5AJYA

Human pfkfb3 in complex with an indole inhibitor 4
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
444
structure length
439
Chain Sequence
PLELTQSRVQKIWVPVDHRPSLPRSCNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQPLDPDKCDRDLSLIKVIDVGRRFLVNRVQDHIQSRIVYYLMNIHVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQLKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTGESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVCTHRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-BISPHOSPHATASE 3
publication title Structure-Based Design of Potent and Selective Inhibitors of the Metabolic Kinase Pfkfb3.
pubmed doi rcsb
source organism Homo sapiens
total genus 157
structure length 439
sequence length 444
ec nomenclature ec 2.7.1.105: 6-phosphofructo-2-kinase.
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
A PF01591 6PF2K 6-phosphofructo-2-kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ajyA01
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 5ajyA02
4JYCA 5KDOA 3IT3A 2J59A 3L8ZA 2ZR9A 3GLHE 2O8DA 4ZKDA 4URVR 4DSOA 2A9JA 3ZZTA 1CVIA 1II9A 4ARZB 4IEEA 3ADDA 4BECA 2F3TA 5FR2A 2IYTA 5A4JA 3W6OA 1UBFA 1HUQA 3CW2A 2ZRAA 4TSFD 4DSUA 3KQNA 1UJ2A 1FUKA 3UK6A 3GFOA 1E2GA 4PPNA 2CCKA 1DE0A 1PLJA 3D31A 3B60A 1XTSA 1OIXA 2QNRA 3K0AB 2R8RA 1EX7A 4JVLA 1JR6A 1COWD 4LBYA 4JOBA 4DIEA 1A1VA 3VKGA 1OXUA 1FW6A 1F5NA 2GA8A 2V54A 5LB4A 3SU8A 4KJZA 2FN4A 2WNHA 3A1SA 1S9HA 2A3RA 3KZ1E 1E2KA 4ASUA 3AVVA 1KDTA 4KSCA 3QPVA 1MRNA 3T06B 4TL9A 1E4VA 1P75A 1NVWQ 1NI3A 2I1VB 5DGXA 2LWIA 3DO6A 2NPFA 4Q4JA 4G5QA 4BEJA 4DXAA 3QJYA 1K6MA 5FOWA 3SR0A 3PUWA 3KB2A 1E79D 2ZQ5A 4QL3A 1G8PA 4UNSA 4DT1A 5L3SA 4NP6A 4UJ5A 2A7QA 1N6HA 4Q1CA 2GETA 1J99A 3THYA 2IYWA 1KYIA 1II8B 1AK2A 1ANKA 4Q48A 2ZSFA 1FOEB 5E7IA 1YRBA 3L2OB 2X2EA 3QUSA 1FUUA 5DI9A 1NLFA 2RGXA 1GM5A 3AKDA 2GK7A 2QP4A 4KBFA 2VSXA 2ONKA 1U8AA 1DAGA 2YNMA 3VTKA 3U44B 2RHMA 2HJVA 1QHGA 2YWHA 3BB1A 4CIDA 5HPYB 4ESVA 5KNBA 4LRWA 3RABA 3TAUA 2G88A 3VR6A 2P30A 3BK7A 3CB4A 2ECKA 5DYIA 2ZI6A 4UQOA 2FE4A 3CH4B 3TSZA 2YWGA 4LX0A 4ZCLA 4AG6A 2ZVQX 3AGPA 3S1AA 1E0AA 5CB8A 4E09A 2XZOA 1YE8A 4NL4H 2QTFA 4MITA 2C99A 1ZM2A 2CNWA 4KU4A 3AGQA 1E94E 1A2KC 1KAOA 2DBYA 1KK2A 1R5OA 2X1VA 4NYIR 3RVBA 4DDVA 3DMDA 4JLVA 3SDZA 4XVUA 5A0FA 3UXMA 1ZCBA 2BEKA 5CK4A 4IDOA 1FP7A 4KI0A 4M1KA 4OYHA 2YWEA 1P7CA 5F2EA 3U3KA 2OG2A 3QIAA 1E32A 1XEFA 1EGAA 4EPVA 1GSIA 5BXQC 1UFQA 1OE0A 5FBQB 3B1YA 5JECA 4S35A 2ATXA 4FMCF 3IT0A 1E2FA 4JL5A 1IN6A 2TMKA 4TL8A 1M7BA 1LVGA 2HDNB 1OFUX 4LHXA 3QNUA 4NYJR 3THOA 3K0CC 4PC2A 3AVWA 3ZH9B 2A5DA 2KSQA 3BRWD 3FOZA 2QAGC 2PZFA 2JLSA 5EP3A 3IO3A 2JLUA 4QHYA 2CNWD 1MV5A 4WBSA 4JL6A 4OL0A 1W36B 3U6KA 1FTNA 1AGPA 3QEOA 2G9NA 4FMBB 2V6JA 2NMVA 4FD2A 3ONWA 5CITA 2WV9A 3IILA 3EW9A 2VTKA 4DC9A 1S9DA 1TF7A 1Z3IX 2J46A 1QHHA 1KOFA 2V7QA 3VX4A 1RPAA 2DFTA 1IXZA 4KITB 2IWRA 2GJSA 2UZ3A 4Q21A 4C0QC 1RE0A 2KWIA 5JHGB 4IVRA 2PEYA 4AKIA 2H18A 2ZI7A 4QFMA 3MMPA 3P20A 1Z08A 2WJYA 2AD5A 1RW4A 4NONA 1HE8B 4OJQA 5D3QA 4V0LA 3MWJA 2FZLA 1W0KA 1IBRA 4JVSB 521PA 2YOFA 2OLKA 2PEZA 3B82A 4V0ME 1N3BA 2BMEA 3U3MA 1KO4A 1OT3A 2CJWB 5DHAA 1N0UA 1E98A 2IL1A 2WICA 1RFLA 1D2EA 4B2IA 5UKDA 2NGRA 1AN0A 4DRZA 1WXQA 4OQFA 4DLVA 1ESNA 4LGMA 4Q00A 1ZIPA 2ZRDA 1IN7A 3AVYA 3SEAA 2V7QD 3C14C 3L43A 1D2NA 4QNRA 1BS1A 1AQUA 2VQSA 4EFNA 3RS5A 2P9ZA 4HUQB 1GOTA 1F2UA 2P3SA 4V03A 1NMXA 1W0KD 4MKIA 4PSVA 4JLMA 5KSOA 2OBLA 4D81A 3WBKA 1DTSA 5FL7A 1ZC3A 3IBGA 5CM8B 5DO9A 5JMTA 5BYJA 1WBDA 1D9ZA 2NZJA 2F55A 4OI2A 5JHHB 3U4QB 1IN4A 3I61A 3H84A 2VP9A 2RFLA 4HAZA 4Q18A 1M1YE 3AVUA 3UKDA 2IK8A 2RMKA 