4GLOA

Crystal structure of a short chain dehydrogenase homolog (target efi-505321) from burkholderia multivorans, with bound nad
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
258
structure length
258
Chain Sequence
MDLNLQDKVVIVTGGASGIGGAISMRLAEERAIPVVFARHAPDGAFLDALAQRQPRATYLPVELQDDAQCRDAVAQTIATFGRLDGLVNNAGVNDGIGLDAGRDAFVASLERNLIHYYAMAHYCVPHLKATRGAIVNISSKTAVTGQGNTSGYCASKGAQLALTREWAVALREHGVRVNAVIPAEVMTPLYRNWIATFEDPEAKLAEIAAKVPLGRRFTTPDEIADTAVFLLSPRASHTTGEWLFVDGGYTHLDRALV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
publication title Crystal structure of a short chain dehydrogenase homolog (target EFI-505321) from burkholderia multivorans, with bound NAD
rcsb
source organism Burkholderia multivorans
total genus 95
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2012-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4gloA00
4Q3DA 5L3ZA 2QG4A 5JMPA 5A5FA 1VSVA 1PR9A 4OIMA 3PQEA 3VVBA 1ONPA 3FR7A 3V2GA 1BXKA 1I3MA 3ETEA 3G1TA 3WICA 5CDGA 1R4MB 4DC1A 2VNAA 3AM4A 1RPNA 3NJ8A 1OOEA 4J4HA 3DHEA 3JQFC 4IY1A 4MKRA 5JE8A 3BMQB 2I9PA 3A1NA 1A9YA 1OZAA 4LCJA 4KTVE 4N18A 4O5OA 3STHA 1YJQA 3GVHA 4OYRA 3NV9A 3RU9A 3DTTA 3F5SA 4DBZA 1D7OA 1X7HA 5DP2A 4YAKA 5KWEA 3F3SA 3K2EA 2HK9A 1ZH8A 3DL2A 5TT1A 2P68A 3VPHA 2DUUA 4I08A 3TRIA 1DXYA 4XKJA 1GPDG 4JGBA 4A26A 1UXGA 3BTSA 1PJSA 5U9CA 2VHVA 3NRCA 1T2CA 2DUWA 1O9BA 2CVQA 4H3VA 4BO1A 4XJSA 1CWUA 4BNYA 4I1IA 5CEJA 3GMDA 4ZHSA 2EF1A 2Y0EA 2YZ7A 4PRKA 3DHNA 1ZJYA 1QP8A 4AJPA 2QYTA 4ZGWA 4XB1A 3AK4A 3JQ9C 1CEQA 2E37A 4M8SA 1B0AA 1FF9A 1PJQA 4IMPA 5THKA 4D44A 5JBIA 4TRNA 1DIBA 5IZCC 5KVCA 5L4SA 4IZIA 2GN8A 2IXAA 3PJEA 4Z3KA 4BMSA 5BNIA 4YEDA 4CQMA 2RHCA 1PZFA 3QWIA 1LRLA 1E3SA 4RLSA 4CLDA 4YR9A 1AXEA 3AFMA 3ZWBA 3GHYA 4BNHA 2B4RO 1DEHA 1JKJA 1OBFO 2EEZA 3K5PA 1HDZA 4JBIA 1F8FA 2JHGA 3JTMA 4D3DA 1ADCA 2Y68A 1Y81A 2QW8A 3FD8A 3HADA 1EBUA 3GFGA 4Y9DA 2W2LA 5DBFA 1Y6JA 4QTZA 5IN5A 1NVTA 4AJJA 1E1NA 1VKNA 1GZ3A 3C1AA 1H2BA 3GH3A 4E0BA 5KJ6A 2FOIA 1XQ1A 3OIDA 3TQHA 1C0IA 5JAQA 5HM8A 5IXYA 3KTDA 5K9ZA 2Y66A 1IOLA 2AQKA 1W8DA 1IPFA 3FTPA 2J5RA 4GVXA 1KVSA 3HDQA 4CR8A 4KOAA 1E0DA 3IP1A 4PG4A 5IDQA 2B83A 3D4OA 2I99A 4OMUA 1Y8QB 1PGOA 2O3SA 2VZ8A 3GNTA 4B79A 4EI2A 2HJSA 5JW6A 2AMFA 2DFVA 3FRJA 1DAOA 2PH3A 5A5EA 2PD3A 3KYDA 4M49A 1EE9A 1A5ZA 4JCOA 4OHUA 3L6EA 3W6UA 1E5QA 2IYOA 2Y1CA 2NVBA 2OBYA 4ALIA 1KEPA 1NFFA 4DMLA 4NFYA 4UREA 3SLKA 2DBQA 2Q46A 1GYPA 1IYZA 4O0LA 3I9NA 3GEMA 4UVDA 3CSDA 4N5LA 3PPIA 4PG6A 2ZB4A 2I66A 1ISIA 2A35A 2DBZA 1P1RA 2C54A 3ZI0A 4E5MA 2QQ5A 4WCFA 1E3EA 1WMBA 3KSUA 4J9UE 1X0XA 5GZ1A 3PYXA 3IC5A 3B6ZA 4W4TA 1C3VA 1QYVA 2BELA 2XF8A 2X0JA 3TNLA 1ZK1A 2PNFA 1T2FA 3A4VA 4BQRA 3GPDG 2NTVA 3NJ4A 5G2OA 3AY3A 3MJCA 4G2NA 2YHIB 4I5DA 3ZU5A 1BDBA 2DBVO 4NBVA 3IS3A 4L0QA 1H6DA 4R1NA 1XQ6A 1XYGA 1NTOA 1Y8RA 2PK3A 3U4CA 3WMXA 3DFUA 3WYBA 1W0CA 1IPEA 3IKTA 4EYEA 2P9CA 1GCUA 1YE3A 4BGEA 3KM0A 5JDCA 1N9GA 3JQBA 4ALMA 1SZJG 1HSZA 1UP6A 1MX3A 2JD2A 3LZ6A 2AHRA 3FR8A 2FPPA 1YL5A 2ZIZA 1Y7TA 4S1VA 5JNLA 4Y67A 1IHYA 3PK0A 4NH4A 1M67A 5TSDA 4B3HA 3HNPA 4Z0TA 4HNHA 1ZXBA 5TQVA 1YL6A 5L45A 1Z73A 1U7HA 4EUFA 5FF9A 2WE8A 1N1GA 3OETA 4PZDA 4YQZA 4YXFA 1SOWA 4W9NA 1X0VA 4M86A 5JLAA 4R4JA 3UGKA 2DU8A 4JBHA 2I3GA 5MDHA 3H3FA 3UCXA 4IS2A 4J91A 1TT5B 2HMTA 4L9RA 1UDBA 4E12A 3GDGA 2PY6A 1ML3A 3DBHA 4GSLA 1MXHA 4DMMA 4LVUA 3CPSA 5JMWA 1MUUA 3INRA 5CDSA 2ZCUA 1HDXA 2NV6A 2PD4A 1N5DA 3D7LA 1R0LA 3PFFA 1YB1A 1B3RA 3H2SA 1GAEO 3ENKA 4GGOA 3C7CB 5F3RA 4C7JA 3BTOA 3C7DB 3B1FA 4FOOA 4AFNA 1T1SA 4CMKA 3IOYA 4R3NA 3UHAA 3KZVA 4OKIA 4EJ0A 3NT2A 3I9OA 3V8BA 2EIHA 4UAGA 3AJRA 2GZ2A 4ND4A 3WSWA 1ZEMA 3PWSA 3QVSA 3CZRA 3FWNA 3X2FA 3F1KA 3I9MA 1SPXA 4D45A 1NHWA 2NM0A 3BTUA 1JWBB 2NWQA 1WDMA 1RJWA 1CQJA 4WLNA 1F12A 2VHYA 3S2FA 3V1TC 3L9WA 4Q3EA 4BO6A 1I5RA 3EK2A 2YJZA 2I6TA 5C5IA 2OP1A 4CMIA 1H9AA 2C20A 3A28A 1E3JA 1CERA 1P0FA 3SX2A 2YY7A 3INGA 4B3IA 3ZGYA 3ADOA 4GX0A 3U3XA 4BNJA 4BO9A 2O3RA 4WLVA 4OM8A 4MP6A 5HS6A 3U4HA 3KRTA 1Q0QA 3DHYA 2F1KA 4UUOA 2CF5A 2HDHA 1KYQA 3FNFA 5U1PA 3PDJA 1A27A 5ITVA 1EVJA 4R9SA 3GVIA 3AOGA 6LDHA 4AG3A 1ZMOA 2Y0CA 1P44A 4QT0A 2A94A 4YJHB 3JQGA 5KNLA 4WOKA 2UUOA 3WLFA 3OA2A 4IQGA 1EE2A 2HCTA 1IY8A 2A92A 4E5KA 3JYOA 3OQBA 4L4XA 1PIWA 4AJLA 1T4BA 3RQSA 4ITUA 3K2BA 4XRRA 3S2GA 5KKCA 3HJAA 4G65A 1MP0A 4BO7A 5DCWA 2X9VA 1DFHA 3I23A 1NPDA 3P5SA 2AA3A 1KVQA 4MKZA 1ZW1A 2FN7A 4CLEA 1T2AA 1DDOA 3ON5A 3W4IA 3MWDB 4U7WA 2Z1NA 4PLHA 2D4AA 4FFLA 3ZWYA 3KB6A 3BMNB 4DVJA 2VTEA 4XIYA 1BTOA 3H3JA 5A04A 1CIVA 4E21A 4ID9A 3GAZA 1TEHA 4WCDA 4ALLA 3DDNA 4DPLA 7MDHA 2G5CA 4PLYA 2OGUA 3HUDA 2OMEA 5HS4A 1QV7A 1B8VA 3TF5A 3DFZA 5G0VA 1I24A 1GCOA 2CUKA 3BMCA 3I9KA 4YDRA 3I1JA 3DZKA 3U49A 4BQPA 1HDRA 3ZW8A 3VC7A 2EJVA 2AW5A 4WLFA 3V2UA 3VKVA 3ZWAA 4Y6RA 4D43A 2DTXA 1R15A 4XIJA 2BGLA 4BVAA 3N74A 3EHEA 4QSMA 4YACA 2ZKLA 4BO8A 3AFNA 3Q1LA 2GCGA 1P9LA 3ZHYA 3A9WA 5KJFA 1QXSA 5JCXA 1B26A 2JFGA 2EGGA 4URFA 3I52A 4J1QA 1LX6A 1PS0A 1U8XX 3LT2A 3W8FA 4CM4B 1R4NA 4JLWA 4NK4A 1C1DA 3DBLB 4GSKA 5JCJA 3PI7A 1PGJA 4EZBA 1B2LA 1H6CA 4OL9A 5T67A 3I4CA 4FGWA 4DLBA 2J5KA 3LU1A 