5AJYA

Human pfkfb3 in complex with an indole inhibitor 4
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
444
structure length
439
Chain Sequence
PLELTQSRVQKIWVPVDHRPSLPRSCNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQPLDPDKCDRDLSLIKVIDVGRRFLVNRVQDHIQSRIVYYLMNIHVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQLKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTGESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVCTHRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-BISPHOSPHATASE 3
publication title Structure-Based Design of Potent and Selective Inhibitors of the Metabolic Kinase Pfkfb3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 157
structure length 439
sequence length 444
ec nomenclature ec 2.7.1.105: 6-phosphofructo-2-kinase.
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
A PF01591 6PF2K 6-phosphofructo-2-kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ajyA01
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 5ajyA02
1GFIA 2VP2A 2JAQA 1JPNA 1DEKA 4PFSA 5GJBA 1E4YA 3AKEA 4N1AA 5DGXA 1XXHE 5FTLA 1XB2A 2GEUA 4H1UA 4M22A 2YNMA 4B3BA 5CDFE 4LBVA 2C96A 3O0TA 3B6EA 1AQUA 5JHGB 1GIAA 3F3KA 1DPFA 1QZXA 1TUEA 2AKYA 2N1BA 1AGPA 4EPVA 2QG6A 2KJQA 4QNRA 3RS2A 3AV0B 8OHMA 2FSIA 1NL3A 5FPSA 5TV2A 2AL7A 3ZZ0A 2HHJA 3GW8A 5AWFC 1R4AA 4D80A 3TNFA 3LY5A 3ADDA 3FDZB 2IS1A 4IDNA 4KFRA 1GG2A 2GJAA 2ZE6A 2BOVA 1KK0A 2CLDX 1F2TA 1SZPA 5BQ5A 3KQLA 2ZXUA 1DKPA 3SJAA 4A2QA 4V0LA 3DO6A 1W5SA 1NVUQ 4Q1FA 1DG1G 3U6BA 1E79D 2QROA 3I61A 1G16A 2F43A 4ARZB 1LB1B 1DELA 2GXUA 5J4LA 3OF5A 1JR3D 3CWZA 3LVRE 4BEJA 1P2TA 3GJ8A 2ASEA 1ZD9A 1NLYA 4US1R 2ZAOA 5AJYA 2GRJA 3BFKA 3ZVRA 4B44A 4KLNA 4YMTA 2NZ8A 4NE2A 4PC6A 2ZRJA 2PA0A 2V7QA 2ZVQX 3LBNA 5FOWA 2WIAA 3TW4A 1U98A 4AG6A 3W6PA 5J40A 4B74A 1UBCA 4GPZA 2G6BA 2CNWD 4V03A 2WTUA 1II0A 3K1JA 4B75A 2NO7A 3AB3A 2P6OA 4KJZA 1P2SA 3RNLA 1A7JA 4PPFA 1T91A 3K0EA 4JLPA 1QHNA 1R7RA 4B43A 2N46A 3EIQA 2J0UA 2ZJOA 4R71A 4C3ZA 1NBMA 4A82A 1J99A 1U81A 4PTLA 4BLRA 4F92B 3AUYA 3D8BA 5IT5A 2MMGA 1W7AA 1NMXA 3DMNA 2PEZA 1XCPA 3PEUA 3FMFA 4FD2A 4A9AA 1XPRA 1NT4A 1Z8FA 4O2LA 4BLOA 2IWRA 3EZNA 2XJ9A 4A0GA 1Z6AA 4LOAA 1T9HA 5JS8A 3ZGXA 3RRNA 2ZETA 1A1VA 1OXTA 2B8WA 2BBTA 2IT1A 3B82A 2QAJA 3DM9B 3K09C 2ZITA 1NKSA 4QJ4A 1HURA 2J7PD 1QHGA 3CB4A 3QXJA 2P2YA 2QMUA 2JA1A 4CEHA 4MRVA 2H57A 4Q7KA 5IDVA 4B76A 2EKZA 2WBLC 1S3GA 4CEHB 1G8PA 2OCPA 121PA 1W49A 2P78A 4GMXA 3T61A 1UKEA 4DIEA 4LSGA 3RS4A 1LVGA 5KDLA 1Q12A 1GUAA 2G77B 4D25A 1LNZA 3EOZA 4TYQA 4JIMA 3RRYA 3GLHA 4IOMA 2QRZA 3CH4B 1MH1A 3SFZA 1N5JA 3FFBA 1TAGA 1UEJA 3GLHB 4X8LA 2E87A 2IWHA 3GLIA 1NVXQ 3RS7A 2DWPA 5JEEA 3GLIB 2GDJA 3DZ8A 2EVWX 2AX4A 4L15A 3BH7A 1J90A 2OO7A 1N5IA 2EYUA 4M0LA 2VLIA 4RCYA 1YR8A 4S35A 6Q21A 4BPBA 1T0HB 3DPUA 3R9WA 3ZIAA 3CR7A 3LFUA 4BE7B 2WWFA 3OESA 2O8DB 2JGNA 3IEVA 3J81k 1QF9A 2QMOA 1SVLA 2RGAA 5FTKA 3W6OA 3EX7C 1CXZA 2ANBA 1OXXK 1AN0A 1JJ7A 3CZPA 1F6BA 1YRBA 2Q3MA 4MGIR 5FH9A 3NFYA 1DAFA 5C46F 2IYSA 1TTTA 4OQXA 3VKGA 4DJTA 1ZP6A 4JLNA 4LHZA 1J8MF 1E9DA 3FMOB 1N6HA 1TMKA 4B6FA 4HZUA 4Z54A 1T5IA 1QBKC 3RYTC 5KNCA 1PUJA 2BM1A 1NG1A 1KKLA 2LKCA 1UKYA 3B8HA 2Q3FA 3ETLA 4FDTA 3I32A 4JKYA 5DI9A 1U9IC 2NIPA 3QPVA 5LBIA 2ZR0A 2NG1A 2O8EA 2CK3A 1BO6A 1BMFA 3PITA 1Z07A 3ZZUA 2FDCA 1OT3A 1KAOA 1W4AA 3EXAA 4PQYA 3R7WB 3UATA 1RE0A 4YXWA 3MAAC 3SNHA 1UF9A 2RGXA 1RVDA 1MO3A 2VP9A 3TR5A 3TQFA 1XD8A 2PT7A 5CLQA 3SZRA 1UBFA 1VMAA 2NO6A 2V8OA 4JJZA 4PGMA 4UJ3A 3N2EA 1MT0A 1P9NA 1XMVA 1E0KA 1CR1A 2JLSA 2OSBA 2X1VA 4HDQB 4LDJA 1OF1A 4URUR 3AM1A 4N0DA 2VQSA 4NKRA 2ZSFA 3KTAA 1JQJC 5BN4A 1H8HA 3M4YA 4ZDJA 5KTYA 3IKJA 3NEJA 3IBGA 3PUZA 5FI0B 1ZM7A 1EFTA 1T4GA 2UZ3A 2OWEA 1ZVQA 1EFCA 5HTKA 1VYVA 4KVGA 3W9YA 1A5TA 2VP4A 1E1RD 3CRQA 2GZAA 2AWNA 4WVFA 3OE7A 2FA9A 4RZ3A 1X3SA 1TQ4A 4GNKA 3C7TA 1SVKA 2W00A 2REXB 3BFVA 1MO4A 3THYB 3B7GA 2QPTA 2C99A 2AD1A 4D4KA 4OHVA 2Q9CA 1IN6A 4Q1EA 4TMVA 2ZRBA 4XH9B 3JVVA 2EKBA 4UQOA 1W36B 2BV3A 3MXOA 4A8JA 1XCGB 2C2HA 2H16A 4L5BA 3OEEA 5KSZA 3AVWA 5DIFA 5JWRA 4QM7A 3QSYA 5EZ6B 2CL7X 2FF7A 1OFTA 2RHDA 1OIWA 1KI2A 2GTPA 3GJ3A 1GVNB 1XJQA 1L2TA 4NYIQ 5JWOA 1T3HA 2PBRA 3MWYW 2B6HA 2YJTD 4HUQA 1S3SA 1SVOA 3A37A 3TW8B 4GP7A 4XWAA 2QUZA 1FQJA 4JVMA 4HBZA 1NI3A 1IN5A 1CIPA 1AIPA 3QPUA 3TAHA 1E1QA 2MSEB 3CUEF 1L4UA 4MUBA 1KHTA 4QHSA 1KO7A 2WSMA 3U4QA 4EPRA 4ZI2A 4MYTA 1G8GA 3QBTA 4EJSA 1NIPA 5C1BA 1US8A 3FJYA 3SYLA 1HV8A 4OK6A 4HAYA 3SU8A 1KMQA 1US8B 2YC2C 4M1TA 4Z8YA 4BFYA 1TPZA 2A5DA 4BUJA 4DLUA 3NBXX 3JVUA 1ESMA 2QY9A 4LJ6A 5J4VA 2GVDC 2GKSA 1R8SA 2W2TA 3QE0A 3WYGA 3TGPA 1OYWA 4DB2A 2ZSDA 2GJ9A 5GVSA 4KFUA 4RVCA 4TTQA 3CF2A 2BMFA 1IXSB 2ZUBA 5SZKB 4HSEA 3NDBB 2F1IA 5IK2D 1N0VC 3U5ZB 2XGJA 1E2KA 3WHKA 4DUGD 2FFAA 1KAGA 4QBHA 5F9FA 1KKMA 1ZC3A 5E7MA 4QHYA 1UKZA 421PA 4U5XA 3LH5A 3WNDA 1QFXA 1XTRA 4RFSA 5JBQA 1II8A 2F3TA 4P4TA 4D4JA 2J0VA 4DEXA 1A2KC 2QAGC 4OJQA 4RFSB 1YVDA 4XVQA 1II8B 5EXSA 5AUOB 1NVVR 1GITA 3L8YA 3D6AA 4PZLA 5CB8A 2VSOA 3KKPA 4Q00A 4RSGA 1V7QA 1A4RA 2WAXA 3VR3A 3WYFA 5EJEA 1LS6A 4QOSA 1L7VC 3EIHA 1W0KA 2XOKD 2DFLA 2PZGA 1G19A 3VR5A 4KLZA 