2D62A 2XTMA 5C2JB 3QPUA 2GXSA 4MUAA 1UDWA 1A4RA 1CJUC 2NO0A 3A58B 3IPXA 1KI2A 1KDRA 1MRSA 3KXKA 4G0NA 2P6MA 4X8HA 2OWEA 1YFKA 1DKLA 4F4JA 1TQ4A 4CT5A 3DZ8A 3ND8A 2ZRKA 2KJQA 1VYVA 4IDPA 4ACBA 1WCV1 4NYMR 1CR4A 3NWJA 3TW4A 3OIWA 1IHPA 3CPJB 5HCIA 2EU8A 2VHTA 1H2FA 1KJYA 2CVFA 1SVOA 2OFOA 3AQ4A 2WVJA 2XTNA 2Z4RA 2ZSAA 1XD8A 2C9CA 3FDIA 1RIFA 3PUYA 4HB3A 1KSGA 4AI6A 1ZNYA 3T1QA 3GLIE 1OLOA 5GVSA 2H4XA 1KI8A 2IHBA 5EE0A 4KODA 2KI5A 1AM4D 1TADA 4KO8A 4G01B 1W4CA 2GVZC 3VKHA 4LBVA 4BFUA 1V7QA 3MG9A 4IDHA 2JLXA 2CVHA 4CZ2A 4RKEA 4G5RA 4P4SA 2YC4C 3ETLA 2VHCA 1G5TA 2ZSEA 2ZJZA 1YZNA 3QKTA 3VU9B 4C9BA 3I32A 5B64A 4X8LA 2VHQA 3ZQ6A 3WNCA 1XJCA 4NE2A 1G3MA 2B21A 2NO7A 4PHGA 2H92A 2AK3A 2Z0MA 2WMOB 1XU4A 2BKUA 2MSEB 4DLXA 2YZ2A 5FL3A 4LYAA 4DCVA 2ORWA 3SOPA 3QKSB 2C77A 4GZMA 3RS3A 1Z07A 4GBMA 2GJ8A 1GP2A 2QMEA 4KAXA 2D2EA 3FHCB 5AWFC 4TWZA 3RRMA 1LV7A 1Z22A 2BM1A 4KFUA 2XJ4A 3EC2A 4BASA 1RJ9B 1ZRHA 4LJ5A 3LH5A 2ZU0C 4Q7KA 2XAUA 2FSFA 3CX6A 5IDVA 3R20A 1W44A 5HE8A 1G6OA 2RGNA 2F9LA 1RZ3A 1UDXA 4JLKA 1EWRA 5EXTA 1R8SA 1Z5ZA 1N0VC 3Q9LA 1RIIA 2ZR0A 1G41A 1PLLA 2QRZA 1Z0JA 2OFWA 4FIDA 4LYHA 4HI0E 1MO6A 3SI7A 2CE2X 4P4TA 1FZQA 1Z63A 4BFVA 3B13B 3UWKA 2WWWA 4B35A 4IHQA 1LB1B 4MKHA 4YONB 4P4UA 3SJBA 1PLKA 3TH5A 2PMDA 4O25A 1C1YA 3R7WA 2NZ8A 4HAXA 3W8NA 2KBEA 5KPDA 2DY1A 4UNNA 4OI0A 3L0OA 1UBCA 2GWHA 3IBYA 1ZU5A 3AM1A 3ZJYA 1ZM7A 3DKPA 4WVFA 3T5GA 1UAAA 1AIPA 4K8OA 2QSZA 3CX8A 4CEHA 4FDUA 2NO6A 2BKEA 5FBRB 1SXJA 3DMNA 1NJFA 4L9WA 4N3NA 4DDUA 4U7DA 1UBEA 1JR3A 1YU9A 2IS6A 1GFIA 3B1ZA 1VMAA 1A5TA 1TQ2A 2Q9CA 4NPHA 1U81A 1U90A 1NSTA 4OK3A 3VHLB 1H65A 2G3YA 4GPTA 4Z54A 5BQ5A 1CULC 1ZU4A 1KO7A 4KFRA 3IIMA 4E5UA 3PUZA 4GP7A 2QROA 2ZYWX 5DLQC 2UKDA 2YVUA 4A15A 2EW1A 1FQJA 1E9SA 3GJ6A 4GMXA 4TYPA 1XDBA 2X77A 4JKYA 3QG5A 4Q4HB 3NH6A 2HIAA 4AC9A 3P4YA 2VPPA 1G17A 3H4MA 4C2TA 1NG1A 4XIGS 3FYHA 1NNEA 3LV8A 1IY2A 5FI1B 3ZD6A 1KO5A 1P62B 4PZ9A 3CWZA 4K81B 3GLFA 3KB1A 1AZTA 3QG1A 3QOFA 3AP2A 2EYUA 1JR3D 4TMXA 1CF4A 1US8A 1OW3B 2J45A 2VH5R 5TB5A 3X2SA 1E99A 3I62A 5CDHA 1QG2A 1XCGB 1AS2A 2G0TA 4QC2A 3BS4A 5FPHA 1G5RA 1A2BA 3ICQB 4GOJA 1JXMA 4II7A 1E1QA 2J9RA 3DVLA 4TLAA 1D5CA 3KJIA 3B9PA 4LV6A 4ZIRB 3HR8A 3P26A 5D3MB 1OJLA 2QM8A 1GNQA 1XJ0A 1AKEA 1J2JA 1FMJA 2HEIA 1E0KA 4Q4LA 5JJIA 2FH5B 1T6NA 1V5WA 2F1IA 4NU0A 2PZEA 4Q7JB 4G5SA 3NTLA 4AWXA 4UXHA 4I1UA 1IY0A 4Q1AA 1KZGB 2VA8A 1GIAA 1Z0IA 2VIIA 2YYZA 2DYKA 3Q3JB 5AJZA 1SKYB 3C7TA 1X86B 1Z0DA 5LBIA 5L3QB 4ARSA 4EQ6A 2PCLA 2P6RA 2WAXA 1AQYA 2ZE8A 1E1QD 1L4UA 1Z6YA 1E2QA 1R0WA 3X1WA 3WRYC 2HPAA 2OHFA 1E69A 3AVTA 3AKYA 1AZSC 2P67A 4I4LA 4URUR 1KTVA 4H1VA 5EE5B 3MUFA 5G41A 3IPYA 5C18A 1YZTA 3QXXA 2RGNC 3THWB 3EZ7A 3BBPA 2GBLA 1Q22A 1XMVA 1DAKA 1G7TA 2XNDD 3RS2A 3SYLA 1NMYA 4DSTA 4JT4A 4XOIA 4A0FA 1P3JA 3MAAC 4LOAA 4MKFA 4JLPA 3W3ZB 1VCIA 3CIOA 5GJVC 1E1RA 5AUPB 3DEFA 2PJRA 2PCJA 4JLBA 1DKOA 1XPOA 1YHNA 3TK1A 2EKBA 2D06A 4U00A 5SZHB 1XMIA 5KDDA 4DB2A 2ANCA 1U0JA 3UATA 5FH9A 4O0MA 4PZZA 4QKQA 1UKYA 5EXPA 1OPXA 2D7CA 4TZ6A 3QBTA 4A6PA 2QE7D 1ND5A 5CX4A 2P79A 1M34E 5JFGA 4A8JC 3IQWA 1T0HB 2J1LA 3QXSA 3R7AA 4M0LA 4PPGA 3VFDA 1SXJC 1S3SA 2R6AA 5CIQA 1CKEA 2QT0A 5CM9C 1VCNA 1FL9A 1E0SA 4W9MC 3DOFA 1E1RD 4Z1MA 4D25A 2W6JD 4DCUA 3QF4B 2IF0A 3EZ6A 4FMDB 3I8XA 5FPYA 2R6FA 2F3RA 1P2TA 3KJEA 3IGFA 4RFSB 1UF9A 1DKMA 1GUAA 3A36A 3TVTA 4BUJA 4UNQA 4DUGA 1JPJA 4O3MA 1MO4A 4TLBA 1TAGA 2ZRJA 3HWSA 3CF2A 2O0JA 3K9NA 3L0IB 1KY3A 2VP0A 1KI9A 3AVQA 1W4BA 4IXMA 1QHIA 3SFVA 2H52A 2FFBA 1V43A 2ZM5A 4HB4A 2QAGB 1CXZA 3GP3A 4GL2A 1K8RA 2YHSA 3E70C 1S3GA 2ZITA 5JRJA 3Q7PA 1DAMA 2O8DB 3H0KA 2J0SA 1OB5A 3BE4A 4Z1MD 