4GLOA

Crystal structure of a short chain dehydrogenase homolog (target efi-505321) from burkholderia multivorans, with bound nad
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
258
structure length
258
Chain Sequence
b'MDLNLQDKVVIVTGGASGIGGAISMRLAEERAIPVVFARHAPDGAFLDALAQRQPRATYLPVELQDDAQCRDAVAQTIATFGRLDGLVNNAGVNDGIGLDAGRDAFVASLERNLIHYYAMAHYCVPHLKATRGAIVNISSKTAVTGQGNTSGYCASKGAQLALTREWAVALREHGVRVNAVIPAEVMTPLYRNWIATFEDPEAKLAEIAAKVPLGRRFTTPDEIADTAVFLLSPRASHTTGEWLFVDGGYTHLDRALV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
molecule tags Oxidoreductase
source organism Burkholderia multivorans
publication title Crystal structure of a short chain dehydrogenase homolog (target EFI-505321) from burkholderia multivorans, with bound NAD
rcsb
total genus 95
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2012-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4gloA00
2E37A 2DVMA 1FF9A 3KSDO 3WJ7A 1LLCA 1YOVB 2P5UA 2X0IA 4QT0A 2BF7A 2PA3A 3DAFA 3AUAA 4H7PA 1RKXA 1TXGA 3GQVA 1I36A 4PFJA 1LNQA 1U9JA 3HZZA 3HWRA 1UXIA 2ZATA 3LLVA 4GLLA 1DAPA 2OUIA 2OFPA 4B7UA 2JHGA 3HUDA 5A03A 4CM1A 4ZVVA 3INRA 4P22A 1ISMA 2A92A 3GAZA 4MVJH 3X2FA 2Z95A 3O4RA 2PD6A 2VHWA 1Z74A 4YB8A 3WGOA 4WNIA 1YQGA 3LDHA 4RPGA 5JLAA 3S2GA 5J23A 2C5AA 4W7HA 4AJEA 2BH9A 2GN4A 4J43A 1YL5A 4JROA 2Q2VA 5LC1A 1XGKA 3GRPA 4D42A 1VL0A 1LU9A 3C7AA 1YONA 3QVOA 1UXGA 2E82A 5DBIA 2BKAA 5LCXA 2B4TO 2UAGA 3IMFA 4BGIA 3PYLA 4DVJA 2J5KA 1VL8A 2AE2A 1P3DA 2FR1A 4HBGA 4MKRA 4RPKA 1P74A 4CM5A 1MV8A 2HMSA 1MLDA 4HADA 3VZQA 3WGIA 3KO8A 4FFLA 4GBJA 3TFQA 1O5IA 2VOJA 3GRKA 1MX3A 2AEJA 3GLQA 3OIGA 4XIYA 3ZWWA 3S2FA 3CE6A 1IOLA 2WD7B 4GH5A 1QV7A 1F8GA 2C0CA 4WJZA 1UP7A 4JBGA 4LISA 4DUPA 5BSGA 5JW6A 1YE3A 4D3DA 3TPCA 1GZ3A 3ZV6A 1DC3A 2F00A 4RO0A 2CDAA 4DQVA 3F46A 2DFVA 1YBVA 2X0RA 4Z3KA 5MDHA 3LYLA 4CLRA 1KC1A 3V1UA 3UGKA 5GY7A 3WB9A 1KVTA 2J3IA 2TMGA 1M6WA 4MIOA 2V6BA 1BW9B 4RZHA 3F9IA 2ZB7A 4BMNA 4CL8A 1N92A 1KEVA 1IE3A 1CQJA 5B37A 3HQ4O 1GFSA 2PGDA 4IY1A 1E77A 1NFRA 3ZU2A 3DAGA 2VTDA 2IZ1A 4NJMB 4P38A 1QYXA 4ALJA 4CM8A 5BQFA 2YUTA 2BFAA 4MINA 5JE8A 5CEFA 4E5KA 4QUKA 4XRRA 1KS9A 1PGOA 2X0JA 4F6LA 4TRJA 2O23A 2BFMA 2GO1A 4J1QA 3V2HA 4FGSA 4YCAA 3PYMA 4XQEA 4BGUA 2HMVA 1N1GA 1ARZA 4UULA 1HYGA 3VPHA 4PG6A 4LN1A 2Y0CA 3AY6A 1P45A 5TC4A 1EK5A 1ULUA 4GWGA 3GG2A 5JY6A 4KDEA 3K73O 3BXXA 2EKPA 2QZZA 2X6TA 3FTNA 4YWJA 2CFCA 4JJGA 3A9WA 4WCFB 4CR6A 5G0UA 2PZLA 4BKUA 4EI2A 4BO4A 3QV1A 5A9SA 5ENVA 4J7CA 1ZW1A 2ZJ0A 1XCBA 4BHTA 3R3JA 5EIOA 2VRCA 5CEJA 1ONPA 4O1MA 3H8VA 3ONFA 4FFNA 2X1HA 1YBMA 2PWZA 3V1YA 1B14A 3KSZO 1U2DA 5CPBA 4RVDA 5JS6A 1PEDA 3RCBA 2IODA 2Y0DA 5T57A 4WEQA 1WVGA 4UVHA 1TT5A 4ZQBA 4YAKA 3L9WA 3C1TA 3DMYA 4NBRA 5TNXA 3PDUA 3MJ4A 3NJ4A 2GASA 1GEGA 2R00A 4O63O 1C1XA 1O95A 5EMHA 4MO2A 1XYGA 3K5PA 1TVEA 4URFA 4DYVA 3VZRA 1FJHA 4FFPA 4ZQGA 1ENZA 1NR1A 5ENDA 4F3YA 3FSRA 1NPTO 4LSMA 1GPDG 4IDCA 1ZKMA 9LDTA 2WE7A 3GVIA 4FCCA 3NTQA 5I7EA 5K9ZA 1DB3A 4FJ1A 1O6ZA 2WE8A 4JGBA 5JDCC 3B20A 3LU1A 1QLJA 3UHAA 4BNFA 4R54A 5DOZA 3JD0A 1BSVA 2JCYA 3PFWO 1UAGA 3K31A 3PJFA 1KYQA 1DDOA 4UVIA 1EFKA 1KVRA 1U3UA 3QJ5A 1I2CA 1WDLA 5AYVA 3I9MA 5C5IA 3AFNA 3JQ9A 2BMAA 1A4IA 1HZJA 1X14A 3H9QA 1BHSA 5GZ6A 4TRNA 1UUFA 3U62A 3WFIA 1BVUA 1MG0A 3C1OA 4UAGA 3ULKA 3V8BA 5BT9A 3W6ZA 4E31A 1P44A 4YT5A 2FPIA 3R6DA 1YL7A 4KOAA 5G4KA 5KWEA 3GG9A 8LDHA 1AXEA 5EQDA 2O3UA 3RU9A 4EJMA 1V3VA 4E5NA 1LXCA 5KJ6A 1ADGA 4D0RA 2X9VA 4WLUA 3FHLA 3G3EA 4E32A 4JJIA 1Y9AA 5CEEA 4IMPA 4S3MA 2GPTA 1NM5A 1NPDA 3KLMX 3CIFA 1X0VA 3MTJA 4YRDA 4IZHA 2C07A 1ENPA 3AU8A 3E03A 3WICA 2D59A 3DZJA 1ZK4A 3WBBA 1QORA 4BKPA 3WS7A 4CLOB 3O26A 4JK3A 3TL2A 3LF2A 1A7KA 4J9UE 3O38A 4R1NA 2Y05A 3NJ8A 3GT0A 3AUTA 2FR0A 3ADPA 1U7TA 3VPXA 3OJLA 1YXMA 3DZKA 1P1JA 2D5AA 2X58A 4KUGA 4XGKA 3U0BA 4HKTA 3KM0A 3VPGA 4YT4A 2OMEA 1JN0A 1LC3A 2Q46A 5IF3A 1VKNA 4U6SA 4CLOA 3WIDA 3IC5A 1Q0LA 1R12A 1ZVMA 3JYOA 3MZ0A 3OEYA 3KXDA 3L0DA 1MC5A 3O9ZA 3EZYA 1SZJG 4J0EA 5DP1A 1XU9A 1PS9A 2DFDA 2ZIZA 3VAZA 3AY3A 5KVCA 3DONA 1G1AA 4YQYA 2GUGA 4TVBA 3RBZA 4D79A 4N5LA 4IJUA 1HDCA 3TZCA 1ZXBA 2DTDA 1DRWA 1NFFA 1PS0A 2C59A 4IS3A 1DJNA 3BMCB 4FC7A 4W7IA 3DHEA 1UH5A 3FRJA 5DP2A 5JDIC 1LRJA 1B8UA 1JVSA 1TB4A 3MCVA 2YDXA 2C54A 2EP7A 4CMAA 4HX5A 3WWZA 3DTTA 3VPSA 3F1LA 3RUIA 3LSYA 3WG9A 5GMOA 3NT2A 3I9OA 2P2SA 2JHFA 3QVWA 1SAYA 1VM6A 3RROA 3OP4A 3P5SA 3U5TA 3TF5A 1XLTA 4NMHA 4PVCA 2GERA 3GVPA 1OMOA 5JDCA 4IJWA 2D3TA 4EJ0A 4MIYA 3DBLB 4GX2A 5TLSA 2WYVA 4IPTA 3MJVA 3ZNOA 3Q1LA 1U4OA 3NDIA 3B1JA 3JQ9C 3LC2O 4J6FA 4BNGA 1W4ZA 3DMTA 4RPJA 2VUSA 2BLLA 2PGLA 1X13A 3ENNA 4I5EA 4NPCA 4OXNA 3D4OA 3D1LA 5IDQA 5TJHA 3JD1A 4CLDA 2ZCUA 4NBTA 1O94A 2G82A 3MWEB 2DTEA 3TNLA 1VL6A 3F5SA 5CAEA 4TRRA 3ETGA 1QLHA 2GLXA 2OZPA 4WNCA 5G4LA 1EE9A 3PIDA 2VZ8A 3PEFA 1R4MA 5HA5A 4MVJF 2IRWA 3ITKA 4IGEA 3OBBA 2DBQA 4XR9A 4YJDA 3TWOA 1I33A 3CMMA 2PGJA 3ETDA 5L9AA 2NU8A 5DZSA 3QWHA 4Q39A 3KRTA 4H3VA 4KWHA 1ZK0A 4I5FA 1ISHA 1WXDA 4GVLA 1I5RA 2Q2QA 2RHCA 4JIGA 1OC4A 3K2EA 4B4WA 4OOFA 2FPPA 3C3XA 5IDWA 3EAGA 3ENKA 2RIRA 4O5OA 2EF1A 4CODB 2I66A 2C29D 2WEKA 3JQEA 