4BNNA 4FCCA 1X1EA 3ZWPA 1SAYA 3PIDA 4Z3DA 2X6TA 4O63O 1IZ9A 1MGOA 1GADO 1UH5A 1VL0A 3IJPA 5ENDA 5BT9A 3PHIA 4BMVA 4Z6KA 4MVJI 4RPGA 3K9QO 2VTDA 3EVTA 5T8KC 1H5QA 3TZQA 2X4GA 1YRLA 1NHGA 1Q2XA 4IGEA 4YPOA 2E6UX 3GRPA 4YAGA 4BB6A 2J6IA 4OXKA 2DM6A 2RHRA 2X9GA 3HDYA 1EDOA 2NU7A 3DBVO 1UXHA 4IDBA 4CUZA 1CF2O 3MJEA 3JYQA 3G49A 1D3AA 3GZNB 4J1NA 3PJGA 1E3IA 1BHSA 5FI3A 2I76A 2IODA 4IZHA 3P19A 4KMSA 1E3WB 2VUUA 2FR1A 1A4UA 3VTZA 3SC4A 2Q3EA 4W7HA 3ANMA 2Y05A 3U9LA 3MCVA 2V6BA 3EVNA 2OXIA 4OKNA 5TRTA 5L7TA 5F1OA 2PWZA 4QXMA 2VT2A 3WGYA 1EVIA 4FJ2A 2H6EA 4YB8A 3PEFA 3RASA 1UR5A 2VHXA 4JJGA 5AYVA 3BHIA 1XWFA 4CV3A 4ZICA 3CXRA 1DSSG 3HHPA 4NPCA 5FWNA 2UUPA 4NU5A 3JQAD 4EDFA 1VE9A 3O03A 3BMOA 1C0PA 1O5IA 3ORFA 1F17A 1WP4A 1GUFA 1R37A 2DFDA 3Q9UA 5I7SA 4RGBA 1ZEJA 2C82A 4FFMA 1U2GA 3GEDA 4NJMA 1IULA 3PTZA 2FZWA 1H9BA 2LDBA 4XA8A 5LC1A 1RWBA 3SJUA 3V1UA 5ILGA 5F1KA 1RM5A 3VAZA 2Y99A 2NVUA 4HNGA 1ISGA 2V65A 1GYQA 1YGYA 4NK5A 1YBAA 3OEYA 3UCEA 3ZCXA 1WDLA 1J4AA 4J1SA 3OICA 2CD9A 3FPLA 1PWZA 3NKLA 4R16A 1DJQA 1QYWA 2J3JA 1I01A 2BD0A 5I9LA 3AM5A 4HKTA 4JIGA 3UOGA 3ETGA 1SCUA 1DC4A 4R1UA 1NQOA 3LLVA 4R69A 3DOCA 1C1XB 3RC1A 1O6ZA 3AOEC 1LLDA 5T64A 4NFSA 2Y1GA 1WLYA 4MVJM 4AJ4A 5I7VA 4TKMA 1P77A 1PL6A 1BXGA 2GD1O 2Q1WA 2X0RA 2W4QA 4PFJA 1GZ4A 1QMGA 4BO4A 1LSOA 3SXPA 1PZGA 1JAYA 5EINA 1TXGA 1UZLA 3ENNA 4BO3A 1JQBA 1LI4A 2WD7A 3ZN2A 4J49A 3WGGA 2IDZA 4TQGA 4B7XA 4ZQHA 4IBOA 2O4CA 3D3WB 1GR0A 1WVGA 2Z1MA 2CMDA 3GT0A 2HUNA 1VJTA 3ZNOA 4BNMA 3GMSA 4BB5A 4BNXA 1DAPA 3E82A 4MVJG 1A71A 4OJNA 3DR3A 3KHUA 5I7FA 3ZNQA 2P91A 1E7SA 1P74A 4XZ3A 1GFSA 4UUPA 3G0OA 3ROKA 2I5PO 2BFAA 1SBYA 1JDJA 3OJOA 1GY8A 2FP4A 3DMTA 2EG9A 2C2YA 2BF7A 4FFOA 3JQAB 4LRTB 1LU9A 3KVOA 3QY9A 4ZVVA 3WGTA 4IIVA 3RUDA 3D5QA 4FFPA 4HX5A 4K26A 2YYYA 4R5MA 3ITKA 1BW9A 1M76A 4QFDA 1YOVA 5EMHA 2DC1A 3RJ5A 4E5PA 2W98A 4RO0A 1Z75A 1U1IA 2J5QA 3JQFA 3KOUA 3S55A 1V6AA 4PLCA 1ZKMA 4NBTA 2D1YA 3WYEA 4Y6SA 4R01A 3O8QA 4HP8A 3VKUA 2GZ3A 1VPDA 1BVRA 4C4OA 3QVWA 1LTHR 2OHXA 3PWKA 1FDSA 3ZV3A 1TI7A 3RC7A 2XAAA 4DRYA 3ONDA 4BV8A 2O2YA 1DIGA 3TPCA 3RD5A 3F6YA 5IDXA 2YDYA 3H9EO 3M1AA 3KYCA 3GQVA 3V2HA 1E7RA 1EFLA 5IDYA 1PL7A 1JN0A 1GV0A 4AJNA 4R1SA 3AU9A 1MC5A 5DULA 4BNGA 4GWGA 4BMNA 3T4EA 5ER9A 4M87A 2VYVA 3WS7A 3ROPA 1I3KA 4YJDA 4YT4A 1GEEA 2G76A 4P22A 1HZZA 4BNKA 1OAAA 3H65A 2VNSA 4PLZA 3NT4A 3MTJA 1ENZA 4R54A 1EBFA 4PCVA 5L9AA 1KVTA 3WTBA 2XPCA 1V0JA 1TLTA 4HXYA 4DQUA 5K6AC 3JQ9A 1ZK4A 2Y1DA 5DCYA 4RVGA 1FJHA 3ZV6A 5LDGA 3OJFA 3RROA 3WGZA 2X0IA 3WQRA 3L4BA 2OFPA 3RUIA 3UN1A 1MB4A 3OQ6A 2IRWA 3JD3A 3OQ1A 3ZWCA 4CR6A 3D3EA 3IUPA 2NSDA 2HRZA 9LDTA 1MXFA 6ADHA 2POQX 4J7UA 4R5HA 4F6LA 3EZYA 4ZQEA 3DZHA 3WIDA 4PN3A 2ILTA 1DFIA 1PTJA 5J23A 4F46A 3VPSA 3OJ0A 5GZ6A 1A7AA 4U0KA 4KWIA 4BNZA 1HE4A 3E9NA 4J2OA 1E92A 2X5KO 4JNKA 3CZMA 1YQXA 3QWHA 3JQ8A 3PHGA 4J90A 3WQSB 1J6UA 3F47A 3K6JA 2DPHA 4I5EA 4HADA 3OH8A 4XQEA 2PFGA 3PFWO 1SC6A 2EKLA 1DRWA 2BLLA 2YQ5A 4I8XA 3TFQA 1H6BA 1O95A 1HE5A 3LDHA 4YTEA 2PZLA 2YHUA 1D4FA 1FDWA 2AEMA 2LDXA 1R4MA 4CJXA 4Q3BA 3I3OA 4OQZA 4LVCA 1LXCA 4JJFA 1GEGA 2CY0A 3BMQA 2YQ4A 3ASUA 3MJ4A 4HFRA 2ZQZA 1VI2A 1VJ0A 4RV9A 3GHHA 5A06A 5BSHA 2O50A 1T2DA 2JAPA 4UEJA 4YJGB 4CLOB 4UVIA 2EERA 1QYDA 4HUJA 4RF3A 3WIEA 3WJ7A 3I5MA 1GTMA 4YJFB 1Z74A 1LSJA 1XELA 2CNBA 2ZYDA 3BYZA 3JYNA 1WPQA 4GX5A 4MVJA 4OAQA 3RKUA 4WNCA 4TSKA 1VL8A 4WJZA 1W73A 4RVDA 1VKOA 3E9QA 4DC0A 2DAPA 1NR1A 2RAFA 3LLSA 3S1LA 1EUDA 4DLAA 1UAYA 3UICA 1GUYA 3K30A 3OBBA 3OMLA 1FDVA 3ROQA 1RYDA 2VUSA 2VZ9A 5I9MA 4J0FA 3AI2A 1L7DA 1I8TA 4LMRA 4YAEA 1CRWG 2IYPA 5B4UA 5I9NA 3H5RA 1EMDA 2DTEA 2DBRA 1HT0A 1K6IA 4DQVA 1NX6A 4GL4A 4NDNE 3ITDA 3H8VA 1EUCA 4NQZA 3IMFA 1HF3A 4RPLA 1X14A 3BTVA 5KTKA 5JS6A 4LK3A 1TVEA 1LEHA 2D0IA 4J4TA 1KC3A 5DT9A 2P5UA 2VYND 2YV2A 4EJMA 5TLSA 2PTGA 4YRDA 3T7EA 3UKOA 1KBZA 4IM7A 5B12A 5COAA 2VUTA 4YT2A 1QLHA 3LF1A 3UVEA 1MFPA 7ADHA 3WGHA 3WJAA 1UDAA 1HETA 4OSPA 5F21A 3AUSA 4YCAA 3GDOA 1DLIA 1DOHA 3M1LA 4IDGA 1OC2A 2Q45A 4ZRNA 2H63A 4PLGA 2QRKA 4WLOA 3CE6A 2EV9A 4II2A 1WWKA 1JTVA 1E7QA 1NWCA 2DLDA 3PWZA 3EUWA 5LCXA 4F6CA 2Z95A 3C85A 2Q2VA 5EIOA 2JD1A 1PJTA 1B14A 4OH1A 3KSDO 2P4QA 3ZNPA 3NEPX 1LQUA 4H7PA 3EC7A 1M6WA 3OJEA 1KS9A 1T4DA 1F06A 2NQ8A 1W6UA 2PA3A 1CYDA 4JN6B 5G4LA 4UVEA 4MDHA 4BNLA 4K9DA 3W4KA 4CV2A 2EKQA 2W2KB 1YBVA 5G0WA 2IZZA 3QVTA 4R3WA 2I65A 2CVZA 1X1TA 4AL4A 4U6QA 5DOVA 3PLRA 5CG1A 3KBOA 2ZTLA 4RQTA 2X5JO 4ROSA 3HB5X 3LT4A 3Q0EA 4CM5A 2WTBA 4YAJA 3U5TA 1U9JA 2IZ1A 1P1JA 1SB8A 3DZJA 3RSHA 1DC3A 2G17A 2WSBA 3S2EA 2R2GA 1FK8A 1O94A 1LDEA 2P5YA 4FPXA 3H4VA 2JJYA 1A9ZA 2CZCA 1SEVA 5TS3A 3AUTA 4I5FA 3I6IA 1HE3A 1MG5A 1HYGA 4FGSA 4CMAA 4ALNA 1F14A 3MOIA 4GMFA 3O26A 4CMCA 4NI5A 3RAJA 4DXHA 4BKPA 1PJLA 1X7GA 4N5NA 3FHLA 2SCUA 1YQGA 5A1TA 1UXKA 5AXBA 3OIFA 4CM8B 3LYLA 3JYLA 1FDUA 1NASA 4IQ8A 4MVJF 2BKAA 3JCZA 1OFGA 3VH3A 4XQ9A 1DHTA 5C3MA 1TB4A 3H6KA 3RUCA 3LC7O 3WNQA 1MV8A 4CQLB 4F3YA 3KXDA 3DBRB 5A3JA 4YVFA 3AY7A 5G0SA 1IL0A 3TZKA 4DYVA 2YHIA 4TRJA 1U4SA 4GLOA 4WCFC 3H7AA 4B7CA 4KDFA 3O4RA 4BGVA 3QQPA 5TJHA 4R68A 3GA0A 3WYCA 4U0JA 1ZXLA 3RBZA 