4EMBA 3PG5A 3SJZA 4F4CA 4O25A 1Z28A 3E9EA 4G01B 3W8NA 1NLZA 3UG7A 4XD7D 4GT1A 1PLLA 2ODBA 4CW7A 2ZYWX 5E4FA 3SFVA 5KHOC 3TSWA 1G7SA 4DZZA 3TIFA 4BFZA 1E96A 3WXMA 3E9CA 1NY5A 3X2SA 1OIVA 2ZSAA 2ZRCA 4B71A 3HR8A 1YKSA 1Z6XA 1DAKA 4QM6A 1CR4A 3HDTA 4QG7A 4WW0A 3REGA 5CX4A 2WOOA 3I62A 2VHTA 2WAYA 1FNNA 4JLJA 2BKEA 3K0CA 1WB9A 4W5WA 3ADBA 1IQPA 4IVQA 2ODEA 1SKAA 1GZSA 2IUSA 5FL7A 3CX6A 5HE8A 5L3RA 1AKYA 1IN8A 5LB2A 2O8FA 3NTUA 3KKMA 3I1FA 3I8SA 1YR9A 5C18A 5J4HA 4P32A 3HU1A 5IF9A 3UPUA 1OPXA 1KI6A 3DKPA 2F1HA 4MUAA 1VTKA 1XF9A 4IXMA 2YWEA 4OK5A 3NKVA 4GPIB 4QC2A 3R7AA 4BFTA 1QRAA 2J7KA 3GQBA 1YZGA 3IHWA 1I4TD 3ASYA 2XZPA 1Z0JA 3GLGB 3SDZA 2BHRA 2RGNA 3F8TA 2YOGA 5JMTA 1DAGA 1S8FA 4WA7A 4PZYA 4CEIA 1ZRHA 1KDOA 4Q02A 4NCJA 4YONB 3UMSA 1YR7A 2O0KA 2QQEA 3BB4A 1VDZA 4CEIB 4G3XA 2DWOA 2ORIA 4QL3A 2KE5A 3PIRA 3T06B 1ZUIA 3IT2A 3MBKA 4FMBB 2FSFA 2A30A 1RRGA 1RRCA 4JL6A 2QZ4A 4TQ9A 4PAOA 3TSZA 4V0MA 1CLUA 4LV6A 3FHTA 1DKMA 5CM8B 2DB3A 1MO5A 2A2ZA 2XNDD 3TMKA 1UKVY 3A6PC 5AJVB 2ZREA 2ZI7A 2IF2A 3BXZA 3QKRB 3ZYCA 4F7WA 3ZS8A 1E58A 1F2UA 5HCNA 5IRCD 4Z8XA 4YDHB 4Z1MD 2OUKA 3MJRA 4LPSA 1O3YA 5DISB 5FUWA 3OFND 4DDTA 4CZ2A 5M04A 4PANA 3SBEA 1VCOA 2ZS7A 3BERA 1NVWQ 2DHRA 1XRJA 1ZD8A 2ZYVX 1T3SA 4YLGA 1JJVA 5JWHA 4DHEA 4B73A 1H8EA 3C4JA 2ERYA 1M7GA 1RPAA 4I1OA 4GRAA 5FBVB 4TMXA 4WIAA 2JJ1A 2L0XA 1PLKA 5DHAA 4K46A 4TT3A 5BYKA 4OHYA 4LGMA 3EAQA 1QHHB 5EP3A 4NYMQ 1DO0A 4BRWA 3UWKA 4C0KA 5FPHA 1CJUC 3N2IA 1E94E 4RCZA 3KQKA 5HE9A 3THXA 3NTLA 1ZINA 1WXQA 4D26A 1MRSA 3EZ6A 2EFDB 2D06A 1JB1A 2P9FA 2Y8EA 4LHXA 2ENUA 1QHXA 3B13B 1XWIA 4CF7A 2ZEJA 3OHMA 1TQ6A 3TK1A 2IYVA 3HJNA 1BOFA 1KO1A 1RW4A 4DLZA 4HLCA 3ICEA 1LTQA 1SK9A 2ZSEA 4BFSA 4FI3C 3AVVA 4L8GA 2BIFA 2VHUA 5EE1A 1R5BA 2BDTA 1YZLA 2WKQA 2EFGA 2WOJA 4LRWA 1C1YA 2FZLA 2ZU6A 3IGFA 1AGRA 2W0MA 1UM8A 2BBOA 1FL9A 4AKIA 5C2JB 5DHFA 3C41J 3FKSD 3KJGA 4W5HA 4U7DA 2ZJ5A 5F98A 3IT0A 1VIYA 3DKVA 4V0KA 4DCTA 1HH4A 1FNMA 1RKBA 4DCVA 4FCVA 1DAEA 4OKSA 3T1VA 5SZJA 1IXZA 1I4LD 4L9WA 2FSGA 3AF3A 3CPJB 2HCJB 3TQCA 2GJ8A 4TSFD 3AP1A 4DCNA 4FN5A 5TVKA 2IEYA 2IS6A 2QTVB 1H65A 2D62A 2Z6VA 1SVIA 4X8OA 2CE2X 4RY2A 1G21E 3KQUA 4AKHA 3ZD6A 3SI7A 1R6BX 2ZRDA 3L0OA 4DLWA 3PFIA 4C2UA 2LKDA 2W6JD 1OFIA 3SJCA 4FCWA 3VX3A 1FX0B 2H17A 3NEYA 4A0RA 3T12A 4Z51A 4A0FA 1WRBA 2IS2A 1OXUA 1W0JD 3GP5A 4TYWA 3CPEA 3VHXA 3QG1A 4D0NA 3AF0A 1E2MA 5FTNA 1E2HA 3BS4A 4XSGA 1E79A 4TZ6A 3FTQA 3AF4A 1UDXA 4B2IA 1PV4A 2XXAB 4DCSA 3QJYA 4NCKA 1JR3A 3U7HB 1EESA 3QVVA 5HKKA 4Q7JB 1KO4A 3HWSA 3NXSA 3LA6A 3GJ0A 3E70C 5BYJA 2WJGA 1U90A 1XU4A 3GD7A 1AA9A 4M1OA 4TTRA 4BZXA 2P6MA 3U44B 2CNWA 2ERXA 2ZRNA 1FFHA 3L0SA 4IVRA 4ACBA 3AP3A 4KO8A 1EXMA 4M1WA 4LJAA 2WMOB 3A1UA 5JSZB 1BQ3A 4FCTA 4NHOA 4Q7LA 1NBME 4PC3A 4HLQB 1E69A 4NMMA 4DLSA 2R6FA 2Q9BA 2P67A 2GBLA 2IYXA 1E32A 4OHXA 4E5UA 3U3KA 4U00A 1BYUA 2XZOA 3PENA 4Q4LA 3LWNA 2MSCB 4WZAE 3RSLA 5J4YA 1E9CA 4TLCA 4US2R 1E2IA 4FMCF 3I4LA 2FE4A 2OBMA 2VEDA 3VKWA 4U02A 4JJKA 1N6OA 1YFKA 3JZAA 2FH5B 2OHFA 4XVUA 4B2LA 4TSRA 3TE6A 1W47A 3RHFA 4AK9A 4Q5IA 4HLUC 2J7PA 2CXXA 1X8KA 4BFUA 1HY3A 1U99A 4S2EA 2J9RA 3LLMA 2IUUA 3IO5A 3IPYA 1E2DA 2ZSBA 4KBFA 3EZFA 5EP1A 2YWGA 1WQ1R 1X8JA 5GVRA 5FBLB 4KYIB 2Z5FA 3EWSA 2J0SA 3K4PA 1KK1A 4ARVA 3GLHE 2PJZA 4B3CA 4M2LA 5H8WA 1LW7A 3G82C 5KSOA 3GLIE 1SXJB 2BBWA 4YMUA 3KQNA 1E0AA 2LWIA 1Z2CA 4JBXA 1OFUX 4LJ9A 2FSHA 3C16C 4EFNA 4PC1A 3SHFA 1YJ5A 4MQBA 1YJXA 1ZIOA 4PAQA 4LYAA 4QBFA 2DCUA 1PVOA 1Z29A 1Q21A 4C0LA 4PHFA 4IVPA 1VG0B 4KV9A 4M1MA 2OEPA 1E2EA 3BAFA 4PC7A 1NY6A 2B7CA 5EXXA 3REFA 4DKXA 1GL7A 4DT1A 1WE2A 1Z47A 4IJMA 1AS3A 2XZLA 2QNRA 2EFHB 3MJHA 2BMDA 1ZD1A 4YMWA 4DT1B 4MYHA 4NDZA 3SQXA 4C0JA 1AS0A 3CNNA 2VHJA 2F90A 4E3WA 1EK0A 2HLDD 5EXTA 3AVYA 1KSHA 1R2QA 1VECA 2D2EA 1VHLA 1KGDA 5AJZA 1G8FA 3CRRA 1QHYA 4ARSA 3MLEA 1ZCBA 3TLXA 1HQYE 4DVGA 3WHLA 5JRJA 2ZRFA 3QEJA 4JL5A 2WKPA 3UIEA 2CVHA 3SYKA 3GJ4A 4H9GA 4B3DA 4BFWA 1R0YA 4JLDA 1KI4A 3FMPB 4XSHA 2H1LA 3GJ5A 4JMPA 2O8CA 4HB4A 521PA 1W4RA 5CU7A 3BBPA 3K70B 2V54A 3LNCA 1F2TB 1F48A 2O8CB 1CJTC 1O87A 2FMXA 2EOAA 1QG4A 2O52A 2J59A 5BW8A 2R6DA 4UXHA 2EFCB 2OM2A 4HAUA 4MRPA 3RAPR 2F43B 3AVUA 2WICA 2ZIAA 4OHZA 1XTIA 721PA 1XFAA 1RRPA 3GFPA 1VG1A 1IXRC 1TEVA 2FPMA 4NCNA 4D0LB 1ZM4A 5FUXA 1FW6A 1OB5A 4RZUA 3A1WA 2X2EA 3ADCA 2LCFA 5F9HA 2ZJBA 3LW8A 4BEBA 1Q22A 1WBBA 4Y0AA 1E1RA 3NWJA 1XJ0A 5EQTA 5G3ZA 3BRWD 4QJ3A 1LS1A 3ZLJA 1L8QA 2JJ2A 3VU9A 2G1KA 3E2IA 5FBWB 5FOXA 2J0UB 3VU9B 1C4OA 1KOFA 5ANRB 3S1AA 5CK4A 2GETA 3MCAA 3W34A 2F3RA 3S1AB 1SHKA 1AM4D 1G5RA 2PX3A 2WKRA 1OYYA 2QRNA 4PX9A 5JCPA 4MDEA 1KDRA 4PQRA 4GL2A 2DYKA 1P4SA 4GP6A 2BMJA 2FV8A 2CLCX 1E4VA 2ZRMA 2XB4A 4LV8B 3UMRA 4UNRA 4R2HA 2JCSA 1HT2E 3VMFA 1DBSA 3GLFA 3I5XA 2HT6A 3MWJA 5FTJA 1QHIA 1D5CA 3G0HA 3GLFB 3K09A 4I1SA 3KKOA 4RJLA 2WWIA 3FKQA 3X1ZA 1ELOA 5GJVC 1GNPA 1XMSA 1EWRA 2YZ2A 4LYHA 2OAP1 3QPWA 4M53A 1COWA 4XTRA 1XD2A 5FPYA 4B6EA 1YZQA 4ZCLA 1XD2B 5TY0A 2PZEA 4DXAA 1KY2A 5F2EA 4HATA 2R2AA 2REOA 4IDHA 4EPXA 3A1VA 2H7VA 3CONA 3CRMA 1E2NA 5E7IA 4CGZA 5IK2A 4R98A 1VHTA 1HE8B 5B58C 5AUQA 4DUGA 1JXOA 1YZKA 1I2MA 1CU1A 3CM0A 2QENA 4US0R 5FOUA 