2QT1A 3EIQA 4OQMA 2CMKA 4DLUA 1LF0A 2G83A 2WKRA 3B1XA 2HYIC 1X8JA 1CP2A 1NL3A 4M1OA 5AJXA 3NHBA 3LWNA 1L7VC 4MRRA 5TMPA 3QKRA 3WHKA 3CUEF 2ZAOA 4AIIA 2IX3A 2I3BA 1FBTA 1OYYA 4M9ZA 3D4IA 3BH7A 4DUGD 4Q9IA 4BLSA 2F6RA 3HPRA 3AF4A 4C0AC 3SFZA 4F38A 1NP6A 4M1MA 1GNRA 4PZAA 1KK0A 4QGHA 1C9KA 3PVSA 2ZRIA 2W00A 4YMUA 4MGZR 4HLDA 3VR5A 5KOYA 1EESA 1VTKA 3ND9A 1P6XA 1CR1A 1W46A 2IUSA 4KYIB 5CIWA 3REGA 4B74A 4ZV4A 5HR5A 3EPJA 4EUNA 2IEYA 2AD1A 4GP6A 2BBOA 4W5WA 2HT1A 4GOKA 2CLSA 4MA4A 5AUNB 1GKYA 1MKYA 2FG5A 2BBWA 4LBZA 2ZI4A 5J4VA 2OCAA 3H86A 2QTVB 2JJ8A 3PCRB 3CR7A 2QEQA 2EVWX 3IHLA 4BZQA 1CLUA 1SHKA 3P4XA 1PUJA 2WZQA 1DPFA 1T8TA 4KYUA 2VSFA 4B3BA 2REOA 4RCZA 3U7HB 2O0KA 1SK9A 2GCNA 2JLZA 1ZM9A 1CJVC 4Q4JB 2IWHA 3CPHA 3W5IA 5JBQA 4BZXA 4KFTA 3KQUA 2ZANA 1HURA 2G1JA 3N70A 3RC8A 5DHFA 5L3SB 3PUVA 4GRAA 4RD2A 2RCNA 4U5XA 3IDQA 4LY6A 4ZPXA 3T35A 3LXXA 2FPLA 4IKEA 3U6BA 3THYB 1E58A 2GBLC 4EAQA 3DOEA 3TSWA 2BMJA 2C98A 1DAHA 3MD0A 2W2VA 3BXZA 3M0EA 3NEYA 1DOAA 1JBKA 2Q9AA 1XFAA 4PC7A 3AKEA 4URYR 5HE9A 2CLDX 5DN6A 3QBVA 1YZKA 4DWJA 1N5JA 2BCJQ 4MH0R 1Z28A 1GRRA 5FOXA 2FFHA 3O8RA 5DYGA 2VP2A 3WMEA 4JODA 2DFNA 4Q7LA 3FMIA 2DWQA 3DPUA 1Z83A 2P77A 2ZR7A 2OE2A 5E95A 4BPBA 5FBVB 4LJ9A 4RZUA 1K5GA 4RZ2A 5KSPA 3PGMA 4AK9A 2FZ4A 1Q3HA 3C16C 4BLRA 4RJLA 5FR1A 4BFWA 2MMGA 3QXJA 4LJAA 5JCZA 1G5PA 4Z8YA 2GCPA 3T1VA 5P21A 4HZUA 1RPTA 4EJSA 1W5TA 2CEAA 4B2LA 2A78A 3PITA 4LHZA 4PAOA 1HTWA 5DN6D 2WWYA 1P2VA 3BERA 4D4KA 1Q20A 1EFRA 4QGFA 2EFCB 3PENA 4C30A 4IDQA 3A37A 2CHGA 2GK6A 1XTKA 4I81A 2CL7X 4EFMA 4YMTA 5JS8A 4JBWA 4BQSA 3AF3A 1TF5A 3AF0A 5CYOA 3OF5A 5CDFE 4NZYA 3UPUA 1QHNA 2R62A 1WQ1R 4UKDA 4B3XA 2BMFA 4PPFA 5AUOB 2Q21A 2ODNA 4EDHA 2BVNA 2XB4A 4EPXA 1S1CA 4EKDA 4ABYA 3SQXA 3SE0A 1VYUA 1U2RA 2GJAA 1E79A 2HV8A 4YXWA 1RC8A 4L4UA 2ZRMA 1EBBA 4Q1EA 3P27A 4RD3A 2EFGA 2R2AA 3KKPA 3LVRE 3WNBA 4YQFA 1QHHB 4OQNA 1AGRA 2D4HA 2W58A 4CEIA 1EFRD 4URWR 4CT4B 4D0GA 2IYUA 3GEIA 3ZIAD 1SKYE 1DO0A 1Z6AA 2BDTA 2I4IA 3EASA 3ZQJA 5KU1A 1PV4A 3E9CA 1SKBA 2RGEA 1N6PA 4DVGA 1X6VA 2YKGA 3G0HA 2NIPA 3NTUA 2HF9A 3GP5A 4S2EA 1ZNXA 1Z29A 4B6FA 2VP5A 3QXHA 2WM9B 4JBXA 4M1TA 4V0MA 5BYKA 2IYQA 4JYBA 2A5FA 2GF9A 1W49A 4B3GA 5HCNA 2FJUA 3MCAA 3MGCA 4HYYA 4I1OA 4YXWD 2R9VA 1N6RA 1T8UA 4JIMA 3RS7A 2O8BA 3TVDA 3EZ2A 4GT1A 2PZGA 1LW7A 1NKSA 1VG8A 4NCHA 1OIVA 1NT4A 2ZYTX 1NG9A 1CRQA 3EPLA 1XX6A 3MRSA 1YR8A 2ZYUX 4DJTA 4I1VA 4OI1A 1X1RA 3TNFA 1G8GA 1W4AA 1QFXA 3ZZ0A 5B57C 1Y3AA 2UZIR 2GESA 4Q9HA 1GRQA 2RHDA 3N2IA 2NO1A 1YZUA 3MWLA 1F2UB 4DLWA 4ERNA 2P9YA 1XJQA 5TVKA 4A0HA 5TARA 2OUKA 4Z51A 2QMUA 1G1MA 2AXNA 4CDGA 3DHWC 1Q12A 1Q3TA 3ZVLA 1CIPA 1MT0A 3I3SR 1NVVQ 3TSOA 4Q7MB 1KSHA 1RPZA 4NCNA 1CS4C 1QRAA 3D7MA 1JB1A 2V4ZA 3IT1A 4WZAE 1G8FA 2C5LA 3ZVMA 2O8EA 1CR2A 3MJHA 3GQBA 4WAUA 2ZVPX 2QN6A 3GJ7A 4MQBA 2GKSA 2QI9C 4PHHA 4US0R 5F9FA 1II0A 1XZQA 3C5HA 1R4AA 3KUCA 3ZDQA 3KKNA 1Z2CA 4F7WA 1Q1EA 3WHLA 3C5CA 2NG1A 3A1WA 1HYQA 1OFHA 2HCBA 4F4CA 3V4RA 1QVAA 2PLRA 4O2RA 4V0OA 1G64A 2ZTSA 5FTMA 5FOVA 4GDFA 1KJZA 4JVNA 1KK1A 1DEKA 4XWKA 1FX0A 1GKUB 1W2HA 3RRNA 4EJSC 3T1TA 4EFLA 3EOZA 3KTAB 1E0JA 5FUXA 1DAEA 3RWOA 2VL7A 5TXGA 1MR3F 4GSYA 3ZD7A 5TDHA 3UMSA 1CTQA 4M4SA 4XTCS 5KNCA 2BJWA 1ZVQA 1I2DA 5SZKB 1ZUNB 4IEIA 4WZ6A 1TTTA 3CLVA 3FDZA 4F4IA 2WTUA 4W5HA 1AKYA 2X19A 5J4KA 1W5SA 2ZI5A 3X1DA 3R8FA 3LA6A 4P4SB 5HZHA 1DO2A 3B7GA 2XJ9A 4CEJA 4ARZA 1QHXA 2NPIA 4MGIR 1G8YA 5G3YA 3GFTA 4TMWA 3E5HA 3EAQA 5EUMA 3A4MA 3GJ3A 3NBYC 2YWFA 4RVCA 1N6LA 4Q9JA 4NCIA 2QBYA 3DZDA 2NO9A 2OCBA 1DBSA 4Q66C 4FN5A 1T4GA 1F3OA 1KKLA 2EWWA 3V9PA 721PA 2DFKB 2PX3A 2XSZA 1D6JA 3ZS8A 4P0TA 4LHVA 2PLFA 