4GLOA

Crystal structure of a short chain dehydrogenase homolog (target efi-505321) from burkholderia multivorans, with bound nad
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
258
structure length
258
Chain Sequence
MDLNLQDKVVIVTGGASGIGGAISMRLAEERAIPVVFARHAPDGAFLDALAQRQPRATYLPVELQDDAQCRDAVAQTIATFGRLDGLVNNAGVNDGIGLDAGRDAFVASLERNLIHYYAMAHYCVPHLKATRGAIVNISSKTAVTGQGNTSGYCASKGAQLALTREWAVALREHGVRVNAVIPAEVMTPLYRNWIATFEDPEAKLAEIAAKVPLGRRFTTPDEIADTAVFLLSPRASHTTGEWLFVDGGYTHLDRALV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a short chain dehydrogenase homolog (target EFI-505321) from burkholderia multivorans, with bound NAD
rcsb
source organism Burkholderia multivorans
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
total genus 95
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2012-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4gloA00
1P1JA 1GU7A 1P1RA 1IULA 4PG8A 4G2NA 4FJ1A 4DQVA 2Q2WA 2PZMA 3VPHA 4I5EA 4OOFA 3DHEA 4MP6A 4ZVVA 4DIBA 1NFQA 4WCFB 3E48A 2CSUA 1B8VA 3KTDA 3QWBA 4OMUA 3JV7A 3N7UA 5JO0A 4MVJG 4G5HA 1LDNA 3C8MA 1LDEA 1QORA 3H9UA 4N5MA 1M2WA 3A14A 3WG9A 3JCZA 1LEHA 3CXRA 1V9LA 3KXDA 1HYHA 5A05A 1KY5A 2V7PA 1YKFA 4CMIB 5GZ3A 1NHWA 3WJAA 1O6ZA 1E7RA 4E5PA 3WGGA 2D2IA 5JMWA 2I99A 3UFXA 4IBOA 4LCEA 2EGHA 2GERA 3EVTA 2BELA 3ONDA 2DUUA 4KOAA 4QECA 1I10A 1XHLA 3K96A 1C1XA 3QVOA 5DNAA 3KOUA 4XGIA 2QRLA 2UDPA 1E1LA 3NDRA 4BVAA 1NQ5A 2O4UX 2UUPA 1B15A 1YL6A 3VDQA 4HWKA 1EQUA 1OFGA 4ESOA 1YL5A 2JL1A 3JD4A 3NT2A 1YH3A 2FMUA 1U8XX 3F46A 1SO8A 1YL7A 4I08A 4YAEA 4BNUA 4EI2A 4Q3EA 4XQCA 1E3EA 1BVRA 3IMFA 4MP8A 5U1PA 3OA0A 3RUDA 3PFWO 2WM3A 3DZFA 4XJSA 4F46A 2AXQA 4UREA 4J7XA 1UAGA 5IJZA 3O8QA 4D45A 5KWEA 3PFFA 2Q45A 4YAGA 2NLOA 3GUYA 5THKA 2JFHA 4L0QA 1GZ3A 3KEQA 1F17A 3NJ8A 1P0CA 1WDKA 4TKMA 3HHPA 3ZHBA 3WGOA 2BFMA 1GDHA 4OSPA 1LDGA 2Y0DA 4XWYA 2PWZA 4WJZA 5EPOA 1WZIA 4J4TA 2YUTA 2YV3A 5KKAA 4H7PA 1PSDA 4OH1A 5KJEA 1NVTA 4ND2A 3HB5X 1FDTA 5EMHA 2EJVA 2Y05A 3WGYA 1I36A 2BF7A 4NU6A 3ONEA 3WSWA 2OMEA 4EDFA 5DZSA 1E5QA 2DVMA 3KYCB 1XGKA 4IQ0A 1E3JA 1T2CA 4K6CA 5KVSA 1K89A 1T2AA 5BNFA 3PHGA 1YBMA 2X5JO 3KHUA 4B7UA 1PQUA 1Q1NA 4BNNA 4TMFA 3S2FA 3OF2A 4IIUA 3C24A 4II3A 4P22A 4CM9A 2X7HA 1Y5MA 3BMQA 5B4VA 3KBOA 3IJPA 2PGDA 3F4LA 4MIEA 3WBFA 2Q1SA 5JY1A 3K31A 5L4LA 1T24A 4R9SA 1P45A 1HE4A 1SAYA 4IDFA 3AU9A 3FPLA 1A4UA 3WGIA 1ZEMA 2CFCA 3UHAA 5L45A 3PVZA 2OORA 1G1AA 3ZU5A 3JQBA 3G79A 2Y1DA 1QYWA 2PZKA 1CETA 1N92A 1UUFA 2I9PA 4GPD1 3H3FA 3PXXA 3DZBA 3JQCA 1LQTA 1TT5A 4RF4A 4D3DA 2CD9A 2WD8A 4UEKA 5DCYA 4E31A 4CV1A 1LC0A 1E1KA 4YJGB 3LT1A 1BMDA 1ZUD1 1WDLA 1S6YA 2PV7A 1NPDA 1AUPA 2PH5A 3LLSA 4RPJA 4WLOA 4Z0TA 4BNXA 5IDQA 3FNGA 3INGA 4FN4A 2Q2VA 3QJ5A 2JJYA 2JAPA 3RFTA 1YO6A 1PGOA 4IDGA 4QT0A 4YT5A 3COSA 3FWZA 4Y67A 4B3HA 4BQRA 2I3AA 1O94A 2VRCD 3IUPA 1E7YA 2Q4BA 3ZNOA 1X14A 2PGLA 5KJ6A 1JWAB 4B4UA 2G1UA 1D4FA 1U3VA 3WS7A 3CIFA 3UXYA 4CLRA 1X15A 5F1PA 3L4BC 3GVIA 4MVJP 3OSUA 3NTQA 4ALKA 2BKAA 4NZ9A 2G17A 3TN7A 3DBLA 1B7GO 1B8PA 1X7HA 4D43A 3JYNA 5BSEA 1Q7GA 3I6QA 1F12A 5ENDA 4E2ZA 5L9AA 3RC2A 1O8CA 1W8DA 4W6ZA 1U4SA 4NFSA 2NVBA 4L73A 2J3JA 1C0PA 1KEUA 4E6PA 4J6FA 2CDAA 3TSCA 5HWSA 2UV8A 4W7HA 4F3YA 3L0DA 3L4BA 5JPIA 1OMOA 4BMNA 2E4AA 3GNTA 4AJHA 2IDZA 1VJ0A 1LSUA 1C3VA 4NMHA 3GEMA 5TS3A 1BGVA 1IOLA 2BFAA 5JDCC 2OUIA 3RKRA 3RC9A 5A3JA 2QW8A 3VPSA 5BQFA 4D3SA 5CHEA 1LXCA 3WFIA 3E9MA 4GI2A 5JO9A 3JQAD 3PZBA 3PIIA 4NJOA 5EIOA 5JW6A 1VE9A 3KYDA 3TDKA 4P8RA 1J49A 1I2CA 2FN7A 1P1HA 4IPTA 1NR7A 3EVNA 2DUWA 1WP4A 4IZHA 3FSRA 1LLCA 3TOZA 2QG4A 3ASVA 4JBGA 1KOLA 1A9YA 4K6FA 3DXFA 3FCOA 5G0VA 1NVMB 4N5NA 2BMAA 1V3UA 2NNLD 4XYLA 5IZCC 3FTNA 3VHRA 1LRJA 3F47A 1B16A 3EDMA 1ONOA 4AJOA 4BNVA 2HMTA 4G65A 4ZQHA 1D8AA 4J0FA 2SCUA 2I66A 1LNQA 3K2EA 2VQ3A 1LU9A 3IP3A 4OOEA 5IAAA 4R1SA 2A9FA 3FD8A 4JIGA 4R51A 4FFPA 1Z7BA 5A03A 1EQ2A 5DBFA 3PDJA 5DT9A 3C85A 1GQYA 4YB8A 1N9GB 1IPEA 1XDWA 3BTSA 5EQDA 4XRGA 2CVZA 4Y6PA 3ROQA 3KYCA 4I9HA 4MIYA 5C7LO 1M6WA 4PG5A 3ZNPA 2H5LA 3HADA 3CPSA 2GYYA 4MKZA 4R54A 5JY6A 4NBTA 1U7HA 3H2SA 4CMJA 4DUPA 4C7KA 5CPFA 4ILKA 3RCBA 4BB6A 3ZV5A 4BNZA 4E32A 2HMSA 4KWHA 3Q1LA 1B3RA 2NTJA 2HSDA 2EKLA 1A4IA 3EC7A 4FFLA 2JCXA 2HMWA 4DYDA 4ND3A 2B5WA 3UN1A 3WOHA 2CMDA 2ZK7A 1PWZA 2W4QA 3MJEA 4B7CA 4IQ8A 4BS9A 3Q11A 1RM4A 1MXHA 2POQX 4L8VA 4MDHA 4MJLA 3LYLA 3U9LA 2AEJA 2IEBA 3DFUA 4XKJA 3S2GA 4HFMA 1DIAA 4NHEA 2BGKA 1K2WA 3DBHB 3AUSA 1PZHA 4YJDA 2Y67A 3F6YA 2DT5A 4M87A 1KIFA 2W98A 3RSHA 3WGQA 5ICMA 2I65A 1MV8A 3DMYA 3WB9A 1HSZA 2VYVA 1HDRA 4FC6A 1QMGA 1ZNQO 3ST7A 1PL6A 1P9LA 3EZYA 3NAQA 3NTRA 4MVJI 1XLTA 5B37A 4LK3A 5F21A 2AA3A 1ZK3A 3SBOA 4BV8A 4E3ZA 2V6BA 2I67A 3WICA 2YHIB 2J5KA 1Y8RA 4PZDA 5GMOA 1U2DA 1OBFO 2PKQP 1KVUA 2V6GA 5COAA 5CG1A 1ENPA 2C5EA 4FW8A 3CMMA 1EVIA 5T5QA 4PVCA 1X7GA 1EUCA 2XXJA 5CDYA 4JJIA 1DXYA 2F00A 1PJLA 2VHVA 3JD2A 1T2FA 3UAGA 4CM3A 1MFPA 3JYLA 4NJMA 2OOSA 2AEFA 4BMSA 4BNKA 5DOZA 1PQWA 2YY7A 4CQMA 3Q3CA 5A04A 3PHIA 4OL9A 1HXHA 3HG7A 2FPGA 1XU9A 3DZJA 3GVXA 1H2HA 3QRWA 3KUXA 4XX0A 2EW2A 2NTNA 5KVVA 3NDIA 1YQXA 4XIYA 5L7YA 4FB5A 3NV9A 4XR9A 3H5AA 