4GLOA

Crystal structure of a short chain dehydrogenase homolog (target efi-505321) from burkholderia multivorans, with bound nad
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
258
structure length
258
Chain Sequence
MDLNLQDKVVIVTGGASGIGGAISMRLAEERAIPVVFARHAPDGAFLDALAQRQPRATYLPVELQDDAQCRDAVAQTIATFGRLDGLVNNAGVNDGIGLDAGRDAFVASLERNLIHYYAMAHYCVPHLKATRGAIVNISSKTAVTGQGNTSGYCASKGAQLALTREWAVALREHGVRVNAVIPAEVMTPLYRNWIATFEDPEAKLAEIAAKVPLGRRFTTPDEIADTAVFLLSPRASHTTGEWLFVDGGYTHLDRALV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
publication title Crystal structure of a short chain dehydrogenase homolog (target EFI-505321) from burkholderia multivorans, with bound NAD
rcsb
source organism Burkholderia multivorans
molecule tags Oxidoreductase
total genus 95
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2012-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4gloA00
3WMWA 4J4TA 4WLVA 3RC2A 4CM5A 3G1UA 2JCXA 4R5HA 1KBZA 2GGSA 5C3MA 3BMNB 4UUMA 4Y8VA 2OORA 1XYGA 2UAGA 4GX0A 1X7DA 3JQGA 2BKAA 3H9JA 2VNAA 1RM4A 2O4UX 3P2YA 3LLVA 3MJTA 2H6EA 3I1JA 3ASVA 2NUAA 3L0DA 3LVFO 4NBTA 2PWZA 3V1UA 3UCXA 2I3GA 5JO0A 5F5LA 4MP8A 3SC4A 4L4SA 3SVTA 4BGEA 1KY5A 1P1HA 3M1AA 4MIOA 4MINA 3ZHXA 3K92A 4JJFA 3W4JA 3ZN2A 1KEWA 3EYWA 1PSDA 2OO5A 1NX6A 2ZB7A 3F46A 4RPGA 4BNKA 2EG9A 3HJAA 3S55A 1N92A 1WDKA 4MVJD 4L4XA 1B26A 1P31A 3NGXA 3CZMA 5JE8A 1PGQA 4PLTA 4RPKA 4EEXA 3INTA 9LDTA 3VDQA 4XX0A 4WASA 2GPTA 3UKOA 1UAYA 3ABIA 4TRJA 3SX2A 1B15A 3PYLA 4XZ3A 5COQA 1LSUA 2PZKA 3C1OA 4DA9A 4IZIA 5BR7A 1HETA 4OKNA 1R0KA 2CNBA 3O8QB 2VYVA 1NQOA 1NP3A 3KM0A 4DTIA 1LXCA 1M66A 1B8VA 1I3KA 2ZATA 3DONA 3EDMA 3KVOA 2C7VA 3EY4A 3WGHA 1V8BA 4RZIA 4P4LA 3E82A 3NAQA 5JC1A 3AFNA 4EITA 3D4NA 5MDHA 2AE1A 5THQA 1AGNA 1HYEA 1P77A 1U2DA 1HE4A 4CV2A 1CF2O 4N18A 2HCTA 2NQTA 3E6AA 4HXYA 5TNXA 1P74A 2VHZA 3GY0A 5K9ZA 1GL3A 4JJGA 3H5AA 2VOEA 1E3WB 4B7XA 2EJVA 2CUKA 3H6KA 3V8BA 4CM4A 1QLHA 3EUWA 4JGBA 4EJ0A 3NTRA 5ICMA 1TLTA 3OIGA 5A1TA 1NR1A 1ULUA 1UR5A 3OETA 4D79A 4R41A 1PJBA 5ILOA 4II2A 2GN8A 4DYDA 1J4AA 2RAFA 1V0JA 5DDIP 1DBVO 1U2GA 2DTEA 3U4IA 3JQAD 4YJGB 2WYUA 2FRDA 5AYVA 5JSFA 3L6OO 3V1TC 5JAZA 2JD0A 2FWMX 1RYEA 2FHSA 3LLSA 5AQ1A 2FZEA 5TS3A 5HBRA 3JD4A 3TZCA 4ESOA 1RWBA 4UAGA 1DRWA 4ZA2A 5F3RA 3WIEA 5T8KA 3BA1A 3OEYA 1U4SA 1P1FA 2Y0EA 4I8XA 5FI3A 4UEKA 1HDRA 4AJ4A 2X0RA 1JA9A 2C7GA 1JU9A 1PGOA 1ZZEA 3TZ6A 4TWRA 4B79A 1U5AA 3JYLA 4ILKA 3RBVA 1RYDA 3OBBA 1E3JA 1ONNA 4RF3A 4MVJM 1BG6A 1Z7BA 2BLLA 4A7PA 2WTBA 2PKQP 3I6IA 3W1VA 2A92A 2ET6A 2QZZA 4O1MA 3VAZA 3FI9A 4J6FA 1IHXA 3GNTA 3DBRB 4IDGA 4R1UA 1HWYA 3WQQA 4CQLB 2B35A 4B4VA 2Q4EA 5BT9A 3RWBA 4RQUA 3U3XA 4OGWA 3FNFA 4ZQHA 2E82A 3N74A 1AHHA 3W8EA 1LJ8A 3PRJA 3SLGA 1KEVA 4GKBA 3KYDA 1NM5A 1HDYA 2BFPA 4MP6A 2P68A 2BD0A 1PWZA 4OQYA 1EUDA 1KVTA 4HKTA 4F3YA 1SB8A 4YRBA 3JD1A 3JQGB 2HUNA 4NBUA 4H15A 4AVYA 5TIIA 3INRA 1T2CA 1XU9A 3GT0A 5EESA 5CDYA 5MGBA 1D1SA 3HQ4O 4PLHA 1V3TA 4D46A 4BKQA 3HDQA 2WD8A 3CPSA 1B7GO 1GEGA 4ZQBA 2HU2A 3QVTA 2FZWA 2I65A 4JNKA 4QECA 5HTOA 1E6UA 4DIFA 3FWNA 5F1OA 1JDJA 2CSUA 7ADHA 3MTGA 3DTTA 5EL0A 1QP8A 4OYRA 4MOWA 2ZJ1A 2DBZA 1N1GA 1S7CA 3BTUA 3IDSA 2CFCA 3AFMA 2IODA 3S1LA 4L74A 1MP0A 4W9NC 1MXFA 2D59A 3JQBC 4CMKA 2NTNA 2UUOA 3L07A 1M75A 3AY3A 5H82A 5HM8A 1HZZA 5G0VA 3LF2A 1EQUA 3NT5A 4CM9A 3R3JA 3ZI0A 2GO1A 1ZK4A 3NTQA 4FBGA 5A3JA 2I66A 5B1YA 2O3TA 4RVFA 3S8MA 1NQTA 4LISA 4KTTE 1NBOA 4RZHA 1HTBA 1VJ0A 2D1YA 3OQ1A 4AJKA 1X1TA 3D3EA 4I5FA 4BNIA 1DB3A 1YBMA 3BMOA 3M1LA 1UDCA 1ULSA 4R54A 3RUCA 1QYWA 5ITWA 4XCVA 1E92A 2JHGA 3HSKA 3W8DA 4WLUA 4XR4A 4XIJA 3AUAA 1ISJA 4XJSA 2D2IA 4CJXA 3DB2A 5FF9A 4ZD6A 4AJLA 1GYPA 4EZBA 5IZCC 2J5KA 1E7RA 3P2OA 1ADCA 4OHUA 1NR7A 3U4HA 2UVDA 3QVWA 5A02A 5IAAA 6ADHA 3PWKA 3VOSA 4CM4B 1Z45A 2GZ3A 1GR0A 2W4QA 3DR3A 1HLDA 2VYND 4OOEA 4IJWA 4A26A 1A27A 1I2BA 2PKRA 1GYQA 1E1NA 1E1LA 2O7SA 2G76A 5COAA 1EDZA 4Y67A 3UW3A 4PG4A 2DM6A 1N7GA 2X9VA 3ADPA 3EC7A 2OP0A 4IXWA 3W8FA 2HO5A 4TROA 2PGDA 2Q99A 4BNVA 4ALIA 1KOLA 4J16A 3B6ZA 2QW8A 4J4HA 1AUPA 3TZQA 1DSSG 4MVJH 1DEHA 1Q2XA 1DHTA 2GN6A 1VC2A 4KUHA 4TQGA 2HMWA 3D5TA 4QQRA 2DBVO 1PIWA 1FXSA 3OMLA 1LBEA 1U3UA 2Y1GA 2Y68A 3E48A 3A9WA 2NV6A 4J9UE 4E6PA 4FGWA 3GR6A 3GVCA 4NFSA 1DC3A 4H7PA 1Z7EA 1DIBA 1W6UA 1ZCJA 2JFFA 4AJEA 1ADBA 5TRTA 3PIDA 4BMNA 3EVNA 5TF4A 1HE5A 1WVGA 1DAPA 5JYEA 1KEUA 1KC1A 3GA0A 2P4HX 1SC6A 4JN6B 4NBRA 1M67A 2OMEA 2XF8A 3PQDA 4Y6SA 3HZZA 4IS3A 5JAMA 4OH1A 3OQBA 1QYXA 1W8DA 4IQ8A 3RQSA 2I9PA 2GDZA 1HYGA 1V3VA 4FJ1A 3MJ4A 3JTMA 5T57A 2ZQYA 3AI2A 2BRUA 4OOFA 5ITVA 1K2WA 3FCOA 3E5MA 2JKVA 3KYDB 3WNVA 3DOCA 4UVEA 3GMSA 5HWSA 3KOUA 2WD7A 1G6KA 3N7UA 4ZICA 1PL6A 4Q3CA 4DPLA 3ITDA 2X86A 4BNLA 3QE3A 4P4GA 2X0IA 1NAIA 4FSHA 3WLEA 3O4RA 1BTOA 1KERA 2A9FA 1M6WA 4GPD1 1EDOA 2AQKA 4FQ8A 3HDHA 3JQFC 3TSCA 2PR2A 3SLKA 1HDXA 3DO5A 1JVSA 2CDBA 3PQFA 4M89A 1SEVA 2A35A 4E13A 5IDQA 2EHDA 3AOEC 1M6HA 2VCYA 4EDFA 4G2NA 4YAKA 3KBOA 5IXSA 4GGOA 5AVOA 4CMEA 1ENYA 5H83A 4EUFA 2B36A 1IUKA 1F14A 1GD1O 4NR0A 3AM4A 1B3RA 4IIVA 3GEGA 3VKUA 1T26A 3AUUA 1VE9A 3V2HA 1ZSNA 4IDEA 5I8WA 1PGJA 1IPEA 