1J8MF 3KKMA 1DADA 4UJ3A 2OBNA 2DR3A 2QMOA 2VLIA 4IRUB 4XH9B 3AH8A 4IJ6A 2CL6X 3FJYA 2CK3D 3VNVA 4A0RA 4R2HA 2DCUA 2JLRA 3EWAA 3FFBA 3I5XA 1XTQA 1EXMA 4FXPA 2ZJ8A 3GW8A 1ETUA 2Z6VA 3BWDD 1P9NA 2B92A 2HUPA 1Q1ZA 3BH0A 3SJZA 2IS1A 4RKFA 4GPIB 2D74A 3GFPA 3CKLA 4FCVA 4RD4A 2ZXUA 2ATVA 1LFDB 1KSFX 2FF7A 2W83A 4OK5A 4HDOB 4PANA 1E9RA 2AL7A 1JQLB 2VP6A 4F91B 2BHRA 4PZYA 1ZINA 3TIFA 3ZYCA 1UM8A 4E03A 2GJ9A 2FSIA 5IT5A 3U3OA 2XSZD 3IQXA 3Q7QA 4P33A 4C3ZA 1D8TA 2P2LA 3CRQA 1IN8A 5B30A 3SHWA 3R7WB 3CM0A 4QBFA 2ZJYA 1L4YA 4RSGA 4QRHA 3I1FA 5CJPA 3GJXC 5FOTA 1U9IA 3WY9A 4BRUA 4TYNA 3BIFA 3KQLA 4HB2A 4A8JB 5BN5A 4DBLC 4CEHB 3DDCA 2QTHA 1DG3A 5FTJA 4OHZA 1SXJB 4DDTA 1TPZA 2JCSA 1E9AA 2R6GA 4R7ZA 2GDJA 2CHQA 1IXSB 4TQAA 1F2TB 1OH6A 3CF0A 3C8UA 3KXIA 3NDBB 2DHRA 1P2SA 1BMFD 4PHFA 4QXAA 4TLCA 2P65A 2W0MA 1VG9B 4IOKA 4KBGA 1B0UA 1GVNB 2FA9A 2QQ0A 3PFIA 3OESA 4BRWA 1IY1A 1ZD1A 1CEEA 2AX4A 2FSHA 1GTVA 1TUEA 4TYYA 4GZLA 1GNPA 4TTQA 5CJ2A 1KK3A 1JAHA 3U7EB 4A36A 2A2ZA 5ELXA 2PA0A 4PPQA 3KX2A 4KLNA 4Q5IA 1TQDA 5GADl 4PSKA 4LPKA 4A4DA 2VSOA 5JWOA 4DLZA 1G3QA 1OYWA 1SKAA 1XEXA 5EQTA 1OHHA 4BLPA 1AJEA 2ZS7A 1E3MA 2ZI3A 1OFTA 2D2FA 1KNXA 3UMFA 3LNCA 2WBLC 4JLDA 4AYWA 1XRJA 1K5DA 3H2YA 421PA 3I72A 5JCPA 1Q44A 4KLZA 2RGBA 4WXRA 2FFAA 2XEXA 4HDCA 4JLOA 4QJ5A 1DARA 5FBLB 4DLTA 1TEVA 2B8TA 2QNIA 3AKCA 1S0UA 2V1UA 2FNAA 2J0QA 3J81k 3K9HA 2VHJA 4MRPA 4C0LA 4ZI2A 3O8DA 4US1R 1JQJC 2Z43A 4PC1A 2IW3A 3F3YA 1DKPA 1HE1C 4DSNA 4EQ6B 1XEWY 2XGJA 1OHHD 4PAQA 5CLQA 2O8FA 2O0HA 4DDWA 1G20E 3FPAA 4D4LA 1FQKA 3TUZC 1HV8A 1ELOA 2WIAA 3K0SA 4Q03A 2AKAB 4QGGA 4PGMA 2WKQA 3WMFA 3CRVA 2QAJA 2V55B 1VCOA 2FFQA 1W36D 5AJYA 1G4AE 1ZMXA 5EP4A 5KO2A 3EG5A 1PUIA 3JVUA 3I8SA 4TYQA 3DB1A 2OV2A 3ZVNA 4PSAA 2IUTA 5LB2A 1OH8A 2GZAA 4XWAA 2P9FA 5K8IA 3LLMA 4DCNA 2OXCA 2RGGA 3L8YA 2HT6A 3KQKA 3I5YA 2QORA 1OB2A 2ZETA 4XVQA 5GVRA 2WJHA 4N1AA 3PJRA 1ZCAA 1SVWA 3AUYA 4QBGB 3FKSD 4TMTA 1G7SA 1ZW6A 4ILEA 2H16A 1UJCA 3KUDA 4Q4AA 3G82C 2EQBA 1GITA 2EFDB 2ZYVX 2CBZA 4J0QA 4R98A 1U9IC 3W5JA 3FHOA 1VG0B 4C0KA 5K8LA 5FPKA 4LC1A 2KBFA 3BGWA 3B2EA 4CVNA 2P0EA 1BQ3A 3EIEA 1G21E 1GZSA 2XXAB 3EIHA 1XXHA 2H7VA 3QQ5A 1NBMA 2BBSA 3JVVA 2Z4SA 5EXSA 3KQHA 2Q3MA 4IJMA 5HZKA 5DI3B 1ND6A 4A92A 1U0LA 3WP0A 4IOJA 1DVRA 1KY2A 4R71A 2GRJA 1N25A 4NDZA 5C4MA 4PR0A 4L5BA 2H4ZA 4N0DA 3GLGB 1T3LA 1Z0KA 2QMHA 2IUUA 2NTYC 1X1SA 3RWMB 1Q21A 4IJ5A 1F48A 2P6UA 3LBIA 4QBHA 3AVPA 4BLTA 3LQRA 4URZR 3GP8A 1OH7A 3SYNA 1LS6A 2BCGY 4FMDF 5EE9A 4ITRC 3ASYA 1LTQA 3OE7A 4LV5B 2ZE7A 1OXSC 2P5SA 1E2DA 1UJBA 3OI7A 3KJGA 3UANA 4ARUA 1NBMD 2EFEB 3JZMA 1L2TA 2QGZA 3TQCA 3HU1A 2XNDA 3HYTA 3AB3A 1AS3A 2QPOA 4KSBA 3MWYW 3QKRB 2PT7A 1M8PA 3BH6A 1OSNA 3EARA 2Q3HA 4OHVA 1M7HA 1M2OB 5BWMA 3MWKA 5JJLA 2GXUA 2EWVA 4JKIA 3U7GA 5CB6A 1Q0UA 5E7MA 5KYKA 3AVOA 1P72A 1MO5A 1UKEA 1R8QA 5EP2A 1GRNA 4XJXA 3WXMA 4A82A 1TQ6A 3D6TB 1JECA 1KI7A 2QGNA 3QKSA 4CRWB 4P3YA 5L3VA 4ARVA 4TTRA 1C7ZA 2G0NA 5GJCA 4M9QA 1W47A 2OT3B 3W8RA 3OE7D 2QE7A 3QXCA 3K8YA 4ZO4A 5FUYA 4B43A 4XSGA 3GEEA 5FTKA 4AROA 1S8FA 3LQQA 4Y0VA 1HY3A 1SVIA 2VYFA 4K46A 4QNMA 5CYPA 1SK8A 2HLDA 4D80A 5C4GB 621PA 3W34A 1Z8FA 3LL4A 2W6JA 5FPSA 2QENA 3TLXA 4A2WA 4AYTA 4ZI3A 3DCYA 3NH9A 3TKLA 4DEYA 4UNRA 2JJ1A 4A1FA 1FPMA 5BN3A 1GL7A 2LKCA 2C8VA 2ZSDA 4QOSA 3V00A 2CHVA 4HATA 1IOZA 2HF8A 3QE0A 2EOAA 2W6IA 2Q6TA 4F92B 3MFYA 3F5FA 3LNTA 4TMVA 4IVQA 3VNUA 5JS7A 5EXXA 1GG2A 1AS0A 2FSGA 3GD7A 1WA5A 4M8NE 4DEXA 1N6KA 3FKQA 4RD1A 3PEWA 5JLJA 5EJEA 3K9GA 1SXJE 3B6EA 3E1SA 2HLDD 4C0SA 4F93B 3LFUA 1I4TD 1X8LA 4WOPA 2ZE5A 1SZPA 5H70A 1JR3E 1N5KA 1QBKC 2G77B 4NBSA 3OEHA 5G40A 4LV8B 5PGMA 