3DW1X

Proteinase k by lb nanotemplate method after the third step high x-ray dose on esrf id14-2 beamline
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Radiation damage in protein structural characterization by Synchrotron Radiation: State of the art and Nanotechnology-based perspective
rcsb
molecule tags Hydrolase
total genus 98
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2008-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3dw1X00
2Z56A 1NDQA 1T1GA 2X8JB 1EGQA 1PEKE 5JXGA 1TO2E 1UBNA 4M1ZA 4Z2AA 3EE6A 4NE7A 1SCJA 1THMA 3VTAA 4ZOQI 2X8JA 2V8BA 3F7MA 1OT5A 3LPAA 4HVLA 4KB5A 3ZXYA 3DE4X 1AVTA 1IAVA 3DW3X 2SICE 1Y34E 1KE2A 1R6VA 3DE1X 2WUVA 2TECE 3VSBA 3SICE 3TECE 3DVSX 1YJAA 5CW1A 2ST1A 1R0RE 2E1PA 3DVRX 4H6WA 1YJBA 1DUIA 1WMDA 3DE2X 4AKSA 3LPDA 4CFYA 1EA7A 2W2MA 1SBIA 1BFKA 1TM3E 2SNIE 1MEEA 2XTJA 1SBNE 1SBTA 3LXUX 1TM5E 1GCIA 1SUDA 3OSZA 1GA4A 1JEAA 2Z2ZA 3A3OA 5FBZA 4YN3A 1GT91 1SCDA 3DDZX 1Y1KE 3DE3X 3PTLA 2XRMA 3F7OA 1Y3BE 5B1DA 3VV3A 3DE0X 2DUJA 1AK9A 1Y4DE 1TMGE 1TECE 2PRKA 5AVKA 5JXHA 3WIUA 2W2OA 3A3PA 5AMXA 1BH6A 3WQBA 4WOBA 3EDYA 1SCAA 1SCBA 1AV7A 2IXTA 5FAXA 1BE6A 2B6NA 1V6CA 4LVNA 1GNSA 4CG0A 1YU6A 4RYDA 1TK2A 4AKTA 3GT4A 1GTL1 1LW6E 1C9MA 2W2QA 1Q5PA 1ST3A 1SBHA 1KDVA 4NE9A 1S2NA 2ZRQA 1NDUA 2HD4A 2Z2XA 5SICE 3GT3A 3TI9A 3SQOA 5FFNA 1SVNA 1Y33E 4FONA 1Y4AE 2HPZA 3AFGA 5ARDA 2WV7A 3BGOS 1ST2A 3VV2A 3CO0S 4KG7A 3VYVA 1ZVJA 3TI7A 3P5BA 1V5IA 1SPBS 2PMWB 3UNXA 1MPTA 1SBCA 1KE1A 3GCXA 3L1KA 5B1EA 3DE7X 1AH2A 1SUAA 3QMPA 2W2PA 4ZARA 1SN7A 1VSBA 2IY9A 2WUWE 1AF4A 5AVJA 4H6XA 1AQNA 3WHIA 1GTG1 2ZWOA 2PWBA 2PQ2A 2W2NA 3DW1X 1OYOA 1BFUA 4C3VA 3I37X 1PTKA 4B5LA 1S02A 4I0WB 1GTJ1 1P7VA 1CSEE 1T1IA 1WMEA 1Y3FE 1OYVA 3VHQA 4LVOA 1A2QA 3HJRA 4OMDA 1NLUA 2SECE 2PWAA 2PKCA 1KDYA 4C3UA 3D9QX 1AU9A 3WIVA 1P7WA 2QTWB 4DZTA 1HT3A 3PRKE 1TM4E 4OV6B 1C9NA 1TO1E 4OMCA 4CFZA 2ZWPA 3T41A 3DE6X 3GCWA 1PFGA 5JXJA 5ARBA 3I30X 1SUCA 3DWEX 1SH7A 1GA6A 1SIOA 5JXIA 4DJ5X 3I2YX 3EIFA 4BWGA 4KPGA 1R64A 3DYBA 1WSDA 1T1EA 1Y3DE 5AQEA 1CNMA 1KDZA 1ZVKA 2WWTA 3H42B 4HX2A 3AJ9A 5K7SA 5ARCA 4DWWA 1SCNE 2P4EA 1Y9ZA 2PYZA 3QFHA 1Y48E 3Q5GA 2Z2YA 1BE8A 1C9JA 1YJCA 4MZDA 2SBTA 5I9SA 2ID8A 2Z57A 4JP8A 1SELA 3I34X 4GI3A 4WOCA 3AJ8A 1S01A 3LPCA 1IC6A 3Q40A 4NMXB 1DBIA 1SIUA 1SUBA 3ZXXA 1TM1E 3DE5X 3BPSA 3F49S 1XF1A 2G4VA 4H6VA 1BJRE 3A3NA 1SUPA 1P8JA 1TM7E 3BX1A 1GA1A 2DQKA 4J94A 3DVQX 2ID4A 3CNQS 1WVMA 1SUEA 5JMOA 1PJ8A 1SIBE 4K8RB 1WMFA 3QTLA 1C3LA 2DP4E 1GNVA 2Z30A 3D43A 2GKOA 1Y3CE 2Z58A
chains in the Genus database with same CATH superfamily
1NUTA 4YECA 2A4MA 4G0OA 3EH2A 3TM4A 1YVUA 3GDFA 2G36A 4YRPA 3K1ZA 4IG9A 3R6WA 2PT6A 1VJTA 4NCKA 5BN1A 3T94A 4JJEA 5JNTA 1PEKE 4JY7A 3TLCA 3FKJA 3JARA 4KIWA 5BRNA 5T4BA 2HTEA 1H85A 4WK6A 1OSNA 5GONB 4AK9A 4NYIR 5AD1A 3OESA 1ABFA 4LZOA 1A5ZA 2VPIA 2BIFA 4J3FA 4N1AA 1D2AA 2BFDA 4Y2PA 2ZJFA 1THMA 4JBHA 2VOJA 2C7RA 3TRHA 1VHDA 4Q1FA 1YA6A 2IDMA 4BO4A 3KSMA 2RGNA 3Q7QA 2Z3ZA 2K87A 3DHNA 1M8KA 5LU8A 1TQHA 2WHPB 4L07A 3JVUA 2W0SA 5AKYA 1XD8A 3OIFA 3OQIA 2WJYA 3RYFA 3HB0A 2O0LA 1SEVA 5A5VA 5E6RB 4V0MA 2XECA 4CQMD 2AHRA 4BB5A 2PQMA 4DRZA 4JOSA 4YMGA 5EPOA 3EGXB 5DX8A 4DVJA 3GLQA 1GUBA 2HXSA 2C8LA 2QD5A 1ZD9A 3KU1A 5K6AC 1Z15A 4WXHA 2Q2QA 2OLKA 1VKZA 2IUYA 3NTOA 3OF5A 4PQYA 4M0PA 4JSTA 4XI9A 1TUBA 3UH0A 3AERA 4KP7A 3JSXA 1QQAA 1QH9A 3PFCA 2RHOA 3PNKA 1H8ED 4W1SA 1FFEA 3V42A 2ODBA 5T5QA 1IHUA 2XD9A 4FCTA 5FYDA 1Z4LA 1XKLA 1ZPDA 2JZCA 3SICE 4CR6A 3L93A 5JEDA 3EGIA 2HX1A 2UUCB 1PUIA 2AUNA 2F8TA 4WNYA 5CW1A 4U2FA 3WQQA 2GDZA 1OE0A 2GPNA 1OBFO 2O8EA 4BQPA 2X5KO 2HK7A 3FG9A 3ICWA 3JQ7B 3H1PA 1IEVA 4DIKA 4PQGA 2D4HA 2DFNA 2VAMA 4H31A 3DE2X 2BH9A 2O1WA 5DM2A 5C1DA 3T7TA 3QUQA 1A5BB 1X8LA 3MUEA 2CJPA 3B9PA 2I1WA 2W2MA 2EFHB 3QVMA 1G5QA 1WHSA 2P8SA 3OOJA 4M1YA 1NWHA 3AHIA 4B6OA 1VJDA 2PYIA 1UPXA 4EDFA 4FFOA 5DXAA 1G21B 3F1KA 3GYBA 1OX5A 3SFTA 1I4EB 3IOCA 4MHSA 1EDEA 4J8PA 1MEJA 4KCGA 3CKYA 4YO7A 1UKAA 4F46A 5DTIA 1BXGB 2O7QA 4JLBA 2FFRA 2CWDA 1FLVA 2IHZA 4U2BA 2M9MA 4RV4A 2A6PA 4WVFA 1WHTA 2PZFA 4F6RB 3CKKA 4C4RA 1DLJA 3HCCA 5JJBA 1G8KA 1DC8A 2FEWB 1TM5E 4ZYXA 4PYRA 1GCIA 4QXPA 4BKUA 1WOMA 2FJPA 2WT9A 4P1ZA 4QGSA 4UBNA 4XGQA 1OVMA 2GLTA 3L7BA 5SV2A 3ZHXA 1QGED 1E89A 1J2UA 2I3ZA 2P6MA 1ZVQA 2PZBA 2VWQA 4H1TA 3SC2A 3L6OO 1VHWA 2IZOA 1BYIA 5JTUA 1J49A 1PP4A 3L7CA 2IYRA 1UXKA 3STUA 2ORED 4DV2B 3G2IA 4MIEA 1L9KA 2RGBA 3GLGA 2HSEA 4A4DA 4L74A 4WKBA 3V8PA 1SFRA 3RIEA 4WBNB 5A3QA 3ADDA 3GFRA 3AYXB 2OEPA 4IF6A 3BD7A 4UVHA 2RKOA 4QXAA 4DKJA 4M99A 2RGRA 1C4WA 3DDZX 4DNOA 3BMQB 2HSDA 2YINC 1NI5A 2XRMA 3ZHUA 1USKA 2YY5A 4O25A 3V2GA 3GNSA 3H9QA 2JCYA 4YFVA 5C0OE 3TMAA 1COWD 1NXQA 1PVDA 4HFMA 4ZVPA 4PFKA 1QC5A 2QTFA 1PR5A 1Y6ZA 2JFBA 3LL7A 5FFFA 2QNIA 2XUIA 1TLFA 5JXHA 1SU8A 3QLEA 1JIQA 2WUEA 4D4HA 2AS0A 1I7NA 4L4ZA 3A3KA 5EZSA 4F9TA 1BMFA 3A6LA 4GYYA 4P33A 4Q93A 2YN2A 5AHXA 2WD7B 2VYNA 2O50A 3C6XA 3C16C 4IXTA 2L0XA 4RK0A 1O8BA 2QSJA 1NR5A 4O02B 3LVQE 1BG6A 5DOZA 4C5CA 1I6WA 1M10A 3RVPA 1HTWA 5GY7A 2Y0EA 1SCAA 2NO9A 1E9VA 2CJXA 