4UEJA 4WE3A 1WLYA 2OZPA 4Q3BA 4ZN6A 1LTHR 4EJ6A 3U0BA 2GERA 2ZYGA 1VL6A 2GRAA 2PA3A 2G0TA 1O8CA 2PV7A 4HBGA 4MDHA 3ZU3A 1FDTA 2B4QA 4K26A 4TZTA 4ALNA 1BW9A 2B5WA 4GLLA 5U1PA 1ZNQO 4IGEA 1FF9A 3ZV3A 3EZLA 1X1EA 2NVUA 2J8ZA 4BV9A 3CE6A 1U28A 1I2ZA 4RLHA 2PFGA 3G79A 1OFGA 3BMOB 4YB8A 1LDYA 1X14A 5ENVA 2JL1A 4E3ZA 4RVHA 5CDTA 1DFGA 4E4YA 4I9HA 3TZKA 2O3QA 3SEFA 1RPNA 3PTZA 2GLXA 5CPFA 1E3SA 2FR1A 5CHEA 2GYYA 4LVCA 2EGGA 1I10A 1UXIA 3EHEA 4CR8A 1XG5A 5JNLA 1TVEA 4B8WA 3ZU4A 4DQUA 2W90A 3HN7A 4L9RA 2R00A 2O7QA 3MJCA 4XWYA 2XXBA 3PJEA 3ZWCA 2E4AA 4KZPA 1G1AA 4BOYA 1OMOA 4G65A 2OFPA 1XU7A 3BYZA 1QLJA 5THKA 5BNTA 1IPFA 3LT4A 5C5IA 2D5AA 1NHWA 3TL2A 1NQAO 1F8FA 1GDHA 2PTGA 1HDOA 1I5RA 3GDGA 3WTBA 2DU8A 4UULA 1ONPA 4M87A 1LUAA 5JAIA 4FJ0A 4AFNA 3D64A 4DMLA 4OSOA 1I2CA 2AEMA 3RUAA 2YYYA 2WDZA 3ZGYA 3H2SA 1ZMTA 2GUGA 3DMTC 1KVUA 4L76A 1ISHA 3L9WA 5G0TA 4YWJA 1LSSA 1KVQA 4CPDA 2AQIA 4E2YA 4YT2A 2EJWA 1I24A 3PYMA 3AU8A 3VH2A 4M55A 3OSUA 4M1QA 5ENDA 3PQEA 5JDCA 4J2OA 4J7UA 3VPHA 1Y81A 2Y1CA 1ZFNA 4E30A 3HFSA 4D43A 1QRRA 5IFLA 3RKRA 3VH1A 5LDHA 1Z6ZA 1MG5A 4F45A 4AJOA 5BQFA 1GUZA 2CD9A 3ONEA 3ZNQA 1X13A 5KJ1A 3HNPA 2FMUA 2OOSA 3JYOA 1DDOA 4YJDA 3B20A 2DPHA 4E0BA 3ONFA 4O5OA 2B4TO 4J3FA 4BNFA 3KB6A 1DLJA 4JP2A 2WD7B 4I1IA 1UZMA 1QMGA 3RUEA 2JAPA 3TQHA 5DOVA 1LC0A 4UUOA 4PGFA 4DGSA 1XQ1A 2ZKLA 1LRJA 3JQ8A 2C82A 3WICA 1ZMOA 1JWBB 3D4PA 5I7VA 2ZTVA 3E9NA 2X8LA 2RCYA 3W4IA 1BXGA 4KWIA 4B7CA 3CMCO 4PN3A 1PZGA 4RGBA 1R15A 2X9GA 3GGPA 4GI2A 4OM8A 1YOVB 1DXYA 3PJFA 2WYWA 1QORA 4KWHA 2EIHA 4N5NA 3NRCA 3UAGA 4D42A 4Y6PA 1PWXA 5U9CA 1YH3A 1CIVA 5B12A 4R51A 1F8GA 1A9ZA 2O2YA 2EEZA 2Q1TA 2Y1OA 1YXMA 4IY1A 4NU5A 5JCJA 3IL2A 4YPOA 1DFIA 4BNYA 1T1SA 1E6WA 2AXQA 2OL4A 4BNZA 3WSVA 1Y9AA 1ZW1A 2GN9A 1KEPA 1Y8QA 3O8QA 2BHLA 4W4TA 2TMDA 1KY4A 4WKGA 3RU7A 4BNGA 2HMUA 5GZ1A 4BNNA 3QVOA 2AEFA 1BW9B 5DOZA 4Z0HO 1YL7A 4TVBA 3ANNA 4L75A 2NVUB 1PEDA 2F1KA 3TZHA 4RPJA 2C59A 1N9GA 2ILTA 3ORFA 1QYCA 3FWZA 1IULA 4RL6A 2PH5A 1LEHA 2QQ5A 5BNFA 1ZKMA 3VPSA 2XPCA 3F1KA 3E03A 4NHEA 4QO8A 4EUEA 3D1LA 4Y98A 3VPGA 4LCEA 1HZJA 3AI1A 4L0QA 1E3WA 2YV3A 1QV6A 1Y9EA 4GX2A 2YW9A 1EE2A 1F17A 4IUYA 1YQDA 4RF5A 4BGIA 4WECA 3KETA 3IQDB 1AN9A 3DXFA 3H3FA 1EQ2A 4I9NA 3CH6A 1C0IA 4CL3A 2WWRA 3DZIA 3G17A 1EFLA 1MA0A 1OI7A 2AW5A 2E37A 3UF0A 4DBZA 4E21A 1PGNA 1H93A 2C5EA 2HAEA 5IG2A 3VZSA 2PD4A 3ZHYA 4U8GA 2E49A 2Q2WA 4H3VA 3WYEA 4WEQA 3LK7A 4CLHA 1I01A 2JD2A 2C0CA 3OJFA 1C14A 1EVYA 4WLOA 5L45A 2AMFA 2DBRA 5U4QA 4CUKA 2ZJ0A 4J1TA 3PWZA 3RIHA 3ZHBA 4ZRNA 4WCDA 2YHIA 1ZIDA 3HB4X 3ZNNA 4RO0A 1Y8RA 4NIMA 3VC7A 2XOXA 3CMMA 2I6TA 2IE0A 1BMDA 3OEWA 4IBOA 4OXNA 3U5TA 4MVJA 4W99A 3RBZA 4R5MA 3GH3A 1KYQA 3ULKA 1E6EA 3PDJA 1L1FA 2VUTA 1VKOA 3D7LA 2BI8A 2PGJA 3QSGA 2EKLA 1E5LA 3LF1A 2OUIA 4H16A 4A27A 5CAEA 5HRUA 2AA3A 1NFFA 5JLAA 3JYPA 3H9QA 8LDHA 4ALMA 2Y99A 1RM5A 3CIFA 4BGVA 3BHIA 3OICA 1OC2A 3DBLA 1PJ2A 3IIEA 2P2SA 3S2GA 4WLEA 4LVUA 4XQEA 2ZCVA 1GQQA 4NNJA 4Q3EA 3VZPA 5EPOA 3EGOA 1JKJA 1TA4A 4BNJA 3LZ6A 1NAHA 4KP7A 1ZK1A 5IF3A 3ZV6A 1MUUA 3JQ8B 3C24A 3K73O 2VZ0A 1O95A 5KVVA 2D8AA 1BXGB 2QRLA 3C7DB 3JD0A 1CRWG 3GHYA 1H9AA 3H65A 5AXDA 3RVDA 2ZB8A 3D3WA 1NPTO 1O5IA 1B14A 4RPLA 1HRDA 3WDSA 4FDAA 4BO0A 1I8TA 2YFHA 2G82A 4W7HA 2GN4A 4BKOA 1ENZA 3F5QA 3F5SA 4GX5A 4BS9A 3H9UA 3TF5A 2DT5A 4BO4A 3JQAA 4IDDA 4XIYA 3LQFA 4RVUA 1D3AA 4YYZA 1CQIA 1Y8QB 3WG9A 1ZH8A 2ZYDA 3BMQA 4A03A 3LYLA 2NSDA 4J0EA 4DQVA 1BSVA 4W9NA 3QA9A 2FPPA 3JQBA 2GZ2A 1E1MA 1DO8A 1C1XA 1V6AA 1JN0A 4CM6A 3QWFA 3PHJA 1G0NA 3A28A 3EZYA 4FOOA 4JBIA 3HUDA 2AQ8A 1N9GB 3F47A 5DT9A 1Y7TA 1GZ6A 3I83A 3K8ZA 3WR5A 1WMAA 4JROA 3AM5A 5A4DA 3KXDA 4NBVA 2AEJA 4CM3A 1HE2A 1V9LA 1FDUA 1GU7A 4YJHA 5C37A 4CQMD 2YHUA 2DC1A 4K6CA 3RUDA 4W6ZA 3WOHA 2VHVA 5LCXA 4HUJA 2QYSA 4JIGA 2P91A 5TJHA 4PG7A 2DVMA 1ISGA 3ZWPA 1Y1PA 1WDLA 2EP7A 2R6JA 4AJHA 1DJNA 2B83A 1K5HA 4BO9A 3FTNA 5BSHA 4IDFA 3E9MA 5IZCA 3A06A 1DIAA 4CM7A 2I76A 2J3HA 3C85A 1PGPA 4KQWA 3DFZA 5TSDA 4N5LA 1SMKA 4NDNE 2X5JO 3KTDA 4UUNA 1SBYA 3FNEA 3GEMA 2Y1FA 1U3TA 4DBVO 2UV8A 4EW6A 3C8MA 1X0XA 2FR8A 4PVCA 2EKPA 2DLDA 1HLPA 1F0YA 5DULA 1J0XO 1SO8A 2DAPA 1GV0A 4QFDA 4RCVA 3WWZA 1QYVA 4BMSA 1OAAA 4OO3A 1X7HA 1LLCA 2YHIB 4R01A 5JCXA 1LNQA 1X0VA 3R6DA 1X7GA 3KEOA 1Y8RB 2YV1A 3V2GA 1JAXA 4UUPA 1TB4A 5C7OO 1HDCA 3KYCA 2IZZA 1Y6JA 4DRYA 3C1AA 3TJRA 3MCVA 5KVQA 3HWRA 3GEDA 3UGKA 3QWBA 1PU2A 2Y93A 3KV3O 3GRPA 3AUTA 4MKZA 4YJFA 1XELA 1SEPA 1CJCA 3RFTA 5K6AC 2GCGA 4CR6A 1Q0QA 3C7CB 2DPGA 2HKIA 1JWAB 4J7CA 3G49A 4YEDA 3UCEA 3PLRA 1IHYA 2HMSA 3WB9A 4YAIA 3AY7A 2J6IA 3A4VA 3DBLB 5BSGA 3VTZA 2D5CA 2VT2A 1IY8A 4OKIA 4YBZA 3Q0EA 2I99A 1JVBA 3OP4A 3DEYX 1T1RA 1U7TA 3ZU2A 3PHHA 3K6JA 1I3LA 1N7HA 4FFLA 4MIEA 3HHPA 1R12A 3Q6IA 1SZJG 2WEKA 1LQUA 3I9OA 3QQPA 4N54A 4HX5A 4BO2A 1NVGA 1WZIA 4EYEA 5BSEA 4NZ9A 3AWDA 1OZAA 3JQFA 3LT0A 2NU6A 4BNXA 4IZHA 3U62A 4PLWA 3D3WB 3RROA 1O6ZA 2QHXA 2QYTA 3VH3A 2H1SA 3CKYA 4YAJA 3AOEA 4MKXA 4UREA 3ZWAA 3WWYA 5IDYA 3INGA 1EVJA 4QXMA 2VYNA 3RFXA 5A05A 4C4OA 3PZRA 3AOGA 5A9RA 1I30A 1N5DA 4AJ2A 1PJCA 5FEUA 3L4SO 3E1KA 5F1KA 3AK4A 3QJ5A 3JQAB 1YB1A 2NTJA 