3DW1X

Proteinase k by lb nanotemplate method after the third step high x-ray dose on esrf id14-2 beamline
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Proteinase K
publication title Radiation damage in protein structural characterization by Synchrotron Radiation: State of the art and Nanotechnology-based perspective
rcsb
total genus 98
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2008-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3dw1X00
2HPZA 3LPCA 2QTWB 3WQBA 2Z2YA 3D9QX 4JP8A 1ZVKA 1KDVA 4MZDA 1THMA 3QMPA 1WSDA 4NMXB 3VHQA 1GA4A 3F7MA 3GCWA 2TECE 2W2PA 2X8JA 1EA7A 2B6NA 4KG7A 2XTJA 3DE1X 4KB5A 1PJ8A 3ZXXA 1Y9ZA 4YN3A 3H42B 2Z57A 3CO0S 1BE8A 1CNMA 1NDQA 1WMFA 2WUVA 4CG0A 2PWAA 4Z2AA 2ST1A 3A3PA 1IC6A 2PQ2A 3AJ8A 3BPSA 1AV7A 3TI7A 3LXUX 3BGOS 1Y3DE 2ID8A 1P7WA 5AQEA 1ZVJA 2ID4A 1KE1A 5ARBA 3EIFA 4K8RB 2Z30A 1SCDA 3P5BA 1AH2A 2G4VA 3DW1X 2SICE 1AQNA 3DE2X 3VV3A 4ZOQI 1R0RE 4DJ5X 1AVTA 3TI9A 3OSZA 1AK9A 1HT3A 1C9MA 4DZTA 3EDYA 2XRMA 2Z58A 1YU6A 2PRKA 2V8BA 1S2NA 1DBIA 1SVNA 4WOCA 4OV6B 3PRKE 5JXGA 3UNXA 2W2NA 1TM5E 4AKSA 1UBNA 5AVKA 4LVNA 1GNSA 1SH7A 3WIUA 1TM4E 4CFZA 1TO2E 1SCNE 1Y3CE 1YJAA 1SELA 3DWEX 4I0WB 4AKTA 5K7SA 5B1DA 4KPGA 1Y33E 1R6VA 1JEAA 1PTKA 1SBIA 1GCIA 3QTLA 1BE6A 2W2QA 3DDZX 1T1IA 3DVRX 1Q5PA 3L1KA 1CSEE 1AF4A 3D43A 1SBTA 3SQOA 1SBHA 1S02A 4GI3A 2WV7A 1V5IA 1SBCA 3T41A 1C9JA 4OMDA 3PTLA 5SICE 3DE5X 1Y3BE 2WUWE 1SPBS 1SCBA 4C3UA 1P7VA 4B5LA 3AJ9A 2SBTA 1SN7A 1SIOA 3SICE 3F49S 4CFYA 1SBNE 2Z2ZA 4BWGA 3VSBA 3DE6X 3DE4X 1TMGE 3A3OA 4C3VA 3QFHA 1GA6A 1GA1A 4WOBA 3WIVA 1KDYA 2IY9A 3I30X 1A2QA 1R64A 2SECE 5JXHA 4FONA 3LPDA 1S01A 5JMOA 2Z56A 3DVQX 1XF1A 2GKOA 2PYZA 2P4EA 1OT5A 3GT3A 4DWWA 4LVOA 1BFUA 1SUBA 4OMCA 2ZWPA 1PFGA 1SUAA 1Y4DE 2PKCA 4ZARA 1ST3A 1SCJA 3VTAA 4NE9A 1TM3E 5JXJA 1WMEA 3I34X 3Q40A 1T1GA 3DYBA 3DE3X 1NLUA 1NDUA 3TECE 3AFGA 3I2YX 3I37X 4M1ZA 2HD4A 3EE6A 1TO1E 1AU9A 2DUJA 1BJRE 1OYVA 1GNVA 4NE7A 1OYOA 1Y3FE 1YJCA 3GT4A 1IAVA 5AMXA 1WMDA 1SUCA 1EGQA 2WWTA 1ST2A 5FFNA 1KE2A 3DW3X 3DE0X 3A3NA 2SNIE 4H6XA 5CW1A 3F7OA 5FBZA 3VV2A 2DP4E 2X8JB 3ZXYA 5B1EA 2IXTA 2E1PA 5I9SA 1Y48E 3Q5GA 1SIBE 1SCAA 2ZWOA 4H6WA 1PEKE 1V6CA 3DVSX 1TM1E 1KDZA 4HX2A 1BH6A 1C9NA 1DUIA 1LW6E 1TECE 1C3LA 3DE7X 3CNQS 1SUPA 1SIUA 2W2MA 1BFKA 1MEEA 4HVLA 3GCXA 4RYDA 5ARDA 2DQKA 1MPTA 1GTJ1 1SUEA 3LPAA 1Y4AE 5AVJA 3VYVA 5ARCA 1GTL1 1GT91 1P8JA 3BX1A 3HJRA 1Y1KE 1T1EA 5FAXA 2ZRQA 1SUDA 3WHIA 1WVMA 4H6VA 2Z2XA 2PWBA 2W2OA 1TM7E 1Y34E 2PMWB 1VSBA 1GTG1 1TK2A 5JXIA 1YJBA 4J94A
chains in the Genus database with same CATH superfamily
1AZTA 2RKOA 3V2GA 3ZWOA 2HPZA 1P2BA 2G1PA 3ODGA 3OJFA 3PEYA 2J07A 1UMBA 1Q12A 3Q8KA 1NE2A 1R4MB 2ZRDA 3KALA 4UUQA 4FKBA 4RZHA 5JJ5A 3GLGB 1ZD5A 4GWLA 2B0CA 3T4XA 2FSVC 3T4EA 1LV8A 2G1JA 3KPVA 1K5DA 4X6LA 4N3AA 1SD2A 3Q9NA 3MS4A 4BFSA 2PU5A 2MYPA 4MZDA 1A5TA 5ER9A 3MMPA 5CD9A 2XOXA 1TRKA 4O4JA 3COJA 3ROTA 4HWRA 4YWJA 4CTJA 4DCUA 2BELA 2BGWA 2C4TA 3B7WA 2YWCA 4HDKA 5AT1A 3MIIA 4BNDA 1IXKA 1MAHA 3OM0A 5DLQC 4NMXB 3STVA 5DLEA 3F9IA 3T1TA 2C8KA 4RD6A 4OAQA 4W9NA 4UEWA 2DTDA 2BI8A 1Y1RA 2HB6A 1U1IA 2IK8A 4LWOA 5EMJA 3CVWA 3EXAA 3GVCA 2LNDA 3V7YA 5I7HA 4DR4B 1JL3A 2JDIA 4FCCA 4EL0A 1VL1A 3IT0A 1A3CA 4RPHA 1QP4A 2AEMA 3LLCA 5A9SB 5BUCA 1XPRA 3HXTA 2TECE 1X8LA 4N49A 3WMGA 1Q83A 4MIYA 3H13A 1TQ8A 2PBRA 2PVPA 1NRWA 3O9VA 4PZPA 5BV0A 5JCXA 1JWAB 3TVDA 4P5DA 2PMEA 1EA7A 4KG7A 1XF9A 3S27A 1PI3A 1C3OB 1W2HA 3STWA 1E1MA 4PAQA 1MOQA 2P9QA 1BNCA 1TA9A 3EC2A 4GZ5A 3KTOA 1UJ4A 3AG5A 1ORVA 5J5CA 2X1MA 4ZTZB 2ADOA 4PLZA 3NXKA 1SUIA 2VF5X 3DO5A 1CX9B 1GVHA 2ZRNA 4N3BA 2W2KB 3D3EA 3QWFA 4HH0A 1DIOB 1BJKA 5AW8A 1KZ7B 1NDQA 4LF8B 2IIQA 4JUFA 1SKMA 5AVUA 3OQ6A 4KCGA 5GPBA 2ZYHA 4TLBA 1H2YA 1UAGA 3W7AA 1GGJA 3I39X 2DY0A 3C5VA 3BRCA 4MA4A 5JD5A 2OLJA 1S7GA 5IBRA 5IKXA 3CHYA 3E7PA 5FPPA 2HLPA 2VHJA 4BJ5A 4FBMA 3M6AA 3Q98A 3TE7A 3GR6A 2VWPA 4GLOA 2O7QA 4F38A 2GZRA 5C8DA 2ZI3A 1Z0AA 3CZ5A 1MJNA 4DNXA 2HIGA 4RK1A 4G56A 3Q7IA 3II6X 1EVJA 3NLLA 2WWFA 4M0EA 3U9LA 3LT0A 3MSXA 3WS7A 2UZ4A 2BKVA 2XGMA 2J5QA 2Q27A 2ZJZA 4X1YA 2ID4A 5IYZA 5ADWA 1PJ3A 1F4LA 3SP1A 3E4CA 1V96A 3KB8A 5BVHA 1MFZA 2I87A 2O7NA 4RA9A 4CF7A 2F67A 1H8EA 3CZAA 3FPFA 3E0QA 1B93A 3D2LA 3H8VA 3O9MA 1GYRA 1HLGA 2BR4A 3FN4A 1V1RB 5DP2A 4QJ5A 3CMCO 4OLHA 1ZLYA 2W4MA 1XR3A 4FSHA 4ZZ1A 3B60A 3G13A 2ZJ0A 2OCIA 3GEBA 2D2EA 2FDXA 4JMPA 2WT9A 4D6YA 4D5EA 4BGIA 2K6GA 2WINI 3P1JA 1EX7A 4FZVA 1NP6A 1IL0A 3O74A 1E5VA 1O96A 1SU7A 3BF7A 3T15A 5BQXA 3KSBC 3PSHA 4HGZA 3L92A 1X2BA 2CNBA 2Q8QA 4CLEA 4UVGA 4CTOA 5JW6A 3GHYA 3GYBA 3LO5A 2AIRA 5FUYA 2BBTA 1Z17A 4NEGA 1C14A 2P11A 1N2CA 4D9IA 5JH7A 1RWNA 1F0YA 3F73A 4MRPA 4I3HA 1YU6A 3RIYA 4DW8A 5H8WA 2KW5A 1CUIA 1P74A 1UFOA 1G8SA 4I4TA 3TX2A 2R97A 1P39A 2R8OA 1HG0A 1S2NA 2WKSA 3QJYA 4TV8F 4R5HA 1JLSA 4QSHA 1GAJA 1I32A 5IJAA 4ZZIA 5HIKA 5DNYB 1Q7TA 3J7TA 4UVEA 2VQFB 1S2DA 3H5OA 2JAUA 3I5AA 1PWXA 1XD9A 3OCUA 4V0MA 5EHIA 5I6DA 1SOVA 2GTPA 5JSQA 2JZCA 1CDZA 2QVYX 1V1MB 2MYTA 3W9UA 1JF8A 4EMSA 2X6RA 4MYRA 1KWGA 4ZC1A 3F6YA 5GJWC 5J1SB 