5JLJA 2YWFA 1Z6YA 4LCBA 3CF6R 5EE5B 4TQUS 2XTZA 4ZCMA 2WVJA 2HYIC 1E0JA 1E9FA 2ZRIA 3IEUA 2JIZA 4JYBA 3FOZA 2QMHA 2ZRPA 4BZQA 1SKYB 1P9RA 4A2PA 3A4NA 2WZQA 4ABYA 1SVWA 4NTZA 1FZTA 3H2YA 4HZUB 3RC8A 1GTVA 4IEEA 2O0HA 3CR8A 2QT0A 4I81A 3EPHA 1GM5A 2WU0A 2B21A 2XOKA 2OBNA 1OH7A 1G3MA 1NN1A 2PLRA 5B2ZA 4MDFA 3CWQA 1IAQA 3NH9A 2GESA 1R8QA 4TWZA 3ZQ6A 4WZ6A 2PT5A 1Q0UA 3BB3A 3EA5A 4RD1A 4A36A 2F7SA 4EIWA 4LBWA 2Q21A 3IIJA 3M1IA 2ECKA 4TYPA 4FIDA 4CRWB 2O8EB 3R20A 3TUIC 2FFBA 3TUJC 5GADl 2VP0A 4HZIA 3BIFA 1U9IA 1KI8A 1MO6A 1XXHA 2C9OA 1G5TA 4GFDA 2G83A 3RABA 4PO8A 1CKEA 3EG5A 1EGAA 4NZYA 1C9KA 3PR1A 4RZ2A 4Q9JA 3KL4A 3GJ7A 1N5KA 3NC1C 4LWZA 3TJZA 1KIMA 4LUCA 3GMTA 1ZNYA 3NIBA 1W5TA 3AVPA 4D4LA 4XWKA 1LV7A 1NN3A 4BWYA 1NNEA 3IT1A 4A1FA 4G5GA 3WBKA 2H52A 5AJXA 2A5JA 1T3LA 3KTAB 4PQFA 4Q47A 3H1TA 2QNIA 1KJYA 2VO1A 4MYUA 3U3MA 1R5OA 3K70D 1DG3A 4JLKA 1GILA 1ZIPA 3E5HA 5L3QA 5H70A 4JODA 3HP1A 1YRAA 4MGYR 4C0SA 3GLGE 4XOIA 5L3QB 4F4IA 1S4QA 1GL9B 4JT4A 3KX2A 5KSYA 3OAAA 3N5CA 1XEWY 2ZUCA 5DI3A 4HB3A 4KXFB 2ZU0C 4MA4A 4AYTA 2J3EA 3B9QA 1OHHA 2PMKA 3TSOA 1EBBA 1OJLA 4M9ZA 2CCKA 1HE1C 4QHTA 1TIPA 1X6VA 3R8CA 2I1VB 3NHBA 1UFQA 1D6JA 3D7MA 4A8JB 3D4IA 1NSTA 1W36C 2MMCA 4DLRA 4ASUA 1P7CA 2Z43A 5CM9C 3X1WA 1GDDA 2DY1A 1E9SA 2CVFA 3DL0A 2ZI3A 3SOPA 1X1SA 2XNDA 2WJVA 4Q9HA 4CEJA 2XSZA 4UNSA 1ZUNB 3P20A 1WCV1 4JOCA 3DM5A 1NBMD 1NN5A 2O5VA 5SZIA 4ERNA 4HUQB 4TZ0A 1X8LA 3FVQA 5FR1A 4WOPA 4HDCA 3AKDA 4JL8A 4PZ9A 1RRFA 2XAUA 3OFNA 1YQTA 1S9HA 1W4CA 4GI7A 1BH2A 2ZI9A 3OIWA 4KSCA 3I72A 5FBRB 2CLSA 4TLDA 3U4QB 3WNBA 3IHLA 1KSFX 5G41A 4CYMA 4EJSB 3K4QA 5P21A 2QM7A 3T1OA 5KPJA 5FI1B 4A6XA 1D9ZA 4JVNA 1BIFA 3K9GA 4EQ6A 4LZZA 3WP0A 1T8UA 2P3SA 4DSUA 1TF7A 1T6NA 4ARUA 2WMNB 3AF1A 4ITRC 1MOZA 2KB0A 4OI2A 1GL6A 1G17A 1CBUA 4P3YA 3D6TB 2OFWA 1DKQA 3RWMB 1ZUHA 3FHCB 3BWDD 2NO1A 2BWJA 3CKLA 1JEEA 1VKJA 2GEVA 1G8HA 3HPQA 3M6AA 2OXCA 3CW2A 4I1VA 5KNDA 1IONA 3IO3A 2GILA 5CJPA 4LC0A 2IYZA 3B1YA 4AY2A 1G291 2BCGY 2EQBA 2DWQA 4G1UC 3MD0A 1KSGA 2QPAA 3AP2A 4D81A 3DMDA 3THOA 3DOEA 2H4ZA 2ZM5A 1RFLA 4MKIA 3AGPA 1S1MA 2GCNA 1E9BA 2PCJA 1KO8A 4C7OA 2VF7A 1QHSA 4Q9KA 2QAGA 3Q8XB 2IYRA 3MSXA 3T34A 3FKSA 4Q48A 1ZC4A 3QXXA 2VHQA 4BFVA 3CLVA 1G3RA 1P5ZB 3K9NA 3SBDA 1VCMA 3F3YA 2VYFA 2JLZA 2F6RA 1NN0A 1NSFA 3A1SA 4MYCA 2OAQ1 1G5PA 4ODIA 1ODFA 3DEFA 2QGZA 5JS7A 1Q3HA 1T0JB 5AK0A 3MGCA 2A78A 3NVAA 2RKOA 3FGNA 3OZXA 3Q7QA 1ZW6A 4RD2A 2WJYA 2GCOA 1R5NA 3Q5EA 4HAWA 3V9PA 2GXQA 2VF8A 2HDNB 3L8ZA 2WPDD 4MH0R 2GCOB 2W6JA 1CR2A 2Q6TA 1BMFD 1GRRA 2UVQA 3B1XA 3CBQA 4P4SA 4Q4HA 5TDHA 3ZD7A 3LBIA 1G7CA 4NH0A 3K0CC 2CHQA 1G64A 4CT4B 2O8FB 4YXWD 2QQ0A 1WDTA 1UADA 1N6NA 2IYYA 1CRPA 4DLTA 4FWIB 5KO2A 5CYOA 1JAIA 1KI6B 2VSFA 4RFVA 4PHTA 4Q7MB 4BECA 4AD8A 3KXIA 5DNYB 3OEHD 3NH6A 1R10A 1NP6A 4EFLA 2ZTSA 5CITA 4B32A 1E2FA 3IUYA 1IBRA 1TEXA 4GPTA 4IFEA 4IHQA 5EP2A 3TH5A 4DIDA 5HCIA 4M9QA 2RGCA 1SVMA 2YYZA 1EWQA 5JHHB 2GK7A 2RGEA 3SEAA 1IY1A 5J47A 2HYDA 3LQQA 2JDID 2YKGA 1JR6A 4Q4AA 4OI1A 2G9NA 5EXPA 1BKDR 4GOKA 1W2HA 2IBMA 3VAAA 4EPYA 5CDHA 3O8RA 3GP3A 1KMHA 4W7SA 2SHKA 2ZUDA 3LW7A 3T35A 2OBLA 1VCNA 4DB4A 2PL3A 1R0WA 4MRRA 1P6XA 3PXGA 3ZVLA 3Q85A 2W6IA 3FDIA 2R8RA 4UXIA 1W36D 1S2MA 2RH5A 4KCGA 4G5QA 1F2UB 2HT1A 3BJIC 2NTYC 3H0KA 1N6RA 1W2GA 2QORA 3D31A 3OEED 4LBYA 1M1YE 4C2TA 2J45A 2QMEA 2NQ2C 2QN6A 3T5GA 4M9SA 5KNBA 2X8AA 3KUDA 221PA 3C15C 4HUTA 5A5GA 2ODWA 2IF0A 2VIIA 4CVNA 3WBJA 5L8VA 4PSAA 3LO5A 1UJ2A 2BCJQ 3GJ6A 3VR2A 3VX4A 1Z22A 4TL6A 1SKQA 4Q9IA 5H68A 2EFEB 2F1RA 3N70A 3AQ4A 2GWHA 3ZVMA 2GAOA 2ZRLA 2P9YA 2QM8A 3ZQJA 4TL7A 5DN6D 1N0UA 2V6JA 3X1XA 1E2GA 4WXRA 1F3OA 5JJIA 3VKHA 4RD6A 3O47A 2B7BA 3THXB 3WNCA 1SXJE 1W4BA 3ZHCA 3KUCA 3A36A 1KDTA 1J7KA 2CHGA 4OQFA 4NBSA 2H4XA 3FE2A 1G7RA 1EFRD 4RKEA 5G3YA 5L3SA 1Q1EA 5KOYA 1OKKA 2XEXA 3DZDA 3CNLA 4G0NA 1JI0A 5L3SB 2AR7A 2QTHA 4F4JA 1X86B 1U0JA 2NGRA 1Y63A 2E1RA 2WSSA 4TL9A 2VH5R 2A7QA 4CT5A 1D2NA 3L2OB 3B78A 1Q3TA 3EWAA 4DLVA 2PZFA 2J46A 1G6HA 1Z0AA 1ZAKA 2P9ZA 3IIMA 3RWOA 1FOEB 3QXSA 2F55A 3KXKA 3VR4A 4FINA 3ZH9B 4EDHA 3JZMA 3RANA 2YOFA 2P2ZA 4MGZR 3LDAA 4AI6A 3QBVA 4TL8A 2HLDA 4N0EA 5KU1A 2DR3A 4DSTA 3MRSA 3KB2A 5DE3A 4PPGA 4Q4JA 2ZAMA 1W0KD 4QGGA 1AS2A 1XCMA 5LD2B 4Q18A 2G3YA 3DOFA 5KSPA 2KBFA 1NIJA 2P79A 2J87A 1G3UA 3PV0A 4HAVA 4IRUB 2IYLD 2QA5A 2OG2A 4ACAA 4MITA 4CDGA 3QVUA 2CL0X 1K8RA 4BLPA 2JLYA 1Z6TA 2WNIA 1P73A 4XWOA 3U7EB 1B23P 3W5JA 2XTMA 3PUWA 2C9YA 1ND6A 3T5DA 4AC9A 1ZMXA 3IBYA 1VYUA 2EWVA 2WWGA 3DB1A 2PX0A 1XMIA 3ICQB 3MUFA 1AZSC 2Z0MA 3W6NA 3EPJA 3GEHA 3V4FA 1L4YA 4P4UA 2NMVA 1JBKA 2A3RA 4LY6A 1ZU5A 1UDWA 4EAQA 1Q20A 3U61B 3X1YA 3P26A 4IOLA 1HQCA 1RJ9A 3LBHA 4R7ZA 2GVZC 2X2FA 3PUYA 4WZBE 4LHVA 5LDDC 2PJRA 2H92A 1KK2A 4JZKA 2FWRA 5EE0A 4M1YA 1UEIA 3D3QA 1XQ9A 5SZHB 3EARA 3LXRA 1VYTA 4JBYA 1XTKA 4I1UA 4FMCB 4OI0A 3KXLA 3W3AA 2IK8A 3GEIA 2GA8A 4MRSA 2TMKA 4QBIA 3EZ7A 1AKEA 1HEIA 3K8YA 1OSNA 3KJIA 3PVSA 1VG9B 2KI5A 4D0GA 2IXGA 4QGAA 4ZPXA 3LVQE 4E22A 2P6NA 2JLWA 2W2VA 2NO0A 2CCGA 1FP6A 2CMKA 4IDQA 3QF4A 1K6MA 2QL6A 4IW3B 5HZKA 1FBTA 4IEIA 3QENA 2FEOA 3AVOA 1W46A 3QF4B 1E98A 1U8ZA 2C5LA 1RYFA 