1MA0A 4E5KA 1BXZA 2VHYA 1HDOA 1D1TA 3AM5A 4YTEA 5CEFA 3AW9A 4ZU3A 4FS3A 1ADCA 3I9KA 1PJTA 3RU7A 4WUVA 3WYCA 3WQRA 5T64A 3WTCA 2HMUA 1M75A 3RBVA 5ICSA 3AOEC 4E2YA 2ZTMA 4CM9D 1KEVA 4FIZA 1DAPA 2NADA 4I9NA 3DR3A 1JA9A 4NR0A 9LDTA 3RI3A 1QKIA 5LC1A 1PJ3A 3I5MA 4YAJA 1GYRA 1PR3A 4HX5A 1WPQA 1AHHA 4HKTA 5G0TA 2P68A 4CM8A 3ABIA 1MG0A 2D59A 2O7QA 3F3SA 5ITVA 3EY4A 3JQ6A 4IINA 2RHCA 1GZ4A 1NQAO 3IJRA 1WMAA 4RVHA 3QLJA 2P2SA 1KERA 5JFOA 1Y7TA 2UUOA 3AFNA 1VC2A 2YHIA 2CF5A 3RKUA 1PGJA 3RUHA 3HQ4O 1HRDA 4EYEA 3VH1A 4EJ0A 1BSVA 1YB4A 2FSVA 2CVQA 1LDYA 3PDUA 2VWGA 5ITWA 1P3DA 2Q1TA 5CG2A 2EIHA 2B69A 4BNYA 1N1EA 4HV4A 3VPFA 3H9JA 2NV6A 3H8VA 3GGOA 5ER9A 3NX4A 1H6AA 5JC8A 1ZJZA 3GHYA 1EBUA 1IHYA 2W2KA 1KVTA 3P5SA 1NQTA 2G76A 2IZ0A 4GAEA 4FFOA 3LQFA 4J0EA 4RVGA 3DQPA 4E30A 4J4BA 1P1KA 4F6CA 1U3TA 3PLRA 4R16A 3UCFA 2OZPA 3IP1A 3PYXA 2VOJA 2ZIZA 4PRLA 1AE1A 4BNFA 4QEDA 1VJTA 4WEOA 1JWBB 2Y1FA 3K73O 5CPBA 4JK3A 4DC0A 4OQYA 1JW9B 4BO3A 1DLJA 3RU9A 3V5NA 3RUFA 3U3XA 3K5PA 3P7MA 4O1MA 5A06A 3JSAA 4NBWA 1ZMTA 1R6DA 4RPLA 1NFRA 1WNTA 3UW3A 5HTOA 1DIHA 4Z3DA 3I9MA 4ZA2A 2O2YA 5H83A 3KSUA 3D3EA 3BYZA 4BO9A 1R12A 2ZCUA 2EV9A 1PJ2A 4RF2A 2GZ3A 3TZKA 1DC3A 4J7UA 3PYMA 4K1LA 4EEXA 1SNYA 1FK8A 5DP1A 4IUYA 4FR5A 1PWXA 4GLOA 3K6JA 1Q2XA 2FPPA 2Z5LA 2HK7A 4HFRA 2VOEA 4E5NA 3W4IA 3TF5A 4E33A 4XR4A 2VCYA 1LQUA 1WVGA 5I8ZA 4A7PA 5FI3A 4UULA 4XB2A 5KVQA 4IDBA 1P31A 4GQAA 1CQIA 1H6CA 1UXGA 3GDGA 1E3IA 5JCJA 3VDRA 4YJFA 1GY8A 1NHGA 3UF0A 1YQDA 3LLVA 3CINA 1TLTA 4BNTA 2EERA 4GGPA 2DBZA 3IAHA 4TZTA 4FOOA 1JU9A 1LBEA 4UEOA 1LRLA 4RPKA 3R3JA 3Q2KA 4YT2A 2D0IA 5KVCA 2GUGA 1EUZA 4XCVA 5FFFA 4ALLA 4Z0PA 4DLBA 3M1AA 2HO5A 4I1IA 1NWHA 1Y6JA 1HSOA 3GZNA 3QA9A 3ZWMA 3DZKA 4RVFA 2X0NA 4R5HA 3QVXA 3TNLA 3AI3A 3C7AA 4AVYA 2CF6A 1HT0A 4OAQA 3F1LA 4YCAA 3BMNA 2DTDA 4RQTA 4U0JA 3AI1A 4JJFA 5FWNA 5IF3A 4Y98A 4KDFA 4OKNA 2X1HA 2IYOA 4M49A 4TRNA 2NWQA 4W9NC 4NFHA 3JD1A 2P5YA 4CL8A 4L4XA 3D3WA 5KOIA 3E9QA 1R4NB 4CUZA 3KSDO 4CODB 4AJLA 4LSMA 1T2DA 3LVFO 5AXAA 3PJEA 4Y9DA 1DIBA 1XU7A 5I7SA 1PR9A 2O4CA 3CE6A 3OIFA 2DPHA 3S55A 3DONA 4MO2A 4MVJD 1ZK4A 4FBGA 3MJTA 5ENVA 3WMWA 5C5IA 1U8FO 2EXXA 4B4OA 3NGXA 1ISJA 1H2BA 4BNLA 2EF1A 4U6QA 3R6DA 3V1YA 4WE3A 2QIOA 3G0OA 4ZQEA 4IJKA 2X0RA 4NBVA 6ADHA 1SEPA 3DBRA 2D5CA 2OO5A 1MC5A 1BG6A 4AJNA 4XA8A 3K30A 5FYDA 5T8KA 4UAGA 4HP8A 1P33A 3MEQA 3GK3A 1RYEA 4KMSA 5TQVA 1PQPA 2NSDA 3WJ7A 5AQ1A 4IJWA 3FF4A 4UEJA 1JAYA 1V3VA 2LDXA 4Y6RA 1YE3A 4LGVA 1PL7A 4BNWA 4BO0A 1ZIDA 4AJKA 3H3JA 3PHLA 3GVCA 4R1TA 4UVDA 1GFSA 4LISA 4PLTA 1B14A 1CF2O 4RL6A 1NAHA 2C0CA 1BDMA 4U0KA 4WLUA 2YQ5A 1E92A 3UGKA 3OH8A 4BB5A 5L7WA 3GOHA 3KYBA 4HY3A 1IL0A 1BXGA 1B0AA 3UCXA 1JVSA 4TQGA 1DIGA 1UXKA 1O5IA 3BA1A 3PI7A 1SOVA 1ZBQA 2H9IA 4HXYA 4UVIA 4KDEA 3ZNNA 4PG4A 4JBHA 1H93A 4PN3A 3GPIA 1XCBA 2Y93A 5T6BA 3A28A 4AJPA 4K28A 3DMTA 5C37A 1R0SA 2P5UA 1EUDA 5THQA 2ZYGA 3H5NA 5TJHA 4W9NA 3D4NA 2VHWA 3RC1A 3SJUA 3ZW9A 1UXIA 1UP4A 2JCVA 4GLLA 3PJFA 4Q3NA 3E6AA 3OJ0A 4P4GA 2AMFA 3Q6IA 1G0NA 5L95A 2QZZA 4I9UA 3TL3A 4DPLA 2AG8A 3KB6A 4LRSB 3KV3O 4K26A 5CEEA 5EESA 4PFJA 1YDWA 4XYMA 5IDXA 1TEHA 1Z82A 2X5OA 4GWGA 1BRMA 1K5HA 3F1KA 3VZQA 3G1UA 5C7OO 3GR6A 4A10A 2VHXA 3AY6A 1I0ZA 2HUNA 3B70A 2W2LA 3GA0A 4Z3KA 3B6ZA 1ZXLA 2Q3EA 3RFXA 1SMKA 2OBNA 2VUUA 1K0UA 1UXHA 2FSSA 3FBTA 1G0OA 2QHXA 4J9UE 4CLDA 3OFSA 3WXBA 1KBZA 3EW7A 3F5SA 4BKPA 2AW5A 3FN4A 4HFNA 4WASA 3S1LA 3VAZA 1PGQA 1V0JA 3ETEA 4WCDA 3GZNB 5F3RA 3RIHA 3HNPA 4MVJH 4MPDA 3BMOB 3DTTA 4CQLA 3H6KA 1Z7EA 1PZFA 2JD1A 3AUUA 4N18A 1XEAA 4XD2A 5DF1A 5IXYA 1NFFA 1NNUA 1DBVO 4UVGA 4BKUA 1H6DA 4BGVA 5U9CA 3JQ7A 4DL9A 3M2PA 4TSKA 2GR9A 7MDHA 3U4HA 1PTJA 4WCFA 1E1NA 4TROA 3HUDA 3AWDA 4GBJA 2DKNA 2YV2A 1FDVA 1K6JA 1XYGA 1NQOA 1AHIA 1TA4A 2FPIA 4J43A 4J90A 4CM5A 5COBA 5F1OA 3S8MA 2W2KB 3OJEA 1TXGA 1ISFA 4J3FA 1EK5A 1OAAA 5CDTA 5I9LA 4FQ8A 3GT0A 3VVCA 3M6IA 4DLLA 1YRLA 1I33A 3RROA 2Y1GA 3ZV6A 4M89A 2ZTVA 5JYDA 4B3JA 2GRAA 1ADGA 4E21A 3U5TA 1Z75A 3OM9A 3JYOA 2Y1CA 1Y8QA 3ZDFA 2Y99A 4PLGA 5A9SB 1B26A 3DHNA 3KZVA 3SC4A 2J3KA 3V2GA 4DPKA 1ENOA 4IMPA 5GZ6A 4WK6A 2B5VA 1R16A 3INRA 3KEOA 4DYVA 4GL4A 4XQ9A 3GRPA 5L53A 5IDWA 3QWIA 1MG5A 2P9GA 1KYQA 3OEWA 2OXIA 1EDZA 1H9BA 1QYXA 2DBRA 2AHRA 3R1IA 1D1SA 4R01A 3AM4A 3LZ6A 3NT5A 4RDHA 4XZ3A 3ZWOA 2HJSA 3IDSA 4DMMA 4DQUA 1VPDA 2DTEA 1E6EA 2VWQA 3JQGB 5DOVA 1JVBA 2OP1A 4W82A 3ZV3A 3G3EA 3X2FA 5A9RA 2WEKA 3RJ5A 3N58A 1C1DA 3C1TA 3P2OA 3N74A 1NM5A 2AE1A 2HKIA 4RDIA 5C7IO 4YJHB 1E3SA 5EINA 3SVTA 1WXDA 3TZCA 4BKOA 4NK5A 5A5EA 2FR1A 4BQPA 1P44A 3BHJA 4BL5A 4FGWA 4YAKA 1IPFA 1H0KA 1HKUA 4M54A 4RLHA 4DWVA 4IS2A 1ZVMA 4RVUA 4AFNA 1ID1A 3A9WA 1VM6A 4OKIA 4CMEC 3RUAA 1IB6A 4J9VA 2GN4A 5JAMA 5H82A 1Q0HA 5FEUA 2B4QA 4XQEA 3KLPX 1NPTO 4RORA 5U4QA 3RVDA 4D0SA 3MJSA 3QE3A 2X9VA 1LUAA 4OM8A 1MUUA 1ENYA 2ZATA 4YWJA 4CUJA 3QY9A 3GGPA 2EKQA 1P1IA 4JJGA 1KS9A 1U9JA 2B37A 3INTA 4ZQBA 3PTZA 3OQ6A 1Y8QB 1XIVA 1Z74A 2YDYA 3EYWA 1N8KA 3ZWWA 4BHTA 3WSVA 4O6VA 4MVJF 3D3WB 4J1QA 2XF8A 1QLHA 1Z73A 2NVUA 2Q50A 1XSEA 2VZ0A 3E9NA 4ALJA 1L7EA 1C0KA 5JAQA 3DEYX 4J4HA 4RF3A 3E8XA 2B4RO 1ISMA 2WD7A 