4GLOA

Crystal structure of a short chain dehydrogenase homolog (target efi-505321) from burkholderia multivorans, with bound nad
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
258
structure length
258
Chain Sequence
MDLNLQDKVVIVTGGASGIGGAISMRLAEERAIPVVFARHAPDGAFLDALAQRQPRATYLPVELQDDAQCRDAVAQTIATFGRLDGLVNNAGVNDGIGLDAGRDAFVASLERNLIHYYAMAHYCVPHLKATRGAIVNISSKTAVTGQGNTSGYCASKGAQLALTREWAVALREHGVRVNAVIPAEVMTPLYRNWIATFEDPEAKLAEIAAKVPLGRRFTTPDEIADTAVFLLSPRASHTTGEWLFVDGGYTHLDRALV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
publication title Crystal structure of a short chain dehydrogenase homolog (target EFI-505321) from burkholderia multivorans, with bound NAD
rcsb
source organism Burkholderia multivorans
molecule tags Oxidoreductase
total genus 95
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2012-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4gloA00
1LC3A 2VHXA 2E49A 4O6VA 1VL0A 3GNTA 1GCOA 2DT5A 2IEBA 4TVOA 3KYDA 3UAGA 1D1SA 5U9CA 4DIOA 4WCFA 3VZPA 3H3JA 4MVJD 3CSDA 4PLFA 5JY1A 1JVBA 3VTFA 3O8QA 1IHYA 1LLUA 3KBOA 3WX0A 1R4NA 2FPIA 2QRJA 1MXHA 4MPDA 1QYVA 4BO2A 4W7HA 9LDBA 1F14A 3AY7A 4MIEA 1GZ4A 1JN0A 3AI1A 2I67A 3H5NA 3VDQA 1ISHA 5TJHA 3KXDA 4IDCA 1F8GA 4MP6A 1KC1A 3RFTA 1Q0QA 4PLYA 1X7HA 2VOEA 5KWEA 3RUAA 3ZCXA 5KVCA 1T2DA 1GV0A 5EERA 4KWHA 2AE1A 1YBMA 2YFQA 4QTZA 3WFIA 2QZZA 3UGKA 4YWJA 2W98A 5B4UA 3B70A 2BFOA 1MP0A 1ZXLA 3ZWVA 3OICA 4BO3A 4DIFA 4J9UE 1FF9A 4J2HA 3ZWXA 4IXTA 4LSWA 1NQAO 3O4RA 4OJNA 3B1FA 1E1LA 2ZYDA 3G1TA 2P4HX 1CJCA 3IUPA 1V35A 2AEMA 4BNHA 4AJNA 1H6AA 4XDZA 3IS3A 1P9LA 3HJAA 2UV8A 5DULA 3D4NA 3S2EA 4H3VA 3AOEA 5JXWA 3T4EA 2DBRA 2UVDA 2ZQZA 3B6ZA 3OIFA 5HRUA 1SOWA 2C2YA 5G4KA 1P33A 4CM9A 1NBOA 3GEMA 2I99A 5I7VA 3CMCO 3DEYX 4XRGA 1R37A 3HADA 2VHYA 5JDCC 2C7VA 2P9GA 1ULSA 3GVXA 3IP3A 4EUHA 3JQ8B 4KWIA 3RSHA 3DR3A 3DHEA 4AJIA 2GR9A 2ZATA 2YV1A 1J5PA 1RPNA 1E1KA 2V6BA 1F12A 1W0CA 4QO7A 2VYVD 2VZ8A 5ER9A 3ZHZA 5C3MA 2EW2A 1NVMB 3OM9A 3HN7A 3DMYA 4Y8VA 4WGGA 4P38A 5AXAA 1UP6A 1B15A 3DXFA 3HDHA 3HZZA 3L0DA 1D4FA 1MC5A 5TRTA 4ZQBA 3PYLA 1H0KA 5KJ6A 2GNAA 2Q4BA 3KETA 2JCYA 5A9SB 2Q45A 1B8VA 8ADHA 3NT4A 1ENPA 1X0XA 1T4BA 5L51A 3PRJA 4R54A 1MGOA 5COBA 2PKRA 3TNLA 2X5KO 4I9UA 3W6UA 3I9NA 3DDNA 2GDZA 1YKFA 3NT2A 3PWKA 1IPEA 3NKLA 4BNWA 3AI3A 4HKTA 4OQZA 2B69A 2X9NA 2Z5LA 3RUCA 2XXBA 3HUDA 1PX0A 1IL0A 4O63O 4WLEA 3WGGA 3FTNA 4U0KA 4CV0A 4IJVA 4R1UA 4E12A 1E7WA 3I9MA 1EZ4A 4ZQGA 1PZHA 2IXBA 3LC7O 2DAPA 1PJLA 4TRRA 2JD1A 2WJPA 1SMKA 2YY7A 3G0OA 2G1UA 3WXBA 4JJGA 1E1NA 3OETA 3HDQA 4KDEA 4RO0A 3D64A 1UDBA 2WSBA 2IZ0A 2PR2A 3VH2A 1BG6A 3U3XA 5JO0A 3D3WA 1LJ8A 3I23A 4YJGA 2ZYAA 1BW9A 4IDFA 4TZKA 3WIEA 1GADO 3RVDA 4CMEA 3UFXA 3H65A 4PLVA 1M76A 3V2UA 5BQFA 1E0DA 4E6PA 1ZVMA 4OGWA 1KY5A 3VKVA 3ZI0A 3JQ6A 4UEOA 4E2WA 1ONOA 1O0SA 3GZNB 3TZHA 1NAHA 5A5EA 1S7CA 4ALLA 1BTOA 1CEQA 4IJKA 3MOIA 4K28A 1YBVA 4LSMA 4BOYA 1CIVA 1AHIA 1PJ4A 1E3WA 4CM7A 5JAZA 3KHUA 3NGXA 1I36A 4WCFC 4H16A 3VHRA 3JQGA 1A71A 1XCBA 4GAEA 2VWHA 3EVNA 4J16A 1RM5A 1P1RA 1A9YA 1LSOA 4GQAA 2RBEA 1H2BA 3HN2A 5TS3A 3KSZO 5AXCA 3ZWAA 4YEDA 4EGFA 1T1SA 1HEUA 4MVJF 3IOYA 1ZCJA 2VTEA 3PWZA 1DJQA 4YT2A 1TT5B 4CQMD 1J4AA 1MFZA 5ICMA 1WAMA 2O2SA 3VPFA 3LC2O 1ZSVA 3CUKA 4L74A 1DEHA 3OECA 1MC4A 5H81A 4Q3DA 5TLSA 3QE3A 4EUFA 2Y0EA 2CF6A 4YTEA 1P31A 3QY9A 3WQRA 3DONA 3CMMA 1J6UA 2YDXA 1Q2XA 2IRWA 2EERA 4DPLA 1LRLA 2GRAA 2Z1NA 3GMDA 4J4BA 4XR4A 5IZ4A 4W82A 4E3ZA 5CDGA 5FFFA 2P91A 1X0VA 3U62A 3G1UA 1HDYA 4XZ3A 4IQ0A 2DPHA 3ASUA 3WBFA 1LC0A 5ES3A 1DDOA 1NQOA 3WGZA 3SLKA 5TT1A 4LRSB 4R9RA 3RJ9A 4CM4B 2WYUA 4DBZA 2BFPA 4TZTA 3AOEC 1UXKA 1NPTO 1Z6ZA 2NUAA 4YJHB 4RF3A 3WNVA 2P5YA 3GAFA 2X22A 3BMQB 1ARZA 3OJEA 1V3UA 2NV6A 3FN4A 1OFGA 1VL8A 1SB9A 1U8XX 2X8LA 1PJSA 1Z45A 3ROMA 1QMGA 3JQAD 3ON5A 4DLAA 5ADHA 4CUKA 2DC1A 4RLHA 2JKVA 4UUNA 4CQLA 1DRVA 4AJPA 1GAEO 3H9EO 3FHLA 2X6TA 4BNNA 1BRMA 3B1KA 3NTOA 3TRIA 3SC4A 4YYZA 1DSSG 3CE6A 3GQVA 4EEXA 5K9ZA 1XU7A 2H9IA 4ZVVA 1NM5A 1P1JA 3M2PA 4GPD1 2V7PA 1Q7GA 1X13A 1U28A 2IYPA 3VH4A 3JTMA 3JD2A 3C85A 1QLJA 2X9VA 2DBVO 3EY4A 2NWQA 4HWKA 5KJEA 3KRTA 2WM3A 1PJ3A 2FR1A 4HUJA 3VC7A 4Y67A 1R0SA 2H5LA 4IUYA 3RAJA 3PJEA 5L45A 1H9BA 5F5NA 1BMDA 1PGPA 4KP7A 5TJ9A 4W4TA 1EK5A 1QR6A 4QUKA 2I6TA 4ALKA 5ILOA 3GGGA 5TQVA 3VVBA 1E7SA 1V8BA 2I65A 3JQ8A 3QIVA 3V1YA 1W73A 3O9ZA 4WOKA 1GPDG 2O3SA 3WFJA 1WWKA 4PLCA 3I52A 1IZ9A 1OZAA 2JL1A 2NTNA 4QEDA 3WB9A 4LW8A 5IDQA 4PRKA 3ETEA 3ENKA 1ADFA 2CUKA 3BTOA 1M2WA 3V5NA 4AJHA 4E13A 2W4QA 4RPGA 5EPOA 5C7IO 1PS9A 4OM8A 1YRLA 2D2IA 1R66A 2DKNA 4FJ0A 4BKRA 3DBRB 3UXYA 2J5KA 3WYBA 5IZCA 4KTTE 3U4CA 3BTSA 4EBFA 1YL7A 1WP4A 2EV9A 1PL6A 1N5DA 4CL8A 2IXAA 4J43A 3SBOA 2HMWA 1A7KA 1HLDA 1P45A 1ZZEA 3OF2A 3QJ5A 4JP3A 4L0QA 1FDTA 1UJMA 5JCJA 3Q2KA 1DIBA 4HP8A 4CMEC 5TT0A 3I6QA 3VPGA 1FDVA 2AXQA 4QQRA 3ROPA 3R6DA 2ZTVA 1YB5A 3RWBA 1PZGA 5I7FA 2P5UA 4GX2A 3SLGA 3IP1A 1QLHA 3A06A 3KVOA 3I6IA 2J3JA 3EYWA 3WGIA 5JC1A 5IXSA 5CAEA 2B35A 3GMSA 4D7AA 3ZNOA 3ZNPA 2CDBA 1F17A 2FMUA 3IC5A 5DDIP 5CFZA 1DIRA 3KZVA 2EJWA 1ZK1A 1PWZA 3JQFC 4XYMA 4F6LA 4UVIA 2HAEA 2HDHA 