4E33A 4ALJA 1KC3A 5L40A 4FD3A 3TOXA 2EKQA 5EERA 4PG8A 3WGIA 3BMQB 5FWNA 3HADA 1EK5A 2NTVA 1PQPA 1A5ZA 3BHMA 4IJUA 1VPDA 1C1XB 3F1LA 4C7KA 1D1TA 4D41A 5DCYA 3ZWWA 3NV9A 5K0ZA 3FR7A 1QXSA 5LC1A 1N2SA 1T4BA 3QRWA 4GWGA 3BAZA 1OOEA 3TPCA 4BKUA 4Z3KA 4E5PA 3ZV4A 3ZWYA 3Q9UA 4WEOA 3FNHA 1AXGA 4BO8A 4IS2A 1YL5A 4YJHB 1UZNA 4YA6A 1TI7A 3W6ZA 4HP8A 1PQUA 5A3VA 2DFDA 5JY1A 2X58A 4KOAA 5EQFA 4RQTA 2FP4A 3QV1A 1I3NA 2FY8A 2D4AA 2FSSA 4J7XA 1MC5A 5I9LA 4L8VA 3RUIA 1D4FA 1DIGA 4DWVA 1PTJA 3GDFA 2ZB4A 5ADHA 5G0WA 3IOYA 2V7PA 1K3TA 4R4JA 3RASA 3DBHA 1ZEJA 1U3VA 3WX0A 3EAGA 4YCAA 2HMVA 1Q0LA 3BMCA 3W4KA 4LMPA 1UXKA 1B8UA 5DBIA 1NFRA 3CUKA 4IDBA 3H4VA 3NX4A 2EGHA 4RVSA 9LDBA 3DZGA 4O0LA 4BQPA 5FYDA 4QUKA 1T25A 3P7MA 3GFGA 1UXHA 5L7YA 5G4KA 1XKQA 5TGDA 4ND4A 1WPQA 4BVAA 2X4GA 2UUPA 2XAAA 4JP3A 1QYDA 4M8SA 1MFZA 1T2EA 1GQ2A 3GG9A 3L9XA 3FRJA 4XJTA 3M2PA 1GZ4A 3E18A 2JD1A 3KYCB 1P45A 4PRKA 2O3UA 3DMTA 2BF7A 3KLMX 3Q3CA 5DF1A 4JK3A 4J1QA 3UFXA 4Q39A 4FFNA 3WGOA 1E3LA 1FMCA 3MEQA 2CY0A 2UYYA 2PZJA 3HN2A 1UP6A 4YJFB 2A4KA 3DAFA 3M2TA 3DOOA 5IXYA 3FBGA 5DZSA 3UH1A 4PFJA 4XYBA 4D45A 2EW8A 4HWKA 1MX3A 3GLQA 4ND3A 5KVSA 2OHXA 4YQYA 1UUFA 2WMDA 2ZQZA 2NU7A 5EN4A 1I36A 2IDZA 1PZFA 1NWCA 5IDWA 3PJGA 3UUWA 1GV1A 2QRJA 2CDAA 2HK9A 4MO2A 2VWQA 1DOHA 4NMHA 3VZRA 1VSVA 1XQ6A 1NXQA 5G0UA 1ZO8A 1FDSA 2HQ1A 4XB2A 1YOVA 3JYNA 5ES3A 5CDGA 3OF2A 5TX7A 4BKPA 3FF4A 1LU9A 1EVZA 1DIHA 1B3BA 4B4OA 3G1TA 1CDOA 2SCUA 4ONEA 4AL4A 5JPIA 1OC4A 2Q3EA 2P5YA 3OIFA 3PXXA 4OAQA 5L51A 4NI5A 3RSHA 4HFJA 1VKNA 5JW6A 2X5KO 3DZKA 2X5OA 4DPMA 2GZ1A 4G81A 4ZRMA 4OXYA 2ZK7A 2X22A 3GAFA 1EUCA 3I52A 4FW8A 4R3NA 1PX0A 1YVEI 2VWHA 3L77A 2I3AA 1YO6A 1ADFA 1UZLA 2AQHA 5IZ4A 1R66A 2VWPA 1YJQA 1YONA 4IDAA 4CUJA 2V6FA 4FFPA 3VPFA 4WGGA 4F46A 4GVLA 1H2HA 4TVOA 4FPXA 4MIYA 4B4UA 3PHGA 1QR6A 3GZNA 4R3WA 5CG1A 2YY7A 4LN1A 2V65A 3JQ7A 1PL8A 3GGGA 1T4DA 3I6QA 1H6AA 1G0OA 2IYOA 3PYXA 3ZH2A 4YACA 4A73A 4NFHA 3ZWBA 3GVHA 3PP8A 3STHA 4XA8A 2HK8A 2VZ9A 2F00A 2ZCUA 4OMUA 3RUHA 4Z9XA 1LDBA 3OA2A 2PNFA 4AJIA 4ID9A 2YV2A 1GADO 4K1LA 4D3DA 4GQAA 2QX7A 3OJEA 3TDKA 2J3KA 2OP1A 4XQCA 1YDWA 1E3EA 3UCFA 1F06A 3ENNA 2GD1O 2CF5A 4J9VA 4KTVE 5DBGA 3VHRA 3NKLA 4NFYA 1FDWA 3WBBA 1CETA 2WJPA 2PD3A 3RFVA 2IXAA 4WUVA 2HMTA 4XYGA 3LT1A 3FPCA 4FC7A 1E5QA 1HDGO 1AHIA 2Q49A 1DRUA 4L4RA 4BIIA 4HNGA 4MVJG 3WGQA 2V6MA 3DBHB 1PZHA 3JD3A 3PLNA 4Q3DA 1DC5A 1D8AA 3BMCB 1K89A 2B0JA 3FHLA 4IMRA 2Q1UA 4JBHA 1E7MA 5JFOA 1GUYA 4PZCA 2DFVA 2QZ9A 4PZDA 3RJ9A 4NU6A 4EBFA 5TT0A 1ZJYA 1C0KA 5L3ZA 4DLLA 5COBA 1FK8A 1A71A 2VTDA 2DBQA 1LI4A 3OECA 5G4KB 4O6VA 1EBUA 3FTPA 1CWUA 3H3JA 1NFQA 3N58A 4R9RA 3W6UA 4EJMA 3ONDA 4RVGA 3WYCA 4JXKA 1B16A 2GR9A 1YQXA 2QRKA 3PFFA 3R3SA 2VRBA 2Z1MA 2X0JA 3ZW9A 1BWSA 4FIZA 1LLDA 2P5UA 3DHNA 4OL9A 1A9YA 4FCCA 1H94A 2NVWA 3I9JA 3HDYA 2WYVA 4PLZA 4TKLA 4LRTB 1VLLA 1GQYA 1CQJA 5IN4A 3OH8A 2YQ4A 2Z5LA 2Y1DA 3MOGA 3WXBA 4EUHA 1NWHA 3GC6A 3K2EA 3MWEB 1T2DA 5DCWA 3WMXA 2PZLA 3E8XA 2NNLD 1MG0A 4R1NA 3TOZA 1YBAA 2CZCA 1Y5RA 1L7EA 2Q1SA 4J2HA 1BRMA 4DUPA 1C3VA 4TRRA 4ND2A 4BO7A 1XGKA 3WJ7A 3NT4A 4IJKA 4I5DA 1PQWA 4W7IA 4YXFA 4XYEA 4I5GA 1HXHA 3CXRA 4E2WA 3ROKA 3JQDA 1VSUA 3A14A 3PIIA 1D7OA 4YRDA 5CEEA 3WTCA 5TQVA 3WQSB 1R4MA 3K30A 3LT2A 4CLOA 4FC6A 2AG5A 1DIRA 4IDCA 2RBEA 5JDIC 1YB5A 2JJYA 4BO3A 2CVQA 5A5EA 1C1DB 1A4IA 3Q1LA 4OSPA 3DOJA 4U0JA 1ADGA 5JO9A 1I3MA 4GH5A 3ETDA 2HRZA 2HDHA 4Z0PA 1UP7A 4S1VA 3DQPA 3GDOA 1N8KA 5TT1A 2C2XA 3UXYA 5L4SA 1P9LA 1E77A 1TT5A 3I9NA 3GN1A 4PZEA 4CV0A 4D3SA 4DL9A 4Q3NA 1FDVA 3NTOA 4YQZA 1ZXBA 3GPDG 4YVFA 5TC4A 5KIAA 1WAMA 2FR0A 3GZNB 4BUCA 1Q1NA 2OGUA 4KQXA 3WFIA 3FSRA 4NG5A 1YE3A 3JQ7B 1S6YA 3UICA 2W2LD 2NM0A 4GKVA 1HT0A 1P1IA 4CUZA 3CZRA 1YJ8A 4YT4A 4WJZA 3PDUA 4AG3A 3ETGA 1WP4A 1PS8A 2RIRA 4I08A 5CEJA 4CMHA 3ON5A 1GZ3A 2FOIA 3Q11A 4OJNA 3ZCXA 4ALKA 4DXHA 4IINA 1NVMB 4GBJA 5F21A 5IN5A 1GPDG 3DZJA 4WNCA 4EGFA 2V6BA 3JQCA 4UVHA 1DFHA 4D44A 1TEHA 2IZ1A 3DDNA 5JXWA 1HYHA 5T6BA 5ICSA 3TWOA 1EFKA 3QHAA 1XIVA 4CLDA 1P0FA 3FR8A 4UEOA 1LQTA 2PKQO 4TRMA 4BGUA 4NBWA 5T64A 3QP9A 4DQXA 4N5MA 4HY3A 3T4XA 1KIFA 3S2FA 1UDAA 4BL5A 4CV1A 1UJMA 5JC8A 3F4BA 3MJEA 3NDIA 5LDGA 1ISFA 3ICPA 3RI3A 1IZ0A 2JHFA 5T5QA 2RHRA 3D0OA 1H9BA 2ZIZA 5AXBA 3TFOA 4D0RA 4O59O 4QX6A 3WBFA 4IJVA 3ADOA 4FR5A 4IGFA 4WCFC 3DL2A 4GMGA 4DYVA 1P1RA 3ZNOA 1KVSA 5ER9A 3BIOA 3PZBA 4PLGA 4BB5A 1RJWA 3RC1A 4YRAA 1HKUA 1T2AA 1V3UA 3QVSA 4JX8A 1TXGA 1WZEA 3TL3A 2HJSA 1MFPA 4ZQEA 5G4LA 4BO5A 2D3TA 3MTJA 3RC9A 3QIVA 2GASA 2BH9A 4J4BA 3RC7A 3ZWXA 3GVXA 4GWKA 4ND5A 4MKRA 3FN4A 2H63A 3KSUA 3OA0A 1XLTA 3I9LA 3I5MA 3T7EA 2Q46A 1WDMA 4FS3A 5DNAA 1PL7A 4XDZA 4INAA 2AG8A 4GL4A 3RUFA 5KJEA 1U5CA 1B8PA 1JQBA 1RM3A 2BFOA 4J1SA 4RPHA 5K6AA 2HRBA 3KUXA 3BXXA 3AJRA 2J5RA 3WS7A 2YZ7A 3LSYA 3L6DA 3NJ4A 4U6SA 5G2OA 4BO6A 1UXGA 2FPGA 4MVJF 3ROQA 2C5AA 4W82A 4BNMA 2B69A 1K6JA 1XA0A 3GFBA 3L4BC 1R4MB 3JQ9C 1SCUA 4B3HA 1PR9A 4CLOB 4F6LA 3COSA 1HF3A 2NU9A 2QG4A 4XDYA 4FOSA 4CQMA 4JCOA 2NQ8A 4HFMA 4B4WA 2VHXA 3B70A 3GUYA 4GGPA 4CMCA 1YL6A 3PK0A 2VRCD 2VZ8A 2EF1A 1P1JA 4XRRA 4DVJA 4BQRA 1BXKA 1NVTA 4JBGA 1LSJA 4J49A 