2GZHA 2AXPA 2WWXA 2Z4SA 3PUXA 3HJGA 1IHPA 4AROA 2AK3A 2IYQA 1M6NA 3QXHA 3VHLB 2CL6X 2A9JA 3QUSA 4IDOA 1XZPA 5GJWC 2GJSA 4JVSB 3P27A 3EC2A 1BS1A 4XJXA 3RS3A 3GLFE 4TYYA 2J1LA 1DKOA 1XEXA 1RYHA 3THWA 1EX7A 2JLXA 4GZMA 3T1TA 5E3HA 4LJ8A 1TQ2A 4O2RA 3O8DA 4KHZA 4RD4A 3RS0A 2J5XA 2P5SA 1MABA 2OCBA 4HLUA 2JASA 4NYIR 4OJKA 1H8ED 2PLFA 1TNDA 4Q9LA 3WMGA 4A15A 2QE7D 4JOBA 1MABB 2QGNA 4AYXA 3FMIA 1RIIA 1QG2A 2YN0A 1XBTA 4O0MA 1FZQA 2JJ1D 3PEYA 2I4IA 1FMJA 4Q1DA 5K8UA 1WA5A 2I1QA 1KYIA 2CJWA 5D3MA 4TT3D 1E0SA 2AWOA 5FL3A 3OI7A 1SXJC 3ADKA 3W5IA 2CJWB 2I3BA 4HI0E 3K53A 4YMVA 4JS0A 2ZR9A 1QWOA 4JLBA 3AVTA 1FUKA 1SK8A 1M8PA 1U0HC 2GHIA 2OLKA 1OB2A 3PGMA 1U94A 3L0IB 2VP6A 2FU5C 2H8KA 3DVLA 4TMKA 4C30A 1SKYE 3NBYC 4ZIRA 1CVIA 4M1KA 4ZIRB 2GJKA 4B3GA 4URWR 1TQDA 4UJ5A 1C80A 3LG2A 1K5DA 2XITA 1GOTA 3BOSA 1K5GA 2V4ZA 1NJFA 3ONWA 4QFMA 1BQ4A 2IHYA 1NMYA 4ZKDA 2WJJA 3LQRA 3A58B 2IW3A 4GOJA 4QJ5A 3GJXC 1G3IA 1XTSA 4NYJQ 3BD9A 2KBEA 3BH0A 4E03A 2IKQA 3GEEA 1KZ7B 4NCHA 3K0AA 3LRPA 5DYIA 1CULC 1KI3A 4C9BA 5K8IA 2IS4A 2HV8A 5B57C 4AKGA 1Z0FA 1ZM3A 3RDPA 4FXPA 1XNJA 3KJHA 4FMDF 1YZTA 3LNTA 1XD9A 3F5FA 2FJUA 2ZJZA 2H18A 3FB4A 3H4MA 4ZO4A 4B33A 1A2BA 1Q1BA 1KNQA 2FFQA 4NPHA 5AUNB 2XX3A 3K70C 1M7HA 4KBGA 2FZ4A 2G1JA 2F1JA 1CJVC 4DBLC 1SHZA 2FG5A 2ZS9A 4RD3A 3TVDA 1NMZA 3FDZA 1P9WA 1DVRA 3EASA 1JALA 2OCAA 4ZV4A 3QKUA 3I8XA 4OQNA 1GKUB 1P61B 1XX6A 4ESVA 2N42A 1WP9A 4AG5A 3AKYA 4J0QA 1XEFA 1LF5A 3PEVA 5A0FA 1NF3A 2R65A 1PJRA 4PR0A 3AGQA 4ARZA 3UXMA 1XPUA 2D4HA 3QI2A 2FPLA 4F93B 4B47A 4IKEA 3HYRA 1AQYA 4EO9A 4JLOA 2ZJ8A 4TQAA 4E07A 2BVNA 5KDDA 4B34A 2HIAA 4PZAA 3U2QA 3KDSE 4XVRA 4EFMA 2ZE5A 1KNXA 2QTFA 2WHXA 2DFNA 2OFXA 2IX3A 2FEMA 5F3WB 1WBDA 1FMLA 1II9A 3IQXA 1G8YA 3U6KA 4JSTA 5H1YA 5CB6A 5KPDA 3IT3A 3CRW1 1HA3A 1Z0KA 2YOHA 2J0QA 4TMWA 4BLSA 3HYTA 1W1WA 4M9XA 2D2FA 4D4MA 4ON9A 4A2WA 1TX4B 4DEYA 3IILA 2G0TA 1OH8A 1AJEA 1XTJA 1VG8A 2XJ4A 5IHPA 3QKSA 4NP6A 2WWYA 4ZI3A 1S1CA 4PHHA 1KSJA 5EE9A 1Q44A 2X19A 1E2JA 3QKSB 3FWYA 2KWIA 1RPZA 2JJ8A 2VHCA 3MWKA 4DRZA 3R8FA 2RB4A 2V3CC 2O8BA 3MG9A 1I2DA 1UAAA 3NG1A 4EPTA 2IA5A 3ND9A 4XTCS 2OILA 5GJCA 3B85A 4JLAA 2NO9A 2O8BB 2ANCA 3C8UA 4BZPA 2DBYA 2RAPA 3KFVA 4L16A 621PA 3CX8A 2IUTA 3CRVA 1JPJA 2P2LA 3I73A 2VA8A 3GCGA 1C81A 2V9PA 2UZIR 5FR2A 5FOTA 1W48A 1LY1A 1LF0A 5JZVA 3B5JA 2YC4C 3B60A 5JJKA 2CDNA 2W58A 2REBA 1R0XA 4Q1CA 4HAXA 1Z0IA 1FTSA 1G6OA 2IHBA 2WWWA 1E2QA 2YINC 5EUMA 1A82A 1KY3A 1T8TA 1JQLB 3EW9A 1JXMA 4ESHA 1E9AA 4II7A 3AF2A 3W90A 1D8TA 4HLDA 2JLRA 4HB2A 3W3ZB 4BLQA 3RRMA 1SXJD 1DE0A 4HDOB 3CNOA 2WIBA 1NLFA 5D3QA 3RSOA 4GMDA 1CP2A 1KK3A 3RS5A 2X77A 4RD0A 3Q7PA 1G18A 1KZGB 2AXNA 4MKGA 4WBSA 1OW3B 5AJWA 1Z63A 1KJWA 4X8HA 4M21A 4NYMR 4P31A 5B64A 3W8RA 1RIFA 2VRWA 2KSQA 2O8DA 4JLMA 1I4DD 2AKAB 2FN4A 3QG5A 2WWHA 4Q1BA 4LPKA 1IN4A 1TADA 2HF9A 5CIQA 1OV4A 1YU9A 3E1SA 4LI0A 4LC1A 2P0EA 3U3OA 1TU4A 2ONJA 5JRZA 2R6CA 2PMDA 1JNYA 5KDOA 3L82B 1HT1E 1GKYA 4KAXA 4ZKEA 2JLQA 1Z08A 2C8VA 1CS4C 1DS6A 3B1WA 4WXPA 3FPAA 4V02A 4XD7A 3SHWA 4K8OA 3QF7A 1E2LA 1U8YA 3ND8A 3ZDQA 3F0TA 5TMPA 2ZROA 1H2EA 1GSIA 2RGGA 3GFTA 1G9XA 5FUVA 3P32A 4PC2A 1CJKC 4JT2A 1J2JA 3EIEA 2GFIA 5A4JA 5CDFA 5JFGA 4YMSA 3IDQA 1G41A 1VPLA 2EU8A 4GBMA 3EPLA 3AH8A 1XXHB 4W9MC 3M0EA 3U60B 1E9RA 1J70A 4DC9A 4G5OA 4TMTA 5CJ2A 2RGDA 5TXGA 4DDUA 1RZ3A 1V5WA 5JEDA 1ND5A 1Z0DA 3QOFA 2A6PA 4BGDA 2WPDA 4KVAA 4B35A 3IQWA 2Q3HA 1E3MA 1TUIA 3PJRA 2QPOA 3R7WA 4UKDA 2R6AA 3AVXA 3TRFA 2K5UA 2QP3A 1DOAA 2P5TB 2P75A 2BBSA 2FNAA 1YR6A 5K8LA 1OH6A 2JEOA 4LYJA 2ZE7A 2FOLA 3HPRA 5C4MA 3KB1A 1YE8A 3LV8A 4CIDA 4OHWA 5TARA 2GAAA 2ZJ2A 2PCLA 4DLXA 2DFTA 3OEHA 2ZRGA 3G5UA 2QSZA 1GWNA 2D3WA 2BEKA 1ETUA 5DI3B 1CRQA 4POAA 2V7QD 1FP7A 3K9LA 1AK2A 3QY0A 4PHGA 4KITB 1XP8A 4MRNA 4HB0A 2YVUA 3SS8A 2BKUA 3EZ9A 2ZPTX 4I4LA 5PGMA 3MWLA 2JDIA 2Z4RA 4V0ME 3RVBA 1OIXA 1DO2A 2WJHA 3QNUA 3NHAA 3DDCA 1FTNA 1YHNA 1E2PA 3LX5A 2ZE8A 4A8JC 2ORWA 2QSYA 3ASZA 3VR6A 3WRXC 4C0AC 3THYA 4DCUA 4ZCIA 2YHSA 4F38A 2JJ2D 1LFDB 5CYPA 1XJCA 4KSBA 2AK2A 1YZNA 4CEJB 3UANA 2XB2A 2Z83A 2RFLA 1P2UA 1OLOA 2V6IA 4Z1MA 4UNQA 2ZRKA 2WJIA 4PPNA 1NJGA 2ZRHA 3RC3A 2WM9B 5DSZA 1S0UA 1Q1ZA 3AEZA 1ZM9A 4IJ6A 1UBEA 4I99A 2D74A 4TN1A 3SR0A 2G88A 2HUPA 4B3FX 1N6KA 2AHOA 3EPKA 1CF4A 1CR0A 4EJSC 2QT1A 5KYKA 4FWTA 1M74A 3EC1A 4QXAA 4EQ6B 1R0ZA 5HKKD 4H1VA 2H0QA 2QEQA 4OL0A 4AIIA 4WAUA 4EKDA 3U7FB 2IL1A 2P6RA 1BYIA 3OIUA 4D82A 5LPNA 1WMSA 3KZ1E 5ELXA 3AVQA 2OE2A 3VFDA 4G5RA 4EPWA 4DWJA 4AURA 1T8PA 1UJCA 5DN6A 4P0TA 4Q1AA 2XTNA 3A4MA 2QP9X 1ZCAA 4ZDKA 1ANKA 4DDWA 1T5LA 1FQKA 1COWD 4NL4H 1ZNWA 2VP5A 5G53C 1EFRA 2IYWA 1OE0A 4RZXA 1Z06A 3OIYA 3B2EA 1G1MA 1KTVA 2GXSA 2HCBA 4DLYA 1P75A 3MMPA 3BE4A 3ZIAD 2EW1A 2YN2A 1IN7A 4GSYA 2C95A 4KFTA 2VBCA 3TAUA 3Q5DA 2DFKB 2AD5A 3E9DA 5G40A 3U3RA 4B3XA 2NPIA 3ECCA 3PQCA 4C7OB 2GK6A 4LYFA 2QAGB 3A1TA 1EX6A 2JLUA 2FGJA 4TYNA 4DSNA 2CE7A 3WMEA 2JIZD 4V0NA 1HTWA 1J8YF 5HR5A 1D9XA 1F5NA 4OBEA 1DADA 3FHOA 2ZI4A 5AR1A 2ZANA 5HPYB 4TSFA 4W5JA 2VPPA 1KDPA 1ZNZA 3WMFA 5C4GB 2ATVA 2OCYC 4MKHA 3SYNA 2ZS8A 1E59A 2ZQ5A 1PLJA 3WRYC 5CIWA 2JATA 1ONBA 4FDUA 2CK3D 3AUXA 4C0BA 3LXXA 