4A7PA 5BSEA 1X14A 1ADBA 1EE2A 2IZ1A 1EK6A 3FRJA 3L9XA 4RVSA 2Y0DA 5A06A 3I9LA 2B36A 1HLPA 4NG5A 2X0IA 1VJ1A 4CLEA 1DJNA 1IE3A 2V6GA 3FCOA 2DUWA 3RC2A 3LQFA 3ZW8A 3QV1A 4D3SA 4Z9YA 1LNQA 1ZK4A 3UUWA 3KM0A 4PLGA 1SZJG 2P9CA 3GZNA 1KVSA 4M1QA 1ISJA 1FDWA 3LT4A 1LDYA 3MCVA 3C24A 3NJ4A 1EVYA 3BMCB 4GLOA 5JC8A 3AUUA 4R1SA 4BO6A 2ZB3A 3EK2A 1PJBA 2NQTA 1VRWA 2NLOA 1TEHA 1OOEA 3LVFO 4U6SA 2YFHA 3RI3A 5G4LA 3TWOA 3W8DA 1D1TA 2VUTA 4ZD6A 4YT4A 1P74A 4CLDA 4WLOA 1JKJA 2CFCA 3V2GA 3JYOA 1QYXA 3MJSA 2F1KA 5TGDA 4A5OA 3T7EA 2NU6A 1VL6A 4HFJA 1T1RA 1X1EA 1TT5A 3C7CB 3IDSA 3VZRA 3ZV5A 4F6CA 4AJ1A 1LTHR 3KEOA 4KQWA 1NHWA 1EVZA 4E0BA 3BTVA 4FJ1A 2C0CA 3PFFA 1GQYA 1WVGA 1HXHA 2JFGA 3EUWA 4OL9A 4NBUA 3F46A 4PLHA 3PYMA 1GEEA 1GCUA 3GPIA 3P19A 4I8XA 4RPKA 2VT3A 3I4FA 4IDGA 4DQXA 2IYOA 3JQBC 1GUYA 1NP3A 2JFHA 4PRLA 4J6FA 4QECA 4B3HA 4UEJA 3FTPA 4BNYA 1UP7A 2W90A 4L76A 5H83A 5JY6A 3B1JA 3QVTA 1U3VA 4CM8B 2Y67A 3WYCA 3DBLB 3ZWOA 2Y1DA 4CV3A 1UZLA 2O23A 3E9QA 4FFNA 4OSOA 5ICSA 1E7QA 2DFVA 5IDYA 4YJHA 4Z0HO 2CVOA 1JTVA 3VPHA 4Q3CA 4EITA 1Y8QB 1FK8A 3GR6A 5G2OA 1N9GA 4E5MA 2O7QA 4BMSA 1SO8A 3ZGYA 2PGJA 2OFPA 3CPSA 4M54A 3LU1A 2PY6A 2VCYA 2VNAA 4RV9A 4BNVA 2HRBA 1EBUA 5IN5A 2LDBA 4WK6A 2B4RO 1VSVA 1U3TA 2PWZA 1PQWA 3LF1A 4D0RA 1ZH8A 2YHIB 3ZHBA 4YVFA 4A0SA 4BNZA 2YUTA 4D3DA 3GGPA 3DHNA 3CH6A 4F46A 4UVDA 4E30A 1B3BA 1XEAA 4W99A 2VHZA 3MJEA 3ZHYA 3VOSA 5LDHA 3VAZA 3G49A 1Y7TA 3DQPA 4JP2A 4XQ9A 1B3RA 4BKQA 2W8ZA 3VKUA 1IPFA 3CIFA 1A72A 1B0AA 4MOWA 4YA6A 2Q50A 4UULA 4XDYA 3NTQA 1QRRA 3ETGA 3HQ4O 5CG2A 4RF5A 5BNTA 2GPTA 4YAEA 3CXRA 2VWPA 3JSAA 2D5CA 2ZTLA 3BZUA 3GDFA 5A3JA 1KVTA 3VDRA 5JAIA 4E31A 1ADGA 3BHIA 5EJ2A 5T8KC 3AOGA 1LLQA 4TMFA 4CMIA 5CDYA 4O5OA 1HYEA 3N7UA 4XKJA 1EQUA 4FSHA 4M89A 2GN9A 1G0OA 2GERA 3S1LA 3RJ5A 1XDWA 2R6JA 3NJ8A 3ENNA 1WXDA 4G65A 4ZU3A 3I9JA 3E82A 3NDRA 3Q1LA 3TL3A 2J5RA 2PD3A 1DIAA 2VTDA 3F1KA 5B4VA 4ZICA 3FBTA 5L3ZA 2Q3EA 3OSUA 2VYNA 4DGSA 5IG2A 2Y93A 3NUGA 1VPDA 3KSDO 2W2KA 1HDZA 1GL3A 1I5RA 4YB8A 2A94A 2PZMA 4CJXA 1Q7BA 2PKQO 2O3RA 4ZQEA 4PLWA 4AJLA 3ANMA 5DN9A 5AVOA 4BNJA 2Y1EA 1E6WA 1K6XA 5TSDA 4IS2A 1O95A 3V1UA 2HO5A 3D7LA 4OAQA 3WNQA 5JMPA 5A02A 4AFNA 3HFGA 4L4RA 3TF5A 4WCDA 4P22A 2WEKA 3QWFA 2AEJA 2HMTA 5C37A 1GV1A 3OEYA 4E4YA 1JVSA 3H2ZA 1XLTA 2C7GA 3JQ9C 1A4IA 1NASA 4XQGA 1Q7CA 4FFRA 3GVHA 4NU5A 5BR7A 3PLRA 4F45A 2FRDA 1XKQA 3NAQA 4FIZA 1QXSA 2NVUB 3Q3CA 5IXYA 2JAPA 1EFKA 3WGHA 1WPQA 3D4PA 3DZBA 2OL4A 3ASVA 4H15A 2ZTUA 3GF4A 4KQXA 3OA2A 1G0NA 2HK9A 2NACA 3C1AA 3ORFA 3QVSA 1JW9B 4JLWA 1VM6A 3AM3A 3PJGA 1WLYA 5BNFA 3WMWA 1Y9EA 5JE8A 2PD6A 3K30A 1H5QA 2YW9A 2XAAA 3DMTC 3HFSA 1QV7A 5CHEA 1LX6A 1U2DA 4NHEA 3VZSA 3BMCA 3AW9A 4QSMA 4XYBA 1KS9A 3BMNA 2YYYA 5KTKA 1NFRA 4W9NA 4KDFA 4YRBA 4GVXA 4NFHA 5T57A 3JV7A 3ICPA 5CG1A 3KLPX 3INRA 4XGKA 1NHGA 4D79A 2EWMA 2J6IA 1HDCA 4NQZA 2O3TA 5JLAA 1Y5MA 1IOLA 2Y1OA 4RDHA 2BD0A 4IXWA 3KOUA 4WECA 4YPOA 1PJ2A 2FZEA 4OMUA 2VZ0A 4XRRA 1P44A 1E3IA 2PTGA 3FI9A 2NU8A 1J0XO 3TFOA 1XA0A 2OBYA 2Q99A 1LSSA 4FB5A 1A4UA 1QG6A 1SAYA 2PA3A 3QHAA 3I9OA 1C0IA 3TJRA 4BGUA 4B4OA 2GLXA 5EINA 3ZV3A 4CMHA 2X7HA 4JN6B 3OP4A 3NRCA 5KJ1A 3GOHA 4YAIA 2VWGA 4MVJE 1SCUA 4ITUA 3Q0EA 4GMGA 4YJDA 1BSVA 5AYVA 3OFSA 2X9GA 1WMAA 3DBVO 2CVQA 4J90A 4ND5A 1SEPA 3TZKA 4CM8A 2BF7A 3ZU2A 2VN8A 1LDBA 1UXHA 3DBLA 3PLNA 4E5YA 4IY1A 1NR1A 2PH3A 3FPCA 5CP8A 1SNYA 1YDEA 1HDGO 4B7XA 4RDIA 1VSUA 5IAAA 3UICA 1OAAA 1U2GA 1ZBQA 2VHVA 5I8WA 4DLLA 1RWBA 4ROSA 4LMPA 2RHCA 4BL5A 3LSYA 4GI2A 2HMUA 3GRKA 4A2CA 1CDOA 1DC6A 3H9GA 4NBRA 1V0JA 3ANLA 2RH4A 4FD3A 3BMOB 4LMRA 4NFSA 1R0KA 2Y05A 1DFGA 3AWDA 3RU9A 4FC6A 1K5HA 3LF2A 3RC9A 1U5AA 3WYEA 3UVEA 1CQIA 3LYLA 4IDEA 1KYQA 1PGOA 4M55A 1I01A 2YQ5A 3JQEA 3F5QA 3PIIA 2NTJA 1HZJA 2JD0A 4OYRA 4YQZA 3H9QA 1P3DA 1RYEA 3I5MA 3L07A 3BIOA 1IY8A 4J0EA 2HLPA 3AJRA 3RFVA 1B2LA 4DRYA 1ZFNA 4C7JA 4P4GA 1V3VA 2RHRA 3GN2A 1JAYA 2TMGA 3ZWWA 3TZQA 4DXHA 3D1LA 4MIYA 4E32A 4FPXA 1I2BA 1U4OA 4GWKA 5DNAA 5KKAA 4BGEA 5I9NA 3WMXA 4I08A 2FPGA 1IUKA 3L9WA 4URFA 1I3LA 4IIUA 2YHUA 3D4OA 3PVZA 2J3IA 1N7GA 4DYDA 3DZJA 3KYCB 3MZ0A 2ZQYA 1DIGA 4Z0TA 2W2LA 4WOJA 4PLTA 4XJSA 1X1TA 4BKOA 5F1KA 1ZJYA 4BHTA 1VLLA 1ORRA 2I3AA 1K0UA 3FNFA 3GVCA 4HADA 1A9ZA 2R2GA 1LRKA 2G76A 2QRKA 1ZW1A 1GQ2A 4D3FA 1Y8RB 1Q1NA 1GZ6A 3HE3A 5A9RA 2O3UA 3PJDA 3PHLA 2HUNA 2RAFA 1AXEA 1YL6A 1E77A 1O94A 1B26A 1DHRA 4QFCA 3DBHB 4OHUA 3U9LA 2C5AA 1NR7A 2ZCVA 3O26A 4J49A 2EGGA 2GUGA 4NPCA 2PV7A 3UHAA 4YT8A 1MXFA 2PK3A 2Q1SA 5JSFA 4M86A 3OQ1A 4Z3KA 3OJLA 3VH3A 3WLEA 4GBJA 1TLTA 3COSA 4R5MA 1ZXBA 2ZK7A 3DZKA 4R51A 3STHA 5I8ZA 2J3KA 1DAOA 1VJ0A 4PLPA 1RM3A 3FF4A 2AEFA 2DM6A 2OOSA 4MIOA 3F6YA 1QSGA 4J3FA 1QV6A 3RUFA 5KJFA 1PJQA 2X58A 2A4KA 4E33A 2FR0A 4BMVA 2AG5A 1EDZA 4CQMB 3WSWA 2YJZA 2X4GA 4KOAA 4LCJA 4P4NA 4PZDA 4AJOA 1AGNA 1P77A 4CM3A 1C1XB 2NVUA 2PGLA 2HKIA 1A27A 2ILTA 4O1MA 1H94A 3RIHA 4PG5A 3JD0A 3H5RA 3UKOA 4MVJA 1EVIA 2JJYA 2C29D 1DRUA 4PLZA 1DLIA 4L75A 4RPHA 4J7UA 4D44A 3LT0A 4M49A 1KETA 2PZJA 4WUVA 2GGSA 4N5NA 3PJFA 5IJZA 4GVLA 1J49A 3GFGA 2QW8A 4FOOA 4RZIA 1GDHA 3NDJA 3NV9A 2OGUA 4L4SA 1FDSA 5DOZA 5CDUA 