5I9MA 3DZHA 1IB6A 1EBFA 3MOIA 3HG7A 1QV7A 2POQX 3K31A 1NTOA 1O0SA 3KLPX 4BB6A 5A9TA 4CLRA 4N7RA 3SJ7A 3GNQA 3MJSA 3K9QO 5IJZA 7MDHA 1YKFA 1GUFA 3UVEA 5A5FA 2RH4A 1TT5B 1AE1A 1JAYA 3IC5A 3IKTA 4JJIA 5AXCA 2WSBA 3DAPA 1PJQA 2DUUA 4UVGA 2BFAA 4Z0TA 3ETEA 5DCUA 4CR7A 2Y0CA 1U8FO 3BTSA 4P38A 1NPDA 2PLAA 4J91A 2NU8A 4HV4A 1A4UA 1SNYA 2VUSA 1CEQA 2YDXA 3JYQA 5KTKA 1C0LA 3G3EA 3JV7A 3F9IA 4LW8A 1J5PA 3DHYA 1IYZA 1ML3A 2Q4BA 3H5NA 4BNTA 1UAGA 3DC2A 2Q1WA 4Y9DA 5DN9A 2C29D 4BMVA 2G5CA 1YWGO 4E5MA 4KDEA 1GY8A 3FPLA 1LDNA 2YFQA 1JLLA 5ER6A 2B4RO 4DC1A 1H5QA 4DLAA 5H81A 4PRLA 2DTDA 4UVDA 4WOJA 4B7UA 1DAOA 2CMDA 1SB9A 5JMPA 4TKMA 3CINA 4CMJA 1U3WA 1WWKA 1H6DA 3DBVO 4WLFA 3ZWMA 2B37A 5EINA 1GFSA 4Q9NA 4ALLA 4CM8A 2J5QA 1ZSVA 2AHRA 4MJLA 1NYTA 4ND1A 4CMAA 2Q2QA 4M49A 5A04A 1I0ZA 3CEAA 1T2FA 2DQ4A 2E6UX 4XB1A 4U5QA 3GMDA 5JMWA 2EXXA 4GMFA 5C7LO 1K6XA 2VYVD 3NUGA 3P19A 1Q7GA 5GMOA 1LRKA 2EWMA 2VTEA 1WW8A 2JAHA 1VJ1A 2EW2A 5GZ3A 5DP1A 1L7DA 3ANMA 2HK7A 4XRGA 1JKFA 2Y1EA 5G0SA 1O9BA 2EP5A 1GAEO 3H7AA 4ZQGA 4PVDA 3P5SA 1PJ3A 4WOKA 3C1TA 4RLSA 3Q2IA 3JSAA 3F6YA 3AU9A 5T67A 3WNQA 1VM6A 2O3JA 5BSFA 3EMKA 4ZU3A 1B2LA 3OJ0A 4CODB 4R68A 5I7SA 3QW2A 3QVXA 4IXTA 1SOVA 2X0NA 1BDBA 2O50A 2YQ5A 4YAGA 3KEQA 4U6QA 3I4CA 2OBNA 3PEFA 1DRVA 5GZ6A 2WE7A 1HSOA 1JW9B 1Q7BA 3CTMA 4EEZA 1GTMA 4MPDA 5BNIA 4RDHA 1YS4A 3UHAA 1NASA 3I4FA 1C0PA 1CYDA 1PR3A 2VN8A 5FI5A 1FJHA 3ZHZA 1KETA 4HADA 1U9JA 4XGIA 1R0LA 3GRKA 1W0CA 4GSKA 3I9MA 2O3SA 4J1NA 1ARZA 3IUPA 4CQMB 3WFJA 6LDHA 4PG5A 2PH3A 5F1PA 1E7QA 3TFQA 3B1FA 2CF6A 5I7EA 2RH8A 4HFNA 4CV3A 4ZQFA 3MWDB 2IYPA 3WIDA 1QKIA 3FD8A 3ITKA 3M6IA 2IRWA 3B1JA 3D4OA 3WGYA 5JS6A 4LSMA 3QWAA 4FJ2A 4AJNA 2NADA 1EE9A 4WNIA 4BHTA 2W2KA 3X2FA 3Q2KA 4PCVA 4CLRB 1O94A 2DTXA 3U4DA 1ORRA 3I3OA 1W73A 3U09A 1WMBA 4DPKA 2CDCA 2J3IA 1LDEA 2Y0DA 1B0AA 4RJTA 1YRLA 4NJMA 2IEBA 4AICA 1ZUD1 4PG6A 1LLQA 2I67A 3DFUA 4RF4A 3V5NA 3ZDFA 1R16A 2JFGA 4LRSB 4Q3AA 3GVPA 5JYDA 2DKNA 5EMHA 5KJFA 4YR9A 1WXDA 3MZ0A 3JD2A 2NACA 1H2BA 4XEHA 1P33A 3ST7A 3RD5A 3KSDO 4GVXA 3GVIA 1O89A 1A7AA 2H9IA 2NVBA 1ZK2A 3FNGA 2OXIA 1K0UA 4OQZA 4TZKA 4CLXA 4XYLA 2GNAA 3VKVA 2BGMA 3DZBA 3AW9A 4WLNA 1ISIA 2YUTA 3GK3A 2PD6A 2EV9A 3IJPA 4LMRA 1LDGA 1EZ4A 4BNUA 3WGZA 1Q7CA 3ZWOA 4FFOA 4MP3A 4GX1A 1SOWA 5B4TA 1H0KA 4NK4A 1Z82A 2FSVA 3PVZA 1ZK3A 3ASUA 4U0KA 4GAEA 3SXPA 2UDPA 1LDMA 2RHCA 1OBFO 4CM8B 1NPYA 1SPXA 4FFMA 4U7WA 4D3FA 4II3A 1ZBQA 1KS9A 1MB4A 3PWSA 3R0IA 4CM9D 2ZTMA 2JCVA 5T8KC 4NQZA 3NDRA 3LC1O 5CG2A 5EJ2A 3VVBA 1V35A 5J23A 2NLOA 5JY6A 4P8RA 1R0SA 1YQGA 1N1EA 4E31A 1GEEA 1QSGA 2NWQA 4K9DA 3VPXA 1A7KA 1VJTA 2BMAA 2VUUA 3HDJA 1U8XX 1P3DA 4LCJA 1UP4A 3WLFA 1ENOA 3GHHA 3GPIA 1ZVMA 3K96A 3X2EA 3GNSA 5EIOA 1LLUA 4BNWA 5CDSA 2VQ3A 3I9KA 4DMMA 3CSDA 4AJ1A 3O9ZA 4E5YA 2OBYA 2W8ZA 4F6CA 2O4CA 3NDJA 4OXKA 3VH4A 2IZ0A 3IP1A 4Z3DA 3QWHA 1E0DA 2Y05A 3OHSX 2VHWA 4KDFA 3ROPA 2DUWA 2PGLA 1RM0A 1ZXLA 4M54A 4FB5A 1ID1A 4CM1A 4A2CA 3F4LA 2ZTUA 3TNLA 1XDWA 3SBOA 1TT7A 2GSDA 1M76A 3H9EO 1J6UA 1T24A 1YDEA 5I9NA 4BKRA 4Z9YA 4YAEA 3EVTA 3S2IA 3U9LA 4ROSA 5A06A 4B8ZA 2ZYAA 1DC6A 1AXEA 3NGLA 1XWFA 1C1DA 4MVJP 3VDRA 1SAYA 4FGSA 4E2ZA 4ZVVA 1ISMA 5HS4A 1P0CA 4R9SA 3LC7O 2W98A 4ZHSA 3H2ZA 2Z1NA 5CEFA 3OFSA 3U49A 5JDIA 4FFRA 3SJUA 3ZV5A 2V6GA 3L6EA 3A1NA 4UVIA 3KHUA 4FN4A 3VTFA 1Q0HA 4R16A 2W2KB 3QY9A 4HFRA 4IQ0A 3HE3A 3FBTA 5DP2A 3SC6A 3IKVA 3NYWA 3ZWNA 3DMYA 4Y6RA 5L7WA 2PZMA 5CP8A 4NPCA 4WK6A 2LDBA 3E5RA 4YT5A 4DLBA 5JAQA 1BGVA 1XSEA 4RF2A 4D7AA 3ROMA 4NJMB 1M2WA 2BGKA 4L73A 3UN1A 4DIBA 4KMSA 3GUCA 5AXAA 1H6BA 5KCZA 3IJRA 3GZ4A 3GG2A 1HL3A 5DBFA 1R37A 2Q45A 1LA2A 3IAHA 1DLIA 1ZSYA 3JQ6A 3WYBA 4CMIA 1DJQA 2LDXA 4E2XA 1VI2A 4XD2A 2YDYA 4B3JA 4TSKA 4JQCA 3WSWA 4E5KA 3KZVA 1YGYA 1E7WA 4M86A 4BO1A 1RKXA 1LSOA 3KO8A 4R1SA 5KNLA 2CVZA 1Z73A 2O48X 4PLVA 1NNUA 2G17A 1NQ5A 4PLPA 5KVCA 8ADHA 1GYRA 4QTZA 5JBIA 4RORA 3DZFA 1IZ9A 1MLDA 2AE2A 3WQRA 3RU9A 2Y66A 3RKUA 5B4VA 1DC4A 4A5OA 4DREA 2CVOA 3ZZNA 3BTOA 3TRIA 2A94A 4BNHA 5CFZA 2JFHA 3GQVA 3IMFA 2Z95A 4CMGA 1I33A 4Z6KA 2BGLA 2J3JA 3HB5X 5I8ZA 3TN7A 3IP3A 4P4NA 4X54A 3NEPX 3JQEA 4O63O 1BVRA 1PJ4A 1XHLA 1HSZA 4XQGA 1E7YA 3Q9NA 5A9SA 2X1HA 3OJOA 3GOHA 2C20A 4WCFA 1W4ZA 4D0SA 4IMPA 1ONOA 4PIVA 2WM3A 3GAZA 3H5RA 1MV8A 2D0IA 1GCOA 1PJSA 3NJ8A 4MVJE 4TRNA 5IDXA 1IOLA 2IXBA 3PI7A 4PLCA 1DPGA 2HLPA 1R4NA 3EK2A 1BHSA 2X9NA 1P1KA 4R69A 1U1IA 3OQ6A 1UDBA 4B3IA 1ZK0A 2YJZA 4ZGWA 2O3RA 3O03A 5L4LA 1CERA 1MXHA 1PS9A 5L4NA 2X7HA 3H9GA 2H5LA 3RJ5A 4CMBA 2VNSA 1ENPA 2W2LA 4HNHA 1PS0A 2GF2A 3HFGA 4CLEA 3ICCA 1HEUA 3BMNA 4RDIA 4NK5A 3V2UA 1XEAA 3AUSA 3V1YA 4AJJA 1YB4A 3K2BA 4DIOA 4IIUA 1LX6A 1LC3A 4QSMA 3ZW8A 5L95A 2I5PO 3U4CA 1K6IA 3F3SA 3L4BA 4E5NA 1ZJZA 3DTYA 4ITUA 4LK3A 4CMEC 3JQ9A 2FN7A 4AJPA 4ZJUA 3B1KA 2P4QA 1U7HA 1XR3A 1PJLA 2IEDA 2VHYA 3PFWO 1EK6A 1MGOA 3UOGA 3ZU5A 3I23A 4EI2A 1QG6A 4QEDA 4Z9FA 5I7FA 3LU1A 3PHLA 1Y5MA 3ANLA 2Q50A 2QIOA 3O26A 3AI3A 1LRLA 3PHIA 1H6CA 4QFCA 3WJAA 3ZNPA 4BV8A 1PJTA 3E9QA 1J49A 3PGJA 4K28A 5L9AA 4XR9A 4R1TA 4S3MA 4NJOA 2JCYA 1EMDA 3DWFA 2TMGA 5ILGA 4QO7A 5KWEA 3PGXA 3T7CA 1KVRA 1E7SA 3S2EA 4URFA 