1XG5A 3VZRA 5GMOA 5A9SB 1ADFA 1MG0A 2CF6A 2Y0DA 4KWHA 1B3BA 2EP7A 4RZIA 2Y93A 2WDZA 2PZJA 3U09A 2O3UA 1PJCA 3NT5A 4IJVA 3ZWXA 1NQ5A 4WNIA 2D3TA 3SJ7A 4PG8A 4BIIA 2OL4A 1LRJA 2X5OA 4RDIA 3CINA 1AUPA 1NWHA 1NXQA 4J7XA 2NTJA 3ONEA 5U4QA 4IJWA 2HSDA 4TKLA 2JAHA 4NBRA 4GKBA 2HMSA 2NVWA 2YDXA 2VOJA 4GVLA 3NYWA 4LSWA 4XJTA 3DZGA 2GN4A 1NM5A 5JDCC 3JQBC 2QYSA 5ITWA 1NPYA 3HWRA 4FC7A 4RCVA 4E2XA 2NNLD 5A9TA 3HSKA 1BMDA 1GPJA 1U3UA 2IEDA 1TT5A 2OBNA 3QWAA 3W8EA 1UDCA 5JC8A 3A06A 5B4TA 4IMRA 2ZB3A 3SC6A 4AJ2A 1SMKA 2VT3A 4W82A 1T2EA 3L6OO 4UVHA 1NVGA 4A0SA 2V6FA 2ZTUA 3Q9NA 4PG7A 3P7MA 4UEOA 3TSCA 4W9NC 3WNVA 5EN4A 3L0DA 2BI8A 1EVYA 3K73O 3VZQA 5HBRA 2PGDA 1UAGA 4JBGA 1YXMA 2C0CA 3EZLA 2HO5A 1J49A 1M66A 1ZSNA 2O23A 4JP2A 1I10A 1OMOA 2VRCA 2BH9A 4MVJP 2Q1UA 5JDIA 5DCUA 2JFFA 4S3MA 2AEFA 4K1LA 1B16A 3C1TA 4D42A 1WMAA 5JPIA 3QE3A 3SLGA 1M6HA 5L4NA 3G1UA 2RBEA 4XWYA 1WNTA 4PIVA 2J3KA 4UULA 5F5NA 4YYZA 4M54A 4CM3A 1UP7A 1DLJA 5HWSA 5B4VA 1EEHA 5T6BA 2Q99A 3ZDFA 1A7KA 4BUCA 5JAMA 2JHFA 3R3JA 3FPCA 1HXHA 1YH3A 1KVRA 1B8UA 3MJVA 4TZTA 4B4WA 4YA6A 1XDWA 2ZB8A 3KO8A 2ZK7A 4FW8A 1HE2A 3DAPA 4FFRA 1XR3A 3D5TA 2H5LA 2QRLA 4E4YA 1HLPA 3DWFA 1YONA 4YBZA 3JQEA 4CMEA 1KERA 3E8XA 5ILOA 3ONFA 1RKXA 5EPOA 2C7GA 2PR2A 1Y9AA 2BHLA 3SVTA 2WYWA 4EBFA 3OSUA 4PLVA 5IG2A 2C7VA 2WWRA 3M2TA 4BNVA 4GLLA 1U7TA 1HLDA 1RYEA 4CLRA 1G1AA 2V6MA 3U0BA 2C59A 3EYWA 4O1MA 1ENOA 3DONA 4PRLA 4E13A 1Z6ZA 3AY6A 1E7YA 3K96A 3GC6A 3JQ7B 2XOXA 3OA0A 2TMDA 2NLOA 1LUAA 1KC1A 2Q4BA 3AUAA 1YWGO 1QYXA 1DIRA 1E77A 1X15A 4NHEA 4KUHA 1P1KA 1PS9A 1Q7CA 1M75A 2IE0A 3G79A 2QIOA 2FR8A 5IAAA 3RWBA 3IQDB 3R6DA 4BO2A 5F1PA 3I83A 1WZEA 4HBGA 4BV9A 3BMNA 3FBGA 2R00A 4ZQBA 3AWDA 4IGFA 4GGPA 3VH4A 1LNQA 3DQPA 2XXJA 4GI2A 2HLPA 1WXDA 4FDAA 2JFHA 4CM9A 1LC0A 2PKQO 3WB9A 5A4DA 2VWGA 4DPMA 3DXFA 5JFOA 3EMKA 4R41A 2VN8A 2C29D 4YRAA 3E9MA 4I5GA 4H15A 5DNAA 3GF4A 3QW2A 5EJ2A 5KVSA 4E32A 5BNTA 3S2IA 2OP0A 4XX0A 1V3TA 2CFCA 1I0ZA 4DREA 1DJNA 3E1KA 5CDYA 5A3VA 1P31A 1ULSA 1Y9EA 4XYBA 4JJIA 1PR3A 3EGOA 2DPGA 3GG2A 1N2SA 1XU7A 5TIIA 5KJEA 2PD6A 1NAIA 1DRVA 1RM0A 1QORA 1E6EA 3GGPA 2GERA 5G4KB 3ZH2A 2FZEA 1J0XO 4IXTA 4ZQGA 3WOHA 4IS3A 2B5WA 3GFBA 4CM4A 3CKYA 4NBUA 5COBA 1ONNA 1XSEA 2HMWA 3DBLA 4P4NA 3TZCA 3LVFO 1WAMA 4B4VA 4DL9A 1O0SA 3GPIA 3E5RA 3W1VA 1PU2A 1ISHA 4E2YA 3C24A 3BHMA 2E48A 4BHTA 2FHSA 5H83A 3DAFA 4QQRA 3GEGA 3MJSA 4D0RA 1HKUA 3L07A 4GWKA 2NACA 1H0KA 1NQTA 1ZSVA 4JROA 5IDWA 4EEZA 1ZFNA 3NGLA 4TMFA 3F4BA 3O9ZA 3HB4X 3RIHA 4ZJUA 2Y1EA 1LC3A 1ADGA 1H2HA 1HWYA 2HK8A 2VWHA 4JP3A 4L76A 3KSZO 2GZ1A 3JD4A 1YJ8A 4CLXA 1E6UA 3U4IA 4BKOA 1E6WA 2RIRA 3GUCA 3QLJA 2VYVD 3JV7A 4XDZA 3GZNA 3ULKA 1U5CA 5CEFA 4IINA 4ALJA 5DDIP 1FMCA 1QG6A 3G17A 4CMHA 4RPJA 4CUJA 1I36A 4N5MA 5DF1A 3AI1A 3GN1A 1JVBA 1NBOA 3IUSA 4PLTA 1IUKA 3MZ0A 1GQ2A 2HU2A 1YVEI 3KLMX 2WYVA 1JWAB 3U4DA 3TOXA 4KTTE 5TC4A 3DZIA 3H9JA 1DC6A 1NFRA 1KOLA 5IZ4A 3ZWWA 5L7WA 4ZA2A 5C37A 3EW7A 5MGBA 3MEQA 4D3FA 3RC2A 3PDUA 5DZSA 1C14A 4PLWA 4Q3AA 4MVJH 1SO8A 3WG9A 2WEKA 4PLFA 4XGNA 3AU8A 1DIHA 2OORA 3CMMA 4M55A 3ZNNA 3PZRA 5TX7A 3MWEB 2ZB7A 4U8GA 4OXYA 1GQQA 5G0TA 1AHHA 4II3A 2VOEA 4WLUA 1K6JA 3IJRA 1ZK0A 2BI7A 5HTOA 3I4FA 5TF4A 1XLTA 1I2BA 1YOVB 4WOJA 3RI3A 5AXDA 5ER6A 3W8DA 5IJZA 5JO9A 4BOYA 2E49A 4L74A 3VVCA 1Y5RA 3WMWA 5AXAA 5FYDA 2VWQA 3BXXA 2C07A 3D4PA 4P4LA 3PYMA 5AXCA 3WGIA 2V6GA 3K31A 3AI3A 4YT5A 2FR0A 3R0IA 4I9NA 4WEOA 1C1XA 3ST7A 2BFPA 2VHZA 3ZHZA 3RJ9A 1JKIA 3FTNA 3GLQA 4JQCA 2GUGA 4CQMD 4ZRMA 4GQAA 1U5AA 4Z0HO 4P38A 1S7CA 2FRDA 3GVPA 3BIOA 3ANLA 3DB2A 3FWZA 2P9EA 5CPFA 3WXBA 4EEXA 1ISJA 1LLQA 2D5CA 2FWMX 1KEVA 8ADHA 5I7EA 4EUHA 2X23A 2J3HA 4Z9YA 2B37A 2Y1OA 3DMYA 1L1FA 4QO8A 2P9GA 2W2LD 4A5OA 3U62A 4AICA 2GN6A 4Y98A 1EZ4A 4MVJD 1NP3A 4FB5A 3D3WA 3ICPA 2HJRA 3R3SA 2I67A 4QO7A 1P45A 4PVDA 4XQCA 4B3JA 1FXSA 1K3TA 1V3VA 3GNQA 2A9FA 2GLXA 3VH2A 4CM6A 1E5LA 5JC1A 5A05A 5DN9A 4BNFA 3PLNA 1YL7A 5CEEA 1CETA 1ZK3A 4OOEA 2JCYA 4IIUA 4J6FA 4D7AA 4E33A 1XA0A 4DYDA 3ZW9A 2Q50A 3KLPX 1LDMA 2EW8A 1NFQA 4LN1A 1ZJZA 2BFOA 3PGXA 1UUFA 2GDZA 3OJLA 3JQAA 1EK5A 4IQ0A 1E3LA 4DIOA 2O2SA 3ZWNA 3C3XA 3WTCA 3GNSA 3TZHA 2BFMA 3HQ4O 4F45A 1YDWA 3X2EA 1QRRA 2CDCA 3ANNA 1K5HA 2HRBA 3C7AA 4NBWA 5L7YA 4O59O 5IZCA 4P4GA 2ZCVA 2C2XA 4G81A 4KZPA 4GH5A 2J3IA 3DMTC 4WKGA 4XD2A 5KCZA 3FNEA 4RPHA 4BS9A 4JK3A 4XDYA 5BSFA 1E7MA 1PJBA 4MP8A 3VZSA 2EXXA 2WYUA 3KV3O 5JSFA 1HSOA 1I2ZA 1XHLA 1LDGA 3HFSA 4HFJA 4ZQFA 2EJWA 4LW8A 1LQTA 1BDMA 3UF0A 2HK7A 2JCVA 2DT5A 4H16A 1I32A 1V8BA 3TL3A 1G0OA 1R6DA 4XYLA 4E2ZA 1LLCA 2B5VA 1VLLA 4OGWA 4RLHA 1PQWA 1NAHA 4MINA 4CQMB 5IF3A 4EJ6A 3RUHA 3NX4A 3ETDA 3G3EA 4IDEA 1KETA 4J0EA 3VPXA 1E1MA 2GO1A 2D59A 4RPKA 3V1YA 5ADHA 1ORRA 1EQUA 4IUYA 5LDHA 1K0UA 1LDBA 3WQQA 4D79A 3CH6A 1H93A 2X86A 4CMJA 3PYLA 4NMHA 4PLPA 1XCBA 3VDQA 4BO5A 4KP7A 1UJMA 4FQ8A 2ZYGA 3CUKA 3GG9A 3B70A 4LSMA 3BHJA 3UCFA 4DPKA 1EVZA 4CUKA 1SNYA 1ISMA 3RFTA 5KJCA 3WBFA 4AJ1A 2JL1A 4I9UA 1TA4A 4LGVA 1P0CA 3NTQA 5TJ9A 2NU9A 3IAHA 4NJOA 4XRGA 2VZ0A 3JYPA 1BGVA 4A2CA 5C7IO 1RM3A 2ZQYA 4Y8VA 3KUXA 2WJPA 1H94A 2E4AA 1YQDA 3ZU3A 4L73A 1ZK2A 