5AJYA

Human pfkfb3 in complex with an indole inhibitor 4
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
444
structure length
439
Chain Sequence
PLELTQSRVQKIWVPVDHRPSLPRSCNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQPLDPDKCDRDLSLIKVIDVGRRFLVNRVQDHIQSRIVYYLMNIHVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQLKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTGESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVCTHRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-BISPHOSPHATASE 3
publication title Structure-Based Design of Potent and Selective Inhibitors of the Metabolic Kinase Pfkfb3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 157
structure length 439
sequence length 444
ec nomenclature ec 2.7.1.105: 6-phosphofructo-2-kinase.
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
A PF01591 6PF2K 6-phosphofructo-2-kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ajyA01
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 5ajyA02
1A2KC 4NCKA 3U61B 2IEYA 2PX0A 1UM8A 1MOZA 3A1UA 2J3EA 4MKIA 3H1TA 2Q9BA 5DH9A 5CDFE 2JLZA 3E5HA 2CJWB 3LX8A 4C0LA 1DAGA 4QM7A 2VHCA 3KUCA 3QPUA 3RHFA 1OFTA 5UKDA 1XEWY 4EPYA 1W1WA 3CRVA 2P3SA 2BBSA 1TEVA 3BC1A 3Q9LA 2VRWA 3KTAA 1Q22A 4LV6A 2C2HA 4M0LA 4UNPA 3WP1B 1IY1A 1YRBA 1HUQA 3CNOA 3Q7QA 1PV4A 3REGA 5EE9A 2R9VA 5EP3A 1N5JA 3FB4A 4WAUA 1W36D 1TL7C 4JLBA 2NIPA 2CLSA 2DFLA 4LY6A 4U5XA 1JR6A 2QMUA 2W0MA 2V3CC 3NG1A 3AVOA 3JVVA 1M7GA 1ZRHA 2OCAA 1GAJA 1NLYA 1V7QA 2QAJA 2A5JA 3ZIAD 4DUGA 2P9ZA 1E98A 5JWOA 2WWXA 1UADA 3D3QA 4Q66C 4GRAA 2BBTA 4HAZA 1GRRA 3J81k 1MKYA 3MD0A 1OH6A 1GKYA 2VPPA 1KZGB 4I1UA 1NN1A 4NYJQ 4JODA 1BS1A 3IO5A 5AK0A 5FPHA 1XMSA 2JLUA 3U4QB 4WOPA 4FWTA 3SQWA 4G5QA 2QI9C 2JLSA 4OQXA 3SI7A 3KKNA 2OILA 2P6UA 3DVLA 1D8TA 1KI1A 1N6RA 1TNDA 4FMCB 4HZIA 3SZRA 3B9PA 1G8FA 1E4VA 4OJQA 3I3SR 2UZIR 3TAUA 3L8YA 3WXMA 5JWHA 3D8BA 4HLDA 1WBBA 2FFAA 1PZNA 1A2BA 1MT0A 1TQ4A 5B58C 2P6OA 5H70A 1VCIA 3EPLA 2J9RA 1NKTA 4XVQA 3EZNA 2YZ2A 2BIFA 2ZVQX 3AKEA 3K09A 2ZU0C 3EAQA 3CONA 1LS1A 1KK1A 4C2TA 1M2OB 4JL5A 1S8FA 1N6NA 1IXSB 4MQBA 2GESA 4PZLA 4WA7A 2GXUA 1UBGA 2QNRA 2ATXA 1P72A 1R7RA 2BOVA 3SOPA 3UMRA 4DCNA 2P2ZA 1AQUA 1EFRA 4XD7A 5FL7D 3OIVA 2IXGA 1I4DD 2NQ2C 1GTVA 3QI2A 3NBFA 5FR2A 2GAOA 4BZPA 5AUPB 3MG9A 2ZI9A 2VIIA 3FJYA 3LW8A 3IUYA 4D4KA 2FOLA 3WHKA 2D74A 2CLCX 4Q19A 2QP3A 3FTQA 2J46A 2WAYA 1E94E 3MWJA 3U44B 2W2XA 3QIAA 1NBMD 2Z4RA 4QNMA 4MKHA 5FOSA 4L5BA 1JEEA 3VR3A 5K8TA 2O8CB 1CR2A 2XZPA 3FGNA 4LV8B 4ITRC 2F9LA 3B6EA 5HPYB 1PLLA 2JCSA 1CJMA 2RHDA 3ETLA 2BEJA 2VBCA 2F43A 4DLTA 3K0EA 2O0JA 1GIAA 1V37A 4EJSB 4Q7JB 3IHWA 5LD2B 4WBSA 4QNRA 2Q3HA 1WP9A 4YMWA 1KJZA 3I72A 1COWA 1KGDA 2RGXA 1B0UA 2GCNA 3BH7A 4V0OA 2X1VA 3C7KA 4MRSA 3I5XA 4CIDA 3NBZC 1G8PA 4FCWA 2VP2A 5L3RA 1KO7A 4XH9B 5DNYB 4US1R 4W5HA 3GJ4A 3I5YA 4OK3A 2GEDA 3RRNA 4EFMA 1E2MA 1X1SA 1QHNA 3PQCA 3U3RA 4H1UA 2IYLD 4QBGB 4C4PA 1LW7A 1FW6A 4HB4A 4B76A 2BKUA 1MR3F 2ZQ5A 3NC0C 3HJGA 3LNTA 5HE8A 1CXZA 1AKYA 2BC9A 4TYNA 3AVQA 1FFHA 2A6PA 3T1TA 1C4OA 3ZZUA 4EPWA 1KI2A 3AH8A 3VAAA 1CJTC 4XTRA 3AF0A 3VU9A 2YINC 1G3RA 2P67A 4TSFA 3K09C 3AF4A 2C77A 1SHKA 2O5VA 1QHXA 4QL3A 3K0FB 1G7CA 4B73A 2O8BB 1L4UA 1Z6TA 2FPKA 4A8JB 1WDTA 4MRPA 1ELOA 1S9DA 2BMDA 3UIEA 1UBCA 1T5LA 4LV5B 2VYFA 2YOHA 1BMFD 5KUTA 3KFVA 1JJVA 2VHJA 1DO0A 2GCPA 1QHYA 3TBKA 3HR7A 1TAGA 4PR0A 4JLNA 3IT0A 1KSJA 1KHTA 1F6BA 2VHQA 4HBZA 4Q4AB 2OWDA 1G5RA 2JIZD 2WBLC 5A4JA 3N70A 1T91A 3I73A 3R9IA 2QSYA 1P9WA 2SHKA 5CITA 3B1XA 1HURA 1KI4A 4B33A 4XSGA 4CGZA 1KI6A 1G3UA 2JGNA 4B2LA 1LS6A 1ZNYA 1XD9A 1SK9A 4Z1MD 3TIFA 4UXHA 1AGPA 5DN6A 3O8CA 1U98A 3AKYA 3L0SA 1ND6A 4LCBA 4IJ5A 2XEXA 3DOEA 1OXUA 1GITA 1DOAA 1EXMA 2C9YA 1MO6A 2PA0A 2O8FB 4IFBA 2JDID 1OXVA 2V1XA 2RGDA 4C0AC 1W36B 4L4UA 2O8DB 1VCOA 3OIYA 4A0GA 1XBTA 3UKDA 3EASA 2QGNA 1TF7A 2CVHA 4LHXA 4WXPA 2Q3FA 1SXJA 3AVPA 1C80A 4KFRA 1ZW6A 2IXFA 5KU1A 3HU3A 2BM0A 2CL6X 5K8LA 2BBOA 3QJYA 4NYIR 3AQ4A 4AYXA 2C04A 4QBIA 1E2QA 1WE2A 3H4MA 3T1OA 1CTQA 2PEYA 3VR6A 4ZV4A 1KJWA 4IHQA 3AVWA 5TB5A 2DBYA 1OV4A 1ZD1A 4JOBA 1VDZA 2OT3B 2D7DA 1Q44A 2RGNA 2JJ2D 4V0KA 5KYKA 1EGAA 1OFUX 2DPXA 3IEUA 4P32A 2GJAA 1IY2A 2WVJA 3VFDA 2YWEA 3F5FA 4DZZA 2R8RA 1WRBA 2J45A 1GM5A 1XEXB 1WQ1R 3K0AA 1Z63A 5GVSA 4JLMA 4IEEA 2Z43A 2DCUA 4NCHA 3TGPA 2KSQA 2CXXA 5FTMA 5PGMA 3P32A 4EKDA 5L8VA 2FFBA 1Z28A 4HAUA 1ESNA 3RC3A 3CW2A 3KQHA 1ZU4A 3QXJA 4EPVA 4TQ9A 2JLVA 1ONBA 1OXTA 3X1DA 4N0DA 1KY3A 3EG5A 3C4JA 3KFXA 1OHHD 4HB0A 4O3MA 4P4SB 5IHPA 1Z22A 4BFSA 2HYDA 3HDTA 2Q9AA 3W3ZB 4DVGA 1GP2A 1TTTA 1N25A 4F4IA 3ADBA 1QHHA 3AVUA 1II9A 2ONKA 3ZYCA 3UWOA 1XWIA 1FZQA 2BCGY 2OAQ1 2WSMA 3KXLA 4LJ7A 1FX0B 3B1VA 3TRFA 3TUJC 3CUEF 3IIJA 5BN4A 2GCOB 1GSIA 2C78A 1MO4A 2G0TA 4Q7KA 2RHMA 3CX7A 1S2MA 4MUBA 2QP9X 4MRVA 2WTUA 1J2JA 4GDFA 3CPHA 4RD0A 3THXB 3NEYA 3ZJYA 4RY2A 4TMTA 1FBTA 1E9SA 2ZR7A 1W2HA 2WNHA 5M04A 2ZS9A 5EE0A 4EAQA 1TX4B 1S9HA 1UBFA 2BJVA 1XQ9A 3CPJB 1EK0A 3KKKA 1GNPA 1UKYA 3DZDA 2QMEA 1KNXA 2GVDC 4JS0A 1JXOA 4DWJA 3KZ1E 2FFQA 3PEUA 4DLZA 1NIPA 5JCZA 3DPUA 2QORA 3ASYA 4QM6A 3SNHA 2F1HA 4BFTA 