3ULKA 1RJWA 3HB4X 1UP4A 4W7IA 3PXXA 1V6AA 3QSGA 3UCXA 1D3AA 4ND4A 3JQAB 4K6CA 3L6DA 2Q1UA 3MJVA 4ILKA 4E2ZA 3GUYA 4PFJA 3E5RA 1H6CA 2FP4A 1FJHA 4RCVA 1M75A 5DF1A 5A05A 4I9NA 5TF4A 3BXXA 4BGVA 3DFZA 1B7GO 2CF5A 4Z6KA 5B1YA 3V2HA 5CPBA 3IKTA 1VKOA 2AQ8A 1GUZA 1B14A 3WBBA 3EZLA 4E2YA 4KUEA 4DTIA 1Q0LA 1I33A 1DFIA 1QYWA 2DQ4A 4BKUA 2X0JA 2FZWA 4YJFB 3AUSA 4OKIA 1YJ8A 4BNXA 1QP8A 3FD8A 3GHYA 4FW8A 4OH1A 3TZCA 3D3EA 3WG9A 1GU7A 3RC7A 1RM0A 3KEQA 4IGFA 5JDIA 2DTEA 4Q3AA 3HDJA 4PZCA 3WJAA 5K6AA 1TI7A 1GFSA 1U5CA 3Q2IA 4IMPA 4AJ2A 4J9VA 3MJ4A 3ITKA 3RUDA 1X7GA 5JCXA 5MGBA 2I76A 3NX4A 4D46A 1HE3A 3OA0A 4WE3A 1HZZA 1Z74A 3NEPX 4LCEA 1E7YA 4YQYA 3K2BA 2YQ4A 3EMKA 2AA3A 1I2ZA 1Y81A 3GDGA 2RCYA 4B3JA 4NU6A 3QVWA 3GVIA 4MKXA 1Y1PA 3UCFA 1A5ZA 3W1VA 4UUOA 4U0JA 2GO1A 2Y99A 3ZWBA 2VNSA 5DP2A 4DA9A 4FFLA 4DLBA 3WDSA 4DPMA 4I5GA 7MDHA 2NVBA 4TSKA 1UXJA 4R01A 1I10A 2WTBA 5HBRA 1MFPA 4L8VA 1WDKA 2VT2A 4ZRMA 2X0RA 3TPCA 4HNHA 3PYXA 4ID9A 1YOVB 4R9SA 5H82A 2XXJA 1PJCA 2BKAA 1BVUA 4B4VA 3AUTA 5A3VA 3RUHA 3S2FA 3DOJA 4GX1A 2GZ3A 3GVPA 1ADCA 3SJ7A 3C8MA 1V3TA 5A9TA 4QX6A 4U5QA 5T67A 4A73A 3WGQA 4J4HA 1UXGA 2AHRA 4LVCA 1EFLA 4XQCA 3X2FA 2YV3A 2IZZA 5BSGA 2B5VA 4YAGA 2YZ7A 2QYSA 4UREA 3GG9A 4BUCA 3VPXA 2FY8A 2VRCA 3WTCA 4ALJA 1NPDA 3GNQA 1FXSA 4GSLA 2VHWA 4U7WA 3P5SA 1NWHA 3OJOA 4Z9XA 2BGLA 2AE2A 5A9SA 3AU8A 1OMOA 3H7AA 2POQX 2Q46A 1DBVO 1HDXA 1Y8RA 2G17A 1NVGA 2V6FA 3H9UA 5JS6A 4S1VA 1P1FA 4BMNA 3OMLA 4ZGWA 2OZPA 3AU9A 1LSJA 2RIRA 3GNSA 3NGLA 3PDUA 3T4XA 1ZNQO 4II2A 3HSKA 2PFGA 5TNXA 3BYZA 5C5IA 3U09A 3QW2A 4YR9A 1CYDA 3AY6A 2NQ8A 4NJMB 5BNIA 4JBGA 5JYEA 3RUEA 1YJQA 1WW8A 4GSKA 3INTA 1FDUA 3PGXA 3MWDB 3IJRA 2JHFA 4BO7A 2ET6A 3AM4A 4RVGA 1YGYA 3PQDA 4OKNA 2P9EA 3L4BA 1CETA 4DIBA 2CNBA 5JNLA 2XPCA 1GYQA 3FR7A 2EGHA 5F1OA 3D5QA 3ZU3A 1ZUD1 2O48X 4IMRA 4J1TA 4WLVA 3SVTA 2ZB8A 1M66A 4BIIA 4CMCA 1EUZA 2PZLA 3LZ6A 1U3UA 3DC2A 3W8EA 4ND3A 3ADPA 2FSVA 4UVHA 2NADA 2H63A 1N7HA 4BO5A 3PPIA 4XB1A 5L9AA 3K73O 1HL3A 3PK0A 4GLLA 1YONA 2VYND 1Y6JA 4FN4A 4CUZA 2O7SA 2G0TA 2NVWA 4GMFA 1F06A 4AJ4A 1LI4A 5AQ1A 1NTOA 4NBWA 5GZ3A 3I4CA 1WZIA 1DPGA 4ZJUA 1SBYA 2FPPA 2P68A 1KBZA 3LK7A 1H9AA 1BXZA 1K3TA 4K1LA 4GGOA 4TQGA 2GASA 4R3WA 5LDGA 2D59A 1UUFA 4NBVA 3A9WA 4IZHA 1W8DA 2D0IA 5JDIC 4G5HA 2WD7B 1PZFA 2DUUA 1SOVA 5K6AC 1X15A 4IQGA 1OI7A 3UCEA 1KEPA 3WGTA 1OC2A 1ENOA 1BHSA 4CV1A 4TRNA 3DTTA 2HJSA 5I9LA 3R3JA 3DAGA 1TA4A 3AFMA 3DZGA 1R16A 3KYDB 4TKMA 1TXGA 2WE8A 1EDOA 1YH3A 3V8BA 3E9MA 5KOIA 3JQ7B 5LCXA 5JFOA 4WCFB 1HE5A 2CY0A 1GD1O 4UAGA 5DP1A 5A04A 2QQ5A 4L4XA 3RBZA 1LLCA 3O8QB 1OBFO 4XEHA 1GYRA 2Q2VA 5F1PA 4ALIA 4CM4A 1HETA 3IAHA 3GY0A 4DQUA 1O5IA 3WIDA 4Y6PA 3JQCA 3OIDA 1TT7A 1R6DA 4AJKA 3BMQA 4DQVA 4PN3A 4HFNA 3F9IA 2JCXA 1YDWA 2X5JO 4ZN6A 1YE3A 3GAZA 4BNUA 1EE9A 1IB6A 5JBIA 3RCBA 1HYGA 3RC1A 3UN1A 4AL4A 4IDAA 2GN6A 1GY8A 4JGBA 2C2XA 1RYDA 1ZO8A 1PGNA 2CMDA 4LRTB 5G0TA 3SX2A 1QYCA 1EBFA 1MB4A 1GZ3A 1HRDA 2O3QA 4D41A 3JQDA 3KSUA 4F3YA 3GLQA 1NAIA 1NVTA 3C7AA 4IJWA 5EQDA 2CVZA 4JBIA 1I24A 4R16A 5G0VA 3RBXA 6ADHA 5A5FA 3GFBA 3QWAA 5C7OO 3GH3A 3G79A 2ZTMA 3PQFA 3SXPA 4CMKA 1EMDA 3C7DB 5COQA 5IZCC 1I8TA 2Y1FA 3JYQA 4E5PA 2QHXA 3KTDA 2B5WA 4CLOB 2ZIZA 4R1NA 3RKRA 5G4KB 1BDBA 2QRLA 3Q9NA 4XR9A 4NJOA 1K2WA 1XIVA 5CDSA 3TFQA 2ZB4A 1T25A 1I3KA 3R0IA 1MA0A 5G0UA 3T7CA 3VH1A 4RF2A 1JDJA 2YV2A 1E92A 5TIIA 4NFYA 3IKVA 3P2YA 4ZQHA 2EP5A 1E6EA 1YO6A 4NNJA 1YL5A 3HG7A 4IDBA 4J91A 5GMOA 1RM4A 4OSPA 1ZMOA 3GEGA 4RVHA 2H6EA 3ZV4A 2VZ9A 1Q0HA 3E5MA 4R41A 3S8MA 5B12A 4NDNE 3DTYA 4YRAA 1XELA 3H6KA 3ONEA 1EUCA 4YAKA 1PL8A 3IQDB 1V9LA 1ISGA 3WS7A 5HS6A 3JD1A 3DBRA 1C14A 1NPYA 5CEEA 1HE4A 5B37A 3HB5X 4J1SA 4JJIA 2A35A 4FCCA 1B8PA 3PHIA 1SC6A 1DRWA 2XOXA 3I1JA 2Y66A 2LDXA 1M67A 3L6EA 1I32A 4HBGA 4KTVE 2DTDA 4YCAA 3EDMA 2ZB7A 2EJVA 3OH8A 4CM9D 2Q4EA 1DOHA 5JDCA 4UUPA 4WJZA 1EEHA 4FFOA 4GWGA 4W6ZA 3SJUA 3ZWCA 2OBNA 4JIGA 3U0BA 4MP3A 1BGVA 3WGYA 4BQRA 1C3VA 4D0SA 1L7EA 4J7CA 4TROA 1Z82A 4OXNA 4YDRA 2VUUA 1WDMA 4PVDA 1HSOA 4UVGA 3KO8A 1UDCA 1LDMA 5JAMA 3IUSA 4CR8A 2RH8A 4NJMA 2OMEA 5L4NA 2WWRA 4PG8A 2EKLA 2O50A 2NTVA 3WWYA 4FOSA 3ZU4A 2VOJA 1H6DA 4Z3DA 3MJTA 2Z95A 4GKVA 3A28A 4A10A 1GEGA 1KVUA 3M2TA 3WR5A 2HK8A 2CDAA 2VWQA 2D8AA 1XU9A 1HSZA 1KVRA 1PGQA 3BHMA 3ICCA 2Y1CA 3RU7A 5I7EA 4MO2A 1SPXA 1ZK3A 3WWZA 4ALNA 3Q6IA 4J2OA 2HU2A 3AI2A 5EL0A 2OP0A 2B4QA 2HCTA 4MDHA 1I2CA 1O89A 3IJPA 1E7RA 3GGOA 1BXGB 2EHDA 3JYNA 1CRWG 1I30A 5IN4A 5G0WA 3VVCA 4HV4A 3ZN2A 4BV9A 2C54A 4EI2A 5ENDA 9LDTA 4MVJG 2J5QA 3N74A 2BRUA 4PG7A 1E5LA 1YVEI 3E1KA 1XWFA 4O0LA 4WKGA 3W4IA 4E5NA 1PIWA 2VRBA 3PGJA 4I5DA 3JYLA 1ZEJA 2F00A 1LQTA 2NU9A 3ANNA 3DWFA 3DAFA 1M6HA 2EKPA 2X5OA 1OC4A 3EC7A 3JQGB 1XHLA 1NYTA 3BHJA 1KOLA 3G3EA 4CLRB 1P1IA 4R4JA 4CM5A 1VI2A 1C0KA 4MVJP 4WEQA 3OHSX 3QWIA 1O6ZA 2O3JA 4NR0A 4CPDA 3F3SA 3I3OA 4II3A 4UVEA 1ZEMA 2UUOA 2AMFA 2WD7A 1PEDA 1X7DA 4N5MA 1YXMA 3TZ6A 2AG8A 2PLAA 4CM6A 3CKYA 3I83A 1UR5A 3R3SA 5A03A 1LXCA 4XGNA 3VTZA 5DBGA 4JNKA 1I3NA 2B0JA 1DIHA 4BB6A 1E3LA 1XGKA 3JQ7A 2YDYA 1LA2A 3GN1A 4N5LA 3EZYA 3ROQA 1NNUA 2X23A 1NWCA 2GSDA 2X0NA 4JK3A 4WLNA 