1A 4ZV7A 3MWKA 3RF7A 6ABPA 1FNCA 5CXSA 2C7PA 4DQDA 4L0CA 1QCYA 3RQIA 1SUFA 5EXDA 3ZXYA 5AVQA 5I48A 1W29A 2NV2B 2GEKA 1Q7RA 4DBZA 1O5TA 3A32A 3GPBA 4JOCA 2WRZA 4WY2A 2GFHA 3A6EA 3X0DA 1WRBA 1XZHA 2I22A 3TSZA 2HJSA 4BASA 4FHCA 1OH5A 1DJOA 1Q7BA 1I7QB 9MHTA 1UPBA 4L5JA 2HA4A 4TWAA 2EKZA 4LI3X 4TKVA 1Y3BE 1FUYB 3VNSA 3B70A 5I8WA 1E79D 3L0PA 3T3GA 1IPHA 3WGNA 5DP2A 1P1FA 3F73A 1B3BA 1SC1A 2NGRA 5GINE 1YE3A 4ZQHA 4TXLA 1OLUA 5F9MA 4CM4A 1U2PA 3NBMA 1Z4OA 2CFRA 5ARBA 1NUHA 3IIJA 3NBKA 4ZCTA 1BCSB 1MW9X 2WD9A 3LKBA 4AL4A 2B4TO 1H8HD 3UC5A 2ID9A 1BMFD 2IYYA 4M4SA 3RUPA 2AWNA 1PGNA 1U2EA 2QYOA 4JEMA 5EYPB 2YXEA 1H2ZA 2BDUA 3SX4A 2I29A 2IODA 3TMKA 5GTDA 2VPIA 2R7MA 4IEFB 2A58A 1MIOB 1RJ9B 1SU7A 1SUIA 5CW2A 4ASUD 3NBAA 2MWMA 4LXGA 1VXOA 1POXA 2ODBA 3RODA 4PAWA 3AFHA 4WIAA 1R4NA 2J45A 4ER7A 4MVJI 2XDAA 3R76A 3PJEA 4CWAA 4RANA 1CJSA 3ZNQA 1S8FA 2VHJA 2RJNA 2RAVA 3QKUA 4YWHA 4YRSA 1OWNA 4U5XA 4B6OA 2VHYA 2Y1XA 2OBLA 2VT3A 3IMGA 3RV4A 1HFJA 1I2MA 1W5AA 3CLTD 2C5EA 5BNWA 2B30A 4A73A 2PLNA 1IZ8A 1FVHA 2NYRA 4HXGA 2XNDA 3CWQA 4IWXA 2FMXA 4A8TA 1NX9A 1GO2A 1Y6QA 4DV6B 1XZIA 2JGIA 1RS0A 3D8BA 3MWEA 5LC1A 3RROA 2Q3LA 4EJ2A 3GLFA 1AK1A 2ZSJA 2FW7A 2C95A 2W98A 3RO7A 5A0TA 3U3KA 4CFZA 1IC6A 4Y2XA 3EQ9A 2QD3A 1IK6A 1QH1A 4C6HA 4Q6WA 1RHMA 2XOXA 5TARA 3Q8WA 4GM0A 1Y5IA 3EEIA 1D2AA 3Q1KA 1C50A 3W7AA 3MMZA 2C82A 4DBLE 2PO7A 1O94C 3ORHA 1JFFA 4YJ3A 2J5KA 4CPDA 1YR7A 2D0IA 1KJZA 3ND6A 3WFZA 1BEEA 3WJ2A 4HMQA 2XWBF 1HLGA 1YRWA 4I1RA 4KX3A 4O2BF 3REFA 3TRHA 3UTDA 3X3HA 5D1HA 4YPOA 1NG1A 2ZG6A 4D96A 2CXOA 4H6WA 4L1KA 1G5QA 4WAUA 4DLTA 2RGBA 4GEGA 2CKDA 4KVZA 3SC2A 1NMSA 3K2BA 1R0ZA 1OZGA 4YALA 3PCXA 2MCFA 3G9UA 3L4EA 4R6XA 1PR4A 3DMNA 1H3NA 1V35A 5ER6A 2BYTA 2RH4A 5HKAA 1AO0A 2H7YA 2VA9A 3UPDA 2FUKA 3DPIA 1V11A 5TGDA 3O8RA 1U3CA 4B8YA 3S1LA 2R8OA 2G04A 3H11A 2V9PA 2G4LA 3AGQA 4AZSA 5G02A 3PJGA 2HJWA 3GUCA 4LQ4A 2ZUWA 3PX3A 4TKUA 4YUXA 5D7NA 1DRUA 4JT2A 3D7SA 4GAEA 2FP3A 