4X66B 4CMJA 1GL9B 3TEMA 4CLOA 4RV9A 3SX2A 3FOZA 2FFRA 3R3UA 2PV7A 1ADJA 2V55B 3V34A 4K81B 3D6FA 5JCOA 4MVJP 1TVKB 5EYPB 1P80A 3BQ9A 4HMQA 4XKJA 3T1HB 2X2EA 3ZDAA 2V7WA 1KZYC 2M2IA 2H0AA 3N07A 1GNTA 2X0EA 1B2RA 4FIDA 1CS0B 2EZ8A 1U9IA 3WXBA 4AN1A 2AW5A 4HTFB 3K96A 5C31A 2XTMA 4E15A 2NP6A 4Z9YA 5AI8A 3B6IA 3SQWA 4BHTA 5G3YA 5CFNA 2A1UB 4POAA 3HE3A 2XVXA 5IMSA 2PX3A 4YP0A 3PR2B 3RHZA 4AO7A 3GPLA 2FH5B 1JAYA 1SBIA 3FUTA 3V4SA 1UK7A 4X85A 1B43A 1GDDA 4H7KA 4ETIA 1K9VF 3KYJB 4QOEA 3O7MA 4QPJC 3OLYA 1K88A 4NOJA 1M0WA 4AYTA 3D6TB 4JDUA 3OC6A 3NS7A 4JOSA 2Y77A 4IVPA 4XFDA 1KFEB 1D9ZA 1JEEA 2CE7A 1KFCB 1UMCA 2H7VA 2CYCA 2FSGA 2RHRA 3Q11A 4FDMA 4A2CA 3BQMB 5ALWA 3FDJA 3D43A 4KHPB 1SBTA 1DADA 2C8JA 2PH1A 3LJKA 1G8GA 4Y2VA 4LF9B 4DQLA 1T5TA 1E79A 3F9CA 3M83A 5EOVA 2VP4A 2PEYA 2W9XA 1DOZA 1ZL2A 3MOGA 3U3OA 5IVDA 1TU4A 4EH1A 4F1JA 4IH1A 2RGYA 2FPSA 4UVDA 1MIOB 2FW0A 2VWQA 5BN1A 4AZVA 4Y6OA 4YJFB 2H08A 5EE5B 1ODJA 4R84A 4EGFA 3I9MA 5TXGA 4PNEA 1XFAA 4DV4B 3OA2A 4PS1A 4MKHA 2FQXA 2JIOA 2H54A 1KQ3A 1K6IA 3HL0A 2FN4A 1GPJA 3LA6A 1CVLA 4MULA 2AZXA 3I9V1 5FWYB 1G6HA 1X19A 3TX6A 2VRCA 2I34A 3DCIA 3F4KA 4I50B 4Q4JB 3R76A 2VRBA 1YRHA 4KPUA 3RH0A 3WTBA 2JLYA 5JR3A 2Q50A 3G88A 3ML1A 3DKRA 4HFNA 4PC1A 3W8RA 4D6PA 4G0UA 3AY3A 1W25A 4UCQA 5I9IA 1E92A 2HL6A 3SLKA 3TW6A 2REBA 2CKMA 4FXOA 4DEVA 5A4IS 5HVNA 1BS1A 4LY6A 3QFHA 4XWGA 2HKIA 4MKXA 1X9HA 1XVLA 2FPLA 2J3MA 4RLSA 2W7TA 4IH9A 5FI5A 2IH2A 4E5MA 2N1BA 3FSJX 3TNFA 4JFAA 4YMLA 1UIRA 2YRXA 1NFRA 2IH4A 2RIPA 3HYCA 4ZAVA 4EEXA 2OHGA 4ND6A 3SAJA 1U8XX 1YJXA 2ISCA 2IY9A 3D1JA 1A2QA 4HS4A 2F4VB 2SECE 3NHLA 2B30A 2O6LA 3OPYI 1WAMA 1XZKA 3G9UA 5KYUB 3A4NA 4QIHA 3L1UA 1RJ9B 3UW1A 1WZCA 2YHUA 4KK4A 4ND7A 2R25B 4XB1A 3JD4A 1N2BA 5IZ4A 5AOCA 1YUNA 3ASYA 1J97A 1ZXXA 3U1BA 2B5VA 3IA2A 3SC4A 3NDBB 1N78A 5D2CA 3KR0A 3TSYA 1V8FA 4H59A 1BCSB 2QTBA 2D62A 2HUPA 2NSLA 4JT4A 2V7UA 4JB8A 2DCMA 2I8CA 1F4VA 4KMSA 3RCBA 4CM3A 3ROQA 3K0CC 2DPHA 4ON9A 4B3SB 1XD8A 1F8XA 1G21B 2FN8A 3ETHA 4AW9A 3CE9A 2NSHA 2FA9A 3IPYA 3QXXA 4NU0A 4K9DA 1LPOA 1XLWA 2O0KA 4TKVB 3ACDA 5C34B 5CA0F 5FWXB 3L02A 1Y4SA 1QDEA 3B7GA 4JX8A 2MMGA 4OA5A 5F9FA 3I12A 1Z5NA 2JIDA 3BXPA 4UJ5A 1KI9A 4MUHA 5LM3A 3R9IA 4AF7A 4RPJA 1QIEA 4UMFA 2X22A 4S2UA 1ST3A 4OK3A 3AI2A 3PX3A 1XE3A 3VTAA 2I4IA 4AZ0B 2Z43A 4EKYA 3DYIA 5EWJB 4GH5A 4OXQA 1T4MA 1Q44A 4TS1A 1N34B 1QFXA 3GA5A 4I9FA 4BTEA 1ZISA 1KOJA 3HS3A 2F9MA 4Q3CA 1WMEA 4Q9AA 2GMWA 2QT1A 3OLXA 5DGTA 1F1BA 2NP7A 3QKRB 3RT1A 2CHQA 4EYSA 2DPLA 5KWJA 3PLRA 3VI3B 4ETNA 3U4IA 2I9KA 2ORED 4R9RA 1CRZA 3CUKA 3RSZA 4R7ZA 4CHGA 3ZYZA 1BD4A 1UQRA 2CD9A 3WV4A 1IIRA 1UBLS 1PJBA 3WLEA 2NTVA 3IAM1 4RVNA 1SC3A 2EEPA 1QCYA 1GYQA 5CYGA 1OE0A 2DUJA 3UUFA 2PUBA 1FP2A 3U60B 3JY6A 3UWPA 2NPFA 4TMKA 3G9QA 3O75A 13PKA 2OXCA 4B73A 3VR1A 5HK9A 4II2A 5JPDA 3HBFA 3EC7A 4BMCA 5TQ0B 5BNZA 4EG0A 4DDHA 3TG8A 4P0QB 2WAOA 4LZLA 4BNHA 1OAKA 5AMXA 4Z4FA 3ESCA 3IIKA 2NWQA 1HDYA 4KWIA 1IVYA 1I6WA 1H4SA 4IS3A 1AKQA 2RJOA 4D0GA 3JZFA 1Q0UA 1Y6QA 4FYHA 4BO5A 2PZAA 4BZPA 4FWTA 4J9UE 1VLJA 4GMXA 5CW1A 3AKCA 4LA4A 1BVHA 5CD1A 1VBFA 4NCXA 1EFRA 1NN5A 1MXFA 1ZFNA 2QV0A 1AB6A 2W4IA 4QG7A 3TQCA 2X9NA 4Q3OA 4J7AA 1RLOA 2X5NA 1HXHA 4DNQA 4EF6A 5E3IA 5DTIA 2IBMA 1QLWA 3PX2A 3ZDQA 2FPRA 1WXWA 2IYTA 2P2GA 3HCAA 5ALFA 2OBLA 4GI5A 2NTJA 2IKSA 4NNOA 4R6XA 5AIAA 2ECFA 4DCTA 4PGAA 1O94C 4ZVMA 3AB3A 5LZ4A 3ADKA 4PZEA 4YT4A 4AJEA 5FLKA 1L6IA 3RTAA 1PEYA 4PGFA 3DBVO 2NUPB 3ZWDA 5GADl 4JJZA 1VQ1A 2ZWOA 3EHDA 3V1MA 1TYCA 3MGAA 2FG6C 4P4LA 1GG9A 1TM1E 2PD4A 2PX0A 1SAYA 2F7SA 4CMCA 2JCXA 3GJ8A 1J25A 3HB4X 3ILHA 2FK8A 3OE7A 2JHAA 4KLZA 4TKUA 3DXXA 1E9AA 1CYDA 2X0JA 1NYLA 3EDOA 4OGKA 3P45A 4WXYB 2W42A 3VYTB 1P9RA 1QZUA 2YN2A 4LFCB 2H0RA 1T1SA 3GHHA 4R8LA 5EJGA 4BGVA 4ZCMA 5CM8B 4HK4A 3V55A 1MTOA 3INGA 1G5QA 5TSDA 1J8VA 2UYOA 3IQHX 4HWTA 1C3LA 4JUBA 4X71A 1X80B 4U5QA 5EVCA 5BV2P 2QAGB 5DCWA 4AN4A 3HY3A 3QW4B 1SUPA 4RD2A 4B2IA 3RSOA 1I1QB 4Z3KA 5IT4A 1W5EA 2VJYA 4WV3A 3IAFA 4KDCA 4YCJA 3X2FA 4YUWA 4JIGA 2PXXA 5EXTA 1NYTA 4M76B 4JJGA 4EX6A 3PI6A 4V0SA 3JYOA 3DEFA 4FOSA 2Z8YM 5FD8A 4A9AA 4CWAA 1SOUA 3HACA 2NU9A 4JVSB 4A8JC 5IS2A 4II7A 2VPXA 4C05A 2P78A 3GP5A 3IPRA 5TB5A 1V9SA 6YASA 3BGDA 1SULA 2OO7A 3B36A 2ECKA 3P8ZA 4LSMA 5T4BA 3LOUA 2YVAA 2QY9A 1UPAA 5KJEA 1WNTA 2I3BA 4Y30A 3ZDEA 1G20E 4EZEA 1IOZA 1I7DA 2XSZA 4L5CA 5FH9A 3LPAA 4ARIA 3NDPA 4R2HA 2RAUA 2BCJQ 4ZOLA 2Y99A 2H48A 1CJSA 3KHSA 4OHVA 2BKEA 2VUHB 3BICA 4PPNA 3BA1A 4WZ6A 1MW9X 5BQFA 5JTUA 3P27A 2E6KA 3C8UA 2XD4A 3RC3A 4F91B 4AMUA 2OBBA 3KCQA 4UNSA 2BJHA 5T3UA 4R05A 2FPWA 1NGSA 2GUGA 2Q6LA 3QVXA 1BEEA 1JI0A 3HM2A 1P5JA 1IQPA 3A4TA 3OHMA 3UT5A 4JLNA 1W94A 4TN5A 2QUZA 2W4QA 3P2IA 4WLNA 4KITB 1BWSA 4Q1AA 4FTWA 3UJ6A 1NUHA 2ZI5A 2GBPA 3L1JA 3MJ4A 3LPLA 4OK5A 3WHIA 3WWZA 4F5WA 2PBFA 2CV1A 1QRSA 1A27A 1Z74A 2FHSA 2B99A 2IY8A 2WTBA 1XBTA 2PWBA 3KRTA 3KLNA 4AL4A 5K03A 1L5WA 3L4BA 3LTEA 4X3PA 5DLDA 5M2QA 3DF9A 2TYSB 5EJFA 2ARKA 2YWXA 2W0SA 1IK4A 4P7BA 3DKVA 4FNGA 3A32A 5TS3A 3KZKA 1USIA 5EXEA 4K9KA 1L3IA 1QMGA 4HSEA 2C4WA 1HDEA 1J2RA 3MT0A 