3DW1X

Proteinase k by lb nanotemplate method after the third step high x-ray dose on esrf id14-2 beamline
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Radiation damage in protein structural characterization by Synchrotron Radiation: State of the art and Nanotechnology-based perspective
rcsb
molecule tags Hydrolase
total genus 98
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2008-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3dw1X00
2W2MA 1PTKA 1SCDA 4BWGA 1GTG1 3F7MA 1ZVKA 3A3OA 1ST3A 3VV3A 1AH2A 1WVMA 2E1PA 1EGQA 3I37X 2PWAA 1WMEA 5B1EA 2WV7A 2PWBA 1NLUA 1GA6A 4FONA 2B6NA 1BFUA 3ZXYA 1KE1A 3CNQS 4DWWA 2SNIE 3DVRX 5JMOA 2GKOA 1OYVA 3LXUX 1C9MA 1TO1E 1SUAA 3BX1A 3DYBA 2ZWOA 2PRKA 3OSZA 2X8JB 3DE2X 1XF1A 1HT3A 3DVSX 1PFGA 1ZVJA 1SCNE 3L1KA 4NE7A 3TI9A 1BFKA 4I0WB 4WOBA 3Q5GA 3DDZX 2W2NA 2Z57A 1TO2E 3GT3A 3VV2A 1T1GA 1Y1KE 1TM3E 4AKSA 4ZARA 3WIVA 3I34X 3A3PA 4H6XA 3QFHA 4GI3A 2Z2ZA 1NDUA 3EDYA 1SIUA 4OMCA 1S01A 3QTLA 1Q5PA 4Z2AA 2DUJA 1Y48E 1NDQA 1P7WA 3AFGA 3VHQA 1AQNA 2P4EA 2PKCA 1SELA 4NE9A 3DE1X 2V8BA 5B1DA 3D43A 3BGOS 4WOCA 1IC6A 5AMXA 3TECE 2ZWPA 1OT5A 5AVKA 1Y4AE 4LVNA 5AVJA 4C3UA 4JP8A 1KDZA 3VSBA 4C3VA 5CW1A 1WMFA 2SECE 3P5BA 4MZDA 1LW6E 3DW3X 3DE0X 1MPTA 2TECE 1SVNA 1SIOA 1C9JA 1EA7A 1WMDA 3SQOA 1MEEA 3Q40A 3BPSA 3GCWA 1CSEE 4DJ5X 3LPDA 1SH7A 2SICE 1TK2A 4RYDA 1V6CA 3I30X 1P8JA 1TM7E 1DUIA 1IAVA 2PMWB 1Y3CE 1S2NA 2ID8A 3H42B 4H6VA 2PYZA 3DWEX 1KDYA 1KE2A 1R64A 3AJ8A 2Z2YA 3A3NA 1PJ8A 4H6WA 3LPCA 4J94A 1S02A 1SPBS 2IY9A 4LVOA 1SUDA 2Z58A 1Y3FE 1AU9A 3I2YX 1SUBA 2WUWE 2W2QA 3PTLA 4M1ZA 3DW1X 5AQEA 1SBTA 2G4VA 1BJRE 1SCBA 2ZRQA 3AJ9A 1ST2A 1TMGE 2Z30A 4CFZA 5FAXA 4DZTA 1AF4A 3GCXA 1GNVA 2QTWB 4K8RB 2HD4A 4KB5A 2XRMA 1OYOA 2X8JA 1GCIA 5ARDA 1R0RE 4HX2A 1T1IA 1TECE 3DE6X 1DBIA 1GTL1 1C3LA 1Y9ZA 3DE3X 2WUVA 2DQKA 1YJCA 1PEKE 5JXGA 1SUEA 3ZXXA 2IXTA 1BH6A 1GTJ1 1SCAA 1SBIA 5ARCA 3DE7X 1Y3BE 3WHIA 3VYVA 1SBHA 1P7VA 2SBTA 1GA1A 1SUPA 3GT4A 1JEAA 3CO0S 4ZOQI 3EIFA 1YJAA 4NMXB 1YU6A 1T1EA 3T41A 1Y4DE 3SICE 3DE4X 4KG7A 1SBCA 1A2QA 3TI7A 4CG0A 1CNMA 1SIBE 4KPGA 1TM4E 1SBNE 2HPZA 2DP4E 3WIUA 1SCJA 3F7OA 5ARBA 3F49S 1R6VA 4B5LA 1GA4A 5JXJA 3LPAA 2PQ2A 1BE6A 4CFYA 5SICE 1SN7A 2W2PA 1AVTA 1TM1E 3DE5X 3D9QX 1YJBA 4YN3A 1Y3DE 1THMA 3PRKE 3VTAA 3HJRA 5JXIA 2W2OA 1BE8A 2WWTA 1SUCA 1WSDA 1GNSA 4OV6B 5K7SA 5I9SA 2ST1A 1AV7A 1VSBA 3WQBA 5FFNA 2Z2XA 1KDVA 1C9NA 1UBNA 1V5IA 4AKTA 4HVLA 1TM5E 1AK9A 4OMDA 5JXHA 3QMPA 2ID4A 2XTJA 1Y34E 3DVQX 1GT91 3EE6A 5FBZA 3UNXA 1Y33E 2Z56A
chains in the Genus database with same CATH superfamily
1NFFA 5J5CA 1NLZA 3F6YA 1ZNXA 4QXMA 5CDFA 2CXQA 4MQFA 4RS3A 3ROZA 4E0BA 2GMWA 4NBKA 4EENA 2HFKA 3DHYA 4JJAA 1VZ3A 1WL8A 2X4IA 1M76A 5ECDA 1Y3HA 1FDIA 4E5NA 4R3WA 9ATCA 1ZVKA 2FLVA 1N2BA 1F8XA 3C6ZA 3ZXSA 5A0FA 1K1EA 5CFZA 1E1QA 3L0BA 3TEFA 4CI9A 4I4TA 1LF0A 2EZTA 2CV1A 1MJHA 2VTBA 4EQZA 4RYLA 4XA8A 3HPRA 3IIIA 5IG2A 3IR5A 3PHBE 3CWQA 1HH4A 1W2HA 2GCGA 2XIQA 2AHRA 1TUBB 2FDRA 1UBMS 4ZV7A 2IE8A 4O63O 1BW9B 3HM2A 5BRJA 4G0XA 5FWXB 4LSZA 1UP4A 2Y77A 4GQBA 4KIGA 2GJSA 1Z74A 3BFXA 3FOZA 2O2XA 3G9ZA 1Z83A 2IHNA 2K2QB 2O0HA 1WA5A 2VK2A 4DLUA 5EIOA 4FB5A 4BO8A 4RTSA 2OV6A 3K6RA 2ZI5A 3BHJA 3IQEA 5ELLA 3DB1A 2HBRA 2C92A 5KYXA 1N36B 1W85B 3NORA 3MD0A 4REQB 4DLXA 2YQ5A 1D2CA 2I2WA 1DIRA 2JD1A 4QPDA 5CR9A 3RB8A 4BVEA 2QDXA 2I7CA 4PGHA 4L16A 1KVUA 3EIOA 1E2UA 4RO0A 4EVQA 1YIAA 1XQXA 3UN1A 2BHNA 4YUWA 4ZZ3A 1IN8A 2PUGA 4CM8A 1FDSA 3FR7A 2Z6AA 1JWLA 1OBVA 4B0OA 4JGGA 1N5KA 3SVLA 3GW8A 3IAM1 2EG5A 4G5XA 2X3UA 2YV1A 1QO0A 1IXSB 2ZUBA 4GMHA 5LB2A 5CDHA 2O2EA 2HA3A 2GXQA 1Z0JA 1C9MA 2EX4A 3FWKA 3IBFA 4MUFA 5KUTA 3QU9A 3FIJA 3MUFA 1X1AA 4JJKA 2ZWOA 4TVKA 3WWZA 1LLQA 4B45A 5J2TA 4KGDA 2GEJA 1Y6ZA 2P5SA 4OM8A 4M7OA 4U00A 4CYMA 3OM8A 2EFDB 1NOIA 4G0VA 3CUYA 3IULA 4DNXA 4BGVA 4NV0A 1DCKA 2WFLB 2B5WA 1DQYA 1U1EA 1U7DA 3BMNB 2E3JA 4F4UA 2BFNA 3LC1O 3FZNA 4HADA 1Q7EA 5G53C 4XW2A 5EXSA 2VDPB 3TVYA 4PYJA 2XMPA 3HN7A 3OCYA 1L7DA 4RXUA 2RIPA 4MGZR 3Q8WA 1XFDA 3AYXB 5A04A 3DBLA 3KQVA 4YRTA 3TQOA 3V32A 1EXNA 2P2LA 1GFWA 4DR5B 4AUNA 5CLJA 2NQ2C 3FPGA 4YAUA 5HM6A 4HO1X 3D1LA 4UM5A 1BH2A 3WSWA 1W1IA 2ANBA 4EL5A 3VZPA 5AK6A 5FO0A 5AYVA 4OI2A 2NZXA 2LTAA 2RHGB 2BL4A 3MK31 2OVBA 1BDBA 1G5IA 1ZD2P 2IXEA 4I1VA 2C8JA 3ZKAA 2C5GA 2G7MC 3D4OA 2G7ZA 2J6HA 2DZDA 2VBGA 5DT9A 5C4GB 3ZI4A 2PH7A 4WBNF 4JLOA 5CFMA 5HK9A 3O0TA 2BN4A 4ZHQF 5KOHB 4LDQA 1YZFA 4CU2A 2GCOB 2HEGA 1NI4A 1ZBDA 1ZK1A 3UUFA 3BB4A 3T34A 2AI2A 1EVIA 3UATA 3DLCA 5CFLA 1DIAA 3R4VA 1KH3A 4GE3A 1C4KA 4LBYA 3ZWAA 4UD6A 5A4JA 3QVVA 1E1LA 1NMYA 3S2GA 2FEAA 1IY8A 1DJLA 1Y48E 4J4BA 4TTRA 3SOPA 5C52B 1GTSA 3LWBA 3RJTA 2IOQA 4ER5A 3T9CA 1O94D 1NOJA 4DC0A 4RCVA 3WV5A 4H4DA 4RDCA 1G20B 4B6QA 4X1IB 1I0IA 4U7TB 2W43A 2GAOA 1EFPB 4M76B 2PSFA 3IVCA 4BMNA 4X95A 1CX9B 1ONPA 4EJSA 2AOUA 3K9BA 4IM7A 1GEGA 3ACCA 1RQ7A 2QLFA 2QTTA 4Y6GB 2KPOA 3L7DA 4S1VA 1DI0A 5I9TA 1TJPB 1RKQA 4EGAA 3MWGA 2IVFA 2JLYA 3GR6A 3KTFA 3P9YA 1J56A 1MO2A 4RVFA 3MSCA 5FOQA 1SXJC 3CLTC 1WLYA 2NGRA 2Q3BA 3WO1A 4KXYA 4EPXA 