1NKTA 1XDBA 5JCZA 3A4LA 4LBZA 4O3MA 3EA0A 5AUPB 5CLLA 4P4SB 3RLFA 4D2IA 4Q4HB 3UG6A 4A92A 3C5CA 1N5LA 4TLAA 1W0JA 4TMZA 2IYUA 4AYWA 3DHWC 4IOKA 1P72A 4NYJR 1NG9A 1DKNA 4MKFA 2BEJA 2BC9A 1DAMA 5FOSA 5KUTA 1JR3E 1XPOA 1XMJA 2QBYA 1OXSC 3LD9A 3BORA 3P4XA 3VNUA 3HU2A 2QBYB 1AZTA 4GZLA 1H8HD 2IC5A 4LJ4A 5LB4A 1IOZA 2R9VA 2ODNA 3NBZC 2RGNC 4KU4A 3PEWA 2GNOA 1JAHA 4JSYA 1DAIA 1Z5ZA 2RCNA 1C7ZA 1S9DA 3SN6A 1G7TA 2A5GA 4LV5B 2ZR7A 3GPLA 1HYQA 4Q4AB 3GLGA 3I3SR 3QXCA 3GP8A 3OE7D 2CHVA 2OFOA 3OAAD 5E7JA 2ZYUX 1KMHB 3BGWA 4TLEA 4ZDWA 4URXR 2RMKA 3BB1A 4URYR 3RRZA 4PXAA 5L3VA 2WV9A 3KKKA 4QIHA 1OHHD 2W0SA 1E9EA 4PO9A 4QGFA 4PPQA 1MRNA 2HXYA 2QI9C 5FFMA 2P65A 2V1XA 4OQLA 3R9XA 4QBGB 4KODA 1IJFA 1ZU4A 4Q21A 4V0OA 1XZQA 3LLUA 4ASUD 3BC1A 4QRHA 3QKRA 3VQTA 2XSZD 5DO9A 3IIKA 3T15A 2FX3A 3TKLA 1RC8A 2A5YB 3UK6A 4A4DA 1QHFA 3H86A 1G20E 2ZJYA 1H2FA 3MFYA 1E1QD 4C4PA 2J41A 3LAWA 4LHYA 3GFOA 5J5CA 2Q0HA 1QVAA 2H5EA 4RKFA 4XIGS 5FUYA 1GNRA 2P30A 4ILEA 2ATXA 5JECA 4L9SA 4E09A 5JI2E 3KKQA 2OESA 3VTKA 4A6PA 5B30A 3C14C 2A5FA 3FYHA 4YDSA 3CO5A 2QE7A 3K0FA 4URZR 1QVRA 2NPFA 4BRUA 2IEZA 4KYUA 3TUZC 1V43A 3VNVA 3K0FB 4HEJA 4PZZA 2IXFA 5EUQB 4TLBA 1QHHA 2FFHA 3BK7A 4NCIA 4YC7A 2ORVA 1TF2A 4DDVA 4QNMA 2C98A 4X8MA 4KFSA 4NONA 3BFXA 3L0PA 2ZI6A 4M4SA 4UNNA 1IY0A 5K8TA 3AKCA 3KJEA 1ZBDA 3O8CA 2D7CA 4JLVA 3PCRB 1N6PA 2GZDA 1B0UA 1ESNA 1KI7A 2C9CA 3H84A 3TVTA 4QKQA 2JLVA 2GF0A 5DH9A 3I5YA 5BWMA 4F91B 3P1JA 4UXJA 1XEWX 3KQHA 1IHUA 1Z2AA 2B92A 4P33A 2R62A 2P6UA 2FGKA 3CZQA 1GRQA 1UPTA 3QKTA 1Z83A 5DYGA 2AFIE 2NZJA 1M2OB 1P62B 1JECA 4IJ5A 2IYTA 2A9KA 3V00A 1VIAA 1Z6GA 4M8NE 5JI3E 4GOXA 1PUIA 2YWHA 2UKDA 2F9MA 2VSXA 4URVR 1Z3IX 2C04A 2E9SA 4M1SA 3B1VA 4PSVA 1N6LA 1N3BA 2HJGA 4Q4JB 4BASA 4LK2A 1N25A 5UKDA 2ZYTX 2HEIA 3NC0C 1E6CA 1GKIA 2BJVA 4JVLA 2BJWA 5LD2C 4PO1A 1EFHA 2Q9AA 5HZHA 3Q3JB 4LJYA 2ZJAA 3CIOA 1U8AA 4QGHA 5FPTA 1GP2A 5BN5A 1QDEA 3OIVA 2HF8A 4NU0A 2OT3B 3K0SA 2HJVA 2GCPA 3CH5A 5J4KA 2YV5A 4IDPA 4Q03A 5FOVA 4R9UC 4BFXA 2BM0A 1MR3F 3HU3A 1FPMA 1MV5A 3TBKA 3Q9LA 2D7DA 1OXVA 2QU8A 4OI4A 3TR0A 3ZVNA 1FX0A 2DPXA 1IJEA 1ZJ6A 2OV2A 2C77A 1MKYA 3QQ5A 5FL7D 2GXAA 3CX7A 1DTSA 3U7GA 4DSOA 1IY2A 5E95A 5CK5A 3O8BA 5BXQC 4Q66C 1HUQA 1S96A 1Y3AA 821PA 3BH6A 3VR1A 3B1ZA 1VCIA 2EWWA 3C5HA 1OFHA 1RJ9B 3QIAA 1FUUA 3K9HA 2XXAA 3SQWA 5JJLA 4MGKR 2FPKA 3F2IA 3D8HA 5BN3A 1G3QA 4L4UA 3L43A 4IFBA 2OZEA 1N2CE 2RGBA 1ZNXA 3KKNA 4Q19A 3T1QA 4BLTA 3U44A 3SC3A 4C0QC 2EYQA 1F60A 2CCJA 2V55B 3WY9A 3LL4A 1U0LA 3Q72A 1X1RA 2RHMA 2PEYA 1U2RA 2GBLC 2ZI5A 4JBWA 1DKLA 1DARA 1SVSA 1DAHA 2R44A 4JKIA 4OYHA 5JSZA 1RPTA 1UJBA 1CTQA 4B2PA 3NBFA 4IXNA 2R6GA 3QEOA 3UMFA 1WF3A 3KFXA 2C78A 5FPKA 1YZUA 1JEDA 2W6ID 4IOJA 1UBGA 1ZYUA 1P60A 2PH1A 4LX0A 1P3JA 1P2VA 2O0JA 4HYYA 2XNSA 4JYCA 1EG7A 4R2IA 4LJ7A 5EZ5A 2BMEA 4Q01A 1Q57A 1XEXB 3THWB 4OQMA 4G5SA 3UKDA 5EP4A 3ZJYA 4ZDIA 2WNHA 3FFAA 4PSKA 5DLQC 1EFUA 2AN9A 1M34E 2GF9A 3CPHA 2AFHE 3ZZTA 2VTKA 2ZVPX 4YQFA 4LJ5A 3X1DA 2OLJA 4HAZA 3C7KA 1XTQA 1N0WA 5FBQB 4BQSA 4KI0A 3WP1B 2CEAA 1N6IA 1D2EA 5D3MB 3R9IA 4OK3A 3P4YA 4AKEA 1V37A 2ONKA 1E99A 4N3NA 3IPXA 2HXSA 2C03A 1NVVQ 3WYAA 1W44A 2G0NA 4UNPA 1IM2A 1G4UR 5EE3A 1GNQA 3U3JA 3HR7A 5TB5A 1GRNA 3I92A 4D6PA 1SXJA 3DCYA 2ENWA 3SE0A 1CJMA 1ZM2A 2P77A 1KI1A 2QP4A 2NOAA 4AWXA 1OKKD 3CF0A 4Y0VA 1SQ5A 4LHWA 3A8TA 4C0HA 1M7BA 2IXEA 2V1UA 2ZRAA 1GAJA 2OWDA 1Q1QA 1OH5A 3NDPA 2F9LA 3PUVA 1G4AE 1SGWA 4FW9A 2MSDB 1PZNA 2VL7A 2WSSD 1SULA 3UWOA 2CBZA 2OXRA 1TU3A 3B9PA 3ZS9A 3EZ2A 1KJZA 3LX8A 4FMDB 4K81B 1KI9A 4TTPA 2B8TA 2W2XA 3V4RA 1CEEA 1TL7C 2W83A 2HPAA 4EUNA 5FTMA 1KO5A 1SKBA 1TF5A 2GEDA 1D2MA 1NRJB 4A0HA 4PAMA 3SJBA 4B48A 3K0AB 4GDFA
chains in the Genus database with same CATH superfamily
2ZKLA 1XU9A 4GIBA 5DNDA 1DEKA 4PFSA 1E4YA 2XUGA 5DGXA 3WLQA 5ALNA 4H1UA 1ZNQO 3MWFA 3LUHA 4RGYA 2A0XA 1BVRA 2Z98A 3CG0A 2G25A 3DHEA 4B3BA 1NVFA 3B6EA 3E9MA 1YQDA 3F3KA 3KYDB 5HKLA 5JHGB 3FLBA 4CKWB 2AKYA 1C50A 2EL7A 4P58A 1VQ1A 3AX6A 2G82A 1M1XB 3PC4A 1LH0A 1C9JA 1QFJA 3RS2A 2X8LA 3DZCA 3U7QA 2WUEA 3ESBA 1NL3A 1Z4QA 1BOOA 2AL7A 3ZZ0A 4UD2A 4EHNA 4R8SA 1KYYA 4F9TA 1CF2O 1IHYA 1GZ6A 1R4AA 2HZ7A 2MSLA 2QW1A 2RJOA 3OVMA 4BB6A 4ESEA 3VNAA 5JSUA 1YMQA 1M5TA 4J0GA 3ZCUA 5A4IS 3FIUA 1P18A 1ACLA 2H9AA 3L5KA 3QK7A 3P9SA 3KTFA 3ROKA 4IDDA 3SJAA 3VJLA 4YDQA 4B3RB 1B43A 4UEKA 3NGXA 5DK6A 2Z6UA 3DO6A 1NVUQ 1DG1G 2JS7A 1RJEA 3ZVNA 1APBA 2F43A 1EIWA 4BS9A 1LB1B 4C6TB 2V59A 3OF5A 5LQMA 3LVRE 4ALMA 2H00A 4YPOA 3GUUA 4US1R 5I7HA 1FDIA 3OA0A 5ERYA 5AOCA 2PA0A 3AM5A 3OECA 3O1IC 3QFCA 4ISBA 4CTJA 3LBNA 4FDMA 3OP4A 5AHOA 2WIAA 3TW4A 5HW0A 2DLCX 4BNNA 2YR0A 3WR5A 1Y6QA 5J40A 2PQ2A 4QATA 4TM7A 1YMUA 2G6BA 5ICEA 5KKAA 3LC7O 4II2A 4MR7A 4V03A 3CEJA 2WTUA 1II0A 1F8UA 1XZ8A 2E4XA 1WSWA 5IW8A 2C4KA 2ADOA 2NO7A 4B75A 5HIAA 1G63A 2IDJA 2P6OA 1A50B 1CC1S 3UXYA 1RADA 2BEWB 2M6RA 4H08A 3MTJA 5DM1A 2UUBB 1QHNA 1R7RA 3EIQA 4OHBA 9ABPA 3KPWA 1Z5PA 4PBSA 5J58A 1VL6A 5LJIA 3OURA 2CVQA 4C3ZA 5AW1A 3ZY2A 3PRYA 2ZYIA 1J99A 3JQAB 2AMJA 3WWZA 4BLRA 5IT5A 1RYZA 3AUYA 1WM1A 2G63A 4BJHB 1W7AA 3KR2A 3B3FA 3ZWBA 3H1EA 3SPXA 3DMNA 3FMFA 4A9AA 