3LT0A 1UDCA 3FNFA 2J6IA 4ONEA 1HYGA 1IZ9A 5JAIA 1GR0A 3VPGA 5CAEA 1HE5A 5ER6A 4WECA 4BOYA 1SCUA 4D7AA 2E82A 4DC1A 4J2OA 4QSMA 1Y5RA 1PU2A 1I24A 4ZRMA 1M66A 3O03A 3LK7A 3JQ7B 5G4KB 1FXSA 4YVFA 3RWBA 4CLXA 3PWZA 4IJUA 4KWIA 4YJHA 4QTZA 2PR2A 4MVJE 4JN6B 3BHIA 2VT2A 4R41A 4CV0A 5K0ZA 3GUCA 3ZNQA 4A26A 3B1JA 1LLDA 3WMXA 3PQEA 4IS3A 3PQDA 3ETGA 1HDXA 3PRJA 4RZHA 2OBYA 3WGZA 5JMPA 1PL8A 2B83A 2Y0CA 2VNAA 4LW8A 2FR0A 4CQMB 1YBAA 4YRBA 4LSWA 2Q1WA 1I01A 1NWCA 4M55A 4QFCA 4J16A 3G49A 3PPIA 1FF9A 2GPTA 3ROMA 2CDCA 3WGTA 3DZIA 3VH2A 2G5CA 5CEJA 1GV1A 1PJCA 4WOKA 2HAEA 4OYRA 4XYBA 5JSFA 2VN8A 1QV6A 2HLPA 2A4KA 2BFPA 3HE3A 4I8XA 4J7CA 1RJWA 5COQA 4CV3A 3ZWNA 1F06A 1FJHA 1XA0A 3PK0A 1KVRA 3SEFA 3L9WA 4GVXA 4CMGA 4RCVA 4PLHA 4JBIA 1B3BA 2X23A 5AVOA 3W4JA 4QUKA 5DBGA 3WLFA 3LF1A 3TPCA 4L74A 4BNIA 3U62A 4F45A 3ADOA 4FFRA 1JKJA 3LT2A 1RKXA 2QX7A 4ND1A 1ONPA 4ZD6A 3CKYA 2V6FA 4NIMA 3OETA 4M1QA 2Q4EA 3UICA 4WNIA 3PWKA 5LDHA 1GCOA 1HYEA 4KTVE 2GCGA 2VUTA 5BNIA 5TSDA 4ZGWA 3LT4A 1I8TA 2VYND 4K9DA 1HTBA 1VKNA 2DFDA 2NQTA 1CEQA 5A9TA 1I2BA 2BGLA 2X5KO 2I5PO 3D7LA 4QQRA 2H63A 3Q2IA 2JFGA 2NUAA 4DVJA 1KEWA 3GHHA 2PZJA 1HZJA 1ZFNA 4L4RA 4O63O 3DFZA 1H94A 5JDIC 2HDHA 2PD3A 3OEYA 1WW8A 2HQ1A 1YS4A 1BW9B 2UVDA 1GYPA 2A92A 4MINA 1LDBA 1ZO8A 1N9GA 4U5QA 3DB2A 2C7VA 3GVPA 4EJ6A 2FHSA 3X2EA 1LJ8A 4YRDA 2ZYDA 5ADHA 1P77A 2ZTLA 4YJGA 1YWGO 3PGJA 5KJFA 1DHTA 1XQ6A 2IYPA 4P4LA 5TX7A 1DEHA 1KEPA 4I5FA 4R3NA 3DTYA 4PVDA 1FDWA 1T1RA 2VUSA 4URFA 3QV1A 4ROSA 8ADHA 3FR8A 1I3KA 4BIIA 4O59O 1WWKA 4IY1A 5AXDA 5JYEA 4A27A 1ZSYA 2H1SA 5GY7A 3IC5A 3PHJA 5DP2A 1HLPA 4NG5A 3WIEA 4IMRA 3FNEA 5G0WA 3BMCA 5I9MA 3ANLA 2ZQZA 3U4DA 1JN0A 3OMLA 2X9NA 3E1KA 3AUTA 1K3TA 3W6ZA 4R1UA 1NR1A 3LSYA 3S2IA 2IRWA 1BVUA 2PH3A 2VWPA 3DZGA 1CERA 3GG2A 4KZPA 3ZHZA 4XJTA 2DLDA 3ZWXA 2D5AA 3VVBA 3OECA 3OP4A 3AI2A 2YV1A 5G4KA 2WTBA 2XXBA 2J3HA 3MOGA 1ISHA 3F4BA 3G17A 2X86A 1Q0LA 3ZWPA 2BFOA 3ZI0A 1U5CA 3GFGA 5B1YA 4BO1A 4BNMA 3EZLA 1H9AA 4YBZA 3FHLA 4ZHSA 3SC6A 1OC4A 1ISIA 1N5DA 2Q1UA 4HBGA 3MCVA 4AJ2A 3GMDA 1LSOA 1SEVA 2GDZA 3QQPA 3NGLA 3ASUA 3PGXA 3CH6A 2Y66A 3GLQA 2GZ1A 3GF4A 2JFFA 1NASA 3MZ0A 2A94A 2GGSA 1T1SA 2PFGA 4GH5A 1ULSA 4PLZA 1HL3A 5KJCA 2RHRA 2VTDA 4XRRA 2P4QA 1E3WB 3GH3A 4PIVA 1HDCA 2Z95A 2B4TO 1R0LA 2EW8A 3JQEA 4NNJA 1UDAA 3O38A 1BTOA 3GNQA 4PLFA 3MWEB 4M86A 2ZB8A 4CM7A 2HK8A 4D79A 3WYBA 4CMCA 1KC3A 3LF2A 1I3NA 2XPCA 1K6IA 3E03A 1PJSA 1UP7A 1GEEA 4WLVA 3HSKA 3JQ9C 3ORFA 4CMBA 2BRUA 1RYDA 2C54A 3I6IA 4LVCA 4CLRB 1TT7A 3IKVA 3UH1A 4F6LA 4CLOB 2EP5A 2J5RA 3R0IA 4CLHA 1DOHA 1YGYA 4FFMA 3MJ4A 1E7WA 4E2WA 1BDBA 4GMFA 3OBBA 3TFOA 4S3MA 4NQZA 1ZK0A 3OA2A 4NK4A 1MFZA 1LLUA 4S1VA 4A73A 5MGBA 3L6OO 3RUIA 4BNHA 5TT1A 1E3LA 3L77A 4ITUA 3JQAB 1QG6A 1AN9A 1J0XO 3I4CA 3ENKA 3P2YA 5KCZA 2YHUA 5I7EA 4BO7A 5I7FA 1A27A 4B8WA 1XQ1A 4IDCA 4TVOA 3OQBA 3RD5A 1EE9A 2QRJA 4KQWA 2WWRA 2AQ8A 4CMAA 3KLMX 5B4TA 4AJIA 1F8FA 1BW9A 3AY7A 4DLAA 3AUAA 5FF9A 2RH4A 2WD7B 4PLWA 1SOWA 2NVWA 4X54A 5IN4A 4YT8A 2YFQA 3BHMA 4FC7A 5TIIA 1OC2A 3TOXA 1MC4A 2VHZA 4BO4A 4EEZA 1IZ0A 5I8WA 3D64A 4L4SA 1JQBA 1YOVB 4LCJA 1E3WA 4ZN6A 3LU1A 4CM4A 5A5FA 1N7HA 4J49A 4CPDA 1U5AA 5AYVA 2ZJ0A 4OGWA 2HK9A 5HRUA 1YQGA 3W8FA 4YPOA 3HN7A 3VZSA 2F1KA 5JLAA 4KQXA 3Q9UA 5JBIA 3PYLA 1JKIA 1GTMA 3C7CB 4RLSA 1ZH8A 2VRBA 3BMCB 1P1FA 3QP9A 3B20A 1DAOA 3I9JA 3RASA 5IDYA 1NP3A 2JD2A 2Y68A 2EKPA 4N54A 5B4UA 2NU7A 2AEMA 2WMDA 4OXNA 5BNTA 5TT0A 3UVEA 5T67A 1U7TA 3ZWAA 3BAZA 5IXSA 3HJAA 2VYVD 1LSSA 1AGNA 3U09A 2EEZA 4DXHA 4YAIA 5CP8A 1I5RA 4PLCA 3U49A 3TZHA 2O48X 1EMDA 4IGEA 3JYQA 4GX2A 1O89A 4MVJA 3ICCA 1ZKMA 1E1MA 3O4RA 3QWHA 5KKCA 2D1YA 3WR5A 2PD4A 3MJCA 4YACA 1VSVA 5KNLA 2WDZA 3Q9NA 1CJCA 4O5OA 4J91A 4PGFA 4DIOA 3ZZNA 3RUEA 1ZK2A 4RPGA 2QYTA 1MLDA 5DDIP 2DAPA 2O3JA 1KVSA 5T57A 1EE2A 1R0KA 1DPGA 1WLYA 3IKTA 1N7GA 2YQ4A 4BNGA 4CQLB 1UZMA 4Q9NA 1CQJA 3O8QB 3DMTC 4U8GA 4IIVA 4OO3A 3V2HA 1Y1PA 4CUKA 4CM4B 1B8UA 3UCEA 4YQZA 2UYYA 2CNBA 2NU9A 5HS4A 1FDUA 3IOYA 1HEUA 2AQHA 1E0DA 2O2SA 3AM3A 4QO7A 2AG5A 4FJ2A 3NTOA 2O3UA 3GY0A 1SBYA 3OIDA 1VRWA 1VLLA 3EK2A 4UUOA 3ZCXA 4NJMB 1PX0A 4JROA 5IZCA 4FJ0A 4TZKA 4OJNA 4XB1A 9LDBA 1GV0A 2DFVA 1ORRA 2Q99A 2ZTUA 2VWHA 4JLWA 4TKLA 4XYEA 3SX2A 1EZ4A 1PS0A 3DBVO 2QRKA 2WYUA 4DRYA 4UUPA 3C3XA 1X1TA 3OICA 1QYCA 3H4VA 4R4JA 1HETA 3ITKA 2QZ9A 3L9XA 2C7GA 2DBVO 2V6MA 4XYGA 5L40A 4N5LA 4QO8A 4D3FA 4WPGA 3AOGA 4Y8VA 3C7DB 4R68A 4BKQA 4FDAA 4LVUA 4PRKA 1XELA 4RQUA 2O23A 7ADHA 4OXKA 2NU8A 4MP3A 3VKVA 4IXWA 2YFHA 4R1NA 2PNFA 1EK6A 4NU5A 2I6TA 1Y81A 4MKRA 4CM1A 2XAAA 2V65A 2IZ1A 2VRCA 1TT5B 4ZICA 2EP7A 1A5ZA 1ADFA 1Z6ZA 1YB1A 1YB5A 1YJ8A 3KYDB 2IZZA 3GDFA 1XKQA 3HDYA 1ZMOA 3PJDA 3ROPA 4BO6A 2I3GA 4IGFA 1GAEO 4CMIA 3B1KA 3WLEA 3E5RA 4BMVA 2W2LD 3OQ1A 3KVOA 1Y9AA 2BLLA 2C2XA 3WNQA 3ZW8A 3PIDA 5TC4A 4WLEA 4WGGA 2Q49A 2HU2A 2RIRA 3JQ8A 3VPXA 3ZH2A 3UKOA 5JAZA 2JKVA 3ZWVA 4R69A 4WLFA 4LN1A 2FWMX 2CDBA 4CQMD 3GFBA 5EN4A 1JDJA 4BKRA 1RM5A 1U1IA 2GN8A 3QVSA 5B12A 1QYVA 3GN2A 3ZHYA 4HNHA 1SZJG 4IDDA 4R3WA 3DHYA 1RWBA 3TZQA 1YXMA 4H15A 1X7DA 3H5RA 4HADA 3WYEA 4BO8A 2PKRA 2ZYAA 4E0BA 3PEFA 5KJ1A 