2P5TB 2IEZA 2NG1A 5C18A 1MV5A 2V1UA 4GPZA 1E2HA 2O8EA 2CEAA 1HE1C 4KVGA 4C0HA 4M2LA 2EFCB 3CRRA 3QQ5A 4ARZA 4JL8A 4D4MA 2FPLA 3ZVRA 4DSOA 2CL7X 2WMOB 1Q20A 2G0NA 2AFIE 3RVBA 4PHHA 1DG3A 5C4MA 1L2TA 1W0KD 3IT2A 3C16C 3RANA 4GPIB 1C7ZA 1E9BA 1TUEA 1T3SA 3AVVA 2AD5A 3SJCA 1X8LA 1N6HA 1Z07A 1KJYA 1CJKC 2ZRNA 3EA5A 1US8B 4R2HA 4CVNA 1ETUA 5JSZB 2JLYA 2Y8EA 1OH5A 4DLVA 4NCIA 4BZQA 4QGAA 1EFHA 1FTSA 1HEIA 4Z8YA 3WP0A 3DM5A 2WM9B 3CF0A 4Q1BA 1U9IA 1DVRA 2WJJA 4IFEA 121PA 4LYAA 5EE3A 4IXMA 5L3SB 2EOAA 1Q12A 2O0HA 5DYIA 1FPMA 1Z08A 1ZM3A 2KI5A 4BPBA 4IOMA 1UFQA 2O52A 4HAVA 4DDVA 2ZI7A 4GT1A 4RJLA 4BE7B 1XPOA 1XEWX 4W5WA 1KO1A 4OQNA 3EPHA 4BRUA 4N3NA 4OK5A 2YC2C 4PHGA 1G4AE 1DEKA 5KNDA 1G16A 1H65A 1NMXA 4A15A 4RZXA 1P2UA 4PPGA 2V6JA 3PV0A 2CL0X 1DAFA 2QL6A 1G20E 3U3KA 3OFND 2XB2A 2FJUA 1CULC 4DSTA 3ADCA 5TMPA 2H4ZA 2RKOA 3U7HB 4GZLA 5CIWA 4E09A 2FA9A 3K9LA 1XXHA 4IDHA 4WVFA 1IJFA 4URYR 2QNIA 5L3VA 5KDLA 1N2CE 2NO7A 2ZITA 3KJIA 2ZAOA 3WMGA 4AURA 4GOKA 5F3WB 4MYTA 1XD2B 4TT3A 2HYIC 2IHBA 3A4MA 4JSYA 2D3WA 2R6AA 3CRW1 4UQOA 4IEIA 3QKRB 1E4YA 3GEEA 3LXRA 3AV0B 5IDVA 4KAXA 2VLIA 3W5JA 1YJXA 4PC1A 2GKSA 4IXNA 2ZANA 2ZJ2A 2XJ4A 1W47A 3EZ2A 1P61B 4B6FA 3SBEA 4CEIB 3QXXA 5TXGA 2EKZA 1VYTA 2OCYC 2ZIAA 3QNUA 3T15A 2HUPA 4V02A 5KNCA 3I1FA 4RKFA 3GP5A 4A92A 4OJKA 3AVXA 2F90A 3QKUA 4IOLA 4FN5A 1N6LA 2PZEA 1DKNA 5FUXA 3CF6R 4B32A 3NDBB 3P26A 3CNNA 1VIAA 2CHVA 3UG7A 4EIWA 1W0JA 2GEVA 2R2AA 4A2PA 4FMCF 1NSFA 5J4LA 4F4JA 3AM1A 4B34A 2ZETA 4MH0R 2IYYA 3DB1A 5JEDA 2F3RA 2J7KA 3DM9B 3Q7PA 4YONB 2IS6A 1W49A 4KFSA 2ZSFA 4TL7A 4LJAA 2PLRA 2WSSA 1XMVA 1Z0AA 2RGAA 4EQ6A 4QJ4A 4RZ2A 1DPFA 1G7RA 5CDHA 2CHGA 1HV8A 2R62A 5E7IA 5B30A 3EA0A 3GCGA 1U9IC 1GL6A 5FOXA 1OE0A 2AWOA 2OESA 4YXWD 1D5CA 2J41A 2W00A 2CVFA 3RS5A 3TUIC 2CE7A 3F8TA 5JS7A 4EPTA 4ZKEA 3GJ3A 2BCJQ 2WWFA 3QKTA 4KYIB 2ZEJA 1F60A 3PGMA 1JNYA 2ZS8A 2EW1A 2OBNA 2R6CA 3AF2A 2WKQA 2REOA 2DWPA 3P4YA 5E95A 2HDNB 4D0LB 2PZGA 3F3YA 1CR0A 4DKXA 4GOJA 4ZDIA 1W2GA 2H1LA 1JI0A 2ZE7A 2GK7A 3W6PA 3CX8A 4BECA 3TSOA 4DSNA 1Q21A 1Z6YA 1TF2A 1E2IA 2D2FA 4MRRA 1X6VA 4OHZA 4FDUA 1E2KA 3HWSA 4BLTA 1E3MA 1F2TB 4L8GA 4NPHA 1SQ5A 4F7WA 3LQRA 5EXPA 3HU2A 3I61A 3U6BA 2OAP1 2TMKA 4B48A 1KDOA 1OB5A 1P2SA 1G8GA 3PXGA 3BIFA 3MJHA 4DXAA 3A58B 2YHSA 1GUAA 2FGJA 5C1BA 1AS0A 5FOVA 1ZIOA 3BE4A 1SVSA 2QP4A 4UNQA 3GJ8A 1SK8A 3V4FA 4A4DA 5A5GA 4JJZA 4R98A 1Z2CA 2BMEA 2IYUA 3AKCA 4G5GA 1Z6GA 3GJ6A 3KX2A 5HCNA 1YQTA 2GNOA 1NVUQ 3A1WA 2J0UB 3QVUA 621PA 3A36A 2AR7A 1C1YA 4IVPA 2O8CA 1D2EA 2WKRA 3LFUA 4TMVA 1KI8A 3GJ0A 5C2JB 4PQRA 4LBWA 1NVWQ 2QMHA 3QG5A 5KSPA 3R7WA 2NMVA 3WY9A 4W7SA 1VTKA 3P1JA 4HAYA 4JSTA 4C0SA 1IXRC 2KBEA 3FKSA 1F2UB 1ZYUA 2CNWA 5DLQC 1ZD8A 4QGHA 1HQCA 4OI2A 4EJSA 4JLAA 3EOZA 2A9KA 4Z54A 2ZRLA 5B64A 5JJIA 3LV8A 2PMKA 4JLDA 1T4GA 5AUOB 4TTQA 4PGMA 1W4BA 3GLFB 3OEHA 4X8MA 2P6NA 4CEHB 4DCVA 2FSIA 1U94A 3BB4A 1IAQA 1P4SA 3EZFA 1XTIA 1GL9B 4B35A 3NTUA 5J40A 4JOCA 1N0VC 2P2LA 3LX5A 1VG9B 3NWJA 5J4VA 4XVUA 3H0KA 4M1KA 1D2NA 4BZXA 4C2UA 4BFZA 4MYCA 2A5DA 2ZYWX 5IK2D 5FPKA 2ZI5A 4TMZA 3NXSA 2EVWX 3FMFA 2W6JA 1II0A 3MBKA 1QFXA 3EW9A 2REXB 2ZUBA 4LGMA 1SKYE 4HI0E 4ERNA 2IF2A 2AK2A 4XTCS 3KKMA 4M53A 3GFPA 2OCPA 2IKQA 3BS4A 3VMFA 5JI3E 1ZM4A 2ZRMA 3KXIA 3R9XA 4QGFA 3A1TA 4HZUB 5K8IA 4HYYA 2ERXA 5EE1A 1QVRA 3O8RA 5JCPA 3K0CC 1PUJA 5TY0A 3EC1A 2O8BA 3EPKA 3FYHA 5BXQC 1ZCBA 1TU3A 3L8ZA 2OE2A 1K6MA 4Q4JB 5CJPA 1AA9A 3PUZA 4QGGA 3EC2A 4AROA 4MUAA 1U0HC 2ZXUA 3B2EA 3GPLA 4XIGS 2G1JA 1VKJA 3C41J 3N5CA 3PFIA 4Q4AA 3SFVA 1TQ6A 2ZSAA 4NL4H 4JT4A 4C7OB 1G18A 1ZC3A 1PVOA 4CZ2A 1OT3A 5G53C 1N5KA 1G6OA 2IYTA 2GXAA 4QIHA 1E2NA 4V0MA 3TUZC 4QRHA 4PC2A 1P6XA 3FFBA 4PZAA 2H5EA 1S4QA 1EWQA 2A3RA 2P65A 3L0OA 3W8NA 4PANA 1ND5A 4OKSA 4LJ8A 3GFTA 1S0UA 2ZRHA 1JXMA 3BB3A 3QXSA 4PPFA 2ODBA 3FDZB 5FBLB 4S2EA 1OIVA 1FNMA 3D6TB 2ZUDA 4Q02A 3W5IA 5F98A 3IBGA 5A0FA 4GNKA 3OESA 3UK6A 2O8DA 2GFIA 3K1JA 4ILEA 1FQJA 1G3IA 4TZ6A 4KI0A 2HEIA 4DLRA 3ZD6A 3VHLB 1P62B 3CRMA 1F5NA 1U0LA 2ZJBA 4NE2A 2GETA 3V4RA 2P6RA 3GJ5A 1XCGB 2BWJA 2ZRJA 3OIWA 2P6MA 1R5BA 2XXAB 1VYVA 3QF7A 3W6NA 4KO8A 2RGGA 3FDIA 1P5ZB 4QXAA 2F1IA 5BW8A 3FHTA 4HLQB 1RC8A 4KLZA 2GILA 4TN1A 2WWWA 3QG1A 3X1ZA 5JEEA 1NN0A 1K5DA 2ZRAA 3IPXA 4PO9A 1YFKA 4KXFB 3FE2A 2J7PD 3BERA 1LNZA 2GA8A 1SKAA 4RZ3A 4LYHA 3BFXA 4JLJA 4Y0VA 4LC0A 4LBYA 3SJAA 4TTPA 1MH1A 1H2FA 1DAMA 3IKJA 1ANKA 3W90A 1I2DA 2A9JA 4M1TA 4BUJA 2GXQA 5DHAA 4LJYA 3FMOB 2QTVB 2OFWA 5EP2A 1W7AA 4M1SA 2QQ0A 5KSOA 1OF1A 4RCZA 1ESMA 2VO1A 3OHMA 2E87A 4ZIRB 2ZYVX 3UATA 4LWZA 3BRWD 5FI1B 2HXYA 821PA 2AXPA 2NO0A 4V0LA 1M74A 2JAQA 1NT4A 1E1RA 4L15A 1DKOA 2QAGC 3DOFA 4NCJA 1XD8A 1F48A 1OXXK 5AR1A 2EQBA 4JYBA 1YR6A 4ACBA 1ZC4A 1U8YA 2HT6A 1VHLA 1ZM7A 5EUMA 3A37A 2ZS7A 1KO4A 1NLZA 4LK2A 4NYIQ 1T0HB 2DFKB 1YR9A 2HF8A 5AUQA 3VKGA 1YU9A 1P60A 4DLUA 3BFVA 3H2YA 4NH0A 4FMBB 3TVDA 3THXA 4WIAA 2UVQA 1I4LD 4LJ4A 3GLHE 3T35A 3A6PC 3LWNA 1FP7A 1HY3A 5E3HA 2J1LA 5JRZA 4ESHA 1N6KA 3ZS9A 1NBMA 1S3SA 2DYKA 4E07A 4J0QA 1YZLA 3WRXC 3PG5A 3P4XA 1E0SA 4D4LA 2HCJB 2VTKA 4G0NA 2VP6A 1EFRD 4XD7D 2CCJA 5CB6A 1E0AA 3M0EA 1BQ3A 2XAUA 3ZVLA 5CK4A 