1CJMA 3VAAA 1NF3A 3FTQA 5DSZA 2WWHA 3VR2A 4PQYA 4TT3A 4A6XA 5F3WB 4V0NA 4ACAA 1T5IA 2ZJBA 5FFMA 1YZLA 2JJ1D 5JZVA 1G4UR 2AXPA 3NXSA 5EZ6B 2JLYA 2ZS9A 3NDPA 2W6ID 1ZJ6A 4BFZA 1CJKC 1VIYA 5E3HA 3R9XA 2OZEA 3EXAA 1R6BX 3NVAA 4PX9A 4UNPA 3R9IA 2A30A 2A5YB 1Z6TA 2IHYA 4EJSB 4GMDA 3SBDA 3SBEA 3QENA 3A1TA 2YV5A 3JZAA 1R5BA 121PA 1E9CA 2MMCA 4ZKEA 1S1MA 1TX4B 4IOLA 4QM7A 1XF9A 4X8OA 5AUQA 2B6HA 4O2LA 2FWRA 1YVDA 2OESA 3NEJA 4KFSA 3OEHD 3GLHA 3K70D 4MDEA 1XTRA 4TT3D 2L0XA 3GJ5A 4RZXA 1TNDA 1R2QA 2FX3A 2ODBA 3CZQA 1SVLA 4JLNA 5FI0B 4D4MA 5HKKD 3IT2A 2XITA 1SVKA 1R10A 4PC6A 1W48A 3SZRA 2DWOA 3KKOA 1M6NA 2A9KA 5J5CA 2BBTA 4C0JA 4R2IA 3OIUA 1QHYA 2FDCA 2ZRBA 5CLLA 2ZRFA 4KVGA 4B3FX 5KSYA 1H8HD 3ADCA 2GCOA 3ZZUA 1YR7A 5H1YA 2FEMA 1P5ZB 1XCMA 3UIEA 3B1VA 4GOXA 4BZPA 5A5GA 4CEIB 1EFHA 1L8QA 2IYLD 3CBQA 2MSDB 2J0UA 2F1RA 4JL8A 1OKKD 1XMSA 2WU0A 3SC3A 3K4PA 3VQTA 1EWQA 1KI6A 5AJVB 3KKQA 4LC0A 4TLDA 1OXVA 3VR3A 1XQ9A 2ENUA 1BKDR 4CYMA 2VHUA 3CO5A 3C7KA 1T3SA 5J4YA 1N6NA 1U98A 3I73A 1D9XA 5AJWA 2VBCA 5KTYA 2EYQA 1WP9A 2VRWA 3BFVA 4D6PA 4CW7A 1G18A 1G19A 5LDDC 1XMJA 4B47A 2WWGA 4UXIA 1YR9A 4DT1B 3R9WA 1JEDA 1NIJA 1ZUHA 2O8BB 2HHJA 2F1HA 1SHZA 4AKEA 3QI2A 2V9PA 3IIKA 1M7GA 4IW3B 4ZCMA 2B7CA 3BAFA 4TMZA 1YR6A 1OFIA 1Q1QA 2CDNA 3C4JA 4G5GA 2ZS8A 1ZYUA 4C0BA 2GAOA 4AY2A 3PXGA 1T5LA 2KB0A 4PHTA 4CGZA 3GJ0A 4DLSA 1VHTA 1NSFA 3D8HA 2EFHB 1FFHA 1XPUA 1BH2A 5JWHA 3N5CA 4ZDWA 4LJ7A 2C96A 2GZHA 3OIVA 3S1AB 3MXOA 2F43A 2OCPA 2BEJA 5DNYB 2O8EB 4QG7A 1JNYA 2WSSD 3IO5A 2Z5FA 2C78A 3LXRA 3Q5EA 1QHFA 3L0PA 3E9EA 4B2PA 1OF1A 1YZQA 3LAWA 3HP1A 4LHWA 5H68A 1UEIA 3K70C 5KPJA 3NKVA 1E2NA 1XCPA 2R65A 4XWOA 2F1JA 4KV9A 3QVVA 3VR1A 1R0ZA 1QVRA 3QF4A 4C7OA 3CF6R 5H8WA 3PR1A 1SQ5A 5L3RA 3O0TA 1RRGA 3ZIAA 2GJKA 3VX3A 3K0FA 3K53A 1ZAKA 1N5IA 3Q72A 2OXRA 1FNNA 1U0HC 4M1YA 5DIFA 2QZ4A 1NJGA 3B78A 3GLGE 3KDSE 1FX0B 4LJ4A 4D4JA 2AFIE 1BO6A 3W90A 4WA7A 5JSZA 3U61B 4BLOA 2O8CA 4RCYA 2G6BA 5JEEA 5B2ZA 1TIPA 3OHMA 4KXFB 4RZ3A 2IXFA 2FGKA 4KCGA 1YJ5A 3PEYA 1S4QA 4ZDIA 1Z06A 1EFCA 1TL7C 3FDZB 3IEVA 1GWNA 4IDNA 3THXA 2C2HA 8OHMA 1NN0A 1OIWA 1S96A 1KNQA 2J5XA 2ZAMA 4NTZA 3T5DA 3M6AA 4CEJB 1KSJA 1KAGA 1LNZA 3X1ZA 4B73A 2BV3A 4NH0A 4Q1DA 1QDEA 3UMRA 2P78A 4A9AA 3RS0A 2O5VA 1KIMA 2H17A 3K4QA 2ERXA 1JEEA 4C4PA 1IQPA 3CNOA 1IAQA 3EA0A 4HB0A 3P1JA 1E9DA 1NKTA 3CONA 1F6BA 2OBMA 1KMHA 3RNLA 3SYKA 4CF7A 3LVQE 2QBYB 1XB2A 3FE2A 1KI4A 1I2MA 5IHPA 1R0YA 1TEXA 4MYHA 5IRCD 3QVUA 2N1BA 2RB4A 2WWFA 2BJVA 3AP3A 1PZNA 2AN9A 3AUXA 3ECCA 3O8CA 2D7DA 3SQWA 4TYWA 2CL0X 3AEZA 4LI0A 1XBTA 2GZDA 4YMVA 3ZHCA 3F3KA 3EA5A 4PAMA 2GFIA 2VF7A 3QEJA 1IM2A 1Q1BA 4G3XA 1GKIA 2OLJA 3F0TA 2BM0A 2QUZA 4M9XA 4Q1BA 4EPWA 1DG1G 2IC5A 2HXSA 4ESHA 1U8ZA 1VHLA 3UWOA 3TRFA 1XD2A 3W9YA 2WWIA 4WIAA 3RYTC 1F60A 4URXR 2P75A 2YOHA 2VO1A 2WJGA 2P2YA 1GL9B 5FBWB 3IUYA 1E2IA 2OILA 3RHFA 3A1UA 5G53C 4IVPA 5KDLA 3F2IA 1P61B 3O8BA 4MYTA 5JI2E 1YRAA 1MH1A 1JAIA 2PX0A 2XNSA 2BOVA 5BW8A 1P60A 5DE3A 2R6DA 3FFAA 2CLCX 4QGAA 3T15A 4B32A 2FU5C 3ADBA 1WDTA 4C0HA 4D2IA 3T34A 4ASUD 2VP4A 4MGKR 2NQ2C 4WW0A 5LPNA 4OI4A 2Y8EA 1E2EA 1UEJA 3D8BA 4ON9A 1U8YA 2JAQA 4FWIB 1HT2E 1NLYA 2HJGA 2OAP1 3NC0C 4FI3C 2B8WA 4B33A 3AP1A 1N6IA 2XZLA 2ZUDA 1ZP6A 3IKJA 3DL0A 3VHXA 3FMPB 4NKRA 4P32A 2E87A 2RAPA 4QM6A 2ZSBA 1VECA 1LY1A 2YC2C 4RY2A 3U60B 5K8UA 2QM7A 4TSRA 4JBYA 4DHEA 1FNMA 2G1KA 1MABA 1QZXA 3B85A 4R9UC 3AVXA 2X2FA 3KFXA 4BFTA 5J4LA 2ANBA 3GLIA 1FP6A 4UXJA 2VF8A 3BC1A 1KJWA 4HLUA 4OKSA 1CJTC 4E22A 4WZBE 1J90A 3QSYA 2OEPA 3ZGXA 5B58C 1I4LD 3CPEA 1TU4A 1UPTA 1VG1A 2BIFA 3K09A 4HAWA 1ZNZA 4LPSA 2CK3A 1BIFA 3GEHA 3VMFA 1O3YA 1X8KA 