3N2KB 4CTMA 3GEMA 2VATA 1EG2A 2YIMA 1VL0A 2Z43A 1SULA 4GVXA 1IE3A 2VIIA 2NU6B 3IP8A 3SJBA 5T41A 1UDCA 2P1ZA 2YYSA 3LKZA 1VFNA 4AK9A 5EIAA 4BP9A 3ADKA 1TJYA 4BCBA 5JI3E 2UZ1A 2Q1SA 3ZD9A 4S1PA 1NWCA 2HRRA 1U7HA 3ETEA 1Z2PX 4RD1A 3IAS6 4C87A 5KQRA 3DV0B 3L6BA 3PRJA 2GDJA 3FDJA 3L8EA 4KXUA 4RZUA 2LVBA 5KNBH 1KO1A 1U2GA 4X3PA 5EYPA 1KBQA 1AKMA 1Z62A 4MR8A 4KQHA 3OE7D 4BVKA 2JIZD 5GONF 2VUUA 2VRCD 3C98A 3LFTA 4ZT3A 2PUFA 4TTQA 5IW8A 3WB1A 1B6SA 3R3UA 5ANRB 3PIIA 5DBOA 3LF1A 2NG1A 4QGHA 1BKYA 3ND8A 2O3TA 4HB0A 2V1UA 3IV9A 3MTJA 4MZXA 2CY0A 5REQA 2OOSA 1VG0B 3FWZA 3I04M 3K9HA 4FIDA 3WYAA 1JHVA 1V47A 2HLDD 3OP4A 2G06A 1WBDA 2DFTA 2EW2A 2ZAGA 5BN5B 3K0CC 1X1DA 4UUPA 2ZT8A 1KYTA 1OI4A 2I34A 3UV3A 4ZEVA 2A9FA 2ZSAA 4QG7A 3R1IA 1NMXA 1DUIA 1V7ZA 3BJZA 4QASA 1F4LA 3OIUA 4G4IA 4TTPA 2QB5A 3FLBA 4G41A 4OQDA 4PGGA 3WHLA 3OPXA 4UJ5A 1L4KA 1SOVA 2AGVA 4KUGA 5JRZA 3QE2A 3VR5H 3P2KA 4UHEA 3Q72A 2BR5A 4N3AA 2GPYA 1UUFA 4PQFA 4QFBA 1YZVA 2VVTA 3MCZA 1MAHA 3KKPA 4JASB 3HO1A 1XRMA 3L41A 2FN7A 2QTVA 3WB9A 4BNFA 4CCSA 5KTNA 2H4WA 3VNRA 3NRCA 5KKNB 1SWVA 2YIDA 2B4KA 4M55A 1Q57A 1OJ7A 2VTDA 3SOZA 1AUPA 1UDBA 2Q3EA 3F3SA 5DWVA 4E32A 3CRZA 2D0DA 4L9AA 3TZCA 1X77A 1VSQA 1Y8CA 3UGKA 5BWOA 2P9QA 4M99A 1MJGM 4V0QA 3KJFA 1WB4A 5EOVA 5FPTA 1JLKA 4GT1A 4FBGA 1W0KA 4POOA 3KAKA 4FDVA 3KDPA 4MLZA 4AXBA 2D5LA 1OWLA 2JC3A 3W3AD 5IM4A 2FN9A 5C9ZA 4JFRA 2PRSA 5DI3A 3LKBA 3LUCA 4KN9S 4KTTE 4WCFB 1X38A 2QGZA 5JCXA 3WP1B 1RHUA 1R0BA 1VBMA 2R7KA 3C2QA 3Q87B 2ZIXB 6CHYA 5LNK1 1YUBA 1IK4A 5AWFC 2VSYA 1PBTA 2RI6A 4GFDA 4PU0A 4TXNA 1T4MA 3SHTA 4O2BA 1R12A 4TLAA 1FFXA 2OLJA 2ZUWA 1B93A 4R1NA 4MGYR 1EFVB 3OPNA 3E0QA 4RZ3A 4XQGA 5P21A 2HBZA 3KJHA 5ENVA 2C31A 5HDBB 5WRFA 3VPBA 3N7AA 5JAPA 3WYNA 4G5RA 4JI3B 1XPRA 4I55A 1QZUA 4RM2A 2IXGA 3S2FA 4MQBA 4CMEA 1OW3B 5GVSA 3JRWA 1O03A 3KEFA 3M5DA 5KNBD 1AKYA 4M8NE 2X2FA 3KSRA 5JJIA 3HO6A 4LVUA 3R2JA 1AQIA 1PLLA 3KUCA 1WNFA 3C5EA 4NAUA 4Q4HA 3RWOA 1EA5A 4Y6LA 2VLBA 4ZC8A 3G2HA 4Y3UA 1IZYA 2PV7A 4AX4A 5LFAA 2EBWA 2CWWA 1KGDA 2Z08A 1VRVA 5B7PA 3GXBA 4IP0A 5GTDA 2OSBA 1NG1A 3M89A 3NEJA 5F1KA 4B6FA 4RPHA 3KQWA 4W4TA 3LIPA 3QG5A 4GQIA 2Q6TA 3L4SO 4WZAA 2NV2B 3UA4A 1ES9A 1UBKS 2FCRA 4LXXA 2JW5A 5D6NA 1Z35A 1JIVA 3V8NA 4B84A 1ZISA 2PKWA 4TVSA 4OG2A 1UJ6A 1MX1A 2H1FA 3KFXA 1L9XA 4B8WA 2VLIA 3C3PA 5A62A 1PKXA 2Y1EA 3SBDA 5I7SA 1CQIB 3L4BC 3LUFA 3H5WA 3FUCA 5DF1A 3K0KA 2JJ2A 1U1CA 1JQKA 4ZQHA 3AGQA 1ONNA 3GJXC 4INOA 4P98A 4QJBA 3A06A 1JQJC 1RLMA 1ZU4A 1XQ9A 4LZAA 5EKXA 5ALMA 4TRRA 3SX4A 1L3IA 2AC7A 2VFAA 2JIRA 2VXYA 1RQXA 3FMIA 1JUDA 2HZ7A 3G2IA 4N0PA 1WF6A 1SQ6A 3R5SA 4AG5A 4JP1A 4BUZA 2Q5EA 3Q9SA 2JDID 4XWAA 4BZQA 1NQ5A 4NATA 4J49A 5DMXA 4C22A 5EKUA 4QTZA 1Y37A 1HM5A 4KXMA 5FBHA 3SSMA 1YGYA 4MUAA 1IRXA 2CBGA 4MIOA 2G40A 2IKSA 3PUXA 4X92A 3NHWA 5AKXA 3EUEA 1AO0A 1UP7A 3T5BA 2YDYA 1BCSB 1VKZA 3PUVA 4J2OA 4BUCA 3MZ0A 1KMQA 2O57A 2VWPA 2QN6A 4J1SA 2IBSA 3NMUF 3GJ0A 4BEWA 1I3OA 2BBWA 3MTEA 3P2EA 1Z7EA 8ATCA 3PQ4A 2XWSA 5CYOA 2DULA 2PZKA 5J23A 1WHSB 2W8BB 1X9HA 2IZ0A 4JEHA 1ZK0A 3R7WA 3VISA 5BSMA 3RS2A 1Q3HA 3KAQA 2G9NA 4P3OA 1EUCA 1AKUA 3A9UA 4PC2A 2IZZA 2J33A 3SJ7A 1WVIA 1YHNA 4Z3KA 3TSYA 4U5QA 1Y4DE 5CH5A 3PC3A 4U7GA 2X0NA 2TMKA 3LHDA 4WLFA 3OT1B 3L7MA 5EE9A 3OZUA 2BKXA 1PS0A 2AMLA 4X6LA 4B2YA 4LNUB 4Q16A 1SD5A 4V39A 1UBSB 2J3KA 3K9LA 1U94A 3WFJA 1A2QA 5H9VA 3ZVMA 3CZRA 3VA7A 3ILSA 4QJ4A 4DQUA 4KPGA 4P86A 4U3JB 2XSZA 2H54A 2VZ0A 2ISSD 5B3LA 3UAZA 1TQ2A 3WZ2A 2MINB 3GK3A 2FRDC 4GEKA 2BCJQ 1Z82A 2BISA 4MR9A 3T61A 3A4LA 4FI3F 1SUSA 1WR8A 2WAXA 5CXUA 4ODIA 2AS0A 1P6XA 4OHMA 2OQIA 4IMPA 1RWPA 3GRKA 5DNAA 2VPIA 3BMQA 1DTSA 1BZYA 1PZXA 5M5BA 1OGYA 4NENA 1B42A 4HFMA 4HD8A 4DS3A 4DV2B 5BVHA 1XALA 1JDPA 3AIMA 3RAFC 5FFMA 1LNZA 3FOCA 3DVAA 4US1R 2Z8ZA 5LR6A 4GX2A 3DWIA 1YKSA 4XZ3A 3E9ZA 4KFUA 4H4CA 4Y18A 1OV6A 5K4AA 2XMRA 3RVMA 2POQX 1V3VA 3AB3A 1Y4UA 3RAEC 4P5DA 1ZSNA 4JUIA 2QKYA 4WBNB 2GZRA 4C2TA 3CVVA 2ZS8A 3JD1A 2VJLA 4PCAA 1R5NA 1DRJA 3MWFA 4JN6B 4UU0A 2HLNA 3AK4A 4P82A 1KMHB 3UUEA 2O2IA 4E70A 1RBQA 3F4KA 3NBZC 5CRIA 1PEYA 5J5VA 4OFWA 4C7JA 3ZY2A 1Q15A 1BVHA 3IQZA 4RMIA 1E5DA 3V48A 2ACKA 4G5YA 1L5MA 4JAVC 1XLVA 4RMJA 4X9XA 5C2JB 1I1NA 4URVR 3NDBB 4XX0A 3JRNA 4N5MA 4PYKA 4QBKA 3W2HA 4ENPA 5C5IA 5AVTA 3E1GA 4LZNA 5A2GA 1IJEA 2RHMA 4RF3A 2OUIA 1J20A 5BQ3A 1GSOA 3Q88A 4LKRA 4IILA 1SQGA 1LSOA 3RREA 2VT7A 3IA7A 3N0XA 3IVRA 1N7JA 2YHIA 3IVAA 2PJUA 2XVAA 3R9IA 4JUDX 5TS2A 4ER3A 4GOND 1HEYA 5D3ZA 1Z5NA 4JR2A 4RGYA 1QXSA 5CG1A 4W9RA 1DAMA 1QGED 5E9AA 2NSHA 4FOLA 4FYJA 5J1TB 2WMYA 1RJGA 2JGLA 2WKSA 1XDGA 3SHOA 2V6JA 3ZY5A 3EOBI 3QHAA 4UMEA 4CV1A 2DKOA 2CZCA 2PD3A 1XVIA 4BRUA 4UOZA 3QXXA 1E63A 5AXDA 3PUKA 4Q1DA 4E46A 5C53B 1X39A 3R7FA 1G59A 4Y9DA 4F6LA 1NQWA 2DVMA 2IH4A 1B1CA 3RH0A 2BKUA 5BR8B 3VR4A 1JEDA 1LX7A 1V7CA 2D00A 2OFXA 2OZEA 1UBNA 2V7WA 3KZVA 5G0SA 1J21A 1P1BA 2A5GA 3WGJA 3EWSA 2OMEA 1PV1A 4KAJA 3E6AA 5GQSA 4TKLA 1TM5E 2F8MA 1N0IA 2RAPA 3QU4A 4IUBS 4M0KA 4IXNA 4B3JA 1EQ2A 1WLSA 1YBVA 1FJHA 4A0RA 3KX2A 5KHOC 3T52A 4C14A 4AYTA 5KSWB 1ZD1A 4LHSA 1Z4IA 3E8MA 