1HT1E 1RRFA 3AF3A 5FPYA 3UXMA 5JZVA 4CEJA 4B2PA 1YZQA 4JKYA 2FEMA 2QZ4A 3BORA 3IHLA 3A8TA 1O3YA 4A2WA 2ZUCA 4DB2A 2V8OA 1CRPA 1N0WA 5KSYA 2EWVA 4IW3B 3NIBA 2XZLA 2BV3A 3ZGXA 1JBKA 3Q85A 2J0SA 1CBUA 4XWKA 5P21A 3E9CA 4MYHA 3E9DA 4DLYA 2EYUA 4EPRA 4P0TA 5G3ZA 4Q1DA 2P9FA 4TMWA 3SU8A 1Z3IX 2AKAB 3QVVA 4UKDA 4RFVA 2N42A 2EYQA 4BGDA 1R2QA 4JBXA 1K8RA 4TYWA 1BOFA 2NO9A 3K8YA 4GMXA 1R8QA 2ENWA 3OE7D 4LHZA 1JALA 2IT1A 2YOGA 3K9NA 2C5LA 2FSHA 5L3SA 2H17A 2X8AA 3R7AA 1UDWA 4FW9A 1COWD 1LB1B 5ANRB 2YNMA 4DB4A 4QHYA 5H68A 2FN4A 2N1BA 4G5OA 1ZAKA 2OLJA 2Z6VA 2A30A 2D06A 1KZ7B 5EXTA 3AGQA 4ZDWA 4DCTA 3ONWA 4AI6A 1X1RA 3L2OB 3I8SA 1MO5A 4NBSA 4IOKA 3PITA 4QHTA 4B3XA 2WJYA 4LJ6A 1TADA 3HYRA 4LPKA 2XB4A 3RC8A 2Q9CA 2P2YA 4ZCLA 3CH4B 4XJXA 1EFUA 1ZM9A 2NOAA 4OQFA 1CJVC 1N5LA 4TMKA 3M6AA 4CRWB 1R0XA 1V5WA 1FMJA 1JQLB 1E9RA 3VKHA 3S1AB 1E2DA 4V0ME 1DKQA 2JIZA 2LCFA 3K70C 4HUQB 1NKSA 2FE4A 2JLQA 5LB2A 2OXRA 1DG1G 1U8ZA 3BWDD 1NN3A 3TMKA 4HEJA 5SZJA 3E1SA 2ZRBA 3VKWA 4DEYA 3IIMA 5CYPA 4I81A 1UJCA 4ARVA 3LY5A 3JZMA 2A5YB 3KQLA 1CJUC 1Z47A 1E0JA 3OEEA 1I2MA 1GWNA 1Y3AA 4Z1MA 1EWRA 1KSFX 1ZNWA 1QVAA 3W8RA 4URWR 4LJ9A 2D4HA 2GTPA 3LD9A 3NVAA 1HA3A 3QF4B 1KDRA 4TTRA 3NDPA 1VHTA 2JDIA 3TH5A 5TVKA 1JR3A 3H84A 2LKCA 3LXXA 1RPZA 2RGCA 3BB1A 4HSEA 2QT0A 2G6BA 2GWHA 2V7QA 4LJ5A 3BXZA 1N6IA 3DEFA 4GP7A 4HB3A 3GLGA 5CX4A 2FWRA 2BHRA 2DR3A 2OG2A 3DL0A 2YWHA 1G1MA 4A82A 4Z51A 4PZ9A 1XB2A 1T5IA 1RYHA 5BQ5A 3LG2A 2WZQA 1CF4A 4LHYA 2L0XA 1SKQA 2PH1A 4P4UA 1JPJA 4ZO4A 2J0QA 1EX6A 2V55B 4LPSA 1GILA 1KAOA 3KTAB 5DN6D 1KO5A 3EZ6A 5E7MA 1Z8FA 2IXEA 5DYGA 4NDZA 1SVKA 4ZCIA 1E79D 2QTFA 1BIFA 2UZ3A 2JJ2A 5F9HA 1E2EA 2ZYUX 3U60B 5DSZA 1WA5A 2IYQA 2IYVA 3L82B 4O2LA 3THYB 5GJVC 4OHVA 3GJ7A 3PIRA 2A78A 2GBLA 1ZUIA 1HTWA 1SXJD 1W5TA 3GLIA 5G40A 2FEOA 2DWOA 5HKKA 5ELXA 4WXRA 4LOAA 4RD1A 4IJMA 3QXHA 1D6JA 1GKIA 1KMHA 1ZNXA 4C30A 1QHIA 4ARSA 3TSWA 2IF0A 1XJ0A 5IF9A 3AGPA 4EUNA 3I8XA 3A1SA 1P9NA 4PAOA 5DI3A 1NMZA 4K81B 4LHWA 4M1MA 2AX4A 2QM7A 2JLWA 1OHHA 4RZUA 1GL7A 3QPVA 5EXXA 1NNEA 2HLDA 2XOKD 2IA5A 1CR4A 1XZPA 1TIPA 3ASZA 4F4CA 1OLOA 5JLJA 2GZHA 4E5UA 1JB1A 3SJBA 1G8YA 2ECKA 4ZI2A 4ZI3A 2QRNA 2QBYB 1G7SA 3PVSA 4HLUA 4Q9HA 3AF1A 5FOTA 4RD3A 3MMPA 4M9SA 5G41A 4OHXA 3V9PA 3T34A 4A0FA 2JLXA 3NHAA 4PX9A 1MO3A 1SULA 4LX0A 3HR8A 1DAKA 4X8HA 3NBXX 1NF3A 1F3OA 4P4TA 1XRJA 4OI4A 3ICEA 2BJWA 2DFTA 3CBQA 3EWAA 4QG7A 5EP4A 5HE9A 4UXJA 1NVVR 5CK5A 5D3QA 1RVDA 2WPDA 3CNLA 4PPNA 3K4PA 1ZMXA 1EFTA 3O8DA 2D62A 3QSYA 1II8B 3THWA 2BEKA 1SVWA 4G5RA 4H9GA 4LSGA 1AZSC 2ZSBA 4BFUA 1R8SA 4CDGA 3U7EB 4RFSB 5DO9A 1AK2A 5HZKA 4PQYA 2J0UA 3UMSA 2CK3A 1A82A 4B74A 1XPRA 1SXJC 1JEDA 1P9RA 1W5SA 1NI3A 4A0HA 1T8UA 1SKBA 3C7TA 1OH7A 3K0SA 5D3MA 1W0KA 3ZQJA 1G64A 1N6OA 1T0JB 2IL1A 1F2UA 1DARA 1N6PA 1X86B 4MGZR 1GVNB 4HAXA 1UAAA 1UF9A 3OAAD 2RGNC 4PC6A 4DT1A 4I99A 3PJRA 3GD7A 2QM8A 3WNBA 1E1QA 2C8VA 5AUNB 1NSTA 3GLFA 3T06B 5FOWA 4B43A 4CEHA 3MSXA 3U2QA 4ASUA 3BD9A 3CR7A 1VECA 4QJ5A 4Q9KA 2XJ9A 1Q0UA 2RH5A 8OHMA 3B1WA 2IK8A 2EU8A 5FPSA 2WIBA 4M8NE 1QG4A 1J99A 2FF7A 3BGWA 2Z5FA 3QEJA 3PUVA 1DBSA 2OUKA 1IN6A 4PSAA 2GDJA 1OIXA 1W46A 5FUVA 4RD6A 2PT5A 1JAIA 3LBIA 1XU4A 1KSHA 3F3KA 3TVTA 4LYJA 2RAPA 5CM9C 3CRQA 4Q1EA 4TLAA 4C0QC 2ODNA 2GZDA 3OFNA 2EFGA 1XJQA 1XFAA 4Q9LA 5J4HA 3AP2A 4D25A 4G5SA 4HZUA 3PEWA 1LY1A 1T9HA 1UPTA 1EBBA 1BQ4A 1Z06A 4AKHA 2PCJA 3ADDA 1O87A 1MABA 3E9EA 1ZD9A 3U3OA 4OBEA 2GRJA 4JVSB 4Q01A 4Q4JA 2W6IA 3K9GA 2GZAA 1QDEA 2ODEA 5JFGA 2VF7A 2PT7A 2YN2A 4JVLA 2YC4C 4GBMA 1R10A 3T12A 2REBA 2J59A 1AGRA 1M8PA 4JZKA 2WWHA 1TQDA 1RJ9A 1OFHA 3FMPB 1KI7A 1KK0A 1RZ3A 4G3XA 5CB8A 4JIMA 4WZ6A 5TARA 2ZRKA 4AWXA 1J8YF 3QPWA 2CJWA 4Q48A 2PZFA 3RS7A 2YKGA 2CDNA 5JBQA 1L8QA 3VQTA 4CT4B 2XITA 4FDTA 5FI0B 1E69A 1TQ2A 6Q21A 4WZBE 3W3AA 1SXJE 4U7DA 2GJ9A 3IILA 4G1UC 2H92A 4TT3D 3CZQA 2DFNA 5FTNA 3OI7A 3KQKA 4GL2A 5CU7A 3FWYA 4ESVA 1YJ5A 3FDZA 1YZGA 3WHLA 4R71A 2VHTA 2F1RA 2CCKA 2QE7A 4OQLA 2EFDB 1IJEA 5E4FA 3SS8A 3R9WA 4OHYA 3TE6A 1Q3TA 3IBYA 1GKUB 521PA 5G3YA 1XTKA 2AWNA 2OBMA 1AS2A 3FKQA 4DDUA 1Z83A 2G77B 3PUYA 1G9XA 1IN7A 5EQTA 4QHSA 4AYWA 5BN5A 4TLEA 1E2LA 5CDFA 2XNSA 1GOTA 4A9AA 4B2IA 2IUTA 2G3YA 2XXAA 4KYUA 3OIUA 2J0VA 5JHGB 3NEJA 1T8PA 1W0JD 4OI0A 5AJYA 1K5GA 3QENA 3REFA 3LQQA 3RRMA 421PA 2H57A 1CRQA 1XF9A 4EFNA 2ZRCA 1VPLA 5F2EA 4Q5IA 3U4QA 3EIHA 3OF5A 1H8EA 1H8HA 4UNRA 5F9FA 1SVOA 3B5JA 4X8LA 2VSOA 4CW7A 4QKQA 4QJ3A 2PMDA 2WSSD 1YZTA 1G41A 1S3GA 1LFDB 3CWQA 3B85A 3QEOA 4XWAA 2UKDA 1OKKD 5LBIA 3UANA 3D6AA 4NZYA 5KDDA 4EDHA 2I1VB 1KSGA 4D4JA 1EX7A 4FCVA 4RVCA 4A0RA 4ZIRA 3KQNA 3OZXA 3KDSE 3W34A 2ONJA 1XP8A 3LDAA 3EX7C 3AP1A 2JJ1D 3PUXA 5EZ6B 4YQFA 5CLQA 1IXZA 2IYWA 4IRUB 5FH9A 1IY0A 3G0HA 2WMNB 3TKLA 1KAGA 3AUXA 1FNNA 2GJ8A 2QSZA 3PUWA 4GPTA 2F1JA 2PEZA 5AJXA 3RSOA 3VX4A 4M1YA 1KMQA 1GG2A 1SVLA 3I4LA 3QKSB 1RE0A 3FOZA 4II7A 2AFHE 1QHHB 2I4IA 3MLEA 1P73A 2EFHB 2EWWA 4MITA 2H4XA 1QHGA 1R4AA 2Q0HA 3FHCB 2XZOA 2QGZA 1NY6A 3WYAA 4F93B 2OHFA 3A4LA 3NC1C 4TYYA 1LF5A 4Q1AA 4ZPXA 4PC7A 4DLSA 3CR8A 2QMOA 4MDFA 3WBJA 3U44A 2VQSA 2WNIA 1XCPA 3RSLA 2ZE6A 4LBZA 3A1VA 3KKPA 4C0KA 