1GAEO 1IHUA 4D4KA 1SJ9A 4RADA 4JUDX 1R7RA 4MR9A 1O89A 2JIZA 3OOWA 4FEYA 4CUZA 3SOZA 1JU4A 3BN3A 2AK3A 4FT4A 4M55A 1UKEA 5EP4A 4Q39A 1GYPA 2OWEA 2QDXA 5FEMA 3QIAA 2A9PA 2H6EA 1WDTA 4TTVA 3Q1LA 4JU9A 1IUKA 2J8ZA 4G4GA 5AH0A 5AKZA 5FFMA 1WB6A 2C0CA 1XUOA 1ZEMA 3FOAA 2P2SA 4N6OA 4M0DA 5ALVA 2PFGA 1VKHA 1DIGA 4QRHA 2C5AA 3KM0A 1NULA 4O6VA 3H0KA 4R5MA 3M3PA 3BMCA 5EHZA 1N5IA 1QG2A 2JI6A 2OHJA 3SZ3A 1JEYA 3ZJTA 1X9IA 1BX0A 3ABSB 3ZIDA 1DARA 1NLMA 1I2MA 2HBYA 2PGJA 3HJTA 4INOA 4QO8A 4UXHA 3R7NA 3W1WA 4B7AA 4DMGA 3AR8A 3BZUA 4Z9FA 1GHTA 3BG5A 5A5FA 5EWMA 3PD0A 3HWRA 1EFPA 2WJ3A 3HWSA 2FRDA 4XVQA 4F2PA 4M37A 4DIMA 3VHQA 4A2QA 1W87A 2ZIWB 4L5JA 3IERA 3HN6A 2I2FA 1BOOA 2CZQA 1AKRA 2IYEA 1TMKA 4WCDA 3S0JA 3KLPX 2GBGA 4CJXA 1ECBA 4AULA 4O8ZA 1I2CA 1LDGA 2ZJ3A 1DKUA 1O6BA 3ROPA 2CVQA 2C2YA 2P68A 3OKPA 2BD0A 1OLSB 2I2XB 2NU6A 2QX7A 1D0SA 4HX9A 4O1IA 4YALA 4BQRA 4N7BA 5A62A 4BMYA 2J33A 4PPQA 1ZOSA 3OWOA 2C9CA 4PPGA 4IFEA 2AB0A 3EAQA 1WUTA 2M98A 5DRYA 4CKBA 1U6KA 4MQ5A 4JSYA 2JKVA 1FBNA 5CNKA 4WK0B 4F6LA 2I1WA 2PR7A 3MHTA 3UMYA 2EJCA 2HSDA 5FTWA 1CUAA 1FS4A 2XUZA 3ZWXA 5J2UF 2VYND 1WRBA 3DD1A 5DNUA 5K0BA 1VIMA 2C4UA 1J0EA 4RJIA 1ZRHA 2PGDA 3OPXA 2OECA 4YMHA 4NZ9A 1N5KA 5KBYA 1RJDA 4AS3A 3X1JA 3UJ8A 4N4AA 4ALLA 1CUDA 1HETA 1ZLXA 1LY1A 1Y42X 4L85A 3ZVRA 2GO7A 3WV5A 4Z4IA 3DAGA 1NKSA 3ABQB 3PQDA 4CQMB 1DRWA 1P19A 4E5VA 5F7XA 4K88A 1NVDA 2B3DA 4KNWA 2A92A 1M1XB 2QY6A 1OXBB 3LXUX 1DKOA 3EY9A 4BP1A 1YZFA 4BBPA 5JASA 1JQLB 1EVLA 1NLZA 4V0LA 4ZI7F 4EI2A 2PX8A 4B3CA 1REQB 1Q14A 3ZD7A 2H9IA 4OHRA 3RR2A 4QWWA 4GOKA 5H9WA 1ZRSA 3IR5A 4H77A 1U63A 1MABA 1LBTA 1FFEA 1DDOA 1Z4JA 3DNFA 4B81A 2ZIEA 3AFHA 1GZUA 4BQNA 3GAAA 3QU7A 5FTLA 2B21A 4ZPJA 1E6WA 1N8KA 2HMTA 3BILA 3FMIA 4KVFA 5KNLA 3FPAA 3BRQA 5CURA 5DKFA 1WDLA 5LZ7A 3EPJA 2MOKA 1FRQA 4IRMA 2SICE 2ZSDA 1H1LA 2JI8A 5J9FA 4X6XA 4CMKA 4P82A 5LZ2A 1ZGHA 1JKFA 1D2AA 3RC2A 4ZHQA 1NVTA 2FEWB 3WWOA 4CLRB 5LQUA 1WUIS 4XGQA 1TJ4A 2HW8A 2RGXA 4IHKA 1BN6A 1QYCA 1ZMXA 3NKLA 2XMCA 1TU3A 3I04A 3KQSA 4QYTA 4AY5A 5C5EA 5KOJB 1I3KA 3IBTA 3AINA 2COKA 4EBFA 3CN7A 5KNCA 1KJ8A 3FLEA 4IIJF 2XUQA 4X97A 4Y2YA 2XE6A 2Z58A 5FB3A 1EFTA 5TT1A 4EG8A 1D9XA 1Z6QA 3DLIA 3P96A 2QPTA 1FXUA 4F8EA 4TKVA 4DGSA 2OCXA 1SOAA 4JU8A 4GYWA 2BFBB 2H2WA 2JFQA 1EE9A 1Z0UA 4AICA 4D9CA 3FHCB 3BC1A 4CM5A 4LC9A 1V16A 1G55A 3DKPA 1X7WB 1AURA 2V58A 2FSHA 1E2QA 2NNWB 3GB9A 4L6IA 1HQKA 2AN4A 2YMPA 1W88A 3GNLA 1Z07A 4ZYWA 1ZRNA 1LCIA 1FE8A 3P19A 4UTXA 1L7DA 2R00C 5LA6B 4B2LA 4DLYA 1QLJA 3E1SA 2FCAA 1QVWA 2BGIA 2IRWA 2I65A 2MR5A 3BWYA 3E5RA 3PGXA 4NE2A 1GWNA 3ZI7A 4UM9B 4LVNA 5GTDA 5BWLA 1VLMA 1H8HD 1ABBA 4LRTB 2NZJA 1JEOA 3UWOA 5T41A 1X7YA 3BF8A 1UZNA 3LQQA 3SYTA 2H1WA 3AM3A 3OI7A 4YAJA 4KRXA 4LTMA 4ZVVA 5GM1A 4TVKA 4CFZA 4KNYA 5LQNA 2AFHE 5EPOA 3K73O 1RRVA 4OPMA 3SJ7A 4XPZA 1QQTA 3VGPA 4ZDIA 4QDJA 1VL2A 2PH7A 3IPLA 1UDCA 3DQPA 1H65A 5B1DA 2D3WA 1CUHA 1IU9A 2XT6A 3K35A 3OT5A 3OUZA 4W9MC 1LBHA 2DMRA 2JRCA 3ECCA 3L1HA 5DM1A 1WXIA 1H0SA 3HWWA 3OIYA 1EWQA 3C3DA 1OBHA 2D0OB 2IITA 3LWDA 3BMNB 3E5NA 1TKAA 1XDDA 2REOA 4TQGA 2UXCB 4GZ3A 2VP2A 1MX9A 3MCWA 4WESA 3TMKA 5BURA 1II9A 2HSEA 3UBMA 4ERXA 2WQZA 1O8BA 3IT1A 4YPVA 1EXNA 4YAGA 5HKLA 5EQDA 2X0NA 4EY7A 4M9XA 3LM8A 3PXDA 1QFYA 2VDVE 3TZCA 1UJBA 5I8PA 3CF2A 3MJSA 3TNDA 4EPRA 5ILGA 1FFCA 4UQPA 2FXIA 4KXUA 2AZMA 5K6TA 5A2GA 3L8CA 3QKTA 1JKMA 3OOJA 4EYEA 3DB2A 5ADVA 4ETMA 4KRFA 4PX3A 2QZSA 5LBIA 1JJAA 1UPFA 2MSKA 3O3CA 3SQOA 4YRAA 2C1ZA 1YBHA 2QRMA 2JCSA 4KSBA 4PZDA 3ENKA 1P7YA 5JT1A 1WV1A 1U81A 4D6XA 4D8XA 5CMLA 3HMKA 2JASA 3PSAA 4B3HA 3LC1O 4PBSA 1FYXA 1JTEA 1OFVA 2XA1A 3OCZA 5SICE 3WZMA 4AM8A 3PCTA 4NFLA 1JHZA 2O4CA 3I1JA 3RS8A 4GR9A 1RI4A 1SPBS 1I14A 1T2EA 3X2EA 4BNWA 3QVSA 1UFKA 3G7UA 4FCTA 5B3JA 2YX1A 5A06A 2EG5A 1AGXA 2MHCA 1JA9A 1O8CA 3IUSA 4EO7A 3TCNA 2P40A 3OM1A 4FGKA 1FU8A 1LI4A 2GN4A 3RU9A 3TFQA 1U2DC 1NVAA 4BN4A 3KT3A 2H1RA 2D2FA 3GH1A 4RTPA 4I8IA 3C16C 1KYWA 2NSDA 2BGTA 2JBWA 1IBMB 4NFHA 4BWGA 4HTAA 3WVNA 1Z0DA 4UDNA 3TL3A 4GSYA 1VG9B 2WILA 4RVSA 1XWFA 9MHTA 2IEYA 2XQGA 4ZYXA 4L8LA 2HSZA 4OQMA 3PXUA 4V1CI 1DAMA 2WWGA 3MTBA 3OCWA 3G68A 1O4VA 3JD1A 1NY5A 4D79A 3AF4A 3KCNA 3Q88A 1Y9AA 2IIBA 2GQ0A 1ZM7A 4K2AA 2CFSA 3IOBA 1G8HA 1SQGA 3TMYA 3VOAA 4EG7A 1NM5A 1MRSA 1JQEA 3U19A 4FN5A 3F5QA 1VGVA 3UGKA 1ZCBA 4BE7B 3GRCA 4Q1DA 5F12A 5KS2A 1DT3A 3ONDA 1M1NB 2OBNA 3JQDA 3ZVMA 2ETXA 3SYNA 2UZ1B 5JAQA 3H5LA 4JXZA 1ZI9A 2PLRA 4HAZA 4ZKEA 2HIHA 4KRGA 4N8EA 4AS1A 3AVUA 2AC4A 1F2DA 1UMKA 3QX7A 2KS6A 1BA3A 5D3KA 4WAUA 3HQ4O 4HFJA 5E3JA 1QF9A 3DFKA 3R5SA 4OHFA 2CNWA 4LTNA 5DGXA 4C5AA 3GEPA 4FD2A 4M0FA 4NU5A 1PFGA 2CDBA 1JMVA 1KVRA 3H65A 1G17A 1NC1A 5K0NA 3UYLA 1XYVA 2LVBA 2CHGA 5CYPA 3N87A 4MK4A 4PG7A 2AR0A 3IUMA 2GM4A 5C52B 1POXA 2Q3BA 2VK8A 3GJRA 4MYDA 4MJLA 2GJ9A 4G81A 4O4HF 3ZIAD 1I6MA 1IEWA 4CKEB 5IZCA 4BTLA 4LC1A 2RG1A 2M6LA 3ND8A 4NZOA 2FTKE 1G8AA 1UP7A 4AQYB 2J4CA 1SVWA 1RNLA 1GQFA 5HOQA 2NTNA 2I71A 1JI3A 4H7HA 2GA8A 2O4UX 1CVRA 1C4KA 1ZWKA 3BFVA 3HZZA 3RS5A 1E5QA 1XXHE 3JWGA 1TUEA 3VDMA 4NQRA 1W5FA 2RHMA 4QYIB 3LP6A 