3GJ4A 4XD7A 3EWSA 1RRPA 4RFVA 3TW8B 4L15A 2JJ2A 1XEXB 2GEVA 1E4YA 2WJVA 2GEDA 4H9GA 2JASA 4LYJA 2WNIA 1YQTA 3KXLA 5J4HA 3LX5A 4FWTA 1XWIA 2J3EA 3T12A 2QPTA 3C15C 1G3IA 2ZI9A 3LW8A 3ZLJA 4AKHA 3Q85A 2HXYA 5FPTA 5JRZA 3N2EA 3RANA 221PA 3K0AA 3RRZA 5IF9A 2WJIA 4M53A 1R7RA 5JJKA 2FV8A 2IKQA 3VKWA 3LO5A 5FTLA 3I4LA 1R5NA 1NMZA 5LD2C 2AFHE 1UKVY 4EO9A 3CR8A 4QHSA 1IJFA 2PJZA 4XD7D 2JJ2D 1H8EA 3BORA 3K9LA 4B76A 3A4NA 3KL4A 2ODEA 4YDSA 2O8FB 2EKZA 3OIYA 1W7AA 4M9SA 4YDHB 3M4YA 2C95A 2DFLA 1J8YF 1Z6XA 2WKPA 1KO1A 1UADA 3MJRA 1ZM4A 3A1VA 4FW9A 1Z47A 1R0XA 2H5EA 1IONA 1BMFA 2XTZA 4LDJA 4HAVA 4IFBA 1IHUA 5J47A 3P32A 3PUXA 1WBBA 2MSCB 3HJGA 3LDAA 3MSXA 4M22A 3FB4A 1II8A 1YZGA 1AA9A 2CCGA 4ODIA 3ASZA 1HA3A 2VEDA 5SZIA 4MDFA 2P6OA 2H57A 2OSBA 1LF5A 1XD9A 2YINC 2RGCA 1KDPA 3TAHA 3Q5DA 3U44A 1H8ED 3B8HA 4HZIA 3RLFA 1ONBA 4LSGA 4QBIA 3HR7A 1G16A 2C04A 4YMWA 3K0EA 4BE7B 4KHZA 4PC3A 2WIBA 1C80A 1OXXK 4Q4AB 1ZD8A 3G5UA 6Q21A 3IIJA 1RRCA 3BJIC 3W3AA 4LJ6A 4EPRA 3WYFA 3IEUA 1FMLA 4FMCB 2JDIA 4WXPA 1Z0FA 1U94A 1KHTA 1P73A 1UBGA 4MYCA 1W1WA 2J7KA 4PZLA 4TZ0A 1QG4A 2Q0HA 4JLJA 4Q47A 1HT1E 2OM2A 1SGWA 1SKQA 4AURA 3MBKA 4YLGA 3LBNA 2PT5A 5J40A 1T0JB 2IYYA 1XXHB 1KI3A 1EFTA 2GXAA 3NBFA 2BWJA 2HYDA 1Z2AA 2ZU6A 2ZRCA 4NCKA 5DISB 2WMNB 4E07A 1RVDA 4AYXA 3BB3A 3HPQA 2C9OA 4XVRA 4TTPA 2ASEA 4MKGA 3LW7A 2ZPTX 1P4SA 1PVOA 3GLFB 2IT1A 5FL7D 1E6CA 1NIPA 1US8B 3CWQA 1T91A 1SVMA 4NYIQ 4HSEA 1G8HA 5GJBA 2BMDA 1W0JA 2Q3FA 1WMSA 3KTAA 2JLVA 4HLUC 2JDID 4OQLA 2ONJA 1EFUA 1T9HA 2RKOA 1KZ7B 3SJCA 3PQCA 3K09C 1E9BA 3HJNA 3WYAA 1QF9A 1DKNA 3HU2A 1E2LA 2N42A 3A4LA 2RH5A 5SZJA 5E4FA 4JZKA 1G7CA 4NYJQ 4EPTA 4LZZA 3EPHA 4E3WA 2ZRPA 3V4FA 3K1JA 3FWYA 5KHOC 1J70A 4POAA 4HBZA 2GNOA 4HAYA 5AR1A 5F98A 5K8TA 1V37A 3AV0B 4LK2A 4M2LA 2QU8A 4Q02A 5FOSA 5CK5A 1W2GA 2Q9BA 3I92A 5DH9A 1YJXA 1T3HA 1LS1A 4TL7A 1ZIOA 2NOAA 2FGJA 4NMMA 1DAFA 3CX7A 2GTPA 4Y0AA 1OXTA 2JGNA 4RD6A 1W0JD 1BQ4A 2REBA 4Q19A 4JMPA 1JJ7A 1NLZA 3FKSA 3PG5A 4DB4A 2CJWA 2J87A 1O87A 3LBHA 2UVQA 1G9XA 1XZPA 2JATA 2XX3A 3OAAA 4FCWA 3IHWA 3GPLA 4KVAA 2GF0A 4TMKA 5EP1A 4TQUS 4B44A 2LCFA 3FMOB 4D26A 1ZD9A 4V02A 1SULA 4RD0A 1ZC4A 5FOUA 2WHXA 2I1QA 5KSZA 3NHAA 4DCTA 2ZUCA 2YJTD 4D82A 2QP3A 2WPDA 2WJJA 4HUQA 4JS0A 4EPYA 5JSZB 3EZNA 2D3WA 1NRJB 2W0SA 2C03A 3WNDA 2V8OA 1JXOA 3FMFA 2QRNA 5JI3E 3M1IA 4I99A 5FUWA 4C2UA 3U4QA 3OAAD 3TUIC 1N6OA 2DWPA 1GL6A 1KO8A 3U2QA 1GILA 4M1WA 4EMBA 2XZPA 4QJ3A 4HUTA 4Q9LA 4HDQB 4A8JA 2ZRHA 5L8VA 2GEUA 2QSYA 4D0LB 1XEWX 4Q9KA 2IS2A 3K70B 1GAJA 2IA5A 4ZDJA 1NN5A 3RS4A 1F2TA 1GDDA 2GVDC 2WPDD 3A8TA 2V3CC 3WBJA 4JOCA 2QP9X 4N0EA 3FVQA 4HLCA 4X8MA 2RGDA 5EZ5A 1EG7A 4LHYA 2K5UA 1N5LA 2GILA 3NIBA 3Q8XB 1XP8A 2AK2A 3CH5A 3OFNA 4PO8A 4G5OA 1Q57A 4M21A 1P9WA 4OBEA 4QHTA 1KKMA 3BB4A 3L82B 5E7JA 2B7BA 4GPZA 4B3DA 4GI7A 1A82A 4PTLA 1JPNA 3CRMA 4A2PA 3LLUA 4JSTA 3T1OA 4NYMQ 3VR4A 3ICEA 1ZNWA 3BD9A 1QHSA 2ZIAA 4DLRA 1D2MA 4MGYR 4NHOA 2ZJ5A 2WOJA 4TN1A 3TR0A 3U5ZB 1SXJD 1C81A 1NN3A 3AF1A 4L8GA 3WMGA 1E2JA 1HQCA 2ZROA 3BFXA 3GLHB 3EZ9A 2FPKA 1BYIA 3REFA 3A6PC 2IYZA 1QWOA 3VU9A 2PH1A 4MYUA 1B23P 2N46A 1E59A 2ODWA 2QA5A 5TY0A 2DPXA 2DB3A 1G3UA 3UG6A 3EX7C 3OFND 1W36C 2E1RA 3C41J 4TLEA 3QY0A 1UKZA 4HEJA 1KMQA 4XTRA 3NC1C 1NVUQ 3U3RA 3O47A 2Z83A 1N2CE 4FCTA 2QQEA 4P31A 2GCOB 1E2HA 2HCJB 4HAUA 3FHTA 1G6HA 4BFSA 1SVSA 2QPAA 2AHOA 1YKSA 1NVXQ 2J0UB 2OWDA 2XOKA 1NN1A 1RJ9A 1Z6GA 1IXRC 3ADKA 1KI6B 4LJYA 3SJAA 3B1WA 4PO9A 3WP1B 1C4OA 4FDTA 2SHKA 2ZE6A 2IBMA 2PBRA 2IXEA 2AKYA 2WAYA 3BOSA 3X1YA 4BEBA 821PA 3UG7A 1EK0A 4LJ8A 3TUJC 1OH5A 1T8PA 4IFEA 2H1LA 1G7RA 1RYFA 3SN6A 4BGDA 1JI0A 1I4DD 