4Q18A 2IWHA 3B82A 1KOFA 1J70A 3TR0A 3RS2A 5FUYA 2IS1A 4R7ZA 3LO5A 4L9WA 4IDPA 4BQSA 3HPQA 1BYIA 2PLFA 2HXSA 1IM2A 4M9ZA 1T8TA 2W83A 3LH5A 1GRQA 4FXPA 1IONA 2X2FA 5FTJA 2H0QA 4Q1CA 1N0UA 3FPAA 5DIFA 3B7GA 4E03A 1Q57A 2C9OA 2O8EB 2GHIA 1NJFA 1Z6XA 1KI3A 4ARZB 1FP6A 1PUIA 1VMAA 5GJCA 4GP6A 1HE8B 2QN6A 2OFXA 2VEDA 4IVQA 4KODA 4RSGA 5FBQB 2YJTD 1DS6A 5IK2A 1XJCA 4MGKR 1TMKA 4RD2A 3B9QA 3PCRB 1OYYA 3KJHA 2RFLA 1QG2A 4Q4HB 2HCBA 2AXNA 2I3BA 3BH6A 4I1SA 2VP9A 4JLOA 1QZXA 2ZJAA 4KLNA 3OEHD 2ZM5A 3PEYA 5JECA 1XXHE 1UKZA 5AJVB 2ZYTX 1ZNZA 5FPTA 3ND8A 2WOJA 4Q00A 1G8HA 3BK7A 3K0FA 3U3JA 4IDOA 1RRGA 1G3QA 4CT5A 3FHOA 4A8JA 1NRJB 1NP6A 1RIFA 2VF8A 5CJ2A 1U8AA 3GP8A 2F55A 3LAWA 1DE0A 1S1MA 4JYCA 1J8MF 4LHVA 1GRNA 3GJXC 4KSCA 4KBFA 5B57C 1G21E 2F6RA 1ZBDA 2OBLA 3A4NA 4HUQA 3WNCA 4KVAA 2WOOA 3QE0A 2OWEA 1AIPA 1ZM2A 2OM2A 1SKYB 2FG5A 3DO6A 3WRYC 3B78A 2FDCA 2XSZD 1J7KA 2R44A 1XZQA 2XX3A 2RB4A 2YYZA 1DKMA 4OHWA 4TLBA 4ZKDA 5AJWA 3WNDA 3U5ZB 1BYUA 4BLPA 2R6GA 2IYSA 5KO2A 3JZAA 2OSBA 3X2SA 3AUYA 4JLVA 2HF9A 3CLVA 3QF4A 2DY1A 4FINA 2XNDD 2YV5A 4BLQA 2O8FA 3X1WA 3B13B 1C9KA 3GQBA 1XTJA 3G82C 4DRZA 2QPOA 3F0TA 4IKEA 2ZJOA 4QC2A 4EJSC 2ZPTX 2CHQA 5LD2C 2YWGA 4Z8XA 3ZIAA 2C95A 2Q3MA 5FBVB 2RCNA 4BFXA 5JMTA 1CS4C 5KPDA 2Z83A 3LBHA 4US0R 1NL3A 3SC3A 1T6NA 4U02A 3WYGA 3IT3A 1VG0B 3H86A 4TLCA 1TF5A 2CLDX 3MGCA 1M34E 3TW8B 1A7JA 4E22A 3B60A 4K8OA 1G291 1L7VC 3T5DA 3THYA 2FMXA 5GADl 2J7PA 4ARUA 3AKDA 4QBHA 1CU1A 1RKBA 4URXR 5DGXA 3LNCA 5C46F 2X2EA 2QROA 4DLXA 4OYHA 1XEXA 4MGYR 4DUGD 1XTRA 1OJLA 4EQ6B 3MWYW 4B3DA 2ERYA 2XTNA 1I4TD 2LKDA 3BAFA 3VX3A 1VCMA 2ZI6A 4C0JA 1IQPA 1DADA 1E2FA 1YVDA 3PEVA 2JEOA 2GEUA 3V00A 1R5NA 1XX6A 5J4YA 2E1RA 2IBMA 1A5TA 2X19A 1TEXA 4ZCMA 4AKGA 2RMKA 4DIEA 3P20A 5LPNA 2HIAA 3K4QA 4P4SA 2FZ4A 2B21A 4A8JC 1G4UR 2YN0A 1GNRA 2C96A 2QT1A 2KWIA 1U2RA 3MAAC 4POAA 1DKLA 3SYLA 2C99A 2QBYA 3HPRA 2B7BA 2NO1A 1RRPA 1H2EA 1FX0A 3KKOA 4YMTA 1NIJA 4KCGA 1W48A 2QRZA 4A6PA 3TJZA 2ZRFA 4PPQA 3MJRA 4TQUS 5FL7A 2GCOA 3CZPA 4AD8A 2ZRIA 3IQWA 4QBFA 1D9ZA 3SR0A 5BYKA 5DI9A 1UEIA 1NMYA 4BLOA 1UJBA 2AN9A 4MYUA 4PAQA 5L3QB 1E1RD 2ZROA 5JJLA 4WZAE 3K9HA 4YDHB 3RYTC 3VR1A 3ZVMA 2WWYA 1QHFA 3ZS8A 1KIMA 4AKEA 4KFUA 2D2EA 2HJGA 1II8A 4OL0A 4GFDA 2OEPA 2ORVA 2ANBA 3LA6A 1PLJA 2V4ZA 2GXSA 1W36C 1YE8A 1UEJA 4RFSA 3CB4A 2BMJA 2GK6A 1QF9A 1JQJC 2YWFA 5K8UA 221PA 3K70D 1EFCA 3TNFA 1XEFA 2KE5A 5CYOA 3QUSA 4IDQA 4PSKA 3MWKA 3THOA 4AIIA 2BMFA 2ZAMA 5IRCD 3VNUA 1YRAA 3IGFA 4D0NA 4D82A 2VP5A 1E9DA 3CM0A 3RLFA 4AK9A 4HDCA 3GLHB 4B3FX 1OXSC 4PTLA 2AKYA 2ZJ8A 1BH2A 1HH4A 1J90A 3VNVA 4JBWA 2ZREA 5CIQA 3EXAA 3R7WB 3LVRE 2PX3A 1US8A 5JSZA 3MXOA 4F38A 2G83A 2ANCA 2VP0A 4JBYA 1WXQA 4NCNA 3ZD7A 3OE7A 2IYZA 1KI9A 3ECCA 3GW8A 3WMFA 2AHOA 4LI0A 1PJRA 2ODWA 4M1WA 2WJIA 2WV9A 3IDQA 2ATVA 1IOZA 2QQEA 4NYMR 5FL3A 5B2ZA 3FFAA 2VL7A 1NVVQ 4JKIA 4TZ0A 2YVUA 4PHTA 4OK6A 2MMCA 4PHFA 2HV8A 2IYXA 4KBGA 4PZZA 2FU5C 3I32A 3PENA 4HAWA 5EP1A 1LVGA 1RPTA 1RRCA 2P78A 1LF0A 2OO7A 4M21A 3UG6A 2VA8A 3T61A 3TLXA 3HP1A 3E2IA 4X8OA 4Q7LA 4B3BA 1AN0A 1W4AA 1BMFA 3RS3A 2NZJA 2RGEA 2ZTSA 1GZSA 3R8FA 2FSGA 2F9MA 2G88A 1G5TA 1RW4A 2WJVA 3U3MA 2W0SA 4B47A 4BRWA 2PCLA 2QA5A 2R65A 1IN4A 3L43A 3MUFA 2W2VA 4FMDB 4P3YA 4UXIA 5GJWC 3RWMB 3U7GA 1EG7A 1OYWA 5JWRA 3HU1A 3T1VA 5KOYA 2ZVPX 3SYKA 1KKMA 4O2RA 5GVRA 3EWSA 3X1YA 2GAAA 1E2JA 2QG6A 4DCUA 2JLRA 2ZR0A 1IHUA 1XD2A 3O8BA 2J87A 4KHZA 4TSFD 5FTKA 2MSCB 3B1YA 4JLPA 3QKRA 3UPUA 5SZIA 3C14C 3SJZA 4AC9A 1E9EA 2QAGB 4NYJR 3WBKA 1VYUA 4FI3C 3RNLA 3RS0A 2ENUA 3SHFA 5FUWA 1XMJA 4AYTA 3CIOA 1WB9A 1FOEB 4GOXA 2WAXA 3MRSA 4CEIA 1G6HA 2ZRGA 3KXKA 5SZHB 1KK2A 2F7SA 2KJQA 2GJKA 4ODIA 5KPJA 1X3SA 1CIPA 1FTNA 1XNJA 3DZ8A 3GEHA 4LBVA 3CO5A 3EARA 1SVIA 2QPTA 3GMTA 2P9YA 3ZHCA 2B92A 2HHJA 1M1YE 1R0YA 2CE2X 1FL9A 2DHRA 4YDSA 5E7JA 2WHXA 2WWGA 4Q03A 5GJBA 3Q8XB 3OEED 1N3BA 2WKPA 1W44A 3RWOA 1KY2A 4TL8A 4BEJA 5LDDC 3P27A 2PL3A 2WJGA 1RPAA 3IPYA 4URVR 4PC3A 3R8CA 1E79A 3IO3A 2IX3A 1KO8A 4NP6A 4CF7A 3PR1A 1UKEA 4OQMA 1ZU5A 1C81A 4HB2A 4CYMA 1JR3D 3TQCA 4DEXA 4OI1A 3LVQE 2V7QD 2NZ8A 4Q21A 1DO2A 1JJ7A 1Z0IA 3QOFA 1UJ2A 2VSXA 4M9XA 4NKRA 4YMVA 3EZ7A 3Q5DA 1TPZA 4Q7MB 3JVUA 4MGIR 1U90A 3RABA 3BH0A 1E99A 4BWYA 2IW3A 2DB3A 2D7CA 4B3GA 4U00A 4DJTA 3U7FB 4GI7A 2QU8A 1VIYA 1AM4D 4ON9A 2JA1A 3QBTA 1FMLA 3FVQA 3ZDQA 1KDPA 3LLUA 3SFZA 3IIKA 4YLGA 1OSNA 4TL6A 4LDJA 1RFLA 5JI2E 1YKSA 1CR1A 3CF2A 2XOKA 2G9NA 2H7VA 3RRYA 1E32A 1FUKA 2KB0A 4A2QA 3ZZTA 3AEZA 4BFYA 1W4CA 1Q1QA 5JRJA 3M4YA 3DMDA 3KB2A 3B8HA 5HKKD 4QFMA 1BKDR 3VR5A 3FMIA 1HYQA 2OV2A 1Z29A 3AB3A 4HDOB 4FD2A 4MKFA 2IWRA 3TW4A 4US2R 4DCSA 3IQXA 2XTZA 4IOJA 3M1IA 1Q1ZA 1F2TA 1LV7A 2GVZC 2W58A 3NH9A 4F91B 5AJZA 3ICQB 4N0EA 4V0NA 1N5IA 1P2TA 1NBME 5TV2A 4O25A 2HLDD 2OFOA 1L4YA 3QKSA 5JS8A 4JLKA 1UKVY 3KKQA 3MCAA 2FFHA 1NN5A 3EPJA 3SYNA 4TWZA 3IT1A 3KUDA 4EPXA 2CBZA 4JMPA 1OH8A 3ZVNA 4AY2A 1Q1EA 4UJ5A 2QTHA 4N1AA 1E9CA 4TL9A 1FZTA 3NKVA 3D7MA 1PLKA 1GDDA 3I62A 3K70B 4G01B 2B8WA 1Y63A 2KBFA 2W2TA 1E59A 2IHYA 1Z2AA 2ASEA 4FWIB 4D6PA 4YMUA 1P3JA 4PZYA 2ZRDA 3CH5A 5FBRB 2FH5B 4YC7A 3C5CA 1XMIA 5BWMA 4B71A 1ZUHA 