4PNHA 3ZW8A 2Z5VA 4XRRA 5IF9A 3RWMB 1E6UA 2AFRA 2IUTA 3COVA 3ZC3A 3HV0A 3BICA 1NYLA 3BZBA 3JZFA 3OPQA 4FI3F 4K05A 4TZTA 3VPCA 3ZY2A 4DCGA 1BE0A 3IEPA 4JYAB 1GCOA 3NYQA 1YR7A 5D3MB 3HXOA 2NPFA 2MR6A 5BO5A 4UUNA 5AW7A 1QGYA 1TF5A 3INRA 2JJ2A 2H4HA 1WDTA 3GR6A 4OK5A 4JUCA 4B80A 5HTKA 3UC9A 2HREA 4ZP1A 4MI6A 1WXHA 3NM6B 1Y63A 2AHOA 4ERNA 1J2TA 1Z4MA 2C2ZA 2VSOA 2V6JA 4OGKA 4HLNA 4K9DA 4R8KA 3GJ7A 4BMVA 2AK2A 4NOJA 1QHNA 5DBFA 1KDVA 5B57C 1L5KA 2PD4A 2B34A 3I0ZA 3INYA 1EK0A 1R6UA 3OJWA 5KNBA 3D2AA 3R2JA 4MQEA 2VJMB 2HF9A 5JE8A 1ULZA 3FRHA 3AVPA 521PA 3IAEA 2EWMA 1HM5A 1F0KA 2OB2A 4FQ5A 5FWDA 1DQRA 5DYGA 4JHXA 1I2CA 1PI3A 4GOJA 3C6YA 1MXHA 1GCAA 3UQYS 2QTRA 4OQZA 2AE1A 5TMPA 2VK4A 3G5TA 3VNUA 1P9LA 1R3UA 1WMSA 3FAKA 1Q84A 4EHIA 4JU8A 2YHUA 3HYCA 4CODB 1A8PA 4I1SA 4PLPA 4HKTA 4AN0A 1E62A 1MIOA 5CP8A 5AHKA 2YYAA 4NF2A 2G1JA 3QV1A 1Z47A 1EBBA 1ML3A 1WEHA 4LXIA 1U3UA 2OC4A 4HCJA 1VBFA 2AWNA 1Y81A 2R79A 4GSLA 1ZI9A 2LUOA 2WK1A 2EHJA 4MV5A 4RKQA 5DP1A 3ZJUA 1IMJA 1BRTA 4YAIA 3DFFA 3CVVA 4P83A 4RV9A 3W1WA 4XYBA 3UFXB 3WK6A 3DTVA 2ZRBA 3KSDO 4MV4A 4LY0A 1ND6A 4TMWA 1J8VA 3K9CA 4MPDA 5CJPA 3A4YA 4BKMA 3NBXX 4U7DA 2ZBEA 2XUGA 4OATA 4PAWA 5EE9A 4C4TA 4EO4A 4KXVA 2IU3A 2RD2A 2EWWA 1OFUX 1TYZA 2JJ8A 4FX5A 1P2TA 1OFGA 4OHPA 4RFSB 4IFIA 2HBZA 4HPWA 4CIBA 2BZSA 3MILA 5KJFA 3I28A 5DLEA 1KE1A 5EHXA 3VA7A 4GM4A 3W8EA 2GM3A 4N5MA 3PEYA 2O8VA 2HBQA 3HBLA 4QT4A 1AIPA 5KDDA 1K7XB 1L4KA 5DEOA 2ZB7A 1IB6A 3L7YA 2VTDA 2ZSDA 1NXSA 3KALA 4W1QA 3CRQA 3AF2A 2W2PA 1NP3A 4X6XA 4K6CA 5EINA 5AWFC 3M5WA 5IJWA 2E9SA 2GXSA 3KQWA 3N1UA 1WXIA 1M83A 1SN7A 4MQ4A 4F1KA 5JDIC 1ACMA 3KE8A 1JLSA 4H3HB 2WP0A 1LTQA 2J07A 2QUBA 1PR0A 3IT0A 3PQ2A 2HQBA 3GH3A 4DMFA 3P4XA 1PJCA 2YCBA 1ONBA 4GI5A 2R66A 1H2HA 4IHKA 4CMCA 1V8ZA 1ZUHA 3O1JC 4IHJB 4URUR 3VPFA 3MFYA 2HMUA 4CJXA 4ESHA 5I7HA 5HM8A 1U3CA 3RHTA 3TW0A 1K97A 2V7VA 3OUTA 2MU1A 5CD1A 1Z68A 1P7PA 2F3PA 2OWEA 4RSMA 2W2NA 4YRCA 2Q2OA 4UHBA 1Q57A 3HJUA 5F9MA 4ENVA 4IV0A 1S8OA 1XDDA 2JAQA 4LZWA 3A70A 5F5LA 3UOGA 4FLFA 4OHZA 2VK8A 4C3VA 3D5QA 1E3MA 2NO5A 3CONA 2E1RA 3LBAA 1V8FA 2MJLA 2P9GA 3E27A 3I8OA 3KFLA 3R0ZA 4DB4A 3GRYA 1USGA 3DZIA 3STWA 1HOXA 4WCFA 1XA4A 2B9VA 1ZZEA 1VHTA 2O6LA 5HA5A 3K4HA 3KKQA 121PA 1G9TA 1MAVA 1Q1EA 1TZMA 1N2JA 1W1WA 2YC4C 3ABRB 4L85A 4MVJG 4AUKA 2PANA 1XZNA 1N75A 4I4NA 1AX9A 4Y2SA 3DO6A 2WB2A 4M8KA 3K0SA 4HVAA 5CYGA 1CETA 2OO3A 2Q0SA 3KS9A 1BN6A 4G4JA 4E5SA 1U2PA 2GPYA 4EGFA 4HNAB 3AF4A 1UQUA 2IYEA 2YS6A 3ZHZA 2C7BA 1GCGA 2R8EA 3DCIA 4C3UA 1EQ2A 3ZV7A 2HQ1A 3K0BA 4P2BA 1LJ8A 1YZGA 2ZYVX 3DLCA 3PFBA 3HHPA 2ISQA 4X1KA 3EY4A 3THYB 1AZTA 3VISA 3AEKA 3QHQA 4YHBA 1K6MA 5TE9A 2JZNA 2OQIA 1SVMA 5DNEA 5KSWB 4NU8X 1SC6A 1VTKA 1SWVA 2JGMA 2PX3A 3EGDB 3OJ0A 4KVZA 2QP9X 4XIFA 4OX9Y 3L2OB 3RF7A 3T1NA 1DC6A 4KMRA 4IIJA 3UB4A 3GRUA 2GTIA 3Q4GA 3AHEA 1RJGA 4JELA 4LJ9A 5E8RA 1MJNA 5C31A 2FJ0A 3DPIA 1LLFA 3ZWXA 5JALA 3VR4D 1F9EA 1XLUA 5E9JA 2OZVA 4QRIA 4NXNB 1XFDA 4FSXA 2GAIA 1W5BA 1EVJA 1WB4A 3LNCA 5H1YA 1NVGA 3PLNA 2NUTB 3BWDD 3IBFA 2L2QA 1B15A 5BW4A 4XEHA 1X7YB 2Q9AA 3H5RA 3UANA 1A9OA 3VO1A 3IFSA 1A2BA 4TROA 4UPEA 1PQWA 2CXSA 1E6MA 5DGCA 2HA3A 5JPDA 3QF4A 1RRMA 1ECCA 3FKSA 5JXIA 5ERGB 1VHLA 4OBWA 3FXAA 4HRYA 2GILA 1GPYA 5KC9A 2WZBA 2NW6A 3GZTB 4XVRA 5DX1A 1M6YA 1ZZGA 1GAWA 1RI3A 2RHRA 1E2DA 1X94A 2B92A 3U7EB 3LXXA 1TZCA 3SF0A 3SYRA 2NTEA 3BC1A 2E5LB 5ADWA 4HR7A 3CF6R 4G5RA 3WX0A 4DS3A 1H0RA 1KF0A 2LRHA 2ZAYA 2WNIA 4BB9A 2AC4A 2CUZA 1CHNA 2R8ZA 1VM6A 1D0IA 1T9GS 4FFWA 2W2VA 5A9RA 4FN5A 4CMIB 2MSDB 2ZRAA 3A0UA 1PT7A 2DTEA 3DHYA 4MX8A 2P5SA 4P82A 1BE8A 4R54A 4L5YA 4TTVA 1C7RA 2P9ZA 5T57A 4B6PA 3PFHA 2QJFA 5EIHA 1NYTA 1U2TA 1BXRB 4LRXA 4WNAA 1N8NA 2IYNA 3H9BA 3P1JA 4PWYA 3GNTA 2J3DA 3L1JA 1HC7A 5CLFA 3KLOA 2C7VA 5H80A 1AY0A 2ADFA 5GTDA 3WYGA 5LXTB 2CK3D 1EVQA 3D4PA 4JP8A 3HB9A 4BFTA 2J6BA 5L7TA 2AMVA 3H8WA 3KTFA 3KUUA 4ZJUA 1A8IA 5AR1A 3Q9LA 2QYOA 5A9SB 1U2RA 1BHJA 2IP2A 3H2JA 1EWKA 5CIWA 4FX2A 3LPCA 1INLA 2VNJA 3RJZA 1FP4A 1EWVA 4B74A 4E13A 4Z49A 2XUQA 4BMSA 1U81A 3PFKA 4XFDA 3M4YA 1SIUA 2G07A 3IYLW 1WY7A 3RVLA 3C6KA 2BUAA 4IM7A 4JB8A 1FTNA 5E2AA 4GZMA 2A9QA 3NT2A 7GPBA 2NZWA 4ES6A 3I52A 1UM8A 3F90A 3QUAA 3OMLA 4PC3A 4HJRA 4RH1A 2AK3A 3FX2A 3HV2A 1T4DA 2G06A 3MRSA 3HMQA 1Q12A 5NULA 4EHJA 3NHRA 3DYVA 3T3DA 5JMTA 4D6XA 4DAEA 3LA6A 3FIJA 3HXKA 3OZUA 2X4IA 1GZ5A 1UMBA 3QLUA 3QHAA 3M4XA 2LPMA 2Y0BA 3JYPA 2Q27A 4IMJB 5CFNA 2WHEA 1GA1A 1N0VC 5J1SB 4MWBA 5CVEA 1QB8A 2RHLA 2JD2A 1FFXB 3DZGA 2Q5EA 2C4UA 1Z0FA 4LQCA 5J5CA 1A9QA 3WLJA 3N70A 3ND5A 4Y2YA 3BHIA 4M36A 2DWCA 4AKHA 4U9UA 2HMYB 3CEAA 5A1JA 2RB4A 5CVTA 1S2GA 3HDQA 4KZKA 4F2GA 2P2GA 1WG8A 2BFBB 2Z8YA 2APJA 1SU7A 1WX1A 2QF7A 4TQGA 4EB6A 4B3MB 4QC2A 3SXJA 2JFXA 2R7MA 5H3HA 1T5DX 3E15A 1DAEA 1ZBDA 5HWSA 4WLVA 1AUVA 1X13A 1KOGA 3NIWA 1XT6A 1QKJA 2YMPA 4XRGA 4HNQA 4S3MA 3PFIA 4M88A 4DMCA 5M3BA 3ZD7A 5EL0A 3BXGA 3D3JA 5BVHA 3I58A 3RKRA 4ZN6A 5IFLA 1G8HA 4BAUA 4R71A 2Q1UA 1A88A 1Z5PA 2VHCA 5FL3A 1Q0PA 2BUBA 3R7FA 3OP1A 2ISSD 2VJKA 4IKEA 1CERA 2HT1A 4XX1A 4BO0A 5I8PA 1XDUA 1T3TA 3WLLA 