4DMMA 4BNGA 5JW6A 1KERA 4Z9FA 5L7YA 1N1EA 2H1SA 2PGDA 3B20A 3JCZA 3K9QO 4JCOA 5IDXA 4R3NA 3ONDA 3H4VA 1JKIA 1NXQA 1Y8QA 1YQDA 4NIMA 3EAGA 1NQTA 2FR8A 1P0FA 3ZNQA 1BVRA 5L7WA 4EYEA 5BSHA 2IE0A 1YBAA 3GRPA 3GUCA 3PFWO 2QZ9A 3TOXA 2JCVA 4G2NA 2J8ZA 1BXKA 1PR3A 2OORA 3OIGA 1Z7BA 3Q11A 4K26A 4RPLA 1HYHA 3K92A 4WNIA 4Y6RA 1GPJA 4OQYA 4RPJA 4CQLB 2YHIA 2I3GA 1MUUA 5JMWA 1ISMA 5IF3A 5IFLA 1HWYA 2E6UX 3DHYA 1ISIA 1MLDA 1HT0A 4B3IA 4CM1A 4U8GA 2PNFA 3PZBA 4RLSA 5LC1A 4ND2A 4IS3A 1LEHA 1SEVA 3G17A 2UYYA 3FNGA 4CLOA 4QT0A 1DO8A 4OIMA 1EQ2A 5I9MA 1UAGA 1I3MA 1QKIA 1JWAB 2WE7A 4IGEA 4DMLA 1W6UA 4KUHA 1KC3A 5DOVA 3RBVA 4EW6A 5KCZA 4RJTA 4NK4A 1T2EA 4DYVA 3K2EA 1XR3A 3S55A 1YQGA 4BS9A 4PCVA 3K96A 4M8SA 2E48A 3PI7A 1PZEA 4YACA 3K8ZA 4CMBA 4XJTA 3DFUA 4BNTA 3OQBA 4J1NA 4RVDA 2GYYA 1MG5A 4PZEA 1EVJA 4IPTA 1U3WA 2FOIA 1YB4A 1C1DB 1WZEA 3PQEA 5HM8A 2GCGA 2BH9A 2WYWA 4D42A 5KKCA 4H7PA 3W4KA 4EJMA 1T2FA 3A4VA 4CLXA 1HDRA 1PGJA 1LU9A 3CINA 3HNPA 4QO8A 4CL3A 1IZ0A 5C7LO 3INGA 1E3SA 1LSUA 3FPLA 5BT9A 2WMDA 3K5PA 5DCUA 3ZZNA 3F47A 1ISFA 1JLLA 4R1TA 5J23A 4UEKA 1WNTA 4QXMA 4B8ZA 5L40A 4BKPA 4JROA 4NI5A 2IEDA 4ALMA 4TVBA 1AXGA 1E5QA 3O03A 3ZWNA 3M1LA 5ENVA 1R12A 1U4SA 4XA8A 2PH5A 6LDHA 1XQ6A 3DZHA 3ADOA 1LQUA 1R0LA 4W9NC 1AE1A 1LDNA 2Q2WA 2FSSA 2DPGA 4RGBA 1W4ZA 1U8FO 4IIVA 1E3EA 1CERA 4JBHA 3NT5A 3P2OA 2VRCD 4INAA 5FEUA 3FWNA 5DT9A 4AVYA 2O4UX 4XCVA 1XSEA 2C59A 5DCWA 2B4TO 2Q49A 4GGPA 4Y98A 1R15A 1FMCA 2E37A 3E9NA 5JCJD 4KMSA 1CWUA 4DL9A 1BXGA 4MVJI 4GKBA 4AICA 2C5EA 1YWGO 1D8AA 5DZSA 1NQ5A 3MJCA 3O38A 4Z0PA 4RVUA 5TX7A 3QRWA 3FR8A 1ZIDA 3MEQA 1E1MA 4K9DA 1ULUA 3UOGA 3QP9A 3WOHA 5EIOA 3QWBA 3M1AA 1CQJA 1PJTA 2A9FA 3L4SO 1Z7EA 2WD8A 2BFMA 1G6KA 3HHPA 1Y9AA 2CD9A 3JQFA 2R00A 4RL6A 1F8FA 1D7OA 4J0FA 4IQ8A 4CLRA 1U1IA 3PHJA 1PQUA 3JYPA 4FC7A 4B7CA 2DFDA 3OBBA 5BSFA 1ZJZA 1U7TA 3TSCA 2Y0CA 4R69A 3V1TC 5L4LA 3WLFA 3ZH2A 4MVJH 8LDHA 1WDLA 3HWRA 3DB2A 4GH5A 3WQSB 3MTGA 2Z1MA 4Q39A 3WJ7A 3E18A 5L7TA 1N8KA 5G0SA 5CEJA 3RROA 5KVQA 1PTJA 1E6UA 3K31A 5MDHA 5GZ1A 4ZQFA 1XQ1A 3GDOA 1DLJA 2EIHA 2B37A 3ZNNA 1VE9A 3ITDA 3UW3A 5FI3A 3WICA 3TOZA 2P4QA 2ZKLA 1ENYA 4E5KA 4J7XA 4FFPA 5FI5A 1QORA 4HFRA 4BQPA 4PGFA 2ZCUA 4OXKA 4IDDA 2OXIA 4XWYA 4FJ2A 4MKZA 2X1HA 4U6QA 1GYPA 1P1KA 1UZMA 4I1IA 2QYTA 4IINA 4CV2A 1K6IA 4EJ6A 2C07A 1T26A 2Q1WA 3KUXA 2VYVA 4BO1A 1KY4A 3C3XA 1N9GB 2EKQA 5B4TA 1UH5A 4BO8A 1DC5A 3GEDA 3BMOA 3Q9UA 2HRZA 1S6YA 3U4DA 3LT2A 5EESA 5GZ6A 2G82A 3JQBA 1IULA 1UDAA 1ZSNA 3PIDA 1ONPA 2SCUA 1U7HA 4NMHA 3ZHXA 1MG0A 3OJFA 4ESOA 4JXKA 1BDMA 2GF2A 3FSRA 3BTUA 1LDEA 3FWZA 4YT5A 4Q3EA 5THQA 2JHGA 1R4MB 3OEWA 4CUJA 5I7SA 1AUPA 1MX3A 4LK3A 3OJ0A 4MVJM 3F4BA 4R5HA 2IODA 4WLFA 5AXBA 1JU9A 4KZPA 2DBQA 1NX6A 1NFFA 4PG4A 1PQPA 1HKUA 3H8VA 5AXDA 1B16A 4TRMA 1LUAA 2IDZA 2OHXA 4LGVA 5L95A 2D4AA 3WGOA 3H5AA 4XYEA 3ZDFA 2I5PO 3PZRA 2CZCA 3UH1A 5EMHA 2BGMA 1VC2A 3F5SA 4MJLA 3KYCA 2ZJ1A 3ETDA 3BAZA 2QX7A 2BFAA 3IL2A 4NH4A 3P7MA 4ONEA 4TKLA 1PWXA 1YS4A 4RVFA 2EP7A 2GZ2A 2DVMA 4O59O 3SC6A 4CMIB 4HY3A 2GN8A 5ER6A 1LRJA 5CDTA 1C1DA 5DBIA 3GG2A 1TVEA 2PZKA 4MKRA 5ILGA 1PR9A 4Y6SA 1ONNA 2GD1O 2VUSA 3BA1A 4J4TA 4JJFA 4HFMA 4J1QA 4ND1A 3MTJA 3KYBA 3DBHA 3FNEA 5L4SA 3D0OA 3ROKA 4Q9NA 1PSDA 4K6FA 1C0PA 4BO0A 3S2IA 2W2KB 4IM7A 4BNIA 2UDPA 4D45A 5HS4A 4LN1A 5ITVA 1AN9A 4DVJA 5F3RA 5JO9A 1NFQA 5TC4A 5KVSA 3TDKA 1K89A 4M87A 4XIYA 4Q3NA 2A92A 1ML3A 5T8KA 1L1FA 1AHHA 2D5AA 4C7KA 5T64A 3RD5A 1ID1A 2E82A 2DLDA 3EGOA 4CODB 4BNMA 5KJCA 2HSDA 5A1TA 4XB2A 4BO4A 3U5TA 4NZ9A 3CZRA 5U1PA 4CQMA 4EZBA 2FWMX 4D43A 3F4LA 3U4IA 1C1XA 5EN4A 3LLSA 4B8WA 1MV8A 1JAXA 3H3FA 3N58A 4S3MA 4RQUA 1T24A 1H6BA 2PD4A 2R00C 3QLJA 4XIJA 1JA9A 2UAGA 3K6JA 1DAPA 1T2AA 4IZIA 2Y68A 4QFDA 5T5QA 1KEWA 2C82A 3IMFA 3LT1A 4MP8A 2NSDA 3R1IA 3GA0A 2EG9A 2OO5A 1LDGA 4X54A 3RKUA 1DC3A 5EQFA 4B79A 1XYGA 3RUIA 4DC1A 4YXFA 2DBZA 3EHEA 1SB8A 2D1YA 4I5EA 4FDAA 2I9PA 3WTBA 3GZ4A 4WPGA 1T2CA 2VQ3A 4CMJA 3QA9A 4AG3A 3TQHA 3GPDG 5U4QA 4ZHSA 5HWSA 2HQ1A 3BMNB 4XD2A 4LVUA 3JQ9A 2EEZA 3L77A 2HMSA 4NK5A 3TN7A 1CF2O 2X86A 2WYVA 4RQTA 4A27A 1H93A 2HJRA 2CDCA 3JQAA 1F0YA 1LLDA 4DWVA 3ONFA 3C1OA 4BVAA 4C4OA 1Z73A 3CEAA 3QWHA 5COAA 2D3TA 4BB5A 7ADHA 4TWRA 4TRJA 3DAPA 1RKXA 1BWSA 5A4DA 1GQQA 5HA5A 2P2SA 2EXXA 2I66A 4FFMA 4A03A 4BNFA 1QYDA 5KIAA 3DZIA 1ZK2A 2HK7A 1YB1A 3DMTA 4PG6A 1R4NB 2FN7A 2AQHA 2JAHA 3U49A 4YJFA 5FWNA 2Q2QA 1IHXA 3CZMA 1VJTA 1ZKMA 4IJUA 4XGIA 4ZA2A 3DZFA 3D5TA 3NTRA 3I9KA 1O8CA 3ZWMA 2NNLD 4AJJA 2EF1A 4FBGA 2V6MA 2JD2A 1U9JA 3W6ZA 3LLVA 3DO5A 3OQ6A 5JAQA 1GR0A 1TB4A 4FQ8A 3ABIA 4B4UA 2QG4A 3JD4A 4GX0A 4BO9A 3HDYA 1JWBB 4HX5A 5IDWA 3FBGA 3H9JA 2G5CA 5F21A 4N18A 4EEZA 1VKNA 4AJEA 2GZ1A 3PDJA 3GT0A 3PHHA 4L73A 4XYLA 4XYGA 2EW8A 3AY3A 4BV8A 3W8FA 1P0CA 2CSUA 3VZQA 3AFNA 1HE2A 1EUDA 4JX8A 5FF9A 1PL7A 3ZV6A 1E7MA 3UF0A 1YOVA 1JKFA 1M6WA 1Y5RA 3CTMA 4N7RA 3RFXA 3F1LA 3A1NA 1R4MA 3ZWYA 2BI8A 1DC4A 2C20A 2NM0A 2TMDA 4NBTA 4XQEA 4PVCA 4FS3A 3QQPA 1KEVA 4E21A 1IYZA 2AQIA 1DHTA 3WQQA 3GHHA 5JYDA 5K0ZA 2B83A 2GN4A 4XX0A 4B7UA 5THKA 1E3JA 3LC1O 3NYWA 5JPIA 3E6AA 3RASA 3NDIA 4I9HA 2DTXA 3KLMX 1PS8A 