5CAEA 4GKVA 4TRMA 3TFOA 3RCBA 4AJIA 1EQ2A 3CTMA 3L4BC 1N1EA 2B0JA 4MIYA 4KQWA 1YO6A 5THQA 5HRUA 2NU6A 1MA0A 4FN4A 4UEKA 1VSUA 1QSGA 4DIBA 3IKVA 4XYMA 3UXYA 1LLUA 3I9JA 1Y1PA 2O3JA 1DFGA 4PZEA 3TN7A 1P1FA 2QZ9A 3KYDB 3NDJA 2Q2WA 3BAZA 2NTNA 2X8LA 1MC4A 5H81A 3Q3CA 2JD0A 2GR9A 3A14A 4BNWA 4XQGA 3ABIA 4RVSA 3RFVA 2BRUA 4M1QA 1H6AA 4GAEA 2GNAA 5FEUA 2UV8A 5GY7A 4GMGA 2OUIA 2H1SA 3DTYA 1B7GO 2X0NA 3ASVA 2YW9A 2JCXA 2BMAA 4Q3CA 5BQFA 8LDHA 3VHRA 5T57A 1E7WA 1JKFA 4M89A 1R16A 4WCFB 1P1IA 4Q9NA 1LRKA 1AGNA 2Q1TA 1ONOA 3D4NA 4YJGA 3RVDA 4BO0A 4GPD1 4CLOA 1BXZA 3DO5A 1A4IA 4FD3A 2YV1A 5KKAA 5BSGA 1O8CA 4J16A 3JQCA 9LDBA 4CR7A 4YJFA 4X54A 2C5AA 2B4QA 3PRJA 3ZHBA 1DBVO 1PX0A 3GY0A 4NZ9A 4QECA 4QUKA 3PHHA 1QLJA 2X9NA 2AXQA 3OP4A 2TMGA 3WFIA 2CSUA 3BA1A 1VL6A 3GVCA 1GDHA 1T1RA 4YT8A 5L53A 1D1SA 4E2WA 3I6QA 2VRBA 1Z7EA 1ZBQA 2UAGA 2IZ0A 1Y8RB 1PEDA 1UP4A 2DKNA 2GGSA 3MJTA 1T25A 1PS8A 2VCYA 3KEOA 3N58A 5CFZA 2G82A 1MLDA 3CIFA 4J4BA 3LT1A 3LK7A 2E82A 1U3TA 2Y67A 1HDGO 1BWSA 3GAFA 1U3WA 3PXXA 1N9GB 1WZIA 2C5EA 4RQUA 5JAIA 4WK6A 1GL3A 3F5QA 4INAA 1BVUA 3ZU2A 4A03A 3RUEA 4CL3A 5JY6A 4AJEA 3K92A 1PSDA 1QKIA 3PZBA 1Y8QA 3M2PA 4N7RA 2B69A 4ND2A 3PGJA 3WWZA 2AQHA 4LRSB 2R6JA 3KEQA 2NU8A 1PL8A 2DVMA 3EY4A 4N54A 3CMCO 3I9LA 2F00A 1LJ8A 4CODB 4JXKA 1AXGA 3SBOA 2VRCD 1YB5A 4K28A 4DWVA 3TWOA 4MKXA 3DZBA 3AUUA 1FDTA 4CM7A 4EW6A 1UXIA 1M2WA 1PGQA 2QHXA 1PZHA 1KEWA 4CLHA 5IN4A 2VWPA 1DIAA 3UUWA 2W8ZA 4OXNA 1P3DA 1JLLA 2Q2QA 3F46A 4TZKA 4CPDA 5F5LA 3RU7A 4R1TA 3DBHB 1LSUA 4FJ1A 4NFHA 3HG7A 3QWFA 3QJ5A 1ADBA 2B36A 4DBVO 2UDPA 4E5YA 5JXWA 1JAXA 2CVOA 3MTGA 2NUAA 3L6DA 4XB2A 1A72A 4ND5A 3RC9A 5JYEA 1IB6A 1KVUA 1XIVA 4YRBA 1G0NA 5EQDA 2RH4A 2GYYA 2BGKA 3FSRA 4IDCA 4ZD6A 3O38A 5JAZA 1SEPA 3WBBA 5CPBA 3ZWOA 4YAIA 4J3FA 2GRAA 4Q39A 4CMBA 3E18A 2A4KA 3QVOA 4J7CA 2X7HA 1PGPA 4HWKA 4IDDA 1D8AA 2W2KA 1L7EA 1HDOA 4MIOA 4AVYA 1O89A 5JY1A 4QX6A 1Z82A 3OIGA 1HDCA 3HDHA 4XCVA 4A27A 4C7KA 4LCEA 4TRRA 4WECA 4MVJE 2AQ8A 4NIMA 2AE2A 4B4UA 1PQPA 2Z5LA 3QIVA 3QWBA 5C7LO 4Z0PA 1QV6A 3TJRA 3L77A 1XGKA 2Q49A 2HAEA 3H2ZA 1SOVA 4CV1A 4NU6A 4CMIB 1AN9A 4FS3A 2IXBA 4ND1A 1I33A 5JO0A 1Y5MA 2UYYA 1HDYA 3H9UA 4G5HA 4PZCA 1ZO8A 1D1TA 2WD8A 4RVHA 4E6PA 3OFSA 4O6VA 3QP9A 3GOHA 3Q11A 4RF2A 1HEUA 3JD0A 2IEBA 5T5QA 3WGOA 4CM8A 3Q2IA 3V5NA 1XKQA 3WR5A 1S6YA 1U3VA 1ENYA 2VYNA 5TGDA 4MIEA 1ZSYA 2J8ZA 5CG2A 1Q1NA 2FSSA 1U2DA 1LA2A 4CQLA 1K89A 4K6FA 5JCJD 3DBRA 1V3UA 1GV1A 1I3LA 3WDSA 3JQGB 4OO3A 3EDMA 4RVUA 5ICSA 4BKUA 3K8ZA 4Q3NA 1C0KA 1Q0HA 1DPGA 1NVMB 2GASA 1R0KA 4CM9D 5A9SA 3GZ4A 1KY5A 2OZPA 2QRJA 3DOJA 1N8KA 4W7IA 4GBJA 3SEFA 1NR7A 1ZZEA 5TNXA 2AE1A 3RBVA 4A10A 3IIEA 2D2IA 2PH5A 1ENPA 4J43A 2HQ1A 3GGOA 4FIZA 3QHAA 4RDHA 1E1KA 1X13A 2D5AA 1F8GA 1Z45A 3HE3A 4TROA 3UH1A 3GVXA 3WSVA 3RFXA 4D41A 5L95A 2WE7A 3ADPA 4FOSA 4L4RA 2JKVA 4NR0A 1OC4A 2AEJA 3PHJA 4QFCA 4Z9FA 3D1LA 5DOZA 4BGIA 4EUEA 5A02A 1PJ4A 2ZYAA 4Z9XA 5FFFA 3ZV4A 2EGHA 2PV7A 4ZU3A 5KVVA 2YUTA 3JQ6A 3T4XA 4EITA 3EAGA 1W4ZA 1DRUA 4DIFA 5I8WA 4KQXA 3WX0A 1HZJA 1ZNQO 4I9HA 4K6CA 1ID1A 4E31A 4RORA 3QVXA 2ZJ1A 3WFJA 2O3TA 5EESA 4A73A 1AE1A 1DHRA 3BMCB 1JW9B 1HTBA 5I8ZA 1RM4A 3ZHXA 2EWMA 3H5NA 4WASA 3LC1O 2EP5A 1LBEA 3OEWA 4WLEA 4XGIA 4CLRB 3OECA 1T26A 2PGJA 2W90A 1WDKA 3NUGA 4WE3A 1QR6A 3PHLA 2ZTMA 4MJLA 4WPGA 2O7QA 1ZCJA 3Q6IA 2EHDA 4FR5A 3RKRA 2X1HA 4D3SA 1GZ6A 3VZPA 3MOGA 2ZATA 3E48A 4ILKA 5L40A 2H9IA 4D46A 4U5QA 4HFMA 5JYDA 1ULUA 1V35A 2FPGA 4YJHA 2G0TA 5IFLA 2XXBA 4BL5A 2O4UX 4L75A 3DC2A 4XR9A 5T8KA 3LQFA 1CDOA 2FSVA 5L4LA 1R4NB 1QYCA 1C1DB 3COSA 4OQYA 5EL0A 1ISFA 5FI5A 4DA9A 2ET6A 4HFNA 5ICMA 4BNUA 1IE3A 1KEUA 4DQXA 4FSHA 4XGKA 4XR4A 3NTOA 2O7SA 1HYHA 1AHIA 2FY8A 4LISA 5JDIC 3TDKA 4ESOA 4ONEA 4IXWA 3JSAA 2YFQA 2GPTA 4IPTA 4MO2A 3DZFA 4XYEA 4B8WA 4E5NA 1IZ0A 1HRDA 4IJUA 2VQ3A 4D0SA 1EDZA 1KIFA 3N7UA 3VDRA 3T7CA 5C7OO 3VPGA 3VTFA 4OSOA 3PVZA 4J2HA 2Q4EA 3IDSA 4WUVA 4OOFA 5ENVA 1DB3A 3ICCA 5AOVA 4CV0A 1WW8A 4GX2A 1R66A 3GN2A 4DUPA 1I3NA 2WMDA 1PGNA 1PQUA 1ZMTA 1Q7BA 4ND3A 3JQDA 1R12A 1ARZA 3S8MA 4NG5A 3DEYX 4MP3A 3NDIA 2X22A 4J9VA 5EERA 3ZV5A 2QX7A 3PIIA 3BZUA 3H9QA 1UXJA 1U28A 5ES3A 3CEAA 3WWYA 1CQIA 4EGFA 4NNJA 3NGXA 4FFNA 4JX8A 2VHWA 2D8AA 4HY3A 1P1HA 3UAGA 3TOZA 1IHXA 3JQ7A 2PZMA 4CMEC 2HMVA 2PLAA 3VPFA 1GUZA 4FC6A 3ZU4A 3E5MA 3GK3A 3P2OA 3ZZNA 2AG8A 2O48X 4R9RA 4BNIA 1MFZA 2BGMA 3BMOB 3KETA 3R1IA 5KJ1A 1VC2A 3DOOA 2UVDA 1K2WA 4NJMB 3INTA 1BSVA 3L9XA 4BGUA 1B15A 1BRMA 4Y6PA 3AOEA 2NQTA 4W6ZA 2NVUB 4AJOA 3FN4A 1YS4A 2B4TO 5DP1A 1DC5A 1C0LA 2Y1FA 5EQFA 1U8FO 4BNTA 4W99A 3H9GA 1BG6A 4WGGA 1NYTA 3M6IA 3NDRA 1GD1O 2OO5A 3RUAA 3RBXA 3VH1A 1NQAO 5AVOA 2R00C 3PP8A 5K0ZA 5DBIA 4DTIA 4RVFA 4TVBA 4L4SA 4UUMA 5KOIA 3LSYA 4KDEA 3HN2A 1LDYA 1JVSA 1GU7A 1BXGB 3PQDA 5CP8A 5CDTA 2GN9A 3JD2A 4WEQA 3OF2A 1B8PA 5BR7A 3IP3A 3C8MA 1E3WA 4YWJA 3GUYA 2PKRA 4KUGA 2X58A 2OOSA 3H5AA 3JD1A 2WD7B 5G4KA 2V7PA 1SB9A 4BKRA 2FPIA 1OI7A 4RJTA 1LSSA 2EKPA 3GR6A 5IXSA 1P33A 2AG5A 3HZZA 3P2YA 4DGSA 1K6XA 4PVCA 3PQFA 4IDAA 4MPDA 2B35A 1E1LA 3OHSX 4J1TA 1V9LA 2CDAA 1Z7BA 1TT7A 3B1JA 1YB4A 3C1OA 1EK6A 1Q7GA 5CDUA 5CHEA 