4KEAA 4TVOA 4D5EA 3NNDA 5F1KA 3TINA 2XOKD 3ETHA 1X15A 1YDEA 4C6TA 4KBGA 3DFMA 1E6LA 1COZA 1SC9A 2CJWA 1PGQA 2XKBA 4P4SB 5CK5A 4XQEA 3NVKI 2OOSA 2OO7A 2CHVA 1CUDA 1U7ZA 3SZMA 1I5RA 1A97A 1VSQA 3LK7A 2ZUDA 3GJ4A 4AL4A 4Y2GA 4EEZA 5AW2A 2RGUA 3ZZTA 3F2IA 3IAM1 4EY4A 1I3NA 4JROA 1H2ZA 3GY0A 4G1EB 3VTAA 3KE9A 1YMUA 3ROZA 3OF2A 4MR8B 1M2OA 5KI6A 3O94A 4ZU1X 2CW5A 3P9SA 1Z08A 3KEQA 1T0JB 3IPLA 5ALYA 4LC1A 1D07A 2YHBA 3CUKA 3V8NA 4Z4EA 1HEYA 2B8WA 2YWCA 3U3KA 2W43A 3OE1A 4D8VA 3WZ2A 4DA0A 3H6HA 4OB8A 5EMJA 2A86A 4ZOEA 3EXEA 1IL0A 2HRBA 3COSA 4NSNA 2E4ZA 4S2EA 3KSZO 4DMMA 4KB5A 3QHPA 2R6JA 2VOEA 1FA9A 3E6AA 3CSUA 2DGDA 3G2OA 4G9GA 2OQVA 3DE4X 1YFLA 5JUWA 1IAVA 3IQEA 4F5DA 2F9LA 3QX8A 1IBMB 1D2RA 3PS9A 1AM4D 3QJYA 4C87A 4B5KA 4C20A 1V37A 1EA5A 4CI9A 4OSPA 2TECE 4EGSA 3HKBA 3L5OA 1C0PA 3MINB 3R9IA 4RKEA 3ZCQA 3JQGB 2GZ2A 4ZCIA 1LS1A 2FVYA 1Q19A 5K8IA 3KQQA 2WTMA 1U90A 3FE2A 1RHRA 4G81A 4KMSA 5FA6A 4U63A 3PNMA 3EFOB 5BN3A 4PHCA 4Q4CA 3KOUA 5J1TB 1GVHA 2WG2A 5HIKA 3C74A 3EGOA 4PFSA 2R6FA 1YJBA 3KEFA 3U4QB 4MI3A 4EUNA 1Y3HA 3W7BA 5BSUA 4ZXFA 3I62A 2NN3C 1YMQA 1K66A 3BRWA 4CFYA 5BSGA 1ZGGA 4IMPA 4CEIB 2XIJA 3A4MA 4F3YA 2RAFA 1E5LA 2WWIA 4GZLA 5EWJA 4HP8A 4ZDJA 1CJCA 5EQFA 7YASA 3WKAA 1E2KA 2X0RA 4K6OA 3SHWA 1C81A 1X7WB 4X45A 5ADHA 1JR4A 4PTYA 3W3AH 3YASA 1R5JA 3AEXA 3CRRA 1YA8A 2EHDA 3B3GA 2CJFA 2HJSA 2UYYA 1C5KA 1AB5A 3CCBA 1A96A 4O2BF 4YUVA 2CZQA 3WRYA 4A82A 5I7RA 2F4VB 1CJTC 1K7FB 3V7WA 2OZKA 3E2IA 3O2SB 1ITZA 2EYUA 2L17A 1KI3A 2FW9A 4HFNA 1I8TA 3BQNB 4ZVLA 2WD8A 2RAVA 1Z7EA 3GX1A 1L7EA 5KEIA 4NVRA 1UBLS 1GA4A 4MS1A 5F35A 3DOFA 1JQLB 2GTPA 4YRLA 3FCCA 3QFTA 4LVUA 4YRRA 4Q3KA 1AGNA 4LGYA 1VE9A 2RH5A 4LCEA 1LDBA 1II8A 1HGXA 5JEEA 1I4DD 3AVQA 2CB9A 3BD9A 4EI9A 4JSRA 4JLAA 2W4MA 3JQ8B 1O6FA 1OHHD 1KIMA 2FB9A 2RC5A 1Q1AA 1LSUA 3WFZA 4E5YA 5JRZA 5KYUB 3BBLA 1XZ8A 2C4WA 3OG9A 4TYWA 4BRUA 5LCXA 1X1TA 5CDHA 1RCTE 4XDGA 1P1JA 1T5HX 1NRXA 4RJIA 1P1CA 5ECGC 4B3XA 2CVPA 5GJBA 3HP7A 3OIGA 2PBFA 1LLUA 3BL5A 1CZRA 1U7UA 4OHCA 3DV0B 1RZUA 4FTWA 5ES4B 1F3LA 4MUJA 4UE2A 3UJNA 1YQWA 4YRDA 2ZI6A 3ZY5A 5A3JA 2O54A 2RBEA 5EIBD 1JEDA 1KY2A 1C4KA 2AI1A 4PRZA 4S0XA 2FWJA 2JRCA 4PLCA 4FDUA 2VP2A 1M6EX 1CDEA 5FPPA 2FWMX 3QELB 1VCHA 3C8ZA 4AC9A 2F1OA 5T8KC 2IYTA 4J1SA 5DM0A 3DZFA 4PLVA 1T3SA 1VG0B 2Y1XA 5CFLA 1G21E 2VAPA 4XQ0A 4Z9XA 2V7PA 2IXTA 4RKRA 2KS6A 3UT5A 4MWSA 4J29A 1DV2A 4MWZA 4ZEWA 1PT6A 4KYUA 4OVKA 2B98A 5CT9A 3WE7A 2V65A 2IH5A 4GRAA 5HK8A 1Q83A 4X44A 1RVV1 5HNKA 2ZPTX 2HRCA 3C2QA 2R6AA 4TTIA 3CRNA 3N7AA 3S29A 2A7XA 1XRJA 4U7FA 3VZSA 1M34E 2P62A 4EB3A 1ZCBA 1LW6E 2PUFA 1TGYA 4RD1A 1UDXA 5EPEA 5KB3A 4QTXA 1DINA 1U8FO 2X0FA 4RWZA 1RCUA 1I4LD 3ML1A 3V33A 4D80A 1RYEA 1DWUA 2RK4A 3F5MA 3T3OA 2D1QA 3ONDA 3OWXA 4UKDA 3UK2A 2QZ9A 2GA8A 3WLTA 1XRNA 3PR2B 5ESWA 1LVGA 1VSVA 1RE0A 5F33A 3ZBUA 5C7YA 1U1EA 1V9LA 2AJBA 2PL3A 4JC0A 1P0QA 3C41J 4LJ5A 4Q6BA 1K08A 1TCVA 4RGVA 1SOAA 3WGVA 2FEXA 5KTRA 3QYPA 1V8BA 2NYVA 4G0YA 3BSYA 3TOSA 3G85A 4DA8A 2XT6A 4XEUA 1KYVA 4NK5A 4HB2A 3QGMA 2IYQA 4NR0A 4GHWA 2H07A 4F8EA 1TKCA 2PIDA 3N8KA 4CMKA 2AOTA 4FWBA 3N2KB 5DULA 5FV7A 1TYBE 1M76A 1M2KA 2VL7A 3I23A 4M0UA 4RJJA 1PSZA 4R16A 3WAGA 2BTQB 2O5RA 3I2IA 5EJFA 4ZT4A 1QV9A 4TL8A 1KZHA 3UHAA 5KHOC 2V59A 1NMYA 4JVMA 3AP1A 5IFKA 1Y33E 3FD8A 3LZCA 4LYDA 3RYHB 1MVNA 1RRVA 2F3QA 5DIFA 1WL8A 1DXQA 2C78A 1R18A 1IVSA 1JIJA 1KJQA 4MWEA 5K1ZA 5KHAA 3DL4A 4RVNA 1IBRA 1K92A 1J7JA 3MMNA 3AO0B 1FRQA 3FCAA 3VUEA 3MS2A 4JK3A 4QJ4A 3Q7IA 4TQUS 2A58A 2QBYA 2O8BB 1HMPA 3RH0A 1F2TB 2VHYA 2QAIA 1I4WA 4GLOA 1N6IA 2IY8A 2J5XA 2QN1A 3O90A 3NHJA 4LYEA 5DBIA 4R8SA 3N0RA 4KVFA 1LBEA 5EE3A 3TTVA 3UG7A 1ORRA 1KYIA 2R8YA 1L8XA 4PHGA 1Z07A 4DXAA 1TW3A 2XCLA 1WKVA 2QIPA 2V6MA 4IO0A 2XCOA 5DHPA 4GI7A 2RHCA 3FLEA 3SEAA 2WRZA 2EF1A 3J81A 1WOYA 4OA5A 3HKDA 3K72B 4JCCA 4HJXA 2Z8YM 4E51A 4UE3S 5JYEA 4MI9A 2BDEA 3Q12A 2EAUA 4DZRA 2YV1A 3GZ4A 3T7CA 2BUCA 2B82A 4NYIQ 2B94A 2Y1LA 4RKYA 1P60A 4YIHA 1N2OA 3QMPA 1HKUA 1PV1A 4B76A 4JB3A 2VJAA 2HI0A 4BZQA 2AZDA 4F2WA 4C4YA 2Q46A 5ENDA 3A9UA 3FR8A 2C9DA 3QBDA 1DMRA 3O3CA 2QL5A 3ZNOA 4EZIA 4FJ1A 5MGBA 3HR7A 3OX2A 2EU8A 2BOVA 2WTEA 3ESDA 1KFBB 5LL6P 4HLCA 4ZOAA 3ELYA 1CK4A 4AWBA 1U7DA 2JFYA 3A1TA 5G41A 4MJ3A 3G6KA 2A5GA 2WMNB 2YZGA 1JLMA 1N5IA 4I1RA 4KC0A 3PDHA 5FLYA 4B8YA 4EAAA 4CLEA 1AF4A 2C5LA 2J0UB 5AI4A 2ZBQA 3HBNA 3I9V6 4ABTA 2FX2A 1QP8A 4R9VA 1H8HD 2WQZA 4NCXA 1V43A 1CRZA 1F2UB 3DKKA 4P53A 2R1ZA 2PQ2A 5L4LA 2HWXA 2IBSA 2ACWA 2CXPA 2B61A 1A5AB 1XQ6A 5DO9A 1SOMA 4ZZ1A 3EZ9A 2GA9A 1Y5MA 1E2FA 1NQUA 2JRLA 2VATA 1P4GA 1LLCA 4ESOA 2JBHA 3PDUA 4E11A 3HKEA 2QMOA 3PA8A 1O95A 1ULUA 1H9AA 2IWRA 4Q7KA 5L3QB 2H4XA 4NBKA 4DQVA 2CEAA 1PZHA 3D7LA 3DBLB 3QVWA 4TSFD 5CURA 1L8LA 3OY2A 3NAZA 3VTFA 1ZOPA 1P7VA 3ET4A 3WHLA 2GAFA 4Y18A 3TSAA 2PMKA 4WXPA 4AY5A 5AKZA 4NZOA 4WFIA 1Y9DA 2VZLA 5F77A 4R8MA 5BSMA 1EX1A 4OAQA 3ZTWA 4OMDA 1REQA 1H6AA 4ETWA 3BA6A 1AOXA 4GOKA 1KSGA 4Y8VA 3AC0A 3BB4A 3MJFA 5C8VA 2ZI5A 4LJ8A 4MVJI 2R65A 2DH5A 3F4KA 4F8JA 4YRBA 1L4EA 3Q7TA 4MV6A 2DETA 4D2IA 1JFTA 1SOVA 2W9XA 3SEZA 