3DAYA 3WL7A 3MWEA 4X64B 3CNHA 3PR2B 1RLOA 2QIPA 2XJ9A 3L8MA 3BMOB 2R6R1 2EZUA 4FUQA 3HB7A 3FOEC 4LOAA 4LSMA 5JS8A 3ZGXA 4N65A 1U8XX 3U3XA 1GQQA 3L7BA 3R5XA 3B82A 2QAJA 5IDWA 2L69A 1UT6A 2ZITA 3DVAA 3UOWA 1NKSA 1UMCB 3MUOA 4QEZA 1HURA 2J7PD 4QJ4A 4W8OA 4R05A 4BV2A 3DLPX 2F8TA 3L9XA 3FPKA 5B4UA 5DP2A 1TM2A 2GUGA 5BW6B 2H57A 2XB9A 2Y1WA 1U2GA 3H5VA 4PICA 4JP2A 4Q7KA 3V48A 2OGTA 4N41A 4CEHB 3ER6A 1W49A 4FR0A 3GXBA 1ZN9A 4CCYA 4GMXA 2Q4BA 3T7DA 5U4QA 1UKEA 1H0HA 1G0OA 3HXKA 3RS4A 5CCBA 4RHTA 4Y2VA 4K6MA 1Q12A 1GUAA 1SBTA 5CA1A 2Z9CA 3DDNA 3L6BA 1FFAA 4GWLA 1N1MA 3RJ9A 3GLHA 4FFBB 3SAJA 2QRZA 3BWEA 1NF2A 3JYQA 4N12A 3VNSA 2OCXA 1QH1B 1OU4A 5KVVA 3GLIA 4B6RA 3H87A 4MKZA 4O4JA 2GDJA 4E5NA 3BA6A 3KVNA 2AX4A 1RXSA 5F73A 1W35A 1KQGA 2VLIA 1JHAA 1YR8A 4X5OA 2BI4A 3LZ6A 3CKYA 4L6CA 1T0HB 3DPUA 1H94A 4DY6A 1Q95A 3R9WA 4MNTA 2EZ9A 3ONVA 2JGNA 1FP4A 5TQVA 1GKKA 5FTKA 1GQOA 1XGKA 3WGZA 3WL3A 4FXOA 1B42A 5HKOA 5F1KA 2BFAA 3J80A 2O3JA 3O82A 4QUGA 1JJ7A 3DE7X 3GMSA 1QX4A 5FV4A 2P4UA 1NQUA 4HEQA 5C7OO 3AJDA 5T5QA 4OQXA 1BW9A 3U7IA 5GOTA 1ZP6A 3TEMA 4UEQA 3PQ8A 1E9DA 1DUSA 4NJMB 4P7JA 1TRHA 1QV6A 4IJQA 3DUFA 2A67A 3GFRA 4HZUA 3V46A 4EA9A 2ZK7A 4M9UA 3RYTC 3WL8A 1TECE 3EMVA 3PUKA 1RLMA 1L8XA 1UKYA 1WB6A 2AJDA 3FPSA 3K35A 3LSYA 1A69A 4LFBB 3KEGA 5DX1A 3CN9A 4YRFA 3M5WA 1SVUA 2QZJA 3I32A 4I6JA 1U9IC 2KYRA 3CX3A 2KX7A 3LGAA 1R66A 2OO5C 5JNLA 1CIVA 5CURA 3PDJA 4RNDB 1H2BA 1JLMA 1TLFA 2NG1A 2EJTA 4ERXA 1NF9A 4MVYA 2I7CA 1VSVA 3SYRA 1WXDA 5TT1A 1Z56C 3MJ4A 2CXPA 1GO2A 4PQYA 3R7WB 3IAHA 4QLOA 4XCVA 3RYFB 5AW6A 5K3DA 1QO9A 1UF9A 1RVDA 2O3QA 5JXIA 1WLYA 2VP9A 4ENRA 4N5LA 3IB3A 1ZK2A 3JPWA 3M7IA 3X44A 2NO6A 1YR1A 3AB7A 4PGMA 4UJ3A 2XD9A 1Z26A 1MT0A 4BNDA 1E0KA 3CIFA 3ELBA 1AQLA 4Y2RA 1HR0B 4MYDA 4HQRA 3QI7A 4NKRA 2VXCA 2ZSFA 4RIIA 3V1UA 3KTAA 4QQNA 5JT1A 2PUJA 1IFXA 5BN4A 1T35A 3WIVA 1S7CA 5KTYA 3OQ1A 1O94A 4EELA 1UXGA 3PYXA 3C5EA 3GV0A 3M1LA 4KQIA 2UZ3A 4X6XA 4NNJA 4F6RB 1ZVQA 4D57A 5T8KA 2X13A 1GPDG 3TX6A 1EFCA 2QNBA 2IHNA 5A0TA 3KLNA 2VBFA 3W9YA 1Z7EA 2VP4A 1E1RD 3CRQA 1PR1A 2AWNA 2FA9A 1MZPA 1WMDA 4OLJA 5I6DA 3OO0A 4C4XA 3ZOKA 3BFVA 3HA5A 1MO4A 3THYB 1DOZA 2QD3A 3OFKA 3FPBA 3UW1A 2AD1A 4KGXA 4D4KA 1IN6A 1X7WA 3F96A 1EM8A 1DINA 3K1ZA 2EKBA 4RSMA 5FAXA 4A8JA 3HB1A 3K7EA 3QX3A 3QIVA 4W9NC 5KSZA 3AVWA 4OGFA 2EWMA 2UZAA 4JOQA 5DIFA 4ND8B 4QM7A 4ZRDA 2IGTA 4LVUA 1OFTA 1X80B 2C59A 3B36A 1TZCA 3OY2A 1R5JA 3FUUA 3CLRD 4UPDA 1GVNB 4XASA 2I80A 2C5GA 1A98A 1RJWA 1ZUNA 3GI1A 3TW8A 5A4DA 3ECSA 3IJPA 3T4UA 3TCKA 1P6QA 4PIPA 2XKAA 2PBRA 5FD8A 5T4HA 3GGPA 2B6HA 4ZMRA 1S3SA 1U4SA 2XA9A 4ZQGA 4QD3A 4U2FA 5SYAA 1FU4A 5JZ9A 4JVMA 1NI3A 1CIPA 1U1CA 3RHTA 1AIPA 2OGUA 3P2JA 4WK6A 5KOIA 4MUBA 1S2IA 2HL6A 3OM0A 4AZ0A 1IVNA 4PS1A 2WB2A 1ZK4A 1NIPA 4O1MA 1ISPA 3DBHA 3ZJ4A 1QO0D 2AG0A 2IVZA 2XKJE 2Q46A 4OK6A 3SYLA 2C29D 4TMFA 3FNBA 2ORYA 3V1MA 4CM5A 2FW8A 1XKLA 2JFUA 1RXWA 4JI6B 1B8PA 5HS4A 5AVZA 2VTBA 3I28A 3IBTA 3IR5A 3RVMA 5GINE 1PJZA 2R4QA 4PYQA 1WXHA 4ZOAA 3QJ5A 3JVUA 4MR8B 4Q34A 5KYUA 2BP7B 1DCFA 4LYYA 1UL1X 2WAAA 3RK1A 3WK9A 2QX9A 3ZYZA 2ZB4A 3BHJA 1SCIA 4CHTA 3WHIA 3TGPA 3WZ2A 1A97A 4CL3A 4CIVA 4ZC8A 4R69A 3PFBA 3PD7A 3DC7A 3JWHA 4FOSA 1AV6A 4I4CA 1GG5A 1BJTA 2BFFB 2QXUA 3A0UA 4N6GA 1IOWA 2PS3A 2XMZA 2RJNA 1Q14A 1IXSB 2ZTUA 2ZUBA 5SZKB 3EBLA 1N0VC 3U5ZB 1FRQA 2XF2A 3L06A 3THXB 4CG3A 1KAGA 4HGNA 3PX7A 5JQGA 1EJ2A 3IP6A 4MQFB 421PA 1BFDA 2TMGA 3VUFA 3LH5A 3WNDA 1QFXA 4IIGA 3WLFA 3JSXA 1R74A 4GPEA 4AUMA 3SC2A 2QW0X 3PJFA 4D4JA 4PZDA 4JBNA 3RODA 2QAGC 3IKVA 3MGAA 1VDMA 4G24A 4WBXC 3GEPA 3VZPA 4X91A 5EXSA 1YE5A 3L8YA 4WCFB 2QG9A 2AQHA 3CV3A 3RT7A 4V24A 1CWUA 4Q00A 3AIOA 3INYA 2DQZA 3GEGA 2X7XA 1DI0A 2FW7A 2H5JA 2LVBA 4QU8A 4X92A 4QOSA 1L7VC 3EIHA 4FONA 4EYGA 5EJEA 1L5YA 1C0EA 2YYSA 1PJQA 1QGUB 2OQ2A 4F4CA 1QS0A 1Z28A 4XDYA 1IBSA 2Q41A 2WFZA 1SCAA 1ZY2A 4XD7D 4L0CA 1PLLA 4CW7A 1CQWA 5KHOC 4KQHA 2Z2IA 3PFFA 3QJGA 1A76A 2W2LD 2XRFA 4R5MA 1VPVA 1QVZA 3SCZA 1JVNA 5A0VA 4FQ8A 1DLIA 4CU2A 1OIVA 2ZSAA 3H9BA 2HGZA 1GA6A 4IF6A 3MVEA 5CA0F 3LT5A 3EOAI 3UVEA 3RF7A 1ZJYA 4QM6A 3IERA 1CR4A 3HDTA 4RCYA 1QIFA 4KWIA 3REGA 2WOOA 4CF6A 4F5YA 2HK8A 1S6YA 1PYDA 1E66A 4B0OA 3EGDB 3K0CA 1F5SA 5HCUA 4YJFA 1PFUA 2ZYRA 1T43A 2UZ1A 3OJXA 3VSAA 1PNRA 2AGVA 2R8OA 3N53A 1KC1A 3ADBA 1V16B 2ODEA 1SKAA 1JG7A 3E0QA 4KNVA 4Z0NA 3SK0A 4AZVA 1MW9X 2QRVA 3KKMA 4ZK2A 1CZOA 3I1FA 3DVRX 1KS2A 2AHRA 1PFKA 3HU1A 4R31A 5IF9A 3STYA 1NTRA 1OPXA 1R12A 2P4EA 1E3EA 3DKPA 4MUAA 3AERB 1JLHA 3DMRA 1MA0A 3FX2A 4TUYB 2WP8J 1XF9A 3FAKA 4JXJA 4JHXA 4M7WA 4ZFNA 3QVGB 3NKVA 3AFMA 2GZRA 3DBRA 4TLLB 3R7AA 1XROA 2ZWAA 3H1BA 1XEAA 2BHTA 2XZPA 3C3JA 4G63A 4GRIA 4HFJA 5AXAA 2BHRA 1ENYA 3FCYA 3F8TA 2ATCA 1DAGA 3DKRA 1GUBA 1MJHA 1BDHA 1ECLA 1H4TA 1PK8A 4IQGA 4DOMA 4ZZ0A 1QHEA 4M3NA 4D8VA 3UMSA 1JAYA 3NM5A 1T5TA 5EKTA 3FZYA 4FGKA 3BB4A 1PUXA 4Y6SA 2LBPA 3TDMA 3LKBA 2ZUVA 2KE5A 2W22A 3IDOA 1ZUIA 2XKBA 4PLWA 5AHKA 4BQFA 4FMBB 2A30A 2H1FA 1IOLA 3L6CA 4PX2A 3M8KA 5EIBC 4PAOA 1MX9A 4R01A 5TNXA 3MB5A 1CLUA 1YQXA 4UTNA 5CM8B 4TTSA 2BFCB 2F3SA 2A2ZA 4G89A 1DWPA 3TMKA 1PJ4A 2NX2A 4TWAA 1LI7A 5JVDB 3EAFA 3EF3A 