1U4OA 3ZWVA 2DQ4A 1J5PA 1N92A 1PJ2A 4RL6A 1EUZA 3FI9A 1LDNA 4CMGA 1N7GA 1N7HA 3WLEA 2DTDA 2RH8A 3FNHA 1JU9A 4QEDA 4CL8A 1R0SA 2RCYA 3VOSA 4ALKA 4TWRA 3PJFA 4XEHA 3UW3A 5HA5A 4YQYA 4XYGA 4P8RA 5B1YA 1T24A 4AJKA 1BW9B 4MOWA 1Q0LA 1NPTO 3GGGA 4E3ZA 3QRWA 3GDFA 3HFGA 3QA9A 4L8VA 3E6AA 1I30A 3FBTA 1JA9A 4B8ZA 4B7UA 3Q2KA 3B20A 3F1LA 4LMPA 4DLLA 2NADA 3O8QB 4IDFA 1I2CA 4A7PA 3FCOA 5A03A 2PGLA 4U6SA 3D64A 1XEAA 5L51A 4KUEA 3KYBA 1YDEA 3L4SO 4ZN6A 1CJCA 5COQA 1ZIDA 4CM1A 2ZTVA 4UUNA 1F0YA 3FNGA 1YKFA 2ZJ0A 3KYCB 3W4JA 4HV4A 5K6AA 4R51A 3LT0A 3TL2A 3RUFA 3NTRA 2Q1SA 2PZKA 5B37A 5BNFA 2PKQP 4B4OA 3DAGA 3B1KA 3HN7A 1DO8A 3QSGA 1GYRA 1PJ3A 3NAQA 3W6ZA 1PWXA 3AM3A 1VM6A 4FJ0A 3LF2A 1ZUD1 2QZZA 3F9IA 3TZ6A 1ZVMA 2WM3A 1GQYA 4GX1A 2YFHA 1VRWA 3F4LA 2P2SA 3UFXA 5DBGA 4FBGA 4RF5A 1VJ1A 3HDJA 1NNUA 3QV1A 4TVOA 5AQ1A 3OM9A 3PJDA 3D0OA 2CDBA 2FMUA 5KVQA 2HKIA 5KIAA 4E30A 3E03A 3GRKA 4PGFA 4PG5A 2O3QA 4AJHA 4RZHA 5A9RA 5G0UA 3FF4A 1UZMA 4UVGA 2GF2A 3LC2O 1PZEA 5GZ3A 3AW9A 1X7DA 2AQIA 1HL3A 5TT0A 4IJKA 2YV3A 4BKQA 1G6KA 4RF4A 2I3AA 1KY4A 2EW2A 3JQ8B 3WGQA 1YBMA 2GSDA 1XU9A 1UZNA 1HYEA 3ROMA 2HMUA 3ZWMA 1EFKA 3IL2A 5H82A 2P4HX 2G1UA 5BSEA
chains in the Genus database with same CATH superfamily
1BMTA 2DKOA 2CHGA 4RW0A 5G3YA 1N6LA 4E94A 4FE4A 1SBNE 4TM8A 4ES6A 1N4AA 2XYVA 2ERCA 1GA4A 4JR2A 2IZOA 3C4QA 4OIMA 2PBFA 1I3MA 4G2TA 4BEJA 3CPEA 5CDGA 4R05A 4DC1A 4HUQA 2ZE8A 5LYYA 5HOEA 3PQ3A 3IQZA 2O1SA 5EY5B 1KEEB 4D4GA 1BKDR 3QM1A 2HADA 3DV0A 3KZOA 3DHEA 4REOA 4MKRA 4RMHA 3UFBA 5EHZA 3IE2A 3LW8A 5FD8A 2F8SA 2NMVA 1TF7A 4D80A 3RWMB 1Z2AA 4LCJA 5DHAA 3LBNA 1G8AA 4EZEA 3B48A 1M34A 4NHOA 5BY2A 1J8VA 1X1RA 2VDUE 2GB4A 1B00A 2VAXA 4DKXA 3LQYA 1I51A 3A3KA 1X7HA 2VH1A 5DP2A 1ZJ6A 2WIDA 4PYQA 2BC9A 3K2EA 1JEOA 2HK9A 3DL2A 4J0IA 4JUBA 2V0CA 2GPWA 1TM1E 2DY0A 1DBQA 2PKYX 1GTL1 1R18A 2P68A 5TT1A 4KVGA 1CUWA 1Z33A 3H9BA 3NAZA 4D4KA 3IKJA 3K8QA 3JR3A 4IKEA 4XKJA 1GPDG 2R11A 1HLGA 4RY0A 4OHYA 1RTTA 2COKA 2WF6A 2DFPA 3T3EA 4ENVA 1VYTA 2MJLA 3KBBA 3FPGA 4I1IA 4Q9KA 1GTG1 1RT9A 3GMDA 3PEEA 2Y0EA 2YZ7A 4DCMA 4HNQA 1L5ZA 3DVRX 3FVWA 1XQYA 1O94D 3KUUA 3JASA 3MAGA 1QO7A 4Q3KA 1PWEA 2GBLA 3A9VA 2C2WA 2BTQA 2FUCA 2WU4A 4E5VA 4YASA 4PNHA 3RHZA 1G7TA 2E37A 3DLPX 4IIJA 1L4FA 1B0AA 1FF9A 1PJQA 4IMPA 4M8SA 4B2IA 4W5JA 1DIBA 1XDBA 4AY4A 5IZCC 5KVCA 1TM7E 2CFOA 4IZIA 1ZR4A 4JBYA 2GN8A 3JATB 4KIGA 4BMSA 1LZKA 4YEDA 3UA4A 1Q0ZA 1XKTA 1VA5A 3O9MA 4OLAA 2A3RA 3ID6C 5DBOA 1V37A 5F98A 4PRZA 1HL7A 3DLBA 3P9ZA 2IXDA 4H6XA 3IOEA 4BNHA 2EEZA 4B76A 1PBTA 2YX1A 3RSZA 3BS4A 2L42A 1F8FA 3PIRA 4HGRA 4RE5A 5IK2A 2N0SA 2Y68A 1CXZA 1N5KA 1R6XA 4KI0A 2HSEA 4TSRA 1G21E 2WJGA 1EBUA 2WU8A 2Q3BA 3GFGA 3KT6A 3R5FA 2ZBQA 2Z8ZA 2Q5QA 3JQQA 4HATA 3M70A 4Y9DA 5DBFA 2NAFA 1T9HA 3ZS8A 4PEVA 4QTZA 1PSWA 5B2FA 3ZIUA 4QYXA 5BWCA 1E1NA 4ABYA 3UK2A 4B5LA 4B75A 4QM6A 1L5NA 3GEHA 4GMDA 1GZ3A 4JV5B 2VUHB 3EVFA 4RCYA 3D6UA 5KJ6A 2IYQA 4QXAA 2V3VA 3P9KA 1UPFA 4U5XA 3UB4A 1C2YA 1XQ1A 2QUBA 1KR2A 1S2LA 3NP9A 1BS9A 3QH4A 4NULA 3T7DA 1FLVA 3TQHA 4JUDX 5DX1A 2F48A 2R7MA 3GFTA 1EM8B 2VPYA 4N6OA 1DO0A 1E61A 4FZVA 3RYCA 7MHTA 1W8DA 2GPBA 5CFNA 1IPFA 3I2GA 3KC2A 3PC2A 2ZBVA 3DLCA 2J5RA 2PUVA 4Y2TA 7REQA 1E32A 3EGXA 3K35A 3EFOB 3M83A 1JLRA 1RCFA 2XVYA 4PG4A 3COVA 4B6JA 1DKQA 2NXCA 2PSEA 3OZAA 2IU0A 5I48A 1G20B 3DOUA 4I19A 5IDQA 4UD2A 5TQJA 5CXSA 3OT1B 3QYFA 3DV2A 4EI2A 4X93A 5E4TA 5JW6A 3TDMA 2C8JA 1DAOA 2P2NA 1E8MA 2PD3A 3FRJA 3IR7A 5A5EA 1W5SA 4QHYA 3FKSD 2ZBPA 3M3DA 4AJ9A 2UZAA 2MWMA 4JCOA 2VQEB 4GUAA 3X3HA 1WB6A 2H08A 5IH7A 1IZ7A 2GILA 1NULA 2V45A 5I4BA 1FQWA 3M89A 1ONBA 4YXWD 4ALIA 2YY5A 4WBNF 1KEPA 2HH9A 5BQXA 1DJMA 4UREA 2FF5A 3CKLA 2VPPA 3AW8A 6PFKA 2KMLA 2OZKA 2C8KA 4ON9A 4R1PA 4TXLA 3I9NA 5HJ7A 2Q5OA 3QTBA 1IEXA 3CSDA 4D4JA 1SIWA 3PPIA 4PG6A 3IQGX 3AVTA 2FEPA 3RF7A 1AGRA 2I66A 2A35A 1N8TA 1E20A 2DBZA 1P1RA 2NX2A 3UYLA 2XCOA 1PV4A 1BS1A 1LPAB 3CC8A 5TPWB 4O5AA 1PVOA 4MNTA 1V8PA 1X0XA 2XNCA 3V3KA 1CJTC 5GZ1A 1R9MA 3G5LA 2WHEA 1W34A 4KE8A 2QUIA 4B4DA 4Q24A 1G18A 4JL8A 4W4TA 5DKFA 2PZ8A 2JLBA 1N2BA 2YMLA 2ZSHA 3DT6A 2VSXA 2Q3MA 3ODGA 1Z7GA 1RXUA 1QYVA 4OHWA 2BELA 2XF8A 4MCIA 4B6QA 5JXGA 3CX8A 1VECA 1BDJA 5HDQA 2O2CA 1ZK1A 2PNFA 2RB4A 4BQRA 1U8TA 3GPDG 3FZEA 3MJCA 1ODFA 3R6GA 4C06A 4C0KA 5DK4A 1NX9A 3CEJA 1BDBA 2YJTD 4NYIR 2C5FA 1SBIA 2DBVO 3KWJA 4NBVA 4L0QA 4PHHA 5AHXA 4B0PA 4QBIA 3NR2A 2PK3A 4DCGA 4QBHA 3WYBA 1W0CA 4QU9A 4INJA 3TBHA 2G1PA 2NG1A 3IKTA 5IJXA 4UZSA 1QE0A 3IAFA 4J16C 2A6PA 1YE3A 3CLHA 3U7QB 3DDWA 2TMKA 3DTVB 3JQBA 2OV4A 3MUEA 2QTHA 3IO3A 1UP6A 3IVMA 3PFBA 3QFCA 3BD9A 4N0QA 5CA0F 2JD2A 2W37A 2GK3A 1QH9A 1Q7EA 1UOEA 2W2PA 1YL5A 2ZIZA 1T0IA 2Q3FA 3QHQA 1Q1QA 5A5DA 4Y67A 1EK2A 4FFDA 3QOXA 4S1PA 3E5HA 1JJBA 3R0QA 1G9XA 1KI6A 1GZ7A 3HNPA 3VOAA 5M29A 2EFHB 2P9YA 1ODSA 3RTBA 1ZXBA 5TQVA 2YFKA 3S1AB 4H7DA 1U7HA 1G8SA 5FF9A 4EUFA 1N1GA 1P1BA 3CH7A 5IWAB 5LZ2A 4W9NA 5IKOA 2QGFA 5KX5F 3K4HA 1OLXA 1PLKA 5JLAA 4R4JA 1PTKA 3PHBE 3CGWA 1U7PA 5KC9A 3NWPA 2I3GA 1X7YB 2FOLA 2R8OA 2BTOA 3HTXA 3EEOA 3I58A 4CEHA 2N9UA 4BLQA 2ONYA 4MUEA 3UCXA 1DBPA 1ZA1A 4HRAA 5ALLA 3UYKA 1QO9A 