3OJEA 2ORIA 3QBTA 4FYIA 4MYUA 2JANA 2O19A 3QXSA 4IJWA 2WIBA 1A9TA 2QLMA 1IY0A 2WB4A 1C9NA 4RS4A 4XDYA 2DFPA 3ZD9A 4BNDA 4DW8A 2VDOB 4BC0A 1T4CA 1AGYA 1CULC 2Z08A 3KQMA 5EKUA 3LBIA 3IEXA 5JAIA 1XN4A 1CQPA 5IC6A 5LQKA 2IKQA 4QHYA 2J6CA 1CRWG 4XVUA 1EK5A 2AN9A 4WL0A 1PFGA 5ULLA 2Z9BA 4N4AA 4IXMA 4PGHA 4EQZA 5JQGF 3WNBA 1ZOSA 2IOQA 1ZH8A 1VRWA 4UM7A 5I4BA 4N7BA 2FMKA 1F1BA 5KNDH 3BSSA 3LUKA 3LP6A 5EMNA 4ZU3A 5HKOA 2F67A 1B2LA 2GKSA 3DNMA 4HUQA 5ALGA 1G63A 4B3HA 1A1SA 3DEIA 4EHFA 1ZS9A 4R3WA 3NMUF 5AJZA 2CLHB 4GT1A 1JXQA 3FCEA 4ZZ2A 5C51B 1KI2A 3AV0B 2PO7A 1PSDA 1X2EA 3DYBA 2AEJA 1GLNA 2VHQA 5BNZA 3EZGA 4HEA6 2RC6A 3FNIA 3H16A 5AT1A 3KYCB 2YQ5A 4IAOA 2BRUA 3GJ5A 4H1WA 2XH8A 1L5HB 1HMYA 2MSWA 4RSRA 3WHKA 3UJAA 1RAIA 3NS7A 1OWOA 4WY2A 1LPAB 1A7UA 1JPVA 2P75A 3KETA 4DGQA 1PT8A 2JATA 1EXWA 4F3KA 1GLGA 4BP9A 3HA3A 1ZO8A 2RB5A 2FUEA 5KU1A 2HRQA 2OXIA 2Y66A 5ER6A 2W37A 3FPAA 2V3VA 3D6VA 1QF7A 4N8EA 5EFZA 4BMYA 1XKTA 4G37A 4GMFA 1EAYA 4L2IA 1L8QA 5EP3A 4BKQA 3U4AA 3FCUB 2VPXA 2O5EA 4NDAA 5THQA 2CFRA 3UYLA 3VVMA 3ZWPA 1QX3A 4B48A 5CDSA 3WK4A 1JMVA 1YUBA 3GPBA 3ZPXA 1V96A 2Y4NA 4BRSA 4ZXPA 2I62A 2Z57A 3I34X 4GC5A 4JBLA 3LC2O 4L4YA 2HV9A 2OM2A 5I9BA 4EB8A 1KQGA 3R24A 1FSFA 1OQAA 1D2CA 2M1XA 2NX2A 1L7AA 2VBCA 3QNWA 1R66A 2BZ0A 1VYHA 2GDJA 2JFNA 4NMXB 4BLWA 2QX6A 1FOEB 1BGWA 4PYNA 4TVSA 4F21A 1T4MA 2ZDHA 2QTHA 4ACAA 3K0EA 5L9AA 4Q48A 1TM1E 1Z34A 3OQBA 2GEKA 4RQAA 3TDMA 2DHRA 2Q49A 4EMSA 5DK6A 3UPUA 3GG2A 1W0CA 3EZFA 2QAGA 4D9EA 1IVNA 2G5GX 2NSHA 3P19A 5BV8A 1MPXA 2ZIXA 1XX6A 4XKJA 1TZKA 1QO9A 3I3OA 4XTRA 2PX2A 3RRXA 5FTNA 1XYVA 4GL2A 2VYFA 1FY2A 4UULA 2Q07A 5FI5A 1Y98A 2QVZX 3PG5A 1U1GA 4UPDA 4DBLC 4X9XA 5HUQA 1XXHA 2O4UX 2VH2A 4YDRA 3JAWB 2JGAA 4A0QA 3VSAA 1FFCA 2HA2A 3NM4A 1W49A 4D3FA 3QXHA 4EUSA 1WB9A 5LBIA 1EMDA 1R5NA 2HDHA 3CNQS 4W5NA 3GCGA 2ZP1A 1Z4IA 4NCNA 1WVMA 1WLSA 1KMMA 3W4JA 2J0QA 3X1KA 4J49A 1PV2A 3LUJA 2NU8A 3KTAA 4LI0A 3ZYCA 2GZSA 3B6JA 5JMOA 1C1DB 2GM9A 4DLPA 4EI7A 4QPDA 3UXMA 3SQXA 2Q6VA 1XHFA 4UAJA 2HRDA 2C99A 4CMEA 1QYVA 1TYDE 3P2YA 5BWCA 3HQ4O 4J0HA 4V1CI 5JJIA 4B3TB 3BXEA 4FQ7A 1TI7A 4KGXA 2RHWA 5BSRA 2GPJA 3W5UA 1HK7A 1YQUA 3BWXA 3LUHA 3LLSA 4YBRA 3PEWA 3IAS6 2BHRA 4G0UA 3PVSA 3S7TA 5JQWA 4G1CA 4NC9A 1ZVVA 1C9YA 3EA5A 4F8YA 5LQDA 2C2XA 3W7AA 5I4IA 2F1IA 1H93A 2FZKA 1Z8HA 4RDCA 3BSFA 2ZB4A 4UAGA 2EX1A 5BYKA 4TXHA 3N0VA 1X1CA 3SIRA 4L78A 2M98A 2ZJ8A 1Y8AA 3FYCA 3OPYB 2YHIB 2GBFA 4GLJA 2DLNA 4DIDA 4WQMA 4KYVA 1D1TA 2X8JB 1SA0B 1JU4A 1XRLA 3R7WB 4MH0R 2R6ZA 1ETUA 1M7GA 3M9XA 4JQSA 4R0NA 1JALA 3AUTA 1JHOA 5DLPA 4YUYA 2X9GA 2HCRA 1IHPA 2XGOA 5BORA 2ZXUA 4ZO4A 4J2OA 1P7CA 4CBVA 3IODA 3ZKWB 1XVTA 2HSGA 3BFPA 3EA4A 4QLOA 3F78A 1TEVA 5FEMA 3ROGA 1HT1E 3ELWA 3N5KA 3TZQA 1LBSA 4LNUA 3GFSA 4DARA 4DRYA 2O6HA 4PLTA 2R97A 3NWJA 4ME6A 4FI3C 3EEBA 2M32A 2GF9A 3BXFA 3I4FA 1T3HA 1JEOA 3MGBA 2AKEA 1RKQA 2VP0A 3O93A 1IQRA 3DDUA 3ASVA 4ZOQI 1SXJB 5IH3A 4DLWA 4R84A 3F7MA 3EHDA 3P96A 2Y2VA 3EVDA 3HYLA 3LH5A 1LA2A 5BSKA 4LC0A 5GONA 3A9RA 2ZUWA 1WCXA 2G7ZA 3ZGNA 2A2ZA 1JDSA 1IFXA 1XHEA 3H2KA 3LF2A 1HLDA 1QHYA 1YRWA 3RTDA 4FKZA 4DQ0A 1FFYA 4XX0B 4QATA 1UOOA 2G0TA 4RA6B 4G5YA 3G0IA 3Q1LA 1Y6QA 2PUCA 3T7AA 2DWUA 2C3MA 1NPTO 2H5EA 2JJ1A 5JOQA 2ZJAA 3ITKA 3SPXA 4IH1A 5GAJA 3DS8A 3KOOA 4BP3A 4NIMA 4KTTE 1F0NA 1YNSA 2ZLBA 2A67A 2CHQA 2WABA 1ENPA 3D0QA 2WHPA 1QTIA 3TECE 3CM0A 1WXQA 4WZZA 3RT1A 4TS9A 5E6RA 1K2WA 4WESB 3B5IA 1MAHA 4I6GA 4KH0A 4RGQA 4G23A 5FHRA 4L9RA 4YX9A 3EGXA 2PYDA 1RQNA 1Q91A 3IDSA 3QKTA 4MPRA 5AVVA 4JLOA 1EFUA 1Q1NA 3IMFA 2XVYA 1IXYA 2JI9A 2W5UA 4N41A 3SYTA 2YIJA 1JHUA 1PS9A 1NTOA 2P9TA 3DBVO 4J9UE 4J0EA 4KUEA 1M1YE 5IZCA 3F7NA 3HNPA 5EJMA 4DV5B 3PUHA 1W2HA 1VGVA 1DUVG 3B9RA 4DB2A 3ZI4A 3EEIA 3KOWA 5GVRA 3VYWA 1UWKA 2B35A 1G6OA 5AKGA 3OJXA 1MT3A 1XVLA 2IHVA 2L19A 3GH1A 3IKJA 3OP4A 1QGAA 4CCSA 5A0TA 2PSJA 4GWLA 2GEFA 2H4ZA 4KQMA 4ZMSA 1KZ1A 1TTPB 3WRXC 2EJVA 1EGAA 1NQXA 1RJFA 2OM6A 3BAZA 3CEMA 3D7NA 3JQ7A 4MITA 2H2GA 4P4UA 4QWMA 1DX9A 3X2FA 4A6EA 4EYKA 4HEJA 3EIOA 3LUPA 1SXPA 4FVTA 4LKRA 1U8EA 1XQYA 3AVVA 1MNAA 2MT9A 3CZ4A 1F8XA 1TU0A 3CUTA 4A2WA 3WJ1A 1TA9A 1XQVA 3WMFA 4YR9A 2HR1A 3T5GA 5DHTA 2XWPA 3JVVA 1RC8A 3RWBA 1LCIA 2BONA 3LV8A 3KDPA 4MKZA 4BFVA 1G21A 3BJRA 1Q95A 1V0JA 4LN1A 5E6UB 1IZ0A 1XPRA 5DVZA 5HF8A 4ED9A 1K5HA 3PXCX 2XCUA 1L8AA 1RWWA 4W7SA 5DCWA 1KBQA 1BXGA 3L8EA 1XMPA 4X93A 3QQ5A 4MA5A 1BD4A 1Z35A 4F6RA 4KV9A 5ALOA 4C01A 2ZM5A 1G3IA 2Y92A 5JNWA 2BGTA 2CLOB 4LOHA 4PZLA 1T15A 4Y30A 1TJ5A 4NRDA 4LXTA 1HTTA 1JT2A 3RWOA 1PJLA 5L6LB 3OIUA 1GYRA 2F1JA 5HZHA 1Y7PA 3T95A 1L7DA 1Z28A 2E6UX 5EXDA 1JDTA 3V00A 1NZFA 2DPLA 4NULA 4U2KA 4W5QA 3CX7A 1R9NA 1DCKA 4M1EA 1WBBA 1A2OA 1KZ4A 1QIHA 1XJ5A 2YW2A 3WIUA 2XXAB 1IPFA 2WI8A 4DCVA 3COWA 1GG2A 2JAPA 2UDPA 4WBNA 1AC5A 1GZSA 3GN1A 5SYAA 1YIDA 2PA0A 3ZGYA 3CZRA 2FR8C 2O23A 4MV1A 3W5IA 4G9BA 4YCBA 3BMQA 5ELLA 2Q1YA 5JASA 5LA6F 3RBVA 3I5YA 2QL7A 2PGDA 3U9LA 4K3VA 3RADC 1EVIA 1SC1A 1WXFA 1PBNA 5B5SA 4P3NA 3W7VA 1BO6A 7ABPA 1RAFA 2B1IA 2CCGA 1JI3A 1K4KA 3H6GA 3L8ZA 5IK2D 1MJFA 4PO8A 3VSEA 3RAEC 