1OB2A 5KSZA 2WPDD 2RGBA 2ZJZA 5FR1A 1YZKA 2WU0A 5BYJA 3TAHA 1KK3A 1E2PA 2R6FA 4TYPA 4YMSA 3TK1A 4BLRA 1M6NA 2ZI4A 3EZ9A 2B8TA 2EFEB 2P0EA 1HQYE 3OAAA 4L16A 1X8KA 4P31A 4S35A 2XGJA 2IS4A 3E70C 1IN8A 4NTZA 2QENA 5EE5B 3GP3A 5KHOC 3Q3JB 3RAPR 1NY5A 2ZE5A 4Q4LA 5J4KA 2H8KA 1G17A 1Z0DA 3DMNA 2CK3D 2F43B 4M9QA 4Y0AA 4D81A 1XTQA 4CEJB 2GBLC 5FBWB 4BEBA 1KYIA 1YR8A 3L0IB 2FV8A 3DKPA 2ZE8A 4EMBA 3C15C 2YOFA 1KTVA 4JL6A 5TDHA 1WCV1 2ZR9A 2H16A 3QXCA 2P79A 2A2ZA 1R0WA 2FX3A 2GF0A 2J5XA 4MA4A 1S96A 4DSUA 4DHEA 2QY9A 3TR5A 3B1ZA 5IT5A 4Q4HA 3SDZA 2VP4A 3IEVA 4XOIA 1BO6A 1NJGA 3NTLA 1E1QD 1WF3A 3ADKA 4KSBA 1V43A 2H52A 4KFTA 4M4SA 3I92A 1CVIA 2E9SA 4ASUD 2G1KA 1NVXQ 4PO1A 2F3TA 3AVTA 2MSEB 2CCGA 2ORWA 4HLUC 1MRNA 4HUTA 1U81A 4PQFA 4LC1A 5CM8B 1G19A 5SZKB 1QBKC 4DDWA 1E6CA 1JECA 4B44A 3T1QA 1SZPA 2BVNA 4B6EA 1JAHA 1R6BX 3EIQA 3VU9B 4KU4A 4DDTA 5JHHB 5LB4A 5JJKA 1T3HA 2P5SA 3RDPA 2WIAA 5FTLA 1A4RA 4GZMA 5DHFA 1Z0FA 2FSFA 2OXCA 1E2GA 4B3CA 4W9MC 4XWOA 4IDNA 1DKPA 3MFYA 1E9AA 4Q9JA 3KB1A 1RYFA 4UNSA 3F2IA 1ZUNB 2OCBA 4R2IA 5EJEA 4C7OA 3SQXA 1JR3E 3HYTA 4IJ6A 3D4IA 2B6HA 2JJ8A 1R0ZA 2ZSEA 4LUCA 1AS3A 3N2EA 3UMFA 2NGRA 1Z0JA 1FQKA 2I1QA 3DKVA 4GMDA 2BKEA 5BN3A 5KNBA 3GLGE 3O0TA 1B23P 4PXAA 2H18A 3LL4A 4MRNA 2HJVA 3GEIA 1E58A 3ZH9B 3LRPA 4M22A 2W6ID 4TLDA 2A7QA 2IUSA 4FCTA 5H1YA 2PJRA 3LW7A 3CWZA 2P77A 1CP2A 3NHBA 4KITB 1KI6B 4PFSA 3EIEA 4KJZA 1Z0KA 4NHOA 2OZEA 3WYFA 2IYRA 2VH5R 4EO9A 2ZU6A 3BOSA 2Z4SA 3UWKA 1TU4A 3RS4A 1G3MA 1OW3B 4Q47A 1VG8A 1IHPA 1IBRA 2IS2A 1QRAA 3KJGA 3GLIE 4AG5A 2C98A 4UJ3A 1ZVQA 2Q21A 2BBWA 1NG1A 1TUIA 4LRWA 2R6DA 3GLGB 2P75A 1SXJB 4YXWA 3O47A 4EFLA 5EUQB 2QE7D 4DLWA 4PO8A 1ZINA 3CKLA 2O0KA 4I1VA 2VHUA 4JVMA 2EKBA 3T5GA 1VCNA 3GFOA 4I4LA 5EZ5A 4D80A 1DELA 5H8WA 1YR7A 4O0MA 5J5CA 4C3ZA 1UDXA 4XSHA 3HJNA 1AKEA 3L0PA 3X1XA 4TMXA 1OKKA 4NMMA 1G7TA 2PJZA 3BJIC 3GLIB 4QOSA 1E96A 1DTSA 3K0AB 1DAEA 4JJKA 4URZR 1EESA 2WICA 1HT2E 3KQUA 4R9UC 2A5GA 2C03A 1KMHB 5HTKA 4B75A 4BFWA 4DC9A 2JJ1A 4NONA 4P33A 4AG6A 1H8ED 1H8HD 2MMGA 5DISB 5DI3B 5CLLA 1NLFA 3KL4A 2FNAA 4F92B 2X77A 4A6XA 1ZCAA 1E0KA 1QHSA 1SHZA 2IC5A 1DAHA 4JVNA 2ZSDA 4A36A 3DHWC 2HT1A 2OLKA 5HCIA 721PA 3TQFA 4TQAA 3ND9A 4JT2A 2FGKA 2K5UA 2CMKA 3SHWA 2NPFA 3K0CA 5DE3A 4H1VA 5L3QA 4LZZA 1CLUA 5FOUA 4ACAA 1QWOA 2HPAA 1XTSA 1ZP6A 2N46A 4WW0A 1KNQA 5EXSA 3TSZA 2XTMA 5J47A 3U6KA 3VTKA 1XDBA 5HZHA 3CPEA 2ZRPA 1E9FA 1X8JA 2BM1A 4FIDA 2P30A 4DBLC 4MDEA 1P2VA 1DAIA 1OPXA 2ZI3A 4ZDJA 1UBEA 3K53A 4AKIA 3LLMA 4PSVA 3BFKA 2V54A 3QY0A 1T3LA 3MWLA 2QUZA 4L9SA 1SGWA 3THWB 2ZJ5A 3GLFE 3AVYA 1D2MA 3G5UA 4D2IA 3VR4A 2FPMA 2ORIA 4W5JA 3QBVA 2QPAA 1U0JA 5FFMA 4GSYA 3Q72A 4RD4A 3GLHA 3NBYC 2GJSA 2VSFA 1VG1A 2Q6TA 5AWFC 2JATA 2WWIA 3D8HA 3DDCA 1CKEA 3D31A 2QEQA 3ZLJA 1JPNA 3CX6A 4BFVA 4K46A 1WMSA 3LBNA 1U99A 4RKEA 2AD1A 5D3MB 2AL7A 4RCYA 3C5HA 1D9XA 4FMDF 4HATA 3FKSD 1NG9A 2CNWD 1YZUA 2WJHA 4DT1B 3AP3A 4ZDKA 2LWIA 1R5OA 1Q1BA 1S1CA 2FZLA 3ZQ6A 3SE0A 2IUUA 3SEAA 4BASA 1FUUA 1M7BA 1AJEA 1P7CA 2DWQA 4NU0A 4Q1FA 4Q9IA 4KV9A 3R20A 3VHXA 4PAMA 1M7HA 1G5PA 3VR2A 1ODFA 2GF9A 1KKLA 4V03A 1P75A 1WBDA 4XVRA 4HLCA 1W4RA 4E3WA 1OIWA 1GNQA 1Q3HA 1ZIPA 3BBPA 4UNNA 2Z0MA 1LTQA 4DIDA 1CEEA 4TYQA 2W6JD 2A5FA 4LYFA 4A1FA 1IN5A 1SVMA 3NH6A 3SN6A 5HR5A 3W6OA 4ABYA 2MSDB 4IVRA 4URUR 3S1AA 4I1OA 2NO6A 2JASA 2AK3A 1OFIA 1MRSA 3WMEA 5KDOA 3SBDA 3RRZA 3Q5EA 1XCMA 1XXHB 2V6IA 5KTYA 1ZJ6A 1A1VA 3N2IA 2XSZA 3W9YA 1YZNA 2NTYC 5C4GB 1MABB 2B7CA 4BLSA 1XPUA 4TSRA 4HDQB 2QAGA 4D0GA 4MKGA 2C9CA 1GFIA 3C8UA 1AQYA 1YHNA 4D26A 2V9PA 3ZZ0A 3NFYA 1RIIA 2BDTA 2PBRA 2NPIA 1Z5ZA 4M1OA 2XNDA 1Z6AA 3KJEA 1AZTA 2ZJYA 3DCYA 1KDTA 4NYMQ 4C9BA 1RJ9B 4C0BA
chains in the Genus database with same CATH superfamily
1EFKA 1Z6QA 4NCKA 5ESRA 3WGTA 3D6MA 4IXDA 4GL4A 1MOZA 4BJ3A 4C7VA 3OT4A 4IIBA 2JLZA 1A7UA 2DHEA 4KYTA 3WJ1A 2RHRA 4JJ7A 1I1QB 1USVA 2VHCA 3DDSA 3KUCA 4QM7A 1YI1A 3PD7A 2OHXA 3QELA 2D8AA 2ODQA 3V8QA 4EPYA 3FWNA 1DTWA 3PXDA 3BC1A 1TEVA 3EFOB 3Q9LA 2FP4A 3PE3A 1JXQA 3UK0A 1NOJA 3W05A 4UNPA 5IZCA 1RBMA 1HUQA 1NNUA 2QD5A 1PV4A 1YB2A 3RSGA 4E14A 2OGSA 5JROA 2P62A 3OUTA 4NICA 2C84A 2F1OA 2CLSA 2DFLA 1A5SB 1XZCA 2QMUA 2YMLA 2W0MA 4HXYA 3NOQA 4R54A 2Q6VA 4MR7B 3LPAA 4YLEA 1NAHA 2HWYA 1V7QA 4O3FA 2ZB2A 2GBCA 2XCIA 3D3QA 4I46A 4GRAA 1VKNA 4JQOA 2PT6A 4B2YA 5C5CA 3J81k 3GDGA 3MD0A 3ONFA 4K6HA 4NAUA 1GKYA 4H7HA 4OQDA 2VPPA 1KZGB 1RPJA 1U6KA 3BJZA 4OHBA 5CPFA 4KNYA 4TMYA 2R00A 3L4SO 2GKOA 3PVZA 1XJWA 4ER0A 5I45A 2MIIA 3KV1A 4W99A 1O6GA 5AK0A 1U3GA 2NZYA 4QDTA 5G0VA 4Y2XA 4D4IA 2UV8A 4FWTA 2Y4OA 3M81A 4F2GA 3G68A 2JLSA 3B7PA 5LQUA 2OILA 2WQZA 2OHVA 1D8TA 1KI1A 2QYTA 3TLBA 3DKIA 3ZDAA 3DFIA 1ZVKA 5IDYA 1E4VA 1GGKA 1NULA 5K05A 1NW9B 2ILVA 3HRHA 3TAUA 3W7VA 5L6MB 1EDZA 3I9LA 4C05A 1B1CA 4HLDA 4YMGA 5AW0A 4DV6B 4DA0A 3IR5A 2FFAA 1MT0A 3BIWA 1T4MA 4F8JA 1GG8A 1VCIA 1C7IA 1JDSA 4XGQA 4H6XA 1BE1A 3ECSA 3UAVA 4DIMA 1Q7RA 3BD7A 3KYJB 3DR3A 1WB6A 4G9EA 2ZU0C 1NJ8A 5JAOA 2O2GA 2Q3BA 2XOXA 3W04A 1S8FA 3EG9B 3N7UA 4J0GA 1N6NA 3QZUA 3VR6H 4RMNA 5EFZA 5I4IA 1BNCA 1FJGB 4WEOA 3P9ZA 1UBGA 4QOHA 2Z9CA 1U3FA 2ATXA 2C0QA 2R7AA 