5CDYA 3M2TA 3VTFA 4D3FA 3COSA 1K89A 3WX0A 1XHLA 2PZMA 3M6IA 3G0OA 1D1TA 1PJLA 5A5FA 1QXSA 3I6QA 5JPIA 3BMOB 3GPIA 4Q3NA 1EMDA 5L40A 3QY9A 3SLGA 4CQMA 1VJTA 1ZK2A 5L7TA 1GZ6A 2X8LA 4CLEA 2OXIA 5ILOA 4Q9NA 3JQGA 2NWQA 1MFPA 4ZU3A 1TT7A 1YOVA 3Q9NA 4XJTA 3TZQA 2G17A 1W0CA 4GKBA 4N18A 4EW6A 3DL2A 3TL3A 3DBLA 1M75A 2G1UA 4R3NA 3G49A 3AW9A 4RJTA 2W2LA 3PWZA 3JSAA 1BGVA 4WEOA 1JQBA 1E5QA 3PZBA 3EMKA 2X4GA 4II3A 4O0LA 4TKLA 4YQZA 3DXFA 5CPFA 3IQDB 3ZWPA 5HBRA 4M86A 4IDBA 3GMSA 4IDDA 4FD3A 3PP8A 4JLWA 1HT0A 1H6CA 3E9NA 4J3FA 5F1PA 4R1UA 5KJCA 3D64A 3U4IA 4A03A 2B69A 1P1IA 4LMPA 3ZCXA 5DBFA 4GI2A 4NR0A 4YTEA 4B7CA 3GUYA 3VDQA 5HTOA 4D3SA 2O3RA 1R4MB 2PTGA 1JWAB 3I83A 3QW2A 4HFJA 4YJHA 2ZQYA 1SNYA 2WWRA 1I3MA 1HSOA 3ORFA 3PWKA 4ND2A 3P2OA 4M54A 1UXJA 4E5YA 1LSJA 2C2XA 4PZEA 3AM5A 1ZH8A 3W8FA 1G0NA 5BR7A 1T26A 1B0AA 1F06A 2C20A 4RZIA 3VDRA 4RVUA 2OBYA 1B8PA 3MJCA 4R68A 5G2OA 2O50A 4Z0TA 4R3WA 2PLAA 2W2KB 4MP6A 5A3JA 2ZYGA 3QWBA 3KETA 4MVJD 4RF2A 1EVIA 5G0TA 3S55A 3HSKA 3HB5X 2VWGA 2O3JA 4J7UA 1EUDA 1E92A 3U49A 3JQ6A 2HDHA 2OL4A 2AEMA 4OL9A 1ZMOA 3GZNA 4GSKA 4QEDA 5F21A 3OSUA 3H3FA 1LI4A 2EKLA 3PGJA 5FI3A 3RSHA 4WE3A 2IXAA 1FDUA 2FOIA 3AY7A 5JC8A 3E9MA 4YT8A 1H6DA 4JN6B 5H82A 3L4BA 1Q0HA 1U5AA 2PNFA 1GZ4A 1MUUA 3TOXA 3ONDA 4XYGA 2DBVO 3LC1O 1ZEJA 7MDHA 4UREA 4U0KA 1DO8A 1OI7A 1YRLA 4AJKA 4XGNA 5B4UA 4FGWA 1VE9A 1XQ6A 3DC2A 5IJZA 4TMFA 1WMAA 4Z3DA 1M2WA 3ZV3A 3SJUA 1MGOA 4W99A 3DBHA 3BIOA 3EDMA 3GC6A 3WYCA 3ZWYA 3FNHA 3PZRA 4DTIA 4W4TA 3DZBA 2JKVA 1HEUA 4BIIA 2GCGA 3C24A 4EZBA 2EGHA 4ZGWA 2B35A 1GV0A 1QV6A 3VKUA 2DQ4A 4BNNA 5CDUA 5JAIA 2VUUA 1YQDA 1HE4A 5L53A 3B6ZA 1LDYA 1H5QA 1O9BA 3E9QA 3I23A 2NVUA 3KYDA 2JAPA 3AM3A 3H7AA 3KBOA 4W6ZA 3KHUA 5JO9A 2HRBA 4AJ2A 3A4VA 4II2A 3BHMA 5L4LA 1F17A 2PR2A 2RH4A 4OYRA 1JKIA 4DA9A 1YL6A 3HADA 3ZU4A 3CEAA 4I9HA 1CERA 5BNFA 2OO5A 4CM4B 2NU9A 3WGYA 3KEOA 3OECA 4E5MA 5I7VA 3TZ6A 4DIFA 2VHXA 2HO5A 1GCOA 1Q7GA 3TQHA 2ZCVA 4FC6A 5DN9A 4NJOA 4PLWA 1GYPA 4K1LA 2H9IA 3OFSA 3Q2IA 2EP5A 3RI3A 3SJ7A 2WMDA 4NFSA 4BV8A 4CMGA 3HFGA 4FFOA 4D43A 3FTPA 4ALLA 3AI2A 1BTOA 4CLXA 2ILTA 1LSOA 1E3WA 1AGNA 1QMGA 2VWHA 3I9KA 3H9EO 3IJPA 3HDJA 1I2BA 2JL1A 4N54A 2NVUB 3NGLA 2YHIB 1NTOA 5I7SA 3G1UA 1IY8A 1PJ4A 5EINA 3U4HA 3BTVA 2O48X 3LT4A 4QFCA 1KVSA 4PLFA 4WCFC 2GN6A 3GZ4A 3INTA 2X9GA 3JYNA 1PL6A 3CH6A 3WXBA 4UEOA 3MTGA 1MB4A 2PZJA 1P1RA 3BMOA 1K0UA 3K6JA 1N9GA 3ROMA 3NX4A 4IGFA 4RQUA 3I4FA 3U09A 1HE3A 3EGOA 5I7FA 5T6BA 2YFQA 3ZZNA 3R0IA 4MKZA 4Z6KA 1O89A 1PIWA 3BYZA 4K9DA 3WGGA 3FNGA 1JWBB 1ZEMA 3D5TA 4YAEA 4Q3CA 3C1AA 3G17A 2V6MA 2RH8A 4XR4A 3RAJA 4BVAA 5L3ZA 3KOUA 4AG3A 1VKOA 3H2SA 1E7MA 1H2HA 3L6OO 3ZV4A 5EN4A 5L95A 1R37A 2C7VA 3GA0A 1LTHR 1T4DA 3Q6IA 1LDBA 3EVNA 4B7XA 1H9AA 4DXHA 1IHXA 4DMMA 4Q3DA 2I9PA 3F1KA 1NVGA 1LSSA 1PGNA 4JQCA 1YDEA 2GDZA 1GUFA 1ADCA 1D8AA 5FWNA 4MVJP 1Q2XA 2JFGA 3JQ7A 3EK2A 4RLHA 1HLDA 1L1FA 3GVHA 1Y8QA 1HYHA 1BXGA 1U1IA 3AWDA 4FDAA 4WUVA 4FOOA 1X7DA 4DLAA 1IUKA 4UVDA 3DOCA 4XYLA 1LC0A 4CLRB 3A14A 5GZ1A 3NTOA 4P4GA 4RF4A 1I10A 1X1TA 3HNPA 4PCVA 3FBTA 1C0KA 4CV1A 4CMBA 1CEQA 5JMPA 1UZNA 4FW8A 3RKUA 4PLGA 1LJ8A 1Y1PA 5B12A 4A7PA 4R5HA 4J4BA 4O6VA 1HDOA 2NADA 3PIIA 2EHDA 2I67A 1T2AA 5T5QA 2EV9A 3PHIA 1E7YA 3ZHBA 3C8MA 3EVTA 3WOHA 2BRUA 2HK8A 4YYZA 1Q0QA 3RD5A 3V2GA 4G2NA 2PY6A 1EZ4A 3JQ7B 3BMQA 4Q3EA 4DWVA 3T7EA 1KY5A 3INGA 1FDTA 3JTMA 1VRWA 4G81A 1SO8A 4R5MA 2IXBA 4BO0A 1DFHA 4RPHA 3GH3A 2J5RA 4RVSA 1Z6ZA 4BOYA 3IOYA 3LZ6A 2D4AA 1GU7A 3TRIA 4J1SA 1IPFA 1J4AA 4XRGA 1ZFNA 4B3IA 3HDYA 1AHHA 1V3UA 4PG7A 3FNEA 2Y1DA 1I30A 2GZ1A 4R1TA 1LDGA 1VI2A 3H6KA 1ID1A 4BNHA 1WZIA 3JQ8B 2BELA 1PJQA 4B79A 3HE3A 4QSMA 4DQXA 1ZBQA 1YJQA 4M8SA 1HETA 1T2FA 3O8QA 2OHXA 2X5OA 2VUTA 2GYYA 3NV9A 2IEDA 2DBRA 1GAEO 3KYBA 2A4KA 2PD3A 2UUOA 4I9UA 1NVTA 4B4VA 3JQAB 4EDFA 5L7WA 4PG4A 4A26A 3AUUA 3E5RA 4Z0HO 4BS9A 1PJCA 1J49A 1SC6A 5F5NA 1PJ3A 4J90A 4D44A 1I3KA 4NHEA 4OGWA 1C0IA 2ET6A 1SPXA 4U5QA 3OIDA 1HTBA 2YDYA 3O8QB 1PQWA 5ICSA 2Q49A 2ZKLA 4HY3A 1CF2O 1GQQA 3U9LA 2Y93A 3F4BA 5F3RA 4WASA 4H15A 4YAJA 4CQLA 2EIHA 1HDXA 1ZJZA 5KTKA 1C14A 4L75A 1A4UA 2Y1EA 4YVFA 3ZWVA 2I6TA 1H2BA 3M2PA 1M76A 3VH2A 3RKRA 2FN7A 5JFOA 1LLUA 1C0LA 1OC2A 4BNVA 3I4CA 4DREA 1UDCA 4IDEA 4CQLB 1YS4A 1N1EA 2A35A 3GF4A 5GZ3A 1PGQA 1XR3A 2DU8A 3QSGA 4EGFA 1EVZA 2VCYA 1V9LA 1YB4A 4E33A 3Q11A 1IYZA 5DCUA 1MXHA 4PLPA 1PX0A 3VKVA 4MP8A 4P4NA 4EEXA 1ZZEA 1E1NA 2JD2A 3N7UA 3JQAD 2P68A 3WLEA 1N8KA 4BNXA 1DOHA 1NNUA 1SCUA 4GQAA 5G4KB 1PZHA 5I8ZA 4U6QA 4XYMA 3BHJA 3U3XA 3IP3A 1C1DB 3PWSA 4ND4A 4NZ9A 2YQ5A 3E6AA 4ZICA 5L4SA 1LRLA 2FHSA 2QRJA 3PTZA 4HWKA 4NIMA 4ZD6A 1U8FO 3K2BA 1HSZA 2RHRA 3PVZA 5L45A 3KEQA 2VYVD 4KUHA 3ABIA 2NVWA 2NV6A 2WTBA 3SLKA 1QR6A 1DAOA 2AQ8A 2WD7A 4RGBA 2CVZA 4ZA2A 2ZB8A 1GQ2A 4JCOA 1A9YA 4HFNA 3DQPA 3CXRA 1P33A 1KEPA 1NQ5A 1RM5A 1A71A 2ZTVA 2VQ3A 1KC3A 4JBIA 3WR5A 1NAIA 5F1OA 1WPQA 3ZHYA 4IUYA 5B4TA 4NBUA 4CR8A 4IQGA 4EUFA 4A27A 2GSDA 3ZHZA 5ADHA 3DHYA 4ZQEA 5IN4A 4BNTA 3OMLA 2HAEA 3STHA 1XU7A 4XA8A 1E1KA 2VYVA 4HXYA 2OORA 2CF6A 2NNLD 4BNUA 1YJ8A 4YJGB 3KZVA 1BXZA 3GFGA 4Y6SA 4IM7A 4I1IA 4W9NC 