2P9TA 1WSDA 3EVFA 4RY8A 3IJRA 2YHBA 3SN6A 2RGRA 4TN5A 5KC9A 4YNBA 2C3MA 4PG5A 5D3MA 3A2KA 4G5YA 3RUDA 2XHEA 4FGJA 1GFIA 2P5TB 2VTEA 3OD1A 2R79A 1BTOA 2FN7A 3DMTC 2C0QA 2FFAA 4TYQA 4PSDA 2O8EB 4JLDA 4I4CA 3WADA 1F2DA 2EKQA 5EQDA 5DGXA 2WJ4A 4NIMA 3T8YA 2QV7A 1XAJA 4B3JA 2Z5VA 3IUMA 5FUBA 1KQGA 4LOHA 2GT1A 5D87A 1HE2A 3ER9A 2XVMA 4M76B 1WU8A 3IT3A 2OXIA 3GLHE 3T5CA 5I9BA 3ZS9A 3OFSA 2QQ5A 5K99A 2XUZA 2IYWA 2W58A 2WD8A 5SY9A 1XTKA 3MS4A 4P34A 3SLGA 3EISA 1J8FA 1QIEA 2W42A 2X5XA 1XI2A 1P77A 2H2AA 1KNQA 3F71A 4JFAA 1O6FA 1NVEA 3H6GA 4HFMA 3FSGD 3CXRA 1NQAO 3G13A 3E9EA 5AK0A 2PMWB 5CVDA 3KXIA 3OE7A 3KFXA 3BCHA 3L4JA 1SXJA 4DBLC 3E0XA 4MJ7A 2B7CA 4WINA 5ED4A 5FUVA 2E4VA 1NNUA 1RWNA 2QL6A 4J76A 5KYTA 1UMBB 4KBGA 5I4KA 1ZK2A 2RHOA 4NOMA 4O4JF 5I4BA 1EDZA 4KACA 1PGQA 1NBME 3WLPA 4I2VA 3TQFA 2PA0A 3TR5A 5KDDA 3NFYA 2AYXA 1VA5A 4J6FA 5EJMA 3VU3A 4ZVLA 1WHTB 3DKPA 2BKUA 2YXPX 1M34A 3DCIA 3H8VA 4K9MA 2EV9A 4DV2B 3GEIA 1C30B 1TM4E 3BD7A 3V8EA 1JG3A 1YBFA 2E2WA 4EF5A 2BFBA 2ECOA 3CBGA 1JECA 1UCFA 3OY2A 2O2IA 4FPXA 4HYEA 2W2MA 4KXUA 2OXRA 4NFYA 2VZ8A 4OREX 2V7VA 3TECE 2XGGA 2JLSA 5IS2A 1P60A 3VJLA 1E2PA 1KGSA 4PXYA 1SUAA 4MHTA 5FBWB 2B4KA 3A25A 5GMOA 1QIKA 2H5JA 1MRSA 5HXAA 4I6GA 5DNYB 3KS9A 2X0NA 3QFSA 4D26A 4ME6A 3FPLA 5I4IA 1QZXA 5FPKA 5LJLA 5JATA 3V46A 4K3UA 1WQ4A 4ZOQI 4GQBA 1DHRA 1YA8A 2D1SA 2UVDA 4D9CA 5KQPA 1KH2A 3FWPA 2QMOA 4C0LA 2OZEA 4PYNA 1UWCA 1FP6A 1Z6PA 5IZ4A 4WQMA 3VR5A 3MUFA 3F67A 1U80A 4FW9A 4NZOA 4P2GA 4BLOA 1EYZA 1IBSA 2GCIA 4BFSA 4QZVA 1SA0A 5JJ5A 1VG8A 2ZRMA 4LMPA 4BTLA 1KEKA 1T5HX 1V6SA 3IAM6 3RSSA 4GI2A 4D02A 3FDZB 4C7VA 1R74A 1QRSA 1HT3A 1FB5A 3NTQA 4UMDA 4IDHA 3UW1A 4RDCA 2WKPA 1OX4A 3LAWA 3U7IA 1CULC 3ZU6A 4Y9TA 3AB8A 3CZCA 3WNCA 1ZR2A 3HA2A 2R7NA 4N0DA 3B12A 5EUBA 3WLLA 3NDBB 4DCJA 2BL4A 1XV5A 1O5OA 4KQ2A 4NOKA 4WADA 3D1VA 3ELWA 3EUAA 4HWRA 3TW6A 4W6QA 3RJ5A 3H1EA 2PKEA 1JDJA 1I3CA 4JAVC 1FDVA 4C4YA 2PGOA 2YV5A 1VRCA 3A1TA 