4LZPA 1WO8A 1W0KD 1Z0SA 5GP1A 1M6WA 4CG0A 4D8XA 2XA1A 4UARA 2OFFA 1IG0A 3VDQA 3CZCA 4RYDA 3B53X 4D8WA 3PV0A 3W9SA 1K8QA 4E15A 5B7GA 2WHQA 2QG6A 1XTTA 2B0JA 2WD7A 3R4VA 4Z99A 3PEFA 4JJAA 1H0KA 3VR3A 3FW1A 4I50F 2JIDA 4A36A 1QIDA 3KCNA 2V4ZA 1NBEA 1XD2B 4GBED 3LBYA 2HJHA 4NPHA 5BSVA 5BUZA 3NKVA 4HX9A 4KQFA 1EE2A 4I14A 4EF6A 5BRAA 1OI3A 1R0BA 3GI1A 5D5PA 1PX0A 1SKQA 3W5HA 4EENA 2P8JA 1YE8A 4BVFA 4IJVA 1JMYA 1TCAA 4V39A 3CNHA 4GOOD 3G9ZA 1IZYA 3HYRA 1HG1A 2BHLA 2J5KA 4TMXA 5D3MA 3LECA 2VJLA 3HWX1 4M7OA 1ZGHA 4C4PA 1WCIB 4ETNA 1E6CA 1KERA 1YBFA 4ILEA 2GM4A 3FUCA 1ABBA 3W8DA 3QKSB 4F4HA 1KEPA 3V4OA 3PE6A 5IT4A 2CE7A 1N9ZA 3LCUA 1QFYA 1MG5A 1KZ9A 1FDTA 2A0YA 2W6MA 1M1NB 2DUWA 5F1OA 3HBJA 3DEJA 4M46A 2ZATA 4N0DA 4PC2A 2QRHA 5HW0A 3OZRA 2O3SA 3PK0A 3AONB 2AOXA 4M0MA 2JLZA 3UJ8A 3QA9A 5JS8A 4S24A 2VJMA 1KI7A 3AB3A 2DQYA 1ZA2A 2C00A 3CF4A 1Y89A 1QHEA 4DMKA 1C14A 1SVSA 3PU6A 4WFKA 1W581 1C9KA 3BAFA 2H1IA 5FHQA 4XUGB 4CUJA 3IPXA 3IMEA 3I0MA 1G8YA 3I9KA 1X92A 2CNOA 4PEVA 1BWQA 3CE9A 1G4AE 2H08A 4R3UC 2RARA 1I80A 1AN0A 4MQBA 3CQ9A 5KWEA 3Q11A 2YASA 4OL9A 1H94A 4EZEA 3K6SB 2Q7DA 5E9QA 3W77A 1NBME 2I4IA 1IATA 3WGNA 4BO2A 2WIJA 2VBIA 4GQBA 3CY6A 4I2NA 1FU8A 5REQB 2XE4A 1X77A 2KM1A 3JZAA 2WDZA 2ZIEA 3RV4A 1TEZA 4Q19A 4XLTA 5IJ0B 4YAFA 4NZNA 4NZMA 5IZ4A 3T3MB 4RHFA 4EFNA 1T6YA 2BEWB 3K2BA 3KU4A 3UFXA 2JAUA 3G9XA 4TXJA 4YFYA 1H5QA 1RLIA 1GKIA 1SURA 3CSDA 1FC0A 3DWIA 4ZOLB 2IDZA 1I9GA 2QD4A 2PGXA 2VDNB 1DSSG 5FOUA 5H3CA 2C7QA 1I2BA 2GVNA 3RLIA 4ONEA 1FCJA 2HLNA 2FP3A 4YP9A 3QNMA 2ZRGA 1QHFA 4RFSA 4XGRA 1NMQA 1GUYA 1QH1B 3VSDA 3T3NA 1ORDA 1YHYA 1A5SB 1WXXA 1KJ8A 4DSAA 4ZJPA 3HLYA 1FMLA 3KR2A 2J9RA 4QFBA 4AP5A 2W2LD 2FOIA 5SYNA 3Q8MA 1RBYA 4TMFA 2GARA 1QDUA 3JS5A 3GCDA 3N6VA 5JQGA 4Q7JB 4ZYUA 1XMOB 3FTDA 3AVYA 2A8YA 1E96A 2GBGA 4P5EA 1L7OA 2O14A 4L95C 1PT9A 2IXBA 3FY4A 2OHJA 2NUPB 4MR7B 5ALJA 1ZWKA 2AEMA 3SYMA 1WXGA 3U9SA 5BQPA 3V4LA 3L5KA 5LWQA 3DD1A 3K9QO 4S1NA 4R1SA 2OD9A 3X1DA 2F3UA 3AU8A 2FSVC 3ACCA 2I55A 4QFDA 4BVKA 1MH1A 1T8UA 4C9BA 3U5TA 3WDMA 5DNUA 3KL2A 4IHJA 4JQYA 4ENQA 2C31A 1JR3E 3D1JA 3UG6A 3ZH9B 1AB6A 2HF8A 1GKUB 3FUUA 5AK3A 5AIBA 1RQXA 4GI1A 3BH6A 4FHFA 2XHZA 10MHA 3C5HA 4GZ6A 3SGLA 4EBBA 4GVPA 4PAMA 3R7BA 1NLUA 4A2CA 4KXYA 4N5NA 1IN4A 4D5GA 1MMFB 2ZYWX 1A7JA 1GZ6A 1TAHA 3NEYA 4FINA 2VK1A 4DSTA 1DMSA 3S40A 2UYHA 1RI1A 4JH0A 3FPFA 4C7OB 2GJSA 4U0JA 4OGFA 1GPNA 3V1TC 5E1MA 2HGZA 4BGDA 5CVCA 4FS3A 1TFRA 2VI5A 3OU7A 4HY3A 2CMKA 4GR9A 2ZRHA 1U2GA 4W5TA 3ZI7A 1BTOA 2AFVA 1O94C 2YRWA 4G4SO 4Y2RA 1II0A 3IBCA 2IV7A 3VHLB 3QVOA 1NQ5A 5CMLA 4D3DA 3VFDA 1VKNA 3DQQA 2PEYA 2R25B 1GQYA 1EE1A 3HXTA 1G5PA 4PAOA 3VR5A 4HNAA 2D13A 2NO7A 2IVFA 3MTJA 2BM9A 1Q0HA 1UPCA 4JOBA 1IN7A 3ZNPA 3CKLA 2GERA 2REOA 1N7IA 3ESYA 4ZT5A 4I3HA 3ZVMA 2FMUA 2RGWA 1FZTA 4PNPA 1N92A 2R6DA 1T8WA 4D99A 4UC0A 4LYFA 4AIRA 4EY7A 3ZLJA 3G2HA 3G82C 1TVEA 1KDOA 3BMCB 3A6EA 3L4BC 4FHZA 4M0LA 3WYNA 4B4WA 1H1TA 4FSDA 4PVDA 1T43A 1SCQA 2VF5X 3R0QA 2H3HA 3UOWA 1YB1A 5C8XA 5JBIA 1TLTA 3RC3A 4ECEA 5BT9A 2J0VA 1ESCA 3NBUA 2WE7A 3E7PA 4YRZA 1EGHA 2CB0A 2EWVA 4MUFA 3Q6MA 4JC4A 1I5EA 5T4HA 5HRUA 1D1SA 5CTAA 4UNQA 1PT5A 2CZGA 5ILQA 4KK4A 2NUTA 3ZZ0A 1SRRA 4JQCA 5CUQA 2BM8A 1X7YA 4YUXA 3Q6IA 4U7JA 2WWTA 2Q2WA 4HX2A 1YK0A 2BHTA 1PS0A 2R47A 3A4VA 2C5BA 5H59A 4QVKA 3U7QB 3IOMA 3NR2A 1EIWA 4Q3EA 4HDRB 1JJ7A 4WCDA 5JDCC 1JTVA 1G3UA 4NCIA 3JYQA 3JQ6A 4TXLA 2WA2A 4NBVA 4JZYA 1R0SA 4Q24A 3FHTA 3QWAA 3MJCA 1T0UA 2BGJA 4O33A 4P84A 9MHTA 1DHRA 4IJQA 5CX1B 4FM9A 3HA2A 4LZJA 1FW6A 3JPYA 1DQNA 4DG8A 5E8JA 5FV4A 1GFIA 3EZLA 5I9LA 5B3JA 1OXXK 2CFIA 1ZWLA 2PKWA 3U4MA 1G8AA 1GVNB 2D0DA 1EX9A 1EVYA 2C2KA 2R60A 4MZDA 4D9BA 3GLTA 4G63A 1AK1A 2P2NA 4I19A 1N78A 1ND5A 4XH9B 4Q05A 2BHNA 2Z9CA 3CIFA 4GD3Q 5T6MA 1SXHA 4GI3A 1ZIPA 4LRYA 3DOEA 3TW4A 3KXPA 3KJEA 3AJ8A 3D2BA 4CMHA 2FQWA 3GGJA 3LXRA 3PC6A 4QNRA 4BNMA 4BX8A 2C88A 4G07A 4O4IB 2GLXA 4X20B 4IY1A 3EXAA 2YXDA 3HFJA 3GRFA 3CB4A 3MT7A 2BFAA 3MVEA 1YULA 2VP5A 2J7PA 3TMYA 2HZ7A 2Y1CA 4DDWA 4MCIA 3CCFA 2Y1FA 4IRMA 3ADOA 3SOPA 3UCXA 5LXTA 3TH5A 4V0LA 4DCNA 5G53C 2EV9A 2OE2A 4RHEA 4ADSG 5HPYB 2V7TA 1N5KA 5A2GA 4M7RA 4DMGA 3U60B 1KK1A 3I39X 3CTMA 3USCS 1X7DA 4IIXA 3U7RA 1DBVO 4RV5A 5TEVA 5A9SA 1JPJA 1EM8B 1RXUA 3E8SA 4G0XA 4AMBA 1JTEA 3I2KA 3QI7A 2X41A 1HI9A 2G8NA 3INTA 3SR0A 3V9AA 1E9DA 1Q7BA 1PR3A 4REOA 3PPXA 4I8DA 1CIJA 3K20A 3ETGA 2ZTUA 5KYKA 3EFHA 3IDZA 1SY7A 3SK0A 3ZQ6A 4EUFA 5A7GA 1OH6A 1HDEA 3I09A 3RG8A 2QSUA 1LH0A 2DLCX 4N3GA 4EFLA 5KMGB 4K8RB 5DEIA 1G20E 4ZAWA 5G0SA 1U9JA 3ENVA 4TV8B 1KWGA 4DHEA 2OGZA 4UU8A 4C4OA 2IEYA 2BW0A 5JD5A 3BDVA 1KAHA 2R7LA 1GZHB 2DVMA 1W76A 1XTIA 3KSBC 4YRTA 1FFXA 4ZFNA 3TTWA 3FMOB 2AH5A 2JGEA 1TU3A 3C87A 1VSUA 2QLTA 3HE3A 2J85A 3FCYA 3OEHA 3T5PA 2B4TO 4XARA 2ZB8A 2NV2B 3GUVA 2FEKA 3OM9A 4JX9A 2BFBA 4ALKA 4UHEA 1P81A 2YNMC 2ZPAA 1E9FA 1UKZA 1SIWA 2AEFA 3OTIA 1N4DA 5JC1A 5IT0A 5F52A 1A9RA 5J2UB 4C0BA 1FEZA 4G0QA 4N5DA 5AJTA 4WOKA 4REMA 3P97A 3W8FA 3DL0A 5IDXA 3AFMA 4PY2A 4EYGA 3QLVC 4OHVA 2AC2A 3PFWO 3UBTA 4UCFA 1Z0KA 4M1ZA 4XSGA 4QOIA 