4GDFA 3M1IA 2XCIA 5K3BA 1CWUA 2ZTMA 5GONB 3OIWA 3LTEA 2FSGA 2JEZA 4DLNA 3OZTA 5A9RA 4TYNA 4ITVA 5LB4A 2ILTA 3QU5A 4ER7A 1Z8NA 3QE0A 4KYTA 1MX3A 2FPSA 3CF0A 1MDFA 3SDZA 1H2FA 1KEVA 3CH4B 4MRAA 3SS7X 3RTCA 1KO8A 2ODPA 1IOVA 1NAIA 3RK0A 1NMEA 3W04A 4AP6A 1G2OA 3C45A 2V5UA 3G8BA 1TTPB 2Q5IA 2KX7A 2LDXA 3A1CA 3AERB 3D7NA 4JVMA 5ED0A 3SVZA 3VHRA 1JJBA 1K08A 2QN2A 1FUEA 3QENA 4KV9A 4P22A 3TTVA 1P3DA 4H17A 4RPIA 3GLGA 1J5EB 1L8OA 1T8WA 3AHDA 5ALVA 3COSA 2QM7A 3BE8A 5JFGA 2DECA 1NASA 3BGVA 3EC2A 1H8ED 1ISMA 1YE5A 4KAAA 2V59A 2VF4X 1Y1RA 2RCNA 1Z12A 3INNA 4NNOA 3VDXA 5CAEA 3RWBA 3QBTA 1XP5A 3ZG6A 2O50A 2W2VA 2HK7A 1LRJA 1EFLA 4YHBA 4DKJA 4RZHA 1NZJA 3ZZMA 1W4ZA 3D7KA 4JD5A 1QZTA 3G0OA 4NJMB 3UT0A 2EFYA 2E18A 5K0GA 4S1OA 4EI8A 1L4EA 4JJZA 4O4JF 3RYFA 1PO7A 4L27A 3UK1A 4A16A 2AC2A 3PNLA 3RIGA 4ZN6A 3ABIA 3G7NA 3IAM6 1GN9A 3IVGA 3CVJA 1BS2A 1KTVA 3K0BA 5CVUA 5K6AA 3SC2A 4YCAA 1J8MF 5JSZB 3FMOB 1J8VA 1I24A 3W6OA 4C4XA 5B64A 5JRJA 1G5QA 1PV4A 1G20E 2A9JA 4PEVA 2JAXA 3QUAA 3UF0A 2GKOA 2JJYA 2R00C 3MM4A 2EW8A 4D3DA 3EEOA 1C0EA 3DAFA 3QEMA 2CVZA 3AF5A 3KV1A 1CS0A 3DZHA 4B8ZA 1WIWA 1DE0A 3L6RA 4GBED 2R2GA 4NI5A 4ACBA 3IERA 1QVRA 1TO1E 1YMQA 2CYAA 1FX0A 4AYXA 3MB8A 3H1TA 3LNTA 3DSRA 3GPIA 3KVRA 4A0HA 1DT5A 4A5SA 4MGIR 1OLOA 4PO9A 1R6DA 1NUQA 1JI3A 2D4AA 2ZIEA 2VYNA 4IGAA 1THTA 3G2KA 4IEEA 3ZE2B 2GX6A 2NADA 2FMKA 2YXNA 1WG8A 3MWJA 2J67A 2DWPA 2ECKA 3MGGA 2NTJA 1ISJA 5L51A 1PWYE 2D74A 2RGNC 3O9VA 3MN1A 3TI9A 3TLAA 4X66B 2ZP1A 3G8DA 2JLVA 1Y5MA 1UXIA 1V4NA 1BFKA 1GEEA 2NSYA 3AW8A 4CIAA 1KQFA 4HDKA 1GARA 5E3IA 3PLNA 4I0WB 3WYCA 5JECA 2OCDA 2GH1A 1C0KA 2BGNA 1I3MA 3DAOA 1S9HA 3BL5A 1ZM7A 2FEPA 3I62A 1TZBA 4MA4A 4HMOA 4HNQA 1NYLA 2V97A 4JSRA 2GPSA 1BO6A 1QC5B 2AFVA 2FR8A 1JG7A 4X6UA 3D2BA 1Y1TA 4NS4A 4N8EA 4CDRA 1H4QA 3ZBPA 1O94C 1REQA 4PRLA 2VQ3A 4BBPA 4FNMA 4BASA 4YJ3F 5IU6A 5HKBA 3DHNA 3B6JA 3JALA 3AR8A 4Q37A 3SC3A 3THSA 5BXYA 3T1NA 4EG4A 2P6NA 3Q12A 2NO1A 4PW0A 3OF3A 1UWVA 3VYTB 3R41A 4Q15A 3VU0A 4AF8A 4QREA 1R0YA 5KYVA 5ES4B 1IZ7A 4RK5A 1NBME 5DNDA 3WLIA 2I4OA 3EZFA 4RD4A 4GI3A 1NUUA 5F21A 4X20A 1K3FA 1SIUA 2CYCA 1AX9A 1IL0A 1MX9A 2FG5A 2RGEA 3HP4A 3KUUA 3RQIA 4XIGS 4MV8A 5DCUA 3SBEA 4CG3A 3JQCA 2VYCA 3L8YA 3IBGA 5JCJD 2YJTD 1UANA 4D74A 2C88A 3THXB 1J0BA 4ENRA 2DWUA 3CF4G 3V8VA 5E6RB 1GUDA 1QPBA 3I05A 4UCFA 3HJCA 2WU0A 3LY5A 5K0TA 4ANFA 4OPMA 4DL9A 3TR5A 1MO5A 1A9YA 2FHSA 3C8MA 2XGGA 2FLWA 1R7RA 3BWCA 4ND2A 5ESXA 3WGUA 1CJBA 4TWRA 1GAEO 2ZIUB 4UNQA 2O8DB 1NBHA 3M6MD 5E9WA 4ZGGA 5JZVA 3D8NA 2WWWA 2OBLA 2OECA 4Z99A 1RAFA 3PEVA 2QRGA 1QONA 1WDMA 3GAAA 3SXUB 3TLGA 1TA4A 3ZDEA 4DJAA 1BOFA 3IT2A 3Q15C 5COAA 3TECE 1H9CA 1RABA 4RPKA 1OT5A 3KT8A 4V1CA 3I4LA 2XBLA 1P31A 1UXHA 5L4LA 2BGUA 2QLTA 3QKSA 4LVNA 4TRNA 7MHTA 5I4KA 2R1ZA 2ZB8A 3H2GA 4NK5A 4S35A 1E9AA 5IEBA 3KJNA 1Y8QB 3VC2A 3PFGA 1GPDG 1IDN1 3IEPA 1BQ4A 4B2IA 2OAQ1 2PR7A 1NVVR 4M1QA 1CE8B 2FSSA 2IHUA 3KLBA 1USIA 3O94A 2ZETA 1DBPA 1TZMA 3G0IA 3GPBA 4N9WA 4YFYA 4DW8A 4EM6A 4YT4A 5JDCA 4DJTA 1CEXA 1ZNWA 1W7AA 1I4LD 5HW0A 4QYXA 4D4LA 5AKEA 3UTCA 1FP2A 3GHHA 3A37A 2EJCA 4ZFNA 5EUCA 1P4HA 4CDNA 3WGHA 3HKCB 4LXYA 4IIJF 1PQYA 3VOBA 4ZZ2A 3NHSA 1QHEA 2NYAA 3ZE9A 2YMPA 4AJ2A 2V4MA 1H9AA 1SEVA 2I1WA 3D8HA 3BIFA 1E1RA 4XTCS 5AKGA 3K4QA 3UUGA 3ZCRA 1MLDA 5C1IA 2ZT6A 3GRUA 2WD8A 3R0XA 1VE1A 5I7UA 4HSEA 4IMJB 1TB4A 1EFUA 2JBAB 2XNHA 4CEJA 2QSJA 4O4LA 1OASA 1T10A 3LUHA 4IX9A 1PJRA 3CLUD 4OHVA 5G1PA 1RRGA 4KU4A 4W5HA 1Q77A 3NOOA 4QBGB 1YZTA 2ZI4A 4ZRDA 2CVHA 1JU4A 3ONWA 1S2NA 1BRTA 2GPWA 2PXCA 3BIWA 3V4PB 1FLDA 3F8SA 3PNVA 4X5OA 4INZA 4EF6A 4EA6A 2C58A 1KE2A 1W36B 2C7RA 3IP3A 1F8FA 3QJ5A 4OHYA 4A5OA 4XLLA 4M38A 2IVZA 3BUSA 1KK2A 1WBJB 4FGLA 3GUUA 5EXPA 5JC8A 3RT1A 2JLAA 4OXRA 1N2IA 4YRZA 4TL9A 3EVCA 1EVJA 1CFJA 1CUWA 2Z5GA 3E5MA 3GGJA 1DFGA 4FFMA 1U2RA 3UJPA 3ZGYA 4GUDA 4DG8A 4IIFA 4QGAA 4WY2A 3WKCA 4N65A 3WV4A 5L3ZA 3MXTA 5LNK6 1TUBA 1ULAA 4BQOA 2R9VA 4PINA 3OT5A 3REGA 2ZYIA 1Z25A 4JC4A 3RNOA 5C3UA 1R3UA 2F8LA 1VKRA 3KZNA 3TM4A 1YF3A 3Q0EA 1SAYA 1V26A 3A3YA 1PR6A 3MAAC 2VJDA 1A77A 5AJWA 4GE0A 3LWDA 3ZDBA 2I4NA 3A2KA 4Y2UA 3WKEA 4DLBA 4AMVA 3RKSA 4BNTA 1T6XA 1JU9A 1UOEA 4EFLA 1W85A 4REQA 3SDSA 2FG7C 3AJ9A 2JFYA 2G70A 4UREA 3IIMA 4EA7A 1SJ9A 4BFLA 1K98A 2G0TA 3TH5A 2Z30A 1RACA 3HLYA 5F7XA 4QXRA 3TUJC 1L1FA 2X5JO 2EQAA 2BKVA 4ND8A 3FNIA 3OFNA 4K03A 2PT5A 4MUEA 2BKAA 1XQ6A 3UH1A 4FE7A 3URMA 5J47A 2ZAIA 4ESEA 2JGRA 1UBJS 1VCHA 3RD5A 3GUYA 4MJXA 2M32A 4Z9YA 3RADC 4S1TA 3UOGA 1YCDA 1U4NA 4GSKA 1UT8A 1ZMBA 1YJ5A 1UBOS 4R1MA 4PXSA 3X2EA 4ASUA 3EASA 4AZVA 4CUZA 4DTIA 4Z7QB 3AH8A 3AUXA 5FLKA 1E2PA 1VRCA 2ZWVA 3UMFA 3JR7A 5H5JA 3FW1A 1Z0ZA 2ADMA 4LGMA 3B1YA 4M83A 4YCNA 4UHKA 1XSEA 3NTXA 1BS1A 1HI9A 1I3LA 2WFLA 4BFXA 3PPYA 3FD8A 3BMNA 1TLFA 2OXCA 1GQ2A 1SVWA 2X4DA 2X19A 3UGJA 5HBGA 5K09A 4JV5B 1Z6AA 4ZT2A 3BZUA 3GH3A 4N18A 5GWXA 1Y80A 4AROA 3UHJA 5B6JA 3RC1A 4CEHB 1WHTB 1ZR4A 1VG1A 3OJFA 3L7KA 1IXZA 4K6GA 2R8RA 3DYVA 2QN3A 4L4RA 2OK8A 4TVOA 3OZFA 2AOVA 4DJFC 4MRRA 2XCLA 4UATA 4KQXA 4P7GA 4GMGA 3LI2A 4WADA 1CVIA 1XVLA 5TY0A 