3JD0A 1FMCA 3RJ9A 1DFIA 1GPDG 5DBIA 4KTTE 1EVZA 4G81A 2P91A 4JXKA 4EGFA 1L7DA 4TRJA 4QFDA 4ALMA 3K9QO 4IM7A 1W0CA 1YVEI 1O9BA 3SLKA 2OHXA 4GVLA 1DJNA 3ZN2A 2TMGA 1U28A 2IE0A 2Q2QA 3GGGA 3GG9A 4A2CA 1PEDA 3FR7A 4WLNA 3HB4X 2DQ4A 4FGSA 2GN6A 1ZK1A 5IZ4A 1N1GA 1M6HA 4Z9YA 4YDRA 1E7SA 1XG5A 4UVEA 5BT9A 2C5AA 2VNSA 2NVUB 3V2UA 4RPHA 2BHLA 4P38A 4XGNA 3WDSA 2CUKA 1ENZA 2O7SA 4NDNE 1GQ2A 1DFGA 3NDJA 4BO2A 3OIGA 5HS6A 4BUCA 1I32A 3H2ZA 2OL4A 5I9NA 1U4OA 2PK3A 3DZHA 1PIWA 5K6AC 3ADPA 2EJWA 4A0SA 2R00C 4B8ZA 1PS9A 3LC2O 4NPCA 4DIFA 4Q3DA 5G2OA 4QXMA 3V1TC 5C3MA 5A02A 4Q3CA 3BMOA 2C82A 4L76A 3ROKA 4E5YA 3EUWA 1VJ1A 3GVHA 4EBFA 3D4OA 3JQ8B 3HDHA 1T26A 5T8KC 3W1VA 1IHXA 3NKLA 3AU8A 2ZB3A 1GD1O 1UXJA 3A1NA 5G4LA 2IXBA 3VH3A 3ZU3A 4PLVA 5ILGA 3D5TA 1ONNA 3CSDA 1DC4A 1S7CA 3QIVA 1DIRA 3BTUA 1ZXBA 3ENNA 3I23A 3K2BA 1Q7CA 3L07A 1CWUA 2J3IA 3PJGA 1EVJA 4JP2A 5TJ9A 2W8ZA 1PZEA 2ZQYA 4GSKA 5L3ZA 2ZB4A 3GEGA 1HE3A 1Q0QA 4JGBA 3S2EA 3SLGA 5CDGA 1O95A 3RC7A 3M2TA 2P9CA 1X0XA 3F9IA 1GL3A 2EWMA 3FTPA 1JLLA 3D5QA 1DC6A 3ITDA 4NFYA 1SC6A 4BV9A 2Z1MA 4ND5A 4IJVA 1BWSA 5A1TA 1LC3A 3VC7A 2NU6A 1UP6A 3VH4A 1UH5A 2PTGA 1DSSG 3U4IA 1CRWG 4JNKA 1V6AA 3SXPA 1G6KA 1DO8A 2IEDA 3CMCO 1HDZA 1MP0A 4Z9XA 1IE3A 3WTBA 4GX0A 1TVEA 3I9LA 3TJRA 4UVHA 1D7OA 2UAGA 4Y6SA 1HWYA 4CR6A 2C59A 2P9EA 4TVBA 3U4CA 3BXXA 2A35A 3GAZA 2X8LA 2X58A 3C1OA 3ANMA 3PWSA 2HCTA 1KETA 3KETA 3GC6A 3V8BA 2ZKLA 1I3LA 3ZU4A 5L4SA 1WDMA 4ZJUA 3WBBA 2AQIA 5BSHA 1C1DB 2O3RA 4RVSA 2GN9A 3H9QA 4FOSA 1M67A 1DRVA 5KTKA 2YJZA 3RFVA 1ZSVA 2GF2A 3ZWYA 1HDGO 2BGMA 1P74A 4B7XA 1C1XB 3DWFA 4II2A 4J1TA 2FR8A 3E82A 1T2EA 3B1FA 3H7AA 4DGSA 1MB4A 2JD0A 3H9GA 5DCUA 2O3SA 1IUKA 3MWDB 1BXKA 4INAA 3W6UA 1EFKA 1QXSA 2PZLA 2GNAA 3JD3A 2J5QA 4GGOA 3A06A 3ZWCA 4YR9A 4W99A 4WCFC 2WYWA 1O0SA 4DQXA 3HFGA 3VKUA 3GRKA 1QLJA 3GMSA 1GUYA 2IODA 3LDHA 4TRMA 2Y0EA 3OHSX 4JP3A 4RVDA 4E13A 4UUMA 1NX6A 1BHSA 1HLDA 3DC2A 4KP7A 3AOEA 3KM0A 1UZLA 1QP8A 2CY0A 1I3MA 2P4HX 2JHGA 1VL8A 3H65A 2DM6A 2DTXA 2Z1NA 3WWZA 1LTHR 2ILTA 1PJQA 1RPNA 1T25A 4AJJA 4NH4A 4HNGA 3T7CA 3EMKA 1GPJA 3FBGA 3DAFA 4XGKA 3PZRA 4PG7A 1I2ZA 1C0IA 1PGPA 2VZ9A 1VKOA 3NJ4A 3WIDA 3U0BA 1GZ6A 1PJ4A 1ADBA 2ZCVA 3GZ4A 4CM8B 3D0OA 1B2LA 3NEPX 4W7IA 3NYWA 1E7QA 3TFQA 5EQFA 2EGGA 2GLXA 4Q3AA 5ILOA 4ZQFA 3MTGA 3R3SA 6LDHA 4J1NA 3CUKA 5LDGA 2HRBA 3ZHXA 3I83A 3ZU2A 1EDOA 1FDSA 3BMQB 1A9ZA 2FP4A 3JQFC 3VTFA 2B0JA 5TNXA 5A9SA 1IYZA 2HMVA 4FPXA 2D3TA 2RAFA 2FY8A 3H9EO 4TWRA 1UR5A 3DOJA 4AG3A 3ON5A 1EBFA 1U3UA 2QYSA 3DOOA 3ETDA 5KIAA 5TRTA 4BNJA 4Q39A 4RGBA 4YYZA 3RAJA 5IN5A 4AICA 4AJEA 3RBXA 1RM3A 2X6TA 3SJ7A 1YONA 4IZIA 3HZZA 2YYYA 4NI5A 5JXWA 4TRRA 3RQSA 1NPYA 3L6DA 3DAGA 4E2XA 4EZBA 3DAPA 1F14A 1U3WA 4EUEA 1H6BA 5L7TA 1NYTA 2ZJ1A 3QSGA 3JYPA 5BR7A 1K6XA 4H16A 1J6UA 5A4DA 1SB8A 3LC1O 3BMNB 2NM0A 5JS6A 3IUSA 1EFLA 1PJBA 2JCYA 1R66A 3PP8A 5DULA 5ES3A 4EJMA 1DFHA 3WQSB 3GNSA 3QWFA 2BH9A 4CJXA 4YRAA 3PQFA 1AXGA 4HUJA 1W73A 1OOEA 3GPDG 4KUGA 4J1SA 3ZV4A 2OFPA 4I5DA 1ULUA 4O0LA 4AJ1A 3ZGYA 5JCJD 2VTEA 2EHDA 1QV7A 4EUHA 4YT4A 2RCYA 2X9GA 5EL0A 2D8AA 1R4MA 3IIEA 4ALIA 1Z45A 3E18A 3D4PA 5JE8A 1LRKA 4L9RA 4EITA 1X1EA 1LDMA 1T4BA 2AE2A 2PLAA 4GSLA 4PZEA 1LLQA 4W4TA 4CR7A 4RF5A 4RV9A 1A7KA 3HWRA 4PLPA 5IFLA 3TL2A 3DBRB 2PD6A 3IS3A 2VZ8A 4GX1A 3WFJA 4Z6KA 1UZNA 3GQVA 4PLYA 2DU8A 2Q46A 2JAHA 3GN1A 1A71A 3KO8A 3EAGA 3TRIA 2O3QA 4D42A 4B3IA 1LSJA 4LMRA 3BTOA 4WNCA 2O3TA 1GUZA 3GDOA 4XIJA 3W4KA 3JQGA 4CMEA 1KVQA 1TB4A 2LDBA 3P19A 4PZCA 1WZEA 2DBQA 3AK4A 5HBRA 4C7JA 1MGOA 2ET6A 3MTJA 4GMGA 1ZCJA 3VTZA 1XWFA 1E77A 3K92A 3F5QA 4FSHA 3W8EA 4MIOA 1E6WA 4R5MA 5FI5A 3PLNA 4OQZA 1WMBA 1TI7A 2BI7A 3CEAA 2BD0A 1M76A 5HA5A 4BGUA 1J4AA 3GAFA 1BXGB 5AOVA 1I30A 4AL4A 5G0SA 2FZEA 4HFJA 4KUHA 3UUWA 1A7AA 3O26A 5A3VA 4GKBA 1X13A 2PKQO 3DBLB 3HDQA 3M1LA 3WNVA 2XOXA 3HFSA 3TZ6A 2BI8A 1ZW1A 2Y1EA 1XR3A 4FD3A 4L75A 4KUEA 5GZ1A 1C14A 1NVGA 2OP0A 3TWOA 2WYVA 4CL3A 5L4NA 1R4MB 3T4EA 1V8BA 2YDXA 3IQDB 3VZRA 2WJPA 1DRUA 3CTMA 4IXTA 2DPGA 3W8DA 4D44A 5TLSA 1UAYA 2ZB7A 3OJOA 1NAIA 1CYDA 2VT3A 5CDSA 3FRJA 2WE8A 3K8ZA 4PG6A 3BIOA 2X0JA 1DHRA 1VL6A 1V35A 1U2GA 4RZIA 3I9OA 4DBVO 3AJRA 4LMPA 1EEHA 4CR8A 2EG9A 1QYDA 2C20A 1SB9A 1HZZA 2C2YA 1F8GA 1ZEJA 3DL2A 2J8ZA 5H81A 4B4VA 1ZJYA 4UUNA 4DBZA 1JKFA 2YW9A 2X22A 2GSDA 3T7EA 5F5LA 1ARZA 2RH8A 5JNLA 5JCXA 1UDBA 4IDEA 2GD1O 4AJ4A 1GADO 2E37A 1ISGA 2GO1A 3L4SO 3AFMA 2H6EA 2C29D 2DC1A 3RBZA 4FCCA 1VSUA 3NT4A 1OI7A 5HM8A 1GEGA 1GUFA 4H3VA 1E5LA 3EHEA 1WAMA 3RUCA 4BGEA 5BSGA 2CVOA 3JQFA 4NBRA 2GASA 4Q3BA 1V3TA 2NTVA 4OHUA 5EERA 3TQHA 3VOSA 3WX0A 2NACA 4DMLA 2PGJA 2VYNA 4ZRNA 1DC5A 2E48A 3JTMA 4R9RA 2I76A 3BTVA 5EJ2A 2OGUA 5L51A 2E6UX 2X4GA 3QVWA 1QRRA 5F1KA 4YEDA 1VI2A 4GKVA 1OZAA 5CDUA 1W6UA 3ONFA 3OJLA 4E4YA 8LDHA 4B4WA 3LC7O 4DREA 2Y1OA 4PCVA 4OSOA 2O50A 2AQKA 4CLEA 3NUGA 3FWNA 2B36A 4CMKA 1HE2A 3MJVA 1ML3A 3ANNA 4BO5A 2W90A 1NTOA 4Z0HO 4IDAA 2RBEA 3CZRA 2R00A 4YQYA 3CZMA 1DJQA 5K6AA 4MOWA 1R4NA 1E6UA 5LCXA 5CFZA 3DBHA 5DN9A 5AXBA 3AY3A 3O9ZA 3PHHA 3KSZO 5F5NA 5IG2A 4FFNA 2X0IA 1MXFA 3OJFA 2E49A 4E12A 2GZ2A 1P0FA 1MX3A 1YDEA 2FRDA 