4TKLA 2J3JA 3V1YA 4I46A 4P22A 3O4GA 2XNCA 5DYYA 2Q3BA 4W9NA 1QH0A 3V8VA 1NE7A 3CT6A 3W2TA 3TX2A 4TLCA 1WPXA 1Y3AA 2WWWA 3LO8A 3VR6H 4JJZA 1JG3A 1RXVA 2ESRA 2HSZA 2V8BA 3CGGA 1FSGA 1Z2CA 1V5FA 2P9CA 2R3SA 3CUEF 3OLQA 5DGHA 3G3EA 3VKVA 3ZXSA 4K6FA 3IQFA 1U3DA 2PS9A 2G40A 3CWZA 4CTMA 2D5BA 3MTIA 1VI2A 3TL3A 1GV0A 1M1YA 1PQUA 2I76A 2A5YB 5U9CA 2C2MA 2FSSA 3NDPA 4P4SA 4LQLA 4MDHA 3G8CA 5DWDA 3GMIA 5CPBA 2EP8A 3U7JA 3WNDA 2EP5A 2YWJA 1ZUD1 1WY5A 1D2GA 1YR3A 2OGWA 5HQJA 4PRLA 3D4LA 2PSHA 4M0EA 3SKYA 2Z6AA 1ZINA 3OBIA 2XEDA 3DW3X 4QVGA 1ZD5A 2QENA 4MR8A 1CS4C 3M4ZA 2P2YA 5FOWA 2WKQA 1T4GA 2ECPA 2ON6A 1RIIA 3DXXA 3GCZA 3IELA 1N0IA 3OT1B 3IQGX 4F1WA 4MGEA 2ROQA 2VR1A 1NSTA 1XB2A 1I32A 3NJ4A 4IEIA 4J76A 4LI3X 5HR5A 5F98A 3P32A 1BVHA 3ECAA 4ND7A 2IYLD 1PJ4A 2OUIA 3AR8A 3K0FB 1XL0A 3KDAA 5DNDA 4CUZA 5ILOA 4ZHQB 1MG0A 3WIBA 3ZWOA 1TNDA 1QVVA 2LXNA 4UCWA 1F48A 2VQDA 3B1JA 1JZSA 2O5VA 2E2WA 1H3EA 1H42A 3LPDA 2GASA 3KT8A 5JH7B 4S04A 4BN4A 1J2JA 3MINA 5KKAA 4BVBA 3JQGA 2PS1A 3NHAA 4CTJA 1F7VA 2HY7A 3R3VA 1GD1O 2I4NA 4AS3A 4KQIA 3RRBA 2QTZA 2ODAA 4N5LA 2YY7A 4MVWA 4EMBA 3JRWA 4TTJA 1ZISA 2A0FA 3EZ6A 5F76A 1NULA 3LLUA 4TPKA 3U4QA 4Q6WA 2B4QA 1I94B 1CY0A 2O3RA 2X4GA 1SXJE 5CB4A 3O8RA 2J41A 2WD9A 3SN6A 2A59A 1HFKA 4BATA 4EHHA 2WAMA 4RJ2A 3W2HA 5I4CA 5JD3A 4WLEA 4CEIA 2AXEA 3L7LA 2HNBA 4O4HF 1SKYE 2IPLA 4CKZA 1FSZA 4JUFA 1G3QA 1V1RB 3ASYA 1BMFD 3KAKA 4J0FA 1LPPA 1X7WA 1AG9A 2C58A 2PS0A 2VYND 3LCCA 4IKPA 4FOOA 5TQ0A 2IXEA 3FGOA 2FHPA 4B6GA 1BMDA 2G9QA 2FDRA 2H9IA 3Q10A 4M2LA 4V2UA 3GUCA 4K5QA 1ZUIA 1GHTA 4TXNA 4ISCA 5KPJA 3ZVKA 1NKVA 4ND4A 1C1XA 4L02A 1ZHOA 2ZUSA 4RD0A 1T4BA 3KWMA 4AZ0B 3F4BA 2C7OA 4GRIA 5AW5A 4BVAA 1QIGA 1O89A 3OU6A 4JB2A 4L5AA 1AQYA 4QSHA 2Z04A 5CPFA 4CM7A 1QFXA 3WLIA 1AO0A 4JODA 2AR0A 4WE3A 2A5DA 3EY9A 4KXFB 4QZVA 4YUAA 1W5SA 2JJ2D 2HHLA 3JQRA 3PE4A 3NEAA 4JLMA 3ROEA 3Q0EA 3ZHSA 3W8RA 3DHWC 3DD5A 1P4HA 3P4YA 4DQUA 3LPMA 2O8FB 3LRPA 4BIMA 1NGSA 4DHWA 2BFFB 5LMUB 2PHZA 3ICPA 3VVBA 2RBGA 5KYUA 1Z6ZA 4EPVA 4WH0A 3DDOA 2YV4A 1LPNA 5F1PA 3SIPA 2LCFA 2O52A 2HB6A 1XYGA 5CLGA 1EFLA 1SCBA 5BPHA 5KNBD 2GAOA 1ZG3A 2ORWA 4MUXA 5DXFA 1U8CB 4X90A 4AMUA 5ALWA 1Q77A 3DV0A 4HVTA 3UHJA 1B23P 2F43B 1XJQA 3IQIX 1G7TA 2F1HA 2CUKA 1RQGA 3B3JA 2GAAA 4AY3A 1T29A 2WAAA 3ZE6A 2JAHA 3CW2A 2C03A 3GT4A 4MO9A 5DE3A 2D8MA 2PEZA 2O48X 2IHTA 3B13B 3PC8A 3QBEA 4R51A 1P0FA 3QELA 1TQ4A 2O2XA 3T4PA 3VAAA 1C9MA 3LWNA 5FH9A 3QFRA 1KFEB 2AXQA 1E79A 4XR4A 2ECKA 2QGZA 2ZPUA 3HA7A 2VUHB 2BDTA 3DEAA 3UUWA 3UBMA 3UAVA 1OPRA 1MA0A 3GEEA 5AXCA 3IE0A 5AM3A 4Z7JA 5ALSA 4ZRMA 3CG4A 1YR9A 4P0TA 2QM3A 2VDUE 1GGVA 4K03A 4U39A 1CJBA 1ZOOA 2JHCA 4GLFA 3CVWA 2Q8NA 3GVHA 3V4RA 1NBMA 1IDN1 4YWHA 3DTVD 2IS1A 2ZR0A 4MAFA 3DHVA 2VF8A 4Z9FA 1SBYA 4RF2A 2WF9A 1A98A 3IR6A 5HF9A 4DMHA 4EK9A 3IGFA 4IL5A 3Q9NA 3TOCA 1HYEA 4R2HA 1NL3A 3GT3A 1E59A 4ER7A 5TGTA 4TL7A 3FOCA 3M0EA 4E03A 2PSDA 2OSVA 3ETLA 2E6KA 1RMTA 1V8PA 1P1BA 5FRDA 3JYLA 1H65A 1R4AA 1SUFA 3A2KA 1KBOA 4DDTA 5IU6A 1HDYA 2EJBA 2VKTA 3CGWA 2C5HA 2PBRA 1DXYA 1IIBA 1W88B 3O92A 3A06A 4BQSA 1CCWA 4Z1MA 5DI9A 1AKRA 5B37A 1AJEA 1XO1A 3PR1A 3P45A 3ZZMA 3DZKA 4HV4A 5IC4A 4RENA 4GZ5A 3AJRA 3F9CA 2FZ4A 3KT6A 3N2KA 1OXKB 1NJ8A 1LB1B 2FQQA 3FPLA 3PD1A 3SM3A 2Q0XA 3K4PA 3RRJA 3VZPA 2ZDQA 4NG5A 2BTQA 4QOEA 3HU2A 1ZJ6A 3IILA 4HXGA 4WAUA 4Y6LA 3WJ7A 1G2PA 3EN0A 1EDDA 3HCPA 3OTGA 1KOLA 2UYCA 3EPJA 1Q74A 2AOUB 4ITRC 2ZI7A 4IIEA 1FVOA 4ZDWA 3RYHA 3R23A 5G0TA 1JG1A 4KE8A 3T3HA 1LQUA 2B1GA 3PQCA 5AKJA 1E18A 3O26A 4XIYA 3HUUA 1ZM9A 2O1SA 4KYIB 3GLIB 3CCCA 3E61A 1JIIA 2D1RA 2ZYHA 3IOEA 2WTAA 4QBFA 4X8MA 1TCBA 4C05A 2CVQA 1ISIA 1SUAA 2O8BA 3AKEA 1PNTA 1F2TA 2C4MA 4MINA 2JGNA 3HZHA 2GXAA 1OAAA 4CNBA 3G8DA 1JR3A 4LNHA 4QOJA 4DPLA 1RYBA 1F38A 1V7PC 4NYJQ 4Q12A 5F4ZA 4B6FA 5K2OA 1NA5A 3PD0A 2D1FA 2R00A 4OJQA 2PMBA 5E6SA 3R7AA 3CLSC 1FDOA 5JNVA 3U7FB 3BDAA 2ZUEA 3UATA 3RFVA 1V26A 1I2ZA 2I3GA 1FU7A 3HVIA 4LJAA 4N0EA 5WRFA 3CVJA 2QSZA 2Y1EA 1CLUA 2PAAA 2ECFA 3O74A 4HQRA 4NJMB 4UD2A 3TQIA 3WIOA 4AS1A 5AVJA 4YAGA 3GPLA 1WQ3A 1EK2A 2EBWA 3F4LA 4LG1A 2IK8A 2GX6A 3HM9A 1Z6YA 3C3WA 3LWDA 4K2HA 4PIVA 5J4KA 1H2BA 2B1QA 2QUIA 4W9RA 3T5TA 5CLQA 2VLBA 3FVTA 4DR1B 3B9QA 4I5FA 3ICVA 2PUVA 1V8OA 4ND1A 4GI2A 4NI5A 3E3MA 4Y6PA 3VC1A 2HWWA 4D9NA 4FPXA 4MICA 1MDBA 1V1JA 2K5UA 4M55A 4PO3X 1G6HA 5AI8A 3PYLA 2P6OA 3L4KA 4HNSA 4G0WA 1FSSA 4G5QA 1APBA 1VE5A 1Y3FE 1VKRA 4OX9B 2KMLA 1O6BA 2HMVA 3QVVA 3P26A 4QLAA 1F2UA 1CNFA 1B0AA 1LDGA 2B1RA 4V0KA 3W5SA 4KLNA 4QBGB 4DLVA 7ADHA 2PT5A 1B0UA 2GM5A 1NV9A 3BL8A 4LS3A 2FPGB 3F47A 1Q22A 2FPXA 3ZI0A 2QIOA 1SD5A 2SECE 2PWAA 2OORC 4YJ2B 3L7AA 4EGCB 3QU5A 2JFUA 3G89A 1E32A 4KFCA 2ZIWB 4AY2A 5L3QA 4GYKA 3U31A 1NMXA 2ZYIA 5GJVC 1MO2A 2NTVA 3C98A 3DBLA 3R3WA 1MJGA 3FKSD 5GIPE 3ROXA 3ZBTA 4C04A 1GQ2A 1PG5A 3O8QB 4YRIA 4JQOA 3WOVA 5EJ5A 3AGPA 1C9DB 2CWWA 3QBVA 5T64A 5FWNA 4DR3B 4KQ6A 1E0AA 3WBBA 2XUDA 2NOAA 4FMCB 4G2TA 3AR5A 4H0FA 4J16C 4ZO9A 1HXHA 1RJDA 4Q82A 5GJCA 5HKKA 1Y1TA 3ZEAA 2BFOA 3KOMA 4LYGA 5JJLA 5J9FA 4NBWA 3PJRA 2IXAA 3PICA 1D0VA 1TJNA 4EECA 