3QIVA 1KETA 4FFMA 1JW9B 4KTVE 2JD1A 3KB6A 1WLYA 4XGIA 4CM4A 3W4JA 4GMGA 4IJVA 5L51A 2O2YA 3OA0A 4FBGA 3K92A 1GPJA 4CM3A 1DHTA 3I52A 4YJGA 3IIEA 4R16A 2DBZA 3JD4A 1JU9A 2ZB3A 4OH1A 3UUWA 3BZUA 4BNZA 4YR9A 1YH3A 1F12A 4L9RA 3ZNPA 4Z9FA 4BGVA 1LLQA 3DBRA 4DL9A 5IDXA 4NH4A 4CMEA 1V35A 3PJEA 1PZEA 3ZV5A 1GTMA 3ZI0A 2UUPA 4CUJA 3OHSX 4ZHSA 5TF4A 4R01A 2CF5A 5CDTA 4M87A 4RDHA 5AVOA 3ZWOA 1NXQA 2P5YA 5TRTA 4A73A 2Q3EA 3FPLA 5DOVA 3D3WA 1IULA 1J6UA 3FNFA 5IAAA 3WNQA 3AOGA 4B3JA 2EKQA 4BNIA 2EXXA 3DWFA 3DZFA 1DC4A 4BNMA 2A94A 3PXXA 3GK3A 3QWFA 5A9TA 3RFTA 2J3JA 4IXTA 2QHXA 2E6UX 2VWPA 3CPSA 5JCJD 4E30A 1B15A 3NTRA 1H6AA 1NFQA 1ADBA 1UP4A 2NU7A 1E3WB 5BSFA 3WSVA 3JQFC 1E7WA 1ONNA 3F47A 2YYYA 1NBOA 1NHWA 1VSVA 3IUPA 4BKRA 3DFZA 4D7AA 3DTYA 5TS3A 4D0SA 4LK3A 1IZ9A 3SC6A 1J5PA 3GOHA 3W1VA 2FZWA 4BKQA 2IE0A 4FB5A 3JQ8A 1SOVA 4QFDA 1NASA 1PZFA 2HMTA 3WQQA 2C82A 2ZQZA 4QXMA 4WECA 4UEJA 2NSDA 1PL7A 2X5KO 3BMCA 1AXGA 1KVUA 3KYCA 1G0OA 3VH1A 2ZJ1A 4A2CA 1RYDA 1B2LA 4J91A 3AOEC 3PHLA 3W6UA 4UVGA 5BNIA 1WZEA 4CMIA 3ASVA 1U5CA 2VHZA 4WGGA 1DRVA 1VJ0A 2IZZA 4ROSA 2OP0A 4GGPA 4WLEA 4EUHA 4Y6RA 4DPMA 1ADFA 4X54A 1K6JA 1ZXLA 4AJ1A 1NPYA 1P1HA 1P1KA 4LW8A 1Z75A 2O2SA 3DZIA 1RWBA 3KVOA 4OSPA 2VYNA 1ZSYA 2PK3A 5JO0A 1BVRA 2HQ1A 1NR7A 1BXGB 4AJPA 2AQIA 4P8RA 3E5MA 2HMUA 4HUJA 4NQZA 3EC7A 3HJAA 2YQ4A 4NJMA 4CMEC 3PFFA 1ULSA 2D1YA 4RV9A 1ZUD1 2D5CA 4XZ3A 5T67A 3BTSA 4CM9D 3NAQA 3QRWA 1ML3A 3A06A 3I9LA 3L9XA 1YB1A 4NU5A 1R16A 4KWIA 2QRKA 1UJMA 4RF3A 3ZDFA 4JBHA 3ZNNA 4ND1A 3NDRA 1C3VA 4AJIA 4PLZA 1XDWA 3AFMA 4XD2A 1LBEA 1LUAA 1YGYA 3C7CB 1P9LA 1Y8QB 5IN5A 2POQX 5COBA 4ALNA 2WYWA 1EUCA 4YRAA 3GEGA 4MVJE 2HKIA 4A5OA 4YRBA 4FJ0A 3PHGA 4WKGA 2NTNA 5COAA 3LT1A 4OXKA 3W8EA 4AJLA 3GY0A 4C7KA 2Y1CA 1V3TA 2HJRA 5I9MA 2X0NA 3QVXA 4CM9A 4E2WA 3ZWAA 1NQAO 1Y5MA 1PWXA 2AXQA 1U3WA 1R4NA 8ADHA 3GNSA 2B4RO 2VNSA 4IIUA 4I08A 5ILGA 1X15A 4GX5A 5AXCA 5IFLA 4FPXA 4ND5A 3JYLA 3BAZA 3H9JA 1JLLA 4PLHA 3ADOA 3GVCA 1ENYA 3HDHA 2Q1SA 1E3IA 1DLJA 2P91A 4PRKA 3FBGA 5EERA 3WWYA 3WQRA 1JTVA 1I24A 2VTEA 4GPD1 4KP7A 5A5EA 1J0XO 4I8XA 4BO2A 4RDIA 1GL3A 5C7OO 2GZ2A 2I99A 2WSBA 3FWZA 3DOOA 2Z1MA 3KYDB 1ISIA 2FPGA 3LT0A 4WLOA 3GEDA 3WLFA 3PJDA 3PQFA 2PZKA 3OQ1A 4JP3A 3VVBA 5KKAA 4OO3A 2YV2A 3UOGA 4J2OA 4NK4A 2Z5LA 1TLTA 2VT3A 4WLFA 4E5PA 2DTXA 1Y8RB 2QX7A 3I9NA 2QW8A 3GPDG 3N74A 4MOWA 4PG8A 4HFMA 2NM0A 3GZNB 3NRCA 2NUAA 2PH3A 4JP2A 4YA6A 3ROKA 5A02A 1K3TA 1RM0A 1GD1O 1W8DA 4R4JA 1UP6A 1N2SA 4QQRA 3VHRA 4LVUA 1PL8A 5KJ1A 2SCUA 2VNAA 3ZU5A 5MGBA 4EUEA 3TN7A 5ER6A 4G65A 2DKNA 1HWYA 1BMDA 2AW5A 5THKA 1NWCA 5B1YA 3UCEA 5KOIA 4EYEA 4CLHA 5DDIP 4BUCA 4BQPA 1R0SA 2X22A 5A9SB 4J49A 1I32A 4K26A 4CV3A 4QTZA 3RIHA 4QECA 4ILKA 2XXJA 4Y9DA 1T1SA 1Y5RA 3L6DA 5HRUA 4CUKA 2WYUA 5BSEA 2PKRA 2QZ9A 3GUCA 2YJZA 3U4DA 4XWYA 3WGZA 1M67A 4E2ZA 5KJFA 1ORRA 3ZN2A 2GNAA 3FCOA 4BO8A 5U1PA 1IB6A 4YAGA 4BGEA 2C2YA 3QWAA 4CMCA 1V0JA 3IP1A 3TDKA 5EPOA 5ER9A 3ZWMA 5BSHA 2AHRA 5JC1A 2Y1FA 1E1MA 2X86A 3W4KA 4NDNE 1E3SA 2C7GA 1UXHA 4BO6A 1CJCA 1X0XA 2GF2A 4YXFA 1Q7CA 3Q2KA 3QQPA 2Y0EA 1SEPA 3VZPA 1M6HA 1VPDA 5EL0A 1KIFA 3UCFA 2W90A 4BNJA 3MJEA 1E5LA 1XELA 1LA2A 4FFRA 4DPLA 3WBFA 2AG8A 1MA0A 4DGSA 2FMUA 4K6FA 3ZWXA 5CHEA 1H94A 4J4HA 4MIEA 2JD0A 4I9NA 1B26A 3HG7A 1G6KA 2X5JO 1ISFA 1HLPA 4NU6A 3L07A 1U4SA 4HP8A 2DPHA 4R1SA 3S1LA 2Q1UA 4BKOA 4LRTB 3JQGB 4PZCA 3A1NA 3OQBA 4RQTA 3F3SA 3UW3A 4R51A 1X1EA 2FZEA 5JMWA 3QA9A 4Z9XA 1QYCA 2DT5A 4E6PA 1JAYA 4GX1A 1LRKA 3E48A 5JAQA 5TT0A 3NYWA 3RWBA 3UICA 2D0IA 3E8XA 3F4LA 1AN9A 1NQOA 1X7HA 4PLTA 3GGOA 3JQBA 2VHYA 4GMFA 2Q99A 1WP4A 3NDJA 4PRLA 2JCXA 3OICA 1P0CA 2VN8A 2CVQA 3PYXA 2VYND 2XAAA 5IXSA 3MOGA 4R69A 1Y7TA 2CMDA 1RYEA 3JQFA 4CM6A 1A27A 2ZK7A 3WSWA 3BMNB 2B4QA 3C85A 3HHPA 3ZNQA 4LGVA 1PU2A 2W98A 3H3JA 5T8KA 3UKOA 1OAAA 2O7QA 4IBOA 3AI3A 4D41A 4MVJA 3NUGA 5ITVA 1LLDA 4XIJA 3DAPA 3ROQA 1BDBA 2ZTLA 3B70A 5KVQA 4TQGA 1A9ZA 4RVFA 3U4CA 2NVBA 4Y6PA 1TA4A 2O3TA 4N7RA 4OAQA 4QO8A 2HRZA 1GV1A 3PQEA 3D0OA 3HFSA 5KVVA 2G76A 1E7RA 3ICCA 1FDWA 4BO7A 2BHLA 1XIVA 2GR9A 1HDYA 4XKJA 2Y67A 3MJSA 1GUYA 2RBEA 1PGJA 5C7IO 2H1SA 3PLRA 3IDSA 1VC2A 4WK6A 2UV8A 1C1XB 4GLOA 1KEWA 3RC1A 1TI7A 2Y1OA 3H65A 1B3RA 3P2YA 1NAHA 2HLPA 1HE5A 1W73A 1PGPA 1UAYA 2GD1O 3CSDA 3Q3CA 2I5PO 2AA3A 1IHYA 2VWQA 4GWKA 5F1KA 5CFZA 3D3WB 3ZGYA 1R66A 1P31A 2V7PA 1T25A 4W9NA 3RBVA 5A06A 5DT9A 4ALKA 2V6GA 3PK0A 4QX6A 2QQ5A 3TZKA 4JNKA 1GEEA 3WGTA 2J6IA 5JNLA 4RPLA 4E12A 3CZRA 3EYWA 2ZTMA 3LK7A 2R6JA 1EDZA 5IZCC 3MEQA 1ZK3A 2AG5A 5AOVA 3IS3A 2VRBA 2YV1A 3K96A 2WM3A 1DC6A 2UVDA 1RM3A 2ZYAA 4WOKA 5JAMA 2EJVA 4D46A 4B3HA 1HKUA 3HN2A 1ZCJA 1V6AA 3IJRA 4TKMA 3LF1A 1ISJA 2YHUA 3RBXA 3B1FA 2CUKA 1QYWA 4CV2A 5DULA 2CDBA 3KSUA 2IYOA 3I3OA 3FF4A 1HL3A 3GN2A 4N5NA 4UUPA 4ZJUA 2VRCD 4MKXA 4PGFA 3ZWBA 3O03A 4M55A 1I0ZA 1GYQA 3RVDA 4DRYA 4GX0A 1U28A 4NG5A 4WLNA 4IDFA 4E13A 4ZRMA 1RJWA 4U8GA 1KEUA 4IDAA 5K6AC 1EUZA 2DPGA 1YBAA 1EQUA 2HCTA 4JJFA 4NBVA 3VOSA 5KVSA 1EDOA 2JJYA 1PJTA 3JQAA 4OQZA 3RUAA 2Q2WA 3DHNA 4KQWA 1E3LA 1E6UA 5DNAA 1F8FA 4CMHA 4KDFA 3DFUA 5JCJA 3GFBA 4DQUA 3ANMA 1DXYA 5DCWA 3V5NA 