4LMPA 1DUIA 3TLJA 4DLPA 3OTWA 2P2ZA 2QW0X 2QTAA 1EFRA 4Q3EA 5BN1A 3I28A 5WRFA 1C3OA 3HWRA 4PRYA 1YD7A 4BB9A 2ZYIA 4FFOA 5B1EA 1GTVA 5I7VA 3ZDDA 3KVNA 1PG5A 2FWJA 3MS4A 3R6GA 5E1MA 4J0JA 2VIIA 1MOQA 1ECPA 2ZK7A 3FJYA 4BTLA 3LW8A 4YIHA 4E6EA 2P91A 3HBAA 2DR2A 1T9BA 1OCEA 4F4FA 5I9NA 4Q19A 3FTQA 4RA9A 4E13A 3U44B 2W2XA 1H66A 2WSBA 4UREA 5FOSA 1SQGA 2VNSA 4L5BA 4F6RB 4WZAB 1CR2A 2XZPA 2DLNA 3E61A 1YDEA 3FGNA 3FPFA 1YRLA 3LKZA 1QB7A 4ITRC 2Q1UA 5FORA 4DARA 4DR7B 3WL8A 5ICCA 5HPYB 1MXFA 4G89A 2X22A 4P4NA 1FW8A 4YCMA 2QMYA 3QYPA 2JKZA 3THRA 3UCFA 4BNZA 4QEKA 2VBCA 2F43A 3VRHA 3U4GA 5D86A 3TR6A 1V37A 1CFZA 2CY0A 5K9ZA 1IZZA 3FZYA 4EJSB 4O8ZA 3X44A 3IHWA 5KWVA 3AETB 1JIUA 3DCJA 4WBSA 5GWXA 3JASB 5BNTA 2OGZA 3A32A 1HDIA 3ANLA 2G36A 1FLDA 3RCBA 3TW6A 4IEFB 3I72A 1COWA 3UJ7A 5JYBA 5KTRA 2FWPA 3EAFA 3AJDA 2GCNA 1L4HA 3FCXA 3HB4X 1N2ZA 4MRSA 4G97A 2WG1A 3RVLA 1YI8A 3V4SA 4CIDA 3DEZA 3NBZC 3PGA1 1U3UA 2VP2A 3TTVA 3OZCA 5AVOA 1OZGA 4LE2A 3ER6A 1CNEA 2R00C 1PJ3A 4US1R 4I3HA 4W5HA 3S68A 3AXSA 4DF3A 1JSCA 1QK4A 3ABZA 1N0HA 2OMEA 3CXUA 4M1QA 3TSYA 1QHNA 1Z2DA 1EVLA 1KC3A 2IYLD 3PI6A 3D7SA 1HEUA 1P1BA 4QBGB 4C4PA 3MJVA 1SBCA 4XXHA 4HB4A 4UAGA 4E31A 4ZMSA 3W5UA 1PQ4A 2FG7C 4RW0A 5IC5A 4B7ZA 4EDFA 1MDFA 1YB4A 2D0DA 5AW5A 5CYGA 5HE8A 3Q9NA 4K9LA 1R88A 3SC2B 2GAFA 3IAS1 1C4OA 3VAAA 2FEXA 3CF4A 4MAAA 4ZVMA 1HFWA 2CEKA 2AGVA 3BHIA 4RV4A 3TGWA 4DY6A 4QG3A 2P67A 3A6DA 3IV9A 3RYIB 2AI3A 4WASA 3RBXA 1QZ3A 1TRHA 4GKKB 5C81A 1T0IA 3DD1A 4BKQA 4A8JB 3L6UA 1WDTA 1MBZA 1ELOA 1S9DA 2HSEA 3D6UA 2YZ7A 2DAPA 3HBLA 3PXXA 4LV5B 1ZD4A 1C8KA 1NQ5A 2Y3IA 4JI4B 3KFVA 1JJVA 2WMYA 9LDBA 3A1FA 1XUOA 5TT0A 3U4AA 1QYCA 3DV9A 3IB3A 2Q46A 3QSGA 4D9EA 4JLNA 4P6VF 2YY7A 3E5RA 4G0YA 3C5VA 2VHQA 1HSZA 3DZIA 3E48A 2OWDA 3PJGA 4HBZA 3E84A 4CETA 2QL5A 5A4JA 1FP4A 1T91A 1VBKA 1J8DA 1P9WA 1T1RA 3C3CA 3IUQA 5CITA 1MA0A 2AA3A 1XDWA 2XA1A 1KI4A 3VVCA 5KYYB 4Z9BA 1G3UA 2BONA 2HUNA 4GX5A 5DTIA 3TIVA 2IUFA 1XD9A 2EX4A 1WPQA 3L4EA 3TIFA 1AGPA 2D5LA 3ABRB 4HCJA 1ND6A 4ZHQB 5JAPA 2GASA 2VDMB 1K92A 1OFGA 1P91A 1LBSA 1OXUA 1DL5A 1EAYA 1EXMA 4NMLA 4CMIB 2PA0A 2XHZA 2BGNA 1T4CB 1K9SA 3NWEA 2V1XA 2Q29A 1W36B 1N2IA 4AICA 3FETA 3C48A 2PPLA 3F49S 4K7JA 1VCOA 2O20A 3OIYA 4JNCA 4L76A 4MQUA 5TPZA 4CHTA 1DI0A 1RWNA 4LDZA 4N7JA 4BMXA 4MRPA 4D79A 4LHXA 4HRYA 1ZJYA 4OMUA 1IPFA 1ZW6A 1J23A 2C3PA 2WD7B 4KFRA 4Q9AA 1HLGA 4TXJA 2JARA 3E4DA 4G0ZA 2BBOA 2ZLBA 2WUFA 1M1YB 2HSGA 2OCDA 3ANNA 4QBIA 1KOLA 5ED4A 3LF1A 1CTQA 3IP3A 5D7NA 3H8VA 2QLFA 3CV3A 1ZJZA 4IHQA 3VHRA 4B8YA 5I47A 3AVWA 2DBYA 1BN7A 2ZSKA 4BLWA 4WUVA 2OTCA 3TQHA 4JOBA 1VDZA 2OV1A 4RKQA 1Q44A 2AMYA 1SUEA 2PVCA 1OC2A 3IB6A 3RKRA 3SBOA 3EE6A 1WKBA 4K8RB 1OFUX 4E5DA 3H2KA 4B8ZA 2HV9A 4OFXA 5ITZB 1BVRA 5DM4A 4JN6B 2WVJA 2JJMA 4YUWA 4DMMA 1IK6A 4IV5A 1GM5A 1XEXB 3K0AA 1L4NA 5AK4A 1DWOA 4IEEA 4ZPJA 1GPH1 1T35A 4O4JF 1NXOA 2CXXA 2UVPA 3WIBA 3G2QA 3P32A 4EKDA 2Z9DA 5C3MA 5HP4A 3NI2A 4HAUA 1M67A 1GUFA 2OCIA 3LRXA 1MLDA 5C1DA 4FKMA 5A71A 1OXTA 3X1DA 4X3PA 4N0DA 4D3FA 2PUEA 3C4JA 3BKWA 4ENWA 5CLIA 4R7GA 4NBUA 3V4ZA 4A91A 5DNEA 1Z22A 3SYRA 5BVHA 2YZKA 3Q8LA 1EFPA 3AUTA 2VRBA 4NBKA 3ADBA 1QHHA 1II9A 1GTMA 1YC5A 3BX1A 4RPKA 1A8UA 1TJ5A 1XWIA 5JDIA 3GMSA 4HMOA 3KXLA 4X41A 3T7SA 1UMCB 2D8MA 3PHBE 3RJTA 4RMGA 1HXHA 2RKBA 4INZA 5BN4A 3SP1A 2JI7A 4CKEB 2WV7A 2HRDA 4AJEA 1MO4A 3ECAA 2HCTA 1JIIA 1XKXA 4FC6A 2M1XA 1ZL2A 1G8AA 1DXHA 3OOHA 3HZHA 1J2JA 4NLLA 3Q88A 1JQBA 4BO2A 4GXRA 3ZJTA 4GDFA 1UXOA 1HE4A 2W9XA 3QP9A 4RY2A 3HVUA 1L6RA 1WEKA 2NTNA 4ZEOA 5GV8A 2BGRA 3NEAA 3OCWA 1C1HA 2WNHA 4Y1GA 3BXHA 1USUA 3D3WA 1QX3A 1FLVA 1NTOA 1T2CA 1TX4B 2BDUA 5LYJF 1FMFA 1ECCA 1EK0A 3KKKA 5K45A 4KQ1A 1XRNA 3ER9A 4Y2QA 2ZT6A 1T3ZA 4IUCS 4K40A 5AM1A 4BMNA 4E2FA 4GVXA 4JS0A 1ODIA 3PEUA 1SAYA 2I7XA 3K92A 2XOEA 3D4NA 4XEUA 2QORA 4QM6A 2AJTA 2XDQB 5EKSA 1RQPA 2SNIE 2IEZA 5C18A 2B4QA 2XRYA 2XWPA 3JYPA 5HFJA 3ZY4A 2JPDA 3F46A 4H77A 4KVGA 3V8VA 3VYVA 2I66A 4C0HA 4DSOA 3WLOA 4XYMA 2VZ0A 5BUCA 2D1RA 3RVBA 3VYRB 1WZEA 4PHHA 3SEFA 1DG3A 3T7CA 2FUNB 3CE9A 3RANA 1RBQA 2BFBB 1C7ZA 2OBXA 4RIIA 1HT0A 2N47A 4NOMA 3AESA 4J0IA 1BCRB 5I3ZA 1X8LA 4KPYA 1KJYA 2ZRNA 1NQOA 1GGJA 1ETUA 4K0RA 4DJDC 1OWLA 3GVIA 1TGVA 1VL1A 3CQ9A 5ALRA 3RU9A 4DADA 2VSNA 4JA0A 5HRCA 1RLJA 5HKAA 3FPHA 1CS0B 1KA9H 3OLCX 1RP7A 4Q1BA 5CHEA 5J9FA 3ZWWA 3AIIA 2DCMA 1OI3A 4IXMA 4B6OA 1A9XA 3ILYA 1FJXA 1Q12A 2GTHA 1E7RA 3IVGA 4K03A 1ZM3A 3GEDA 1DEXA 8LDHA 2G71A 4A03A 5AKKA 2HQBA 3I9MA 4GT1A 4RJLA 1XPOA 4M7RA 4W5WA 1WZCA 2XGGA 1KO1A 3UB2A 3E15A 3EPHA 5HCUA 4PHGA 1J1UA 3L4BA 2BGKA 1ZHHA 3GD5A 4O59O 4Q12A 2NSLA 4YT8A 1YVPA 5FJJA 3KSAC 3H7AA 4RZXA 2P4HX 5JMPA 1XMPA 4RJKA 1YZ3A 5E8RA 2FAXA 2C4KA 2HMTA 2O6HA 3UT5A 2FJUA 4DSTA 3VC1A 2NU7B 5TMPA 1KXZA 4OLBA 3U7HB 2A9PA 2PG3A 1MB3A 3LPMA 2CXHA 4ZT4A 2BTQA 3K9LA 4IDHA 1PJ8A 3LQ4A 1L0BA 3EHEA 2QNIA 1NVEA 2H9IA 1CE8A 1MJGA 3V8RA 1QF6A 2F48A 2ZITA 1E66A 4KRYA 4FGSA 4GC5A 1GSHA 1KH1A 3WMGA 5IJ0B 1VSTA 4IR7A 2GO7A 2ZM6B 1Q6YA 5BN5A 1FS5A 2IHBA 4LG1A 4BNTA 1JHOA 2D3WA 2R6AA 2I34A 4UQOA 3QKRB 1E4YA 4FILA 3PZRA 5BSKA 2FQXA 3R5XA 4RSRA 1KZ1A 4UUPA 1KH2A 1UL1X 3DR5A 4IXNA 