4K0RA 1GZ6A 1D1PA 1GSAA 1LU9A 1Z56C 1P9NA 4WFQA 3ZVLA 1QIDA 1XZIA 5BV1A 1MZVA 3KAKA 5CDUA 2J3IA 1MW8X 3KVRA 1ZD3A 5HZGA 2CNKA 1GZVA 5U4QA 1YR7A 3T9BA 3PNVA 5DU2A 3GD5A 2ZRLA 3NUGA 3H99A 4UE6A 3DLAA 1SKYE 1RXEA 3JD2A 5A4JA 4MQMA 1M1YE 2Y6VA 5J4HA 3G1WA 1QORA 1YJCA 2IHZA 1IAVA 2WAMA 3DULA 4IJ5A 1HM5A 5K01A 1F8YA 5HPYB 1T8RA 3K0FA 5BY2A 2O2EA 1XRMA 1KP9A 3BD7A 5KX5A 3VR5A 3VNVA 4FX2A 5F3WB 3OX3A 5EJ2A 5KNDA 3MIZA 1JWBB 3WDSA 4PWZA 5AM5A 3A25A 2GAJA 3VISA 4KBGA 4B82A 4Z7JA 3QKSB 1MXHA 2XVZA 3NBKA 4P1ZA 4CEHB 2DP4E 2YJ5A 3JALB 1PNTA 4UXIA 4DVJA 4C5CA 1JQ5A 3HC7A 1G3MA 1XRJA 3L0YA 2YC2C 3JQ7A 2EVWX 2HJGA 3RRMA 3D4IA 5BWCA 3E35A 3VXKA 4GXRA 1ENPA 4INPA 5IKMA 2JEZA 4OYHA 5E2IA 1Q3HA 5ETJA 2O2SA 4U2DA 2HMUA 4S1TA 3PRYA 3FCCA 3QWAA 3U3DA 3BFKA 2BMAA 4F85A 2C7PA 1TYEB 3WWEA 2AFHA 1UK9A 3RS2A 1SCAA 1FCJA 3B3AA 2AFIB 3GC6A 2Q4RA 2WPNA 4IG9A 3U2QA 3X1ZA 1UWVA 3DDHA 3OIUA 4OYYA 2CL0X 5HKBA 4QODA 5K2OA 2ZIVB 2Q1SA 1R15A 1XVTA 2H7CA 5U4XA 3VGJA 1T0JB 1P0QA 2DTXA 4DV0B 1MB4A 2P90A 4W5OA 2IBSA 5JAUA 3QXCA 3RROA 2HC9A 4D74A 1C9NA 3CH6A 4D81A 2AOTA 5AI9A 2HJVA 4KV9A 1Z0IA 3LHDA 3WWCA 1F06A 2XVYA 3HJUA 3ZKWA 4C0HA 3WNDA 2ZJ2A 3WAJA 5E9WA 1R0KA 5K4GA 1JMYA 1H4VB 2D7CA 3O7WA 4XUEA 2J3KA 5L95A 1GNRA 3SR4A 1KIMA 2QGZA 2QTFA 3G6KA 4IIUA 5A3RA 4KBYA 4GZLA 3J81k 1W4ZA 2UVPA 2F6RA 2J0SA 1FTYA 2Q1YA 2R1TA 4BKMA 3FJYA 4B4DA 1T0UA 4DV1B 1AMOA 3I61A 1AKVA 1TFRA 1RWOA 3R0ZA 1V95A 3AERA 3RBAA 3ID6C 4KDEA 4YCSA 1B3RA 3CCFA 1ZO8A 2GVZC 4IKOA 4RDCA 1U9JA 1ZGCA 1I13A 3GPIA 3NGXA 2YXBA 4I55F 4JVOA 4Y6RA 4B0OA 4ZCSA 4S05A 1QRUA 1G7TA 1QGUB 4G01B 4K9MA 1Q6ZA 3CUVA 3T5MA 4P81A 4DE5A 2DUWA 1ACMA 1P1HA 3L04A 4JLWA 4N0EA 5DPMA 3ZHTA 4BNGA 5IVHA 4F4CA 1GP2A 4ZZ2A 3G9TA 3RAFC 1O9BA 4O2BF 1PN3A 4BE4A 4JI7B 4CKXA 5EN4A 2E4ZA 3ET4A 4FHZA 4G5HA 4GBMA 3IQXA 3EF1A 1N92A 2OD7A 3E22B 2J59A 3KVYA 1NW4A 4YUYA 3KQUA 4NATA 2R1VA 3TLJA 2R96A 4TXHA 3NOVA 1MQSA 1K2VN 1ULTA 3QNUA 3MWDA 2BFOA 3WGZA 4MJ7A 3PPYA 1U04A 1WU8A 1UPXA 1ZR2A 2OENG 5EJ7A 1RHKA 2DUUA 3ONVA 3EGVA 1OHHA 3BX1A 3N58A 4PZ0A 2V8OA 1T1EA 4WZBB 2ZRQA 4FJ2A 4WADA 1U8AA 2CUKA 3AMVA 3UAZA 4D3FA 3BXOA 2HX1A 3KZCA 4YAUA 2A7QA 2WNIA 2I67A 4H4EA 3ESBA 4UHKA 4JYAB 5H7XA 1RPNA 3KXLA 4H6VA 1L7NA 3QU2A 1M6VA 2QI9F 2XECA 1AQ6A 2O05A 4YYEA 2N75A 4E08A 5IWAB 4XJSA 3C7TA 5CT5A 3TR0A 2E85A 4RACA 3I9JA 3NWJA 4B3FX 4E03A 5ICMA 2R6AA 2WJWA 3FAKA 5JRZA 2HMWA 3RYCA 3KZOA 1UJMA 2OZLB 3F2VA 1ND6A 3O73A 4R40A 4U5XA 1IOVA 4ZJUA 4F3YA 5KOHA 2Z2KA 3D8HA 2II6A 2NOAA 1H0KA 1E98A 1OX4B 1E96A 3IC5A 3LZ6A 5K0LA 4AKHA 4NZZA 2I1VB 1LKZA 5EP2A 3BREA 2VTEA 4EW2A 2GXSA 4YAIA 2PUEA 4P0PB 4US0R 3I52A 2P9FA 3WYBA 1Y80A 4CTMA 1DI0A 1IZZA 4DZRA 5DI3A 1XEFA 4QUJA 3WTCA 3AUJB 2HCJB 4E7OA 1H69A 3J81A 1QO0A 2H4JA 2C4HA 2X5KO 4D9HA 4DPMA 4L8GA 3VPDA 3VNSA 4OH1A 1ICEA 2GD1O 2OFWA 4I19A 1L8OA 4NKRA 2I2AA 3GZJA 4KZPA 3THSA 4LGVA 3DR3A 2J30A 1Z45A 4BNFA 2ZQ5A 4K9NA 4KP7A 3VHXB 3OIDA 1Q1NA 3KAPA 1WO8A 4Q37A 4FFSA 4RO0A 5CVJA 3KKQA 2DPYA 4EKDA 5BV8A 3BWBA 3PD1A 1WSDA 3NHYA 3QHAA 1ID8A 3QYJA 1U0BB 4Z9BA 3QEKA 5K0JA 3R5TA 1V35A 3ORHA 1GPAA 2XQKA 4TMXA 3QLTA 3QXHA 2OP1A 3L7CA 1XXHA 1YK0A 4G0QA 3DTYA 4LF4B 3MQ2A 1U28A 1QJ4A 1W0JD 4UATA 2Q6IA 3O1LA 2VAWA 3TLZA 4M1SA 5C7OO 3FZGA 1U98A 4PZLA 1T8PA 3QY9A 5HRUA 1QPBA 3JQ9A 5EQFA 4IL5A 3LY8A 4UMEA 4YCCA 2XYRA 3F47A 3ZQ6A 2AI1A 4Y0NA 3GU3A 3WYEA 3TAUA 3IMKA 1LVHA 3LTNC 3TEJA 1E5XA 3CY6A 1QTIA 1E7MA 4WUTA 2X8JA 1R16A 2XTAA 2O3JA 2XTJA 7REQB 1IY8A 1G4HA 1I4OA 5KYYB 5HXAA 2XX3A 3HSSA 4QTUB 5F23A 2OZEA 1NNLA 1RJFA 1XAGA 2HT1A 3UO8B 3ZLJA 1GOTA 1W0CA 2ZPTX 2Y0CA 1E2KA 2QM0A 2FYTA 3BIXA 1SFRA 3N2KB 3QGMA 4FB5A 2ZCJA 1PU2A 1DKNA 2BT4A 3D3WB 4UZSA 3WAGA 4DTIA 1CNMA 3GMTA 3UANA 1ADFA 1NFQA 4D8TA 2WWWA 2VRNA 3LY9A 4M9QA 1KJYA 1EYZA 2J6HA 4MWDA 1VHLA 3MERA 1OI2A 4BKUA 2XXAB 1VLLA 1FMLA 1K6JA 3IV7A 3LBYA 1RQLA 1E8NA 5D7BA 4N12A 3T5AA 1W1UA 5HTOA 3VUFA 1IDN1 1VKRA 2Q6KA 3ZWPA 2PH5A 1E0SA 1NT2A 3B20A 2AMJA 2FQ1A 5F78A 4OMUA 2BTOA 1OXKB 2RCNA 3I01A 1SUFA 3SDBA 3HXQA 4CCYA 4IKPA 2PMKA 4URFA 2C2XA 5FNVF 1CY7A 4G84A 5AK0A 1O9HA 5HKOA 5JDIA 1Z0ZA 1O97C 3EIOA 2J85A 4ALIA 1JKJB 3NOOA 4C0SA 1KE1A 3QUBA 2Q8PA 4HEA6 2FETA 1K7XB 2ZJ6A 4LQDA 3R8XA 4MV9A 5AKXA 3WLQA 2ZCVA 4F2DA 1TQHA 2G5PA 1LK5A 3P5BA 2HGZA 4M2LA 2NYVA 2WIJA 2YIVX 4ZI5A 5FEUA 1VJGA 2O3UA 2FPKA 2ZR0A 4H0CA 3B5EA 5B36A 4I1SA 4FOLA 2CUTA 2IPAB 2QEQA 4RORA 5A4KA 1XRSB 2LTAA 2TRSB 3L7DA 4C22A 3OUTA 1ZVVA 2XAUA 5C5IA 5CYOA 5LNK1 5TRTA 1M1NA 4CIVA 2I22A 2OOSA 3IELA 2PJRA 3E2MA 1IEXA 3R9XB 1AK9A 3GVHA 3NRCA 3AX6A 2OFXA 5C81A 2H2IA 1WR8A 2HSWA 2OGZA 1BN7A 2BDUA 1MC1A 3OTQA 1IZYA 2BWJA 4DDWA 1R0XA 3ADCA 1EU1A 5LQCA 2YWRA 4ZVPA 4YPOA 3TCKA 4I1YA 1W0KA 2Z83A 4B7UA 5KYKA 1HNZB 4NMWA 2YFHA 3NC0C 1Y8CA 3PR3A 1HC7A 1CEQA 2XZTA 4YEDA 2WP0A 4RIHA 1E1CA 4GKBA 1HBJA 2H3EA 2J67A 3O92A 4TWAA 3A36A 4EUNA 3SEAA 4B74A 1LLQA 5E7IA 1NBEA 2Q5LA 3LHFA 3PRKE 2Z2JA 3UA4A 3OA0A 1IY2A 4MVCA 2G6TA 5K51A 1JKIA 3KJHA 4C0KA 4OGFA 5BWMA 5KQMA 1IWPB 5E9JA 3VJLA 1PR6A 1KZ9A 5BSGA 1QGYA 1PZEA 3SZUA 5GV7A 4JQZA 2FW9A 4UHFA 3E5HA 3MXOA 