5K0ZA 1B3BA 2VZ9A 3DMTC 4L73A 1U7HA 3WFJA 2WDZA 3GVXA 4IQ8A 1QYVA 4FIZA 3S2EA 7ADHA 1S6YA 3JYQA 4DC1A 2IZ0A 2ZYDA 5FEUA 4W82A 4LVCA 4CQMB 5KCZA 2AQKA 1AUPA 3FR8A 5K6AA 3UH1A 4ZRNA 1V8BA 1QRRA 3ZWCA 4BL5A 4HV4A 1UR5A 4BMSA 1H0KA 4LCJA 1CRWG 1N9GB 3H9GA 3P19A 1T24A 1MC4A 4B8ZA 4XX0A 3E18A 3D7LA 1UDBA 1MXFA 2BGMA 2NQ8A 4BO3A 1PQUA 5TSDA 4FOSA 4XQ9A 3K9QO 2EJWA 4WPGA 2EEZA 2G5CA 3NGXA 5A05A 2GGSA 1MP0A 1BRMA 3H5NA 3EHEA 3DDNA 1LSUA 2ZTUA 1U2GA 4R41A 1Y8RA 1EEHA 1PS8A 3LQFA 5TJ9A 1M66A 4B4UA 3QVTA 2Q1TA 5C3MA 2EW8A 1I01A 4FR5A 1OOEA 2Y99A 3K8ZA 3I5MA 2JAHA 1T2EA 4DYDA 1DIGA 4KTTE 1Q1NA 4MVJG 2W2KA 4INAA 4FS3A 4YJFB 2DC1A 2R00C 4TVOA 4R9SA 3VPFA 1L7DA 3RJ5A 3KV3O 1XA0A 1HDZA 3L4SO 2YY7A 1EFLA 3H4VA 1PTJA 4UUOA 2PH5A 4E0BA 3GHYA 1EBFA 2Y66A 4ZQFA 3VH3A 4OSOA 1LX6A 2B83A 5KNLA 5COQA 3KUXA 4OM8A 4J9VA 1N5DA 5HWSA 3CZMA 2E4AA 3PDJA 4WCFA 4J7XA 5T64A 4IDGA 5IDYA 5A4DA 1E6EA 1PR9A 4YJHB 2PKQO 3RQSA 1CYDA 2I65A 3FI9A 1JAXA 3MJTA 1K6IA 4TWRA 3L4BC 3ITDA 2P4QA 3GNQA 1O0SA 4XDYA 2LDXA 1WNTA 5TQVA 4YPOA 3UN1A 1NHGA 1JA9A 5JBIA 1CQIA 3HN7A 3ST7A 2GN8A 4Y98A 3UCXA 3DBHB 4E4YA 5HS6A 4E2YA 3NT4A 3EW7A 1R6DA 3RC7A 3H2ZA 5JXWA 1WWKA 1ZO8A 1LDMA 3M1AA 1TT5B 3WYEA 3FD8A 5JCXA 3PHHA 1ONOA 3RC9A 3OETA 5L7YA 2W2LD 1DIRA 5EQFA 4WOJA 4E21A 1F14A 5JDIA 3DZHA 5U4QA 4BMVA 2O4CA 2V65A 4PLVA 3OJFA 1KERA 3RUHA 3SX2A 2GZ3A 1NX6A 1HYEA 1EK6A 2EGGA 2J8ZA 4NFYA 4NFHA 2BGKA 4UUMA 4DIBA 1XSEA 5T8KC 1BG6A 1C1DA 3TFOA 3GGGA 1GR0A 2C5EA 4PG5A 1YKFA 5TT1A 3VTZA 1AHIA 1DPGA 4BV9A 2WD8A 2PKQP 4DLBA 5IXYA 4PIVA 2Z1NA 3UF0A 4AFNA 3WGQA 4AVYA 1DFGA 4G5HA 5DBGA 1Z45A 3N58A 4U0JA 1DSSG 4IJKA 4Z9YA 3TOZA 1KY4A 1RPNA 4BO9A 3WJAA 4A0SA 3RUCA 4CUZA 1SB8A 3BTOA 5ICMA 4AICA 1B7GO 3BA1A 1DJQA 2HMWA 2E49A 1L7EA 3OEWA 1E6WA 5L4NA 3GDFA 2OOSA 3D4PA 3S2IA 4XDZA 3V2UA 3ONEA 5AQ1A 4OQYA 1K2WA 3IKVA 1WAMA 3WIEA 2I3AA 1JDJA 2NTJA 1VJ1A 4OJNA 3D5QA 3ZW9A 4N5MA 2Q50A 2V6FA 4J1TA 4WCDA 5IG2A 1NQTA 2NTVA 3WMXA 3GDGA 3EY4A 1U8XX 4UUNA 4PN3A 5G0WA 2FWMX 5G0SA 1CIVA 3IKTA 4NBWA 3PGXA 3JYPA 4EITA 1T1RA 3SC4A 3W4IA 2I76A 3I9JA 1GYRA 1DIAA 3NEPX 2HU2A 4CV0A 3CMCO 3WTCA 2O3SA 2Q45A 3E82A 5DF1A 1R15A 1YWGO 1LDEA 3T4XA 3OIFA 3VH4A 3DBVO 1A72A 2BI7A 1D4FA 4H16A 2X9NA 1DFIA 4BQRA 3ANNA 3ASUA 3PQDA 4O59O 5A04A 5C7LO 3R1IA 2B5VA 1QYDA 5AXAA 2H5LA 1U3VA 2JFFA 4YACA 4RORA 3BHIA 3OH8A 2NACA 4FJ2A 4NNJA 4Y8VA 1TEHA 3NKLA 4BNLA 2YZ7A 3PRJA 3QLJA 3AI1A 3LT2A 1YO6A 1EBUA 4U7WA 1T2DA 2GN9A 4LRSB 4F6CA 1Y9EA 2WJPA 3BMQB 1PSDA 5FI5A 2J5QA 4WLVA 3JCZA 2R2GA 2VHVA 2X23A 2QRLA 1CDOA 2QYSA 3GEMA 4NK5A 4B4OA 4BNWA 1HDRA 4CMKA 2OGUA 3UFXA 5AXBA 2DM6A 3K30A 2Q1WA 1D7OA 1UXKA 5LDGA 2JCVA 4GGOA 4C7JA 2PD4A 3TJRA 5I9LA 2DAPA 2XXBA 4L0QA 4E3ZA 2BD0A 1NP3A 4ESOA 4L4RA 1NWHA 1R4NB 3CUKA 5H83A 5ITWA 2AQHA 2W8ZA 2X7HA 3ANLA 4F46A 6LDHA 4IS2A 4LSWA 6ADHA 2PV7A 1DIHA 3OJOA 4UVEA 1QG6A 3M1LA 1YQXA 1GUZA 4MPDA 3T4EA 4YT2A 3RC2A 5IZCA 4KZPA 3SEFA 4CMIB 3LLSA 4J16A 2D8AA 3ICPA 4Y67A 4J1NA 5CP8A 1D3AA 1K6XA 2FSSA 3S8MA 5A1TA 1PR3A 5LDHA 4MDHA 5HM8A 3IUSA 4ZN6A 4BO1A 1FXSA 2O4UX 4CPDA 2YFHA 2CY0A 4CQMD 4K28A 1I3NA 3QHAA 1ZJYA 1KOLA 5KKCA 1DLIA 2P9CA 2DLDA 1CWUA 3LVFO 3G79A 3DEYX 4CJXA 1PJSA 4PVDA 3DOJA 1ZMTA 1FDSA 1PQPA 1XQ1A 2P9GA 2OBNA 1A7AA 2Y68A 2PFGA 3QVSA 2HUNA 2B37A 4ONEA 1BW9A 3WQSB 2F1KA 3BTUA 5EESA 5U9CA 3G1TA 5TX7A 2CDCA 2OP1A 2QYTA 1QKIA 4QO7A 2ZB4A 1DC5A 4KQXA 3ZW8A 1JVBA 2VOEA 1SB9A 2H6EA 4AL4A 4XCVA 5TIIA 3PPIA 3H5RA 3ROPA 3A28A 4B8WA 2AEFA 3QE3A 3L77A 1P1FA 1NYTA 1WMBA 3T7CA 5EJ2A 4C4OA 3JQBC 3JV7A 5JYDA 4DIOA 1E7QA 1BDMA 4OKNA 3WYBA 4TZTA 2DUWA 1ISGA 1ZNQO 3OJEA 1HRDA 4RVGA 4S1VA 2VZ0A 3OM9A 1R0LA 4BNKA 3WDSA 3B1KA 3SXPA 2B36A 1HXHA 3AU9A 1MG5A 4F45A 1H9BA 3PJGA 4I5GA 1WDMA 3UXYA 5I9NA 4L4SA 5C37A 2P9EA 5THQA 4P4LA 2G0TA 3RFVA 3RFXA 5ES3A 4I5DA 4JX8A 4BB6A 4L4XA 3F5QA 4IINA 1X7GA 4XEHA 3PLNA 5FF9A 1P0FA 4DBVO 3LC7O 4UEKA 4CM7A 2IEBA 1JKJA 2I3GA 4IQ0A 4CM8B 2NU6A 1H6BA 1B8VA 4OMUA 2W4QA 1KVQA 1EVYA 4M49A 4OXYA 4AJNA 1GQYA 4AJOA 2NLOA 4KMSA 1I3LA 3P7MA 4R9RA 4D45A 3UVEA 5KJEA 2HK9A 4XB1A 3WGHA 3ZHXA 4TROA 1N7HA 1VSUA 3H9UA 3EUWA 3DO5A 4M1QA 4RCVA 4ND3A 3CINA 1ZSNA 3WNVA 3Q9UA 3ZH2A 3F6YA 4KUEA 1S7CA 4Z0PA 1DHRA 2FSVA 4OKIA 4XQCA 4IIVA 3KLPX 3V1TC 4AJJA 5CDGA 2CVOA 1B16A 4CL3A 2CNBA 1E3JA 1LQTA 1VLLA 1WDKA 5IZ4A 1E3EA 4FSHA 2O7SA 3AUSA 3FWNA 2DUUA 2CSUA 4E2XA 4Q3AA 1CETA 3I1JA 5CG1A 1D1SA 4A10A 4PLYA 1PJBA 1HZZA 1E0DA 3IAHA 3CKYA 1DRUA 1GADO 4YAIA 5BNTA 1Z82A 2RAFA 4M89A 3GN1A 1Z7BA 2AMFA 2QIOA 2YW9A 3C7DB 4OHUA 4OOEA 1U3TA 4DLLA 5DCYA 1SOWA 2XPCA 3JQCA 4PLCA 3WMWA 4TZKA 4EEZA 5AXDA 1P77A 5HS4A 3D4NA 1W6UA 1GCUA 1FK8A 1QP8A 4GAEA 5CG2A 3SVTA 1I2ZA 4JXKA 2BFPA 4FN4A 9LDBA 5CDSA 5G0VA 1XWFA 2J3KA 4RF5A 1EE2A 3PI7A 1EVJA 4J2HA 3FR7A 3OQ6A 3RJ9A 3FN4A 3GR6A 1PZGA 4XJSA 2GRAA 3RUFA 4YEDA 1EQ2A 4RL6A 1BXKA 1H93A 3RUDA 3HDQA 4GVXA 3ETEA 4BB5A 4ID9A 3GMDA 2B5WA 1YVEI 1O8CA 1Y6JA 2XF8A 4HNHA 2JFHA 4XB2A 2FY8A 1AE1A 2P4HX 1GY8A 4LCEA 3UAGA 3Q0EA 1RM4A 3TZHA 3TSCA 1HE2A 2HJSA 3RASA 1WW8A 3IL2A 3OA2A 2Q4EA 3BMNA 2D2IA 4DBZA 5I8WA 4IMRA 4L74A 2A9FA 3MWDB 1SBYA 4EBFA 5F5LA 2LDBA 3E1KA 