3G1TA 5TF4A 4GWKA 3GEDA 5G0UA 4EW6A 1YOVA 1N2SA 2G82A 4D0RA 4RO0A 3JQBC 4WOJA 1Y8RB 4P4NA 2JHFA 1W4ZA 1C0LA 3IL2A 3NRCA 2WSBA 3HDJA 4NBUA 1T4DA 1JTVA 1CDOA 1NBOA 3D1LA 2YZ7A 1GYQA 5MDHA 1YBVA 3QHAA 4JQCA 1A72A 5J23A 1EVYA 3I9NA 2G0TA 3QW2A 4ND4A 5K9ZA 1SPXA 2D4AA 3DO5A 1Q7BA 1D3AA 1L1FA 4I5GA 4YA6A 1NXQA 2IXAA 4WKGA 4EUFA 4MVJM 4GX5A 4D46A 1DLIA 1Y9EA 1DB3A 4N7RA 1JAXA 1LA2A 2HRZA 5JDCA 4DPMA 5AXCA 3I4FA 1F0YA 1HF3A 1RM0A 2PA3A 1IY8A 2TMDA 1CIVA 1PS8A 3VZPA 1PGNA 5I7VA 4A5OA 1KC1A 3I52A 4J2HA 2R2GA 3V1UA 3UOGA 1E7MA 2NQ8A 3KRTA 5JDIA 1ZZEA 1PZGA 3QWAA 3QVTA 3C1AA 4IQGA 3I3OA 4ALNA 3ULKA 4A03A 4E5MA 4YXFA 1R37A 1YJQA 1R15A 4CLOA 3L6EA 1X0VA 4XDYA 1GQQA 4XEHA 4M8SA 1HDYA 3E5MA 4BGIA 3STHA 4ZQGA 3ZWBA 4C4OA 4CMHA 3DDNA 4MKXA 3HN2A 3I1JA 1QR6A 3ICPA 3T4XA 1LX6A 4Z9FA 4U6SA 2C07A 3FPCA 1LI4A 3JQAA 4LRTB 4WEQA 1ZSNA 1GCUA 3DOCA 4RJTA 4OIMA 5TGDA 1DDOA 1KY4A 4CM6A 2QQ5A 1AXEA 3A4VA 3JQDA 1VL0A 3FNHA 4CV2A 4YJFB 3WQQA 1UJMA 3JQ9A 3MOIA 1J5PA 3WGHA 4JX8A 4XQGA 4XDZA 3EGOA 4DTIA 5DCWA 2FZWA 2HJRA 3FI9A 5BSFA 5JC1A 3WWYA 2CZCA 1H5QA 1DRWA 2B35A 2FOIA 4B79A 1QSGA 3Q0EA 4U7WA 4D41A 4OXYA 2WE7A 3BZUA 2R6JA 4QX6A 2PY6A 4JCOA 4DA9A 4ID9A
chains in the Genus database with same CATH superfamily
4L95C 5JV5A 2PX0A 3OESA 4CTNA 1VG1A 2C98A 4MV6A 3RNOA 4G84A 1IULA 3NBQA 1BN7A 5EZYB 1USWA 5MHTA 1CUGA 3C16C 4PAQA 4YAFA 3DE3X 2ILVA 4NG4A 3VPHA 3ANTA 1KDPA 4YJ3B 2F8LA 2B92A 4MP6A 4DIBA 4AK9A 1UIRA 1ESDA 3E48A 2CSUA 3V4PB 3G7NA 2A9KA 4REMA 5DXFA 2J4CA 4RZXA 4MCHA 5CXUA 3M82A 1PG0A 3JASA 3QK7A 4PGGA 4MVJG 4PCUA 3VPCA 2MYTA 3AM1A 1ODJA 1V7QA 4KN6A 2VNJA 5A9SB 4WFIA 3A14A 3N0VA 2YKGA 3WG9A 1FFYA 3JCZA 2NP7A 1LEHA 1TM2A 4JYZA 3OPYI 5T41A 3LTEA 3K32A 3KXDA 1HYHA 4MEBA 4NAHA 3UHOA 4MGIR 2Q9UA 2J85A 3KSAC 2QMUA 3P97A 4CMIB 2ZT7A 3MGKA 3AHDA 3MAGA 2FFHA 1SJ9A 4J16C 2D2IA 1N77A 2ZSAA 1W76A 1YC5A 2I99A 2YMLA 3KQVA 4G37A 3T0GA 2H17A 4LBYA 3RAGA 4IBOA 3TQIA 4DAOA 1Y7PA 2P35A 3SF8A 3L7KA 3SBEA 2GBPA 2PH7A 5KQMA 5FOXA 3EVTA 4M8LA 4C5CA 2BELA 3EQ7A 3ONDA 5BP7A 3AVQA 1WULS 4QECA 1I10A 1XHLA 2ZRCA 4FMDB 2Z4TA 1KTVA 1U0GA 3LBIA 4NARA 1CQWA 1R8YA 1T5BA 4RA9A 2C4KA 3WRWA 2FSPA 2UDPA 4RTLA 2MSDB 4YHHB 1ZOPA 3LX4A 2W70A 3SMVA 3T7AA 4BVAA 4ZK6A 4HGZA 3I30X 1WMEA 2YVQA 5K3FB 3V8EA 1JAHA 1E2HA 3N87A 4HWKA 4R9VA 3T0IA 4ESOA 3JD4A 4EG0A 1TJ3A 1MORA 1YH3A 4W8GA 3KJIA 4QJIA 1U8XX 2OCDA 3F46A 1SO8A 1RP7A 4EI2A 3F7OA 4PANA 1QVWA 5DX8A 2GCIA 4IOMA 4ZMSA 2YV5A 2F90A 2QDKA 2HXSA 1EJBA 3OA0A 4KAFA 3RUDA 1BGXT 3PFWO 4TUYB 1X77A 1ZOOA 2VJMA 3HYTA 2AXQA 4L5BA 4X95A 4CFZA 4QKQA 2G72A 3UMRA 1IN1A 3TLBA 1UAGA 4RENA 4WW0A 5T4HA 4LC0A 1RNLA 3F97A 1RJDA 2R47A 1XHEA 2BP7A 4G0NA 3OT1A 1Z4JA 2PL1A 2VYQA 4G0YA 4L0QA 4OL0A 4DABA 3Q8MA 4Y2GA 3JYHA 1P0CA 1WDKA 2OXRA 2JLQA 1FFAA 4P58A 2ETXA 2PGOA 1R64A 1JR3A 3PICA 5F73A 3S44A 3T5MA 4A82A 2V0GA 1TYEB 1WZIA 3EGDB 4J4TA 2HDNB 2YUTA 5KKAA 1Q50A 2ATXA 1PSDA 3NAZA 2BEJA 2ZWVA 1CVRA 4QBTA 2H48A 3I34X 1NRWA 4YRFA 1V1MA 2R1ZA 2Y05A 1NA5A 3WGYA 3NNNA 1I36A 4DR3B 5EXPA 4DR7B 3WSWA 1K8QA 1CFZA 2OMEA 3B85A 1KSJA 4IO0A 4EDFA 3KYCB 4IQ0A 3ZD6A 1XGKA 4GI7A 1E3JA 2AC4A 4HGRA 1T4CB 3L7BA 4DG5A 2FNAA 3R0QA 1HG1A 2R4TA 2YWDA 4X8MA 2I7XA 1B43A 4Y2HA 3TQQA 1VG9B 2SKDA 1C7QA 4YECA 3UUGA 4B7UA 3ZQUA 1Q1NA 4BNNA 1SKBA 3ND8A 1XX6A 4ZHQA 1E4EB 1NNI1 1RE0A 3DH0A 2ZUDA 3CS3A 5IDVA 1GGMA 5E9JA 3LY8A 2WWYA 2X7HA 4IWXA 3OFNA 1Y5MA 3ESAA 3KBOA 1VMAA 3F4LA 4MIEA 5IJ0B 2P2LA 1CJKC 2Q1SA 2XD4A 3OUTA 5JY1A 2QT0A 1QVVA 5DNYB 3CJTA 2H85A 2XSZD 2Y9MB 3VR1A 3HJUA 2OCKA 4A1FA 3AU9A 1A4UA 2QLTA 4I7EA 2CFCA 7GPBA 5KNBD 2C95A 3ES9A 4BAUA 1XT6A 1Q0TA 3ONWA 3FA2A 1Z47A 3ZU5A 4AQ7A 2ZRLA 4OA5A 3V48A 3CNEA 5C4IA 4GPD1 4Z9AA 2QPLA 1K0FA 4BFYA 3DV2A 1LQTA 1ZQ9A 2WD8A 4D3DA 4WY5A 5KWJA 4E31A 2GHRA 2AIRA 3OX4A 4PS1A 1VYVA 4DLZA 4ZU1X 4ZDKA 5BPHA 1BMDA 1W4AA 1WDLA 3SR4A 2EFCB 5A5GA 3LQRA 3BXOA 4KR6A 1ZH4A 2R2AA 3HWX1 4TVKA 1GPLA 4WLOA 4Z0TA 2ZETA 3FNGA 3TTVA 3PRYA 3K4PA 2IP2A 3MT9A 1THZA 4FN4A 1K06A 4E88A 2H9YA 5TMBA 2JAOA 1W9HA 3DEZA 3UV7A 2IU0A 2QAGC 4IDGA 3WLLA 4YT5A 4B3HA 1C7EA 3H9CA 4Y67A 1O94A 1FSSA 3ORYA 4JIMA 1JI3A 2VVTA 1N6IA 2Q4BA 4JEIA 3U31A 1GNPA 2GWRA 4X64B 2LWIA 2CJFA 2XUZA 1X14A 1PBTA 3CNLA 5GONB 4IXDA 3RFFA 3RSCA 3ESBA 5FUXA 1D4FA 4B4UA 5AKKA 1QFYA 1S8FA 1Z6GA 3UMJA 2EFYA 5F1PA 4PCLA 4MVJP 1H2AS 1KJNA 2BHNA 1QQ5A 2XQJA 5CUQA 3UAVA 1WR8A 3CX4A 3VMFA 4C0KA 5C7YA 2DHRA 2JGJA 4FM9A 1DVRA 3D4BA 1FE8A 3OMWA 3I53A 4NZ9A 2PTHA 1YR9A 1L5LA 4PSKA 3RYTC 5LQUA 4YMWA 1VP9A 3GLRA 1Q7GA 5ENDA 5KPJA 1VJ5A 3GRUA 1DZ3A 4E2ZA 4EKNB 2W8BB 3BFPA 4BEJA 4W6ZA 1E32A 1O2DA 3V3TA 5IH7A 2V9CA 4L73A 1RQRA 4N6OA 3K9CA 4JY7A 4IUBS 3HACA 3T61A 1Q91A 2Q3HA 3O90A 4J6FA 3TSCA 2UZ4A 2LCQA 1WXWA 4F3YA 1P61B 4J0KA 4ENPA 1JLHA 1OR8A 5JPIA 3FKQA 4MMXB 5KTSA 3I61A 4CCWA 3A9UA 1KJIA 1SVNA 4BMNA 4NZPA 4YI3A 5CTAA 1LSUA 4YRMA 4NMHA 1GIAA 1IOLA 3BF8A 2DJIA 4FMCB 4JKIA 3V8NA 1SQ5A 2OVFA 3RC9A 4B2PA 2QW8A 2O8NA 5GJVC 4ZI7F 3R3WA 1Z2DA 5BQFA 1HFEL 3WFIA 2MJLA 2C96A 3M4XA 4GI2A 1C29B 4UE3S 2RGYA 2MSNA 2WU8A 5C32A 2C84A 1PFGA 4MJ7A 4Z8YA 2XX3A 4NBKA 1SHJA 4N12A 1VE9A 3TDKA 2QVGA 