3DZBA 4YXFA 3ET5A 1QP8A 7MHTA 3JQFC 2X13A 1K7YA 1VG8A 3CKKA 2J0VA 3G0DA 4GMGA 1G0OA 2VDLB 3RVDA 2OYSA 3BE4A 4OHMA 1NMSA 4WFIA 2RH9B 4D3ZA 4WY2A 1RAHA 1H4TA 3BWVA 5GMOA 4IMPA 3LYLA 3QLJA 4MNTA 4EI7A 5H3LA 1Y3CE 2H5EA 5T6MA 3LVFO 3HCWA 1Y63A 4OMFG 3SGLA 4CV3A 3BL5A 2CD7A 1AN0A 2QQGA 2PRZA 4RV5A 4P58A 1R6VA 2WM2A 3OEHA 4E2YA 2CUZA 2WU3A 4EA8A 1BGVA 2GPAA 3U44A 4XPIA 1ZUWA 1GPUA 1L5GB 1MC5A 2QW1A 1L5VA 1Z29A 4N7MA 4JEUA 2BSQA 3RO7A 1PV4A 1GJRA 2A14A 3A10A 3FETA 3HB1A 5CA0B 4YIHA 2BONA 1HOXA 4MRRA 1J20A 1D3AA 1QQAA 2V6MA 4DILA 1M8JA 1S89A 4NYIR 4AG5A 1B0PA 3EZ9A 4B34A 5DN9A 3BM5A 2ZJFA 4M4SA 2LPMA 2ZFUA 3PXAA 3GLHE 1NVUQ 3X0DA 2R5NA 1SBHA 4Y3UA 3SY8A 1YVPA 4JSRA 5T67A 4GVLA 4GPD1 2VSOA 5B5SA 2OMKA 1OF1A 3O8BA 4QYSA 4QU0A 3CZPA 5DM4A 3K2EA 3TEFA 3U5ZB 1T8WA 1RQ7A 3IUYA 2PKYX 4FR2A 5ECGC 3T41A 5B4VA 3PWZA 4ZCTA 3BSSA 3KYCA 4NAUA 1DO8A 1K1EA 3JARA 2IXDA 4AMZA 3H6HA 1U0EA 4EELA 3VYWA 1XVUA 2JD2A 3PV0A 4C6HA 5EKTA 4YRKA 1TRHA 3W06A 4AZTA 1ZEJA 1Z7YA 1RWPA 3AJ9A 4XASA 3GELA 4K9QA 4HFRA 3F5DA 3I5MA 2BKXA 2HI0A 4KQEA 2XNKA 2HSJA 3CVUA 4JB3A 1BHJA 1U6JA 2NX2A 1LPNA 4YP7A 1FJXA 3Q85A 4HXYA 3M6MD 4O2AF 2SKDA 1MO2A 1RPJA 4MS1A 1DAHA 1RM4A 1JDBB 5AI4A 5BUSA 3U6KA 1JV2B 3SFZA 3U9SA 4I9NA 2W6JA 4I1RA 1FZTA 3E3LA 3AKZA 2F8TA 2FGKA 2DUNA 3RVKA 2PMDA 2VWGA 1G8FA 1Z5UA 2ATXA 2EBUA 1S1CA 3HDVA 1WCWA 4FD3A 4HDOB 4ID9A 5CA1B 2B20A 4BNMA 4U9IS 5G1PA 3L2OB 5CIQA 3KL2A 1R1DA 1ZN7A 2IZ6A 3RVLA 1MO5A 3N8HA 4FX5A 4YRGA 1QJCA 3OD5A 2PQMA 4UMDA 2VNJA 1TOAA 4FDLA 3I30X 2HQBA 3W04A 3PPIA 1Y4UA 4IBOA 1G8KA 2HY7A 2RARA 1HYBA 4MMXB 1ECGA 4YAFA 1BMQA 4ZALA 1RABA 2GASA 2HPHA 2VS1A 2YIDA 4MPPA 2R1ZA 4PZZA 2Z8ZA 4HZUA 2WWVD 3GG9A 1E1RD 2JFNA 1XLVA 1UWLA 3CLRD 2BFNA 1F48A 1UIMA 3GUHA 3IQZA 1Y4ZA 4GM1A 1P4AA 2B1JA 4IJUA 1D6SA 4JR2A 1X70A 1WXEA 5KREA 4EABA 2PYZA 4N54A 2VNSA 4C1NA 4H4CA 2AQKA 2Z4TA 1R6TA 1XU4A 3EGDB 3VNRA 4MVJF 4CYMA 4HDNA 4XD7D 4DLPA 5K4HA 1A0OA 1J8DA 2D8AA 2R4TA 2X7XA 1P91A 4HH1A 4WGGA 5EI5A 1V71A 4QLAA 5CT8A 4N01A 1M74A 1W47A 3V8NA 1AHNA 1UMDB 4J29A 3IQEA 1KORA 3JRWA 3K9CA 3LIPA 5K20A 5DCYA 5LOVF 4Y2TA 5L4LA 3K0BA 3E58A 3QPVA 1EQUA 4ZARA 3MGGA 4JL8A 3SYLA 2AZDA 3CT6A 1TC1A 3T5CA 2H51A 1R6XA 2TSYB 4U6NA 4BNKA 5FAKA 3D7LA 4C7OB 4LIPD 3DL4A 1FX1A 1YQTA 3SX4A 2GO1A 3COYA 3NEAA 4G5OA 1O97D 1PRYA 4WX2B 4KI0A 3WGOA 3BB4A 2I54A 1ESEA 1YQWA 1Z6XA 5F2OA 2B37A 5HIJA 4MLPA 3TOVA 3I2YX 3GA7A 3I37X 4QRDA 3IRVA 4G09A 4M1ZA 3I6IA 2VPZA 5EC8A 3VMFA 4D56A 2OORC 4ZEOA 1WCIA 3V4FA 3ND7A 2R751 1T9BA 1VE7A 4NECA 2XA9A 1L8XA 1G9TA 2I9PA 3K8OE 5C18A 4G9EA 1N5JA 2V6JA 1D8AA 4JI5B 3TBKA 1H5NA 1KSFX 1T0PA 2E3JA 4DADA 4MWSA 2BUBA 2PJUA 3H2KA 3IBCA 4WLUA 4BJ3A 4C08A 1TTHA 4ML3A 1YFJA 2FUCA 4P84A 5AW2A 1B14A 4QPZA 3WI7A 3CUUA 1G2QA 4DNFA 4R1OA 3F3MA 3NWEA 3R0XA 2WZDA 4RIEA 3ECSA 4IX9A 4IUBS 5BMVB 4GKVA 2WWTA 4V0NA 1KJWA 3A14A 1WG8A 5FFNA 1KE2A 2WUFA 3TTWA 1OKKD 4WRRA 4Y98A 3SZMA 1NXOA 2QTTA 2HUNA 4XB6B 4YRIA 5I3ZA 3E18A 3N2LA 1I5EA 3SS8A 3H5IA 2SNIE 3T5GA 3VJKA 1BDIA 4WLOA 5JO0A 2OHOA 3F7OA 3M1IA 4B80A 4TQUS 4PR0A 2GJSA 5IDQA 2CVZA 4UXJA 1RP7A 3AYZB 2GN1A 3WFZA 3EVBA 1BVYF 3PNPA 4R81A 1OPRA 5TQ2B 3T3HA 3Q5GA 3ER9A 1XKXA 4IDEA 1YVDA 5KOYA 4V1CA 5AICA 4QUAA 3S1AA 1PYGA 3UK2A 3MBKA 3KKMA 2Y1DA 4EECA 2WVJA 2NPOA 1Q17A 3G49A 4A3SA 4AZ3B 4D46A 1QQ5A 2C3OA 2AR9A 2HJHA 2ODTX 2YNMD 2QPAA 3L3BA 2F3PA 4N9WA 1Q1AA 2JW5A 4GOOD 4EP1A 3I9LA 3LT2A 2OC4A 4J0QA 3K4QA 4L5BA 2QZ9A 4XFKA 4FS8A 4C87A 4CKYA 1F8FA 3B2EA 2WJAA 4H6WA 1M2VB 4J16A 1SC9A 4L74A 3U4GA 2ZJAA 2J4DA 4TV8A 3AW9A 1RXVA 4M8KA 1Y0BA 2ZI4A 3HEAA 4Z7QB 3AKEA 4Z7NB 1T43A 1W85A 2X77A 4JXJA 4NJEA 1V2HE 3T3EA 4DSOA 2CLCX 1PTJA 2X8AA 4RD0A 4RMJA 2LDBA 5E4TA 4OREX 1T1RA 4NZMA 1JIQA 1L8QA 2A5GA 4LZWA 4D0NA 2PXAA 4PBTA 2GBLC 3ZCUA 1ZC4A 1XTJA 2PS9A 1TECE 3IVCA 4TTQA 2MJLA 4TZKA 1WPQA 5EGNA 4E1VA 2I6FA 4Z51A 2YUTA 1JDZA 1O6ZA 2R6ZA 4JLAA 2NN3C 1JSLA 2NVWA 1KK2A 5M29A 4PSVA 4U2BA 1J9EA 3BERA 1NF9A 1U0JA 2JGRA 3GFSA 2GXAA 4IEFB 1BW9B 1O5OA 3IE0A 3M89A 3EWSA 3ZQKA 5FO1A 1E1QD 1G4AE 4K86A 4RZUA 2DWOA 1KJ9A 1QBGA 1OY1A 1E77A 3L7JA 3KR1A 1T5LA 2H7XA 3OQMA 3PHIA 3AHHA 5BNWA 1FJHA 4ZJZA 2FRVA 2NMVA 3TAXA 1RQNA 2NZXA 1QXSA 4O2LA 4CMEA 5KMGB 1KOLA 3TRFA 2R44A 3NM4A 1TVEA 4N03A 1DC3A 4BB5A 4DUGD 3BXEA 4DC1A 1YL5A 3LUAA 2I80A 1MJ5A 4M83A 4RJKA 4B4UA 5EIEA 5J23A 3KBOA 2AOXA 4LJKA 1LK0A 3C70A 2QTVB 4IICA 4F4HA 4WY5A 3KS9A 5A9RA 2AH5A 3ENNA 4JQOA 2W2TA 3HU2A 4U2CA 5ES4B 2JFFA 1G3QA 4Q7EA 4DEXA 1AT1A 2QX4A 5GY7A 3WC4A 1TTPB 1HUQA 3LI2A 3E03A 3JZAA 5DO9A 1DAPA 2OKGA 2QIPA 3L46A 4HCJA 3IHTA 2X2PA 3EZFA 3H2BA 4M9UA 3RI3A 1VGQA 1I3LA 1Y1KE 2DFTA 2FW1A 3MN1A 4S0ZA 5AESA 4A0SA 4XOIA 1C0IA 5J2UB 2HA7A 3K70C 1QH8A 2CZGA 1KTIA 2FW6A 4R41A 4EB8A 2XQIA 3SF0A 4U7TB 4IPTA 2JHPA 5JI3E 1VECA 3VOTA 1AXEA 5KSYA 1FC0A 4PG6A 2CJWB 3GP8A 3C2QA 2IJGX 1PX2A 1R4NA 2QAJA 3TRIA 2QU8A 2YZNA 3AEUB 1D6NA 1QHFA 1IE3A 3EXHA 2XIJA 4OJYA 4YJGA 3FTEA 3BMQB 1AXGA 4KI7A 4U7GA 4ZAGA 4RK0A 4L73A 4OP1A 3N6VA 4JS0A 4D3XA 4A73A 2JD1A 2P9EA 2PT6A 3A9SA 3MUFA 2QLLA 4YJ3F 3WB1A 2YWJA 1L4KA 1RM5A 4G0MA 