1ZSYA 1KVQA 3EVTA 1WMBA 4GX5A 4RF4A 3U4HA 2BLLA 3ST7A 3MOGA 5CPFA 2J3HA 1GTMA 1PS0A 3H2SA 5F5LA 2FHSA 1N2SA 1H2HA 5L53A 3L4BC 3MWEB 2Y1GA 4Y9DA 1ZK0A 3PEFA 4R68A 4L9RA 4WASA 4MINA 1PU2A 4EJ0A 4P8RA 3S2GA 4DREA 3DOOA 4LISA 4DUPA 4OO3A 4ZRNA 3IIEA 1I0ZA 5AOVA 4YAJA 3X2EA 3ZW9A 3JD3A 5GY7A 3A14A 2UUPA 4DBVO 4OOEA 5FYDA 4YBZA 4RZHA 3PWSA 4HXYA 1O9BA 4WEOA 3AM5A 3DL2A 4EDFA 1ENZA 3ZU5A 4E2XA 1YQXA 4DC0A 1ZMTA 1JQBA 4I5FA 2O2YA 3PTZA 1N1GA 4CLHA 1P1HA 4FGSA 2QIOA 4JQCA 4CR6A 4Q3BA 4WNCA 1DXYA 4DPKA 4G81A 1K6JA 1Z75A 1DB3A 1XG5A 3GC6A 4UUMA 4A26A 2XF8A 5CEFA 2BMAA 4PIVA 4EUEA 2DU8A 2W2LD 3LDHA 3QVXA 5DCYA 4CMAA 3FNHA 3RQSA 4FGWA 4N54A 3D3WB 1C0LA 1GUFA 4YJGB 5ITWA 2E4AA 1BW9B 3SEFA 2ZJ0A 3E48A 3L6OO 2AW5A 1DFHA 1L7DA 2HMVA 2OP1A 2ZYGA 4OOFA 5KVVA 3KB6A 1HTBA 2PKQP 3C1TA 3PHGA 4GL4A 4YRDA 4P4LA 1G1AA 1T4DA 4RORA 4FR5A 4BGIA 3KV3O 3EW7A 3E8XA 1UXIA 2NU7A 5HTOA 3PP8A 4CR7A 1HF3A 1E3WB 5T6BA 1KEUA 2AQKA 2Q1TA 3AK4A 1LBEA 5KNLA 2V65A 2O4CA 4CMGA 3E03A 1A7AA 3GK3A 3QVOA 2BI7A 3TL2A 2JFFA 3WSVA 4B4WA 4IBOA 2WDZA 1N92A 1KIFA 3VPSA 2BELA 3AUAA 3DOCA 1UAYA 4HNGA 3W4JA 5DBFA 4OXYA 3ZWPA 4BNKA 3M6IA 4BNLA 4KUGA 2BGKA 1B8UA 1UZNA 2BHLA 1HDOA 2OUIA 4WLUA
chains in the Genus database with same CATH superfamily
5DTEA 3I8SA 1OROA 1REQA 3KZKA 2E49A 1QIKA 3RRJA 3ET4A 2Y3IA 3GNTA 4YJ3F 4MV7A 4TVOA 1CFJA 3SNKA 3V4VB 5I4KA 1IZZA 3T7KA 3WI7A 3UJ9A 5H3CA 5GJBA 3ND5A 2GBFA 3F7NA 1YJ5A 3BH6A 4WCFA 1KJJA 3K2QA 1M8FA 5AI6A 1DGQA 1Z4OA 3PT9A 4C43A 5KQSA 4BVLA 2V59A 1ISPA 1R0XA 3AL2A 4RA9A 1XCPA 2XOKA 3U80A 4KAJA 3VTFA 4TTAA 1XRQA 4FOPA 4QSHA 2IEIA 2O9JA 4HH1A 5EG5A 4MCHA 4GW3A 4YRMA 1XUOA 2PT9A 2WM2A 2L17A 3DP7A 1GZ4A 3HSYA 3SIPA 2VH2A 2PHZA 1L4HA 3SP1A 3VDQA 1ISHA 4CZ2A 4DVGA 1KARA 5F7JA 5JCPA 2NZYA 4MP6A 2PZFA 4MEAA 1RC1A 1Z34A 5EWLA 3RARA 1SRRA 4PLYA 2VOEA 3RFTA 4B87A 1ETUA 1QFSA 3U9TA 5DIFA 3ZCXA 1CSEE 1T2NA 3E3NA 3Q5DA 4WDQA 1A2OA 2YFQA 2YH2A 3EZFA 2HQRA 4M9UA 5LKRA 1NF3A 3UGKA 2ESRA 4FOLA 4KMRA 4MA4A 2W98A 2PQ2A 1R4ZA 4GPIB 1L5FA 2BFOA 3MQ2A 5CFLA 3MCWA 3Q3VA 2BZGA 2QLBA 3ZQJA 1YNOA 2JH3A 3A6DA 5AUPB 2IW1A 4J9UE 4ARUA 5I6DA 5LBUA 2WT4A 5EFOA 4OJNA 1HBJA 4QGSA 5KWIA 3DOIA 1XAHA 2IP4A 3NP7A 4LRYA 3IUPA 2AEMA 3P0IA 3X3HA 4FFVA 2ZITA 3KB8A 4HTFB 2C0PA 2RMKA 3IS3A 1ZGAA 5DLPA 2UV8A 4HVTA 5DULA 4K81B 4JX9A 3UT0A 3TVTA 3HPQA 1DI0A 4H3VA 1S3SA 3DT9A 1GL9B 3E4CA 3OU6A 3QVJA 3TQTA 5JXWA 3T4EA 3BXGA 4NJEB 3B6ZA 3I73A 3OIFA 4LFAB 2H29A 3V7NA 2NXCA 1P33A 1Z0AA 3LAWA 1GZUA 2SBTA 3DP9A 3HV2A 1NBOA 3MN1A 4EX6A 4MV4A 3DEYX 1R37A 3R9WA 2HDWA 3T34A 1VHQA 2OSVA 4EG1A 4OU5A 4F72A 3G9ZA 2RFLA 2QJRA 3O7MA 3JQ8B 1YZFA 1IXKA 1GDTA 3DR3A 1L0BA 3IFSA 4AJIA 4L78A 5LDDC 3PG5A 3PEWA 5F51A 5SY4A 3V8NA 1U3CA 4Q4JA 2YV1A 2ZE5A 3DPUA 3M33A 4KJXA 4ZD6A 2ZTSA 3RFUA 5IJ9B 2HXYA 1LQ2A 5ALHA 5C18A 1MB2A 2BUBA 1GTG1 1DT5A 4MI3A 4TVKA 2VZ8A 4YP9A 2KSQA 2ZSIA 1QF7A 3DCJA 1NVMB 1AT1A 3FDZB 3CLUC 4RENA 4CTJA 3Q8XB 2PO7A 4Y8VA 3EW9A 5AXAA 1XFDA 4WIAA 5FJJA 3HDHA 1B15A 2BAGA 3IO5A 2Y1KA 1D4FA 1MC5A 5AKXA 4ZQBA 1P0QA 2BEVA 4LZAA 4CKBA 2O8FB 3B3GA 2BKVA 4KXLA 4NDAA 3FYTA 4QUJA 5IASA 2CLCX 2GNAA 2Q4BA 1A50B 4JOQA 4CKYA 2JCYA 2YXEA 3RJZA 3OY2A 1LVHA 2IYQA 5AM2A 3ZCVA 1Z35A 3MTBA 1T0UA 3STTA 6REQB 1V1RA 1YHYA 5COBA 1PV2A 3EWAA 3TNLA 3I9NA 4YI5A 2GDZA 1NN3A 2GQ0A 3BSWA 3PWKA 1XZAA 1X7WA 2AKEA 4Q15A 1AKUA 1EFVA 4NAVA 2UXBB 1LWNA 4RELA 2JZOA 3RUCA 2G7ZA 2XXBA 1PX0A 3HUDA 4H4DA 2X9QA 4WLEA 1B1AA 3SOPA 3T3GA 3LO5A 4IW3B 3TR0A 3WGGA 4WN9A 1LK5A 4AY3A 4CV0A 2GK4A 2D7DA 1KXJA 5A6SB 3DDZX 1XYVA 2QRMA 3VZDA 4NC9A 4MQEA 2DAPA 2QY6A 4H0NA 3SM9A 1PJLA 1J24A 4LJ5A 1KMMA 4M6WA 1Z2DA 5TR9A 4D9GA 2E5FA 4PQEA 2X1MA 4MQFB 2ZBUA 1FE8A 3OETA 1Q6YA 3D64A 2WSBA 3OC0A 2IZ0A 3WP0A 3UIEA 1OYOA 3L8HA 1LJ8A 3I23A 1RRPA 1ZGBA 4YRCA 2ZYAA 3E9DA 1BKYA 1MEJA 4IF4A 4B7CA 4CMEA 5KREA 4PLVA 5BQFA 1G7SA 4FNOA 2XD9A 2ALJA 2B4YA 1ZVMA 3GCWA 3SKVA 5IM4A 3BHNA 4FDUA 4X1IB 1B6TA 3F9RA 1ONOA 3GFPA 1O0SA 3E3MA 4DEVA 1GM5A 4JLVA 1K8ZB 4ALLA 2C3YA 2OCLA 4ZGGA 3FTFA 5EIHA 1XRRA 4K28A 3UV6A 3AZOA 1G98A 1XDSA 1T43A 1XZPA 2HHJA 4PONA 2GBPA 4MAAA 3TTYA 1GO2A 4RY2A 1CXZA 2QL7A 4PRZA 4DIDA 4BP9A 4DR5B 3JAWB 1NVVQ 4GAEA 3EVNA 4OYLA 1P1RA 5BNZA 1KSGA 2AVDA 1Y5IA 1CQPA 4F06A 2HHAA 1LSOA 2QTBA 4GLFA 3NR2A 4LWOA 3V7FA 5JZOA 1CNEA 5DX1A 4PANA 3ONWA 4IWYA 4ZT2A 4YRPA 4TTQA 2UZ4A 1W88B 3KSZO 1XV5A 3UQZA 5ALOA 1NT2A 1T1SA 1HEUA 1ZITA 4RHXA 3UMSA 1K7EB 2VT7A 2G9NA 3MIIA 1EEXB 2PUEA 4E15A 1H1LA 4CQMD 4AG5A 3KQYA 3GBPA 4ASUA 5ICMA 1DKOA 1JHXA 3I8OA 5AM1A 1GSOA 1WAMA 5WRFA 3NEJA 4NNOA 3MIZA 3ESXA 3OECA 1MC4A 5KSYA 2FMTA 2CF6A 1TC1A 2I6FA 3BH0A 4Y6LA 4NLLA 5GM1A 2C7RA 3LUKA 1S8NA 3WQRA 3QVGB 5B55A 4A82A 2HPZA 1J6UA 1CZLA 1L4YA 221PA 2BTOA 2RGYA 4PPFA 2GRAA 3GMDA 5TGTA 1SCQA 4W82A 4OHRA 4E3ZA 5CDGA 4BECA 3IIIA 3LXMA 5C81A 1Q0TA 4RD3A 1E1RD 2OKGA 1HDYA 2WTMA 4KLCA 4XZ3A 3U62A 3UMRA 4IQ0A 3TW8B 1CUGA 3BAFA 1EWYA 4TPKA 1XT6A 5ES3A 5K01A 3WGZA 3SLKA 3RJ9A 4CM4B 1CLEA 3OZVA 4DBZA 4TZTA 3NHRA 3AOEC 1PNOA 3K4PA 2N3ZA 3DLCA 1IN6A 1EJ2A 1Z6ZA 2P2CA 2PUVA 4MWTA 4Y6OA 2IS4A 4RF3A 1C7EA 3QX7A 4RZSA 2IL1A 3BMQB 3OO0A 3UWOA 1CQXA 