1LBQA 3NHMA 4RK4A 4UD6A 1IDOA 3C6YA 1LZLA 2XJ4A 1YRYE 4FFSA 4C0XA 3ACBA 4ZEXA 2DQKA 2XWQA 2PS0A 3QXXA 1W85B 2D3TA 5TGDA 3QNUA 4O2AB 2FCAA 3L6EA 5KNBD 3U9SA 4UFPA 5KNCA 1PCXA 2QK4A 4RKFA 2Z2JA 3GP5A 4AF6A 4GBED 1XGKA 3PXEA 1GZHB 1K66A 1X7XB 4N5LA 4B32A 3NDBB 1PNVA 4HNVA 3ESRA 1CUSA 2CHVA 1H3EA 1EWYA 1W0JA 1H4SA 1Y7PA 1XAHA 4QODA 2OK8A 1AKTA 2FK7A 1AMNA 1YR1A 3AM1A 2ZVDA 4B34A 2W2QA 4X7PA 1FP1D 4J1SA 1MGPA 4MR7A 4N4AA 4YONB 5C80A 2IS6A 4KFSA 2JZNA 4Q3CA 5GGYA 1Q83A 4LJAA 1UPFA 2WSLA 3IOYA 2WF7A 4RZ2A 1LJLA 4MDHA 1G7RA 3IAM6 1H4TA 3EFEA 2CHGA 3LDHA 2DH6A 4RZSA 4FX5A 2QXTA 3D43A 3GCGA 3AR2A 3ZD9A 3WWPA 2P5UA 3EDCA 1LPSA 5HF8A 1Y8RB 2W70A 2NSYA 5KX5F 1NVTA 5CVUA 3PR2B 4YXWD 1LBHA 1UMDA 3ED5A 3ICWA 2CE7A 3FG9A 5I9BA 4Z7OB 4LGCA 3G6WA 3BHMA 4HLNA 1EGQA 3ZE1B 1RLIA 1BOOA 4BVAA 1F60A 2DKOA 4IQ4A 2L42A 4PLYA 2Q7DA 1SZCA 1OASA 1JNYA 3ZDFA 2BFEB 5BP7A 4Z4CA 4B7XA 1MB2A 3BXEA 2OBNA 2R6CA 1BXRB 2IHNA 1IN1A 2JVKA 2WKQA 2FRDA 4INAA 1I2CA 2BHLA 5E4YA 1XFDA 2A0XA 4DKXA 3ONEA 1XMOB 4GOJA 4DPKA 1ZJWA 2N1MA 4FP9A 3H9UA 2NQ8A 1VMEA 3BUSA 3FTCA 2GK7A 4ZDIA 5A04A 4DSNA 1Q21A 4XZ3A 3G9QA 1KE1A 3P2EA 1WSDA 5THXA 1LK7A 3LF2A 3ANYB 4OHZA 4B3MB 4B5LA 3EG9A 2HSJA 3M8KA 3OMLA 4L7VA 4TM8A 4HQOA 3STYA 4BLTA 3PICA 3ZCXA 1KWGA 1F2TB 2Z04A 4BPRA 1VB5A 2GN0A 1L4FA 2YS7A 3I61A 1QQ6A 2VYND 3SK0A 2BZGA 4B48A 2PDAA 4YJ2A 1MA3A 2A3NA 4QDOA 4RM3A 3PXGA 5IKEA 3F6RA 1FTYA 1NJSA 2B0CA 1MQAA 3ZCRA 5FI3A 4Q3OA 3EF0A 4V3BA 1U0NA 1CIVA 2QP4A 4RFLA 3V4FA 3A6FA 4JJZA 3ACDA 2DETA 1Z2CA 1N2BA 5EMJA 3CUVA 2YYAA 3KSZO 2QSUA 3H83A 1OX5A 3U7QB 1YQTA 1NVUQ 1XL1A 2BJHA 3QVUA 2ZBDA 1VL0A 4NAHA 5CW2A 1L1QA 1KOJA 3EQ2A 4ZA2A 1YS1X 3E3NA 4Z99A 4WZAA 5TQJA 4F6RA 1XU9A 3DCNA 3UMBA 4C7XA 1VXRA 2FKAA 1M2EA 3P2MA 1V71A 3OZVA 2VCHA 4LBWA 1NVWQ 2QMHA 3QG5A 5CVTA 1BX3A 4CDMA 3WY9A 3OFKA 1VTKA 4JSTA 1Q1AA 4JJ8A 1LH0A 2JI4A 4C0SA 5KHLB 1MW9X 1F2UB 1ZYUA 3F6BX 2CNWA 3MINB 1ZD8A 2JAXA 2ZYRA 1BG6A 1LVHA 4YMIA 4EJSA 1S02A 3DPSA 3KQVA 4LZPA 1PK7A 5B64A 4ZTUB 4C6TB 4JLDA 1T4GA 2IPXA 3C6ZA 3ONDA 2YIJA 4RELA 4BGIA 1A9RA 2OV3A 2IDZA 3OEHA 2A35A 3KIPA 2ZJ0A 3TLGB 3NAZA 4DCVA 4U2KA 4CEHB 2ACKA 3BB4A 1P4SA 4P7GA 3ZWVA 1GL9B 1P39A 4RQBA 5J40A 1F4VA 3UQYS 2Y68A 2GNAA 3KB6A 3H0KA 1OX4B 1Z26A 2C94A 1MC1A 2FZWA 5LWHA 3B52X 3LWBA 1Z4NA 4C2UA 3MC1A 1I30A 4BFZA 4MYCA 3GOQA 3OBIA 2G25A 2ZI5A 2V0CA 3EIOA 4TMZA 3JRXA 1KFEB 4PFQA 1OFUA 4H7IA 5I7HA 3FMFA 4YI5A 3U1BA 2PLNA 2I62A 3STUA 3WZMA 2FRDC 4V38A 3ROEA 1G59A 2F3UA 3O91A 1E1MA 2REXB 1LRLA 2BPOA 5TGTA 3CU5A 4ZV7A 2AG5A 5JFOA 2ON6A 2HNKA 5JVDB 2D59A 3BS4A 2CJFA 3KXIA 3TZQA 2ZYAA 3A4TA 3IAUA 2TS1A 3G2HA 3R9XA 2IYAA 4MQ4A 2ERXA 3QVMA 5EE1A 1QVRA 4B4UA 3P9XA 1BVHA 1XWFA 3HVJA 5IUKC 3D8RA 2B35A 4NABA 1GFZA 1O94A 3GUUA 2HK6A 3FYHA 4X6YA 1S8AA 3F7OA 3WBFA 4C4XA 1KJIA 1TU3A 5DMXA 4DRXB 4AUNA 1K6MA 1EK1A 3A28A 4UMDA 1AA9A 1OILA 1DQSA 3PUZA 2QTLA 4YJDA 5IAEA 3T15A 2DWCA 2CWDA 3NV7A 2XH8A 4AROA 4G56A 1K75A 4MUAA 1R64A 3Q7RA 3GK3A 2O7NA 4H1TA 2ZXUA 4L4YA 5ENZA 4YYZA 5K0EA 1VA4A 1AOXA 1NRXA 1G18A 3I04A 5ALIA 5EVCA 3TL2A 4EZEA 4Q3AA 5IBRA 3U81A 5LNK6 1J5EB 5G53C 1N5KA 2O9JA 3WV5A 4HWKA 5IAAA 3ROTA 1E2NA 4LFCB 5KYYA 3WTBA 1P6XA 3FFBA 3SIXA 3SVLA 4XM0A 5EJFA 9MHTA 1S4QA 1EWQA 2A3RA 4TTSA 4BNGA 1DGQA 1VSQA 4G0PA 1XLUA 3G5MA 4HNRA 4JI7B 2WT4A 5EERA 4G1EB 5EZYB 3ZU2A 4LJ8A 1ISGA 4DGQA 4ZHQA 2OBYA 4CKXA 1JXMA 4XLLA 4DIOA 4JA2A 3RRBA 2ODBA 3FDZB 4GX1A 3VO1A 3WRXA 5FV7A 3A25A 3D64A 4EMTA 4CMIA 2JCGA 2WR8A 1FNMA 3BXOA 1KRWA 4PAGA 1KC1A 1W5AA 4R40A 3ZN2A 5A0FA 2AEJA 3NGXA 4GNKA 4WCVA 4C4OA 3B12A 4LQ4A 4ZI7F 4FB4A 4TZ6A 2QVYX 2CHUA 3C97A 2F1KA 3OPNA 2J9GA 4C7KA 5C3UA 1P62B 3CRMA 1DT3A 1ZH2A 2UYCA 1F5NA 1F4PA 2B7LA 4BC1A 4G37A 3GJ5A 2YJ4A 1QV6A 1XCGB 2BWJA 2FN7A 5LLDA 4QUDA 2NSDA 2ZRJA 2RK4A 2A9OA 4CQLB 1THGA 2CV0A 4MKXA 3FDIA 2F1IA 2AG6A 3FDXA 2XB6A 1RC8A 4LWQA 3P71T 4R68A 2JLCA 4WUTA 3GIWA 5DXFA 2HHLA 4HNSA 1V0JA 1BAPA 5JSYA 3TIXB 3WLKX 4LMBA 3ZHRA 2ZRAA 4C07A 1YFKA 4LIPD 4WZZA 3B6MA 5ITZA 3BERA 1LNZA 4IZOA 3RTEA 4RL6A 4LC0A 3FTNA 5ECDA 1LK5A 1I7LA 3SJAA 1MH1A 3QFFA 3ZV4A 3KUUA 3B3AA 1QTRA 4XFKA 3DOIA 3W90A 2R84A 4KWIA 4FFBB 5J2UF 3EZGA 2GXQA 3JYLA 4X0EA 5DHAA 4ARAA 2Q0SA 4YUYA 2HK8A 3PUHA 5AM5A 1W7AA 4KR7A 2QQ0A 3DZHA 2VO1A 2X7HA 4YJ3F 5DLEA 4ZIRB 4CCYB 4FM9A 1GCAA 4I5FA 5I7FA 1SB9A 1T2UA 2IZ5A 2NO0A 4BNKA 1NT4A 1E1RA 4WECA 5EWLB 4LF7B 4II3A 5T4HA 3FFWA 1L5HA 3U3XA 3N2NA 3ZGOA 1QR2A 2Y99A 5AR1A 4JYBA 1YR6A 3B8EA 4CIWA 4XWWA 3COWA 1VE5A 2PV0A 1U8YA 3ANXA 3U49A 1J2TA 2BH2A 1ZN8A 3JZFA 3PNSA 2ZS7A 2IDMA 3H5OA 4CKEA 1IHXA 4LK2A 4NYIQ 1T0HB 2DFKB 4EW2A 1YR9A 1JB9A 5CNKA 3AOEA 4JB8A 5F1YA 3BFVA 3MWEA 4DL9A 4FMBB 3HXMA 1I5RA 3ZOZA 1X1DA 2C2XA 5F64A 1C29B 3T35A 4R1TA 4MZXA 3A6PC 1L5KA 2FZVA 1KETA 1PZMA 2H29A 3EVCA 5FB3A 4H27A 1ABBA 5JRZA 4C08A 1N6KA 2J32A 4XCXA 2J9ZB 1QRTA 4HEHA 3RYFA 1C8VB 3WRXC 1KQOA 3E7DA 1SCNE 3KT8A 1GN8A 3QYAA 4LEIA 1R6TA 1UXHA 3KZMA 4O4LB 1BKYA 3FVTA 2VTKA 3O21A 3C3DA 2BFWA 1J42A 4PX3A 4XD7D 5HJEA 3PC6A 2EEPA 3PJDA 2JFQA 1A7KA 3UC9A 4IICA 4RQUA 2V4MA 4KW7A 3EEIA 1E0AA 3M0EA 1BQ3A 4CIAA 1BGWA 3H8SA 3ABOB 5CK4A 5JZVA 5CNMA 4WNIA 