4MP3A 4Q3BA 1OFGA 3JD3A 1Z7EA 2IDZA 3WTBA 3X2EA 1BWSA 2XOXA 1Z73A 1ZIDA 1XG5A 4FQ8A 5JAZA 5JY1A 3DBRB 4J0FA 4CMJA 1PJ2A 4GSLA 1DBVO 3AJRA 5TGDA 2EG9A 4TRMA 3EZLA 5A9RA 3MOIA 1LEHA 4NI5A 4AJ4A 1OBFO 1T2CA 1ZSVA 3I6IA 1HF3A 3RUEA 3W8DA 1FDVA 1A5ZA 2UYYA 3ZU3A 3NT5A 1Y81A 1UZMA 1Q7BA 1R0KA 2EERA 4MVJM 5A3VA 3DR3A 2E48A 3H5AA 4GKVA 2EWMA 3SBOA 5KIAA 2Q4BA 2CZCA 1T4BA 3GAFA 2HSDA 3AK4A 2Y1GA 1DEHA 4YDRA 4DC0A 1IL0A 2CD9A 3JD2A 3RU7A 1GDHA 1NVMB 4BNYA 4RLSA 1C0PA 2FP4A 3GNTA 5JSFA 2FRDA 4IZIA 4ALIA 1YDWA 2FR8A 1QSGA 4HFRA 2RCYA 5FYDA 1I8TA 5B4VA 2UDPA 2BGLA 1FMCA 1XKQA 2BI8A 1PWZA 1DIBA 3HB4X 1UZLA 1F0YA 1N7GA 2BFOA 3L6EA 2YHIA 3KTDA 4EJ6A 1HDGO 4L76A 1SEVA 3GDOA 1UDAA 5FFFA 4GL4A 4RVHA 3DZGA 2HK7A 4DPKA 4YJFA 3JQDA 4XYEA 4ZQHA 1LDNA 4OIMA 1LQUA 1OZAA 1SMKA 2QG4A 4DMLA 4K6CA 1MFZA 4ITUA 1IZ0A 2YV3A 4HNGA 5JYEA 3D3EA 1YB5A 3ON5A 4L8VA 3PHJA 4LMRA 1E7SA 3AOEA 2TMDA 3CTMA 3DB2A 2AE1A 1ENOA 2B0JA 2VT2A 2NQTA 4TSKA 2EW2A 3OJ0A 3ZWNA 5H81A 4MVJI 2H63A 1E1LA 2O3QA 3GGPA 4IXWA 4MJLA 4PZDA 2J3HA 4XYBA 4CR7A 3VVCA 1IPEA 4YBZA 3KYCB 4BO5A 3R3SA 3OF2A 3FPCA 1ZK1A 1K5HA 1XEAA 3QWIA 1KBZA 4J4TA 4XQGA 3QP9A 3AM4A 3VC7A 4ALMA 1JKFA 3GHHA 4AJHA 3VZSA 2IYPA
chains in the Genus database with same CATH superfamily
3WAGA 3LCVB 4MVWA 1QFZA 4X1KB 3DOFA 3RK1A 3VVMA 2ABWA 1J39A 3DVAA 2C78A 4DW8A 4C3OB 4QT0A 3PKZA 1T9GS 3CEHA 2GLTA 5BMOA 3WLJA 3PQ7A 5SYMA 5JWHA 4PFJA 1MVOA 4KOEC 1R0ZA 2VQ6A 3H18A 3U7IA 1U9JA 2B4KA 4JX9A 3HWRA 1G59A 1BQEA 2ASEA 3LLVA 4C14A 4RIGA 3N7TA 2FN8A 2OVFA 4F11A 2FK7A 5BRNA 4B7UA 3B6MA 5A03A 1T6BY 1U2SA 3WJ1A 3PDCA 2SECE 1UIMA 1UMDB 3N2YA 4HGRA 2Z95A 3PLAE 2OGTA 2NX2A 2WUVA 3IMGA 1KH2A 4WNIA 1YQGA 3Q7EA 3O90A 5IAEA 4DQKA 2BM9A 1JLLB 1YU6A 4WOCA 5J23A 2C5AA 4AURA 4K8RB 2VSNA 4IF4A 1M1YB 2GN4A 1X7XB 1YL5A 3MSXA 3P94A 3RSZA 3SAJA 3FPJA 5LC1A 4ARVA 3E9RA 1VJRA 4D42A 4GDFA 1LU9A 3C7AA 2IZOA 3QKIA 3MW8A 5BPHA 1H9CA 2G08A 5CURA 2VH1A 1NSYA 4N9QA 1Z0ZA 2XE4A 4MEAA 3OQMA 3MWJA 2J5KA 3V4SA 3P9NA 4OREX 4RPKA 1EFDN 1BGXT 1I51A 1RSZA 5E4YA 4B75A 4II7A 5AJHA 4LAFA 1F1BA 2HMSA 4UZFA 5FFNA 2ZR8A 4HADA 3VZQA 1Z5VA 5IWCA 1I4DD 3KO8A 4FFLA 1YS9A 1E2HA 4OLJA 2E0IA 2CMFA 2E6KA 2AFHA 5JXIA 1QIMA 1UINA 4NE9A 2C4VA 1UL1X 4B6PA 1JIQA 3MGGA 4ZCSA 5KC9A 1IOLA 1IY0A 3OWXA 4KQJA 5C0OE 1FSSA 1B2RA 1YA8A 2C0CA 1D2MA 1UP7A 2BBSA 4LISA 4BJ1A 2VXBA 5JW6A 3MUEA 3E22A 1S8NA 4MI1A 3S2UA 1ELOA 2AOVA 1NN0A 4DQVA 1Z4MA 3WWCA 3EZ2A 2HB6A 4M0UA 5EIBD 3TS1A 3UGKA 8ABPA 4N82A 3WB9A 3FSEA 4X3PA 5JALA 1L7QA 1KVTA 4XUDA 3OZUA 1EKXA 2I2BA 2TMGA 3JR7A 3SQMA 3FVVA 4LJKA 1YQUA 1RAIA 2HREA 1BW9B 1WF6A 3F9IA 2ZB7A 3KT3A 3P2EA 2ATEA 1YZHA 3IJEB 4JIMA 3NBMA 4YASA 4JI7B 1MB9A 2E87A 1HFEL 3AP1A 2PGDA 2VF5X 1J8MF 1NE2A 1WA5A 3DAGA 1NV9A 2IZ1A 4NJMB 5A6SA 4G84A 2FW0A 2FEPA 3NATA 1II0A 1JQJC 1QQ6A 4ALJA 2RE8A 3EMVA 4MINA 4MSUA 2B1RA 4QUKA 4E5KA 2X0JA 1PGOA 4IIFA 4BU1A 3UHOA 1TEXA 5F64A 2WWYA 4LV6A 2GO1A 4BQOA 4EJ2A 1UQRA 1QHHB 4TYYA 3HWSA 1J09A 2L82A 4FGSA 4FZRA 1JFSA 2A9OA 1HQYE 5ALMA 1V7PC 4XQEA 4E70A 3ZZUA 3PNQA 2XCQA 1L1QA 3TVDA 4NWIA 4RELA 4I8IA 2P9QA 1TAQA 3EPRA 5H7XA 4LN1A 4GLJA 1K4MA 5TC4A 1EJ0A 4LRWA 3KUDA 1G2QA 3VC1A 1S3IA 1UBRS 3R7BA 1SQ5A 4LS3A 3EWSA 1QANA 5BR4A 2EKPA 5AW2A 3N3AC 4NYMQ 4QGSA 2OM6A 1GNTA 1XXLA 2PBRA 3KCQA 3QV1A 5CCEA 3UJNA 4AKIA 1PUJA 3H9BA 3GYBA 5FJIA 2P9HA 4J7CA 2H8KA 5A9SA 2POCA 5FADA 1ONPA 3H8VA 3ONFA 2O5CA 2VUIB 1F2VA 1CJVC 3EZ7A 4GNKA 2D2VA 2R6FA 4DCJA 1QRSA 3KSZO 3NKVA 1Y7LA 2ADOA 1FMTA 3HEAA 4WJKB 2C4WA 2D1QA 1UOOA 1TNDA 2EGUA 4F3NA 4HQFA 1DRJA 2FWBA 3WRXA 3ER8A 4WEQA 3KZCA 1M33A 1TT5A 2Z5VA 1NUSA 2PUEA 3L9WA 3C1TA 3DMYA 4GYKA 1E4OA 3PDUA 4HAUA 1Z28A 3NJ4A 4X9XA 3KVYA 3LVBA 1R5OA 3L7JA 3EXAA 2FWIA 1G5QA 1EUDB 4UBNA 1N34B 1C1XA 4L7VA 1S8AA 3M4XA 3FGPA 3CCBA 1N0VC 1O95A 3OFND 4EG3A 1JR4A 5BWOA 3K5PA 1SQ0A 3VZRA 4ENWA 1FJHA 3GA5A 4FFPA 3AKYA 3K35A 4J3JA 4DIEA 3PFIA 2OHIA 2UXBB 5ENDA 4EIWA 1C7EA 3AR3A 4LSMA 3PNOA 4GPBA 1FYFA 2X5XA 1GPDG 4AT1A 4OQFA 1ESEA 1O6GA 2QI9C 3BQNB 4GLBA 4YJ3B 2PT5A 3QZUA 1L8QA 1D09A 4A8JC 5I7EA 2I4IA 1K98A 1RPAA 2WTEA 2WE8A 4FJ1A 4JGBA 2IEYA 4ZC8A 5JDCC 4XUEA 5TPWA 3RH0A 4OK5A 4DV2B 2IOQA 1JEQA 3CT4A 3JX9A 1H5UA 2BHSA 3MXTA 3COJA 2BDEA 3VHXA 3PUHA 5IEBA 2Q4TA 3P4YA 3JD0A 3GJ7A 3PFWO 4PO3X 3TSOA 3K31A 4BP3A 2P7IA 3I2IA 1DDOA 2BJVA 5ENZA 3KCNA 1KVRA 1PWYE 2CWWA 1TYZA 2K4MA 3WB1A 3R24A 4KAJA 5KYYA 4FBMA 1CUBA 4JXXA 4UHHA 3WLOA 5C5IA 3JQ9A 1KI8A 1KMHB 3M9LA 4M38A 2DGDA 2BMAA 1EP3B 3CLHA 1A4IA 5KYKA 2FP3A 1HZJA 1X14A 3H3XA 3H9QA 3P20A 4A9AA 1G6HA 3O8CA 5GZ6A 4PY2A 4TRNA 5DIFA 3QE4A 3WFIA 5I5GA 4H4DA 3W6ZA 3ULKA 2O7VA 5CM9C 1I7NA 3OE5A 1P44A 5K3OA 3R6DA 2D3WA 4H0NA 1N6LA 2XWJI 4MQ6A 5TGZA 3HKDB 1AXEA 3PEWA 2O3UA 2Q7OE 2N3ZA 3HXLA 3B7WA 1PFKA 4ENQA 3G2IA 4YJ3A 4CIVA 3TUIC 1ADGA 1J33A 1S2MA 4P58A 3UJDA 5AVWA 1WZNA 3L1KA 3LYUA 4N8DA 4AROA 4CF3A 2YIMA 4JJIA 4AZ0B 4GI3A 2IYRA 2FGJA 4RCZA 3TD9A 1JFFA 1QIHA 4DJAA 3KLMX 1NM5A 1N0UA 2PWYA 5EPUA 2CXXA 4TXMA 4O2BA 1F9AA 3MTJA 3IVRA 4G1VA 4K9NA 4NENB 1X1BA 1ENPA 4YRDA 4S04A 2E5LB 2ATVA 2WIGA 4K0RA 2C5LA 3DZJA 1ZK4A 4Y1EA 5T4BA 3WBBA 5HMMA 3C6KA 3WS7A 