3LHFA 4CQMB 3A6PC 1DJNA 2X0IA 1I51A 4PGGA 5FWDA 3B8EA 3ET5A 4PLYA 4LQLA 2ZBUA 4F1KA 4Z8XA 1QTQA 4YAIA 2OQIA 5AI8A 5KWIA 5DISB 4YP6A 1C1XA 5FWNA 4ZEVA 3SBEA 4J0EA 3NHYA 2UYCA 1R6UA 2ZAGA 5DKFA 5ESRA 2WTEA 4K1LA 1K98A 1DDGA 2DHRA 3FYUC 1VBFA 3AG5A 2QI9F 3G2KA 2VK2A 4GI1A 4YLGA 3RKUA 1Y8AA 4B73A 2D1YA 2MSKA 2BFOA 3DLCA 1AQJA 1T34A 2ERYA 1AO3A 1M7GA 3QQPA 4K9SA 1U7HA 1K7SN 3NW9A 1WZNA 2WZBA 1GYRA 4WIAA 2JJ1A 4O8CA 2HF2A 4J9UE 1VXOA 4BCDA 4FFDA 4Q39A 3F4BA 4K46A 4TT3A 2DF8A 4PPYA 3VI3B 5CP8A 3HBMA 4C7XA 4D9IA 4OHYA 3JTEA 3R74A 1E7YA 1UPFA 1W94A 1RE1A 5DTEA 4EB0A 1JDSA 2FW1A 3FWNA 5CLHA 5EERA 3WGGA 4C0KA 1IZ8A 2VT6A 1CJUC 3N2IA 1IC6A 1YR3A 4HJXA 4WEQA 4UQLA 3NTLA 2C07A 1PEKE 1WQ3A 1WXQA 2GHTA 2WIDA 2Z1DA 3HCEA 3AY6A 4TWRA 5CDTA 4AUKA 1UJNA 1MRSA 3V8NA 4H6VA 2ENUA 2W8ZA 2Y8EA 3BIJA 4LHXA 3RRXA 5EOVA 5JD5A 4CF7A 1T2NA 4RXTA 3TTYA 1UMDA 2AOUB 2YVQA 4KXYA 3TK1A 1BOFA 3T4XA 4RSHA 1KO1A 1COZA 1RW4A 1YKGA 4RU1A 1G8KA 3K2EA 3ZDFA 3PHIA 4MW0A 4DLZA 2AJTA 2MDTA 1QU2A 3ERCA 2XA1A 3A11A 2DUWA 4QSHA 2BIFA 2VHUA 4KN8A 2I6TA 2O19A 1WY7A 4X90A 5G1PA 3HJCA 1BU8A 5IEBA 1T3TA 1C1YA 1E5LA 3BTUA 3ENVA 3GJSA 4ZZ2A 3IQIX 2FZLA 3IGFA 4HEA1 1IPHA 3AEKA 4REOA 4RK7A 5HQJA 3AETB 2DULA 2WM8A 1BE6A 4HHEA 4BLVA 3ZLUA 4XYGA 4KQ9A 3WGHA 1I94B 4PSUA 1RHRA 2O2EA 3A9TA 2ZJ5A 3UN1A 1U4NA 1R6XA 1FFXA 2C82A 3EE6A 3JQ9C 3DKVA 4R2JA 4V0KA 2AZDA 1RZVA 4BU0A 1DIHA 4DCTA 9LDBA 1EPUA 3OD5A 2YW9A 5ALQA 2UYHA 5LYJF 4OKSA 5C5CA 3MJVA 2O7RA 3KR9A 3UAWA 2QZZA 4MLZA 4V38A 1J0DA 4OBBA 1TD9A 1IXZA 1J8DA 3JQBC 1I4LD 3I39X 4L9WA 4Y7DA 3AF3A 4A27A 1JG1A 2PIAA 1Q5PA 2GJ8A 2BZSA 2WSLA 2ZZKA 3AP1A 5AVJA 3DZHA 4HMOA 3TCNA 3THYA 1SVIA 4WLFA 2CE2X 3COPA 1G21E 1GN8A 1RQPA 2YRFA 3KQUA 4AKHA 3Q5GA 1PJCA 4HN2A 4WXYB 4ZEWA 3UQYS 2X4IA 3SICE 1T15A 2DM6A 1SCKA 2OZPA 1D4FA 4A0RA 4ARAA 2BR4A 4E6EA 4G0QA 3T12A 5HM8A 1M73E 2AG1A 4WKOA 5CCEA 5K3FA 1MF7A 4PCAA 1MB0A 1QTRA 1XZBA 1KH2A 3LPNA 1GQSA 4MUMA 3VHXA 3QG1A 2ZXEA 1M2HA 3AF0A 5EGNA 1O2DA 1E2HA 4ITVA 4LG1A 4DLLA 2R1UA 3AJRA 3ICCA 4LQDA 4TZ6A 1PSZA 1EVKA 3H8SA 2XXAB 4UUPA 5JS1A 4DCSA 5B1YA 3QJYA 2WR8A 4ETWA 2HQOA 1Z0UA 2JD0A 4AUEA 3QVVA 4BVJA 3MILA 1NJ1A 3G7NA 1UJ5A 1IUOA 4ZXFA 3GJ0A 5A1TA 3E70C 1RI4A 1OT5A 4YJKA 1DXQA 4ZEXA 3KPJA 4IGAA 3W4KA 2EF1A 2P6MA 3OX4A 5KB3A 1TEZA 3ZDDA 4R1OA 1MFPA 2B1QA 1ZD3A 1X7XA 2ZRNA 4UBLA 4ACBA 1ZDMA 1L5KA 2OV6A 3T94A 2B36A 4R16A 3O9ZA 1XLUA 5IHXA 4L07A 4MUFA 1EKXA 2CYAA 2DZDA 4M1WA 3KD2A 5GV7A 1RNLA 4LJAA 2WAOA 1K2WA 4HDSB 1SCJA 5JSZB 3I6BA 1GCAA 1GUZA 2PZ8A 2R7KA 3EQ9A 4PC3A 3CUYA 2AJLI 2P5YA 4HLQB 4DLSA 3WLKX 3V7YA 2FQQA 2WTBA 2EV9A 2WT9A 4Q3CA 2GBLA 4CM4A 4D92A 2GSDA 3U3KA 3PF8A 2E0IA 3BWMA 2XUJA 4U00A 3ZJUA 4EH1A 1AHHA 5L53A 2A1TR 1G5HA 2ECQA 3ENZA 2FCRA 1YDFA 2OBMA 4FKBA 2VEDA 3NTXA 3HG7A 4U02A 3VKWA 1XF1A 4B46A 2IEGA 1YFJA 4BMCA 2M1ZA 2FH5B 3V42A 5C52B 2OHFA 2QRJA 1QP7A 2XBMA 3OZFA 4P7GA 5HF8A 1W47A 2ZT8A 3RHFA 3PNMA 4FC7A 4Q5IA 4YAJA 1QB7A 5HOQA 2CXXA 2HU2A 3UW3A 2Z57A 1A04A 1USVA 3BXHA 4R1UA 4FZRA 3SQDA 2AOTB 4HAOA 3FDJA 3EZFA 5BVGB 1DJOA 2FVYA 1WQ1R 4EENA 5GVRA 5FBLB 3I2HA 4KYIB 1T3GA 2JH3A 1USGA 5LXTB 2J0SA 2GCGA 4TZKA 3QLEA 1V8PA 1JAZA 3D2LA 3GLHE 3NBMA 5HBRA 1JEYA 4KQGA 1Z2DA 1KOLA 4M2LA 4MYSA 3HKCB 1HNWB 4D56A 2VVTA 5KSOA 1PR2A 1XVAA 3WL4A 3GLIE 4JXXA 2CLFB 2BBWA 3AZPA 5FO1A 2PUGA 3KAPA 4IO1A 4R4JA 1Z2CA 1GPNA 1CRLA 5C1OA 2IE0A 2H06A 1L3CA 1GG8A 3PDIB 4B79A 3C16C 4J7CA 4OYLA 2FDXA 2OM6A 3GA0A 3G0OA 3A0RB 4TVBA 4F93B 5IT9A 2CUTA 4M87A 1Z82A 1QYXA 3AHFA 3UV7A 3O84A 1Z29A 1OTYA 5BVHA 4AMGA 1J0XO 4GGMX 4OGWA 4PHFA 1O4VA 4AJHA 5DOZA 4IFIA 3FR8A 2QRMA 1SC9A 3DAFA 4FOLA 4WGGA 1UFVA 4BMNA 1E2EA 5C5DA 5EXXA 5TVGA 1FYFA 3HDVA 5CXXA 3CQ9A 1LRKA 1BCRB 1ZGBA 4CV2A 5IBCA 4BMSA 1F14A 1Z47A 4ICIA 4IJMA 3WLAA 5AW5A 2XZLA 1Y5MA 2BMDA 4DT1B 4MYHA 1W85A 1EXDA 2I5PO 3SE7A 5HQ3A 3T7CA 4EHJA 1HC7A 3CNNA 3SFTA 1EK0A 2VDQB 3HVHA 2PUWA 5GAJA 1FS4A 2ZTVA 2C7BA 5ALVA 1YI1A 5DCYA 5JASA 1MOQA 4G9BA 2I6SA 1XVUA 5I4IA 5EIEA 4F9EA 3VMMA 3MLEA 3O8QB 4LWQA 1VBKA 1ZCBA 2B35A 3O8OB 4WXMA 1EI9A 4DVGA 5JRJA 3QEJA 4JL5A 3LT4A 3KZOA 1P7YA 3Q8WA 5GZ6A 4RPCA 4KXLA 2IIPA 3SYKA 4TTAA 5K5EA 2ES4A 3QYJA 4LF5B 2A0YA 2LD4A 3JCZA 2X1MA 1SCQA 1FLNA 1BWQA 1PP4A 4U2BA 1OR8A 4AF8A 3GLRA 3OEYA 2O8CA 2XMCA 4HB4A 4LDAA 2LDBA 4CDMA 4NJEA 1E63A 3RSHA 2C0PA 5JG7A 4XFKA 1F48A 2EOAA 1QG4A 3HDGA 3R77A 2J59A 1G98A 1E3LA 1PQYA 2VDNB 3VAYA 2FPGA 2NUPB 4F7DA 2HUNA 4FE3A 3PNQA 2Z95A 3AVUA 2ZIAA 3FBTA 1XTIA 4DBVO 3USZA 1SCNE 2FEKA 3INGA 3N8HA 4MIOA 3UV3A 5JCJA 1F20A 3CINA 1AVTA 1NUAA 1TEVA 3N2NA 2PWBA 4RZSA 1ZIDA 3PXBA 4NCNA 4REQA 1BD4A 4MV6A 2G36A 4B4OA 1TGYA 2ZOSA 3ADCA 4TYMA 1NLMA 4PONA 2XDYA 2BM9A 5DSTA 4AT1A 1BXRA 2PGAA 4Z4CA 3W2TA 3E4CA 4JXZA 4NK5A 2FZVA 2P9BA 2C83A 5GOZA 1SVNA 2PMBA 3BSSA 1WOYA 1HDEA 3SS9X 1Q7BA 2J0UB 3NPMA 1E9VA 3PVZA 5FOXA 1QM5A 1WZCA 3INTA 1J20A 1C4OA 1CFJA 4N39A 4AAYA 5CYGA 3BXOA 3WADA 4OHFA 1M2EA 3W34A 5JMWA 5LBUA 1SHKA 4V0QA 5FBKA 2D5BA 2VAVA 2H8GA 2QRNA 2W4QA 2B5OA 1KP2A 4BEVA 1KDRA 4TTTS 3LLSA 4RIGA 2BMJA 4KO2S 3U1TA 5HGXA 2CMGA 1TAQA 4BGVA 4UOZA 2XB4A 1ADFA 1IK4A 1L5HB 2GPYA 3UMRA 5JMOA 4W9RA 