3HYRA 4B34A 2A5JA 4Z8XA 2X8AA 4JJZA 2KE5A 2C9YA 3PEUA 3LG2A 2FOLA 3KKKA 4MRSA 2XOKD 5TV2A 5CU7A 2ZJAA 1XPRA 2REXB 1WRBA 2OAQ1 3NG1A 3OEEA 1P9RA 3QF7A 2ZEJA 5EUQB 2IYRA 2CXXA 2BC9A 1XTJA 4W5JA 4BLQA 2GXQA 4DLYA 4MRVA 4A2QA 3F8TA 3TR5A 1HQYE 4AG5A 2WOOA 3EC1A 1JALA 2YN2A 5HTKA 4OJKA 1MO3A 1KI1A 4JJKA 4LUCA 4PQFA 2F43B 5HKKA 3SHFA 3HDTA 2P5TB 3RAPR 3PEVA 3LRPA 4LYFA 1RRFA 5IK2A 1TMKA 4YMSA 4HLQB 3GCGA 2E9SA 1G3RA 3WRXC 1XXHE 2AWOA 3T61A 4HZUB 2IYXA 3QKUA 3SS8A 2W2TA 1FZTA 4QJ4A 3CNLA 4TL6A 4Q4HA 2XXAA 1H8HA 1NBME 4MUBA 4B75A 4BFXA 1WB9A 1WF3A 3EPKA 4EIWA 3NBZC 3H1TA 1WE2A 1P2UA 3OEED 1VCMA 4GNKA 3RC3A 2ZUBA 4C7OB 3U7FB 3GJ8A 2V6IA 1H2EA 5M04A 1E96A 2R6CA 3GLFE 4U02A 1OKKA 5FUVA 5DI3A 3NFYA 5GJWC 1CR0A 3K0FB 3RDPA 1CRPA 2A5GA 4V0KA 3B5JA 3ZVRA 1RYHA 4B71A 3LD9A 2ZRGA 3D3QA 4Q1FA 3GLGA 4AD8A 2ZRNA 5CDFA 1JJVA 1NY6A 3RSOA 1E2PA 3QPWA 4ZDKA 1MOZA 2F9MA 1IJEA 4B6EA 2O8CB 4QIHA 1ZM3A 1HEIA 5IK2D 2JA1A 2YOGA 4JT2A 3KJHA 4ZIRA 2F7SA 3MLEA 5D3MA 2ENWA 1HH4A 4D0NA 2J7PA 3D6AA 1DS6A 4PXAA 3THXB 1VIAA 4L16A 2OFXA 2ZREA 5FTNA 4DCSA 2R44A 1TUIA 2QY9A 3SNHA 1G291 2OO7A 4GFDA 3AF2A 4OHWA 5EE1A 4US2R 4FINA 4LCBA 2J41A 5KNDA 2FPMA 4PQRA 2GAAA 5LD2B 2PL3A 2XB2A 4BFYA 3CRRA 5BN4A 5L3QA 3PIRA 1X3SA 5C1BA 1KMHB 1VKJA 1KDOA 2CE7A 5G3ZA 2H0QA 2PMKA 4PO1A 1FTSA 4JVMA 4I1SA 2QG6A 2IEZA 4A0GA 3LX8A 2ZJ2A 1Y63A 2AR7A 4TQ9A 1IN5A 3HU3A 3W6PA 2J7PD 1NY5A 2WSSA 2A6PA 4B3CA 2ORIA 1J7KA 4DIDA 1XNJA 2GHIA 5AK0A 2ZRLA 3THWA 1NVVR 1PJRA 2IS4A 2IF2A 3B9QA 2P6NA 2YN0A 4LWZA 1TF2A 1VYTA 1ZUIA 2ZJOA 3E2IA 1XTIA 4LBWA 1A7JA 1DKQA 1XD2B 1TU3A 4OHXA 1OV4A 2OCYC 3X1XA 1E9FA 1EX6A 4PFSA 4YC7A 2RGAA 4JLAA 3L0SA 4BWYA 5JEDA 5JWRA 2WSMA 2WWXA 2JEOA 4ZCIA 4NCJA 4OHYA 1CU1A 3BFKA 4MRNA 3DKVA 1VDZA 2AWNA 2IYVA 2JIZA 3TQFA 4AKGA 4JSYA 4IXNA 2ORVA 4B48A 3LY5A 4G1UC 3ZS9A 4DZZA 2H8KA 1W4RA 3CRW1 2JLQA 1ODFA 2IYSA 3OZXA 1M74A 4OQXA 2QL6A 3TE6A 1Z0AA 4M1SA 2FEOA 2V1XA 3TMKA 4Q01A 4OK6A 4L9SA 2LKDA 1DAIA 2J0VA 1BYUA 2FMXA 3DM5A 1E2MA 2JLWA 3TJZA 1ESMA 1ZBDA 3CZPA 3EZFA 1CBUA 1U99A 2O52A 4RFSA 4TSFA 2P2ZA 3W6NA 1DELA 3NBXX 5ANRB 2W2XA 3TBKA 3TGPA 1N0WA 1RKBA 3WYGA 5C46F 3FGNA 1KGDA 1E9EA 3E9DA 3R8CA 5EE3A 5F9HA 2CCJA 1BOFA 4IOMA 1MABB 3DM9B 2IXGA 1S2MA 2JIZD 3K0CA 3KFVA 3PV0A 3RRYA 3U3JA 4H1UA 4XSHA 3RSLA 3GLIB 4W7SA 2QAGA 2ERYA 4DKXA 3GMTA 3CNNA 5KUTA 1COWA 1VPLA 2F90A
chains in the Genus database with same CATH superfamily
1GV0A 3WLMA 1GPWB 3F7MA 2O8DA 4G67A 1PHPA 2BEVA 4ZGWA 5BWNA 3D0OA 2PT9A 1JEAA 1J22A 2WP0A 2A9JA 2AB0A 5EINA 4YREA 3GDFA 4X66B 3HMKA 3L4JA 1UT5A 5AM2A 1L5ZA 1II9A 1WPRA 1RXVA 4I3GA 1Z4OA 3JQBA 2DQ4A 2VYCA 5FR2A 1DGQA 3W6OA 1UBFA 2BHSA 5K0TA 2C82A 3EVCA 2PUCA 4J43A 3NWOA 3RF6A 3UK6A 3HU5A 3GFOA 2C94A 3A6GA 1YJBA 1E2GA 3CNEA 4O3FA 2I8LA 5BR4A 2CCKA 3TRKA 3GVHA 3TW0A 3D31A 4WFIA 1N92A 1Q3KA 1GDHA 2C54A 3B60A 4G2TA 1OY1A 3P0JA 4U7PB 3V1NA 5BW4A 2UXDB 3BRQA 4RTRA 4TWIA 3H4VA 4KDFA 1QB7A 4HSGA 5IXJA 3DZCA 2CYBA 3PNBA 4WCFC 1JR6A 1O0CA 3TD6A 1RWMA 3C2QA 4UAVA 5ECGC 2BGKA 1JZQA 2HX1A 2X6QA 2XMBA 2ECPA 1KQGA 2H4WA 5E9JA 1AQIA 1NWCA 4FR0A 1DC3A 2AT1A 2ID7A 1F20A 4I8DA 1GZ3A 1M1NA 1S9HA 3OURA 4YAWA 2PYIA 1PJLA 1V2HE 3T5TA 3SYMA 2AFHA 1KDTA 2J3MA 3R3UA 4KSCA 1MRNA 4QXOA 1YQQA 3T06B 3ABIA 1N3LA 1WUTA 1NXXA 1E4VA 4TRNA 3R76A 1NVWQ 1KFJB 1ODJA 3OIDA 1HFWA 1MC5A 1GYQA 3AY0A 1C3VA 2Y4NA 1Y7HA 4LVUA 2R97A 1XVUA 3QJYA 4LZJA 2DC1A 1K6MA 1SUIA 1G6KA 3TRDA 1GU0A 1SUSA 3SR0A 4B7AA 2OHOA 5LP6F 2ZQ5A 4UNSA 1QYIA 3IB3A 4X91A 1JH8A 1AUPA 1G63A 3NS7A 3R0ZA 2GETA 3UB3A 2R5NA 3THYA 1YFJA 4KNYA 5K3EA 1KYIA 4IIJF 4DWVA 2C20A 2YICA 3FNBA 3EUEA 5DP1A 1FDSA 1V7PC 1FOEB 