5EQTA 1BFUA 1J49A 5FWYB 2WOJA 3EIOA 3QUCA 2OA0A 1JL3A 1TAUA 1AKMA 4BFZA 1LLCA 1KK3A 2NXWA 3O83A 3TOZA 2QG4A 4OLJA 1Y1TA 4GQBA 4LIPD 4QGAA 2QBYB 3DXFA 3FCOA 4HAZA 5KYTA 1NVMB 1NBWB 1GTL1 2BMAA 1V3UA 2NNLD 4XYLA 3SI7A 1T0HB 4E94A 1ONSA 2FAXA 1PD1A 3NHBA 2KS6A 1LRJA 1B16A 4BNVA 3E9DA 3GLIB 2YBEA 2HMTA 4ZQHA 2BM1A 2C00A 1PT8A 1N7IA 2I66A 1LU9A 4HAIA 1JEJA 5IAAA 4KJZA 3HYSA 2A9FA 2IP1A 3FD8A 4ZVKA 2D1RA 5BSRA 3T94A 3CWQA 1T1EA 3JTEA 3NEYA 1WQ4A 2ASVA 1X42A 3AKEA 4ZDJA 4GOND 3HSSA 1ZL2A 3C85A 3GBSA 5DT9A 4WIAA 2WT4A 4P32A 1W2GA 4YUYA 2XDAA 2ZT6A 1AM4D 1OYVA 3GJ5A 5TPWB 4J07A 1O87A 4A8JB 2NPIA 1CS4C 2I6FA 3IAS6 3OTIA 1HTTA 5H02A 1X1CA 5C7LO 4L4YA 4NYMQ 3CPSA 2AOTB 4FNAA 1K92A 2Z2XA 3H0EA 3KQPA 3GEHA 4A0FA 1P4HA 2AG0A 1GRRA 1HO3A 5CVVA 1QHXA 1RKBA 3BG5A 3O8DA 4QELA 2RAVA 1WB9A 1V1JA 2W5UA 3R3VA 2BGIA 2EKLA 1VZ3A 3EC7A 4IQ4A 3EH2A 5K05A 1QMPA 1IQPA 2HMWA 2NU6B 2B5WA 2OKGA 4Q9DA 2QORA 4EX6A 4EDHA 1QBGA 2ZK7A 1YDHA 3G7SA 4IQ8A 5DW0A 1A2KC 4FWIB 5BR1A 1RM4A 1N5JA 3ZY6A 1POWA 2WFLB 5L6MB 2BM9A 1XCGB 2GNOA 3MXOA 2H4WA 4MDHA 1AKVA 4MQMA 1QGUA 3C5EA 3U7EB 5B7QA 3DFUA 3JZFA 3LBYA 4GQIA 2F3SA 5K8LA 3AUSA 4IP0A 2Y67A 3WGQA 4HDQB 2W98A 4HZGA 1XJCA 4CG3A 1RFLA 1OIWA 2D0PB 2R65A 4POAA 1U81A 1L7MA 5J4YA 5BVHA 1ZNQO 2P62A 4LDZA 3ROTA 3ST7A 1P17A 2R7KA 1PL6A 1U3CA 3NAQA 2OK8A 4YV2A 3NHLA 1GRVA 4S2EA 1MJHA 1Q0UA 4MV5A 5DE3A 1XLTA 4FDTA 2AA3A 1GGHA 4IZOA 4E3ZA 1XPOA 4MWZA 2WPNA 4BZXA 2V6BA 2I67A 5E3IA 2BCEA 1HH4A 1W5SA 4WXYB 2EBHX 3WICA 2IH2A 2FPMA 2J5KA 1OBFO 4GOJA 2BFBB 1P7ZA 2M6LA 3DVQX 2C5EA 3PUJA 4O4HA 1H4QA 2JGDB 4KRYA 2X3FA 1J5EB 4JKOA 3HRHA 3LKBA 4PVCA 3NDBB 4L1KA 2I2XB 1W9MA 1YNSA 1B8NA 1MVLA 2MWMA 4JJIA 4CF6A 3SF0A 4E5SA 3JD2A 2QT9A 3EA0A 3UAGA 3F4KA 4CM3A 1MFPA 4NJMA 3IODA 3FF1A 2E4VA 4RVOA 2D0DA 2VF8A 1LW6E 2YY7A 5G1PA 3AUJB 5A04A 2O5CA 2V1XA 4CXMA 1C1HA 1KPGA 1OWOA 1YQEA 3I1FA 3IPLA 1HKHA 3KD3A 3SQMA 4F72A 2FPGA 5SYMA 4YPVA 3GVXA 5DNUA 4EVQA 1TF2A 4FFBA 1C7IA 3QU5A 4O4LA 4HLCA 5IHXA 2V96A 1FP7A 1NYRA 1W44A 1Y6QA 4XX0A 3HA2A 3W34A 1D6NA 3WMFA 1G2PA 4U2GA 1YQXA 3B3QA 4US1R 4XIYA 4O0MA 4WL0A 5L7YA 4JB8A 5CX1B 5KWVA 4N76A 1EIWA 1P0MA 1UIMA 3FHOA 4LJRA 2QQFA 4XM2A 5LXTB 1TKRA 2HV8A 3SQOA 1KAQA 2HLDD 3BRSA 4HAOA 4H1WA 4NHOA 5DIZA 4BX3A 3TGWA 4OHWA 3WK9A 3PE4A 3DM5A 2HR1A 1LI7A 3AW9A 2V98A 3OPQA 4R1LA 5D01A 3I9KA 1PJTA 4NOMA 3RU7A 4WUVA 4D8VA 1CQPA 3ROFA 2GF0A 3GV0A 3VJKA 1Z0FA 3RBVA 1DGQA 2YIJA 3AOEC 4MS4B 1S4MA 4E2YA 4JI6B 4KN8A 3V6MA 1VI6A 4L22A 1KEVA 2FGKA 3L8MA 4FIZA 2NADA 4I9NA 5KX5A 3ZVLA 4LHWA 4UBLA 2PBLA 2JJ2A 1G20E 1QKIA 2GFHA 2FCRA 3LCMA 1QJCA 1PR3A 3P52A 2QL5A 1AHHA 5TS2A 4YV1A 1QO0A 3CR8A 5LM3A 4X66B 4NCBA 1N4AA 1SCUB 1JDZA 4JOQA 2WJ6A 1EA7A 2D1QA 3F3SA 1NM5C 4Y2UA 1PNVA 2JLRA 2QD3A 3LGSA 1NQAO 4DUGA 2G9UA 1W0JD 3Q6MA 4FWBA 4DQLA 1AQNA 3QLJA 4M1MA 4FYWA 3KJXA 2B1JA 4MR8B 3IQGX 3K0KA 2B7LA 2K5UA 2CCJA 2HH9A 2JFUA 3U7QB 3WO0A 3HQ4O 3G5MA 4Z9BA 5A4FS 2J0UA 1TE2A 5JSZB 1DV2A 1BSVA 1YB4A 3IIJA 5BT8A 1W5TA 4WERA 3DL0A 3MWFA 3KHSA 3RARA 4FT4A 2C2MA 1P3DA 5CG2A 3H16A 1K6MA 3QBVA 2ORWA 3VPFA 3WWEA 2NV6A 4OAOA 3HVKA 1ZL0A 5BWNA 5CA0B 2ACEA 2QGZA 3GHYA 5FR2A 1RABA 3EDOA 2W2KA 4QULA 5D5QA 1MBZA 4UE6A 3NUQA 1NQTA 2G76A 2IZ0A 2W6IA 4E30A 1CRPA 1JUDA 3FLBA 1GNRA 4J4BA 3T1QA 1P1KA 3W5SA 4DV4B 1F4LA 3BEOA 1FNNA 3L0IB 2Q5IA 2VPPA 3PLRA 2JF0A 4X1YA 5DGDA 4U9UA 3KB8A 3SIRA 3IP1A 1EB8A 2VOJA 2GPWA 1ZY2A 1RS0A 4JJ7A 4JJAA 4BNFA 2QLNA 2MR6A 1NUTA 1E9AA 1YRAA 1JWBB 2W7TA 3UYLA 3RUPA 3VR2D 2AD1A 3M4JA 1N5OX 1JW9B 1OXBB 3OZ7A 4DY4A 1KAEA 2W2PA 1R8QA 1O77A 3U3XA 1QGUB 4KRFA 3P7MA 4I50A 1VHWA 4LYHA 1XNRB 2P1RA 2R44A 4B46A 1R6DA 1IU9A 4ZVQA 3GZTB 5FH9A 2MSEB 1A50B 2FQ1A 4G23A 1OXTA 1BEZA 4YRNA 3QYFA 4A5SA 2ZCUA 1QPBA 2Z8YM 4CTKA 4EEXA 4M38A 1DUSA 1OWNA 4IUYA 4GLOA 1WB5A 4AUEA 5H68A 4BBPA 2YUIA 1BCSA 2Z5LA 5EJ7A 2HK7A 2VSFA 1U31A 4RHEA 2UUAB 1N78A 4DJ5X 3W4IA 3HXLA 3SVLA 2PUVA 3D8BA 3KTFA 2ZAGA 4MGYR 2DULA 1WVGA 3OU2A 4AT1A 4CL0A 5CVTA 3DKVA 3E27A 4A7PA 2X1LA 4I55F 1X8KA 4F1JA 4IDBA 1JIQA 4JLKA 1W0KD 1CQIA 1BA2A 3O8NA 1E3IA 3MQ4A 5JCJA 3VDRA 1NHGA 1SZDA 2BUCA 2JHCA 3KZXA 3T5DA 4ANFA 4CW7A 4F5WA 7YASA 1TPZA 2HPVA 3PCRB 4KO2S 1PG5A 3A6JA 4TZTA 3RTGA 5BOSB 1LBEA 3HGMA 1OH8A 2HBQA 3TAUA 3LOPA 4NPHA 2PS1A 5KVCA 2GUGA 4S04A 2ZJOA 3L4JA 1DX6A 2R5WA 4XCVA 3E9CA 3TR0A 3IGFA 2X41A 2QLBA 2ZUWA 5FFFA 5CYGA 2KWIA 3U7FB 4DLBA 3KPWA 2HO5A 1OJLA 1NWHA 2DECA 3KB1A 3LOUA 3QA9A 4MAMA 1OPXA 4JL6A 1T0BA 3RAEC 3OMXA 4RVFA 3MQ2A 4FHZA 1R88A 2X0NA 3HH8A 1Y8CA 2Z8YA 2YXBA 3AI3A 2HXYA 3OT5A 1EFCA 4ECAA 3GLIA 4XASA 4KHZA 3CF6R 4V0KA 3F1LA 2F17A 1SXHA 2Y8EA 3BMNA 4NENA 4RQTA 3AI1A 4QA9A 3IO5A 1S2GA 5FWNA 1V11A 5IF3A 1KIMA 2PX8A 3E5HA 3CZAA 4Z7NB 2IYEA 2IUEA 2C57A 3MQFA 3R4CA 3IE0A 1X8XA 2NO5A 4GR5A 4MV4A 4B44A 4L4XA 3D3WA 3INNA 3K20A 4U4AA 5G3ZA 3KOXA 3E9QA 1MEEA 1R4NB 1T9GR 2M6RA 4BVFA 2CXXA 4L8FA 4LZPA 4RGYA 3PJEA 3DE7X 2PGNA 1DIBA 2NSJA 3ICWA 4JT4A 1MCZA 5I7SA 2GN2A 5C2JB 3DONA 1FP4A 4MVJD 1FX0A 4YCDA 1IBLB 3X1YA 1TVCA 3WMWA 3C0KA 1ZGAA 1DRJA 3NNDA 2EXXA 4X20B 3UN1A 1IB0A 4FOTA 3KUKA 2ZYTX 4KSYA 1X9GA 3NGXA 3T3DA 2EFDB 1KWKA 1KO1A 