2C5BA 2BFAA 2OTCA 4GI1A 1YO6A 2BEWB 1ONBA 2I6UA 4M9RA 1CWUA 1JT9A 1Q0QA 3IOMA 1XA4A 2IPNA 4K6MA 3P9KA 4PHTA 4YUAA 2VDWB 3KQTA 4QVIA 421PA 5TF4A 4ZMSA 2XNSA 2ZYGA 3B2NA 1S2GA 2F3UA 3QLEA 3ED1A 4X20A 5EKSA 4BGUA 4DPLA 3Q9SA 5AXAA 2BYTA 4JP8A 2VJPA 5K8VA 2P9YA 4D9NA 5FKJA 5A9TA 3AYXB 4OXYA 3I72A 2OQVA 4RY8A 2QLNA 3FIUA 4JI3B 3UUGA 2WG0A 1N32B 2O3TA 2FW8A 1OA1A 1SCUB 4QAQA 3USCS 3VJMA 3PI7A 4N5IX 4AMVA 3KIPA 2KLHA 1T9GS 3TOCA 3ASUA 5FBQB 4Y8VA 1WNFA 4KUGA 3PX7A 1W4CA 3IYLW 3LGAA 3FWHA 3A0RB 5CNJA 5JATA 4RHTA 2QTAA 1C1DB 3ZZTA 1PJAA 4M89A 4IIJB 5A6SA 3QE9Y 4DJ5X 2J08A 4G41A 3LU1A 3ESQA 2PS3A 5AK5A 5GZ1A 2XIQA 4NQZA 5CA0A 1RTKA 2P9HA 1XRQA 3W5JA 1BA2A 3QUSA 4JOCA 4JX9A 2NADA 3ITKA 3SQXA 2XPCA 4LI3X 3VZBA 4C0WA 4KLNA 2PUVA 4JUCA 5CDFE 1LD3A 1PJ8A 5C8YA 2RMKA 2X41A 2EDAA 1Z47A 3AY7A 1ZBQA 2IA5A 1DX9A 3DMTC 1L4FA 3H42B 1NWCA 3ZBQA 4GL4A 5BR7A 5IHXA 2IYAA 3CO0S 3TPCA 1OV4A 4DL9A 2B4TO 4YJ2A 2BHNA 1L8LA 2F9LA 3O1HB 3QPWA 4HFMA 1Z38A 1YA4A 4YI5A 2EP7A 1GR0A 1PD1A 4Q9JA 3WJAA 3DO6A 1YD7A 4UREA 2IE8A 4IGEA 4WCFB 4TL9A 4Z2AA 4JI6B 4LY0A 4MQ4A 2ZTHA 2AG0A 3AUXA 5LC1A 3DZKA 4RHYA 5TJ9A 2GKGA 3TGWA 2C20A 3IQFA 1RKQA 3OJOA 3UJHA 1ILWA 4KXWA 4ZQGA 1JFFB 3KT0A 2AC7A 2F43A 4BNDB 4MDFA 3S55A 1A9PA 2VHUA 1KWKA 4Q5IA 2F8SA 4EJFA 1XCJA 1Q7BA 3Q0TA 4G36A 5JIBA 2QLJA 4YBRA 3WGJA 1P7WA 1PT8A 3FKQA 1X7GA 1SVUA 1SWWA 5AQEA 2GS9A 2XMPA 4JLKA 5CNIA 4YROA 1YT5A 4GPIB 3ZV5A 7ADHA 5JS7A 4IIGA 2EL7A 4DA7A 4CIWA 5A3JA 3C6XA 2QROA 2WLSA 1E5DA 1U2TA 4NV1A 4XGIA 5TPWA 1ZNQO 2YHIB 3L6DA 3CVOA 3I2KA 4OB7A 3V7WA 1NQXA 1BCRB 2AMYA 4YX9A 4ZEMA 2QV7A 1UBUS 4RSMA 4DG8A 1J33A 2FSVA 3K31A 4KPYA 4JOBA 4C2UA 2GRAA 2NVBA 3QF4A 4JC5A 5EA2A 4EYOA 2C9OA 1VPLA 1CFJA 1G20B 1OC2A 1R4AA 2ZGVA 3PUHA 5FJJA 3HKDB 2A0FA 4GI7A 4D45A 2EL9A 3JD3A 4Q00A 1KBZA 3R0VA 2N42A 3WGHA 1N7IA 2XOKD 5B3KA 5CBPB 1XOIA 3K15A 4IFTA 4WK2B 3VHLB 4P98A 3Q5EA 3CG0A 2PZFA 4MW7A 2ZUWA 3IOCA 1WV0A 1X86B 4PHGA 4QGHA 4X1KA 1A77A 5BSVA 2JCYA 4EKNB 1PKEA 3TLXA 2BJWA 2O5VA 4R16A 1X0VA 5IG2A 2FQQA 1VCHA 3TSOA 4E70A 2XVAA 4KE6A 5E7QA 3RBZA 2X8LA 4J4TA 4TWJA 3F6EX 2NZVG 3OIWA 1P18A 1QNFA 4WOCA 2EWMA 4GX2A 5FV7A 3BL8A 4YRLA 5FYDA 1KSJA 3A31A 4AXBA 4YUZA 1LWNA 2JJ2D 3MMXA 4LYGA 4NONA 2OV1A 3QITA 4YCNA 3JW8A 4JVNA 4J3FA 4O5AA 1POWA 2YJ6A 3KOYA 2HA6A 4ZGWA 2WLTA 3OJLA 1PEAA 3LP8A 5B6PA 4PR3A 4C0AC 2GCOA 5JFTA 1XCBA 3CJRA 4GT1A 5AVKA 5A02A 4G0WA 1RYDA 4FI3C 1TAQA 1XZNA 4DMLA 5LZ5A 1J42A 1KK1A 3EQ7A 1XQWA 4GOXA 1L0BA 1RLJA 3SBXA 4KMOA 4DLKA 2P3OA 4ZVRA 2PAFA 3USES 2C88A 4MS3B 2LKDA 3WLTA 3OO0A 3TSAA 1OYWA 1LJ8A 3A4LA 3LX5A 4P3XA 1RRFA 2VCYA 3TUZC 3UEOA 1YS6A 1RU3A 1SELA 2X3FA 1AQLA 2Y0EA 3QTTA 2IYUA 5KU7A 2BEUA 3KPJA 4UBIA 1YA6A 1FXSA 4REOA 3VDQA 2YXPX 2FUKA 4UFOA 4YJHA 5BN4B 3BA6A 2J0UB 5JDCC 1WD7A 1JHRA 3DBRB 3SS7X 4YJKA 4Z49A 1E63A 2E18A 1DAOA 4JV5B 3H9JA 4C0BA 4UCWA 1L3CA 2WE7A 1MF7A 2PNFA 3H83A 3TTSA 4IDPA 2HCRA 1YCGA 2ERYA 1HLPA 2EW1A 5BQOA 1YZVA 4IYJA 3DM5A 3R5JA 3K2QA 2FFJA 5ESWA 2ASEA 2W2QA 4E6EA 1JR3D 3DDZX 3DNPA 2GYVA 1OUMA 2DPGA 4JBIA 4BATA 5LU9A 1G8MA 1L9XA 4Y67A 1XTVA 4ZT4A 4L9RA 3CQ9A 1DKRA 5EIAA 4ZYZA 4AJPA 3LCJA 4DLXA 1MOZA 1XTTA 5JJLA 2CNDA 1OREA 3NBUA 5K3BA 2XADA 1G5FA 4MW9A 1C1HA 1EVEA 2ZSIA 1KZHA 3R9KA 1TAUA 4RIIA 2WKPA 1NXWA 3C97A 4LOJA 3W05A 4MEBA 4PYOA 2O0JA 1G7RA 4ZVTA 2DZDA 2QQ5A 1P7VA 4ER3A 2JB9A 3DJFA 1YB6A 2H3HA 3D64A 4GWGA 4MUMA 5LB2A 2EQBA 1S1MA 4BKOA 3DOUA 2H2FA 4EGJA 1RIIA 1VGRA 1VRWA 1VSQA 2BC9A 2IYYA 3SICE 3F49S 5DV9A 3QW2A 3OUUA 3HCEA 4UBJA 4O33A 4BFZA 4DYDA 4TZ6A 2BTQB 3NDRA 3CRVA 2RBEA 3SX0A 1NR1A 2IHUA 3QVOA 4JLVA 4Y1FA 1A5BB 3U3XA 4XM0A 5KSPA 3BORA 3PHJA 4QASA 5CDFA 3LO8A 2MINB 1WXHA 2PFSA 1WMBA 2ZROA 3H9BA 3MJVA 4RKFA 2ES4A 4YAWA 3BE8A 3L6OO 2NU8B 4WOBA 1O87A 1YFKA 3AVXA 1K06A 2VUSA 2LR0A 3FLAA 2G77B 3H9GA 2V7EA 2VJAA 3BRSA 4L5AA 4Y9UA 1TPYA 4Z8XA 4IG4A 4N6GA 4PXYA 3C7CB 2JLSA 2ZSKA 1S9DA 4FONA 1AZSC 4LMAA 5IHPA 4D80A 4W9NC 5BOSA 5B1YA 4BX0A 1NQTA 3H75A 4EFLA 1SG0A 4NBKA 3RF6A 2W22A 1AD2A 1XZMA 1ESMA 2FMIA 2Z4SA 3CB4A 3CONA 3PVZA 1C0PA 2O1SA 1UJ6A 2I7DA 3LW7A 3RUCA 4ALNA 3VO8A 4JASB 2XCOA 4R7GA 3DD5A 4MWOA 1IXYA 4G07A 4NJMA 1O6CA 1IAQA 1L7OA 4MVJM 3SEQA 1NVXQ 4B6EA 1QF7A 1AKYA 5MN5A 4HDAA 4DQVA 4QREA 2CLKB 1T8UA 2AN5A 3L5KA 3GT7A 2I99A 5FF9A 4HWOA 4DCOA 4RX1A 5FA5A 4R8VA 1F2VA 1D04A 4DLZA 1HYQA 1UM8A 3M1LA 1NVFA 5K8LA 3SVLA 1YC2A 2UYHA 3HUFA 3L8GA 2R6JA 2H1CA 3S2EA 4RTNA 1RKXA 1ZZGA 3CIOA 4LJ6A 4RE5A 4XTCS 4BBJA 2BR5A 4BXOA 1H2HA 1E2NA 1KPHA 3GDHA 1TDJA 2O2ZA 4OUKX 5K3SA 5DNCA 2IXBA 2C5LA 3N8NA 3DDCA 4C0LA 1CDEA 2IXAA 1Z6AA 4O29A 2GPBA 4PIMA 1RSZA 4RUKA 5F33A 3UTDA 2B4AA 3EQ8A 1DG9A 3GFGA 1NLUA 3HA5A 3K6KA 3C6MA 1JTVA 2X4IA 3C3WA 2CJWA 2Q2QA 3IP3A 4OSOA 4UTNA 4Z7OB 4UEJA 5JQGB 3PUZA 1CS4C 3K2BA 4MS4A 1MAWA 1IN4A 1YMVA 3T1NA 5B7GA 5BXYA 3LUCA 3V1NA 2N46A 2WWXA 5FBRB 3BJMA 4NYJR 4DEYA 4L7QA 1OFGA 2AQHA 3FXAA 3KB2A 1P8AA 1PCXA 1VIVA 3F6PA 1AU9A 4V0RA 4B9EA 1JPJA 2WNSA 3ETDA 1T8YA 2BW0A 1DOHA 4I55B 4V02A 2BM9A 4ZI7A 4KIJA 1MZPA 1JDPA 1PJLA 4F6CA 3ORYA 1B42A 2A1TR 1USVA 3CW9A 5BMOA 4A27A 