2E2WA 4M36A 4JB8A 2W6ZA 2JEOA 4V1CI 1VLMA 4DNQA 1SB9A 5ALYA 5IAEA 1JA1A 1MTZA 1RC0A 3P9IA 1XTUA 4DLAA 4PPGA 4C5BA 5JH7B 1J70A 2OD9A 2ZIUB 3R4CA 1RMYA 2JKVA 4I8IA 4H77A 4UUNA 1DRVA 3P32A 2W93A 2Z56A 1SVOA 3A3OA 3HMQA 1NR5A 1VKJA 2R8XA 4LRXA 3ODPA 2PZGA 1KU6A 3FHLA 5AT1A 4BNNA 3TX2A 1KO7A 3N8DA 5BSVA 4YYZA 4JEHA 2WTAA 1PDVA 3RREA 4EEXA 1N3YA 2FPOA 2C5GA 1D1QA 4PFQA 3L0OA 5EP2A 1JR3E 2H9IA 4NPAA 5AM5A 3E23A 4GPD1 3VPBA 3B3FA 3WL3A 3FCEA 3AI7A 3FW1A 4RJJA 2IYPA 2GEUA 1U2EA 3JTMA 3ZVRA 3TVYA 4DJFC 4J75A 5DWDA 4EQZA 2C57A 2NWQA 2ZYVX 4Y0VA 4B40A 3T1NA 4NOJA 4LNAA 3KRTA 4RE6A 1PJ3A 5AWFC 2FR1A 3T0GA 4AZWA 5EGSA 5KMGA 4P83A 5KCMA 3M5WA 4LY6A 3RT7A 1XL1A 3CB4A 4G5FA 2JAQA 3I42A 5E95A 1RQGA 1H9BA 2A9QA 4JFAA 3CX3A 5HSGA 3WSTA 5TJ9A 4KP7A 2NUTB 4RZ3A 4W4TA 3PUWA 5D7BA 1EK5A 1PT7A 1RQPA 1HOXA 1PJ8A 2I6TA 3HXTA 4QUKA 5FTWA 4U2KA 3GGGA 1RQXA 3JZAA 1SHZA 4NBSA 5ILOA 1XO1A 2EWVA 3QIVA 4IFTA 1W73A 3OTQA 1AF7A 1EUQA 2PT5A 3NHYA 2EC5A 3C7TA 4WESA 3KT8A 2XODA 4DBLC 1OZAA 1S2NA 1QHSA 1VP9A 4JLUA 5EHIA 2ODQA 5IDQA 1X77A 3RYCB 2XKKA 2R7LA 2CUKA 4LGCA 3V5NA 3WWCA 4JC8A 1G4HA 2AN5A 2VZLA 4JHLA 4W8GA 4WBSA 1EUCB 5HE9A 3VM6A 1TA0A 2Q41A 2W4QA 5C7IO 1VECA 3GU3A 1TQ8A 1YRLA 2D2IA 2R1TA 4PZZA 1EXDA 3UPDA 3UXYA 4KTTE 3L7CA 1V3QE 4N01A 1MX9A 4PXSA 2EV9A 1M1YB 4R40A 2I2CA 1PL6A 2XITA 3SBOA 1Q0ZA 3D8HA 4YO7A 1J99A 2F48A 1ZZEA 2QAGB 3ZIUA 3OPVA 3FUVA 4NVRA 3T95A 2O06A 3LT5A 2YQZA 2ST1A 1RQ2A 2PIAA 5HYVA 4Q9KA 1MNQA 3AKCA 4WERA 1YZLA 5DHFA 5TT0A 5B30A 4JVNA 1CYEA 2H5JA 1P73A 4QQRA 3SG0A 3R6DA 2ZTVA 4Y0NA 1OJLA 5I7FA 2JGDA 3MHTA 4GX2A 2XSZA 4AWXA 1NT4A 3ECAA 3LX8A 4Z51A 4RTQA 2II6A 3RHSA 5KWSA 1GJRA 2C3PA 3KVOA 3I6IA 2LIPA 1XZIA 5G3YA 3MCTA 2FMXA 4QNMA 3IDQA 4TS9A 5HXAA 5JC1A 4LJ9A 2B35A 1R8XA 3GMSA 3SD7A 4KSCA 2IIPA 3P9ZA 4DCCA 3SQWA 2I2DA 1CF9A 2FMUA 1F17A 1MQAA 2I4OA 1W5SA 2J30A 2NPOA 2XKBA 4NMLA 5TPZA 4C2BA 2ZG6A 4N41A 1B0ZA 3DKIA 4D4GA 3FJYA 1Y89A 2EJWA 3KZVA 4GEKA 1PWZA 4J16C 2XUGA 3AF1A 4NE9A 4X20A 3WKAA 4HNTA 3I8XA 4UVIA 2ODBA 3OLXA 4Z4QA 4I0WB 2DPMA 3N76A 3U3JA 5BSEA 2I2AA 3NEAA 3D6FA 5FPHA 3I0MA 4ZOLB 2B36A 2E7ZA 4C7OA 3E2PA 3QUCA 1SCJA 4AKSA 2CNNA 3BD9A 4G0YA 1M1YE 5DHQA 4AY4A 4MB6A 1P7WA 4CNQA 1CEYA 2J07A 3D0QA 4Y2VA 3LQFA 2XYQA 3AEUB 1ZD3A 1Y9ZA 1GDDA 1I6LA 3VC1A 3IPLA 3W3AD 1SZJG 2NOAA 3GZNA 1KVSA 3PEEA 1FDWA 4RZUA 4CL2A 2A3NA 3FYUC 2YRXA 1A9TA 3PKIA 5LXTF 1KI7A 2CFRA 1LPNA 1PYDA 3RSZA 4B2LA 1LH0A 4NE7A 4YJ3B 3AUUA 2FE1A 1WV1A 3OZCA 1VRWA 4ZQCB 4X95A 3SVZA 1IOVA 1EK1A 2BFCB 4GM4A 1I4OA 4YIHA 3A1WA 1W30A 1VIMA 1KE2A 4DMKA 1S89A 3KKQA 2J3EA 3IOCA 5EP4A 5IAJA 2XB9A 2JLSA 2A1UA 3V2GA 2OFXA 3GRYA 3TPFA 2AOXA 3QBJA 5TGDA 4UFPA 1HQDA 2AK2A 3A70A 2BOVA 1ODLA 1ZNWA 5CTJA 3RS7A 1KOGA 4UNNA 1Q3HA 4P84A 1R8JA 3T7EA 4R1LA 3DM5A 3VZRA 1YS9A 4H31A 4KQWA 1UK9A 1EVZA 3M4ZA 5TV2A 1PYGA 5H68A 3NNSA 5HQJA 3G1WA 3O1LA 3PFFA 2JFGA 1HXHA 4BVGA 1C29B 3JAKB 4HLUC 2ZW9A 4PLHA 1E61A 1VLJA 1DP4A 2WTXA 1GCUA 3R7WA 2PYDA 4ZZ1A 1MAVA 3LY9A 1UJ4A 4P7JA 2VH5R 3Q1KA 2OB2A 5K2OA 3LGAA 1SCUB 1C9JA 5B1IA 3EC2A 3LXXA 5BUSA 3ESCA 1OLSA 3BWVA 1QZZA 1J2EA 1GFWA 1KPHA 4J6FA 3VV2A 4GFDA 3FTPA 3Q40A 1S2IA 3SY8A 3EIOA 2W90A 4L76A 2QBYB 3O95A 5EHNA 2WOJA 3QKRA 1K92A 2H5EA 3IAAA 4M1MA 2R6CA 1P75A 1U3VA 1S8OA 4QTXA 4AX8A 1FMJA 1NVBA 1EM6A 4QLOA 3EQ9A 3WYCA 3VU9A 1ESCA 2IHUA 1MT3A 2Y1DA 2XHZA 3NUZA 4U7GA 2ZS9A 1UZLA 3E9QA 3EWSA 1FUIA 2B1QA 2LTAA 2W6CX 5ICSA 4RNCA 4LPKA 5HFAA 3TRKA 3JYHA 2CVOA 4FXOA 4WY2A 3G0HA 3NUQA 4R81A 2ONJA 4EITA 2X0EA 1BQEA 1W2GA 3DB1A 3IHLA 2W6QA 1N9GA 5JLJA 4O4HA 4O4JF 2EKDA 4LSZA 1SO8A 5ALMA 2PGJA 3VOTA 4Z9BA 2G9ZA 2WIFA 5BOSA 3QX8A 3LU1A 5FX2A 4O02B 1T5HX 3CVJA 1Z5PA 2VCYA 3AUKA 4JLJA 4RV9A 2QT9A 1PSWA 1JG4A 3BSSA 4I5IA 3G6WA 4UTXA 1NVUQ 5MHTA 5AM3A 1XTPA 2LCIA 1JPNA 5JNSA 4MW9A 3B89A 4UM8B 2R6R1 4JEMA 4DLSA 3G5TA 1ZI6A 4ZHQF 3M70A 4AZTA 1UEXC 3NAGA 3AKEA 4LXIA 1BDJA 4PXAA 1T0HB 1XZQA 2YUTA 3A26A 2QK4A 3BE5A 5KNCH 2EIXA 3IEVA 4F46A 1FBNA 4M21A 4MEBA 3SHVA 4QBIA 1OTHA 1XEAA 4W99A 3VFDA 3ZHYA 2JBAA 1N3LA 4TVSA 1Y1RA 5LLTA 3FFTA 3VAZA 1XYYA 3QVMA 4UAVA 5CFNA 2DH6A 4X65B 4DV6B 1QGAA 1A5TA 1B3RA 2Y8EA 1E99A 3GJQA 4HAVA 1FFHA 3NIGB 4DY6A 5I7RA 1A72A 4I3GA 4E7PA 3X1KA 4ZTBA 5LMNB 4LI0A 3RLFA 1NUQA 4XDYA 2Y0BA 2A1TR 3ETGA 3G2MA 1U8UA 5IU6A 2Z4TA 3FCSB 2E9SA 2Q3FA 3CXRA 2VWPA 5AOBA 1JEQA 2RGBA 2P90A 3FJOA 3UTCA 1NC1A 2CV2A 3BZUA 1KK0A 5A3JA 1U0LA 4X71A 3G6KA 5KTYA 4EG8A 2XMZA 3MLEA 4L15A 1WMDA 2AVNA 2COKA 4HLDA 3WIBA 1ITZA 1QH8B 4G37A 4CMIA 3WBKA 1XRJA 1J97A 1F8XA 2QORA 2GN9A 3C4VA 1G0OA 3IKMB 4YWHA 4YCBA 4DDWA 8GPBA 4YDQA 1XDWA 3NM4A 5HIJA 3NJ8A 5G40A 4NYMR 2P8SA 4G65A 1NJ8A 3I9JA 3E82A 3NDRA 3U13A 1Z2OX 3QUQA 4R2KA 4G0VA 4I4CA 4LE1A 4KN9S 2RHBA 2VTDA 2ZSJA 5B4VA 1P72A 3RTGA 3SR0A 2Q3EA 3SR4A 2VYNA 4HGPA 3HFJA 1PW7A 5KOHA 4IKOA 1QCZA 2L42A 4WZ6A 5BUZA 2A94A 4W1SA 4AS1A 1FNCA 2HY7A 4MVCA 2PZMA 5IJ0B 2H1VA 2FYTA 4RXMA 2PKQO 3NEYA 3DXXA 1E6WA 1K6XA 1Z5UA 2W6IA 3V97A 1O95A 1N9KA 4LUCA 4NMWA 1Z0IA 4QUEA 2E85A 1TLFA 5JMPA 1MH1A 1XTIA 1OT5A 2IIQA 4AFNA 3HFGA 4D81A 4L4RA 4BEWA 4YUAA 1RRGA 2WEKA 2VLIA 3I1FA 4EMTA 4PM4A 5JEEA 2A5YB 