1Q5PA 2QVYX 3R6DA 4EKGA 2NPFA 2PQ2A 3OCUA 4NBVA 5JSZA 2OO5A 1CUHA 5FYDA 2PSSA 1NSTA 3JZDA 4HP8A 2A1TS 4BLQA 3GCXA 4WJKB 2C4UA 3TPZA 2Z6UA 3OX3A 1M0TA 3R3HA 1TK9A 1T1JA 2PJZA 1PQPA 3ZCSA 2NSDA 3WJ7A 1JR3E 5AQ1A 5BV2P 2MOKA 6AT1A 4IJWA 4C0BA 4MS1A 2WILA 2ZVQX 1JVNA 1KQOA 4JJ8A 4LJLA 4UEJA 5KOYA 3ZKWB 5KQLA 1DJLA 5EXEA 4CIVA 4JLNA 1GZUA 1NN5A 4Y6RA 5KC8A 4FLEA 3IEVA 3DT8A 4PZAA 4Z86A 5SV2A 2XBLA 5AKEA 2VJNA 1Z4PX 2PX5A 3AIMA 3F6SA 4Q1BA 4F85A 4A8TA 2QAGB 1X9HA 2I4RA 4PLTA 1NZDA 4OCZA 4JI2B 3EA5A 1NLFA 4IRUB 3SYTA 1XN1A 3OIWA 2OEPA 3VFDA 3CU5A 3TFWA 1RW4A 5L7WA 3KT3A 4J0QA 2EBWA 3KYBA 2DSNA 3AKZA 5CH3A 4Q24A 1LV8A 2CEAA 4I50B 5CGQB 1JIJA 2P9YA 2RGWA 2GBFA 1NXXA 4HXYA 4QDTA 1TZCA 1X74A 3C4VA 4N7MA 2ZBRA 1PSZA 5EVCA 1YFZA 4DG8A 5B55A 4TMYA 1IN4A 2GLUA 3GPIA 3L0CA 1KH1A 1T8TA 2P9HA 1Q77A 1T35A 2P5UA 1RLUA 5THQA 4XWKA 1Z34A 1E2UA 3MCTA 3ID6C 3D4NA 4GDMA 1K6EA 4K2AA 4RA6A 3E6AA 5C4MA 3GAMA 3E22B 1U8YA 1AN0A 2QROA 2X4DA 4PX5A 4I9UA 1CUAA 2DQSA 3TL3A 2VQEB 1U5BB 4DPLA 4HJXA 4NV1A 3V8MA 2WKQA 5CEEA 2XMBA 5EESA 3AINA 1OREA 4LVNA 1NVVQ 2G0NA 5DBHX 1KFCB 3ZVKA 4RACA 1LKZA 1TEHA 1Z82A 4GWGA 3NEAA 2PIDA 1BRMA 4NVRA 3T8YA 3CWZA 4YK7A 4AC9A 4M0FA 2Y1XA 2O8BB 3G1UA 3GR6A 4A10A 1TX4B 2VHXA 1UJ5A 4KIUA 1L1QA 1RLTA 2W2LA 3B70A 3C6QA 3WLNA 4AF6A 1ZXLA 3RFXA 3CG4A 4GEGA 1SMKA 2OBNA 5D3QA 1NF2A 3CB2A 3WB2A 5LUAA 2GBLA 2WHXA 4J9UE 3DT9A 3DPSA 3QKUA 2ASEA 3UC5A 1E0KA 4DHWA 4EMBA 2ZUUA 3ZU6A 4BFCA 4AY2A 1AQLA 4DC9A 5BMOA 1TKAA 5F3RA 2WJZB 4M7PA 1A8HA 2EBUA 2PO5A 3E8SA 4WZAA 3MJFA 1KFEB 1H69A 1OBVA 3BMOB 4MPDA 3DTTA 3N2GA 4WWHA 3GO4A 3AUUA 1EFRA 2JD1A 4JODA 1XEAA 3DJYA 4XD2A 1CQJB 5DT2A 2IPNA 2H8GA 3A9TA 1DBVO 3SDZA 3FYUB 2JK1A 2XGSA 2YFKA 4Q1DA 2BN4A 4YHBA 4BGVA 4DL9A 5DH9A 3ZLTA 3IJ5A 2WJAA 3L02A 5AW6A 4MHTA 2Q2OA 4L9WA 3U7QA 4AB1A 4DMHA 5KQGA 1G6Q1 5DGCA 3IUNA 1HL7A 1PDWA 1PTJA 2H2HA 3ECAA 2QUIA 2H2WA 4PTLA 2HMYB 4EHKA 1N33B 4XDHA 4NEQA 2AWNA 3K6RA 2O8EA 3WYAA 2GTIA 1K6JA 2NZ2A 4ZI5A 3JZAA 2ECOA 2FPIA 3B7GA 2XEXA 2PO7A 3R7DA 1DAIA 1RE1A 5COBA 2DPXA 1NRXA 4BQNA 2HUPA 2W2KB 1D0VA 2OD9A 1ISFA 1QGOA 1EK5A 3MAAC 1OAAA 5CDTA 1XMQB 1ZJ4A 4LMBA 1FX0B 3K9GA 4OATA 3QVGB 3A1VA 2AOTA 2ZBEA 4L8GA 1UZAA 4QBHA 5D00A 2WWFA 4XFKA 2D5IA 5DHSA 2QW1A 1SZCA 1TJ4A 1FY2A 1YAJA 2Y1GA 2HSJA 3QKSB 3Q0IA 4M89A 3AONB 1CY7A 1RYBA 2A84A 4COOA 4LVOA 1ADGA 2R7AA 2AJ8A 2G80A 3JXEA 4FGLA 2QY6A 3SF8B 2BKXA 1Z75A 2ZSFA 4BVLA 3JYOA 5JBQA 2VFAA 4UDOA 2D06A 2I29A 2L42A 3FPAA 3KZVA 3SC4A 3RYCB 2J3KA 4NBSA 3V2GA 2OB1A 2GPYA 1E2IA 1ENOA 2A0KA 2QUKA 1OY1A 4RZ2A 4NECA 1R16A 3Q1KA 2EBFX 4PRZA 1IEXA 4IDPA 3TLGA 3ZDRA 721PA 3HJFA 4PYMA 2ZYRA 4G86A 4X94A 3D0QA 3QWIA 1MG5A 2VYFA 1KYQA 1S8NA 2YN4A 3AEYA 1KZGB 3D6UA 3Q9SA 3D8NA 4CKXA 3W5BA 2F67A 4DA7A 1H9BA 4DCPA 3EG9B 1D1SA 4V3BA 4XZ3A 2EZ8A 1P7YA 1Z83A 2HJSA 3Q7TA 1ZKDA 4RTJA 4YMVA 3E3MA 1XDDA 1T4GA 1UXOA 1VPDA 2VWQA 3PCTA 5FOSA 4PXAA 1JVBA 5C80A 3QE9Y 1MQSA 5DLEA 2CB9A 5E4TA 3TEJA 2GESA 3BJRA 3G3EA 3NOVA 2Q0SA 3X2FA 4CRWB 2CV2A 4HEHA 5F1YA 4HH1A 5A9RA 2EL7A 1CUEA 1NM5A 2AE1A 4RJKA 2I4OA 4YJHB 1E3SA 1HBJA 3GW8A 4S1NA 4EG6A 1JSRA 1WXDA 5FOQA 2NUPA 1ECFA 4NK5A 4MUHA 4N4AA 1BFKA 2FR1A 1BX1A 2VHUA 3HU2A 5JNVA 4WKNA 3FTEA 3U7RA 1G63A 3D3KA 3E3OA 5DTIA 4MUGA 5F9FA 5AM3A 1H0KA 3KALA 3HZOA 1W19A 1KHTA 1O96B 2H5IA 4AFNA 4RVUA 4KXVA 1SUAA 2GVZC 2WMOB 4B35A 1A3CA 4R83A 5ULLA 3D6JA 3UAWA 3RUAA 3W2HA 3ZGOA 2GN4A 4BXOB 2C9OA 4DNFA 2GPNA 5JAMA 2CMKA 4Z4FA 1TKCA 4FE4A 2AN9A 2XT9A 2HRCA 1CU1A 1FEZA 1ANKA 5CXQA 3CQ9A 3KLPX 3PXAA 1NPTO 4OMDA 1M2GA 1PV2A 2ODTX 5LOVB 3W3ZB 3QENA 1BS2A 1IXKA 2PBFA 4PZ0A 4AKEA 2ZREA 5KHLB 1QB7A 2I1VB 3QE3A 3WVNA 2QP4A 2X9VA 3GELA 4OM8A 4QXQA 1CRQA 3KQLA 1BDJA 1CHNA 1M1UA 1P1IA 2EKQA 2FB9A 3E58A 3OCWA 1U9JA 4ZQBA 1W1WA 3EYWA 1XIVA 2YDYA 3V2IA 3ZWWA 2ZULA 4KXUA 3WSVA 4AMVA 5K6RA 2HYIC 2ISSD 1Z0KA 3KE8A 4UHBA 4XM1A 3M89A 4W5OA 3L18A 1UADA 1FJGB 3BIXA 1UK7A 2GJAA 1J0DA 4TSFA 1C0KA 3HR4A 4B71A 4RPCA 4EPVA 4HF7A 2LPMA 5K0CA 4XARA 1JIXA 1OWLA 1A4RA 3KR1A 4NZYA 4KK3A 3OZDA 4R2LA 3ZVRA 1XTBA 1ZCZA 2FQQA 4JVOA 1GR0A 2HCJB 3VPGA 2Q5OA 3TSWA 4D9FA 4MYUA 1S89A 3C3MA 3HJHA 2AR0A 3DE2X 3HMQA 3JX9A 3PX7A 2JATA 4J2OA 3H5VA 1PU2A 1UBSB 1I24A 4ZRMA 3GT4A 2CFOA 2LR0A 4H3SA 2F7SA 5G4KB 4FYPA 4IOKA 2RJNA 3KVYA 2J9XB 1FXSA 3EASA 4HRAA 2P5SA 4MUXA 1OBCA 2ZIXA 2PU5A 4KWIA 2OM2A 5ERGB 4QTZA 3IIKA 4JLOA 1XEXB 1IZZA 4KV7A 3GCDA 4E6EA 2HIHA 5BY2A 1YRHA 4GOKA 1ORHA 3RSGA 3WMXA 4ZEWA 3PQEA 4WXHA 4L08A 1SRQA 3ETGA 3KSMA 1Z9BA 4MLCA 4TS1A 3KQTA 4DDKA 4D9JA 4YR7A 1QKJA 3HI4A 3GRRA 2OBYA 2F8SA 1TZMA 4LF9B 5JMPA 1T3LA 4IOJA 1SC3A 3AUFA 4JUFA 4MWEA 1PL8A 2Y0CA 3MS4A 3TDMA 3WRYA 5JH7B 1A7UA 2VNAA 4D0GA 1YBAA 3AL2A 3NANA 4KE9A 4JFRA 3AXSA 4HNTA 3U37A 5JSHA 1NWCA 3QE2A 2PZFA 1Y1SA 2ESRA 1L4GA 1OV6A 1FF9A 2C9ZA 1CBUA 5C1DA 3E7XA 2W8BA 2CDCA 3WGTA 3GLGA 3BQMB 1C7FA 2VH5R 1GPWB 3DEHA 3WMEA 1GTZA 1QE5A 3MYRA 3SKYA 3WKDA 4DLVA 2B0CA 5CFMA 3NOQA 3TCKA 2HAEA 3G88A 4OYRA 3LRPA 5HYVA 3TSYA 1QV6A 1ZRHA 2QMEA 1XWIA 1U0SY 2BFPA 2IYXA 3FVQA 3GQBA 3UHPA 2QMYA 1RJWA 3Q3IA 5COQA 4CV3A 3MMXA 4FZVA 3U61B 1XA0A 2BTEA 4HDNA 4QYMA 1P2GA 1M0SA 