1YZGA 4B76A 3O26A 1NVXQ 4JK3A 4LUCA 3TL2A 3LXMA 4IHJA 2BSQA 2V7GA 2I4TA 4IJ5A 4HGQA 5DNUA 2PUBA 2A3RA 2WBLC 1L3CA 4KRYA 2DHCA 4W8OA 2FR0A 3ADPA 2X3UA 2Q5FA 3OJLA 1W34A 4QOEA 5I6DA 2BEKA 4HKTA 3KM0A 2WV9A 4RK6A 4E08A 4HOYA 1DP4A 4DCPA 3ZE7A 4YT4A 4GOXA 1JN0A 1LC3A 2GEDA 2Q46A 3N76A 2ZI5A 3TH5A 2EOAA 1E60A 2XUPA 5HBGA 2QMOA 2GTHA 1E9BA 2HQRA 4CLOA 5IT4A 3S8EA 3IC5A 1KFKB 1R12A 1ZVMA 1K7FB 2ZIXA 4ZJYA 2R6ZA 2JBHA 2ILVA 1AOXA 3L0DA 3L79A 3Q15C 4DL9A 1Z33A 1HE8B 1XKXA 3OLQA 2X0KA 1YA4A 4GBGA 2VNJA 4C30A 5KVCA 4AKHA 3N2NA 1EQAA 1G1AA 1NLFA 2XXAB 3W90A 2HQOA 4HYQA 1HDCA 1RWPA 1EFCA 2IFTA 2PUFA 4JT9A 2NUTA 4M36A 1NFFA 1EPUA 2HTEA 3B1XA 3F2VA 3GRRA 4MJ7A 4W7IA 5AJZA 5FNVB 4CKBB 4UNPA 1FX1A 1ATZA 1MIOB 1JQ5A 2OK7A 1CNMA 1LRJA 2UZ4A 2J0SA 1NBMD 1GGKA 2O2ZA 3GBPA 3V34A 1DADA 4JI8B 4HX5A 4XUCA 3WWZA 3DTTA 3RIMA 1PT5A 3EDCA 3NPAA 3MS2A 2A33A 2RDMA 3OEEA 1RAHA 2BVNA 3ISJA 3NT2A 2NU8B 3WG9A 3I2KA 5BSKA 4P7BA 3SEQA 1KDPA 3U7GA 2JHFA 3QVWA 3O4IA 3SDBA 3DLPX 1ORTA 3OP4A 1KU6A 1HG0A 3P5SA 3U5TA 4E11A 2AB0A 4PVCA 1CQJB 1OMOA 5JDCA 3N53A 4TWAA 2D3TA 2OCAA 3P27A 4GX2A 2WYVA 5K0TA 4RE6A 3SYNA 3LQ4A 4BZPA 1DNPA 3Q1LA 3GJ0A 1X7ZA 3UHPA 1KO1A 4DQLA 3DMTA 4HEHA 3M4ZA 1SXHA 1PT6A 1EP9A 4DZTA 2HIAA 4LZPA 2PGLA 1DBQA 4G9GA 2ZANA 4I5EA 1ZMXA 3DV9A 5IDQA 1NW6A 3JD1A 1RKUA 4PQEA 3S1AB 2H16A 3MWEB 2DTEA 2A88A 4M1SA 1CY4A 2C2OA 4A4DA 1JG3A 2AVDA 5JXJA 3BIFA 2XCSB 1GILA 1GA4A 3VTAA 1BGWA 1R8SA 4B6QA 3CO5A 3E0XA 3AEXA 2E5FA 5G4LA 4PZYA 3FDJA 5KYTA 3R3YA 2D7DA 1OLXA 2ZZMA 2RHJA 4GWLA 1GGHA 1R4MA 1ICEA 1NIPA 3ZS9A 4OBWA 1S01A 4MVJF 3TWOA 3R9XA 2I7DA 4EYQA 1AZSC 2PGJA 1YCHA 2ZREA 5HK9A 1L5YA 2DYKA 3Q2OA 2NU8A 1GZ5A 5L9AA 5LQUA 4KN5A 4JEUA 1NKVA 5F4BA 1PLLA 5KSPA 2QNIA 1MW9X 4A36A 3DMDA 1F3LA 2I7VA 4FKZA 4GVLA 4C78A 4Y2GA 4Q9JA 4EPYA 3BDVA 4U7DA 1W8IA 2N42A 3HXOA 1DWQA 5LP6C 3OPXA 1Y33E 2OBMA 2XUIA 5IDWA 5FNZA 3SZRA 2O5RA 4RESA 4J7AA 4NYIQ 2HRRA 1UC4B 1LPPA 2RIRA 3DV0B 5HKLA 2EF1A 5H59A 2C29D 4NPHA 3VTFA 3C3DA 2HWUA 1QTIA 4A8JB 2IJGX 3WRXC 1ZD1A 1Y1LA 1U8TA 2BKEA 2EFHB 2PZMA 1D1TA 3SI7A 4PC3A 3OIWA 1E1CA 1TTPB 5JPIA 2P4EA 4LJYA 1XWIA 1EMDA 1UODA 5CBPB 3A3OA 2QU7A 3BFJA 3HUTA 1EB8A 4LJ9A 5J2TF 4B9AA 3CX7A 3QY9A 3LQRA 4CQMA 4G25A 2W2MA 2FWNA 1A9OA 4IIGA 5L7TA 1QOPB 1ZBDA 3G5AA 2Y1KA 3MS7A 5TS2A 2OXIA 3VYUB 4ZXPA 1MFPA 4Q6BA 1P9OA 4KN9S 1TT7A 4IVPA 1RKQA 3Q9NA 5EYPB 5CFQA 2PPVA 3UMRA 3A6GA 4MW1A 2R751 4PCLA 4QUEA 2IX3A 1D0VA 1BYIA 2JAQA 4MQFA 2G1PA 3LX5A 2X2FA 3FNBA 3O8OA 2B9VA 5AKHA 1M75A 3VJMA 2ERCA 4JLNA 4DKJA 1F20A 4YO7A 4GT1A 3EG9A 1KRXA 2H51A 2O7RA 5FPPA 1E5QA 2BEWA 5C4IA 3EMKA 5KTOA 1YRBA 2IE8A 4KBFA 5CPFA 3EVZA 5JAOA 2O0HA 2WJVA 3BHNA 4PPYA 3GMSA 2YHBA 1Y8CA 1UFVA 4QGFA 4JLWA 1HT0A 3EVAA 5CH3A 5HRCA 2F1HA 3FYUA 3KJXA 2RBKA 2Z9CA 1U0JA 4R1UA 3HA3A 3ZGNA 5KJCA 1P1IA 1WSWA 2ID7A 3M5PA 2PWAA 5EKXA 2H92A 4GI2A 1AMNA 3HCPA 4YTEA 1M9NA 2CXUA 3X1KA 2MSLA 4EY3A 1R4MB 2PTGA 3I83A 4HFJA 1MO6A 1V8DA 3OFKA 4YJHA 3BG5A 2AKYA 1FZQA 2OHOA 3T35A 4LTMA 3OP1A 3ZCPA 1M2OA 1PNQA 1O94C 2WWRA 1VPVA 1I3MA 4PF1A 1FXUA 1HSOA 1U2PA 2BFFB 3V8EA 3PWKA 1DAIA 3UENA 3P2OA 1GLNA 1E0AA 1CZNA 2PX6A 2H52A 3MBKA 5EXTA 2UUCB 2R8BA 3WL8A 1TECE 2V3VA 3RHZA 4PZEA 1ZH8A 3LPDA 3W8FA 2H8GA 4IILA 3PHBE 3WADA 2OCIA 4TMZA 4PNZA 3EEYA 1MOSA 4RZIA 5D84A 1YRWA 2QX6A 3O4VA 4B47A 4DT1A 1QB7A 1Z68A 2RHGB 2HCFA 4YUVA 3MJCA 4R68A 1USIA 4UAJA 2O50A 4GECA 2PLAA 5A3JA 4U3JB 3IAAA 1HFKA 1RD4A 1T6ZA 4QATA 2XUAA 3U1BA 3PC2A 2WUGA 4MVJD 1EVIA 4RF2A 3EIQA 2ZRNA 3S55A 3HSKA 2FWJA 1PR4A 3EXIA 3TW8B 2VWGA 4PGGA 2VJMB 5KHLB 4J7UA 2B2CA 1E92A 1W4AA 2VPYA 4CG1A 3OPYI 2AEMA 5U4QA 1ZMOA 2XYQA 3GZNA 1XQVA 2IYZA 3QLUC 4WXMA 5FI3A 1WZ2A 1MDBA 3B12A 2AV6A 4NS4A 1PEAA 5TMEA 3CZAA 3HKBA 3J81A 1OH8A 3BKWA 2ZYSA 4BVHA 1WUJS 221PA 3MNFA 4GE3A 3L4BA 3UPUA 1E3MA 2VYCA 2BUAA 2PNFA 3DL4A 3ED5A 1MUUA 3G8BA 4L3WA 4Q1VA 5B3KA 1WR8A 1E2IA 4RMJA 3PXDA 4XYGA 3AILA 3PFNA 1Z4KA 4O08A 5EEGA 3WV4A 4M0DA 2HT1A 5PNTA 2X6QA 7MDHA 2OBLA 1DO8A 1OAKA 1OI7A 1YRLA 1F2DA 2H00A 3L7MA 4J1TC 3THXA 2LUOA 1NW5A 2NUPA 5B4UA 5FUMA 4FLEA 1XQ6A 2VPZA 2R25B 3BGVA 4B3CA 1DELA 1M0WA 4J0JA 4NESA 1NMQA 1M2WA 2QMYA 2X14A 3BH0A 3QPCA 1MGOA 1P6QA 3DBHA 4DA6A 3BIOA 3GC6A 1MO5A 4UHFA 2CNLA 3FNHA 4ARCA 3ACBA 2RJNA 4DTIA 4W4TA 2DOKA 1NZJA 3DZBA 3GEHA 2XUHA 4PZ9A 1GA1A 2GCGA 2QDXA 3C24A 3UK6A 1QZ3A 4YUXA 3RVBA 2B35A 2MSEB 2QS9A 5IBQA 4HGPA 1H42A 3UV3A 1GV0A 3TW8A 3UXHA 1K66A 1TM1E 3FDIA 1YQDA 4QOSA 4U8HA 1HE4A 3RSCA 3H42B 5LVAA 3E7FA 1J8YF 3B6ZA 1LDYA 2X0EA 3LGSA 4HQRA 1TZMA 4JU9A 4UE3S 1MOZA 2JAPA 1C8BA 3KBOA 4K9OA 1YC2A 2HEIA 1QKKA 2B1IA 4YRCA 5F7JA 4II2A 2ZUBA 3BHMA 1N6IA 1RAFA 3VR2A 1MO4A 2FFHA 1W25A 3RRJA 1RC1A 1YL6A 4LXUA 2DQYA 3V3TA 2PJZA 2XNKA 2QVGA 3CRNA 5I7VA 3FDFA 5AVJA 5JSQA 3RV3A 4R2KA 4G1MB 1VL1A 1QBGA 5AHWA 4A73A 3HCWA 4QZVA 3BJZA 4J03A 3G5LA 1GYPA 3T6KA 5JJBA 2E4VA 3O6VA 2H9IA 3PC8C 1NUAA 3PT5A 4UTVA 1A76A 1O96A 2VPXA 2YL2A 3RI3A 3DSRA 3SJ7A 5C46F 2C7PA 2GK3A 1BE6A 3IBCA 3M1IA 2B7LA 2QB5A 4FFOA 3U4QA 4MPRA 2YINC 2OEPA 4KCGA 2C5FA 1BTOA 2ZYRA 2C7BA 1XAJA 5DYYA 3I42A 2VJMA 1REQB 1BHJA 3IQEA 4Y7DA 1FP1D 3QMPA 2JLQA 