1P5ZB 4YMSA 3OEYA 4E4YA 1UBUS 1D04A 2E4UA 3OZXA 1J21A 3JQ9C 4TWAA 1ADYA 3OE1A 4Q02A 5CVCA 1A4IA 5D3MA 5K99A 1Q7CA 3DLHA 3OEEA 4RULA 5D86A 2A14A 3AF0A 3SC2A 1NW4A 4F45A 1WZUA 2ZI9A 2JFVA 3F98A 1VBKA 2ZDQA 2X6QA 4ZAVA 4AU1A 1P2TA 3LO8A 4MIKA 1D9XA 3BJEA 3Q3CA 4EIWA 3UMBA 4P5PA 4RA6B 1MO5A 3KP1A 2CYAA 4H1VA 1NRXA 4H15A 1SURA 4ZI5A 2O0HA 2ZTUA 3MTDA 3OA2A 5J5AA 1YI8A 4AMBA 2F8TA 4G9GA 3BWCA 1KZ1A 3KT3A 2D1TA 4HEA6 3L40A 2F3QA 4KI7A 3FPEA 4G0PA 4EARA 5JE8A 3SE0A 3WZ2A 3IP8A 2EFHB 1RPAA 4P7FA 2YW9A 3CR7A 3QA3E 2MSEB 4NCBA 1COWA 1HE8B 1LX6A 1U2DA 1ULAA 1USGA 4QBKA 4WK4B 3SYRA 3ISTA 1EWQA 4XYBA 4G56A 1C9DB 5KTKA 3ZY5A 5L8VA 1MOPA 2OYCA 4W9NA 1SVSA 4LBZA 5C5EA 1QNFA 2A33A 3FUWA 4NFHA 5E3IA 5T57A 5AJHA 2IYZA 5CG1A 3AKDA 2IHTA 1KH2A 3H5IA 1JIQA 3EZ9A 4RIFA 2NQ2C 2XUZA 4EG5A 4NQZA 2JCSA 5A4JA 3QITA 1UOEA 1II0A 2AZDA 5CJ2A 1XVIA 4RDHA 2C3OA 1U02A 5DLDA 1JR6A 4FS8A 5K3FA 3GEPA 2FZEA 2FW0A 4GT1A 2Z8XA 4XRRA 3FOEC 5FWDA 1YHZA 5CCXA 4RFSB 3FI9A 4W5WA 5F4BA 5J2TF 3UKJA 1DWOA 1DJMA 4NBNA 1BXRA 4E22A 2HA3A 1CCWA 4DLUA 5LP6A 3ERCA 5EE0A 4A2PA 2Q99A 1LSSA 1WUJS 2QQFA 1QG6A 3T3NA 3GYGA 2FUNB 3LECA 4REOA 1H2AS 3QHAA 1QH9A 5ALWA 2Q3BA 1SPBS 4BGUA 4G5QA 2GLXA 3AR8A 3LQ4A 4KPUA 5EINA 4MYUA 3T5AA 1O77A 1XF9A 1WB6A 2IPOA 5IFKA 2VWGA 4FHDA 3OBIA 2D54A 4ITUA 3Q0EA 1V95A 1X92A 1N5JA 1EJBA 2MWMA 2EKZA 3EFBA 4INOA 4LRUA 4YJDA 4D9KA 821PA 5K0EA 4H7EA 1WO8A 3OFSA 2PANA 2WIDA 3DBVO 4L0CA 2GEVA 4J90A 1NVFA 3KLNA 4Z99A 5DFAA 3X1MA 1H3FA 3O7WA 2OYRA 1SEPA 3Q72A 5DH9A 2ZUVA 4G0QA 4PHHA 1XBTA 3TZKA 3ZU2A 4CM8A 1UDWA 1P7ZA 3PLNA 1A98A 1HQYE 4D92A 4B6GA 1P2UA 1R6UA 2PH3A 4QUBA 1EX7A 3ONNA 1SNYA 5CP8A 3CLTC 1HDGO 4YBRA 2NSHA 2GZHA 1T36A 4YRIA 5ICFA 4R9UC 1OAAA 5TF0A 4LJLA 2NT4A 4TYYA 2QRUA 3Q7EA 3WB0A 1DKMA 2AIRA 1GT91 1SXPA 3BVPA 3NLLA 4KO1S 4BL5A 1ZW6A 2HMUA 3GRKA 4CKCB 5KX5F 3L1HA 5BWBA 1TM5E 4NBRA 2A5FA 3WZLA 4FGJA 3OOWA 2I7VA 4ASUD 3CUUA 2BFWA 2NVOA 3A4IA 4A2WA 2XQGA 2GAOA 3KJEA 3LUHA 4KQGA 3LDFA 4NFSA 1R0KA 3A4MA 3AWDA 3QXCA 1PO7A 5DM0A 3TINA 5A2GA 3HEAA 4HSGA 1W36D 1XAJA 2VQFB 4GC9A 3WYEA 3C3MA 1F2UA 3GRAA 2A59A 4J0IA 1CQIA 1YSCA 3EQZA 3LYLA 5EZYB 1WKVA 1OUMA 4KB5A 5KTNA 1A5BB 2JARA 3SHQA 5FO0A 4O4LA 1J00A 4HHEA 2PV0A 2A6PA 3HVHA 4I1OA 4JJ4A 2XYPA 3E5HA 3EIQA 3V4LA 2NTJA 3I5MA 4Q7KA 1T0IA 1S1CA 1XF1A 4PC7A 4S1OA 3AY0A 4OCZA 3PC6A 2X76A 1RYMA 5AJXA 3RFVA 2H0RA 5DGDA 3VR3D 1NRIA 1JJIA 2Z83A 1ZFNA 1AM4D 5DX8A 3PXUA 4P4GA 1V3VA 2RHRA 1DKUA 1JHVA 2R4TA 3AIMA 2UVPB 1LJLA 3HRKA 2EJUA 4FQ7A 1T3TA 3ZWWA 4DXHA 4EJSA 4E32A 5KKAA 1FEZA 1I2BA 2R62A 1JUDA 3KEMA 5JRZA 4FHEA 2D1QA 3WMXA 1UBOS 1PV4A 3L0PA 4LHSA 4FYXA 5TDHA 3D4OA 4Y1RB 3PVZA 3IAEA 2UKDA 1PT9A 2AUTA 2JATA 1IDN1 4LRWA 2ZQYA 1DIGA 4Z0TA 2PZEA 3RVKA 2CFIA 4YYEA 4LF7B 1ULHA 4C29A 1ZPDA 2BFBA 4HAIA 4TYMA 3QUTA 2M1XA 3AR4A 1HFWA 4GECA 5F1KA 4X45A 4TKVB 2H1FA 3NTVA 4HADA 4OATA 5F9FA 1AZTA 1IWBB 1LRKA 2A9JA 3LW8A 4H17A 5FP0A 1YVPA 2QRKA 3D0RA 3NHLA 3RRZA 1E8MA 4RH0A 2AJTA 1GZ6A 3UPTA 1H4TA 1J1ZA 2RCNA 2V96A 5FTLA 2VTKA 2PWAA 3PHLA 2HUNA 3Q6MA 2YWBA 4GBMA 2KX7A 1AXEA 3NBZC 4M1KA 4DNFA 1E77A 1B26A 1DHRA 4QFCA 2XADA 4CG3A 3CVWA 4UEWA 1NR7A 2ZCVA 3C8HA 2HJ9A 5BSTA 3HRHA 1WR8A 2Q5QA 2JLXA 5KHOC 3QNMA 1MJHA 3D7RA 4PIPA 3UHAA 4BMDA 1J25A 4YT8A 5C46F 2E4WA 2G80A 4M7OA 3U61B 1RKUA 2C7BA 4XAQA 3T5TA 2Q1SA 3RAPR 1CLUA 5JSFA 4M86A 3OQ1A 2C9BA 4OI1A 4Z3KA 4G4GA 3VH3A 4HDRB 2R6GA 2YIJA 3HBNA 1CIPA 2Q7OE 3DZKA 2ID7A 5GWXA 5I8ZA 2J3KA 2OWDA 2EJTA 2P11A 1UDXA 1DAOA 3WWDA 1RM3A 4YHBA 2TRSB 4YC7A 4Q19A 2A1TS 1W7AA 2JJ8A 1KH3A 3C45A 2R47A 1LK7A 3K35A 1R0RE 3MGGA 3C41J 3UUEA 2VK2A 2IGTA 5LXTB 1ZNXA 4U4AA 4BN4A 4Q4LA 4OQMA 3T1OA 1QRSA 5KTTA 3QI2A 4WZBB 2FPXA 4AS3A 2JDID 1G5PA 2VVTA 1PF7E 1QFYA 4KQ1A 1FTGA 3JARB 1P77A 4G0ZA 1BMQA 1YIDA 3CVVA 2NVUA 1KWGA 2PS0A 4HEHA 2KM1A 5KTRA 1UZAA 3GFQA 4AMYA 1H66A 4DGQA 1FVFA 1JEEA 4E94A 3QH4A 1H94A 5DBOA 2PM8A 2BGNA 1G4AE 4PG5A 4C0HA 1IEWA 1U0NA 2QNIA 2YJGA 1SUBA 4MVJA 4EVSA 2JJYA 2DP4E 2HQOA 2WHPA 2C29D 2NP6A 1JFVA 2OZLB 3TUIC 5JYBA 1DLIA 1QGUB 4BX3A 3A05A 1RXUA 3A8TA 4PYMA 4P4SA 4D44A 3E0XA 1YMVA 1U9IA 5AHWA 5B1HA 2GILA 4UM9D 3KSMA 1X80A 1ST3A 3KHTA 4N5NA 3PJFA 3WDKA 3WY9A 3PICA 1J49A 3IPCA 2NSLA 3AERA 4KXUA 3K5HA 4FOOA 2XSZD 5ARDA 1O58A 1Q84A 1KAHA 1V1MA 4J76A 1K88A 2AG0A 1YZHA 1II8A 2HRRA 3BIJA 3ULKA 3KR0A 1OD6A 2HRCA 5E7QA 3EF1A 1EFTA 3HEMA 3PIRA 3HB4X 4KJZA 1UP4A 5K51A 4X66B 1I0LA 1G9SA 2FW7A 3QSGA 1MRSA 3UCXA 1JNXX 4ND4A 5TPZD 4RKQA 4K6CA 4UDNA 4K2AA 3U31A 2F7SA 1WSAA 3NC4A 1RXEA 4C3VA 4A5SA 3HKBA 1QGDA 1VL2A 2P9JA 3DFZA 4L8WB 2CF5A 1X7ZA 5B1YA 1GLNA 5JAHA 3DYIA 1A7UA 2YN0A 3EWNA 2QP4A 3CRQA 1U0BB 1XZEA 1U2GC 1D7AA 3KKNA 2O8CB 2RGDA 4JLBA 4Q7EA 3UK0A 1JQJC 1S2LA 2DUNA 3K8QA 5JROA 4TTIA 1I1HA 1GR1A 5CX1A 1B8NA 2J3QA 2JI8A 3B51X 1EVQA 4IGIA 1RSZA 1YC5A 3MRSA 1IZYA 1GPNA 4K03A 5EI5A 1KEEA 4TT3A 4BKUA 3F5FA 2X0JA 4IJ6A 4YJFB 3AUSA 4MPTA 1FQJA 4OKIA 4BNXA 2ZBRA 3WLHA 3H0EA 3D3EA 5AK3A 3TH5A 5F9MA 3C3YA 2J4CA 1NDQA 3RC7A 3KQKA 1WY5A 1T9ZA 3G5UA 2OBBA 4I7EA 3ACBA 3STYA 4N3NA 4ZHQB 3WK9A 2NZJA 4IMPA 1EWRA 1I6MA 4DFDA 5MGBA 1YS2X 2I76A 3M3DA 2PUFA 1JH8A 