4KUEA 4XKJA 1P44A 3KSZO 2O23A 3DHEA 1WNTA 1I32A 3RCBA 1E1KA 4CMIB 2P9EA 4XQ9A 1IE3A 4MVJI 4YDRA 4OIMA 1BDMA 4I9UA 4KUGA 4C7JA 1E3IA 2G1UA 2HJRA 3IUSA 3KRTA 3PPIA 5KOIA 1EVIA 1U4OA 3C7AA 4XYMA 5TLSA 2ZB3A 3GF4A 4XGNA 5B4UA 3MJVA 4E32A 1JKIA 1X15A 1HE3A 2BELA 1EUZA 2E48A 3BZUA 4YT8A 4P22A 4CL8A 1GCUA 2R00C 4I5EA 1R6DA 1BVUA 1IL0A 2EERA 3K5PA 4IQGA 2C54A 3DAGA 4WPGA 3BHJA 4RV9A 3AM3A 3AY6A 5HA5A 2P9CA 1NHGA 4LSWA 4LGVA 3WGTA 2PY6A 3LDHA 5HS6A 5KJCA 1VL8A 4J43A 5JCJD 3LC2O 2O2SA 2P9GA 3PJDA 4YJGA 5FFFA 3JCZA 2VT3A 5F5NA 5KKCA 4YTEA 4J90A 5L53A 2Y67A 4GSLA 5CPBA 3ENKA 3D5QA 1VRWA 1DHRA 2VOJA 3OIDA 4PLYA 4QT0A 3RAJA 5CDUA 1Z74A 5B37A 1A72A 1EEHA 3QLJA 3OM9A 4NH4A 3H8VA 4A10A 3G0OA 3IS3A 5KKAA 1XCBA 2WE8A 2BFMA 4IPTA 5EQDA 3EW7A 1HDZA 3OJLA 1YBVA 4E12A 1UH5A 1JTVA 2X6TA 2ZTLA 4TMFA 5TJ9A 5A9SB 1MC4A 3KYBA 4JLWA 1GPJA 2VRCA 4WCFB 1F12A 5C7IO 2X23A 4A0SA 4IM7A 4K6FA 2B5VA 2HSDA 4PLFA 4GLOA 5GY7A 1ZEMA 5JDCC 1VL0A 3VZQA 1R4NB 2FPIA 3GN2A 3QWIA 3VVCA 3T4EA 4J0FA 3ZWVA 3O38A 3GGOA 1PZEA 5AOVA 3DBRA 3R1IA 3NT2A 4RVDA 3WGGA 4G5HA 4CQLA 1UXJA 2C2YA 3C3XA 4XGKA 3RBXA 2XXJA 4DC0A 5KJ6A 2PK3A 1BXZA 5A03A 2Q2VA 1Z75A 3BTVA 2VWGA 2C07A 2BI7A 5L7TA 2R2GA
chains in the Genus database with same CATH superfamily
2NOAA 4GOOD 1DKUA 5KYGA 4DR4B 2IEYA 4KKXB 2JIDA 2PVSA 5C8DA 1NOJA 5HF9A 4ZOEA 2OORA 1XYGA 2UAGA 3PF9A 3SZGA 4CEJA 2XQKA 3JQGA 6ABPA 2QU7A 4ZU1X 4GYYA 2IC5A 2P6RA 3TLKA 1EP3B 3O8DA 2EFCB 1B0UA 1KY2A 4C7MA 1RM4A 3BGVA 1H3FA 2RKWA 2X6QA 2CXXA 3LLVA 1FYVA 1VGQA 3D3NA 1SD5A 3MJTA 3PXDA 3CVYA 2Y4NA 3ASVA 4XSGA 2D6FA 5F2KA 2Z0MA 1Z47A 4JI4B 1FTGA 5K8UA 1WW2A 2GAIA 1VLVA 1L4HA 3EWSA 3KL2A 4OB7A 4X7PA 3SVTA 2CLDX 4KMMA 4YMLA 3BXHA 4QA9A 1IH8A 1P72A 4FCVA 4JJFA 3W4JA 1XZBA 1KEWA 3NONA 1NNLA 3V9PA 1RABA 2GLUA 3F46A 4CKBA 2P6PA 3S5JA 3V4RA 1N5LA 3WGUA 3TUJC 2B34A 2WAOA 3GZTB 5K0JA 1I2AA 1B26A 1MC1A 2GAJA 4KRGA 5YASA 2OFWA 1JX6A 4E5DA 2HA4A 1UAYA 3ABIA 4JLDA 2HFJA 2G1KA 4TRJA 4OQNA 1ZHOA 1B15A 3DFKA 3PYLA 4XZ3A 2XEDA 1FTQA 1JG1A 4LDQA 1PNQA 1CS0B 3R5HA 4YDQA 3AEKA 3TM5A 3ZW7A 2FSUA 2F3RA 2BTOA 4G0PA 1GR1A 3QVUA 4R2MA 3K4QA 1YUMA 3H2IA 1L3CA 1X7WA 5EEGA 2FN8A 2VYVA 4MIKA 1NQOA 1WZUA 2CMFA 3AVYA 3WLIA 4D9EA 3DF7A 2ZU6A 3DONA 1A7JA 3KVOA 2O2XA 5KYWB 1DWOA 3WGHA 4ZV4A 4JP1A 3E82A 4P82A 4JY7A 3O1IC 2HQRA 3UUEA 2X3YA 2X0EA 4G1UC 5THQA 1AGNA 1O95D 2YWCA 1OPRA 4K87A 2QAIA 4KG7A 3UYLA 2Q8QA 3LGXA 1A0OA 3REQA 3E6AA 3M1IA 3ZCUA 4D4GA 1WXHA 3KQTA 1SOUA 2ZROA 1Q7RA 3TBFA 1EFAA 3GY0A 1QKJA 2VNHA 1YI0A 2Q8PA 3H5AA 3FVTA 5DHFA 4AMBA 2FI1A 2KI5A 4RHCA 2XRZA 1E2QA 2QI9F 3H6KA 5FOVA 1T9GS 2HCRA 3ROEA 4A26A 4CM4A 4J0IA 2I1WA 2ZUUA 2Y1KA 4ZVOA 1XP8A 2QAGC 3ORSA 4NNPA 1N0WA 2WU0A 1ULUA 3FHCB 3OETA 2X3FA 4G86A 3QXJA 3X3HA 5JISA 3I62A 1X1AA 1P1BA 2DFNA 1KDYA 1J4AA 2ZBPA 5F7ZA 1DBVO 1ZGAA 2DTEA 1RQ7A 3U4IA 3A6ZA 2AG0A 2RFLA 2WYUA 3MTAA 1YMUA 1T5DX 3ZYZA 4RFSB 1BYIA 1I7PA 5TS2A 4TTAA 1P1CA 2PN1A 3GO4A 4GM0A 1PJZA 2FZEA 3VO2A 4ZJYA 3OT4A 3E15A 2XZPA 3JD4A 1V9CA 1UMBB 3ZG6A 1FPMA 1MHPA 1EXDA 4ESOA 1RWBA 2ZETA 3T41A 5DHQA 2QZPA 5F3RA 4HT3B 4KQ9A 4HOYA 4EH1A 2TECE 5B57C 3FFXA 3BKXA 2A0YA 1ST3A 4POAA 1U4SA 4V0LA 1P1FA 1KP2A 4ZODA 3LBHA 5DYTA 5FI3A 1OGJA 1SOMA 4BN5A 1X1QA 2CJXA 2IW1A 2WJJA 1GSIA 2VH5R 4RXTA 4Q6WA 3BGSA 4UJ5A 1JU9A 4IIBA 1R00A 1ZZEA 2WV9A 1CVIA 2FAXA 1DQZA 3TZ6A 4TWRA 3JYLA 2NO6A 1ONNA 1YFKA 4D9JA 3CWQA 1CPYA 3ESDA 1XN1A 5LBIA 3W1VA 4DARA 2QZZA 2FPIB 4O1MA 3BXPA 1PT5A 5CUQA 2WQZA 5ECYA 2GBLA 1EFRD 2NUPB 4DA0A 1HURA 1IHXA 4YMSA 2AIRA 2OV8A 4IDGA 4RAQA 3RFFA 4E94A 2HJ9A 5AW8A 2PKEA 2X8WA 5DX0A 5BT9A 3RWBA 3GIDA 4F91B 3RSOA 4X7MA 3UJHA 1JB1A 3KHKA 2P78A 3W2HA 1YUBA 1BMTA 2JB9A 4G5QA 4RSMA 4TSRA 2FWIA 4H31A 4GOLD 4DB2A 3OEEA 4GKBA 1D5CA 3GX1A 4FGKA 1DE0A 2B0CA 4PSDA 3W9UA 2BFPA 3UENA 4MP6A 2P68A 4F3YA 3FPSA 4YRBA 1VG9B 1ABBA 3JD1A 1N4DA 3JQGB 4U8HA 2RJ3A 1W36C 2ATCA 5AHOA 4V02A 3GT0A 1TIKA 1ZUIA 1R5OA 4XWGA 3ND8A 2DPLA 4X45A 1JKJB 3GEBA 1D1SA 3NEYA 1DCFA 3IB3A 4D46A 1QQ7A 3ISVA 4LV8B 2JLSA 2WD8A 3CPSA 5JQGA 2E6KA 4V1CA 2HU2A 2FZWA 2I65A 4QECA 1TD9A 5CT6A 1FU4A 3ENWA 3SYKA 2XTNA 2VHEA 3KP1A 3W7BA 1JDJA 1LPOA 4DIFA 3AR8A 5C1OA 5KZMB 3MTGA 2ODBA 1S9DA 2VS1A 3BAFA 1PN3A 1GT91 1XMVA 2F1RA 5EL0A 4ZC1A 4IV0A 3UAVA 5ALPA 3D6NB 2DBZA 1H2XA 1N1GA 3M5CA 2PRKA 4I7EA 1H2EA 1Y9ZA 3CNEA 4LECA 4MKHA 1Z7YA 1UC4B 4QXQA 4NOMA 1FU7A 1RHJA 5IM5A 1X94A 3S1LA 5JD5A 1MP0A 4F21A 4W9NC 3BH7A 1F60A 1UMKA 2UUOA 1V1RB 3AL2A 3M9WA 1I9GA 5EUBA 2BE9A 3AY3A 5H82A 4DW8A 1HZZA 5AVYA 1X1BA 5HM8A 2OD2A 1N6OA 4ZMRA 4H1WA 1GGKA 3RTGA 2KWIA 2UZ1A 3ECCA 3JZDA 4FBGA 4AN0A 3L7NA 4CTOA 3UJ6A 1X7WB 1Z6QA 5THXA 2Z4RA 4F3CA 2PIAA 1UOQA 4RVFA 3IOMA 3OKPA 4JASB 2O8EA 1IN5A 2GEDA 1V8OA 3BRCA 3D0KA 3DJYA 2P65A 3M5WA 3TX2A 3TB6A 3EZ7A 4JT2A 2FJ0A 1CVLA 2YOGA 4BNIA 1DB3A 4EFMA 2H65A 2CV2A 1DBWA 2OUKA 3NWBA 5KHLB 4XCVA 1G2IA 1XZEA 3L01A 3QBTA 3M5DA 5BSUA 1PE0A 3EDYA 1DIOB 1U31A 3KJEA 2CW5A 4KIWA 2Q7DA 3REQB 3AG5A 4RAOA 4DCVA 3WMGA 2I91A 2IDKA 3RE1A 1Q77A 2AYXA 3ETJA 4ZD6A 5J43A 5B55A 1R0CA 4ZKEA 4BQQA 1T3GA 2G9VA 2GZDA 2J5KA 3L4JA 2QY6A 3P2OA 4JLOA 1AF4A 3QVWA 4DEVA 4CM4B 