3T9EA 2IXTA 5B58T 5H9WA 1O95D 3UMVA 5K0EA 4K1XA 4JEUA 4G9GA 3BXFA 5IUJC 4AF6A 3Q8KA 3NWEA 1UZLA 2FE4A 1MRSA 2PWZA 1H22A 2NVWA 1GZ4A 5KC8A 2P7IA 3T7KA 3RHFA 1F2TA 4CM9D 4BJ5A 1GGNA 1P7ZA 2N9UA 4NMLA 1Z45A 2OZVA 4QA9A 4LTNA 1F8YA 3R0QA 2V9ZA 2FZLA 3VH3A 2KJQA 1YS6A 4OO3A 4ZOQI 2O5CA 1IOLA 1TU3A 4AY4A 1DT3A 2XODA 3AUFA 1GYRA 3RRXA 1B8UA 4CU5A 4BLWA 1B2RA 4O4JB 3THWA 1G20A 3FSJX 3LMKA 3ISJA 4X1IA 1YCFA 1EAYA 1G7CA 3AKYA 3MYYA 1EFPA 1I6KA 4KQEA 4PZLA 5LWHA 5HJ5A 1DC5A 2A30A 2ZJ5A 4Q3AA 1FDVA 3GZ4A 5KYGA 4R51A 3F2VA 4IHJF 2VT3A 1VHDA 3ETDA 4OJTA 4R41A 4MQMA 1E5QA 3D3NA 4HRYA 4RUKA 3U0BA 1MOQA 2FW7A 3ZE8A 1ZWKA 2R2AA 2XQGA 4LYDA 5J4KA 2WG2A 2W4QA 2ORED 3GAZA 4P53A 4RZXA 4YP6A 1ZM4A 3F9RA 3AY0A 4BLRA 1XDZA 2X8LA 4G8JA 3N2KA 5I7EA 1L5HB 3R6DA 2XXAA 4UBJA 2QOEA 2NU6A 1BHJA 5G4LA 3QJYA 1UC4B 1WVGA 4HGPA 1A76A 1YA4A 1VXOA 4IDFA 3QFFA 5HF8A 4BRZA 4JJ4A 3M7IA 4G67A 1ZCFA 2A0XA 3B52X 1WWKA 4J1TC 4KE7A 2P9ZA 1TC2A 1PLKA 2AYXA 1J70A 2PQMA 2Q46A 3AZOA 3DV0A 3QX3A 2ATCA 1HETA 2GZ2A 3RO7A 3GMDA 3GMIA 2CJYA 3LDGA 3K30A 3NCTA 1U0RA 4HQKA 4JA0A 3DZKA 1B74A 5T8KC 1JEYB 1DV2A 1RKXA 1SXJB 1ORHA 1XRJA 4HQLA 5JV5A 2G5TA 3OFSA 2CLKB 4JNCA 2VZEA 2XWPA 4IXWA 4R1OA 3TW4A 1HTBA 4MW5A 3VRHA 3RTBA 2FZKA 3P20A 4LGVA 1BG6A 5I7WA 4TMFA 1XDSA 2CCJA 1HLPA 2OM2A 4M37A 4Y7DA 2K7ZA 3FFWA 4TKZA 1V35A 4RSMA 4YJ3B 4OHZA 4B3CA 1E64A 1WXIA 1XEFA 1MFPA 3CYFA 4RLHA 4DCJA 4LZJA 3FPCA 1VPLA 5F73A 1TKBA 2DPXA 4B1FA 2ZB4A 4X84A 4A8HA 1WCXA 2RKWA 2VJQA 5CB4F 2AF4C 1AHNA 1X1RA 2MSKA 3LPNA 3ECAA 1KK0A 2XDWA 3HJRA 4HWPA 2HA2A 1UZMA 5A5EA 3OFJA 3ABOB 1YJQA 4CM4A 4MP6A 3M5CA 3GJ4A 1YB1A 2DY0A 3AVYA 2NUPB 1C2YA 1VJRA 2D5BA 4LJ7A 3WNCA 3WFZA 3QSYA 4ZI5A 5JCPA 2ZZNA 1YZGA 3EVFA 4MVCA 2JIQA 3INTA 4U8HA 3VSCA 3K16A 5JPDA 3WP0A 5BVGA 4QQNA 2ZRJA 3ZEIA 5BV8A 2IEYA 3PL1A 4RULA 4MWTA 4PNPA 2PNJA 4JVLA 3LUKA 3UB4A 2KBEA 2OXFA 2EDCA 2PGNA 4HXYA 5JRDS 1DAPA 1ZRMA 4GECA 4UHFA 3ZBQA 3MC1A 1T9CA 3AHGA 5JSYA 3FPHA 2X0DA 3SFVA 2C1ZA 4M9CA 4PAWA 1IQRA 3R76A 3AY6A 1FY2A 3FVTA 1YZLA 3OVMA 5CBPB 2ZK7A 3TFWA 1K63A 5LQKA 3C24A 3QHQA 3K71B 2GOYA 3LO8A 3IQGX 5IVPA 2IF2A 4QKQA 4M9RA 5H4GA 2FZCA 4EI9A 4TZKA 4Q3EA 4B3SB 1KDVA 3QZUA 3TZQA 1CYDA 1KPIA 4Q3OA 1M8PA 3TRHA 1EGVB 2IXFA 3Q8XB 4EAAA 1T43A 4U2KA 5CH3A 4BECA 2ZIXA 3RBVA 2RJOA 4GEGA 1I7DA 4NABA 4KQWA 1N32B 2VEDA 1ZMXA 5TQ2A 2WWRA 2G9VA 4JLBA 2GVZC 4LI3X 1J33A 1EFVA 2GZMA 3DD5A 4BQEA 4P4SB 4D57A 4M21A 3M4JA 5FWYB 2IYUA 3I9KA 4KQCA 4CLXA 3STUA 1R4AA 1O9GA 3OLXA 3CUUA 2E6UX 4V0LA 1U8UA 2PXHA 3Q7PA 4HTAA 1CQWA 3V1UA 4BO6A 4HNVA 2R0QC 2NVBA 3T1YB 4IIJB 1P44A 2X76A 1MFZA 4BWGA 1K2WA 1VG9B 4NEGA 3AR7A 2GPTA 1CW2B 3WWYA 3AM5A 3OQHA 4LYEA 3TOCA 4ALIA 3T95A 2Z1MA 4W1RA 1X8KA 2H9YA 2CN1A 3ED5A 2I7TA 3GI1A 3M6VA 4QYTA 3KEMA 1VB3A 1TKRA 2R5NA 2X4GA 5F78A 3OWHA 2WOJA 5FA8A 5GADl 1JNYA 1DUVG 3A70A 5G4KB 3UH0A 3LGXA 4GI2A 4W5TA 1FXWF 3S2SA 2I76A 3BWBA 2ZR8A 5BN4B 1GJRA 3H9EO 4EO7A 1FDOA 3SYMA 1NVVQ 1YOBA 5EIBD 5FQNA 1VJCA 4RIGA 1M5RA 3VDNB 1OC4A 2Q41A 4XJTA 2HCBA 3CJTA 3UVEA 2UUAB 3TTYA 5KYWB 1TA9A 2JFUA 1CQIA 3C5WP 1JXMA 1M6VA 3JVVA 1WXQA 4ARZB 5CNMA 4NBUA 1V9SA 4W63A 4DY4A 3REQB 1GA6A 2D0PB 2FCAA 2YL2A 4MVJI 1E9FA 5CHYA 4XH9B 5EVCA 4DUGA 3RASA 1K68A 3BH0A 2JH9A 3WHPA 4PYMA 3AVOA 4JOBA 3ZGVA 3PXUA 8AT1A 1WZNA 2PH1A 3ESAA 3OEYA 4M1YA 1F0KA 3EVEA 1DJPA 2QYOA 1VJDA 4CM5A 1GSHA 2C7VA 4DLPA 5B7NA 2Q21A 1Q84A 3PBKA 4JIMA 5BW8A 3WRVA 3EYAA 4Q24A 3K53A 3SJZA 1YR1A 1Z2NX 2OYSA 3L79A 2HT1A 3ESCA 1I2MA 3B6EA 2H2FA 1JQLB 1OFUX 2VJKA 3QPWA 1NQOA 1WB6A 4ARAA 4AKIA 1BCSA 1J7KA 1K89A 1HT3A 1H2YA 2YOFA 2UV8A 4WNAA 1XZNA 1QRSA 5EZYF 2FSHA 1FBTA 3AF3A 3G5LA 2I29A 1YO6A 2ZJZA 3AG5A 4LG1A 2X8BA 1QV6A 2H85A 1WHSA 2W8BA 3C74A 4WBSA 3ZWOA 4PZEA 4JB2A 3UAOA 3GJYA 4G5QA 4I4IA 1GXSB 3MINB 3UC9A 5DTQA 1NJSA 5BYJA 1A4UA 4E14A 3SE7A 3IPCA 5SZJA 3H4VA 5CJJA 3WOHA 4Y2XA 2AZ4A 1ORRA 2VP2A 2V9CA 1RLIA 4LNUA 2QN1A 4KLAA 4BX0A 3FDXA 4NC9A 2NPOA 3OPYI 4IZOA 5J4VA 4DXDA 3FGPA 3EXIB 2YRXA 3ZU5A 2PX4A 1JMYA 1Z15A 4OVKA 3FETA 4RTKA 2O8VA 2CLCX 3UIEA 3PCTA 1JHAA 4QVGA 4EW6A 4PBTA 5D8DA 4U3JA 3MTQA 1JA9A 2EYUA 4AKSA 2MINA 3JYNA 4EMTA 1ZJYA 1KORA 3VO9A 3WQHA 5F1PA 3WG9A 3SQXA 2BFBB 3PS9A 1I01A 3O84A 4P7JA 2AKYA 1HOTA 5AK3A 1NW7A 3QFHA 2VO1A 3EC7A 3MGAA 4UEOA 1HFJA 4XGIA 3BGSA 1Z73A 4IDCA 3L4EA 4E6PA 2CHFA 1F3LA 4R83A 5G0VA 5IKMA 5JYDA 2GRAA 2O4CA 1NATA 2NP6A 3DFFA 5LQSA 4EGCB 1SHLA 4N12A 3PE3A 2F3SA 4UE2A 4DHWA 2O20A 4KGZA 2BDUA 4W5JA 1IN7A 1KQGA 2W6ID 1JHOA 2XTAA 4NCHA 2V7QD 1UWKA 4L5BA 4G81A 1H3EA 5AVYA 4N5NA 4REMA 4QDOA 5LYJB 1BE0A 2ZCJA 1A1VA 1BDMA 2IV2X 3PPWA 3FCEA 1XR3A 3IKMB 2QDKA 5JNLA 3ICWA 4WOCA 5IJ9A 1FEZA 3N1UA 2B1RA 4Z9XA 1OAKA 1CVRA 4F3RA 4MOWA 1UIMA 5C4IA 5H8WA 4ZKEA 1B6GA 4C05A 4DSNA 1F5SA 4CV3A 1KMHA 2FPGB 3ETHA 2NP7A 4O4HF 2GBPA 2J9XB 2PKRA 2R25B 2QTGA 4FYMA 4ECEA 5DN6A 4HT3B 2FW8A 1VI6A 1KF0A 3GEHA 3L6OO 4QO7A 2ATIA 4EI7A 1SCQA 4JP8A 3TF5A 3IQXA 3LUGA 1MGOA 3B5IA 4QRHA 2Y99A 3GRVA 3N39C 4MCIA 3LECA 1MORA 1BDIA 1F0YA 2VWHA 4DUPA 3RS7A 1E2DA 2PMDA 1DO8A 1VE5A 4E5SA 2ZS7A 4KPYA 2SECE 3KOXA 3O4IA 