5L4NA 1IYZA 1UDBA 1QFJA 1YZQA 1VC2A 2X6RA 3WL3A 4R5HA 3K20A 4DCCA 4YAFA 1O3YA 1Z56C 3T5CA 3WWCA 3ZLBA 2OHIA 3L5KA 1AO3A 3W7BA 1CRPA 5KSYA 3I1YA 3N0VA 5IULC 2XZLA 2R8PA 1WMEA 2ZCVA 3HH8A 5C35A 1HLPA 1QV7A 2DE0X 3FCAA 2IODA 3LT4A 4D45A 5ALWA 4HS4A 4EELA 4MA0A 2HMAA 1HE5A 3SU8A 3TPFA 2AKAB 3QVVA 4UKDA 1GHTA 1ONPA 1R8YA 5ALVA 4JBXA 1RMTA 1BOFA 1EQAA 1R8QA 3S28A 2XODA 3K4HA 4XVCA 3HRIA 2TSYB 5LQJA 1DBRA 2NYRA 4LHZA 1CS0A 1DC5A 3UMVA 1ULTA 2YMQA 1Y4AE 4UTZA 3L8EA 3I5MA 2Y1WA 1SG9A 1AKRA 4KN9S 2GFQA 4M9CA 4KR2A 4E1VA 2HOQA 1LB1B 4FT4A 4DV3B 2JFHA 2PKCA 2OUIA 2Y1DA 3I2JA 3DMYA 3D5QA 4XCVA 5L6LB 5EXTA 4ES6A 2AVDA 3ER8A 3H17A 1MO5A 3TN7A 3ZWOA 2FRXA 1M6EX 2QRKA 4ALMA 1T2FA 3PITA 4ND7A 1NXXA 4OMDA 1WXDA 2WJYA 5AKGA 5AKHA 1TADA 3IQDB 4B3XA 4D02A 1U2DC 1QS0B 3HYRA 4LPKA 4A6DA 3AL3A 3PA6A 5FWXB 3OPXA 2P2YA 1H6DA 3LHFA 5AI9A 2NU7A 4EX7A 2BTEA 1YASA 4JH0A 3CH4B 4FXOA 3PQ7A 1EFUA 1ZM9A 4XJXA 1YIDA 4XRRA 2ZR8A 4QTTB 2JFPA 4TRJA 1SC4A 1YS2X 4ILKA 1LQTA 5AW2A 1YTUA 3JS5A 4Y9TA 1JQLB 2GX6A 3VKHA 3DE3X 1BC5A 3IQZA 2GLTA 1DKQA 1PT8A 3AOEC 4V0ME 5IJ0A 1NKSA 2FE4A 2JLQA 5FQNA 1RZVA 4JT9A 4GKAA 4TV9B 1U8ZA 3TMKA 2WRZA 3G59A 1U7OA 2IBTA 3C3BA 5SZJA 3E1SA 1NHGA 4G4SP 1U7ZA 2ZRBA 4FGZA 4DEYA 2HT1A 4F3CA 2FUCA 5MGBA 5BQXA 3SGLA 3JZMA 4G86A 1K6IA 1Z47A 2F00A 3F7NA 3TI9A 4WCDA 1QVZA 4W8OA 1PJ4A 1RWQA 1FFYA 3D5EA 1RXUA 1P6UA 2QX8A 4LJ9A 3E5NA 3N05A 5IABA 2W48A 3QF4B 1KDRA 3LYAA 2V45A 4TTRA 1LU9A 4O2AA 3WK9A 3NDPA 2CUNA 2JDIA 2OAGA 3I76A 4QXPA 3L5OA 5TVKA 4RPCA 3MWFA 2D54A 4I4TB 4P3OA 2XY4A 3WKDA 2RGCA 1I01A 4HSEA 4RIHA 2GWHA 2V7QA 2ZBPA 2HM7A 3BXZA 1N6IA 3F6EX 2JAWA 3N0XA 4HB3A 2BEUA 1X7XA 5CX4A 2BHRA 3SIRA 1M9NA 1G1MA 1V5EA 4Z51A 4MR8A 1T5IA 3JPYA 2NYVA 3PU6A 4MWOA 4HK4A 2P27A 4LHYA 5BQ5A 2L0XA 2HFKA 1AMUA 4W8HA 1I3KA 1JPJA 4KZKA 4P4UA 4ZO4A 2BW0A 3WMRA 2I4LA 1KAOA 3PDCA 5DN6D 1H0SA 5ALYA 2H1CA 3HVRA 1VHQA 2X86A 3AHGA 1C4XA 1T2AA 1G98A 1J22A 3EZ6A 5DWQA 3VPBA 3HADA 4ZCIA 4NDZA 1GUZA 3OCJA 2QTFA 1HNNA 2Z8XA 3WIEA 1HKHA 4A8PA 3CZRA 3G1UA 4E4TA 1XE3A 3LYUA 1M3SA 2PL5A 4LOLA 2IYVA 3WGJA 1CUXA 4O2LA 3THYB 1I2AA 2BT4A 2HQ1A 1SD1A 3PIRA 4EVSA 4DJEC 2JD2A 5IKOA 4CUKA 3I8OA 4LDNA 2UUOA 3F5MA 3GPBA 3B6IA 1ZUIA 1W5TA 4MI9A 1Q7EA 2DWOA 2NTJA 1QJ4A 4MPRA 4E6PA 1P1CA 5H7XA 4IFTA 4IJMA 1ECBA 1GKIA 1KMHA 1ZNXA 3H87A 1QHIA 5JZMA 2OVFA 2EHDA 3VR6D 5IF9A 2AR9A 3W3AH 1NNLA 1V6CA 3AGPA 4DR3B 3LECA 1GTJ1 3A1SA 4R6WA 3QLUC 4DQUA 4DV0B 3RROA 4R8SA 1Y1PA 2CMDA 4M1MA 2AX4A 2BFEA 3ZTTA 1D2GA 2NZXA 4MHTA 3KB8A 3IRUA 4OEHA 1WHSB 4J03A 2Q5CA 5CTJA 3U16A 2VYVD 3K6KA 4F4CA 1V8OA 4WMLA 1TMYA 4GICA 3BA1A 4OJYA 5DNWA 5L40A 1JB1A 2F59A 1G8YA 4HOYA 4QARA 1RT9A 4J9VA 2QBYB 1G7SA 1JBQA 3PVSA 4HLUA 7REQB 2R96A 3T9FA 3TINA 3KYCA 3LVFO 2XCQA 5G41A 2EC5A 1BCSB 2ONCA 3DAFA 4HVTA 3T34A 3V9PA 3T3GA 3O4IA 2RHWA 3IQIX 3WYDA 5LMZA 2O1SA 2Z6QA 1KPIA 3G8DA 3HR8A 1NF3A 4OAOA 3NRBA 1N1GA 1J09A 1RAAA 5I48A 1XRJA 4MTCA 5DGDA 2O3SA 1A50B 2C00A 2C57A 4P7KA 1KFJB 2ZWVA 5EP4A 1HK7A 1OLXA 1VIMA 3LP5A 4M76B 4TTIA 1X1CA 3L8FA 4QBTA 4YRGA 3CNLA 4AJ2A 1G8KA 1ZMXA 1EFTA 4GKVA 4RNCA 3IA7A 3O8DA 4X6LA 4KO3S 4FHCA 3QSYA 3OCCA 2M6RA 2V7VA 2GD0A 1U28C 5LZ2A 4QUIA 3THWA 4G5RA 3S55A 4MEJA 1N34B 1AZSC 4HY3A 3CSDA 1R8SA 3ADOA 4OCZA 3RARA 3W2TA 4BFUA 4Q37A 2V7UA 3U7EB 4RFSB 3U7QA 1AK2A 1JAYA 2VK2A 3ELUA 3IQGX 1TA0A 5E4TA 4KR9A 4MVJA 1BWRA 4Z9AA 4B74A 2HBYA 3FGPA 4IIDA 3QE3A 3NHFA 1NI3A 4WTOA 3W5BA 3CLTD 3PRHA 2VAXA 1SKBA 2CXQA 3C7TA 3WNZA 1OH7A 1JZSA 3OP1A 4JFRA 2ZCJA 3CCBA 3WGNA 3ZQJA 4P1ZA 4JROA 1GPBA 1T0JB 1X39A 2EKQA 2EKLA 3O92A 1F2UA 1WEHA 1DARA 1QPGA 1T10A 3MINA 4LGYA 5K2MA 1C9JA 1D4AA 2CFIA 1RADA 1UAAA 4QE3A 2RGNC 3KQWA 3P9SA 3PUIA 2OB1A 4C6TA 2QM8A 3DT9A 3WNBA 4AQ7A 2IW1A 2XXBA 3C5EA 3HEAA 4IHJF 1NSTA 3PPIA 3FNGA 1GDTA 5KQPA 3T06B 1QOPB 3TLGA 1JEQB 4CEHA 3MSXA 5HNKA 4L8VA 4ASUA 3CR7A 3QPBA 4Q9KA 1V35A 8OHMA 5L7WA 3A70A 4TGLA 2EU8A 2NSJA 4LRSB 3RHZA 1CHDA 4LCEA 4RVOA 4BUCA 1OX4A 2WIBA 1P1KA 2LBPA 1XNGA 4RVDA 1DHTA 4M8NE 5I9SA 1XO1A 1J99A 1VLHA 4Y7CA 2Z5FA 4W5TA 4LOIA 1JBEA 3ES9A 1DQYA 3ND6A 3N8GA 4L4RA 5IUNC 1IN6A 1K6XA 1O7JA 2AFIB 4PSAA 4QU9A 1U8EA 3GROA 3LLVA 3CVYA 2J4FA 5FUVA 2QL7A 4W1SA 1I9GA 4W1QA 2O7SA 3TB4A 1RXWA 3LBIA 1XU4A 1YOVA 4A2CA 4N6GA 1QH8B 1PWHA 1Z0UA 4TLAA 4Z9FA 1TZMA 4UZSA 4AZSA 4YASA 5ULLA 3OFNA 4MNTA 1HE2A 2OHGA 2V5UA 2RG1A 3PE6A 1DU4A 4X1KA 5ALUA 1FQOA 1YAHA 2FQQA 4QYXA 3V7YA 3PEWA 3RFXA 4AKSA 1T9HA 4D25A 3MOSA 1EBBA 2OV8A 3JCZA 4AKHA 2Q7OE 4U1RA 3ADDA 2I4NA 1R27A 3N3BC 4OGLA 1OLSB 1Y8AA 1EM6A 4OBEA 3U3OA 1TKCA 3VNBA 5CNJA 3CKKA 1L7QA 1XYYA 2OFPA 2X3FA 3K9GA 2Q4BA 4UFOA 3AM5A 3NAMA 4LISA 1EXDA 5JFGA 1JHUA 1VPDA 3KR0A 3N8DA 3BTUA 2GYUA 4JVLA 3T12A 5ER9A 1ODSA 2REBA 1D0IA 1KEEB 1PFKA 3DQPA 4C14A 5C37A 1JFVA 2GN9A 2WWHA 1KI7A 3BJMA 2E6UX 1KK0A 2ZCUA 1RZ3A 1T0UA 1N9KA 4G3XA 1GFWA 5LVAA 4H3VA 2K4MA 5TARA 2ZRKA 4MIKA 2EAUA 1G21A 2V98A 4UEJA 1RJWA 1L8QA 1L5VA 5IMBA 4FT2A 3ROKA 4ZARA 4CT4B 1JE1A 2R4TA 4S0XA 4NCAA 4LY0A 4G1UC 2H92A 3GRVA 3BRSA 2DFNA 3CUYA 1XTPA 3CX3A 5FTNA 5M2QA 4GL2A 1NDUA 1PTJA 2FMFA 3DOUA 3FDZA 4X6XA 5TRTA 1YZGA 2YFYA 4ESVA 3WHLA 2W8BB 4R9SA 3UWPA