1A77A 5JJ5A 2GARA 1RC1A 2ZLBA 4RHTA 3GDGA 2Q4RA 2QW0X 3LIIA 1YR2A 4GSLA 1XTPA 1MXHA 1GQSA 1F5SA 1ID8A 3PGVA 4DNXA 3CUYA 3F5MA 2NV6A 2VZLA 1UM9B 1R0LA 1UM8A 2IH5A 1MRZA 1GAEO 3ENKA 5IYZB 3C7CB 3JS5A 2GBFA 2JEZA 1LNZA 4A82A 1Z12A 3B1FA 5H0IA 3W1EA 3QVJA 1RKUA 3ZOZA 2C7RA 4X1OA 2NV2B 1MQ8B 3IVCA 4AFNA 4BVGA 5KYGA 3IOYA 1TM4E 2XWBF 2C7QA 2QPTA 3CT6A 2NXEA 3AR9A 3LX6A 2EBFX 3NT2A 4Y2SA 4FIDA 4LF9B 1VBFA 1SFRA 3FHCB 3T1OA 3ZHSA 3OWXA 2AZ4A 1ZEMA 3PWSA 2R8YA 13PKA 3Q3IA 4HQFA 3RQIA 1GZ5A 3DDOA 3F1KA 2V74B 4PZPA 5AICA 3AJ8A 4MUBA 1RAIA 2DJ5A 3O3CA 1B6TA 1MEEA 2Y0BA 3E9CA 3GLIE 1JS1X 1N0WA 4N12A 2PL3A 3KEFA 3PX3A 3U1VA 4D4LA 4I4CA 4KRFA 1JYEA 2XLCA 1RAAA 1MAUA 1P0MA 2J7PD 3S2FA 3SZLA 4I6GA 1XF1A 1L5OA 3RGWS 1XZLA 4DG8A 3L9WA 4BO6A 4JT2A 4YPVA 3SQXA 3CM0A 1VJ5A 3NWBA 4LF7B 1OF1A 3LHFA 4QOFA 1QU2A 1ABFA 5JRJA 5IJ0A 1JPVA 2C20A 5DSTA 4C0JA 4CN8A 1PWHA 3K6RA 4V0LA 3SX2A 4IKOA 3UJDA 4MGHA 1D9ZA 3H2JA 4B3IA 2QRNA 4C3ZA 1E9BA 1GZVA 2WJJA 4MB6A 4C14A 4OK5A 3ADOA 2C7PA 3AV3A 3OQIB 3KJZA 1GN9A 1FYWA 1XVVA 3RS4A 1F4VA 4L72A 4WLVA 1AB5A 1BHO1 4QPNA 1J99A 1ZLYA 4XTCS 3NXKA 3O9VA 4CETA 5AW6A 1Q0QA 2PYZA 4R9VA 2WWVD 1R5BA 5EUBA 1DJLA 4ZAYA 3E7DA 4ZVSA 1RE0A 5U1PA 3AERA 4R9SA 4ND8B 1ACLA 5KWJA 2FDCA 1PDOA 5FUVA 6LDHA 2AL7A 1Z5GA 3PNSA 4R1OA 1P44A 1WSAA 2ECQA 3WC4A 2V9ZA 5JJKA 4KX3A 3ZZ1A 5MN5A 4K88A 1EWQA 1WETA 3OA2A 4LVOA 4UJ5A 4CKCB 4E5KA 2A92A 2P4SA 4TGLA 3FMOB 3WAKA 3OQBA 2WUDA 1XNRB 3GA7A 1QG4A 3ND6A 1UC9A 3MMZA 3N59A 4KYIB 4G65A 3WAJA 3KZNA 4TYYA 1E4OA 2OFXA 4TTJA 1MP0A 3NOQA 5GV8A 4FTWA 3U7EB 4AP5A 3P2IA 5JEDA 2FCAA 1E9AA 4F4JA 3K9LA 4GT1A 3Q7SA 5EXEA 3TLCA 4N3GA 3VKHA 2FMIA 1WTAA 2EFJA 4LVNA 4EOGA 2OVBA 2V7EA 1T2AA 4EKYA 1A9XA 3EXHA 1DDOA 1UODA 1ODLA 2IY7A 3AUJB 3DNMA 3O7WA 4JYCA 2FFQA 4YP9A 5HCUA 3K8OE 4JIMA 2O14A 3K5IA 4TTRA 2PMBA 2HO4A 4M9ZA 2YXDA 4X00A 2D4AA 3M6VA 4XXHA 5DVZA 1G2PA 1YB6A 2HPVA 3BMNB 3TLXA 3WK9A 5LFAA 1SXJD 4LZLA 1TKBA 3H3JA 2W9XA 4KN6A 5A04A 1J2YA 4AWAA 1XX6A 4KBGA 4ID9A 2AG1A 1TEHA 3IUJA 1UMCA 3DDNA 4MLDA 4UCWA 2JAUA 7MDHA 1NW7A 4PLYA 3GLGE 3NONA 2OGUA 3QE0A 3WDLA 1T6NA 3VPAA 3ZK7A 3EUEA 4LRQA 1FU8A 2QSZA 2H31A 3OPXA 4ZDWA 5HS4A 4B3GA 3DAOA 5CIQA 4EJSA 4X84A 2O5RA 3G2IA 3E9ZA 4Q05A 5G0VA 4DCPA 2CMKA 4MI6A 5BSKA 2C4KA 2X13A 2XMCA 4BNJA 1HQDA 4M6WA 4KYVA 2ZULA 2QZJA 4O8CA 2A33A 3U49A 1J9EA 3EG9B 4NBNA 3H18A 3KOYA 3GT3A 4Q7KA 1OB5A 2GWRA 4LOJA 3VKVA 4CT4B 1IVYA 3W5HA 3GX1A 3PFNA 3UUEA 3NHMA 3QV2A 1N2XA 1ZS9A 3N74A 4QSMA 2VR1A 3VNBA 2E21A 3OCYA 4BV2A 1ZUNA 3ZBTA 3WLAA 1XDDA 3B53X 1NBIA 2BEUB 1P9LA 1Z39A 3ZHYA 5KJFA 5ECDA 4UOQA 3OOHA 3BB1A 4N5HX 5CDFA 2VDJA 2JFGA 3PDIA 2WMOB 3ZWQA 2EGGA 3LYHA 2W83A 2P3QA 3I52A 3INNA 4URFA 4DJ5X 5EMLA 5B7NA 2I6FA 1PS0A 3LVQE 3LT2A 1Z0ZA 4LJYA 1R4NA 4NK4A 4WTOA 3TUZC 4WZAB 3SMQA 2BBSA 3VR5D 4QA9A 4C43A 1IZZA 2EBHX 4KLNA 4F92B 3VDNB 3ZDYB 3KE9A 4X7PA 2EFGA 1OWNA 3F6SA 3FZQA 4GLBA 1PVDA 4RIIA 2MSKA 3HLTA 4LY3A 5AM0A 2HYDA 4HRVA 1UH5A 1GADO 1VL0A 2ZR8A 4F06A 4YRSA 1ZISA 1NOIA 1QDEA 3G5TA 5MGNA 3K9QO 4ERXA 3H1BA 3EVTA 3OU6A 3TW0A 5HBGA 2FSVC 2QDKA 3OESA 3GFVA 1HOXA 4P82A 3V4PB 5KYTA 1YRLA 1NHGA 1Q2XA 4OB6A 5EMJA 2OFFA 4DA6A 3GRPA 1NLMA 3AJDA 2J6IA 5EIEA 5ALNA 2XRZA 1XK6A 2FZGA 5REQA 5H68A 1KJNA 1P4AA 2ATXA 2NU7A 1P29A 4MWEA 4EY5A 2QUKA 2DFNA 2GM3A 2PV0A 3GZNB 3E8MA 2JIZA 1BHSA 3I3SR 3IDFA 1L7RA 2I76A 5A6VA 5HKOA 1ZNXA 3T5DA 1A9SA 4FUTA 4HD8A 4HWGA 5DHFA 4B74A 1T5OA 4DJFC 4DSZA 1AF7A 5IUJC 3COYA 1GILA 1DKNA 3DCJA 3G23A 1DP4A 3SC4A 4ETIA 4W7HA 2WVGA 3NPAA 4JXZA 5ARBA 3L5KA 3IIKA 4Q4HB 3T12A 4LOIA 1D2AA 3DUFB 2XR1A 2I6UA 4LOHA 4DCJA 2HV9A 2PWZA 3ENVA 5F1OA 2I55A 4QXMA 2VT2A 1KAEA 3GUHA 4HOYA 1T5SA 2GO7A 2REQA 4OFWA 5CJPA 4YQEA 2W2VA 1YS6A 3KWFA 4IFTA 1UR5A 5E9QA 4PN7A 1BYIA 2BM8A 4ZAVA 1VE1A 3LRTA 4CV3A 2HLDD 4AW9A 1NXSA 2HTEA 4ZCLA 3J7TA 3FUWA 4ID3A 4HDKA 2A9JA 3HHPA 4NPCA 2X0DA 1KIMA 4BN5A 2O06A 5FWNA 1QCZA 2UUPA 5WRFA 2IUUA 1VE9A 1AZWA 1RWNA 3MGCA 3O03A 2W6JD 1OT3A 4WZZA 4AQDA 2ZUEA 2FG7C 1NVFA 4FS8A 3RNOA 4F5EA 5BVGA 2O8DA 3IGFA 1Z3IX 4XIFA 1ZEJA 4DJTA 2C82A 5CH3A 2BJWA 2CJFA 1CUGA 1U2GA 4FFMA 4KPGA 4NCXA 3WHKA 4ZYWA 2HGZA 2FE4A 5KNBH 3VYWA 1NVAA 2LDBA 4I9FA 5LC1A 2C58A 2H59A 1WEHA 5F77A 2ETXA 2CLHB 1RM5A 2PWPA 2SECE 2VSOA 2ZJ5A 4RANA 5J40A 1IBRA 1PHRA 2H4ZA 2R4TA 4JT4A 1LJLA 1DBSA 1GFIA 1ZI8A 2HBQA 3CNBA 4JT9A 1SRQA 1YBAA 1BYUA 3BFJA 3IT1A 2FN8A 3WYFA 3FPLA 3NKLA 1VLZA 2HF9A 4A2QA 5E6UA 2J3JA 2YRXA 2RGNC 2BD0A 2CV2A 2WWTA 4QU5A 1IK6A 3F9RA 4MW1A 1XBTA 5F12A 5IMSA 1SCUA 4JYZA 1BEZA 4D8VA 2ZRHA 4ZOAA 1R6VA 2NXNA 5AMXA 1C1XB 4Y1RA 2Z0MA 3RC1A 4ZC1A 3X1ZA 3WISA 4MUXA 3JTEA 5THXA 2IUEA 3AOEC 4TYPA 1LLDA 2IWHA 2UXBB 4G01B 4P3XA 1ZHFA 4MVJM 4DABA 1NOJA 1Q3KA 3KQQA 4B2PA 4MRMB 5KYKA 1IATA 1KTVA 4WNYA 2ACWA 2Q1WA 2X0RA 4YUAA 3GJSA 4HNTA 4PFJA 3UMFA 1Z2PX 4H7EA 1LSOA 4MW2A 4A3SA 5JAZA 3TEFA 4BBZA 3V1KA 1GPNA 3MGBA 1BVHA 3G2LA 3W9UA 1CD5A 1U1DA 3WA7A 4ZK2A 4J49A 3EE6A 3W06A 2JGKA 3C8UA 3EWNA 4MCHA 2V59A 5DT2A 4QGHA 1GGEA 4X1IA 2O4CA 3WGZA 5DYYA 1SC9A 5I47A 4AZWA 2CNOA 5A4AA 4MEBA 2FWPA 4WH0A 3HUUA 1VRVA 2Z1MA 4B46A 5AHOA 1CY4A 1VJTA 2JS7A 1SC1A 