2ZWPA 4I4TF 4O2LA 2BKLA 3U1VA 3IL2A 3M33A 1VKOA 4H7PA 2Q3CA 2WJWA 3GROA 1W34A 4KKXB 4BU0A 4K1XA 3RT7A 3DKPA 3F5SA 5IAKA 2B1JA 5CH8A 2ISCA 1S0UA 4HBGA 2QX9A 2R5FA 1ZH4A 3I30X 5AXBA 3RROA 1PGPA 3QY9A 2G70A 5HGJA 1LV7A 3HJAA 3BXPA 3KPJA 4UNPA 3HO8A 2IGTA 2ZJ6A 1SH7A 3MWFA 1GA6A 1XA0A 3DVAB 1CWUA 2J30A 3U62A 4PR3A 4KFTA 1OILA 2QW0X 3NLLA 4Q1CA 4K6HA 5HUHA 3G88A 3DUFB 4Y1EA 2XCIA 1GKYA 3KZVA 4D82A 1G8PA 2XQJA 3RVMA 3HB4X 3AIIA 3AW8A 3RSSA 1D1PA 3KJHA 5FBHA 5JPIA 4MVCA 1EM6A 2HW8A 4IIUA 3SEFA 3RTCA 2OV3A 1ZD4A 3E58A 1IG3A 3RJTA 2CL6X 1E1CB 1JDPA 1TO6A 1R8JA 1YBMA 2QX7A 1N1EA 3G1WA 3GXBA 5G3ZA 5T67A 2VPZA 4G5OA 2JW5A 2HO5A 1ZCFA 3LOQA 4K46A 4PTZA 4HYYA 4AZWA 5LQMA 1DBSA 1HT2E 2XUKA 2AN3A 1W29A 3ZHCA 1IUNA 2ZAIA 3FPBA 4IIGA 1QNLA 4GH5A 1FBTA 3LDFA 4JT2A 3ROTA 3TNLA 3UV3A 2NTNA 5K03A 3RHSA 4BLRA 2CC2A 2GOYA 2NZ2A 1U0JA 3DZHA 3D8TA 1Q7GA 2FF5A 2XTNA 2GCPA 1S1CA 3ODPA 3IR5A 2ODNA 1MGPA 3TLXA 2R5WA 5KS2A 3GIWA 4AG6A 3OOEA 5IAOA 2C5EA 4L08A 1D6JA 1KPIA 2H2HA 2WTBA 1KP2A 4C29A 3M2TA 4NBUA 3A4NA 2GPBA 1HT0A 2XUAA 3OZGA 1G20A 1T2EA 2FLVA 3I01A 3WDLA 4LMRA 1W44A 1OJ7A 1QYDA 3P0IA 1FFBA 3N8HA 4LRSB 4A2PA 3M49A 1FPMA 5CLHA 2PSSA 3AZOA 2YMMA 3AYZB 3UHOA 1FTYA 2UXDB 3PEVA 2RSLA 3M70A 2C82A 2ZVPX 4H7KA 5EZYB 4YUWA 2VTVA 4TLDA 5EI5A 4K87A 4PQRA 1W47A 1XF1A 5DZSA 2DWPA 2NWQA 4BEJA 6GPBA 2DHQA 4P3PA 4WPGA 3RLFA 1OD6A 4C03A 1N3BA 1L1FA 2ZKIA 4CDRA 1ZIOA 3Q7EA 4L0MA 4UJ3A 5FX2A 1P1RA 4MW0A 4BDSA 4NS4A 2CXQA 5HHTA 4JFAA 4Q3CA 2VJQA 1MQ9A 2E4AA 3DPSA 4HUTA 4V0SA 3W05A 4YPVA 3INNA 3X1ZA 1F0YA 4RTJA 2VWGA 4RTOA 4EX6A 1P1FA 5DNCA 4P93A 4DJAA 3CX3A 3HFSA 1PJ8A 3E7XA 4P34A 5IKMA 4CCYB 1MCZA 4HGYA 1GPMA 3ILYA 3NAMA 5JFTA 4AO6A 1WIWA 1CJVC 5DHUA 1E1KA 3UAXA 3PPVA 1MHPA 3JTEA 2PSFA 3B78A 4HWKA 5DYWA 4TYYA 4AU1A 3AFIA 2CFTA 4JSYA 3DSRA 1LEHA 3AR6A 3JAWA 2QLFA 3SIXA 4TV9B 1P31A 1E9SA 1K5DA 1OWPA 4NL4H 4YCMA 4TYMA 1QS0B 2FSFA 2IHJA 3SI7A 1OIVA 2P1ZA 3G0CA 1ML4A 4KL8S 4BV3A 3C5WP 1RQ2A 2PRZA 3AHCA 2R8OA 5LQNA 1C1DA 3ND8A 3MELA 3WGUA 5B2EA 4JXKA 3PJEA 4RKWA 1G9XA 4PHHA 4PQEA 3VPDA 2JA1A 3ORQA 3I45A 1E7RA 1NMEA 2WWRA 2ZK7A 1QJCA 1EGQA 1R6AA 4KXUA 2YJGA 3TGLA 3ER9A 1IN6A 4RPIA 5CCEA 2VRBA 4KIFA 4B47A 1HDIA 1VCNA 2FQYA 3H9GA 1X74A 1VHQA 3ZE2B 1IHDA 4CRWB 5JMWA 3O38A 3TPZA 1T3GA 1VPVA 2PPVA 4PPYA 4E3ZA 3GBVA 3OQJA 1YR8A 4DV1B 2P41A 1DL5A 1HQCA 4CL0A 1A8HA 5CDTA 5C5CA 2AG8A 4QARA 4Y1GA 1YB7A 2ZJZA 3IC5A 1XP5A 1TCUA 3LQQA 2OMEA 2YHIA 3LY8A 3KVNA 3OPYA 4J3JA 4UVGA 4XASA 5ALQA 1KAEA 4F9GA 1FK8A 1S89A 2X8JA 1SA0A 4FYJA 3R7WA 3HCDA 4A27A 1NV8A 3AQ4A 2QRKA 2IVZA 3KKPA 4KFRA 3U3JA 2R4TA 4PAGA 1C7EA 3SQLA 1P73A 2Q1TA 2EVWX 1P9RA 4KLRA 1VBKA 3A6JA 4GW3A 4B09A 2IXDA 1UXOA 3BIFA 1JKXA 3I92A 1FDVA 1WWKA 4MTCA 5F3RA 1GU0A 1MO6A 3BRWD 2ATXA 3SZRA 4QM6A 1Q14A 1PZMA 1U94A 2OQ2A 2VP4A 3I32A 2QVYX 4GPEA 4QUIA 4YACA 4DBVO 2AZTA 4L5BA 1WD5A 2WZDA 3O3MB 4YJGA 2IPAB 5J43A 1NKTA 1SXJA 1FB5A 1QOZA 5B1YA 1ZOIA 4DNQA 2FGJA 3IQXA 1XA3A 2WUVA 2VZEA 3UAYA 1E2LA 4QXRA 1WZNA 3EQ7A 4B2PA 4CF3A 1ZHHA 2X2OA 5C80A 4FFSA 4QXOA 1YJAA 3DMFA 1MVLA 1XQXA 2W8BA 3MPUA 3L18A 4IRUB 4H3KB 2NM0A 3G0GA 4NDNE 4XVHA 4JU9A 1I3MA 4EG8A 3BHJA 2R8XA 3EXFB 3ZGXA 5F2EA 1CUEA 4RA6A 3FZNA 3ROPA 5A1TA 5DTQA 1NN0A 2NZYA 5JAUA 1C1HA 3WLAA 1KPHA 2D5LA 4IOKA 1UZAA 3NOVA 2G9RA 4FW8A 4MB6A 2JH3A 2NVBA 1G6KA 2IUSA 1KEKA 4QAQA 5BWBA 1CRQA 2F55A 3KKNA 3QW2A 4C0WA 1BZYA 4G5HA 1O54A 2KLHA 3B70A 4BBAA 1VIYA 4IDOA 2GR9A 3IJRA 4WESA 3IAFA 3MQFA 2QM7A 4KSBA 5L95A 1IOLA 3B1WA 4KR0A 4EL0A 1RM0A 3SQDA 3TQHA 2MINB 4E07A 4MRAA 5COQA 2VFAA 5AHRA 5BYJA 4RHUA 4P0QB 3UCFA 3QSYA 4NMLA 2AQKA 3L0PA 2X42A 1KFCB 3VKFA 4OHYA 2G6TA 1DB3A 1EE9A 4MCHA 2QN2A 1MQAA 2FDXA 3CC8A 3AI7A 1MJGM 3A3OA 3ASZA 5A4MS 2XVMA 3A4IA 4BMOB 4DLBA 3DQZA 3E4DA 3GDHA 3LF1A 2ZWMA 3QVUA 1TTQB 4WFJA 2B20A 2QXUA 5H8WA 1G7RA 1PG2A 4QGAA 3VYTB 1U8YA 2MSKA 1CVLA 3KPVA 4NKRA 2C29D 2ID7A 4WXYB 5DCLA 3DLTA 1GGFA 5BV2P 4BO1A 1MTZA 2BR4A 1J97A 4JLUA 1J8FA 4U2GA 1P3Y1 1YDWA 1CE8B 3P0FA 3S55A 1YK1A 4AF6A 5CFRA 1UL1X 2RAPA 3QU7A 2DR0A 1U8TA 1CKEA 3H8SA 3QE0A 2JHGA 3IIKA 2VSQA 2HCTA 1MRSA 4JLKA 4A5OA 5BYAA 5E6UA 2UYQA 1E63A 3I04A 1FXSA 2EOAA 3N53A 3TXXA 5K4GA 3NQ41 2JLVA 3C39A 4DJEC 2VQFB 1XZMA 3K70C 2ZUVA 3EC2A 3UEOA 1ODJA 2O05A 4IDNA 1ODIA 4LWZA 1NVEA 4EEKA 1OI4A 4ID9A 4C43A 1U8AA 2H7XA 4KRYA 2WHXA 1NBOA 5LYJF 5LLSA 4QU5A 4OI0A 1KHHA 1EJBA 2OTCA 4OLAA 2EFEB 4B7XA 4LSZA 4XDHA 4B7AA 5C34B 2BGGA 1GV1A 4OSEA 2B6NA 1NXOA 2BCJQ 4MKIA 4RD4A 1P0IA 2GCEA 3CINA 4TL9A 2RG7A 2I2WA 4HQNA 5CA1B 3OHMA 3OKAA 1KSFX 4KXQA 2B7LA 2GCGA 2XXAA 621PA 1FXWA 1N5LA 3B60A 2PVPA 5JZVA 1CUBA 3HO1A 4GICA 4ZQHA 3MPOA 3UMVA 4Q4AA 4DFDA 3AL3A 1MBZA 3F98A 4UW9A 4HI0E 3K9FC 1R0XA 3F9IA 2F7SA 5H68A 2W6NA 1Z29A 3FF1A 3OFVA 4KK3A 4LHSA 3GDWA 4D3SA 1PVVA 2QZJA 3DVLA 1HLFA 4XAQA 1L5GB 1NAIA 1ZN9A 1S8FA 2P9FA 3GGOA 2BJWA 3IJPA 4IWYA 3A25A 1ZLXA 2P1RA 3TMKA 2XADA 5AKKA 4BVJA 1BQEA 2AIRA 2OD7A 4UJ5A 3KR9A 4I4LA 3R7DA 2IT1A 4LXYA 2QLLA 3ZKAA 4J0JA 2QVXX 1YGYA 3NHZA 4NE9A 1PYGA 3EGWA 3LT1A 4PIPA 5IT5A 4FDLA 5EMKA 1DWQA 3NYWA 5K8UA 3QX7A 