4ZOAA 2PWYA 3LCRA 2PXCA 2FUEA 4G8DA 1XDUA 4WE3A 2JIQA 1HZZA 2NX2A 2QUIA 3ZJ4A 1NURA 2FQWA 4LCEA 2DR3A 1KDVA 3ZVKA 3CR3C 1Y81A 1WPGA 3F8WA 3VYWA 5CCEA 4B3JA 4QDJA 5C8XA 1Y8AA 3P9KA 4HTFA 5FPYA 2VJCA 3GVIA 1GRNA 1Y1PA 2ZUSA 1SVKA 4OB7A 3W1VA 1TGVA 5FBVB 5D5QA 1UZUA 3MRTA 4DLBA 3AX6A 4FFLA 3ZQ6A 4YMIA 2O20A 1RQNA 4AWAA 4I5GA 1YKGA 4YDSA 1PQYA 4NJEA 4YJKA 7MDHA 1PR0A 3IOMA 1I10A 3VDNB 3W5BA 1WDKA 4BZPA 4JITA 3M6XA 2I2FA 3IXLA 3HU2A 5K0LA 4PQGA 5EEGA 3C4QA 3PYXA 4ID9A 1G291 5H82A 2IYNA 2AW3A 5SICE 3TTSA 2P5TB 2OV4A 2XQIA 4CQJA 4TL9A 2OM2A 1F5NA 1PJCA 1BVUA 2BKAA 2C4KA 2GNPA 3OPQA 1L5GB 4AKIA 1NJ1A 4PYLA 2G77B 1ZJ4A 3DOJA 3RUHA 1CJKC 2CEAA 2ISSD 4XSVA 3FZYA 3T99A 4Q7LA 4JL6A 1ICIA 2D5IA 3H13A 1L5HB 2ZSBA 3UFBA 1ZH2A 4B81A 4A73A 2UXCB 5C8YB 3NTXA 3WGQA 2ORWA 5HK9A 1BGWA 1UXGA 5IJ9A 2YV3A 3BWBA 1KOJA 5C1OA 2P35A 2N0SA 3DXYA 4TTVA 4M8KA 1FNSA 1SVNA 3LBFA 2FFQA 4U7TB 3A9SA 3Q41A 1N0WA 4WQMA 3GWZA 3ND7A 2CLSA 4MW2A 2QYSA 1T6ZA 3UAOA 3A36A 3INNA 4BUCA 2FY8A 2Q2OA 5IRCD 4IL5A 2GZDA 4KGDA 4EP1A 1NPDA 3KJIA 1TGYA 2O8FA 1CR2A 1FXSA 1NMEA 4I1YA 5D5HA 5EHGA 1E5VA 1V9CA 1YAHA 3P5SA 2IVZA 4N6NA 2R6HA 3SQDA 1K0FA 4L7VA 2BGLA 2EVWX 5J47A 2FI1A 1N6NA 2FPMA 2GCNA 1NQXA 2IC5A 5I8PA 4YV2A 3K9WA 4DR7B 1W46A 1AX9A 1EB9A 1Z38A 3AHEA 3E7DA 3ORSA 1FDIA 1Z07A 3M0EA 4D4IA 4BCBA 4ZGWA 2EQBA 3L3BA 1Q1AA 2J4DA 2CDRA 1EIZA 3NNDA 3AU9A 3GNSA 4UCFA 3PDUA 3T5MA 4BVEA 5AKEA 2HCRA 2XZOA 5C5IA 2Z2KA 3QW2A 5EVJA 4YR9A 3CG4A 2XT9A 3WGVA 4WBNF 4JOBA 3COZA 1UWVA 1PNTA 5BNIA 1SBZA 3GT3A 5E2AA 2BP7A 2RH9B 2ECPA 1TVCA 2FN9A 3MWDB 4OQNA 1NKVA 1UT5A 2ET6A 3LDAA 4MQFA 4YALA 2FFRA 5FFNA 4OKNA 1CETA 3N8HA 1QVAA 5KAPA 5IS2A 5JNLA 1E2GA 4YAFA 1IAVA 1XRLA 1KZHA 1GYQA 3W9SA 2EGHA 5F1OA 4XOIA 1N32B 1KK3A 1PX2A 4MUKA 3A2LA 1GPWB 1P80A 3ZU3A 5BN3A 4IMRA 4MKHA 3SVTA 1GRQA 2ZLBA 3KX2A 3WL8A 3KTAB 3O3CA 2PZLA 1Z6TA 2QG9A 5ALZA 1LPOA 1DEKA 4POOA 3PWTA 3CLVA 2V7QA 3HBFA 2QRQA 2WSSA 3VSAA 4JYCA 4OA8A 4D6YA 4F0JA 1HX7A 1H42A 4X1IA 2ZWIA 3PPIA 4ZYXA 3ABSB 1NDUA 4B7AA 1HL3A 5AI5A 3KKZA 3P9NA 1JDBC 4EMSA 3LCMA 1JT9A 4D2IA 2VYND 2DPYA 1Y6JA 4FN4A 5JG7A 3OLQA 3DULA 3VAAA 2QLMA 5M34A 4BY9E 4CIWA 4XARA 4HDAA 2AFRA 5FNVB 1RQLA 1U2ZA 1LI4A 3PPYA 2WZQA 5AQ1A 1NTOA 3JAWA 1NLZA 4RMJA 3ESDA 5GZ3A 4J0DA 3IAM6 1ZM9A 4JT8A 1N6OA 1WXWA 2FFAA 2J4FA 2B1GA 4FYVA 4J3JA 3AFOA 4NCNA 4NRDA 3TB4A 3WMGA 4ZJUA 1JEYB 3DMDA 2R1VA 2IYSA 2W6ID 3U3OA 1O95D 3REFA 1T1JA 4MWDA 1Q77A 3OIYA 1XTTA 4FONA 1BXZA 4P35A 2B8WA 1RLMA 4KW7A 4M3NA 3T1HB 2A5GA 1BJKA 1WY7A 1HY3A 2C77A 3B13B 3IMGA 3R7SA 3NC1C 1MGPA 2ZJ8A 4FYPA 3I1YA 5LDGA 3COPA 5ELLA 1V8FA 3FSEA 1W8DA 4RMNA 4AUNA 3DE1X 2HRDA 2QTCA 1C4KA 2GFHA 4G5HA 3EXHB 1QWOA 5D8DA 1U0OC 2HCFA 5K6AC 1X15A 5ALDA 1OI7A 1F2TB 3OEED 2FPWA 3RSLA 1YUBA 1OC2A 4HXEB 3WGTA 3HVRA 3K32A 4ZK6A 2ZIGA 3CF4A 4CV1A 1ZL0A 2IXDA 3OE5A 3QVGA 3I2KA 5ALKA 5JZVA 1SOAA 3DZGA 1R16A 3KYDB 3SZRA 1TXGA 2QLLA 3V8BA 1TJYA 2YNMD 2GLTA 1FLDA 5SY6A 3T94A 2QW0X 3BL8A 3JW8A 4P3XA 5DP1A 5FL3A 5A04A 3FLAA 2RJOA 2OLKA 3TW8A 4PIMA 1I9GA 1DAMA 4L4XA 2IITA 4ALIA 5HZMA 5TMDA 5KX5B 3NWBA 2FPIB 4CM4A 1K8XB 2FX2A 3HA5A 4Q9HA 4E51A 1F4PA 4TS1A 2NV0A 3SM3A 3LUBA 2IHNA 3COWA 4D6PA 3RNLA 1RCFA 3DEKA 1IHOA 4AJKA 3BMQA 1D2AA 3EC1A 3OT5A 3OPMA 1CKEA 3ZLBA 4R1MA 2F8SA 3TUJC 2CLIB 1PEAA 1XN4A 1SIUA 4GUDA 2Y1XA 4TGLA 5JH7A 1HG1A 1LVGA 4OLAA 4QOHA 2QUBA 5LMZA 1I2DA 1ZU4A 1HYGA 3RC1A 1U7WA 3KOXA 4IDAA 4YJ2A 1PHPA 4DT1A 4C6HA 5EIXA 1Q1EA 2ACKA 2C5LA 1PGNA 2CMDA 5AKZA 1Y1QA 3OTIA 1EBFA 4KNYA 3CLHA 4GP7A 2ZBQA 4MGEA 1ZVQA 1B74A 2Q5FA 3PL1A 4R8LA 1MB4A 1CUHA 1HRDA 3H2JA 4GSYA 3KSUA 4D41A 4M0FA 1AQNA 3HO6A 3EPRA 4JBIA 1G8PA 1I24A 4Y0AA 1VPLA 5FT9A 5A5FA 2MIIA 3AVYA 4UXIA 3WRXA 1JFFA 1E0KA 2H8GA 2JBHA 4D0LB 3V3KA 4FWBA 4HL6A 1XMSA 3TLJA 4EMUA 3PQFA 4EO9A 6Q21A 2FN3A 3OZWA 2OG1A 3DWIA 3EEOA 2FDXA 5AJZA 3C7DB 5COQA 1AZSC 1P0PA 2PG3A 1L5YA 3F7MA 1SOUA 2C9MA 1WEKA 2FQXA 4OQ4A 2YZ2A 3B36A 3Q3JB 4DM7A 4D25A 4L4UA 1LPAB 2B5WA 1J2TA 4WACA 3SBEA 3NHMA 3MAJA 4CLOB 2G4LA 1YE8A 3Q7SA 1V7PC 3P1JA 2QRLA 3Q9NA 4X6LA 4N1AA 4WKBA 5G0UA 2OCIA 3R0IA 4L5JA 2QN2A 2YIVX 3NG1A 3VH1A 2WM9B 1JDJA 2YV2A 1KY3A 2XCUA 4NFYA 2WHRA 4Y7DA 2ZGVA 5TIIA 4NNJA 1YO6A 5A0VA 1YL5A 1RM4A 4DC9A 5CXUA 3A1SA 3OFNA 4CDRA 1ODTC 2IXEA 3E5MA 4R41A 3ZUGA 1UF9A 3KFLA 4NDNE 4Z4GA 3GT7A 1YU6A 4YRAA 3H6KA 1EUCA 2VI5A 3BXEA 3ZGOA 2QSUA 4QXAA 4FYJA 7AT1A 4D8VA 3K6SB 4V2IA 3JD1A 1ZH0A 4DDMA 2V7XA 2RHMA 1NPYA 5CEEA 3HB5X 1DTEA 2PQ0A 4J1SA 4OMDA 2GD2A 2H92A 4KXYA 4HBZA 3JVUA 1NN1A 5E6RB 1SC6A 1DRWA 1RWKA 4FNGA 2NG1A 2BZ0A 1AQLA 2ETXA 2EFYA 4CF4A 1T6NA 3MT7A 3RK4A 4MCAA 3FRIA 3UBTA 3OQMA 2QAGA 4YCAA 1ZD2P 5AJWA 4Y2JA 4DAOA 4F8YA 3CEMA 3VDMA 3OH8A 2Q4EA 3MJRA 1CZRA 5I3CA 5KQGA 1HR0B 4WJZA 1GNQA 4ZU1X 3IV9A 4W6ZA 1UQRA 1Y5NA 3FOFC 3A6LA 3GLGE 1ZIOA 3AH8A 4JIGA 4Y1FA 3UV7A 3FDFA 5DASA 5JJCA 5B3AA 1BGVA 3SXUB 4OBWA 1Z82A 1RJ9B 4NOMA 2ODNA 2DKFA 4OXNA 3ZGZA 5JSHA 3CLSC 4FEAA 3ZJ5A 2PDAA 3KO8A 1LDMA 3W6PA 4TMYA 3PGVA 3EXG2 5IDVA 4EYOA 2VDUE 4CR8A 1PZMA 2QUZA 2RH8A 4NJMA 2WWRA 4KE9A 4OQDA 2WJJA 1A76A 1L7RA 4X6XA 5LUAA 3Q8MA 5INTA 2H3EA 4EY8A 1UEJA 1PAUA 2O50A