2IEBA 3CLUC 2V58A 5C8ZA 3H99A 3UK0A 2P9CA 4G2TA 4CGYA 4LJLA 2HRQA 3PYLA 3H0CA 3KAPA 5ULLA 3H11B 1Z26A 5TPZD 3K5WA 4YLGA 1Z22A 3OTOB 1EA7A 4ZMRA 1IDOA 3SQOA 3ZWDA 1Z7YA 2E82A 2OC4A 1RXSA 1CR4A 1O96A 2O06A 2XA9A 2QAGC 4QGGA 3V4VB 3H65A 4RXMA 5B7GA 2Q3MA 3NYIA 1P1IA 3WQSB 2GM4A 1U8CB 2BEVB 4ZAFA 2I67A 5FR2A 3Q8LA 3MJTA 3TBKA 1VJTA 2Y0BA 3A2LA 3GGCA 3LFUA 3Q11A 3VNUA 1OKKA 3F1LA 3PPXA 4OQXA 3CZPA 4HZGA 2OCBA 3TMYA 4EUFA 2GBIA 2FFRA 3KXDA 3W5IA 1UWLA 1CRWG 5IANA 1Y8ZA 1I1OA 5IVKA 1XCMA 4TXJA 3PQCA 1Y7LA 521PA 5LZ7A 4DLRA 9GPBA 1LLDA 1RU3A 1TYEB 2EP5A 4IJUA 3IL2A 2YV3A 2IX3A 2OORA 2XR1A 1CUIA 1E8NA 1ZC4A 2WPDA 4FP9A 1E6CA 2XVXA 4UPEA 4BDTA 1UBGA 1ZNYA 1KIFA 3Q5DA 4BLTA 2QMOA 2RHOA 1UOQA 4U5XA 3LUBA 3R7LA 3CH6A 2EFJA 4IFBA 4U6NA 1NF8A 3EFOB 4LYYA 5AHKA 3HKEB 1PHRA 2QX7A 1EHIA 1T8PA 2IZ6A 4MYCA 1L4MA 5H1YA 2GA8A 2X42A 3QVGB 5JCOA 5CB4B 1KAGA 4IGEA 4Y98A 4R40A 4AW9A 4IHAA 1G66A 3KOYA 4RBNA 3A26A 4R68A 5JZ9A 3JATA 2BCEA 3N2IA 1OJLA 2QT9A 1TU0A 2XA2A 3PIDA 4LMRA 4ZEWA 3FWPA 4G26A 4F5EA 1F6BA 3RODA 3JQAD 1UMCA 5LBIA 3JZMA 1T9HA 3IP6A 3OH8A 5BUZA 4OOFA 5JS2A 5E4FA 1DKOA 2JATA 5A5VA 2QMHA 3UW3A 1NN1A 3K96A 5ALNA 4GWKA 4P33A 3DP9A 3T3NA 3FKSD 2I2DA 2AXNA 3O2JA 4J6EA 5AJZA 2ZRDA 5H4HA 3UAVA 2II6A 1BJTA 2X7XA 1UEIA 4NLLA 4UQOA 2FGKA 2AKEA 1U7PA 3TIXB 3HA2A 4TXHA 1XBTA 3VR6H 5JSZA 1EJ2A 2KS6A 3EOAI 3ZWNA 1Q50A 1D1QA 2PD4A 2ODAA 4J0JA 1G8MA 2X6TA 2ZYRA 2P91A 3AR6A 4K05A 2BJHA 2FFAA 2UKDA 3KBOA 3I2FA 4M9UA 1Q83A 1A9OA 1GNVA 2IOFA 5B30A 1QTIA 3C7CB 3RS8A 2IDJA 3SG0A 8OHMA 2J5BA 4LMBA 2YBDA 2VDKB 3BOSA 3FXAA 3IUEA 3TTXA 3ZQ6A 1G2IA 4ZO9A 2IX9A 5MFPA 4WD3A 3RVDA 4OREX 3UCXA 3UT6A 2Q7XA 3S2ZA 4AWAA 5ITZA 1IEXA 5FBRB 1IJKA 4V0KA 1Y1QA 2PGOA 4R9UC 4XDHA 3L40A 1A69A 1LTHR 2H9IA 4IOMA 3FSEA 3CT4A 3GRPA 1W1UA 1TECE 1YB7A 3H6KA 1BWQA 2NM0A 3PLRA 3CONA 3DR3A 1XQYA 1ZXLA 3A6JA 2GERA 3NM4A 1T3HA 4MWBA 5CMLA 5IK2A 3GMSA 5CHEA 1FUUA 1MV5A 1CJKC 2HCFA 1MH9A 2GPJA 2IIPA 3O93A 3PHGA 1C1DB 4LKOA 3S81A 3ECCA 4HEA1 3LX5A 1DWPA 3U4HA 1K8YB 4ZEOA 3L01A 2GK3A 1QC5A 3E22A 3WGKA 1KERA 4BV3A 1I2AA 3W0LB 2Z9BA 4WK2B 1SXJE 1TT7A 2NO0A 2YC4C 1T13A 3DBRB 5JEEA 3GVIA 1E1NA 2OWDA 3GX1A 3MRTA 3TDNA 3O21A 1D5WA 2PAFA 1VKOA 4RY9A 4BP1A 4D3SA 1FC0A 1KQ3A 1WMAA 4G0NA 5CVCA 3RROA 4J0HA 4OHRA 1JRLA 1OLSB 2NXCA 4EOGA 5BQOA 3FFBA 2HLHA 3CY6A 4P2BA 5DK4A 5L3SB 3UXHA 5ALRA 2HHJA 2J09A 4TSFA 4RVDA 1AHIA 3NAMA 4BKQA 5E3HA 3SYLA 3O38A 1X7DA 4LXTA 2DPMA 5BOVA 1HDXA 1PVVA 1Y7HA 3EIFA 3NHMA 3OZAA 4MVJH 3SDBA 2P75A 1HEIA 2VSNA 4R2KA 5E6RA 1ORDA 3UJ3X 2XCRB 4TTJA 3OJ0A 2GJAA 4W9NA 3NDRA 5E6UA 1EP9A 2UZ0A 4WBXC 4JI7B 4QHYA 3MTIA 4CXMA 3OX1A 3H0EA 2GN2A 4XOUA 1YUMA 2QROA 2M6LA 5KJCA 2B8TA 3W8RA 2GPAA 1DEHA 3FNFA 1L4GA 4FNGA 2Q3JA 1Q22A 3L0ZA 1DKPA 2NO4A 4IQ0A 4MKIA 4H7KA 1QKJA 1B6TA 1Q19A 5HVNA 2HV8A 4DGSA 4Q9LA 5H83A 3EZ2A 1UL1X 3LVQE 4MVJM 3L7AA 4TWBA 2PANA 3PQ5A 4FWTA 3OF5A 1MVNA 2WK1A 4UM7A 1UBEA 5DP1A 5E4TA 4XB1A 5EZYB 4DA9A 2O3UA 1JB1A 4HPJB 4PLWA 5DBIA 1Y8QA 2G08A 1M2GA 2PZFA 4X00A 3UZUA 3GRRA 4C4YA 3HVUA 3EF3A 3A9SA 2G76A 2OILA 1PFUA 1Q1BA 2Q8QA 2VJMB 3AHHA 3EXAA 3P26A 4J7AA 3U56A 3R3YA 1RI2A 1YR7A 4A82A 4F8JA 3M9XA 1ZMRA 2HOQA 1N0VC 2RI1A 3K32A 1PT9A 4PYQA 4NHOA 4ZCSA 3EXEA 5C3MA 2P9BA 2NU7B 2JVJA 4FDLA 3HDYA 5D84A 4YK7A 5DWQA 2WTXA 5CLHA 5HXAA 1E1QD 2AFIB 5TRTA 1SN7A 1NHGA 2W2PA 1B43A 3OZRA 1MJ5A 2NSDA 3AX6A 3N07A 4ZQBA 1U5AA 2C4NA 3HKCA 3OJCA 5EJFA 3RT9A 2FA9A 3GB9A 4RV5A 1V7PC 4DA8A 4EYGA 3BQ9A 1KRHA 3D1VA 4MWGA 3IQIX 4XIJA 2PVPA 4IVRA 4D3XA 1I7LA 1T0PA 1DAHA 3CMMA 2E5LB 4HVAA 1SKMA 3OZGA 3QWIA 2ZXFA 3EIUA 4NU8X 4Q9DA 3UFBA 4ZCIA 2IOHA 4KJZA 4Q5IA 5TSDA 2B4AA 3FTDA 3HDTA 3NAZA 5HDQA 3SMQA 5C32A 1IY1A 1R2QA 4BOYA 3FCXA 3HMKA 4X45A 3QFSA 3KE9A 3M6XA 3GC6A 3IX7A 6YASA 1EK1A 1WEKA 4GPIB 4ZKDA 1H85A 2E4ZA 1ZH2A 2AFRA 5EQDA 1OXUA 4HXFB 4CIBA 1X7YB 2WFAA 4GOKA 2JVKA 3PT9A 4JJ7A 3ACBA 1AURA 1FQWA 1XEWX 2GQ0A 1S9DA 2PT7A 4KVGA 4M7WA 4P93A 4MVJD 4RACA 3UJ8A 3VUEA 3LCUA 2JCYA 4ZAXA 3OZDA 3A1SA 4IV0A 2OCGA 4Q9NA 5JAMA 3EXFA 4CQMD 1QO0D 1R8JA 3OAAA 1YCHA 3HL0A 4KEAA 1GU0A 1RVDA 2BMWA 1HE2A 3I6BA 3QV2A 2PLRA 1ZNQO 3B5JA 4ZOLA 3BXZA 4D43A 4IDQA 2DHEA 4YRFA 5C35A 4MPPA 3GF4A 2YYYA 1F4PA 1MQ8B 5FEMA 2FAXA 1E2IA 1TJ4A 2J0UA 2YZNA 3VR1A 4DADA 4O4HB 1ETHA 1I7NA 4W1SA 3RG8A 1KJJA 2C0QA 3JYOA 4BVGA 1X0VA 3AINA 5FUYA 1NWHA 3K9QO 4RD3A 2G07A 3EDRA 2G5PA 4FDAA 5EHNA 1E5TA 2J3DA 4KVFA 3K8ZA 4K6OA 1MQAA 3LO5A 1I2BA 2DKFA 4MWCA 4M88A 5EPUA 2BFCB 1WTAA 3D4BA 2VA8A 4HVLA 3QYPA 4G89A 4J4TA 1P2FA 1AK9A 1WE2A 5LQDA 3FHCB 3OICA 3ZBTA 1X2BA 3SSAA 1OWPA 2GHRA 1MHTA 2YMQA 3GT0A 3C4QA 4Q7KA 4CT5A 5HZHA 1Z75A 3U2QA 1X86B 4Q82A 3UWOA 4CE6A 4KH0A 5CBKA 1KR5A 2W2TA 3WSTA 5ICCA 2YKGA 3KUDA 5EIBC 1Q2UA 3HCWA 3WIDA 1PSDA 3HYSA 2W2MA 5KCZA 4H7HA 4I2VA 1JQEA 4CMHA 3WKDA 1DFHA 3VNSA 1QFJA 1S7CA 4QPCA 1VIYA 2X1MA 3CWZA 4A2QA 4ZTZB 2P3SA 1OXMA 2J3HA 4C43A 2RJNA 1TCBA 3C4VA 1GVNB 4R0NA 5B1YA 1YRBA 2W48A 4MUMA 4HG2A 5MN5A 5BXQC 1WVMA 2BTOA 3OCXA 3K0HA 1SOAA 2IPAB 4DBLC 2Y1OA 3A6HA 3HXLA 2R6ZA 4B0PA 2GJ8A 1P80A 4L6IA 1MO6A 5AW1A 2RARA 