2Z2IA 4GVXA 1I2DA 1W88B 3GPBA 4X7RA 4ZZ2A 3N3AC 4PLHA 1L7XA 5IK2D 5AVOA 3CVUA 3W4JA 1Z39A 3MF4A 4OQDA 4QATA 4NONA 2C77A 1GKUB 5DBGA 1WHTA 2B98A 1PUIA 2GXSA 2ZU0C 2I03A 1VIDA 3E53A 3ADOA 4L74A 3U62A 3LT2A 1DC8A 2QRVA 2XJ4A 1ZVJA 4LZOA 1T29A 1GDDA 3FWHA 4ND1A 4AIIA 1JU4A 5H16A 1E66A 2FA9A 2RI6A 4NIMA 3EGWA 3VVLA 1G8AA 2Q4EA 3W2TA 2EAUA 2ZP1A 3FOBA 1P5FA 2JC3A 3TLZA 1LS6A 1T5TA 1QF9A 5IAOA 3PNYA 5JG7A 1R5JA 1P2SA 1U3GA 2WMYA 5KYUA 5GONF 2NQTA 3SD7A 4TTSA 1Y3CE 1I2BA 2BGLA 2JVKA 4OFBA 1ZOSA 1YZKA 3FFXA 5IMBA 3X1MA 5F7XA 3AETB 2AFIB 2ZRNA 3GNLA 4PFKA 2YNMD 4DVJA 1KEWA 1UANA 3AB8A 3GHHA 4S2UA 2IU4A 3X0DA 1ZFNA 2BEVB 4O63O 3DFZA 1H94A 2GF9A 4RGQA 1RRVA 1Q11A 5FOUA 3OEYA 1ODTC 3SYNA 3UT6A 1Z28A 1YS4A 2HQ1A 4HGQA 4JYPA 5K3SA 4FN5A 3HVIA 1KGSA 1QIIA 1CUIA 2UVDA 3LY5A 4G0ZA 3SDBA 3W05A 3ZIAD 1U0JA 5LP1A 1VHTA 1G17A 5LYYA 1U2GC 2A33A 3BFJA 1DWOA 3DB2A 2G1KA 3OT4A 4FBLA 1X7YA 1HY3A 4U5QA 3RVKA 2FZVA 1P2UA 5JARA 1LJ8A 5KWIA 1JR4A 3BWYA 5TGTA 5ADHA 4FMCF 1YWGO 1F8XA 2GH1A 3EVFA 3PGJA 4KFRA 4KVGA 4UDXX 3S5UA 1DHTA 1JPVA 1XQ6A 3IULA 4KBFA 5WRFA 3UJPA 4BMOB 5IFKA 5KOHA 1O58A 3HR8A 4K9LA 1YFLA 1AB5A 1UWLA 4PVDA 1FDWA 1EJ0A 3EWIA 3CN7A 4KBYA 3BIJA 4ROSA 5DASA 3FR8A 8ADHA 2IYTA 2WI8A 1QTQA 3LP6A 3S68A 1PCXA 4BIIA 1NMQA 1RMTA 2CHQA 4JELA 2H9AA 1G8HA 1ZSYA 2H1SA 1JTFA 1DRKA 2PMFA 1UQTA 2Q7DA 5EOVA 3C3CA 2I1LA 1ZVQA 2XITA 3T5PA 1TC2A 3QVMA 5G0WA 5AI5A 5HF8A 4BVJA 2ZQZA 3PDIA 3IB6A 3H8SA 4OQ4A 5DWDA 1RWXA 4JJEA 2NZXA 4M0MA 4ZYYA 3U7IA 4A91A 3H11A 1H1DA 1OYOA 1X2EA 1YS6A 2NV0A 5ESWA 2RI1A 2ZJBA 2E3JA 1T4MA 3S2IA 2PT9A 5LQDA 3U44B 5D3ZA 2ERYA 4UMDA 3R0XA 3GRFA 4P7JA 5HIMA 2DLDA 5F2NA 3SQNA 3EGIA 4M9CA 4PF1A 2VAVA 4IIEA 1B0UA 3B8HA 4QDUA 4U2BA 4L72A 3TCXB 1TCAA 3AI2A 2YV1A 4WNYA 5G4KA 5SY9A 1JTEA 2J3HA 4J0GA 2YMQA 4B48A 1J2TA 3G17A 1PQYA 3GRZA 3HEAA 3HDGA 1TIPA 1Q0LA 2O06A 4JQZA 4OQLA 4BTLA 4DDWA 3N2YA 5CIWA 4HNUA 5CD1A 3WZ2A 1XZKA 1VHDA 1SCAA 3ZI0A 1K8ZB 4DADA 4BGDA 1JXAA 1P0QA 3KD2A 5DHFA 3N0TA 3RSZA 1TKBA 4BO1A 2AFHB 3TBKA 4BNMA 4PNEA 1ESEA 4ZHSA 3OEED 1ZQ1A 5JI3E 1U0BB 1TUEA 3IQFA 1OC4A 3PUWA 1AU9A 1N5DA 2Q1UA 3MWDA 3MCVA 4AJ2A 2VAMA 4OXQA 1SEVA 3KPJA 3P5BA 3Q3HA 1SR8A 2I9KA 3ASUA 1E3TA 4GKAA 3JQRA 5JS2A 2GZ1A 3A1FA 1AKRA 4RZSA 2DLNA 2JFFA 1FDRA 1NASA 2IUFA 2OHIA 4OVKA 5KYVA 5CB4F 1N7JA 3N75A 1T3HA 2VTDA 3GUUA 4WDRA 3M6FA 1P5RA 1RBZA 1YFJA 2Z95A 3VZCA 1R0LA 3JQEA 4NNJA 3T41A 1GNVA 4PLFA 1BTOA 3IALA 1K08A 4OJYA 2DHDA 1EFPA 5LYJA 5IYZA 1ECBA 1W581 2XTMA 3G9UA 2ZB8A 4M86A 3LWDA 1KI9A 4I9GA 2FWNA 5EE9A 4CFSA 4CMCA 2F9MA 1M6YA 5FUMA 1I3NA 1LS1A 3GJ3A 2NUPB 2OCPA 1P0PA 2P2ZA 3IV6A 4FYMA 4ZJPA 1PJSA 5BXQC 4YV0A 4YUXA 2CLLB 1WV1A 2OG1A 1WV0A 2HWYA 2P9BA 3CZ4A 1H05A 2XA9A 3MINA 3ORFA 2BRUA 4MW6A 4W5TA 3WV5A 1RYDA 3OLYA 4QEZA 4W1PA 2PKYX 3O8BA 3IKVA 2AOUB 3Q7PA 4I9FA 4YP5A 4C06A 2VJDA 1XC7A 4EKDA 4M8IA 1DOHA 2F2TA 1HRKA 1W29A 2R3SA 3OBBA 4OGFA 2W93A 1J99A 3AP2A 1Y3FE 1ZK0A 1JFTA 5AW5A 3I0NA 4X3PA 4FTWA 4UM5A 4H6XA 5ICCA 1LLUA 4H0CA 3FTCA 2OK7A 2HQRA 3SS9X 2GJSA 2QPOA 2CLSA 5FJJA 5BW6B 4FQ7A 4LOKA 5CIYA 3L6OO 3RGGA 1G2QA 3NBXX 3KWMA 2YWCA 5TT1A 2XGJA 2IEGA 1E3LA 5KX5F 3L77A 4ITUA 5AVYA 2WUEA 3JQAB 2ZCJA 3L1JA 1QJ4A 1J0XO 3I4CA 4YJ3F 4D8UA 2RH5A 1J42A 3P2YA 3QI7A 4PCAA 2YHUA 4QUDA 5KCZA 4I4TA 5B7PA 2WTUA 5I7EA 1TFUA 2C99A 4RD3A 2FEOA 3RYIA 4BO7A 5TMEA 5LQNA 1DBQA 1F60A 2ODEA 2QD1A 4CHGA 3TINA 1YRQA 3K0CA 2NSLA 3CVWA 3IEKA 1YMQA 2AI1A 3NP7A 5KUTA 2AQ8A 3GLSA 4LNUB 1BW9A 2R97A 3EXHA 4YXWA 3ED5A 5DW3A 5FF9A 3U7JA 4BP9A 3TTSA 1YHNA 4F2WA 2RH4A 1K86A 1VLMA 5KYWB 1XTTA 3OP1A 4PLWA 4WHMA 2NVWA 4X54A 4CQJA 2DR3A 4DKXA 4YT8A 5IN4A 2BW0A 3T5TA 2GNPA 5I7HA 1R0RE 3WAGA 3QJYA 2XUDA 2GUWA 3DEFA 3MOSA 2VHZA 3NHPA 4HVTA 1C8BA 5I8WA 3D64A 2A5FA 3LBAA 5H4HA 2V7VA 1X8LA 4ME6A 1E3WA 1EGQA 3A4YA 5J9FA 1TTPB 3X44A 1N7HA 2CLKB 3U1BA 4XI9A 3E15A 4IR7A 2C4HA 1OLOA 1R1DA 2C3PA 2ZJ0A 1XZIA 4JWTA 5AH0A 4M99A 3WNBA 4C04A 3A7EA 5JLAA 4TLBA 4A0QA 1V71A 2PJUA 4F3TA 1NN0A 1IEWA 1YMVA 4BLWA 1GTMA 3T3IA 1AUOA 4X7MA 5MN4A 1SVIA 1DEAA 2CXRA 3WLAA 1ODCA 3UWDA 2YIVX 4AWBA 2R6AA 4HH3C 4J7AA 1EM6A 3GXOA 3U81A 2O8EB 1NP3A 1VE3A 2JD2A 2O5VA 3QPUA 4FGKA 5ICFA 5IYZF 4A8JA 2EKPA 1IOVA 5LYJF 4N54A 5B4UA 1P2TA 2FJPA 1GTRA 4ZO4A 2NU7A 3W7BA 1EE1A 2WMDA 4M0UA 1G7TA 4DMCA 2XVXA 2IUYA 3UVEA 5T67A 5TQ2A 4BN0A 2QRGA 4LS3A 3NBZC 3S8YA 1JX6A 1Z2NX 4W8HA 1O0CA 3U09A 2D74A 1CUZA 3NB0A 3VDXA 4DXHA 1KWGA 3FTQA 1RXWA 1MPTA 1YHYA 5F64A 3EIWA 3I32A 3P9ZA 5A4AA 4B5LA 1AK2A 3MVEA 2VA8A 5KTMA 4XLZA 4KO4S 3TB4A 2ZWPA 1KK0A 2WHRA 1AKWA 4LHSA 5IM5A 2JB9A 2Q5LA 3HBNA 4LNHA 3ICCA 3EUAA 3CLRD 3O4RA 1WBBA 2D1YA 2IIPA 4G0PA 1VSVA 2JFWA 3QVJA 2IKSA 3SOPA 1CJCA 3H1FA 4N39A 4O5OA 4JXZA 2N3ZA 1IMOA 1JA1A 1RJ9A 4Q1EA 4TZ6A 3ZZNA 5FUQA 2WIDA 3EVDA 3T1TA 2DAPA 1W93A 1PEAA 1N6RA 1XXLA 3MJDA 5T57A 1EE2A 1M7BA 5J4VA 1BZYA 1X86B 1RLOA 4BQIA 4M0CA 3SHFA 4C6TA 4M46A 4MUMA 5AUNB 4M9QA 3GLFB 1PT9A 5CK4A 1LI5A 2PH1A 3LPMA 3NTXA 1QG4A 2DKFA 4URYR 3TXXA 4CUKA 4CM4B 5K3CA 5BYAA 1V8ZA 5LVAA 1ZR4A 1B8UA 1USKA 2V7QA 3KKKA 4L50A 2AFIA 2YVUA 4GBGA 2UYYA 2C1EA 4RZ3A 5AOCA 4ZVSA 1MKYA 1N6HA 2NU9A 3F71A