1XWWA 1NQUA 4IIYA 2YJ3A 1RE1A 1GN9A 3IPYA 5I7RA 5LMUB 1PJ4A 3B89A 4K9PA 4X97A 3BTVA 3IPRA 3OZWA 3G2OA 5IRCD 4KXVA 2WQ6A 4FKBA 4FMDF 3U1VA 3LT5A 4PLFA 4Q82A 5CB8A 3TX6A 2X9GA 2ZUUA 2F48A 3IP5A 4UEOA 4Y2JA 1PLKA 5DTRA 5LU9A 3M83A 3MTGA 3I8OA 3T9DA 2HU8A 3SKXA 4IGFA 3I4FA 2BE7A 4E51A 1NJ1A 4BEBA 2AYZA 2GXSA 1FMJA 2QVLA 3EGOA 4MW2A 3CNNA 5ULLA 4TXNA 5I7FA 2I80A 4WA7A 4X85A 7REQB 1O89A 1PIWA 2G06A 3OZDA 2I03A 2F8LA 2FSGA 4PZ0A 5TGTA 5I7WA 5KYNA 1XPUA 1ZEMA 1KBQA 2CT8A 1FQJA 3I61A 2IEZA 4Q3CA 5E7IA 2H0RA 2HH9A 4DB2A 4WQMA 1N1MA 3R4CA 4XR4A 3E5HA 1PV1A 4M0EA 1Z56C 3TBFA 4U1RA 1YRYE 5KDOA 2I1WA 2W6QA 3R5JA 5DIZA 3UAYA 2CNWD 3MCUA 4HWRA 4HDCA 1PWHA 2WY2D 4CEJA 3PIRA 3JAKB 1X9HA 4FCTA 1R37A 2C7VA 1RIFA 1LTHR 3L92A 4HDOB 1CVLA 3EVNA 1G8GA 1UEJA 1GZVA 3G2KA 1MB2A 3LPLA 4V0NA 4WKNA 4DMMA 3V4PB 5L3SA 2I9PA 1QHGA 3F1KA 3W2HA 5IUNC 3GCWA 4HVCA 1YDEA 2WVHA 3KPUA 1SK9A 4XVQA 1D8AA 4P4SA 5FR1A 4YGXB 2EQ5A 4MVJP 4OFBA 5D3ZA 1Q2XA 5JCOA 2XIQA 1E99A 3ZDYB 5EJ9A 1B6RA 1P2SA 4EFKA 4LRXA 1HLDA 1L1FA 2HJHA 4BJHB 3IJ5A 3K0BA 1Y8QA 3N2GB 1BXGA 1UPCA 4FZVA 1PR0A 1HORA 1EXWA 3AI7A 4FOOA 3ZE8A 2G9RA 5JZOA 2VFAA 4CTOA 4CLRB 1L7MA 5LB2A 3EQ8A 1L5VA 1AKVA 1W49A 1QGUA 2W42A 2D4HA 2PAAA 3ZBPA 5LQMA 4YRTA 4RF4A 3HNPA 2E55A 2VHJA 3PV0A 1C0KA 1SUWA 5J4LA 2YMPA 2V0GA 3KX2A 4QDTA 1HK7A 3I32A 1TM4E 5AKIA 2QTLA 5H02A 1N6PA 1ODFA 1X77A 2ECOA 2I4RA 2GAAA 3RKUA 3ND9A 3VR5D 3WDLA 3MSCA 4ZI2A 1GAJA 2GRUA 5BUZA 4O6VA 1KIAA 3LKDA 3X1YA 5ALGA 2ORIA 4WE3A 3P9SA 1YQWA 3O8LA 5BRJA 2XGMA 4HWPA 4RV4A 4N3CA 4QGBA 5EJ4A 1L4LA 1E5TA 1H2WA 2MINB 5HPYB 5JHHB 1CLUA 1XQXA 4L1KA 5GADl 3OTQA 3OCVA 4Q3EA 4DWVA 4MCAA 1H2FA 5TDHA 3W5HA 2FQ1A 1XRSB 4HYTA 4R5MA 5EJGA 1GXSA 3STUA 2J5RA 4RVSA 1A9RA 5HF8A 1V7ZA 3LZ6A 3K09C 4IDNA 4XRGA 1AA9A 1V5GA 4O2AA 2AWNA 2PGNA 3L8DA 4JB2A 4B3IA 1MEJA 1AHHA 1PKXA 3QVKA 2GZ1A 2QZSA 3RG8A 4R1TA 5FP0A 1LDGA 1L4HA 2JI4A 3H6KA 4TTTS 4HGOA 4AUMA 2L17A 2GF0A 3ESZA 5KX5F 1JDSA 2Z43A 3BIJA 1XJ5A 3ZK9A 2Q62A 3O8QA 5D85A 5GJCA 2VUTA 4ZQCB 3DF9A 1U98A 3KYBA 2VRNA 2PD3A 4L5JA 2BZGA 2V3CC 3NHJA 1PD1A 4ZYYA 2MR6A 4R1QA 1SQ6A 1GPAA 1SC6A 4OPMA 2GAIA 4Z9YA 3DDSA 4CPDA 2BFWA 3CJRA 1RQ2A 1XMXA 2Q6KA 1Z6PA 1UMKA 4OGWA 4P9NA 4A92A 3UWPA 1HTBA 1EIWA 1ONBA 1PZNA 3AUFA 1V4VA 1Z2NX 1QHFA 3QF4A 3RS9A 1SHKA 1ZD8A 4YIHA 3KYJB 1YVPA 5FQNA 1WX1A 1J1ZA 4JI6B 3GPCA 5F3RA 3GLFB 1G55A 1E66A 3FCYA 1H8EA 3K5IA 4ANFA 4AULA 1HDXA 5BVHB 1HC7A 3FRHA 5KDDA 3L7DA 5DSZA 1A4UA 4S1TA 1D2CA 3CUTA 3F2IA 3EA4A 4QRHA 4FI3C 5CK5A 4JI4B 5JFOA 3F3YA 1YD7A 3HUUA 1QAOA 4Q7MB 1OC2A 4QJBA 3QE2A 2HUPA 3TCXB 3SBDA 4E2FA 4D8VA 4TL6A 4C87A 4FXOA 4DAOA 2VKTA 3QXCA 3COPA 4TWIA 1Q0RA 2VF8A 3FLBA 4HSEA 4BBPA 4B73A 4IRUB 1YKGA 1Z4JA 3ZIAD 2BHNA 2GK6A 4P4TA 4BMCA 1V9LA 1D4ZA 3PI6A 4E33A 1E9DA 2J3MA 2PO7A 2V58A 3Q11A 1IYZA 1L8XA 2ZIXB 3K2QA 5E6SB 4R8KA 5HZMA 1RZRD 4PO9A 4PLPA 1I2AA 4MP8A 1ZZEA 3FFXA 3WLSA 2H5JA 2WJHA 4UEWA 2HL6A 4BNXA 4O33A 4GI1A 2C5GA 3L2OB 4Y2QA 1U3GA 4OGGA 5K3BA 1GQFA 4JBNA 3R0JA 4EQ6B 1PZHA 5K20A 2PUDA 4WTOA 5AVVA 4KDCA 5DNYB 3ZWNA 1I4LD 4RD6A 4XYMA 4WHMA 4AS1A 2BUBA 3VR6A 5J47A 3GJXC 2ZUFA 4P3YA 2FUCA 5JARA 3E6AA 3EW9A 2OPHA 2WHQA 2YYZA 3GPBA 3UXEA 5LNK1 5HSGA 1JEQB 3FYTA 1SBQA 5ALOA 2WA2A 4O1IA 1FFYA 4U7GA 3EHDA 4KNWA 4LQ4A 4HT3B 1FB5A 1QCDA 1U0TA 4A0RA 2VYVD 5KC8A 4KUHA 2YRFA 2ZRGA 3HFRA 4KO3S 3LK6A 4JI0B 1QR6A 1ULZA 4ZOLB 1WRBA 3NC0C 4KXFB 1VGQA 2ZB8A 2BY4A 1I1NA 3REOA 4GYWA 4LKRA 4QBGB 1GQ2A 3A6KA 5JAUA 1RLJA 2ZWAA 1AV6A 2O1EA 1CU1A 1P33A 3GD5A 4DUYB 5K0EA 1A71A 1G5IA 1KYZA 3QE9Y 3SM9A 1YJBA 3DUFB 1C9DB 1RBQA 5F1OA 4PSVA 2JEYA 2GBPA 4EB8A 3WMFA 4NBUA 3AONB 3W04A 4B80A 2WHPB 1OFTA 1RYZA 4LJ8A 4O1HA 1EX7A 5AM4A 3QELA 3UJCA 2GSDA 4H18A 4QBIA 3ZHZA 3H1TA 2BIFA 3OMLA 5DXFA 4EQ6A 2CC2A 3FSGA 5AR1A 3S29A 1XMPA 4HXYA 4TKZA 2CLLB 4B4KA 4EVIA 2NNLD 3A58B 3EXHA 1MJNA 2BKXA 4RAOA 1VPEA 4UTZA 3SDSA 1YJ8A 4DMCA 3FCXA 1Q0SA 2WTUA 3RIYA 4W9NC 4BBZA 4YI5A 5GP1A 1KETA 3PFGA 3E3NA 1JR6A 1D0SA 2YVLA 3DAHA 5LA6F 2OCGA 4RMGA 3TSYA 5EE3A 3L6BA 1M2NA 4NENA 1GAXA 2O2YA 4PYRA 4AO7A 3OA0A 1U3CA 3GQBB 4Q9DA 1KZ9A 5AW4A 2P4UA 5HQ3A 1E8MA 4MR9A 1IQPA 5FWDA 3R7FA 3JD4A 3ZE1B 4INZA 3UUWA 3C3MA 4WGFA 3O9VA 3DVLA 4XLTA 3KKKA 3P0HA 5K0JA 5JAHA 4JEHA 4WV3A 4PZLA 1MRNA 2N0SA 5JS2A 4NTZA 3DBRA 5AHKA 4OEHA 3K6KA 1V48A 5IDXA 4L72A 5EZSA 1V35A 4CMEA 5LD2C 1WQ3A 2EX4A 2WHPA 3CW9A 1KY2A 3GARA 3ZV5A 4B32A 5FPKA 3GCDA 3C3JA 3ILYA 4CUJA 1NJ5A 4W8GA 4R01A 2CF5A 5EIHA 1C81A 2JIZA 3PGVA 1UJ4A 2OA0A 3HWWA 1J6UA 3K0AB 2OCLA 5BXYA 4H3SA 1GNVA 3FKSD 4JGIA 4G07A 3ZY2A 5IAAA 3WNQA 2J32A 3Q7QA 3VU9A 1H8ED 3IV9A 4BNIA 5CLGA 4A82A 1DC4A 1E5VA 3BXHA 4OJMX 2BFCB 3U7EB 1S0UA 5A9TA 3IX7A 5JRJA 3ESYA 4Z4GA 1J56A 2XADA 2YHAA 2P8SA 4K9QA 4MS1A 2PVSA 3I2HA 3OCWA 5EPEA 3UGTA 5KU7A 1B15A 1MIOA 5D87A 4WIAA 5FOXA 4EHFA 1ZLXA 4RGVA 2NU7A 4PPGA 4KGVA 2ZJ6A 3THYA 3LWDA 4UM9D 3F47A 1VSVA 4ICIA 3VPAA 3GJ6A 3OCZA 4GP6A 3TXAA 4C3VA 5EE1A 2Z9DA 5C1PA 1CFJA 1D2AA 4H4CA 4D0SA 1ID8A 2P3QA 2OHVA 1J5PA 5BYBA 3TNJA 3LHDA 4YUZA 1MPXA 2P3LA 1OA1A 1HE1C 1UDWA 1Y3CE 2Q6LA 4FB5A 5E1DA 4IIBA 4HRVA 1RYMA 1JECA 2IT1A 2JIOA 3FCUB 2ZQZA 