3KLNA 3TLZA 1W59A 3GAFA 1GY8A 4FVTA 4A8JB 4X7MA 2ECQA 1X77A 1ODLA 1YR9A 4XFJA 2FZ4A 3WGIA 4N54A 4CRWB 4EFMA 4E3WA 1NA5A 1DRWA 3P94A 1Z8NA 4EJSA 2GNOA 4B3SB 4GBMA 1LI7A 3LK7A 2PMFA 5D00A 3WO0A 4FM9A 1TQ6A 2K6GA 3U80A 4QIHA 3VM6A 1DTEA 1Q2XA 2OC4A 3HABA 3EVTA 2QD2A 4RMHA 5TEVA 1L5WA 4HZUA 2CUTA 1EB8A 1KI6A 1N9KA 1HQKA 2MSCB 3B6JA 3BTUA 4N5HX 1Y8QA 3VC1A 2G8LA 2I91A 4DRXA 3PXDA 4FKBA 4X1IA 2QD4A 4BKMA 5LU8A 1URPA 1XO1A 4U9HS 2Q3DA 1JT9A 2QSZA 3PHGA 5MN6A 2E4YA 5JO0A 3IBGA 1YRBA 4H7JA 2VHQA 4PHFA 4RU1A 2CW5A 2G76A 5T4BA 4DA8A 4NBLA 1T5IA 3HK2A 1YIOA 1E9CA 1QLWA 1RMQA 1E89A 1KPGA 2R8ZA 1FSZA 3EQ7A 4I9UA 2V3CC 1CZHA 4I9FA 4D4IA 1BE1A 1O8CA 4TOIA 3QV2A 3ZBQA 2FWAA 2JGDB 4LRYA 4RV5A 3BIOA 4JEHA 1QV6A 2YXDA 3R3HA 4EMUA 5BSFA 2AXPA 4PU0A 4CTJA 3MUEA 3HA7A 1MXFA 3FUTA 2J33A 4QICA 5DHUA 5IYZF 1ORVA 2O07A 4KNVA 4BGVA 2AFIA 3FUCA 4JT9A 4QHSA 3DKIA 3L6UA 4C2TA 1G5IA 1NZDA 4N65A 1H9CA 2GCEA 1J1IA 3GJ5A 4YRGA 2PZEA 3MLBA 4D79A 2FWRA 2JHFA 2PPVA 1KC1A 2V65A 3AHIA 3GRAA 3JRXA 2RARA 4G9BA 4L57A 4X00A 3VDRA 2VTBA 1BJTA 1V2HE 3H9EO 4HH0A 5L3VA 1HTBA 5JBQA 2G1JA 4BNZA 3PIDA 1VB3A 3DB2A 1Y4SA 2DFLA 1RXYA 2C2XA 3EGXA 3JU3A 3K73O 3QE3A 4WTOA 3I1IA 3VC3A 4MKIA 3A4MA 1V1JA 2ORYA 2Q0HA 4ZANA 4OQMA 4KV7A 3NHSA 1DEOA 4N82A 2CCKA 4UATA 3MPUA 5BVGA 4MUHA 1TT5B 2I7VA 2UXBB 1WP9A 1HXHA 3R7WA 4B4UA 4MP8A 1B0PA 3NH6A 1JAXA 5IDXA 1TM2A 1OAKA 1W30A 3HJNA 4RQAA 5ICEA 4LF5B 3PWTA 4OU5A 3EC2A 4Q3OA 1G41A 1BXRB 4MCAA 4RJJA 5F35A 3U37A 3TVYA 3SX0A 3UG7A 4BLVA 4EDHA 5ADHA 5D84A 1MP0A 3M4ZA 2WT8A 4UD2A 2QNBA 3V7WA 4RXMA 2JGEA 2HZBA 5KOHB 3EASA 4C88A 1KI3A 2RIRA 1ULZA 1I4OA 2VJBA 2UYOA 3E23A 3M1YA 2E5LB 1YJQA 1J00A 4PGMA 3ZW7A 1YMVA 4FFMA 2C4NA 4AQDA 3LPAA 2G6BA 4ZOLF 1F2UB 2QL9A 5F7XA 4IJUA 5E8RA 2ODTX 1FIUA 5I9LA 2HHHB 1I5OA 2BGUA 1V5EA 2Y1WA 3FOWA 4U7HA 2EL9A 1R18A 3FF1A 3QELB 3TXXA 5C35A 4AMVA 1IBMB 2UKDA 4EHLA 1JLKA 1QRDA 2RKOA 1E2QA 4EZEA 4N40A 2XADA 1YA4A 4CKYA 4M53A 3RGGA 