3DZDA 4CN9A 3U81A 2W4QA 2C5FA 4B46A 2XNDA 4GE3A 3CCBA 3OWOA 2VYND 3CR7A 3CZ4A 4Q0MA 1A27A 1I2BA 3WXMA 3ZTWA 4QTTB 5T41A 2JIZD 1N7IA 2DPYA 2BGRA 4RLFA 4Y9SA 4ZAXA 2G76A 2C3YA 3KZOA 3FMVA 3SZMA 3LBNA 6GPBA 1Z0KA 4YUYA 1CNEA 2V7WA 1Y4SA 4IXWA 4LYDA 5FBWB 4QARA 3STYA 1LJUA 2ZT5A 4AUEA 1JHAA 3IB6A 3K4PA 4IGIA 3K9LA 1KOLA 1XXHA 4J16A 1LI7A 2JHPA 1YOBA 2I7DA 2H29A 2HV8A 3K4HA 3C3CA 4M1MA 4NXMB 1Q2XA 1DHTA 1FTNA 1JPNA 2J45A 3FOCA 1U1GA 4KUHA 4TQGA 4OXQA 2YHAA 1R3UA 1JNXX 3MW8A 1JT2A 1PIWA 4DR1B 1FXSA 2XUAA 1EAYA 4CG0A 1O0CA 2Y1GA 2Y68A 1SOAA 1QUFA 2V54A 2YWBA 4L0DA 3QX3A 2Q3MA 4GKKB 4FGWA 3AKDA 5EJ5A 3ESAA 4PHGA 4BZZA 5K8LA 3HXMA 1TZCA 2XUOA 3FSGD 1X42A 1J9ZA 4Y1RA 1FP2A 2X8BA 2JFFA 4Z4HA 1F51E 5J4KA 4BMNA 2OY0A 1STOA 5JYEA 1KI7A 2P4HX 1BFUA 4NFLA 1Z4LA 5WRFA 4HDCA 1M67A 2CT8A 2WJIA 2XF8A 3ZE6A 2PTHA 2PZ8A 3PQDA 4S35A 2QTTA 2E4YA 5AVWA 1LVHA 2JW5A 3OQBA 1W8DA 1DINA 2A0KA 3FMFA 4Q7QA 2I9PA 1VFNA 1FRNA 4LIPD 4ARVA 2ZSFA 3JTMA 1H23A 3S2ZA 4UHHA 4MR9A 4OOFA 2IA5A 1WQ3A 3E5MA 1NUUA 3N0WA 4D8XA 1CZRA 3O31A 3OI7A 4K7JA 3S1AA 5HWSA 1CHNA 4ZICA 1T6BY 2YIMA 3RTDA 1LGYA 4HNUA 2KE5A 2ZYHA 4TXLA 3QE3A 4P4GA 5I9TA 1J7KA 2X0IA 1BYUA 1RZ3A 2VA8A 3CBQA 1NGSA 5D6OA 1DC8A 3TQIA 3AUKA 4I2VA 5IJWA 4FDVA 4HQOA 1T5TA 3HDHA 3MWKA 3I92A 1L5WA 1SKYE 3ME5A 3SHWA 4B3XA 5F2NA 4JOCA 1SEVA 2A35A 3HGTA 5JQGB 4XIFA 1E4OA 2WA1A 4Q15A 4JQOA 4BBPA 3C5EA 2E21A 2VDWB 1DAMA 2IOFA 1ENYA 4HJXA 1LPSA 4W5NA 1VLJA 2AYZA 4HNSA 2PUDA 2AVDA 2P7IA 3CB2A 5IK2D 5HJ5A 1KTVA 1W9MA 3C45A 4IEFB 1T26A 2J67A 2QL9A 3AUUA 5DTIA 4RHUA 1S9HA 4QVIA 1R4AA 4B5KA 4ZYZA 1PGJA 3F3MA 4WE3A 4J3JA 4EG7A 1MB3A 3D2CA 4BZXA 4E03A 3J81k 4LZAA 3OWHA 2HRRA 1LKZA 3QZUA 3QPCA 4XQ0A 3R7NA 3ZWQA 5L3QB 2G0TA 2IYVA 3L6RA 4R2KA 5FHRA 4MDHA 5CITA 1VCMA 3B1YA 2UZ1B 3NH6A 3OFND 2C5GA 4IYRA 2B9VA 2B5WA 1Q91A 5U1PA 2GEBA 2NUBA 2M6KA 3K3PA 4GM1A 1IM5A 2HDNB 2QDXA 3EZLA 3OQOA 2O8EB 3IVXA 3UA3A 1O9GA 3VR4D 4K3VA 1C7EA 1WUHS 4YCJA 2IXEA 2ZJFA 3HEBA 4MO9A 3G79A 2CFTA 5IC6A 1GCIA 4YB8A 1LDYA 2F67A 3V33A 2PSJA 1XJCA 5DWQA 1ZAYA 2B4YA 2YRFA 3WYGA 1DFGA 1YJAA 2JIMA 3FFBA 2LCIA 3B3AA 4I9HA 3PBKA 2QZ4A 4E1VA 1PYOA 4E4YA 4IFBA 4K9LA 3CWCA 2FSHA 3OF3A 2P9BA 4BFLA 1W5TA 2ZG6A 1IZYA 1L6IA 3DE2X 3QOYA 2P2YA 1PTJC 1ZITA 2OK7A 4CR8A 2B1RA 1NQVA 1UPUA 1F2DA 2G80A 3QLVA 4LZPA 3C7KA 3AFIA 4QLBA 1X2EA 2AXNA 1YK1A 2A9KA 2FMIA 2GEVA 1WJGA 2W90A 1YR3A 2OBFA 3FZYA 2G1AA 1UBUS 2FCAA 2YOHA 2D1RA 3MJCA 3PJEA 4LJYA 3A9TA 5I5GA 1DO0A 3ZY3A 4CCAA 1UCFA 3PXUA 1G1AA 1JF8A 4BOYA 4P36A 4NZPA 1QLJA 5CGZA 1IPFA 3LT4A 2FB9A 1U8TA 2D5AA 1NHWA 1KJNA 5ALIA 1KI6B 4XWAA 5FL7D 3STVA 3Q8XB 1NJSA 1F8FA 3AHHA 3CLVA 1XXHB 4OHCA 2PTGA 3M3HA 3WTBA 1Q6ZA 2Z4TA 3H8SA 3GRCA 4UULA 1WUYA 2XWJI 3EMVA 1T6XA 2ORYA 1Y1TA 2GJKA 1UPTA 4AFNA 4DJAA 2IQ5A 3H13A 3H97A 5DMHA 4DMLA 4LHYA 1I2CA 1Q19A 3CZ5A 5EKSA 5HZMA 1EAMA 4PZYA 1G8JA 2IK8A 1GAWA 1EE1A 3BEOA 1ZMTA 3FVRA 2HSGA 3ZKAA 1JQ5A 4KVFA 5G0TA 3L9WA 4Y1RB 5FWYB 1KOGA 1LSSA 2ZBFA 4K88A 5K3BA 1BGXT 1WEKA 1D2MA 2VJOA 2V7GA 2HCJB 2XDAA 3EEQA 5CH5A 1C2TA 2VT6A 4MGYR 2HTFA 3A6FA 3PYMA 2ODQA 5KX5A 5C18A 4PY2A 1NYLA 3IBSA 4UC0A 5KYXA 5ENDA 3PQEA 4A5SA 4CU2A 5AW0A 5JDCA 3ET5A 4PBSA 3H2HA 1T0IA 3IP8A 5DASA 1KFEB 2Y1CA 1I7DA 3PC3A 3O7MA 1RS0A 4OHWA 2V3WA 2HZ7A 5H9WA 4WI1A 2F8MA 4AJOA 4DR2B 4MWTA 1RHUA 2CD9A 2OB2A 3OE1A 3ONEA 1YBFA 4FINA 2BCEA 3ZNQA 1V6CA 2X15A 3QUBA 1EPUA 5KJ1A 5CFLA 1XMIA 1AZSC 4MR9B 1DDOA 1A8SA 3TCXB 3MSXA 3ONFA 5AW1A 3KT6A 1KAEA 2Y4OA 4MKFA 1CJVC 5JH7F 2X1LA 4ZVQA 1L4KA 3QPBA 1QMGA 4XWOA 2JAPA 5AKHA 5FNZA 5B2FA 3QPAA 3IAAA 1XQ1A 4UU1A 1HFJA 3H1AA 2ZYSA 2I1QA 2IITA 1GCGA 3D4PA 4OHVA 5I7VA 2PE5A 4M9QA 4EFDA 2G08A 3G8CA 3QE9Y 4LFBB 1QGAA 4KWIA 4B7CA 2WSIA 4PN3A 3B6EA 1FFAA 4RGBA 1R15A 1VSTA 1ZCAA 2OQVA 4KXFB 3DV9A 1RWVA 3HN6A 3PT5A 2FSFA 5LIRA 4P08A 2AHOA 1DXYA 1YBHA 3PJFA 3VU1A 4CKXA 4RTQA 1OA0A 4YRNA 2D1QA 2W6JA 1C9DB 2I80A 3UHPA 4M0FA 3UAGA 1AG9A 4Y6PA 2G9NA 2X4DA 4YRLA 2J85A 2IUTA 1A9ZA 1JR6A 2QRZA 2CMGA 2SNIE 3KYJB 2YW2A 3AEUA 4IY1A 5D87A 3PSHA 4BQEA 3AIMA 1T5HX 4BNYA 1T1SA 1E6WA 2QPAA 1ZA1A 4WA7A 2YXNA 1KEPA 1Y8QA 3MA0A 1NE7A 2FN4A 1LBTA 2J0EA 4W4TA 3OTOB 3GEIA 4Q7EA 1GQFA 4URUR 1Z25A 2H7XA 1AHNA 1FEZA 3BB1A 3NQ41 1TTHA 2B82A 4BNNA 3P9CA 1H4SA 4ZT2A 2BZ0A 5DOZA 1BMFD 3D2BA 1F3LA 3BF7A 2ALJA 2YN4A 3FGZA 2PGOA 5DJ5A 1ODSA 3K5IA 3V1KA 4BWVA 1PEDA 5EHQA 3A36A 2BM9A 2IP2A 3TZHA 4OI4A 2OYRA 1XZPA 2C2OA 2YIVX 3DXXA 3KOXA 3QPWA 4F8JA 1WS6A 3ESZA 2OXFA 4Q37A 3E03A 4NHEA 4QO8A 4EECA 3KQOA 2MOKA 1V3QE 4IMIB 1HZJA 2BF4A 3X43A 1M5TA 4M1WA 3VKGA 1E3WA 4F60A 5JAPA 1S3SA 1Y9EA 3G2JA 3OWXA 3VOBA 3DL7A 1SCBA 3AR9A 4Y6GB 1J07A 2HSEA 3O47A 3Q4GA 1ZCZA 1ZQ1A 4PQEA 3NBXX 4IJQA 2Y77A 4UQPA 4OGGA 1VYVA 3U17A 1EQ2A 3LKVA 1EFUA 4JJ6A 3DZIA 1MA0A 2E37A 2ZUVA 3BL6A 2WNSA 4E21A 2I4IA 1V9SA 3IQZA 4LJKA 1PGNA 1GGEA 1H93A 2QAGA 4EX7A 3VZSA 3I9FA 2AX4A 3P0JA 1U1CA 3FCEA 3SVLA 3CX4A 2PD4A 5IJAA 3HFRA 4KBGA 1P9NA 4DUYB 3IAM1 4WEQA 1RLTA 1I01A 3NTVA 2WILA 3TJMA 4BATA 2MSLA 2NZWA 3QA3E 4AU1A 1ND6A 5BSRA 3D4IA 3G9TA 1CLEA 1EVYA 2WPDD 3FW1A 3ILSA 3CWZA 3IP5A 3NI2A 1V2HE 4PU0A 2GPSA 4RDCA 5C8ZA 5DSTA 