4IG4A 1N8SA 5TF0A 5G40A 3GMIA 4BATA 2VK8A 1LS1A 4UEJA 2I6FA 1NRXA 1RYHA 1U9ZA 1OKKD 1KVUA 2YBDA 3WVNA 3SQDA 4Q4LA 4A2CA 5I9SA 4MA5A 3ESAA 1B2LA 4UZSA 5IU6A 3PHLA 3LY5A 4AS3A 2OOKA 5BNIA 2FQXA 2TRSB 4ND8B 4CMIA 2P2YA 4WGGA 1D1PA 3M8KA 3W3AD 5FH9A 4V3BA 4B9EA 5IM5A 2CLIB 2OP0A 3KQVA 2XNSA 4DPMA 1F0PA 3MWEA 1ADFA 4X54A 4Q37A 4AJ1A 4EPVA 1C30B 1E64A 2IKSA 3EFHA 4D82A 5IX8A 2FKNA 3AUKA 1P1HA 2P7HA 3EGWA 3NEAA 4JKYA 5D8DA 5A3SA 1GOTA 4BN4A 5AVZA 3K72B 3DZIA 1DAEA 1ZSYA 5JO0A 3KQMA 3U61B 5AK4A 3UAZA 1FFCA 1OXXK 1M8PA 2HQ1A 2KS6A 1KJIA 5ALSA 4AJPA 5EKSA 2VYQA 4HRAA 4JUIA 2Y27A 4IWXA 4HUJA 4FHCA 1RI3A 4IHJF 4CMEC 4YC7A 2VC2B 4XZ3A 2D5CA 1Y3AA 1F51E 1E1RA 3H6HA 3K1JA 3LBNA 3MWGA 4HEA6 3KEFA 5CVEA 3I9LA 3SD7A 3NHZA 3AMVA 3S81A 4DC9A 1C7IA 1N2CB 3GLVA 4JBHA 4KFUA 2YRXA 4MV6A 4RF3A 4E7PA 1Y9ZA 3AHFA 4PNPA 2PX5A 1SRQA 4KXMA 1LUAA 4MDYA 4HB3A 1TZJA 3ZUPA 1HBJA 3LHSA 5EIFA 5KNCH 2Z8YA 3VO9A 2H2GA 1P72A 1EVEA 1BFKA 1Z37A 1TMGE 3GEGA 4MVJE 4OY3A 2HKIA 3SP1A 4YRBA 4FJ0A 2L69A 4WKGA 3RVOA 4PR3A 1QLWA 1PD0A 3E53A 4OXKA 3W8EA 2GHQA 3DVRX 5C32A 1V3TA 4LRQA 2YVUA 1V16B 4S24A 1JTFA 2XYRA 2A5JA 4E2WA 4B85A 1YR8A 1RRKA 2I29A 5SZIA 3THYB 2AXQA 3IE2A 1U3WA 2FH5B 1RWWA 2B4RO 5ILGA 3KUCA 1ILWA 2YH2A 1X15A 2OWDA 1NP6A 3CF2A 3R6WA 2JLVA 4HGNA 3BORA 5KZMB 1UJ2A 2DJIA 2K7FA 1JILA 4ER5A 5KOHA 2VHUA 4YCJA 3S4YA 2DFLA 1H8HD 3FX2A 4GEKA 4TXJA 3HDHA 5AM1A 3OTIA 3TNFA 1D6JA 1DLJA 4B7AA 5GINE 1DQSA 3C43A 3C5WP 1NJSA 3KPVA 4ARZA 4NCBA 1JTVA 1I24A 3MPUA 1G8KA 5EHGA 3RFCA 2O52A 3DE4X 5BV2P 2IWRA 4KP7A 4L8WB 3D6MA 1IRXA 3IELA 3B51X 1Y9JA 2H06A 4KE7A 1WVIA 2ZI9A 3G2PA 4TLCA 4D4MA 3U6KA 4GBMA 2CBGA 4RPIA 4YRKA 3X3HA 5K6TA 2Z1MA 4NYIR 2OV2A 1ISIA 3TZLA 1D5CA 1XDUA 2IYVA 1VZ3A 4BAGA 4BRSA 2RB5A 3AB3A 3GEDA 2PZKA 1QFYA 3VVBA 2Y76A 5LLDA 1C30A 2P27A 1VPLA 2WFZA 4J2OA 3UJHA 1I4WA 4YRIA 4JXJA 2Z5LA 1TLTA 1Z2EA 3NVDA 5LSAA 5IYZA 4JJ7A 4KG7A 1VTKA 2DTXA 3C97A 1XRQA 4F4DA 2QW8A 2P0YA 3GPDG 4X7BA 4BX8A 5C53B 3IXLA 2PH7A 4JP2A 2ICAA 2NUAA 5EWJB 3OLZA 1T3ZA 1YHZA 1K3TA 1RM0A 1AF4A 2WF7A 2X9QA 5TPZD 5G1PA 4P92A 5KJ1A 5JSUA 4QKQA 2SCUA 4FONA 2OKGA 2VNAA 1YV9A 4C4ZA 5MGBA 4EUEA 3C3PA 2UYGA 2IP4A 3ENQA 2DKOA 3Q4GA 1YR6A 5THKA 2VF4X 2GZMA 3H2YA 5AK6A 3UCEA 4G5RA 3S2SA 1LVUA 3P2KA 3PSHA 1P29A 5IC6A 4HQLA 2X41A 4C76A 1CF4A 1RMTA 2C31A 2Z3ZA 2ZJ4A 4BQPA 3T3NA 3DC7A 3QVJA 3FOWA 2EVWX 2X22A 3NVMB 2G1KA 2ZM5A 2P41A 3D59A 1QHEA 5GAJA 4BBJA 2QBYB 1TCBA 4CV3A 1ZG3A 2FJUA 3KFLA 1YA6A 3D7SA 3NU1A 3L0YA 4MV5A 1NKSA 3LKBA 3R0XA 2NO4A 1C7JA 1GTJ1 4IV8A 5BSEA 5ERYA 5K0BA 4E2ZA 3U4DA 2AN1A 2YCLA 1X1SA 2BR4A 3A70A 2JVIA 3R7AA 2BW0A 1YJXA 4P3KA 5EQTA 2PMBA 1PE0A 4BO8A 4EKNB 1ZCFA 4EWLA 4DR3B 1Z0DA 4C0XA 4CMCA 5BSHA 2QVXX 3IUEA 2AHRA 2RH5A 1F7VA 1BWRA 1AS3A 3JALA 1WKCA 5IT5A 2X86A 3EZFA 2HF7A 4RV5A 4NDNE 3KQYA 1UXHA 3K5WA 5NULA 4PX5A 3LO8A 2QU8A 1GO2A 1C9YA 2PFKA 4EA6A 2EYQA 1TIPA 3QQPA 1VDZA 1XA4A 1SEPA 2Y0EA 2Z0MA 1PG0A 1SKBA 1KIFA 4GG1A 4BNJA 1T8PA 1E5LA 3VR3D 1XELA 3BB4A 2PX2A 4FFRA 2B8TA 2W0SA 2G40A 3LQQA 3REQB 4YJ2A 4DGSA 4EHKA 2FMUA 4K2AA 5D5QA 5FUWA 5CHEA 5DLPA 5E95A 1VHWA 2ZIWB 3AZQA 1ZOOA 3BS4A 4J4HA 4MI3A 5CGQB 4ZVUA 2CLDX 2GHTA 2P5TB 3TKYA 1GGNA 4PQYA 3V2IA 2JEZA 1RXSA 1XLUA 2RGCA 3KT8A 3BBPA 3V9AA 1B26A 4P6VF 4Z51A 3DDZX 4OMDA 1G291 2J9XB 4WBXC 4YN3A 4A3SA 5DWVA 3D3JA 2D06A 3L07A 4JUDX 3BXGA 2DPHA 3S1LA 3OE1A 1Z4QA 3B2QA 1PAUA 3PE6A 3OQBA 2IHTA 3DXXA 4RQTA 3L0PA 2VP6A 4R51A 1DJOA 1U1CA 2FZEA 3QA9A 3MIZA 1FTQA 2DT5A 2ZI3A 5BT8A 3K0EA 4E5DA 2JDID 2PJUA 1XMOB 4QULA 3RWBA 3UQZA 2D0IA 3U6BA 5HYVA 2AYXA 4JUCA 2H7YA 1FTNA 3LTEA 4FTWA 3RIGA 3O8BA 3QFFA 3FNRA 5HM6A 4I1SA 5K09A 3LHIA 2E4ZA 2IDMA 3NDJA 5GJBA 1STOA 2R1VA 4AMYA 2GN1A 3FZQA 1MABB 3UCFA 3IIKA 1LZKA 4J76A 1FSFA 3LVRE 1KI1A 1GL6A 5JCPA 3SKVA 4C0HA 2IU6A 1JDVA 1S8FA 2VYND 1RP7A 2XAAA 3MB5A 4LV5B 4RVNA 1RXUA 4W5JA 3HVIA 1QP7A 1QFJA 2CMDA 5JVDF 2V5VA 3ZXXA 1L4NA 2GKSA 3E7WA 3LV8A 1A27A 1DUVG 2QSJA 2ZK7A 3DXYA 4RM3A 5DX0A 5LOVA 1UOEA 2B4QA 1P2TA 3FTDA 2B1GA 3HRHA 4LGVA 2OILA 2O7QA 3RBAA 1M7HA 3UPDA 1BQ3A 3AI3A 3NDPA 4L27A 2FMHA 4YROA 4D41A 1CUXA 1NG9A 2IY9A 3SNHA 1ZM7A 1QQBA 4PZUA 1YUNA 5KYWB 1BDBA 2BONA 5D6OA 4LYJA 1X1DA 2ZTLA 1YTUA 3B70A 2E85A 4TQGA 1A9ZA 3FPKA 3LJKA 4RVFA 4RBNA 4Y6PA 1TA4A 1M0SA 3U4CA 3BWXA 3QU7A 1KMCA 3CF0A 2OQIA 4DYHA 3AHHA 3AFIA 3GT4A 5JU6A 1HFJA 3OY2A 5KVVA 1JSXA 1DVRA 4BB9A 4O4HA 4BPBA 1NI3A 3CG4A 3ICCA 4EKGA 3CR7A 3AF6A 1EUCB 1XC7A 1C2YA 2BHLA 3CURA 1JXMA 3BGWA 1E1QA 4XKJA 3VPCA 2QJOA 2Z8YM 4BNDB 1W29A 2W6ID 1GRNA 4LGCA 2ZRMA 3P2JA 5LQDA 4LJSA 5KTPA 3FETA 4DNQA 4WK6A 2PRKA 1SKMA 2UV8A 4UDNA 2ZJYA 1UJNA 3UHJA 2JGEA 4GLOA 1SBZA 1B93A 1YE8A 1Y98A 3A2MA 1TI7A 2KB0A 3H65A 1Q6ZA 1B3RA 1BFUA 1P2FA 2QMEA 3P2YA 4QD3A 3BQMB 3ER9A 3REQA 5KMGA 3Q12A 4ZV4A 4QYIA 3TLGB 5BMVA 4DSUA 3ZR4B 2I5PO 2PSDA 3D3WB 4MYRA 4P35A 3ZGYA 4J07A 3QMMA 3LBHA 5A06A 4UNIA 5AD1A 3FSJX 4H60A 5DT9A 3VZCA 1FC0A 2EF0A 2VHQA 3TZKA 4LFAB 3W9UA 4LOJA 4JNKA 4L6IA 5ERGB 4B82A 4OI0A 3WGTA 5JZBA 2J6IA 1G42A 2VAXA 3ZLVA 4E12A 4WCVA 3V80A 4AB1A 4C4RA 3CRMA 3WLTA 3EYWA 2P9YA 2R6JA 3QFTA 4X44A 2PL1A 4KPEC 1P3Y1 2R6R1