2BFFA 2EFHB 4QOJA 5CEEA 4HNRA 4GKKB 2BEJA 2Y27A 4TL6A 1YQUA 4O2BB 1H2WA 1KU0A 3DMRA 2VIIA 2WF9A 3KQVA 3R0JA 4UU1A 1W2GA 2ZITA 1LK7A 4X54A 1N3LA 1U2EA 3I1IA 3OPYB 1CV2A 4YWHA 1NN1A 2AXPA 4OQXA 3J80A 1U0FA 2Q3DA 1NXPA 4WACA 3BGIA 3M3DA 2O8EB 1JAHA 2FPIB 1NAIA 3CZMA 1EDOA 3KG2A 4UU7A 3X1WA 4BRSA 3M70A 1VBNA 1LLFA 3RYHB 1DO2A 1BYUA 1YRYE 4YREA 1JU9A 4CIXA 4R0NA 3TLGB 1G9SA 3LDHA 1ZD8A 4CETA 1P0MA 4O63O 1P44A 1XQ6A 3F3SA 2ZM5A 3CPEA 3GJ3A 2RI1A 1DTSA 3SMQA 2NU7B 4FFOA 2H18A 4G5FA 4S12A 1P5FA 4MO9A 3PJEA 2GHTA 4JB0A 3IMFA 2VP3A 3QENA 5ICGA 5KWEA 2QTZA 3SFVA 2UUOA 2QJOA 4XYMA 3K0CA 5JBIA 5M3BA 2F64A 3Q3HA 3ILYA 3T9FA 2EX4A 4HVCA 2BGNA 3R8CA 4TTAA 4DYHA 3R3WA 1EXVA 4EW6A 3SJZA 4DS3A 4NBVA 1M7GA 1JLLA 1RAFA 3CSSA 4IINA 2IOYA 4JP5A 3D31A 2XRFA 4AJJA 4QOSA 3ND6A 4JP3A 1EUDB 5JCOC 1JJIA 2CWDA 2WMNB 4NWIA 3MILA 1QHEA 3HN2A 2L19A 3EXG1 1DP4A 3HI4A 3LD9A 1N4DA 3I6YA 3N6XA 3K0KA 1QP7A 1A4UA 2NTEA 3T1YB 4G9BA 3DUFB 2AEEA 4WCFA 1Y8QB 5B37A 1BXRA 1RADA 2O8CB 1U9IC 2AJ8A 2VT2A 4JIMA 3UJAA 2V5VA 4IMIB 2Q7OE 5AIBA 4A91A 1K08A 3ZE1B 3KB6A 3ONFA 1BVUA 1H2FA 1Y3HA 4MQEB 4NTZA 2FDRA 2PCJA 4GX1A 5LP6F 1JE1A 3PKJA 3DC2A 3LDAA 3LIIA 4P7JA 5LIRA 4MRNA 5F73A 1K6EA 4NFSA 4X6UA 1CETA 2PL3A 2QM7A 2BFEA 2RHBA 1L4GA 5F4ZA 4C14A 1HZZA 2GPJA 1MV8A 4MGKR 4Y2HA 3C3AA 3RTGA 1JIIA 5C51B 4GRAA 2G82A 4W1PA 3H2IA 1GPMA 3BHNA 2EFCB 4RGVA 4QFDA 2XCSB 3C3EA 4PFKA 3L40A 4RGQA 2YKGA 2VYNA 3BBLA 3MTAA 4MB2A 4BB6A 3M6FA 3WYCA 5B7PA 1UBEA 5FPYA 2COEA 3TDMA 5IC4A 4LDPA 5HUQA 5ITVA 2EBHX 2ZB8A 4RHCA 5ILQA 1QO9A 5K0FA 5M04A 2C4MA 3PHLA 4CKCA 1QV6A 2NQTA 4OH7A 5AKLA 3INYA 2OAQ1 5KINB 4C20A 3QZUA 2ZLBA 1CUYA 3WFIA 1NURA 3QJGA 1E2EA 5ALDA 3EBLA 1FQOA 2UZ3A 3UV7A 4F93B 4FYMA 3I62A 1DGQA 5GOZA 1GADO 1DCTA 1L7MA 3AV0B 3OZRA 5JADA 3OZDA 2HTFA 1YQ9A 3PDJA 1CY1A 5KOIA 1OBCA 4M49A 3R9WA 2A4KA 2IPMA 1J0XO 1JKXA 2AA3A 3R3YA 5AK3A 5FIUA 3MBOA 5FPQA 5I9TA 3VPBA 3GJ4A 2ZRKA 3HEBA 4A0FA 1L7AA 2VPYA 2H0QA 3MFYA 4QQRA 4K6CA 4EJ2A 4B0PA 4FHDA 3THWB 1PG0A 4BNXA 2AF3C 4HPWA 3SM9A 1RTTA 1QYRA 2ZZNA 2EARA 3AEKA 3WLJA 4LBZA 4OJNA 3PENA 3TUJC 4NZPA 3BL6A 3I3SR 1I7PA 2IYPA 3RVMA 3THXA 4DIFA 4JI0B 3ZBPA 1HEIA 1MNQA 3EVFA 4GM4A 4GU5A 4R1QA 3UHFA 3HBAA 1WDMA 5ALRA 5KZMB 1BD3A 3EIUA 5SYMA 3QPUA 5FNVB 4MQFB 7ABPA 3Q8WA 3U7EB 2PZKA 4F72A 1EDZA 3P71T 3C6YA 4O1HA 3VBEA 3KYDA 2A3RA 3EDMA 4XWYA 3SC2A 2Z5FA 4XVCA 3FYDA 5A5GA 4DJTA 1Y7IA 1CT9A 2WKRA 1U3TA 2D2VA 5SY9A 2IOHA 1J0DA 4HAXA 1WX1A 2HRQA 4FFMA 2PAAA 3HXKA 3DMYA 3EULA 3OECA 4OVKA 3WO0A 4D41A 2V6BA 3W90A 4Q4HA 1E1KA 3EDCA 3ZCPA 5JJBA 1M1YB 1LQ2A 4RSRA 5KTYA 4RNCA 3HRKA 1ONNA 2OGSA 3U16A 5DEOA 3U4QB 1TMYA 4RHEA 3ONEA 2IPOA 3M5PA 5C46F 1NXQA 4ZK6A 5FBKA 3IP5A 3JVEA 4Z8YA 3TOXA 4A8JA 1TA0A 3EG9A 2FR1A 3BAZA 5CDGA 1WDWB 1K6XA 1X7XA 1Q0ZA 1EG7A 1L5SA 2Q2WA 3R6WA 5AUPB 1IIBA 4AAYA 3UPUA 3DBLB 3OFJA 2GK4A 3MA0A 3UK7A 4EENA 2Z1DA 1ODIA 1TZMA 1DAKA 3AJAA 4PO3X 3OQPA 2TMYA 4IJQA 5DHFA 5DHQA 5KTNA 4GD3Q 4MR8A 2ZBGA 3SEZA 2MSEB 4PLCA 3WSTA 1G38A 5AVTA 1H8HA 4KK3A 4RK6A 2GVNA 3SSAA 3FGPA 5AJVB 2WZBA 4LRUA 1Y7LA 2PSDA 1NDHA 3EZ7A 1QVAA 2C2ZA 2EBWA 4O4HA 2ONJA 2R86A 1PQ4A 4TT8A 4HQ6A 3QE3A 4O4IB 2NZ8A 2NYUA 1FFWA 1HH4A 2PSFA 2HIAA 4IV0A 2K2QB 4R2XA 3PQEA 2PSJA 2CLIB 1KZ4A 2G07A 3GGCA 4N8SA 4W82A 4QGGA 4A0RA 4E5NA 1QTQA 1Q92A 3K3PA 4C06A 1YVRA 1E3DA 2XKAA 3A3KA 5EIXA 4OOFA 2ZE7A 1DB3A 3TM4A 1YNSA 2WV9A 3OESA 4R6WA 1NYQA 1PUIA 3O0DA 2CHUA 2XKBA 1JDVA 4FMCF 3OVMA 4RTRA 2IU4A 4W8OA 1V6AA 2CHFA 2V6IA 5IH7A 3E7XA 3ROGA 1KVQA 3CUSA 3ZVNA 4GLFA 2P69A 2FVXA 3DWIA 5AHKA 1DFHA 3UAGA 1AQUA 2HK6A 3A4MA 3AI3A 4KN5A 3OFSA 3E1KA 4QAJA 1CJMA 3JQAB 5AKKA 2W70A 5BYBA 4I6JA 4WI1A 1AQIA 3O84A 1A96A 3CLSC 3O95A 1E0JA 1Z68A 4HXGA 4Q3LA 4HT3B 2G25A 3PQ6A 3S68A 5EGSA 1JDTA 2F1OA 3KYIB 2VYCA 2FWJA 4F60A 3MJDA 5CFLA 1DIAA 3QFSA 5JMTA 1JH8A 5HF8A 3R09A 3BHMA 5JRDS 4CW7A 1OB5A 1EG2A 1ODTC 5FBVB 2KSQA 3N2GB 3QVVA 1TJYA 3BCHA 1EHCA 5T4EA 1JEQA 3ELBA 5E6RB 5HDBB 3GUUA 2DOKA 4HNQA 5DNWA 2ZBRA 4QXRA 1RDFA 2XGSA 1D2NA 4EITA 2AK2A 1P2SA 3OZSA 1DFIA 2H1FA 5IW8A 4YV2A 4N7RA 3OT1B 4WXMA 4Z0PA 1VA4A 1SRQA 3VPSA 5ICSA 2HMSA 3GAFA 4HI0E 2OB1A 1HT3A 3DLTA 4JJ7A 3CT4A 4KC0A 4G1CA 4OATA 1UZLA 3LQ2A 5FQOA 1I8TA 2ABWA 2QMUA 1Y6GA 4C30A 5LQDA 4JH0A 4RM3A 1KXZA 4DVGA 821PA 1PAUA 4DPKA 4Z3OA 5KIAA 1D4ZA 1HEUA 1K8ZB 1VMEA 1VL5A 3AEYA 4FHCA 1V7QA 3RREA 3VU9A 2R8BA 3E53A 4UAVA 3C8DA 2ATEA 1A4RA 5HS6A 1IRXA 2NW6A 2VNKA 3CR3C 4R01A 5D51S 1XMQB 5LLSA 1BWRA 1JJFA 2JPDA 2W43A 3H2SA 2XUPA 4PNHA 4HAIA 2UYCA 3QM1A 3RS0A 2EGGA 3NXSA 3C3BA 4BEJA 3IKVA 4O2AB 3LGSA 1CZNA 3UNXA 4YQEA 1GQQA 5K09A 2EDCA 1NUTA 2WYHA 3PUXA 3JQ8A 4R8SA 3QH4A 4B4VA 4QTYA 1S2MA 1HE5A 4W5NA 1E2BA 3BH7A 4QQ8A 4PIVA 1IFXA 1SVKA 2J9ZB 4EJMA 1WKVA 4NF2A 4BCBA 3IUNA 1GFSA 4ZVSA 4NFYA 3WDLA 5DNEA 1A4IA 3B1XA 2OHVA 1ISMA 4WD3A 1EM6A 1C7EA 4UDOA 2O19A 1OBFO 2N9UA 3BWMA 5D3ZA 2VH5R 4KUEA 3WIUA 2P7IA 3C6QA 4EJ6A 5GJBA 1MLDA 5DI9A 1DNPA 1EXWA 4WE3A 2C9MA 4IM7A 3WL3A 3A6PC 4Z54A 3F96A 2TMDA 3AIIA 3ICVA 2Y05A 4CMBA 3A6KA 1TUIA 3NBAA 2PV0A 2X0DA 4NCAA 1Q0RA 1CJVC 2K7ZA 1KXJA 