2F7SA 4CUKA 1JT9A 1ST2A 4IUBS 2ZJ0A 5C80A 3KQHA 3NC4A 1SQSA 4ZRNA 4M8NE 3QPUA 4CE6A 3CKLA 1JG3A 3B60A 2DFKB 4L3VA 3A3OA 1RQRA 2XOXA 4LQ4A 5AIBA 2QJOA 1BMDA 5IYZA 3CLRC 4W99A 1VGVA 1JIQA 4EF4A 2XF2A 2WT9A 2OVBA 3MPUA 1QCZA 1W35A 1WUIS 2X8AA 1VPVA 3GH3A 4WK0B 5B1DA 3U1VA 2JEZA 3AR3A 5KX5B 3ULKA 5KYXB 1E6EA 1CUZA 2COKA 1B8OA 5JZMA 1C9EA 3UC5A 3D7LA 2DH5A 2HGZA 4DSOA 1ID8A 4M2LA 5FQOA 1C7JA 4A27A 2H06A 4CCYB 2WF8A 4L0CA 1QIGA 3UMRA 4UPEA 5HRUA 1PUXA 1K63A 4D4JA 3K1JA 4ZHQA 1TYDE 2OO3A 4NKRA 3T38A 3NHYA 3TRDA 1FY2A 1PWYE 1TMGE 1CB0A 5FUBA 5GIOE 4OP2A 4X8OA 3EQ8A 3GRFA 1HOXA 5FB3A 1PJ2A 2C8VA 1TC2A 2X4LA 4CU5A 3Q2OA 3G8DA 1ZBDA 2ZCVA 1E2FA 1KSGA 4L4YA 1Z6PA 5E7QA 4NNJA 4Q3EA 3VZPA 1KMIY 1K3UB 1SHKA 3DTNA 1ZK1A 1M0TA 1GGFA 1ZG3A 3E0QA 5IBRA 1NLFA 4QRHA 4YDHB 1NNI1 1P5FA 4TYYA 3FUTA 1N5OX 2D8AA 5I6DA 2IS2A 1CDEA 1MO2A 2QRLA 3JD0A 2QZJA 3PE3A 2BISA 3NAGA 1H9AA 3N8NA 3O84A 4MRPA 4S2UA 3D7SA 1N77A 4L57A 1MU0A 3AQ4A 2PKCA 1B14A 3BX1A 1RJGA 3GL9A 1OQAA 5E6UA 5JPCA 3C39A 4J0GA 2NZUG 4N7BA 4UD2A 2G82A 3ZGXA 1PV4A 4BASA 1MVLA 1ZHHA 3CUYA 3GXBA 4XARA 5JAHA 1KBQA 3L1HA 3KK0A 4MW1A 4QYTA 4BN4A 3TF5A 4GX5A 4GOJA 4K9QA 3LO8A 5IT5A 1JDTA 3AEUB 4CF4A 4WVFA 4ESVA 1DXHA 4UBKA 1XU4A 3RHFA 4Y2YA 1IY2A 3WLJA 1P4SA 1D3AA 5FT9A 3WV4A 4F84A 5EMJA 4YYZA 1Y8QB 4G8BA 1CTQA 1VCOA 2X1MA 4WVLA 3DM9B 4OQEA 3LYLA 3RS9A 4YJ2F 4RETA 4J0EA 4W9NA 4O4HF 3QA9A 3WLQA 1GNLA 1PFWA 1Z4PX 2GZ2A 2YN2A 3FYUC 3NO4A 4ENTA 1V6AA 4QYIA 3R9XA 4O4IF 3UMSA 2V3CC 4MDFA 3OPQA 3PHJA 2QLBA 5J9FA 1N9ZA 4HDSA 4FOOA 1CEYA 1UWLA 1YT5A 1XTTA 2AQ8A 5JECA 2NTYC 4OQFA 2R0QC 5IBQA 3ZJTA 4U7JA 4QOJA 1ILEA 1WTCA 1QHIA 1C7RA 1T36A 3BH6A 5AI6A 1OHHA 2GAOA 5M34A 2ODAA 3ORQA 3BXOA 5EFZA 4DMKA 1G3MA 4ENSA 2JCBA 2JKZA 4FWIB 4CWAA 4X1KA 3CQ9A 1HE2A 3PENA 1IJEA 1TZJA 4YJHA 3ABRB 4B1FA 4ZYWA 4PN7A 3KT8A 1TGYA 3SGLA 5TGZA 4ERNA 5IABA 3HUFA 2QYSA 4NBKA 4B82A 4D8UA 2DVMA 5ALQA 1E66A 1WU7A 4WW0A 4AJHA 4EAQA 1PZNA 2R6JA 2XMZA 3WK9A 1DJNA 2QLLA 5BSHA 4BMDA 3IMEA 3I53A 2AFHE 4QQ8A 4KLZA 2X6RA 4UHBA 3ZTYA 4KQWA 3C15C 4C0KA 5HXAA 1ZJ4A 2O06A 2ZRIA 4N5LA 5TSDA 2PAFA 2E1RA 3R9IA 1IN4A 1HI9A 2QAGB 2PH7A 3AR6A 1CR6A 4YRMA 3DWIA 3EJWA 5DYWA 1LI5A 2P9YA 3A6PC 4AUKA 3GEMA 2Y1FA 1XTIA 1JZSA 2WAYA 1ZVVA 3DAOA 4DBVO 2QZSA 4NG4A 5E9WA 1L5RA 1ZGJA 4R8VA 3RAEC 2ZUWA 2OCYC 5FOWA 3PJRA 2DEUA 4WZBE 3CN7A 4HDNA 3EPKA 4TT8A 2VO1A 4O29A 3DKRA 2Q3JA 1QOPB 1C3LA 2JGNA 5IVIA 4RZ3A 1XZLA 3HBNA 3U39A 4RCVA 4C5CA 1VGRA 4BMSA 4EQZA 1VA5A 1CJTC 2D5IA 3EC2A 1N2CA 1SZPA 2FZ5A 1X7HA 4R01A 5FYQA 1GNVA 3R6DA 1X7GA 2VQSA 3KEOA 4JV5B 3GLHB 1KK2A 1M1YE 1SBIA 4TMTA 4C4XA 4URZR 2A9PA 4FDUA 1NXTA 2YR0A 5IYZB 4P54A 3GLVA 3H2GA 1EWQA 2IZZA 4JVNA 1AGYA 4GMKA 3M5PA 3PC2A 4LNUA 3LI2A 4NARA 2NXWA 3TJRA 2PH1A 3GRZA 1ZIXA 2ZYVX 3C6XA 3UGKA 5LFAA 1ACJA 3NUQA 4FXPA 4ZOCA 3QWBA 1C30A 1PU2A 3KV3O 3GRPA 5CHYA 1Z0ZA 4FYKA 3G2QA 5E9QA 5CLHA 3RS2A 2GCGA 4KQEA 3C4JA 1U7ZA 2H8GA 2XYPA 4Q7JB 1JDSA 1MPXA 4FEGA 1JR3A 3WKCA 2GFHA 4DFDA 4ZHQB 1ZWLA 2L69A 2ZBVA 1IHYA 4EVQA 1JI0A 2XYGA 1OU4A 4LXIA 5CW2A 5JZVA 4ARCA 3AY7A 2J6IA 3T7RA 3O0DA 2DWPA 1QHSA 1V4VA 2BUAA 1SU4A 4ER5A 1TKCA 4DLVA 3C8ZA 4YUXA 4MAFA 2HNKA 3ZKWA 2I99A 1OVMA 3OP4A 3DEYX 3OZUA 1U7TA 2JFXA 3PHHA 2ZYIA 1T9DA 2JJ2D 1RJEA 3T52A 4MIEA 1KFCB 4OFWA 1DDIA 5TARA 2XQIA 3WADA 1SZJG 3OO0A 1JQLB 1JSLA 2IW3A 1S89A 2H4HA 3C48A 1XK6A 4YROA 2OSVA 3QQPA 2YXPX 5DGTA 2P9ZA 1NVGA 1GTZA 2C4NA 3OPMA 1W36B 3HLYA 4RH1A 3T7KA 1VL5A 1R0BA 2Q6IA 4FX5A 4JC0A 1J2EA 3BVPA 1JG4A 4LDAA 4MLZA 1Z12A 3LO5A 1Z13A 3B3FA 4IZHA 4PLWA 3X1YA 2JZCA 1LBQA 1MT0A 2P5SA 3RROA 1WR8A 4AG5A 3EISA 5E6UB 5FUYA 5CCEA 7YASA 2H1SA 5BV2P 2IHVA 4BLWA 3LC0A 1B74A 3D7RA 3INGA 3GRRA 3CF2A 1QHNA 4HK4A 3SBXA 4UXJA 2QNIA 3G8BA 2O0JA 3HCRA 1ZH6A 2QL6A 5A05A 5B58C 2HV9A 4LEIA 1MB0A 1PJCA 3GJ7A 4JLKA 4AJ2A 1ZM2A 5EVJA 1LS6A 1NULA 1XPJA 4YY3B 1CZKA 3JALA 4CI0B 3CX3A 5L40A 1HE1C 1IHDA 3SF0A 4KO8A 3X1ZA 2EKQA 4K5QA 4PG8A 3NHMA 3K6SA 1WABA 1Z22A 1EK5A 2D62A 1OZ0A 1E2BA 1UBTS 1RAHA 2E4ZA 3R7BA 4PWZA 5KSPA 3OQPA 4IJUA 3RH0A 5LOVF 4HUQA 4RHFA 1USUA 4QYIB 5TMEA 1LNZA 1JQJC 2IDMA 1QBGA 3E1GA 5C8YF 5FULA 3BXGA 3WK5A 4RY9A 3LX8A 4HDSB 1WB6A 2W71A 8ATCA 3O8RA 2EAUA 1OYYA 2O7NA 4C21A 1C8LA 1Y8ZA 1T36B 3QRWA 3SR0A 4MPRA 4BRUA 3F6EX 1SXHA 3BAZA 1WSDA 4BKUA 3ZXIA 2FJPA 4O4LA 4X1KB 3ZCTA 3UGTA 1E5TA 4YJHB 5FL3A 3NHWA 1KYYA 2JVKA 2JLQA 4HP8A 1P7WA 2COUA 2Q07A 3OOYA 4KXVA 3AF0A 4W8HA 4KOAA 1VHWA 2V0GA 4U7PB 3F6CA 4RULA 2Q3BA 5AK4A 2HTEA 2IKQA 4L8VA 4HNTA 2Q5EA 3OOHA 1D4FA 2JBAA 4OHOA 3VJRA 1DIGA 2QUAA 1AKEA 2ST1A 1PTJA 3GDFA 4LVNA 5E3JA 2AFIE 1JIJA 4H27A 3IOYA 2V7PA 1BJRE 2IYAA 2MWMA 1ESEA 3WX0A 1O94D 3R23A 1TMOA 2HMVA 4X00A 4KR9A 3KVVA 4AN1A 1K7FB 1HLFA 2DH6A 1M7BA 4ZYVA 2RI0A 1UXKA 3UV7A 5DBIA 1QG4A 2FA9A 4LX0A 1NX9A 3H4VA 2DQZA 1M54A 1XCOA 1J70A 4RVSA 2ZBEA 1W96A 3DZGA 2Q7XA 3L43A 3PQCA 1IIRA 1FCJA 5C52B 4FUTA 2VF4X 4HDNB 1CY0A 4CL0A 3U6BA 1GM5A 4PYRA 3TBKA 2JFVA 2H11A 4LVOA 1P3JA 1QO9A 2J41A 2FXVA 5TGDA 3RV3A 4BVAA 4UE6A 2WM8A 5ITSA 4B43A 4RQBA 1JMYA 2KS6A 1N2CB 2CLSA 2HRDA 5CT5A 1GZSA 3LKDA 1U8UA 1MFZA 3BWCA 1GQ2A 3FDJA 3GG9A 5F51A 