4AZTA 5KAPA 3IDAA 4M22A 3V33A 4EBFA 3W4JA 3X2FA 3HZRA 3NLLA 3NWOA 2DF8A 4FR5A 2DM6A 2ZJ3A 4OHUA 3UAYA 1IY9A 4CEHA 3P27A 1QV7A 1WHTA 3KYDA 2QY9A 4CVNA 2O2GA 3JSAA 5KI6A 2WILA 4XOIA 1JI0A 3FNEA 4Y1FA 4C5AA 5EHQA 3B1VA 1MG0A 4EDFA 4RS4A 4BLSA 4C01A 1H1TA 2WA2A 1RHMA 1P9RA 1EFDN 2ZJYA 2WNIA 3TTWA 3ZN2A 4D9EA 1JR6A 2ONYA 4M1SA 1XK7A 3BAFA 2H6EA 4OL9A 3L93A 1G1AA 1RYBA 1GTRA 4FHCA 4FS3A 4LK3A 4QDZA 5DLPA 1XU9A 1YI8A 1PN3A 2O2SA 1P9NA 1FJXA 4KMSA 4P3PA 3UYLA 1KS9A 3KL4A 4GICA 3TQQA 2C7QA 2PH5A 1CR0A 5JYBA 1E0AA 2WMOB 4UM9D 1ZA2A 4LOKA 2XTZA 5LDDC 4Y2JA 4TQAA 1S4QA 4O25A 3VAYA 1F06A 3QITA 3S6JA 3W7VA 1BQEA 1E2NA 4BGIA 4BZWA 4HAWA 4F9EA 4A8TA 2PRKA 1XWIA 1XTPA 2X8JB 1INLA 3KLMX 5ALIA 1YE8A 3WNBA 1XA0A 2FX3A 3DD1A 2ZVDA 2DPGA 1ZD3A 1SCNE 4DR7B 1JIUA 2JLRA 4GKKB 2J6CA 2VDLB 2W6PA 1HQKA 4WOPA 1I3NA 4PC7A 1E3DA 4O4JA 2IA5A 1JYSA 3HLTA 3QOYA 2EEZA 4KSBA 1GZUA 1FPMA 4FZ5A 4G0QA 3ZCQA 3QVJA 4RXTA 1KXJA 4Q4LA 1JYEA 2Q2QA 3KXPA 3ZDRA 3CSSA 3I1YA 3MCAA 4PHTA 2WB2A 2BAGA 4KBFA 1MR3F 4AI6A 2Q5LA 3R3WA 3C3YA 1PBNA 2H1RA 1Z18A 3PC4A 5I5EA 3M70A 3L7BA 1LBEA 4FILA 1OH6A 5FWAA 4CM7A 4YB8A 2B98A 3O2NA 5IS2A 2PT6A 4C0QC 1QP7A 1RYFA 3HJNA 1G8KA 1SXGA 1R27A 6Q21A 1KJNA 3KJQA 5I4CA 3PHLA 5FF9A 4URZR 1HRDA 4OUDB 2E5FA 2OMKA 5IAKA 2XCOA 4ZAGA 1KZGB 3UKDA 3TLMA 3SEFA 1UK7A 4Y9TA 2W83A 3UUWA 3M9LA 2IHZA 3L84A 3AUKA 5AVVA 1GZ7A 1JW9B 3H83A 5D01A 4K9SA 2E4VA 4IKEA 3B89A 5SY4A 3IFSA 1S01A 1NU8A 3K92A 3E7XA 1UH5A 3NV9A 1DNPA 5IKPA 3D8RA 3PEFA 4A7PA 4RA9B 5I3ZA 1JEYA 3O8DA 4XEUA 2ZM6B 1T4CB 3CS3A 1SXJA 1N5MA 3NP9A 4LX0A 4BFZA 1OXXK 3M82A 3OEWA 3EARA 3PIRA 4UMDA 2Q6LA 3M4NA 1ZQ1A 2AJ8A 2IYVA 1JLSA 3EGDB 4Y0VA 2HMVA 1TF7A 3BMCB 4V0RA 5B1DA 1ZGJA 1Z13A 3QJGA 1W0KD 3HCFA 3FHOA 4LHVA 2IHVA 3EH1A 5FO1A 3LWZA 1YB2A 2HWXA 5HOQA 5IJWA 1P75A 2F9FA 4QPJC 1YRWA 5FWDA 2IITA 4NCXA 4OF4A 3VGJA 3RSFA 3KCNA 1WB9A 1M6YA 3HWX1 4IINA 2JH8A 4Y1GA 4XVHA 4EKDA 1IFXA 1YQWA 1U3UA 3ICOA 1QMPA 5EJ7A 1KDOA 3SC4A 3UQZA 2NUPA 1FLAA 4GPTA 4E09A 4DANA 1B8OA 4KQIA 3UJ9A 4B3GA 3NTVA 4QYWA 2IS2A 5CX4A 2BSQA 4MW2A 5G2OA 4KR7A 3ECSA 5G41A 5BR4A 1G3RA 1LW7A 3QSGA 2ADFA 4NEQA 5EKTA 1DQSA 3Q10A 1Y6RA 4PZUA 1P4JA 3FUXA 1QHSA 5M29A 3J80A 2Y4NA 4IDHA 4U2DA 3WHKA 1W75A 1CDOA 3K0CA 3RC8A 1MPTA 3IYLW 1Z0KA 3QFRA 4IDEA 3VSEA 1Z2OX 5C1DA 1SD2A 2P41A 2I62A 4U6QA 2VF7A 4W5QA 3IO3A 4WVLA 3QTTA 4YRAA 5CBPA 1W4AA 1GPUA 3MMNA 1KJWA 4G8CA 4EPYA 4XKJA 5JANA 1MF7A 3TM5A 1N1GA 1GDDA 2FETA 1ZIXA 4IOJA 1SWWA 2ZIFA 5BN3B 1WUYA 1ZOSA 1BX0A 1L1EA 5U4XA 1SH7A 1Y8AA 5F5LA 4O3FA 2P6MA 3F2IA 3GVHA 4XLZA 1Z8DA 3RAPR 4BQRA 1Z68A 1JSCA 1NVUQ 3OCCA 5JS1A 2Q3FA 1JF8A 4PFSA 3T4XA 1T2VA 2SCUB 1V6AA 3VPGA 2DE0X 4CLOA 9MHTA 3QVUA 4GM4A 4IS2A 2WQ7A 1O4VA 2M2IA 2HCTA 4P4SA 3PEEA 1MVOA 1AUOA 2I6QA 3T3IA 5FWYA 4FYIA 3HJAA 1GG8A 1YA8A 3O8OB 1Y5NA 3WWPA 3TW0A 3WGVA 2R7LA 1HORA 4B76A 4D0LB 5KVAA 1C7EA 2NO6A 3M1AA 1GRQA 4Q6BA 1E1CB 5KOJB 2WSMA 1N3LA 4JUBA 4UXJA 2D1FA 4FMDF 3RW9A 4DV4B 2NVOA 3UHAA 1KOFA 2VPTA 4IH9A 1H2WA 3U4GA 1BJKA 2GDZA 2YV5A 2IU3A 5EUQB 2ORYA 1Z2EA 4P4TA 1CNFA 1N4DA 1PJ8A 2Y2UA 1L8LA 3V2GA 4D3ZA 5JADA 1S02A 3N58A 2X58A 4LF4B 3KYCA 2DKNA 1AHHA 3LT4A 3N8HA 2VQEB 4IO0A 5C5CA 1M7HA 3ENWA 5H3HA 1SURA 3GHYA 2AOWA 3LCJA 1J8QA 4WXHA 4ZMSA 1QRUA 2O2HA 3GP3A 3HBNA 1T4GA 1YR2A 2H4YA 5G4KA 2ATVA 3I01A 3M5PA 4P4GA 3L1VA 2HXYA 1KZ7B 4KKVA 5JFTA 1TGYA 2Z58A 2G9RA 2W2XA 2X6QA 4Y2TA 1AU9A 1HE3A 1ZIPA 5LP1A 4ZVNA 3LBNA 4ZWNA 2PUEA 1JG1A 9LDTA 3QEAZ 1NM5C 3AB8A 2CT8A 1FRVA 4L95C 3C3CA 4YRDA 5KYWA 1KP2A 3DW1X 2R6AA 4KO4S 3REOA 1J0XO 1HO3A 3N2YA 4ARZA 1SBTA 2Q8PA 2CKMA 3ENNA 3RC7A 3REQA 1JR4A 2OCXA 2HA7A 1ST2A 4QLAA 1AB6A 3HHEA 3U3MA 3VJMA 2YQ4A 4F93B 5C7IO 1Y82A 2QD2A 1JPUA 4YBZA 1GLNA 1H6CA 1NBOA 3H75A 1YRHA 4R98A 2PSJA 1LC3A 1Z37A 5AUQA 2OWEA 1H4SA 3UJ7A 3F78A 2XSZD 4GXTA 1M54A 4R0VA 1X19A 4I1PA 4EY7A 4EECA 3IJ5A 1GKUB 2PD6A 5BSKA 3U7GA 2HD4A 3PD7A 4MI9A 4ZQGA 5BSEA 1L7RA 2XRMA 3HH8A 3QX8A 1CJCA 2OFFA 4B4KA 4EY4A 6LDHA 4K3VA 1GCIA 1EU1A 3L1HA 3NT4A 1BGXT 5ARDA 2YWEA 5ECYA 5ICGA 1XYGA 4XDYA 2NAPA 1Z88A 2FB9A 2J46A 3T7RA 5ICFA 4AAYA 1C1YA 1L6RA 4L3VA 2IU6A 3ETNA 2Y1KA 5BSUA 4DMGA 3EW7A 4C0AC 2OKGA 3FYHA 1T29A 1XMXA 1GXSA 3MINA 4N3BA 1JV2B 3MWYW 4NH4A 3FCUB 3R7NA 3Q0IA 1G5HA 3FH0A 3VGPA 4OQZA 3QTBA 2FG6C 3C3DA 2OBMA 4KQKA 1UZNA 1Q17A 4ZVVA 3ZV4A 4AULA 3IHKA 1E7QA 3BIOA 3GAMA 4BGUA 2BKEA 1GDHA 4G56A 3R9WA 2NPFA 4RZQA 3QY9A 2CE2X 3EXIA 1SUEA 3TVDA 2YUIA 3ROKA 3WK5A 4HAUA 1WY5A 2AFIE 3SM3A 3LXRA 3IPAA 4MKRA 3HPQA 2ONJA 5LBUA 4EHAA 1AGXA 3OU2A 2I6TA 3K1AB 4NOKA 1FMTA 1NUAA 1O6FA 1UJ4A 3S3TA 3MJDA 4AKEA 1H69A 1VXRA 1C7FA 1W2WB 2YN0A 3DE7X 2PAAA 5DKFA 2BFBA 3AIIA 3WA6A 2PCJA 3LTNC 3AUSA 4C0BA 2J9GA 3R4CA 2YNMD 1SVIA 3B9BA 3GAFA 4YA6A 4ZXFA 2BPOA 4IMRA 4F84A 3DUWA 4YUZA 2BE9A 4DVJA 4MV4A 3ZX5A 2WD7B 1HSZA 3O8LA 2TS1A 1DAOA 1D7AA 4F6RB 2G1UA 2BFFA 2AZMA 2I9KA 4ZMBA 1VL5A 1WW3A 4EFKA 4ZK2A 2O0KA 3MT7A 5LKRA 4JH0A 1I80A 4I46A 4NMXB 4EGFA 1YU6A 1K0FA 3D5EA 3OD1A 1OX5A 3A6ZA 5ESRA 1XHEA 4QUKA 5LYJA 3RRNA 4DMMA 3M2PA 3JAMA 1OILA 1SM4A 3MIIA 1EWQA 4DSTA 4NBVA 