3M6LA 4K9SA 4G97A 4XI9A 3ZY2A 1COZA 1WLSA 1FRZA 2HU5A 16PKA 3FFTA 5D5QA 4ZVQA 3V8RA 1GQYA 3KT8A 4RVDA 3WNCA 3ZIAA 1L4BA 2D5AA 1UPTA 1G5HA 3NBXX 1E2PA 1EWVA 2PEZA 1UUFA 3NEJA 3AILA 2Z1NA 3NVDA 1L5ZA 3EIXA 5ALTA 4CM6A 4C7BA 3QU9A 3PDWA 5TARA 4DBZA 4DWVA 1SA0B 2AR7A 3FR8A 2VYVD 3QSYA 1TAGA 3IA7A 4MIKA 3NVKI 3OY2A 1PR4A 3BXGA 5LOVB 3PUIA 5EJEA 1YWGO 2FFHA 2CB0A 2C94A 5AJHA 4C76A 2WQ6A 1ELOA 3K9GA 3G8DA 1I3OA 4Q9DA 1KEZA 1VYHA 1Z3IX 3DVRX 4RY2A 3I5UA 3NAQA 1XDZA 3PGMA 5F77A 4ZT7A 3TF5A 2ZOSA 5CAEB 1U7PA 4N5DA 4UHBA 1C7FA 3TLGA 1JZSA 3VVMA 4Z53A 1U0NA 4P4SA 1LZKA 2ZG6A 3IHKA 3HR4A 4KLRA 4W5QA 3WK8A 3CNOA 3UB2A 3UKDA 4BVLA 2O8FA 2YWBA 5COQA 2WUWE 4YT2A 1ICIA 4TTIA 3CX6A 1NWHA 2GNOA 3BMOB 3TNLA 2WJ4A 4GI2A 1LFAA 1IZ8A 1J49A 4JA2A 4CGZA 3DG9A 4IO1A 3NETA 2B8JA 4KO8A 1JA0A 3UHOA 3A06A 1KYXA 3OG9A 4BEWA 2ZZMA 2O8VA 3TQIA 1OU4A 2LCIA 3DQZA 3HMQA 2VA8A 1GFIA 2JA2A 2P9CA 4ZRDA 2F48A 1NNI1 5K0TA 1K4KA 5EJMA 2HADA 3ZDDA 1M1UA 1CEEA 2GAAA 1XZBA 1L7XA 3CX4A 1VM6A 4Q0MA 1FUKA 4CL8A 4JQSA 1HE4A 1PVDA 1S9HA 2BZ1A 2RBKA 3LRTA 4LYEA 2G0NA 4MUYA 4AIRA 3EEOA 1DQSA 2DYKA 1Y8QA 3DT8A 3K5IA 2WF7A 3KE9A 5LKAA 2WD7B 2C3UA 2O9JA 3AEXA 5LZ8A 3ZNNA 3ZHRA 5IUJC 5J4YA 1SC4A 1IMJA 1MEOA 1KMQA 1PFKA 3LP5A 3MMNA 2IYWA 5NULA 2X76A 3OTIA 1J1UA 1T0HB 4UTPA 1R6UA 3ZY5A 2YWEA 1L1EA 1P61B 3GF4A 1V7ZA 3FF1A 4RMIA 2FRDC 2FFQA 3FWYA 5TJHA 3LUHA 4Q3EA 3TQHA 1XPJA 2I4OA 2X58A 4GMDA 4G9GA 4ONEA 5BUQA 2Z56A 2QRLA 4GSLA 1FB5A 2B9EA 1NVGA 4L4RA 1ZUHA 4YRSA 5HUJA 1B8UA 1CZLA 1SNYA 1HT1E 1H22A 3R7DA 2EKBA 3EVZA 2Q0XA 2IVZA 7GPBA 5T8KA 1PG5A 2P4EA 2XMZA 4XZ3A 2IIVA 1R0BA 3QKWA 3W6ZA 2O54A 4BO8A 5DULA 1TQ6A 4PCUA 4MV5A 3AM4A 3TH5A 4LJLA 4UW9A 1GKYA 5EWLB 3NT5A 3C0KA 2D1YA 4PINA 4D4LA 3E3NA 2EKQA 1QE0A 1MG0A 4Q1FA 1UDAA 2WAAA 5K6RA 2WHPB 1K8QA 3G59A 2PKCA 5CIYA 2PZBA 2ZJ7A 1GQRA 3ICPA 4JJ4A 1D0IA 5THKA 3QA9A 4OHYA 4HWGA 2EZUA 5L7WA 4ES6A 3CLSD 2D74A 3SZOA 1DKMA 5K8UA 4JP2A 3MS7A 1ORIA 1T1GA 2JGJA 2PKRA 1RCUA 1LS1A 1R6DA 3E8XA 3Q40A 4C4OA 1P6QA 3EISA 4TMZA 4CN9A 4NOKA 5IFLA 1QK5A 1W1WA 1Y5NA 2JF0A 3ZJUA 4MUGA 3D6JA 3E9ZA 3O94A 3THOA 4DLAA 2BOVA 4JLMA 3R40A 2KI5A 1KEKA 4I5DA 3MRSA 1TO1E 1AGRA 1K0UA 3TCXB 2RGCA 1MC8A 1Z7WA 3SVTA 1NHGA 1PWZA 4CTKA 1U2DA 2YY5A 1TIBA 1T9CA 1Z9BA 2WVAA 2XWQA 3D02A 2ATCA 5HM6A 5DX0A 1YS1X 2CBXA 3H0CA 5FNVA 3PCRB 3TBHA 3VMMA 2AF4C 4C2BA 2GM5A 1G7SA 3BE6A 4PAGA 5CB4A 3RFXA 1RCFA 1SQSA 1GTMA 1ST2A 1MJHA 3CYFA 4TQAA 3K53A 2WSBA 5I51A 4TV9F 1N1MA 1TJNA 3L18A 5HF6A 3ZDYB 4H6XA 1D07A 3TLMA 2E21A 1BFDA 3GBPA 3FOCA 3PC6A 4QTXA 1ADBA 1PNVA 1X9GA 2Y6UA 3NIWA 1NJSA 4J4HA 4XSVA 5CLQA 3TJRA 3USZA 3A9WA 1NJGA 1Y48E 1U99A 2FWRA 2QXUA 1ULUA 3D8RA 1LXCA 4ZMBA 2HHHB 3SIPA 1K7SN 2JARA 5JNTA 3HV0A 5K9ZA 1YZKA 3FNRA 3Q15C 4V2UA 1CJCA 3TRKA 2QRVB 2WKQA 3T0IA 2A35A 2B5WA 3A05A 1FNSA 1U9ZA 2O8BB 5MDHA 1XG5A 4ND8A 3ISJA 3K6SA 1M8FA 1KQPA 3DBLA 3EH2A 4L9SA 5KTTA 1D6JA 1KTVA 1JWLA 1T2DA 3ITEA 3JVUA 4JY7A 1MV5A 4DHEA 3VZSA 3KHTA 1MORA 4LKRA 1BKDR 4P86A 4CKZA 1UPBA 4KXMA 1H0RA 3MTGA 1DS6A 3D2CA 1KDZA 2Y92A 5L4SA 3NHUA 2WUEA 1CLEA 4K6OA 1D7AA 3LBAA 2YVKA 4YJ3B 1YZTA 2WM3A 2WSMA 3I73A 1HE2A 4ZQEA 5J4KA 1YK1A 1EDEA 3BXFA 3A4YA 2Y1CA 4L4ZA 3MSCA 3ANMA 2ODNA 2YQZA 4ZIRA 1T6NA 3MK31 5PGMA 4AUNA 3JRNA 3IAS1 1K92A 1E4OA 2NO5A 5A5DA 1RXCA 1DUIA 2IW1A 2V6FA 1CKEA 1ECCA 3NHSA 3PL1A 4E14A 1A04A 1ZMRA 1W0JA 1NI5A 2BP7B 2EZ4A 3A6HA 4TLEA 5HX7A 1EUCB 5CVVA 2NZUG 1G41A 2YRWA 3AETA 4HB4A 4D4JA 1W73A 1Q16A 4O59O 1G60A 1EK1A 2D5CA 5DTRA 5I47A 3I2GA 1Z39A 2EGHA 3UMSA 3NYIA 3OQJA 2IF2A 1GEEA 2FWBA 3EN0A 3QHQA 4HVLA 1SXGA 4G23A 4N8DA 3L7AA 4QBKA 5IKEA 4X8HA 3BK7A 5AJTA 2XZOA 4AFNA 2ZE8A 3KEMA 1W7AA 4Y0AA 1K0FA 1S8AA 2DHCA 2H16A 3IBYA 3JQAA 4GVXA 1SBZA 3RKUA 4G5RA 3IR7A 1TZKA 4UASA 4DAEA 5JZSA 5DVZA 1EWTA 2PD3A 3MLBA 4P9NA 4MR7B 2FWPA 2ZYTX 4WERA 3EGXB 2IEAA 3K8QA 2C07A 2H65A 2HQOA 1HYGA 1U5BB 2NXWA 2R87A 4NRDA 3SVZA 5FOQA 4FUQA 1H9AA 3HJGA 4FMPA 5CIWA 4EJSA 5AD1A 4GP7A 2H8GA 9ABPA 2AG5A 1H1DA 1HT2E 1ZMOA 3F5SA 4GNRA 4MMZB 2R11A 1LI5A 2BGJA 4KXVA 2ZQZA 1F0KA 4H0FA 1KO5A 3BRWD 1BH2A 4OFWA 1GQ2A 5EESA 1TJ3A 2PNJA 4C7XA 1LA2A 3VYUB 1Z4NA 5JARA 1Q7CA 4B6QA 3CJQA 3ZE0B 2JFXA 3CN9A 3GV0A 3IB3A 1FDTA 2ALJA 4BNIA 2QLMA 3NCTA 1SKQA 5REQA 2ZBUA 2F1JA 2PRSA 4B6JA 3QE2A 2GZMA 2P9JA 4C21A 5CXSA 1G98A 4AWXA 3PFCA 2FPOA 1GZDA 1L5HA 2FZGA 1BQ4A 4HN4B 1CQJB 5KYNA 3GJZA 3G1TA 4RIGA 1BS2A 1X92A 5CTAA 2OA0A 1LTQA 1RZRA 1OH6A 1EB8A 1OYYA 4TROA 2IUTA 2NQ8A 3L6UA 2GCGA 2F62A 4DOMA 4ENUA 4PX2A 4UZFA 4GX5A 3RRFA 1ZESA 4G4SP 2Q21A 2FSSA 5J58A 3L8FA 4RH3A 3C3MA 1KERA 3W2HA 1NW5A 1P60A 3W5SA 2IF0A 4QHYA 4K1LA 3F8WA 2L82A 5FPKA 1YBVA 4MUFA 3GVXA 2J09A 4HNAA 3LPCA 3HTXA 3B53X 1E3WB 3AO0B 1R0YA 4CEJA 4B32A 2JAHA 1YR8A 1EFDN 4K9LA 3NONA 2UVDA 4K5QA 4L22A 3BCSA 4MRAA 2ODPA 3TW4A 1NR5A 3U7QB 3WGGA 4B84A 2QVBA 1YBAA 2ZTUA 1FTSA 3FVQA 3KWJA 3QFTA 1P1BA 5F5NA 1PO7A 1NI4A 2GEBA 1LH0A 1TL7C 1KDVA 1IN7A 4NS4A 3NYRA 5EUCA 3TS1A 5LQKA 2RB4A 1KBOA 2A0YA 3V6LA 1FFXB 3E9RA 2O5CA 4FEAA 5EJ8A 3GH3A 1C4XA 4BEVA 5BNIA 1IEVA 3FTQA 3EMDA 3RT9A 3NV9A 1C30A <