4UNRA 4R2HA 2BEVA 1D09A 3ZUGA 2JCSA 2V65A 3WYBA 1H3NA 1ES9A 1YQEA 3ZHXA 3D7RA 5EJ8A 4X7PA 1FDUA 2V74B 1BKSB 1DBSA 3SEZA 3I5XA 3I9OA 2QDXA 4OJYA 2NAFA 4WNCA 4LKRA 1F12A 1YL7A 2JI4A 1OWMA 2ZXFA 4HGOA 3NALA 5CT8A 1D5CA 1J5EB 2CDAA 3I9JA 1WABA 4JQZA 5EWJA 1LBSA 2WWIA 4FYXA 4RJLA 3RAEC 4URFA 1LWOA 4Q3KA 4ZC1A 3DF7A 4R40A 5FI5A 1VPWA 3KELA 1XMSA 1U6JA 4ND2A 3MB8A 2RH4A 4LYHA 1M34A 2H59A 2OAP1 3LSTA 1P1HA 1RM4A 3PF9A 3QPWA 3KZKA 4IDFA 2JJYA 1VE6A 4EPWA 4Y8VA 4F12A 3ZCRA 4KXMA 2C7VA 1XD2B 3J7TA 2ARKA 4MVXA 4B17A 5AVUA 1R4ZA 1ZR2A 4HATA 1H2HA 3TZ6A 2R2AA 5B6JA 4J75A 2BGTA 2X6QA 4MUGA 7AT1A 3CRMA 2XMBA 4CGZA 1GZ3A 4HYTA 1TKRA 4K9LA 1XVLA 1RHUA 3RUCA 2X0NA 5K3FB 2R11A 1MG0A 1O6ZA 1RI1A 1KIFA 1CU1A 3DR3A 4HX2A 3NCHA 5F2NA 3SEQA 4LCBA 1Z6YA 4RVUA 3K8OE 4BKPA 4ZCMA 1XYGA 2WVJA 1PRYA 3G7UA 1RWXA 1REQB 4JYBA 2CMFA 2QMHA 1C3VA 1K1EA 2ZRPA 3T5CA 3TG2A 4BZQA 4KR3A 3ORYA 2RKWA 4A2PA 3A4NA 1L7XA 4CE6A 1YZFA 4MWCA 3AF5A 3VYSB 2XAAA 1OUMA 4JBIA 4UDOA 5K3OA 3KZVA 3RC8A 1GTVA 4IEEA 3CJTA 2PSEA 2J5RA 4RKRA 2C57A 1GM5A 3CEPB 1RR6A 3DDUA 3IAUA 2GEJA 4U9HS 3E9RA 2EJVA 1NN1A 4NMWA 4QTZA 1YDEA 2B83A 3CWQA 1IAQA 1CUZA 4Z0TA 1R8QA 4KE6A 4TGLA 2XVXA 1XAIA 3R44A 4RD1A 4UZFA 1SURA 1H2RS 1U1IA 2AMFA 3ABIA 5D5PA 1CP3A 5DB4A 5IAJA 4DLPA 4A36A 4LBWA 4FE4A 1I1OA 3JSAA 2O8EB 1PHPA 3EDOA 1LZLA 3U4HA 1U9IA 1QK3A 2OO5A 1XXHA 2PYZA 4YP0A 3RABA 3FRJA 5IZ4A 5JZMA 1EGAA 3PR1A 3NC1C 1N5KA 4QOGA 1KIMA 2FR0A 2BMVA 2YUIA 2J6IA 3NIBA 3HI4A 4FGUA 1Y7HA 5H4HA 1AOXA 1J24A 1JF8A 1W5TA 3AVPA 4PWYA 3NHWA 4YT2A 1QF7A 1NN3A 3R6GA 1NNEA 1SUEA 4A1FA 1U7WA 5AJXA 1BMQA 1WOMA 3MTBA 2NUTA 2PUVA 3TLJA 3ZDCA 1E2BA 2VUSA 1ZITA 3H1TA 1KJYA 3SDBA 4F21A 3GFGA 1R5OA 1SQFA 1IXKA 1MC8A 1BWRA 3DB2A 4BJ1A 3LC1O 4RZHA 1DG3A 2HMYB 1ZIPA 2FWNA 1NW8A 1OFVA 1RI2A 1ADYA 1GPUA 4C0SA 2JAHA 5L7YA 5AVWA 3DTNA 2HIMA 1SU7A 3P2EA 3DFZA 1FIUA 3KYCB 1GL9B 3FY4A 3T4PA 4CL0A 3HLYA 2ZUCA 4TZTA 4OBXA 4JGGA 3VDNB 3L77A 2Q29A 4MA4A 1Y8QA 4AYTA 1YOBA 4I14A 3TSOA 4E5KA 5EZYB 4NCBA 1EBBA 4IJKA 4RJKA 3GDWA 3JQ6A 3K6SA 4QHTA 3F8WA 3IVXA 2I1VB 2HFKA 3A9SA 1CQIB 1UFQA 4JI5B 1OMOA 4F3KA 3D7MA 3D4IA 1M1ZA 1NSTA 4H0CA 5JD3A 3PSHA 2Z2YA 5BPHA 3E5RA 5CM9C 3X1WA 4OM8A 2GPWA 3JAKA 3L7JA 3VZSA 6AT1A 1Z16A 2V9CA 4OH1A 2XNCA 2ZATA 4I1YA 2WJVA 3GPIA 3N3AC 3K1YA 1PL0A 4FFOA 5A4KA 4QQRA 3DBLB 4CEJA 1AXRA 2ACWA 4JOCA 2GCIA 4UASA 4W9NA 2JGIA 1NN5A 2OZLA 3VPHA 4ERNA 1CB7A 1NVEA 1X8LA 3LYAA 4HUQB 4BVFA 3FVQA 3OQNA 3IP3A 1SUFA 4LXXA 5IN4A 2HOQA 2BGNA 3EMBA 5K03A 3BXFA 2V45A 5AT1A 4KW7A 4GI7A 4DUPA 4JBHA 2Z4TA 3REQB 2CLSA 3VO2A 5LLTA 1K6EA 4CYMA 4JGIA 1HDIA 5P21A 4NG5A 2C4WA 3T1OA 1E6EA 4A6XA 4JVNA 3VOTA 3A6DA 1LZKA 3EZYA 3QV2A 3S2YA 3AEQB 1X7ZA 5AI6A 1C9YA 1TF7A 1UPCA 2Z3WA 4MRMB 3BGVA 4E4TA 3GDFA 6ADHA 5LOVA 1MOZA 2ODQA 2O59A 5E4YA 1FW8A 1QH9A 2ZJ6A 1TYZA 5DLEA 4Z9XA 5TC4A 2JRLA 2ZBVA 1CBUA 2WY2D 3SVTA 4MLDA 1DKQA 2QD4A 2V5VA 4F06A 4Z4EA 1EDEA 4IFTA 1RQLA 4GNRA 2DBQA 2ZUTA 3FHCB 3RWMB 2BWJA 3HPQA 1WUTA 3ZK9A 1D6SA 3KR1A 2FJ0A 3ABRB 2BEUB 4WKNA 4I46A 2ZJ4A 3GC6A 5CJPA 3WRWA 3IP7A 3LPCA 2VPIA 4AY2A 5JNTA 2EQBA 1K6IA 2QJOA 2D3TA 3HY4A 3H75A 2PGOA 1J09A 3LFHA 3THOA 3ZE7A 1JIQA 4L4RA 3WDMA 2GR9A 3IOYA 1RFLA 5JYCA 1IEWA 2I6UA 4MKIA 4J1SA 4O4LB 5IAEA 4DSAA 4D79A 1VBNA 1E9BA 1XI2A 3JAWB 2OL4A 5BUCA 1EWYA 2J09A 3KTOA 4Q3OA 2QAGA 2RAFA 1TAHA 4MP3A 3RFVA 2IYRA 3K5HA 4PG4A 1NUSA 5I4BA 4HDRB 4Y1GA 3UMGA 1ZC4A 3ZNOA 1P1FA 3QXXA 4RC9A 2OTCA 4BFVA 4GM0A 4LJLA 4D98A 1P5ZB 3NT2A 3TB6A 3GGOA 5KYGA 3F3YA 3V2UA 1NN0A 4IO0A 2WF5A 2QSJA 1ZLXA 3OZTA 1AMNA 3R6LA 4IHJB 4ODIA 2I0FA 2VYNA 3GNLA 3QU4A 4PG5A 1H6BA 5AK0A 4QFDA 3AHIA 2ZIXB 3RUDA 1J21A 4IAOA 2A35A 2RKOA 3JQPA 3O0DA 5K45A 3Q7QA 4LE1A 1VCHA 3KWJA 5CB4F 3CWCA 1GN9A 3KWMA 4WNAB 2BGJA 3O74A 4Y9SA 5LYYA 1QONA 1HYBA 2NVUA 2WPDD 1I9CA 2GCOB 2PD6A 3ETCA 4J43A 3LOQA 2QQFA 3B1XA 3ZD7A 4EW3A 3P0HA 1C3JA 3UJPA 1JZQA 4M0KA 4EGSA 1UIMA 3O9VA 4FZ5A 3JWPA 3U62A 4ATNA 1SHLA 4RIEA 4EITA 2W6QA 3IAEA 1MIHA 5U9CA 1AMOA 3BWVA 2CNBA 2ST1A 2W11A 1CRPA 1VLVA 3IUMA 4DLTA 4UTXA 5KO2A 1OLXB 1RMQA 1JAIA 2VSFA 4RFVA 4RJ2A 5CYOA 4PHTA 2JEZA 4Q7MB 3SY8A 3HJUA 3DEYX 3OEHD 4ZZ1A 3NH6A 1R10A 3KE8A 1JSCA 2HWXA 3GLVA 1HRDA 4EFLA 1E2FA 3IUYA 1IBRA 3FTFA 5DM2A 2JGEA 1L5NA 2WM3A 2DWCA 1Y5LA 3H7IA 4YAOA 4UAVA 1UT8A 4UOEA 1VSTA 1O94D 5JHHB 2GK7A 3ISJA 4U7WA 2RGEA 4YMGA 2FN3A 2JDID 3WB2A 2YMMA 1MPXA 4GOKA 3OEWA 3E7WA 4AS1A 3VAAA 1AUOA 1NVMB 2PSJA 3LW7A 2ZUDA 2OBLA 1ATIA 1S89A 5K20A 4DB4A 2LR0A 4J3JA 4MRRA 1TB4A 3MXTA 5CAEA 3T99A 3FDIA 3T7IA 3NATA 3EWNA 3NV9A 4UXIA 3NVDA 2XUHA 1BHQ1 3DNPA 3ZWAA 2RH5A 1NMEA 3F97A 1RXYA 1A9YA 1Z4JA 2ZSKA 4CCSA 5DYYA 5FUQA 3H0KA 5HX7A 4S1TA 1FYVA 2CWDA 2QY6A 4N76A 2PUBA 1XQYA 2QMEA 3HB9A 2VCHA 1RKVA 1HQDA 2WJWA 3DZGA 3V4SA 3T7EA 1RCUA 2X8AA 3KUDA 5KTPA 3ZUPA 4HWGA 1I0ZA 4HUTA 3KEMA 4OA5A 5A5GA 2DEUA 1A88A 4MV9A 3ANLA 4GVXA 3UNXA 2OYSA 2RAVA 1NURA 3GRUA 4PSAA 1W5EA 4Q9AA 4WY8A 4L73A 2ZYDA 1U3UA 1DV1A 2A0WA 3DVSX 3GJ6A 5BN1A 3FYUA 1XZMA 1D1TA 1FSSA 2B8JA 3HFSA 3QU5A 2DFVA 5H68A 3VNQA 3AQ4A 3TLEA 2GWHA 1K3FA 5JSKA 3R8XA 3SXJA 5CEFA 2GAOA 2C88A 2ZRLA 2HA5A 3MF4A 3O91A 3ZVMA 4GKJB 1N2HA