2D2XA 5ERXA 2XUQA 5BNWA 2HCJB 3HRIA 4IWYA 3UK2A 1X8JA 3GLHA 2WAAA 3HI4A 2V65A 3VR4D 5BQFA 2HPVA 2GM3A 2FPGA 1N2HA 3GELA 3AKZA 5EUBA 2P6RA 2PTGA 2WP8J 2HPZA 5K3FB 2BGJA 2FZ5A 4LRUA 1QGAA 3L07A 4QPPA 3SJAA 5B57C 3WJ1A 2Y0DA 1SCJA 5ARBA 2B4QA 2OE2A 3F49S 5A4DA 3BGDA 5CA0A 4K28A 1AN9A 4BWVA 4DV1B 1PIWA 5FBKA 3KLNA 5ITSA 1JFLA 1VOTA 2GFIA 4KOEC 1ZY2A 3O95A 1WCYA 1ZAKA 2XE7A 4K9RA 2ZRLA 3VHLB 1P5HA 4IOLA 5JROA 3NC4A 3A1TA 3HQ4O 3HZOA 5DHFA 3Q8MA 2CNKA 1ZUHA 4PR3A 1DKMA 1VKNA 4CNQA 4ARSA 1QE3A 5SICE 3CF4A 4P7KA 5HZKA 1AVTA 4YRNA 4NPCA 1TMKA 3BCUA 2QORA 1U4OA 1X14A 2Q0QA 3R6TA 2ECFA 5C34B 3SR4A 1H23A 4J0GA 3ZZTA 1TXGA 1WKBA 3CZ4A 2DUWA 4RDXA 2BEVA 2WABA 4XWKA 3SMVA 4DNFA 4YRMA 2AR9A 2HNBA 2XWJI 4EB6B 2O0JA 4UPDA 4GU5A 2C9BA 3PFBA 4C0LA 3P0IA 2YMLA 2PO5A 4B2LA 5A06A 2C95A 1YBAA 5K3SA 5K0JA 5IHXA 3J81A 3SQWA 1SHTX 3BE6A 1AJEA 2QF7A 2VJNA 4WVFA 4JZYA 1FVOA 4N3CA 1D6JA 4UHCA 5DXJA 1W49A 5F33A 3RUDA 4BMCA 3M3DA 4PONA 2XYRA 1I32A 2I65A 1T6ZA 4OATA 3SCZA 4RPLA 4CHTA 4JS0A 3KP1A 3NHKA 2QAGB 2QUZA 1LCIA 4GPZA 3PTAA 2QR5A 1MV8A 1YZ3A 1N6OA 1DS6A 4YPFA 4Z3OA 1UPFA 3KE8A 2PVCA 3R0VA 1EZZA 3VZQA 1O9BA 4GGPA 3ZU3A 4WBNA 2GZAA 3GFRA 3D6HA 4U7WA 1JILA 5HHTA 3EFOA 2R96A 1G8FA 4XM2A 3HKEA 1UQUA 4K7JA 1J9EA 1RPJA 2BONA 1OZHA 3GA7A 5FFNA 2WTUA 4MI6A 2RBEA 2G25A 1MB3A 3QVGA 2ZRIA 2CLEB 4ALJA 3QYJA 1NXWA 2ZSJA 4FWBA 1MC4A 4I99A 3S8YA 4YXWA 3IC5A 1B0AA 5L40A 2JFXA 3WAGA 3X2SA 2QUJA 4AZWA 1Y9JA 2AZDA 2JGKA 2WWHA 1N6LA 4UEKA 1GG5A 2YZGA 3UYKA 2PKQO 1V5IA 4MWDA 4GSLA 4ND3A 2OHGA 4TZ0A 1IVYA 2EFHB 1EFKA 1O2DA 1DAFA 1FS4A 5K9ZA 4QEDA 3ZWCA 3R0JA 1EE9A 1PYOA 1TLLA 2FE1A 5EPOA 1J1UA 2NTYC 5JXHA 1T36A 5I7FA 2ID4A 3CG0A 3R5XA 1GT91 4NDNE 1WNTA 3SIXA 3I3SR 2GGSA 1T1JA 4MPDA 3I6QA 2O8BA 2PYDA 1A7UA 5FQOA 1ZONA 3Q3GE 5CX1B 2FZWA 2PL9A 1O6ZA 1R0ZA 5ENZA 1YQGA 2YXBA 3F7MA 5CTAA 5L8VA 4EJSC 3BSFA 2YBEA 3N9IA 2WI8A 1T8YA 4H08A 5CB0A 4E21A 1KK3A 4JUCA 1S5PA 4PBSA 4HQOA 4UBMA 3OZWA 1XTTA 3V8BA 4EKYA 3MPOA 1PDWA 2ZYWX 2FJUA 2VPWA 4ZGWA 2X2PA 3CVWA 3M6WA 1YE3A 3AXTA 2FU5C 3QI2A 2WNHA 4K2HA 5GJCA 2I4IA 4YV7A 5BW4A 1M2VB 1Y1SA 1EGQA 3QMMA 5F2KA 5BRNA 3IEUA 1EGMB 4G63A 4BE4A 2GPBA 3P0EA 4NZOA 1JTVA 1GN8A 3CKMA 3ND6A 1IEQA 4OP3A 4F1WA 1C1DA 2CJPA 2FEMA 3PX3A 5EZ5A 4FMDB 4PY2A 1U3TA 5CIYA 4MW7A 1T5HX 3R20A 1LX6A 1E2FA 1EMDA 2F90A 4FOTA 1BKSB 3AY3A 3V3TA 4ECAA 3CINA 1U2GC 4B9AA 4AJIA 4BAZA 3EEIA 1E1DA 3NUQA 1VIVA 3F5SA 1R5JA 3PU6A 4WY5A 3WB0A 5JS6A 2XOKD 2J5KA 4LMAA 4O5AA 3MYRA 1E89A 1FSZA 4DGQA 1KZ9A 3PR3A 4GPBA 3STHA 3SXPA 2HK9A 4XYGA 1U2ZA 3Q41A 2WU3A 4KHZA 4XM0A 3UCFA 3QFCA 6PFKA 3EF0A 3A11A 3G13A 1FXWA 4RELA 5HJEA 1J2JA 1W59A 2QZJA 3K0FB 2D5IA 3ZCPA 5F98A 4ID9A 1OLSA 3OIYA 3L7LA 4Z9AA 3I8XA 3C0KA 5JHHB 1LVUA 1X70A 1VL1A 4WSOA 4C1BA 2QG6A 1XZDA 3DE2X 4GYYA 3TE6A 3M6LA 1PFGA 2MMGA 2QVBA 4FWIB 5KCMA 1XTJA 3A4MA 3UWDA 2OHFA 2ZRKA 2VHVA 3CR3C 5KC9A 3UBMA 4EKEA 1TKCA 2EIXA 1QWSA 2FMUA 2PG3A 1DL5A 2M1ZA 1P2DA 4I7EA 1D8AA 4YALA 3MW8A 4QU8A 3LH5A 3ANYB 4RSGA 3GLRA 1WX1A 2A88A 2O52A 3KBBA 5I6DA 3EPLA 4KQ6A 1EDZA 4FE3A 4A6XA 1A5BB 1JHQA 2WWGA 4B3HA 3OU7A 1E1RD 3FDZB 3UPUA 1U81A 1M0EA 2B6HA 3GT3A 3M1LA 2HU8A 2X5XA 1VLVA 4DZZA 1SRRA 4HYEA 1HLDA 1BKDR 3IB6A 1DTEA 3G8YA 4IWXA 4P80A 1TM3E 4F92B 3VZSA 3PCXA 2VJYA 1EQUA 2OZLB 4QULA 1O6BA 2ABWA 2CJWA 2FH5B 3SGLA 5KJ6A 2JLUA 2Q4EA 1W0CA 4RK6A 1WP9A 2F3UA 1Z29A 2EGGA 1EUZA 4RGQA 2ZU6A 2Z9DA 1R37A 3OZIA 1G42A 3HCCA 3I34X 5TMPA 5FLXA 4MVJG 3DUFB 1EX1A 3QF4A 4JLUA 2GK4A 1I36A 2RAFA 2VJMA 1NDUA 3FNHA 3Q3EA 4HDNB 4JCCA 4N3NA 4OD0A 4Y0NA 2DAPA 5F7ZA 3S0JA 2XMQA 2O8NA 5J4YA 5AVWA 3QTLA 4LNHA 4MB2A 5K45A 3ORQA 3G8CA 3H8SA 4BQSA 5MGBA 4Y67A 3ZNQA 4LE1A 2NU7A 2R87A 3DTTA 3OE7A 5EXDA 5HBRA 2JIZA 1Q3KA 2PX5A 2VS1A 2VRCA 4KACA 3KSDO 4LXGA 4C7BA 3LYLA 5J4LA 4NCBA 1LJUA 2NX2A 2DFLA 4GXRA 1BMDA 1FSSA 3RSGA 4P54A 4LDZA 3B7GA 2E0IA 4HGQA 2IXAA 3G8AA 4ZOCA 4D7AA 4D79A 2OZKA 1W5FA 3CM0A 1E9RA 2Y92A 1XXHB 1X1CA 4HRVA 4UHJA 4Z3DA 4CMEC 2H5LA 2I33A 1X7ZB 3A04A 1PR0A 1KP9A 5AJTA 3I5YA 4NTZA 2O7QA 3T5TA 2Y1CA 2ZBPA 3MTDA 1P3Y1 1V16B 1OV4A 2IJGX 4YRIA 4GGMX 1EP3B 2IEAA 3URKA 4AN1A 4EHHA 4CKWB 5KU1A 3MHTA 4O59O 1N2EA 5LWQA 3AFHA 2AG5A 4QTTB 4D4MA 2ZWPA 2J4CA 3BBPA 4V3CA 5T4FA 4JYAB 1L7OA 3OQOA 2LNDA 4R01A 5DTJA 4AN4A 1LS6A 2C4UA 1NV8A 1Z36A 1YRAA 2WJAA 3A4NA 1XTVA 3L7CA 4GC5A 3DQZA 1IPHA 5KOIA 2X0IA 4AZ3B 2VYVD 2VTEA 4NBWA 4UCQA 4JQZA 2XXJA 3A58B 4LOIA 4TKVB 1EB8A 4ZCLA 4Z0HO 1G8GA 1A2BA 1FFGA 1EYZA 4Z8YA 4EB8A 2UUPA 5FUQA 4QYIB 2OAGA 3OFND 4L4SA 2R1VB 3INYA 4NQZA 3BEOA 1KMNA 2AX3A 3GP5A 2QG9A 3BS4A 3S4YA 1TQHA 3HYLA 5IDQA 2GT1A 2YVAA 3WJ7A 2Q3LA 1IWBB 4GC9A 3JQEA 3N8IA 3BFVA 1WMDA 3F3KA 4RTMA 3GZNB 4YT5A 4H0NA 4ASUD 4JCOA 2FEWB 3RUCA 5DYIA 3ZOZA 3ES9A 3HK2A 3UCEA 3W8NA 2XCTB 4GLJA 3G6KA 1L8XA 4JXJA 5JTTA 1EINA 4WOKA 2WZDA 2ZRFA 4V0NA 4PPQA 3QU2A 3ICEA 3E70C 1HNXB 1H2HA 2RAVA 3AHEA 1XL1A 1HZZA 1NLYA 2ZYAA 4HBGA 5JATA 3PF9A 5GZ1A 3PJGA 5K51A 2C77A 4F3KA 2WJHA 1TM7E 3U4DA 4PIMA 3ELUA 3MQFA 3DMRA 1NRXA 1H2AS 1KJZA 3PHCA 2GYUA 3ASVA 1M1UA 2P69A 3UHPA 5ILOA 4ZVKA 2BIFA 3E4DA 