4IH9A 2FW8A 1VPLA 2LCIA 4KLCA 2IIVA 4MIKA 4MVJG 1JE1A 4DQDA 4ZYZA 3PQ4A 3U4AA 3ZNQA 5LSAA 1E7SA 1KAQA 2CLKB 2OHFA 3A6PC 1KSJA 4WOCA 5A4JA 5MN4A 2D1TA 2ZJ3A 3S5JA 3ROKA 1XV5A 2I5PO 5A3QA 1XEWY 1E1RD 2VAPA 3OJOA 5HMMA 4QJ3A 1GY8A 2FP4A 2B61A 3AUKA 2C2YA 3C48A 2DKFA 2IL1A 3MJDA 4QQNA 1SN7A 1ZVJA 1YE5A 4J1TC 3WGTA 2X8JA 3QY9A 4KGDA 1DE0A 2BGUA 1W59A 3L7LA 2P0AA 4WZ6A 1JP7A 3KKQA 5ESWA 1RADA 4QFDA 2SHKA 2CNWA 3R3WA 4XIIA 3RJ5A 1J7JA 5KI6A 3ZZMA 4F5ZA 1WF3A 1SXIA 1R8XA 3L8GA 5D7BA 2J5QA 3JQFA 3S55A 5LVAA 1V6AA 3LY7A 4O02B 1DX6A 2GMWA 4OFXA 1ZKMA 4PLCA 3R75A 3W5UA 2D1YA 4BP1A 4RDXA 3OWHA 4R01A 1EGHA 2XMQA 4HP8A 4ZT3A 5AJHA 4LRUA 4IIBA 1BVRA 4C4OA 4BTLA 2C3OA 3WL6A 2OHXA 1U2PA 3ENQA 3ZV3A 1WCV1 4I99A 1TLLA 4MDEA 3WXMA 5LZ9A 4BV8A 2JGDA 2O2YA 3L82B 2RK6A 3HR4A 5IDXA 2YDYA 5BR1A 5J1SB 2YXBA 3PNPA 3A1TA 4QQ8A 2GXAA 1E7RA 5KTNA 2P8JA 1JN0A 4V0SA 4AJNA 1CK4A 4LJLA 4MCJA 2E4ZA 5D1HA 2H2FA 2GAAA 5AJUA 3TRKA 4CF4A 2GBPA 4L57A 5DULA 3RIYA 4BNGA 2XEXA 4GWGA 4GMXA 3WVNA 1ZVKA 3M49A 4DCOA 2OKCA 4JSTA 3BDAA 5I3ZA 1RMTA 3WS7A 1L3BA 2VYVA 5GM1A 3HA3A 2G40A 1ATZA 5DN6D 2ZJ8A 4EO4A 3AFIA 2O8FA 1OAAA 3MTJA 3GAAA 3GRUA 4R54A 4DZZA 2XGJA 1EBFA 1T3HA 1Y9JA 5DLEA 1V0JA 3WTBA 4LZPA 3SIXA 1SXJE 5LQJA 5DCYA 2MCFA 621PA 2Q3JA 1T3LA 3WQRA 3L41A 3LKDA 1ZN8A 3ECAA 4ZT5A 3ED5A 2IRWA 3I1FA 3OQ1A 5G3ZA 3R7NA 4R0VA 4CR6A 1ADYA 1OKKA 4G4JA 1SCAA 1Q16A 4CDNA 1UDXA 5DNVA 2POQX 4RJIA 2NO1A 1RU3A 2FAXA 1KK3A 1DRJA 2J1LA 3UOWA 3C4JA 3A9SA 2FW0A 4DMUB 2VPWA 1PTJA 4BLSA 4KFRA 4WJKB 5IJ9B 4Q4AB 5GZ6A 1CBUA 1I4DD 3OZRA 6NULA 4YIHA 1RJGA 1HE4A 3E9NA 3AVQA 3N7AA 1EXNA 3E4DA 3Q3HA 1QHXA 1LD3A 2DBYA 1JIXA 1TVMA 3JQ8A 4JQZA 2NU6B 4UEQA 1J6UA 3KQTA 3V4ZA 3KOWA 4S1TA 2WWFA 1KYYA 2UXCB 2R8EA 4RIGA 2JATA 2QP4A 2XT9A 2ZIXA 3OH8A 4RD0A 1Q17A 1YZUA 2PMWB 5F3DA 1ZNYA 1ZG3A 4LV5B 2Z43A 1HORA 2YQ5A 3E9RA 2B20A 1N5IA 1E3MA 1S4QA 4JLPA 1GA6A 4G4GA 1H6BA 4WXEA 4QD3A 3K6SB 1M5TA 2ZRKA 4JXJA 1Y6GA 2J4FA 2X2EA 2BKXA 1D4FA 4IIXA 4FX5A 1FW6A 3RHTA 1PWYE 1QM5A 2VJPA 1KDPA 3IRUA 4OQZA 1RXSA 1VKZA 2NT3A 4PPFA 5E1OA 5AO9A 2AUMA 4TS1A 1NJ6A 5IAEA 4ZHQF 2HJGA 4LXXA 5C7YA 1W19A 3SC2A 2PT5A 3EZGA 4G09A 2ZQZA 1GGNA 4JMPA 1JQ3A 1KMIY 3G0CA 1KGSA 3GHHA 2FEWB 2QR5A 4JFRA 3VZBA 3L2OB 1VB3A 2ADOA 5FNVB 2O50A 3ET5A 2X6QA 4YJGB 4LE1A 4XWKA 1OJ7A 3LPNA 2WM2A 3T7RA 2VTBB 4UVIA 4UFPA 1VTKA 3I8OA 4YMUA 5ICGA 3ZJVA 2AN5A 2ZJOA 1CDZA 2ZR7A 3NM5A 3ZKWB 3VNUA 5KTTA 4RV4A 2RI1A 2G36A 3I5MA 4AZVA 3EFEA 1WUTA 4YJFB 1D07A 4MVJA 1XP5A 3C39A 3EEFA 3JYNA 4GX5A 4WINA 4WNCA 1VL8A 4O4IF 4LECA 5GJWC 1XTQA 2UKDA 4I5IA 4RVDA 5CX1B 4IG9A 5D3ZA 2DAPA 3IX7A 3ESXA 2H52A 3A1WA 3O1HB 4TLLB 1P9NA 3Q7PA 2CKMA 4DLAA 1LJUA 4UW9A 4A6DA 2ROQA 4D81A 3UICA 5BVHA 3ZZTA 5F23A 2P1ZA 3OEEA 2BP7A 3ZY3A 4DGQA 3DJFA 4HF7A 1UBHS 2VZ9A 4Q7LA 3P94A 3LFHA 1DC8A 2PR7A 1II0A 1VCOA 4NNOA 3N8KA 2ZJ6A 3RANA 2X8BA 4HTAA 2X1MA 4RK7A 5I9NA 2Q8NA 2QLNA 1JDSA 3VMMA 4EM6A 2ZUDA 4NYIQ 4DQVA 4GL4A 2Z2KA 2ATEA 4NDNE 2YMQA 2YJNA 3D8NA 3OF3A 1EUCA 1HFEL 4MYCA 3IMFA 1OLUB 4QDKA 1X14A 4UM8B 4ZAFA 2Q7XA 5KTKA 2VH2A 4CEIA 3MS4A 3JRNA 5JNWA 3UV7A 1ZD3A 2ZU6A 7YASA 8GPBA 2FMXA 2P5UA 2YV2A 3C7KA 1K63A 3FGOA 4Z8XA 3UKOA 4DBLC 1R3UA 4RNDB 3AVXA 3KZ1E 5FOXA 1J56A 1D2EA 3NOXA 4MR9A 5COAA 3CWQA 1XWIA 4ENUA 3IIMA 3D31A 2GBLC 3N87A 2V54A 2J6BA 3I2IA 4ILEA 4M9XA 1KHTA 3T5AA 1JLSA 2IYSA 2Z2JA 1A2KC 1QHHA 2I3BA 3KPWA 3EGIA 7ADHA 3AFOA 4Q9LA 1UDAA 4Q15A 5IC4A 1Z6QA 1II8A 3IBFA 5GJBA 1TYAE 4AMGA 4OBWA 1H3NA 2H63A 4QYIB 3MLBA 4PLGA 4KQEA 3WRWA 4II2A 2J30A 5KQLA 1QFSA 1E7QA 3PWZA 3A2KA 5EUMA 1L4HA 1A9PA 3FCXA 3R09A 4JZKA 5EIOA 4FDLA 3KJNA 1PJTA 1SVWA 2IXFA 2PUHA 2PYDA 5ADVA 5LP6F 3V34A 1UKYA 2P4QA 1A5BB 1J7KA 3NEPX 2GZHA 2JLAA 3D7RA 3ETLA 4EBBA 1W96A 4KN9S 3OJEA 3K2IA 1ZC4A 2NQ8A 3BSFA 1W6UA 2HWUA 1XRLA 2WNIA 1CYDA 1NDUA 2H5EA 1IY2A 2D4HA 4UVEA 2ECFA 1C4WA 2IOYA 3W4KA 2O20A 4HAZA 4N8DA 5EZ5A 2EKQA 3HNOA 1IDN1 2AJ8A 2QPOA 3FMVA 1KI6B 4H4EA 1YBVA 1QQ5A 3F6EX 3U6KA 3HK2A 4L9AA 5CD9A 4AI6A 1V1JA 1XVAA 4R3WA 2HU5A 1P2TA 2HL6A 1SM4A 2CVZA 3MCTA 3R3VA 2D0OB 4UHDA 2E85A 2DETA 3E8SA 2XUHA 3MXTA 2CHQA 4PCUA 2JLXA 4KC0A 2BUCA 3K72B 3KBOA 1U9IA 2X5JO 4ROSA 4B80A 3LT4A 8ADHA 5JNVA 4YAJA 3U5TA 4JB2A 1V7QA 2BGNA 3BL5A 3OZTA 2IZ1A 1P1JA 2R5FA 5JCZA 4BDTA 2G17A 4ZMBA 4KXMA 2WSBA 3H1GA 5D00A 1TQ8A 4EUKA 5BW8A 2P5YA 1O94A 3H2GA 3ZVMA 4D98A 1T34A 1YS7A 1SEVA 1ICIA 1XD8A 1W49A 4G4SP 5TS3A 3C6MA 2BM0A 3VYRB 6Q21A 2XVAA 1HE3A 1A5AB 1Z0JA 2BCGY 3GD7A 1MG5A 3FRHA 4FGSA 4MYRA 1I4WA 4OF4A 1F14A 3QBTA 1HEIA 3WWEA 4AN4A 4RMIA 2VQSA 4DXHA 1P6UA 4IICA 4YRQA 3KT3A 4BKPA 4DLXA 4X9XA 2PUAA 2HFJA 3FHLA 1YQGA 1NVBA 3PXCX 4U7JA 4ZPJA 3PFCA 1Y8ZA 1W88A 2GF0A 1Y89A 5CLGA 3VRHA 3ZG6A 1YCGA 2UUBB 4DSTA 1CUJA 2ZIAA 3VZCA 5C3MA 5BV2P 4I6JA 4V1CA 1TB4A 1YS9A 4HLNA 4J76A 3IUMA 2RGRA 3O4GA 1MV8A 2WKSA 3NEAA 4LJSA 4ZFNA 1YUNA 4YVFA 3AY7A 3AR6A 4Q4DA 2ZYSA 3AKDA 2VJAA 3FG9A 3LP6A 1YBFA 3PA6A 3SJAA 1Y6FA 1VMEA 4GLOA 4RHXA 2EJTA 4WESA 4AUNA 2XSZA 4QUGA 1KZ1A 1E4VA 1FMJA 1EFPA 4ECAA 4DADA 5F35A 4EW1A 3DH0A 4FQ5A 4TZ6A 1CZRA 4KWHA 1P4HA 3BJMA 2EP7A 3F7OA 2WSMA 1UFRA 3L40A 5TF0A 2Y93A 3KJQA 