4P98A 1USIA 2OPBA 2W6NA 3Q12A 4GP6A 3HLKA 1L7BA 3TTYA 4D6XA 5B3JC 4PSCA 1OGIA 2J08A 3KTAA 2IQIA 3HKEB 1M2WA 3FWNA 1H85A 3T9AA 2MHCA 4FZ5A 1DRJA 1XOIA 2FZGA 3FDFA 3RKSA 2HSZA 3LX6A 2ODWA 3W8FA 1NR7A 5AVKA 3HY3A 4H0FA 2G83A 2CSXA 4LDZA 1M6NA 3PDHA 3V2HA 3RABA 3AOGA 2DPLA 1F5NA 2H2IA 3FDIA 1O95C 5ALLA 1EHYA 3FCSB 1T4GA 1Z13A 4BE7B 3OLYA 3C3PA 4PCUA 1N9GB 5JRJA 4JVOA 5BNFA 3Q9LA 2CV0A 1JWAB 5JTUA 3VA7A 4EDFA 2PL5A 3O74A 1QRTA 3Q6NA 1DEAA 5BWOA 4S0ZA 1XQ9A 4V3BA 3OQOA 2XT6A 5LB2A 3R74A 3WMGA 4D6YA 1FP4B 1SM4A 4UQLA 2VDPB 4UAVA 3VJKA 1IHYA 1DBQA 1T43A 4QYSA 4B6JA 4S0XA 1R66A 4LDJA 1M7BA 1AOXA 1GRCA 2YMLA 4J0DA 4EHDA 4L4UA 5F7JA 3DE5X 3EIOA 3FYUA 3KYDB 3DO6A 5EESA 3HXOA 2JD0A 3MCTA 4LDPA 1NC3A 2IA5A 1EGAA 1LNZA 2QMYA 2WC1A 3FFTA 2JA1A 2F4VB 2Q1WA 2QN6A 3QUQA 4MLDA 2AMLA 2G9RA 3QWHA 1Z0KA 3MCZA 3MJEA 5E3JA 1ZHOA 3H5IA 3KZMA 4PAMA 5EINA 4JJZA 4Y1GA 1S6YA 1TU3A 5KNCA 5K4GA 1ODKA 1BKYA 1WB6A 2AXEA 2Y1KA 3CRZA 2W2VA 1DZ3A 1JG2A 4RBNA 2P9GA 4BUZA 8LDHA 3RVRA 1E1QA 1EXDA 1CJTC 2UZIR 4DS3A 3W04A 1J39A 2XVAA 3GG9A 2Q7XA 1FZTA 1Z3CA 3VPXA 3PUZA 4ATNA 3EG9A 4QUBA 3IOBA 1X1AA 2O6LA 1IBCA 2BKLA 3QU2A 4QPJC 1QJCA 4YP6A 4OD0A 1B8NA 2GBGA 1IVYA 1N1EA 3B9PA 4NX2A 3PHCA 1CRWG 3CLRD 2GBPA 4PNHA 4WKNA 2OBMA 4XIIA 3G5UA 5CLLA 5AI0A 1T8PA 2NXWA 3KBOA 2ETVA 2J5RA 2VNAA 2JRCA 2ZIVB 4FBMA 4PC1A 4UVEA 3CX3A 5JNWA 1ZXLA 3TQQA 4TUYB 2PSEA 3HLYA 1NM5C 2PMBA 3RIEA 4MB0A 1Z28A 3LW8A 2HMUA 1JU9A 4LMAA 5FFNA 4HNAA 2ZYGA 4NDZA 4PLCA 1NN1A 4LXHA 2O8VA 3F7OA 3N6VA 4B09A 2ERYA 5T64A 4YQYA 3SEAA 5CFNA 1GEEA 3VV3A 3SDSA 4EKNB 2MYTA 3GFQA 2EJUA 4BXOA 4R1SA 1FP7A 1FSGA 3CRMA 2PRYA 3QF4B 1M33A 4JJGA 1SU6A 2B5WA 2FPSA 4LYAA 1LJUA 4NICA 3T5MA 3CNBA 4M1KA 2Y4NA 3B1XA 5IT4A 2Z95A 1UMDB 3GVPA 1BNCA 5B1DA 4CM8A 2PWYA 5AUPB 2CNWA 2IDMA 1H9AA 1V48A 3KAQA 4XYGA 1OTXA 3B7WA 5C5IA 4Z99A 3ZX4A 3BQMB 3PVCA 5F4BA 1EQ2A 2IP2A 5A5EA 5KJCA 4YX9A 2HX1A 2I5PO 2OCPA 3HN7A 5EY5B 4DE5A 3TSCA 3KTOA 3ROPA 1T91A