4YV2A 1TA0A 4K6OA 4KAJA 3SSOA 2EL7A 3NORA 2QQ0A 3WGLA 3UT5B 3H6HA 4EI8A 1ISSA 3NOQA 4IIDA 4XIIA 2JD1A 4QASA 1II9A 1A76A 4LNUB 4UFOA 3R74A 3TD2A 1L7BA 4JC4A 4J1QA 1RHQA 1RAFA 2Q9UA 4PBTA 4Q39A 5JV5A 2WZBA 1E3LA 3WGOA 4YGYA 3PWTA 2IPXA 2UYYA 1C30B 1G5HA 3COPA 3MWEA 2PUEA 3VV2A 2A4KA 3RAFC 1VCHA 3B2EA 4NLLA 3M2TA 3T3MB 4Q1CA 3WZ2A 3T6KA 3OE7A 4YCSA 5L3QA 5D1HA 5IXYA 2XNHA 3OLYA 4PFJA 4HMPA 4HWKA 4BVEA 4ND3A 2CLKB 1ZLXA 1W5BA 4Q1DA 1YVRA 5EZ5A 4BAUA 5KVSA 1NRIA 3VYSB 4EY8A 4L7VA 2XB6A 2ZQZA 1Q92A 2NU7A 2IDZA 1P8AA 2Q5CA 1RNLA 2EFGA 1AUOA 3PJGA 3DE4X 3ZKWB 4Y6QA 4OUDA 2CDAA 2D0OB 1CUYA 3G13A 4JSRA 4UZEA 3EODA 3QU9A 3VZRA 3ESXA 1XCJA 5DNCA 1XF1A 4HEQA 1U0SY 4ZQIA 1JR4A 4XB2A 5ES3A 4XLTA 1D4AA 1P2TA 5D3MA 1W44A 5TX7A 2IZ6A 4QKQA 1JQDA 4C7XA 4IVRA 2VHCA 1LU9A 5A3RA 4TTIA 1B3BA 2J6HA 4ASUD 1ZR4A 5EAIA 3W5SA 4AL4A 5JPIA 1JJVA 4ZARA 4Q3LA 2YX1A 3RSHA 4A91A 3CUVA 4HCJA 4EA9A 4GC9A 1VKNA 4C6TA 5JW6A 2X5OA 4DPMA 4UNRA 4JENA 1C3EA 4OXYA 1A77A 1DG9A 4IQ4A 3C3WA 4OGFA 1PX0A 1I14A 1TRKA 1CUSA 3R6TA 1CUUA 1DKLA 3L77A 4HAUA 3T5CA 5KMGA 3CO0S 4DIMA 3UJCA 2AQHA 2GJAA 1R66A 4GE0A 1MO4A 1CR0A 4IDAA 1YJQA 3JZFA 4C30A 4CUJA 1T9ZA 3ZCVA 4FFPA 1SXQA 4NCIA 4I55F 4F46A 3JALB 1Y7PA 2FGKA 1FW8A 2RBGA 3E8MA 4HEJA 1H2HA 4QIHA 1E61A 1MVNA 4DMHA 2H1RA 3LWBA 3NS7A 5ALTA 3RSFA 5CG1A 4MW6A 1XAGA 3B8HA 1TIBA 3ORHA 2AK3A 2AOXA 2JFUA 3WLOA 1PT8A 1C4KA 2V65A 3GGGA 1C8KA 2MYUA 3LLCA 4HUQB 1H6AA 2IYOA 3ZH2A 4FUQA 3BCSA 1AB6A 1Y3AA 2WTXA 5LJIA 1FPQA 3FMGA 4YACA 3VR5A 1A9RA 4G41A 3DDWA 4A73A 4EI9A 1D03A 1YR8A 521PA 2IXTA 3PP8A 3KUKA 3RUHA 3LBIA 2F00A 5FBQB 3VHLB 4LC9A 4Z9XA 2XKAA 1XVTA 3ANYB 3PC4A 4H08A 3WE7A 5GWXA 4QTYA 2YWEA 2EJTA 1G2PA 4P93A 4LNAA 3FXAA 4O4LB 4QYWA 4QHSA 1RWPA 1W0JA 1QVRA 4R8MA 4BCDA 4BPRA 4COKA 2BHRA 1QB8A 2J3KA 2OP1A 4XQCA 4ECEA 3F49S 5SYNA 2RE8A 1G3UA 4XDHA 1F06A 2HRQA 2R4UA 1T8SA 1NVEA 1PD0A 2GI4A 4RGYA 1OT3A 4LV6A 4MTCA 4L02A 3RW9A 3SI7A 3BIXA 4DA4A 4OHFA 5K0EA 5AR1A 1ECJA 3H5WA 3AP2A 3NBKA 1INLA 4FC7A 3A6GA 1E5QA 2X2OA 3HU1A 1TCCA 3DOIA 3QKWA 1THTA 4QNMA 4GDMA 1G8KA 2XTMA 1UKZA 3WGQA 3JD3A 5HRCA 5IRCD 1Z38A 1P6UA 1LZKA 4PPYA 4F8EA 3FHLA 621PA 1P2UA 1GUYA 2XWPA 1NKTA 1M1NA 2IUYA 3RJ9A 5KWJA 2WIGA 4XCXA 4YIKA 1ZJYA 1C0KA 3OSZA 3UJ9A 3V6LA 4ARIA 2VAWA 3ANSA 3FRHA 1FK8A 8ABPA 3M3DA 3LLMA 1LI4A 1ZESA 3ZD6A 2Z5FA 3BM5A 4G0NA 4UBJA 5IAGA 3N58A 4JT9A 3W6UA 1NFQA 2CXPA 2HM7A 3FZQA 4NAVA 4J0JA 4O8ZA 4R9RA 4G0VA 3VOAA 2N42A 3SNHA 1W2WB 1B16A 3AM1A 5EGSA 2QE6A 4EFLA 4E5VA 3PNYA 4HLUA 4IIFA 3WLAA 3ZW9A 4LKRA 4U7HA 3DHNA 1H94A 3CRNA 1BCSA 4LRTB 3EVGA 1CQJA 3RJTA 1OF1A 1H0SA 3DDOA 5F2OA 3OH8A 3I5UA 4BMXA 3OQHA 5KSWB 2BJVA 4RTRA 2CD7A 4I1SA 2ZT8A 3GC6A 3MWEB 5DCWA 1PJAA 1ORDA 1C8VB 2NZVG 2FOXA 5KNBA 2RHHA 4EABA 4UHJA 1YBAA 1BWPA 1CLUA 1COWA 4GBMA 3I64A 3L7DA 1BOFA 4LOLA 4RBNA 4DUPA 3J7AC 1C3VA 1RXIA 2IUFA 1SUDA 2ZIFA 1VJ5A 5ED0A 3PGMA 3WJ7A 1CD5A 3NETA 4W7IA 4DLZA 1RPAA 2NU7B 1AM4D 5JASA 4B3FX 5SY4A 4YUVA 3UJ8A 3V4VB 4OUDB 4NJEA 5HK8A 4KV9A 2DWUA 5K0BA 4E2WA 4RS4A 3VJMA 1RBYA 3JQDA 2QR5A 3PIIA 1Q17A 1W59A 3FTDA 2PMEA 3WTCA 5AJWA 1JFVA 1R4MA 1XTSA 2P30A 1YTLA 3HDGA 2REQA 4IHJA 4RD0A 2O8CA 4RA6A 1CUEA 3PITA 4F4DA 1DIRA 5D3MB 1KMHA 4OXIA 3ZLJA 3ZD8A 5FP0A 4AXBA 2QD4A 1BJKA 2B3TA 4KPUA 1CE8A 2JJYA 3SQDA 3GNLA 2FHPA 3G7NA 2CVQA 4MK4A 4AURA 4CDGA 4DJTA 4A1FA 2WHPA 3B36A 4WY2A 4KMRA 3THWA 4JJZA 1F6BA 4P58A 1J9GA 1JFLA 5F2EA 3ZDEA 2XUJA 3DOJA 1W19A 2J7PD 1HFKA 5KREA 1ADGA 4UJ3A 3W2GA 2DOKA 1UWCA 4DDTA 2QE7D 3PF8A 3WV5A 4X93A 4C7BA 1KI9A 2JFBA 1ZOIA 1F7UA 2V03A 3DQPA 5JSHA 3RRYA 3HA5A 4MA4A 5KMGB 1JH9A 4EGQA 2QMYA 4G4IA 5TT1A 2C2XA 2AVNA 1SU7A 1P9LA 4X71A 3RNLA 1P60A 4PZEA 1WCYA 3NTOA 5EKDA 1BHJA 3ZDXB 4DV4B 1Z6AA 1E6MA 2QJTA 4H7HA 1Q1NA 2DT8A 2OGUA 4BUCA 1R6VA 2ZBGA 4N5IX 5H3CA 2C9MA 5F76A 1SK8A 2NM0A 3KTAB 1HT0A 1P1IA 1Q7EA 1EXNA 3CZRA 1UQUA 1XE3A 4JYCA 3PDUA 3FYUA 1KFKB 2NXNA 3JYHA 2IEAA 3G2LA 3ETGA 3LCVB 3U37A 1ZHFA 3S5UA 4ZOLF 4I08A 3UJ3X 1ZI9A 2FOIA 4OJNA 5E38A 4X90A 5K51A 4D9GA 2BMVA 2F1JA 1NVMB 2Y1WA 4MUYA 4OMDA 1ZOLA 1JE0A 2TS1A 2F2TA 1S7GA 1H42A 3DZJA 4IFEA 2V6BA 4EGFA 4PXYA 1I4OA 3ELDA 1L9XA 2ES4A 3NP7A 2OFXA 4LQDA 1MDBA 3VAAA 4B71A 2D74A 3K8YA 1JJ7A 2VXBA 3G2MA 4MRAA 5T6BA 2GHTA 3LOQA 3G9XA 1H2ZA 2ZWIA 3QHAA 3D3JA 3W5VA 1K08A 4CLDA 3WLNA 1Q1GA 1XC7A 1EI9A 2VYQA 4XJXA 5HE9A 4AF7A 2IH4A 1LQTA 1W88A 1ZONA 3HJNA 2PKQO 4TRMA 5DYGA 2WKSA 4ZDIA 5AVZA 4N5MA 2JHCA 2VJCA 2D54A 1XTQA 1KIFA 3CUWA 4HY3A 1T0HB 4FFSA 5IKMA 3AY0A 1YDFA 2AG6A 2R6ZA 4RHXA 3TNJA 5KQLA 3NDIA 4KXNA 1ODFA 3RI3A 2C5SA 1IZ0A 1QZZA 3I2FA 1GZ5A 1OUMA 1M1NB 2JHFA 4WINA 1M0EA 4TWBA 3D0OA 4U7GA 4F9FA 2J9GA 3R7DA 2ZIZA 5H9VA 3TFOA 1G2QA 3UEOA 4QDOA 5T4HA 3QYJA 3AB7A 3P2EA 1CDZA 5FOTA 2IGTA 4HATA 1JFSA 1D04A 4MW9A 4EMUA 4G89A 1KVSA 3BJMA 3ZR4B 3MD9A 1AUVA 1AK1A 4PAOA 1T9HA 3KKZA 4MWOA 5CX4A 5DW0A 1E63A 2PT9A 1FFDA 1HKUA 1YRQA 2QJFA 3UK2A 1T2AA 1V3UA 4JUIA 2ATEA 2CK3A 2HJSA 2C94A 2P3LA 4MCJA 4D26A 4WY8A 1YAJA 5G4LA 1BCSB 1ZD5A 1LQ2A 2D3TA 3RVNA 1GGVA 3EXEA 1CQJB 3LXUX 3RGGA 1NI3A 2V59A 4HAIA 3V1LA 1HFEL 4DRZA 5CDUA 1YKGA 1GNRA 4HDMB 1NNEA 2LUOA 4JHLA