5JANA 1H3FA 1XXHB 2P1DA 2YFYA 1G5FA 3GRVA 1JHOA 2O3UA 3L6RA 1KMHB 1S8AA 3D7NA 1I6KA 2A7QA 3ZWXA 1NQ5A 1XA4A 4QBTA 3R3YA 4WNIA 3ZE6A 3I28A 1W9HA 1ZESA 3WWCA 3CVUA 1U9ZA 4R2LA 3IPCA 2IX3A 2GBIA 2AK2A 2IPAB 3P52A 4ZK6A 4OLHA 5KNCA 1Q84A 3IAS6 4IJWA 4LDQA 5U4QA 4TKLA 2E18A 3TTXA 5FTMA 1GPUA 1BAPA 3O83A 2HMSA 4Y18A 4QICA 2WICA 1E2UA 2WKQA 2YDXA 1T10A 4EH1A 4EHJA 2PXAA 1RQLA 1YVDA 3K3PA 3DZGA 1QE3A 3KTAB 4KE7A 4MPTA 4NE9A 5JDCC 3JQBC 3KJEA 3PF9A 4FB4A 3CH5A 4LZOA 5BPFA 2IWRA 2NNLD 3FZYA 3N8NA 4UUBA 3BDIA 5CM9C 1CQXA 3AERB 3FKSA 3T34A 5HZGA 221PA 2IVFA 2I78A 1TT5A 4X65B 3N0VA 4D6PA 1EBBA 4GIBA 4UQLA 1DCKA 2ZB3A 4IMRA 5J5AA 4YXWA 3LCCA 1SMKA 2XITA 5B7GA 3T5PA 1KORA 1IM8A 1VA4A 1Z6GA 1NVGA 3BH7A 1KGDA 1FTNA 4W9NC 4BP8A 4F4IA 5EN4A 3CCCA 2BI8A 2W2TA 2DECA 3NEJA 4OUDB 4RFLA 3K73O 2O19A 3JWEA 3SKXA 2N75A 5B30A 2BMJA 4FXOA 3VZQA 4ZV9A 3ZKAA 1UAGA 4XM2A 2O8CA 3ONNA 4Y9TA 2HO5A 4PYJA 1SKQA 2NZUG 2FEAA 4IYJA 4A6XA 3O8OA 2AMYA 2VRCA 4E03A 2XUQA 2LWIA 1XE3A 5DCUA 3DWIA 4TXMA 3GLHE 2J9RA 1FFDA 1SKBA 4O2RA 4S3MA 4GDFA 1NT2A 3DD5A 3O73A 3C97A 2X41A 4Y2HA 2M2IA 3T0GA 1B16A 2VJOA 1WMAA 1M1UA 2ZXFA 5JPIA 4IIEA 1V5FA 1H2WA 5B58C 1KH1A 4O8ZA 5K0NA 4XWYA 1MW9X 1WNTA 3LP8A 4NENA 1UFQA 1ZICA 1I0IA 1T1GA 2J3KA 3EXG1 4UULA 3WMFA 4D2IA 3DDSA 4O2AA 1UP7A 1JTFA 1CS0A 1DLJA 3SEZA 5B4VA 1RCUA 1H2YA 2J32A 5T6BA 1EDBA 4NDAA 2TSYB 3ISJA 3C74A 4HB0A 3SCZA 2JHFA 3DM9B 3DVQX 3P4YA 4X92A 1RZVA 2L17A 5J63A 4DN6A 5LU8A 1UC8A 2RC6A 4BDSA 3DMRA 4NBSA 2B8JA 2BEJA 2X19A 4B4WA 4KHPB 4DDMA 1T8WA 2ZB8A 1IRIA 1OX5A 4RHYA 4K40A 1P2FA 1XFDA 3TR0A 5IANA 1HE1C 2P2YA 4N0EA 1QFYA 3G5AA 1FNDA 1OTYA 1FX1A 4FFRA 4Y2PA 2QUJA 2QRLA 3D6AA 4E4YA 1HLPA 4NZZA 4RV5A 3JQEA 4U2FA 4CMEA 1KERA 3WLSA 2B5OA 4UNSA 4BFSA 1RKXA 2AF3C 5JVDF 5KCZA 2CCKA 1XF9A 4KQHA 3B82A 1V5EA 3QPDA 5EFOA 1B2RA 5FIUA 3RRNA 1Y9AA 4HNVA 3SVTA 3P0JA 4AB1A 1IDOA 3ESAA 1WXFA 2FUKA 2LP4Y 2QAGA 1AKTA 1Q1GA 3DO8A 3C8DA 1HLDA 2ZAYA 1G1AA 3L7KA 5IVDA 3AETB 1WB9A 1SBQA 2CCJA 3EYWA 5E9WA 3B3FA 4F97A 4NXNB 4B84A 4KK4A 3ZJUA 3AY6A 4KO8A 4E2YA 4OYLA 1E7YA 3B89A 2H0AA 2XOXA 4M0FA 4FE3A 3IEPA 4F1WA 2Q4BA 3VC3A 3GFFA 1YWGO 4IZ6A 2GPJA 4CEJB 1I6WA 2WWXA 1AKQA 4Q00A 3LC0A 1X15A 2C4TA 5K0LA 3OTHA 2ZVDA 1P1KA 1B42A 4MGEA 2G4LA 3S99A 3HZHA 1KKUA 2R8RA 5IAAA 1OZ0A 4YMHA 2Z56A 3K94A 3ZHQA 3R6DA 2QNBA 1DIOB 4H6WA 4BO2A 1QTQA 3HKCB 3I83A 1WZEA 4IV0A 3BKXA 2WT4A 1RLJA 1WQ1R 3FBGA 4Z7JA 2R00A 3SZRA 2CB0A 3ZBQA 2EFCB 3VH4A 1LNQA 3DQPA 2G06A 2G63A 2FF7A 4XCQA 1UBSB 3VR4A 2XXJA 4I0WB 3QU2A 4FSDA 3VJMA 3H42B 3L06A 5LIRA 2C7OA 4FDAA 2JFHA 2EZ9A 2PKQO 3WB9A 2Y1XA 4NOJA 4RTMA 1RI2A 2J7PA 1T0HB 3EXHC 4MW7A 2XJ9A 3BFVA 3RRYA 5A0VA 3IERA 1AF4A 4B9AA 5IVKA 2VN8A 3HYRA 4MI1A 1XPOA 1UWCA 1OXSC 4I5GA 3MUNA 4WA8A 4E32A 5BNTA 1NXXA 4NOLA 4XX0A 2PUWA 3GT7A 4Q93A 2QQEA 1V3TA 3CEPB 4MX8A 4DREA 1QQ7A 2XYPA 3KD2A 3LHIA 4RENA 5AW2A 4RJKA 4U63A 1GHTA 2H7VA 3E1KA 2XMSA 3DL7A 2E5WA 1QGYA 2FG6C 2K4MA 3ZCTA 5CITA 1ULSA 2FWJA 1Y9EA 2PIDA 5I7HA 3UGJA 2QRVA 3N28A 1WXQA 1X6VA 3WLRA 4W5RA 2D7DA 4WKBA 5KJEA 4MRVA 5J2TA 2ZYTX 1RM0A 3HXTA 4PFQA 1QORA 1EU1A 5JI2E 1E6EA 3GGPA 1Q2UA 4IHKA 1HFWA 4PU0A 1CUFA 5G4KB 3V8RA 1P2GA 2FPIB 3EXIA 4ZQGA 2IDKA 1XLUA 1WM1A 1WCIB 2DH5A 2A5YB 4MLPA 3GEPA 3DBLA 2HMWA 3WMEA 5FFNA 3RJZA 2GT1A 3LVFO 4RK6A 3HL4A 5EJEA 1UXOA 1UBTS 4LNAA 4NATA 2A1TS 2PAAA 3L7IA 1KEKA 3NNDA 2L18A 2R60A 1ISHA 2C2HA 2H1RA 2R751 4HLUA 4HSGA 1ZGAA 2A7XA 2B8EA 2E48A 2IK8A 4MQUA 5K0JA 5H83A 2IEGA 5AM1A 4MYUA 3JALA 3C3KA 2NPFA 4WN3A 5AIBA 1YJBA 5LA6A 3R5XA 1C3JA 1QUFA 1FL9A 1UK7A 3QBDA 2YZNA 4G25A 4ZJUA 2FJ0A 5I5EA 3SS7X 3OMWA 3TLBA 1LC3A 1ADGA 1KDRA 1IPHA 4OXIA 5SY6A 1V11A 2XUJA 3E15A 2L19A 3R6TA 5E38A 4BQSA 3U4IA 1AHNA 2JGEA 3TVDA 3GUCA 4EA7A 2GOYA 2GAIA 3E3AA 3PUYA 1KXZA 5EJFA 3B1XA 1T4GA 3ULKA 3WLMA 4NYMR 1U5CA 1IIRA 2WI8A 1KH2A 4QUJA 5KHAA 4DLVA 1FLAA 4JEUA 4OPMA 4RA6B 2C2GA 1W4AA 4MLZA 4CUJA 2FZVA 5DF1A 2MYPA 5BW5A 2IQIA 2ODWA 2Z83A 4DKJA 2XXAB 1BVYF 1NBOA 2MSLA 3IUSA 5CBPA 4EY8A 2CSXA 1U0BB 2W00A 1TIBA 3MINB 1GXSB 4UZEA 2GZAA 3DFIA 2VXOA 1N0VC 1YVEI 1CLUA 1QIKA 3KLMX 1JWAB 1RYNA 3VGJA 4JBLA 1ORVA 4IFBA 4YRCA 3DZIA 1UIMA 1DC6A 1NFRA 4QXQA 3DCNA 1KOLA 3SXUB 3UMVA 4YRIA 3G2PA 5BNWA 1Z4KA 3EW7A 3HY3A 4AYXA 4OHXA 2FUNB 3BXZA 3LRPA 4QG3A 2P3SA 2J9GA 3ZDZB 1PD0A 2D1SA 3ELBA 5J5CA 1HYQA 1LK0A 1SOMA 1CSEE 1M7GA 3AU8A 3HKBB 4KJZA 2VPQA 3PZRA 5IM4A 1YZ3A 4Q34A 4RULA 4CQNA 1J8DA 1JR3D 5JEEA 4PX2A 3ZJ5A 4TVKA 2VDOB 2QV7A 3TB4A 3M6XA 1PFVA 4I2NA 5G0TA 4YECA 2BIFA 4MS3B 2R47A 2AK3A 1K6JA 2BM9A 4PX5A 4LWQA 5ALXA 3UUFA 3R9WA 3I4FA 1L8LA 1I2BA 1N5MA 2FJPA 4JKOA 3HDTA 3JVUA 5IJAA 4M98A 5TPZD 3X44A 1AKVA 1XZIA 5AXDA 1XNHA 4FD2A 2ONJA 3SD7A 5IJZA 3IQXA 3IDAA 4L74A 3VR5A 3WMWA 2HF8A 4Q37A 1Z6AA 3F71A 5AXAA 4LHSA 1JHMA 5FYDA 3D4PA 5AXCA 3Q9LA 1ZL0A 2AFIB 1YI1A 4KAFA 4OGGA 1OX6A 4FK8A 1N2EA 1I4OA 4PANA 1U2GC 2M6LA 3O8LA 1T91A 4UC0A 4JI0B 1L9XA 4QWMA 2VHZA 3ICQB 3EIHA 4XVRA 1XDZA 3RSQA 2C0PA 3GLQA 2BI4A 4JQCA 5KTMA 2C7BA 5H9VA 1FNMA 3TSOA 3T9DA 2C4VA 2Y76A 4X1KB 4DNOA 3BIOA 2W4IA 3B3AA 3GT4A 5BUCA 4HAIA 1W5TA 1NXWA 4YHBA 1TZ2A 1FUIA 4EEXA <