3AOEC 1XJQA 2POCA 5G0WA 4HQNA 1WPRA 3HU3A 3AR3A 2N0SA 2MMCA 2IV3A 1YQDA 3VTFA 2CVQA 3LUAA 4ND4A 4PAQA 3RFCA 2HX1A 1P8AA 4E5YA 5KNBA 3GCGA 3QK7A 1M75A 4V2UA 2REXB 2OAP1 3OEEA 4L5CA 3EVAA 5FLYA 1ZU5A 2A1UA 4B82A 1VE7A 1QQ6A 4PLVA 4URXR 4G1VA 2I4TA 4RCZA 1XTZA 2IYNA 2OV3A 3LUPA 4I3FA 2PPVA 5AESA 2JFWA 4YJDA 3B1XA 3NBMA 3ROPA 2Q4BA 3CG4A 3L6UA 3KWJA 5A0TA 1LDBA 4TLLB 4LBZA 1SPBS 4MA0A 4NULA 3ABZA 2IY9A 3BIJA 1PR2A 3WDLA 4IY1A 1ZIDA 5L7TA 1T4DA 3OEHA 3OI7A 4LVOA 5KO2A 3LA6A 2I2CA 4NOLA 5TQVA 1QPGA 1P2TA 4JB0A 4X64B 4EJMA 2ZT5A 5I51A 4BLVA 4CLHA 2IGTA 3DBIA 1A8SA 1FYEA 1Y3FE 4IRUB 4N7MA 4R5MA 2OBNA 2VJAA 4OFXA 4OHXA 1U0LA 3TNFA 3EPKA 1X0XA 1AS2A 2ZG6A 4R16A 1EK6A 4LZPA 3VR5A 4QE3A 1MJNA 3LLVA 4DV7B 2VQ6A 1M2HA 1ICIA 1M33A 4TN1A 3SQLA 1OI7A 2J08A 2PEZA 3JQBA 4U9IS 1Y7TA 3I73A 2B99A 5LZ2A 2G4VA 3N5KA 2AQHA 4FQ5A 3GFFA 4QFDA 4ZV9A 3IUSA 2YIJA 4JB3A 4PF1A 1WUKS 3V34A 4OI1A 3WYBA 2QTCA 1NW4A 1TYZA 3VR0A 1MAUA 4DDVA 1QP0A 1B2LA 3KKNA 5TQ0B 1NQTA 4LHYA 2FOLA 2N3ZA 3GT7A 4G0ZA 4IVQA 3RVRA 2DTEA 3I09A 3WICA 4BO4A 2Q9BA 1KEKA 1CQJA 2DFVA 5AHOA 4HI0E 5CDYA 3DCNA 3F1KA 2VPPA 2WRZA 2AD1A 3PXAA 3T3OA 2QL9A 2PKXA 2X8JA 5SYMA 2Y9MB 3DC2A 2D2FA 4IKOA 3I8SA 3N53A 1RXVA 2FPXA 1PYDA 2JAOA 4B83A 4OK3A 2JAWA 4XYLA 2RGXA 4R71A 3WXMA 5AOBA 1L4YA 1K7XB 1VP9A 3SXJA 3TLEA 4QAQA 2ZANA 3HP7A 5TQJA 4GVLA 3KEQA 3UKOA 5L95A 4Q4JB 4CEIB 2H3EA 1N1DA 5FBLB 1K8ZB 1RYYA 2GESA 3TNLA 4YT8A 3GEDA 3C7AA 1TKAA 2ACEA 4PNZA 5KZMB 1GQFA 4ZVOA 2GYYA 2YNMC 3ICPA 4JQOA 3ZDQA 5EP3A 1C81A 3FROA 1SVKA 2GCNA 3WWOA 4OU5A 5JNSA 4TM7A 4LZLA 3SC6A 3MBOA 3KM0A 5E8JA 1ZN2A 2QM0A 3KL2A 3BRSA 3OIVA 4TMTA 2IYLD 3JYQA 2I5PO 4N49A 4PTZA 3ERCA 2FUCA 2BP7A 2OV8A 1JIXA 2V45A 4TMYA 2QP9X 2PL1A 3RFXA 3T54A 1GZSA 1HT1E 4BNDB 4DXHA 1SCAA 3HXPA 1RMQA 4FW8A 4F2PA 2DR2A 3RVQA 4B3MB 2NWQA 1P2SA 1QKIA 2IHBA 2V7XA 3AILA 3C5CA 1JQDA 1QNLA 1JJIA 3CLHA 4OQPA 4OUDA 4YDRA 3RBAA 5TR9A 1NSYA 2AJCA 4B7AA 1XWFA 2I2FA 1ZD5A 4P4LA 4B81A 5JG7A 1JDSA 2XW6A 4EFMA 1SBYA 2VQSA 3E1KA 4RKYA 3GROA 1XTKA 1ODLA 2OHVA 1CV2A 2RHBA 4IJQA 3SBXA 1TNDA 2R5WA 4RA9A 4BCCA 3QVXA 5K0BA 1T4CA 3IEXA 3L8HA 3JD2A 5CLLA 2CUKA 5E6SB 3NAGA 1NHWA 4DNQA 4IH4A 3EGOA 5BMOA 2I8LA 2V6MA 4MVJF 1E5LA 4XRRA 3CMCO 4BQQA 4CWAA 4BMYA 3EXHB 5I9LA 3GFOA 1EM8B 2GXAA 1LH0A 2D3TA 3D02A 3GA5A 4XYEA 5CCDA 2GEKA 3WGYA 2ONKA 2XZDA 2OD2A 4XI9A 1ZYUA 3BXOA 3ORRA 5FOUA 1X7XB 4YASA 3DPUA 4C2BA 4NCAA 4QGSA 2XRFA 4J1TA 2PS0A 1TT5B 3STWA 3VYSB 4QUHA 4AIRA 3DZJA 4OHFA 2BR4A 2OCLA 1H65A 4HRAA 1L4FA 4Z51A 4ABYA 4KR3A 2PKQP 5TDHA 2CB9A 2W0MA 2XF8A 3KKOA 2EAUA 3LQFA 3ZBUA 3N8DA 1MAAA 1EX9A 2ZDQA 4HNUA 4QSMA 1PUIA 5F77A 3P9KA 1JAIA 4CTNA 4HUTA 3H6GA 1I7QB 1ZJJA 3BJMA 2W5UA 3KQHA 1AHPA 1J8FA 1RQRA 3NASA 4KE8A 3H2ZA 1SCIA 4IJ6A 3ITNA 4AQ7A 3UTDA 1KETA 3I53A 2FUNB 3JQGB 4YMTA 1JG6A 1E7WA 3EF1A 4BJHB 4J0QA 5B58C 4J4HA 5JXJA 5KTPA 4GHWA 5LQNA 1G9TA 1DOHA 2ERCA 2FWIA 1DWUA 3K1JA 3NH9A 3QPDA 1VHLA 3K9CA 1DWOA 1TM2A 4CL0A 3BWEA 4XCVA 4PQRA 3VO1A 4DLAA 4M46A 1DB3A 2IYFA 1OBFO 2JK0A 1YIOA 3ZI0A 4L5IA 4YP0A 1QAOA 1R0SA 1X13A 2WSYB 2FW1A 5AT1A 4M1WA 4HLUC 4HZIA 2N1MA 4TYMA 3PXDA 4C0SA 5BWBA 4URUR 5DSZA 3HY3A 1DJNA 5K6AC 1I4OA 1BC5A 4OGLA 4K5QA 5KHAA 4GO1A 3A10A 3BHMA 3B13B 3INGA 3LPMA 2AJLI 5HKKA 2O7SA 2IZ7A 4LDPA 1IB6A 5TGTA 1UDRA 2BGIA 3ZZNA 1QGDA 5B1SA 3NOVA 2XQJA 5KNDH 2AEMA 4B6PA 1OBHA 2QRMA 4OLJA 4MQEA 1J0CA 2SCUA 1SVUA 2B7LA 4F8EA 4EYSA 4U2FA 2Q4RA 2XB4A 3ACDA 4FKBA 5HZMA 3EZ9A 4G4SO 4PSKA 5GOZA 4YROA 2GZ1A 2OGZA 4FKMA 4YEDA 3U60B 2QN7A 3YASA 1FNMA 3B1JA 3O8OA 1P1CA 4J07A 3OZVA 2G80A 2KQUA 4HXEB 3ANTA 4DCVA 2IYOA 4KYVA 5K7SA 1E1CA 2V4ZA 2ZZKA 3K0AA 4QRIA 4WLEA 3TKYA 4M0CA 2M9MA 2ONZA 5SZKB 4B40A 2WUGA 4ZI3A 1AV7A 2Q4DA 1E9CA 5F4BA 2VDNB 4WK0B 3PFKA 2ODEA 3V4FA 1G18A 1RE1A 4Q6WA 4ZAYA 5JAOA 3K8QA 2NPIA 3STVA 4JBXA 4GL2A 3DBHB 3MGKA 5IN5A 4AB1A 4AMBA 2N42A 1ULTA 3D6MA 2NXWA 1KPHA 2Y6UA 5GY7A 2FR8C 2C9ZA 1W94A 1KU6A 4FFSA 1C9KA 1J8DA 1G6Q1 1XJCA 2PFGA 3T9AA 3ROXA 3FJOA 1A95A 1A9RA 1CR1A 1UADA 2H9AA 4ENWA 3G0CA 1KI1A 4G5OA 3V7UA 3JQAB 1GL9B 4YDSA 2PCLA 4Y6QA 3RRYA 3S2UA 3E5NA 2YCBA 1A96A 2PE5A 1CZHA 4WEQA 3VJRA 5DTEA 1V48A 821PA 4GAEA 2P65A 2YINC 2ZUCA 4Z0PA 4BMOB 3RJ9A 4ERXA 1B3BA 3U81A 5IDVA 2DBZA 2KLBA 2XJ4A 2ZAMA 5K3EA 2IW3A 3C5HA 3AY7A 4TGLA 1WDTA 1Y3IA 3PKJA 3M4ZA 1EPUA 4QXAA 1U28A 2Y66A 1YQQA 4MJLA 2C0PA 4FZRA 5LN1A 2VAVA 1Y9DA 3K8OE 1XMOB 3E7PA 1A5ZA 1HDYA 2B20A 1Y34E 3M81A 5FTKA 1BXKA 1VB5A 1YA6A 1UC8A 4F8YA 3REFA 1T35A 1V4VA 1Y33E 4BNJA 1BHQ1 2WIGA 1JHUA 1RAEA 3KQMA 1RCTE 1V0JA 4JELA 3OPMA 5JU6A 3X1MA 1C9YA 3AJRA 2FMTA 2WHQA 4BKUA 1YBHA 1JP7A 5K8IA 4D02A 4V0SA 3IUPA 3FGZA 2X22A 5FLEX 1XXLA 1VKJA 4MIEA 2IE0A 4L9RA 1A4XA 3VPHA 5H3LA 4J7UA 5H68A 1LSSA 4A10A 1NW3A 3F71A 2ZJ7A 5FPPA 2JHCA 2YHSA 4NG4A 1IQPA 2HA5A 3OQBA 3PPIA 2W2LA 5K0CA 2J45A 2FEOA 1H2BA 4KODA 1QOPB 4R2HA 3V7WA 5KNDD 2WYVA 2IS6A 2VP6A 1U65A 4LWZA 2H1VA 3RBXA 2GAAA 5DGDA 1DIBA 1G21A 4UMVA 2O7NA 4CM1A 5C5DA 3ZHTA 3NONA 5EN4A 4ETWA 1PTJC 2PY6A 1IUPA 4MINA 4QOEA 4YS6A 5AD1A 2XCUA 3I9FA 3QNWA 5JNTA 4BFCA 2V0CA 3HNPA<