4OLBA 4YJ3F 2CXTA 4LRUA 2PKYX 1JF8A 1ZESA 1MABB 4L4UA 1XD2A 1U0NA 3I01M 4PLWA 4DA7A 1DAMA 1CX9B 1KWKA 4KGDA 5JMPA 1FLAA 1NMSA 3O21A 1MGOA 4KPEC 1EESA 5JAOA 4QKQA 4DABA 1CB7A 1YIAA 1ZY2A 3AR2A 3V7NA 1A77A 1HORA 1DXHA 5IVHA 3OO0A 2H7YA 4CM1A 1L4FA 4D26A 3FTEA 1EFDN 2CCKA 3KX2A 4ILKA 2XYGA 1XTKA 2J9GA 4G97A 4B32A 5F7JA 4A0HA 1SAYA 3GN2A 4FFLA 2AWOA 3AUXA 4PZEA 2BTEA 5ADVA 5AKEA 2C98A 3DUWA 5ARDA 1JHXA 1WCIA 1TF2A 3TZKA 2HHCA 4MQUA 3BBPA 2ZRMA 4UD6A 5K0SA 4B3GA 3T4EA 8AT1A 4K9SA 1XLVA 1R5OA 1MX3A 3LX6A 1PL6A 4NICA 2B2XA 4C1NA 3N7UA 5KVQA 3B82A 2LWIA 4XSVA 2D7CA 5BNTA 4BUZA 2IE0A 1M3SA 1SPBS 2QP3A 3PJDA 4OH7A 4EABA 1M6VB 3IUEA 1FUKA 5DLYA 4R1QA 3RTGA 1KXZA 2I7XA 4D0LB 2VNAA 2PBLA 2G28A 4FDMA 2REXB 1NUAA 2HAEA 1Q6YA 2DBZA 3GA0A 3IV7A 4G0PA 1MFZA 4DGSA 4GP9A 4H1VA 1T9CA 3UQZA 4X6UA 3D7RA 1T5TA 3EASA 2Z6QA 4RABA 5JYDA 2W70A 3UYKA 2HXYA 3PXBA 3U40A 4J6EA 1O95D 3BD8A 3R9XB 4ZCLA 2EJWA 3K6SA 3QIVA 4C7BA 1MOPA 4M9RA 5BNFA 3R3SA 3IJEB 2GXUA 4WACA 3U3OA 1VMDA 4IIVA 3VOBA 3ZLBA 1PJAA 3H5IA 4RLQA 2X8BA 2F9FA 2OGTA 3DGEC 4YRKA 4PAQA 3TJRA 2C9YA 5K6RA 5REQA 4RADA 1O87A 1PNRA 3T3GA 2WUWE 1MOSA 3AI2A 3ABQB 2B7BA 2O07A 3HI4A 4H6XA 2GYVA 4X3OA 3K2IA 5EE0A 1NNUA 1Z7WA 1D2HA 5CNIA 3WHIA 4F2PA 5IJ0A 3SZUA 1ILWA 2BEWA 3BB3A 4UATA 4OB6A 3RSZA 3A6DA 2M6RA 4ZOLA 1N4AA 2G77B 3O47A 2LIVA 5C8YB 1IWPB 3DLPX 1S6YA 1RJEA 1XJ0A 3DW1X 1E20A 1U0TA 3F5FA 3Q9UA 3LSTA 4LE1A 1E6KA 4UDNA 5EIOA 3V1KA 2A9PA 3WWCA 1QH1A 2AOVA 5K0BA 4E94A 1XNJA 2UVDA 4HDQB 1PTKA 1GOTA 3WLFA 5EKXA 3UJBA 3M83A 3PQEA 4DBZA 1KMIY 1DTWA 2B2NA 5I7VA 3DM9B 2VYVA 3Q8KA 1MD9A 4G8DA 4WZ6A 4NMHA 3FNBA 3NH9A 1RLJA 3NHYA 1F6WA 4LDNA 3MBIA 3G13A 3BB1A 3IQWA 2RIRA 1FFWA 3LIPA 4EB0A 3CJRA 2ZBRA 2OPHA 2IA5A 4J1TC 2Q5IA 4U2EA 3DC7A 5EMHA 1YI1A 5ESXA 4CM6A 4DJTA 2XB4A 4DDVA 1NXXA 1G41A 4CGYA 2PX0A 1L4YA 2NUPA 3BG5A 3GLIE 2AZXA 1K75A 1QR2A 3WIVA 3BTVA 4MQLA 3VAZA 5LOVF 2VTEA 1YI0A 2X15A 1YZNA 2EJTA 1WUIS 3KLPX 1P0PA 1IN8A 1EK6A 1Y1LA 4LJKA 4R4JA 4X6LA 3GYGA 1GPLA 3N2NA 5CDFE 3ZU3A 1YQTA 4CVNA 1A69A 1G64A 2JCXA 4D41A 2G5PA 2XX3A 2OFPA 3KWLA 4XW2A 4ZCRA 4AG5A 3ZHQA 4EJ2A 4WA7A 3V8RA 1PSWA 1OA1A 3AEUB 4H3SA 3RTAA 5HKKD 5HMMA 1MJHA 4AWAA 1BKYA 3C3CA 3W9YA 4QLBA 1UJMA 3IP3A 3KXKA 4KUGA 4TTTS 4UMDA 5DNWA 1EUDB 5B1HA 2JBWA 3HRKA 5T4FA 4EO9A 4C7OA 1QVAA 3FM9A 3QWBA 1IDOA 2CF6A 3D6NB 1E6WA 1NXVA 3MRVA 1AZWA 4I1IA 3ZLTA 1SUSA 3N2EA 4HWOA 2PGLA 2PU5A 4UXHA 4C0JA 2XJ4A 5FO0A 3FUVA 3HJCA 1RD4A 1NR1A 6NULA 4BFXA 2RI1A 1N25A 3FJOA 4ZDKA 3GJZA 3DB2A 1DKRA 1ORVA 2J6IA 2CEKA 4TWZA 1WZUA 4S1PA 2YICA 4OHRA 1M0EA 4D46A 3MB8A 5CNJA 3RSLA 2WIDA 4INPA 1JBKA 2ZIFA 4V02A 1HUQA 4CLOB 2PGOA 5JSQA 1IHXA 3T34A 2JHFA 3VR4H 1BWPA 1XLTA 4IVQA 2TYSB 4CI0B 1XSEA 3O9MA 5HQ3B 2E55A 2PD3A 4JYBA 5CH5A 5I9TA 4I3FA 3LCRA 1J1ZA 4JR0A 3TYXA 3MLBA 2NAFA 3BMCA 3P9QA 4IGAA 2VTKA 3DBOB 4LX8A 4RTMA 2P7HA 3LCVB 1NG1A 3KG2A 3QKIA 5KWVA 3ZGOA 1ZNZA 2V55B 3WLNA 4LWPA 3RC1A 5K5EA 2FE1A 1KJYA 2EQ5A 4HWGA 2PS3A 3OAAA 4F7WA 1C0KA 1TZJA 1PW5A 3Q41A 3ZCSA 3N58A 3JASB 4HWPA 1CUXA 4EWLA 2QJTA 3NWBA 8MHTA 1RABA 1CUJA 4PSVA 4JDPA 3H9JA 5IS2A 4YBZA 2FSPA 4UTNA 4AROA 5LZ9A 1D7OA 4UTRA 1RBMA 4JBYA 5DIZA 4CV1A 1OFIA 3OWOA 1UJ4A 1AQUA 1M9NA 4FEGA 4LK3A 3U7QA 5IWCA 4FILA 2QQFA 1S4MA 4OBXA 4HDRA 4GUDA 3M5DA 4FYWA 5H82A 1P5RA 5LB2A 4EI8A 4CETA 4N12A 3ZOZA 4X95A 1XNQB 1JP7A 4KXWA 3AG5A 2KBFA 9ABPA 3NKFA 3PUXA 3MCVA 5GQSA 3QFSA 5CX1A 1A5TA 3JAKB 4IZIA 2BCEA 3MEQA 1GPBA 1X1AA 1ZGZA 1K3UB 3DOJA 3V32A 5A04A 3H05A 1SUBA 8ADHA 3ZXXA 5CB6A 1M5RA 3VDRA 3DE5X 3UPTA 2JEZA 3WRWA 4YLEA 4AKEA 2I8CA 2ONYA 3LYAA 4XSHA 3G7NA 5I47A 1IK4A 3ORYA 4PTLA 1E66A 1KI1A 4HYTA 3RVQA 3M3PA 3H04A 1WU8A 1QQBA 4L16A 3IUYA 4MGIR 1CJSA 2P7IA 3ND7A 4NAUA 5GINE 3L6BA 5ERYA 5L7WA 4E3WA 3ONWA 4O4LF 3N3BC 4O4IA 1E1LA 5DTRA 4X20A 3DEFA 2PFSA 5CRIA 5TNXA 2VEDA 2CNKA 4JUBA 3IVGA 3S28A 3AM5A 1R8QA 2NG1A 4BVGA 4N39A 5K99A 1XDGA 1XCMA 2ZULA 1L6IA 3M5PA 1EFAA 1SIBE 4Q00A 1SNYA 2RGXA 5D6OA 5JAPA 1TAGA 1R15A 1IMOA 4E88A 1FP1D 1WUJS 2AX3A 1NAHA 1ZITA 5LZ7A 3K2EA 5B55A 1EM8A 1H3FA 3HEBA 2WPNA 1XRPA 1FDRA 4LPKA 1S9HA 3L49A 4N5HX 3KDSE 2JKVA 1VJCA 1IHOA 4GX2A 3JD2A 2XWJI 1EINA 4U2DA 3F3MA 3FUWA 4BWVA 3IDAA 1UEXC 1QOQB 3ADPA 1YR6A 5KHLB 5THKA 3IBTA 5BSFA 3QUBA 4POAA 3OCYA 3FYDA 5KMGA 3FYUB 1NDQA 1XBTA 1UAGA 1SB8A 1ZSVA 4K40A 3SVZA 2C1ZA 3KO8A 4TV8A 2ONJA 1LDMA 3L06A 4NX2A 3D1VA 2ZAMA 1DIBA 1RZVA 2VN8A 3QVLA 1EFPB 4YP6A 1MZVA 2H0RA 2ONKA 2WU4A 2B30A 4MP3A 1KIAA 2IFTA 3BTSA 4IVPA 4LW8A 2H1CA 2JJ1D 3EMDA 1FU4A 2QX4A 2WTUA 2ET6A 4FNGA 1L7QA 3PT9A 4QXQA 5J63A 5KX5F 4WIAA 4AZ3B 4BFSA 4CQLB 4S12A 1Y42X 1G6Q1 3D5TA 1XG5A 1K4MA 4BTLA 4KJZA 3TOXA 4RESA 4TZ6A 4UMEA 4ZKDA 4IDQA 1PIWA 5JTTA 3RYCB 4E30A 5AI9A 1ICIA 1V3UA 4M60A 4D9MA 2WINI 5J2UA 1PR9A 4GUAA 3PFFA 2I9PA 1WAMA 5K05A 4P92A 3E9QA 2BSQA 2C2BA 2DPYA 2E87A 3CO5A 1AKQA 1N8KA 1RAEA 1MFPA 4YONB 5IKEA 2OC9A 5K8LA 2YN0A 3E9YA 4ETIA 2GN6A 4NONA 5IEBA 2V1UA 4I55F 2Y2UA 3ZXYA 5KIAA 4BFCA 2RKWA 2O3TA 4R9SA 1OZGA 2CHGA 3C7AA 2YY6A 4IXDA 5LLTA 1LBHA 3EODA 1R0ZA 2AI2A 1V71A 4HTAA 4L5IA 1ZN8A<