2ZSFA 4RDCA 4BOYA 1ZJYA 4MHTA 3HYLA 2EFYA 4MDYA 3UMJA 4R1LA 4XGNA 3F9RA 2YVLA 4Z4GA 3RG2A 3ZZMA 2WD7B 5AKEA 2Q3CA 2YNMA 1XZLA 4CJXA 3HQ4O 3U44B 4RU1A 2OD2A 1Y6RA 3IUNA 2HJVA 4LDPA 2C5AA 1V35A 5B1DA 1A4UA 2EP7A 4ME6A 5HG0A 2YWHA 2Z9BA 4CIDA 2FEAA 4ESVA 3GRCA 4OXIA 1G8MA 4OTZA 2G88A 3TAUA 2FPRA 4BCDA 1W5FA 2ECKA 3PP8A 1UC5B 2YJ4A 3G8BA 2NUTA 1QH1A 3C87A 1GPLA 3CZAA 3WKCA 5CVUA 1V5FA 2ZAYA 1SIUA 4E09A 4O1MA 1F12A 3OPVA 1K3FA 4P80A 1BMDA 5CLJA 2Y3IA 2CNWA 4ENVA 1E94E 1Q74A 3NU1A 4MUXA 4ZAVA 1YB6A 1XP5A 3MS2A 2EBUA 4IFIA 4MQFB 1L5NA 1ADYA 4NYIR 4DSZA 1ZAYA 3HEAA 3JR3A 4JA2A 3SDZA 4DV2B 1LQUA 1UJMA 1JHUA 1KXZA 1M5RA 1LTHR 1UZMA 2LR0A 1ZCBA 3DCJA 2BEKA 1P1FA 4CF4A 1H2YA 1LPSA 1YA4A 2JIPA 3FPKA 2C1ZA 4M1KA 2OG2A 4NBTA 3OCXA 5DHQA 1P5RA 3QVKA 1WW8A 4EPVA 1DBIA 1UFQA 4IQ4A 4B1FA 3B1YA 1ARZA 4UBKA 1A2QA 5KNBD 4S35A 2Z6UA 3IT0A 1LC0A 2HBZA 4JL5A 4ZAWA 1VJGA 3I23A 2VI5A 5IABA 1D09A 1M7BA 4EUHA 1SQ0A 2HDNB 1OFUX 2VAXA 3CW9A 3FDJA 4LDRA 3QNUA 4H3KB 4Q3BA 5IC5A 4NYJR 3WQBA 3K0CC 4PC2A 4K6MA 2GJ4A 2A67A 3RT7A 1GNLA 2KSQA 2DJ5A 3N8IA 3B48A 2VPXA 4PNEA 3J80A 2HMTA 5EP3A 3IO3A 3ILYA 4EKGA 4I5FA 4WBSA 4JL6A 3G0BA 2XMSA 4OL0A 3ZY4A 4CMEA 2ZXEA 3EGCA 4G24A 1O96A 3QEOA 5COAA 3V34A 3D2CA 4MO2A 4C4XA 5FP0A 4FMBB 2V6JA 3MCZA 3AJAA 2YMMA 3IILA 5ALSA 1ESEA 3EW9A 2EIXA 3JU3A 4EKNB 2QUAA 3GBSA 4E14A 3O3NB 4WLNA 2J46A 1RLJA 1QHHA 4HQLA 3JQBC 3QFCA 4RPIA 1AKNA 4UEJA 2B7LA 3VX4A 1XDUA 2VT7A 3TCXB 4MWTA 5DTMA 4C0QC 4HRYA 1RE0A 2KWIA 3OKFA 5JHGB 2C2KA 2PEYA 2VSYA 4AKIA 2I2XB 1GD1O 3NRJA 5D3QA 3B2NA 3P20A 5KAPA 3VR6A 1RW4A 3GPCA 4U2BA 2YMLA 1BX1A 1ONNA 2FZLA 3G3EA 1IBRA 1TXGA 2AC7A 3A70A 3C3XA 3MWJA 1DEOA 4JVSB 2GUWA 5E9QA 1EFDN 1SCBA 4IAOA 1N3BA 3E7FA 3U3MA 1KO4A 3K9FC 3R3ZA 3EVGA 5EC8A 1E98A 2W7TA 3FY4A 2I1WA 1Y1KE 4ZWNA 5IAKA 5H5JA 4QODA 2WP8J 3ABOB 1QQ7A 3NIDB 3RU9A 1JBEA 3OTHA 3Q6MA 4KGXA 4DLVA 1RM5A 1ESNA 1O9BA 4LGMA 5IAOA 5KTOA 1UUFA 2CFIA 4QOIA 4WKPA 1FSZA 5BNFA 5I45A 3V6LA 3CINA 3QLTA 3MTDA 4MWCA 5B3KA 2V7QD 1EE9A 4J8PA 3Q88A 2A86A 3C14C 4ENUA 4HF7A 3S8YA 1D6MA 1G9TA 4YK7A 2CXTA 3DFIA 3HMQA 1NW4A 3EF1A 3JQ6A 4L5YA 4WCDA 4KIWA 3DE1X 5GIPE 1MNAA 4G0YA 3V1MA 4Q7QA 2ZWIA 1GR1A 3PNOA 2SKCA 4OHCA 1GOTA 2P3SA 1ENOA 3KOUA 4C6SA 1QCZA 3GK3A 1WMDA 4JLMA 5HDQA 3EGEA 2DWCA 4EVRA 5KSOA 3OQNA 5DO9A 3WLHA 4OM8A 4NVRA 5BYJA 1D9ZA 1ECFA 2NZJA 4R1TA 3ZJ4A 2B8JA 3U4QB 3GEPA 4UTOA 2Z98A 3FUVA 2EKDA 2G0AA 3I61A 2VK4A 4ARIA 2VP9A 2AMVA 2RFLA 5E9AA 5IVDA 5A5EA 3HEBA 1ISMA 3LC7O 1Q7EA 3PK0A 3AVUA 1BNCA 2YNMC 4Q37A 3RJTA 4WHMA 5C2JB 2GXSA 3KQMA 2PRYA 4PYIA 3DUFA 3TLGA 3ELBA 1F0PA 1EP2B 1PV2A 1O6ZA 4KUHA 1W96A 3T3MB 3WGOA 1E4EA 3SOZA 3FJ1A 1AKMA 2EQAA 2OWEA 1YFKA 2E6KA 1Z6QA 4RF2A 1DKLA 4PX2A 3Q8WA 1IBKB 2WHYA 1FQWA 4EF5A 2YVKA 1WCV1 4NYMR 1CR4A 1N5DA 2XVZA 3A04A 3IIEA 3NASA 4KP7A 3R7LA 3TW4A 1TM5E 1XEAA 3NC4A 1E1NA 3I9OA 5CNIA 3HGMA 3OCCA 1O6GA 2FW1A 4KWIA 2IKSA 1KJYA 2OFOA 1SVOA 3D8RA 4RVSA 3AL2A 3NVKI 2FN7A 2Z4RA 3FDIA 1KSGA 1TC2A 1ZNYA 2CXUA 2QE6A 3C48A 4RKQA 1I7PA 3GEBA 1R18A 5BV2P 3GLIE 2Y1OA 3B9BA 5GVSA 3WLNA 5EE0A 2QYTA 2AZXA 1EH5A 3PI6A 4EGJA 2KI5A 4NZPA 4G01B 3UA4A 4CL8A 3VU0A 5C8YB 2FTKE 1KH3A 2CZCA 2W2LD 1QZ3A 1XA3A 4BFUA 2NZWA 3NR2A 4TTSA 1Q0QA 3VC2A 4ND4A 2CVHA 2VAVA 1U3GA 4OF4A 4AW9A 1YGYA 2Y1GA 2I3ZA 3LKBA 4RK6A 3ETLA 4X0EA 3VU9B 1JF8A 2ZSEA 1O6FA 2ZJZA 4Y30A 3S28A 1TJPB 3SDSA 4C9BA 3DTYA 1LQ2A 2QT9A 1JLHA 1OWPA 4DKJA 5FUBA 1SZDA 1W4LA 3RSGA 2RHLA 3EGVA 4BP1A 4CMEC 4KQIA 1W29A 4ATNA 2WMOB 1XU4A 3QV1A 4DLXA 2NAFA 1XXLA 4QUJA 3KTDA 4JJ6A 1MQ9A 3JYLA 4LYAA 1S5PA 2FK8A 3WICA 2RHJA 4XCVA 3W0LB 3B1FA 4B4WA 3TG8A 2C77A 4LZOA 2AOVA 1OA1A 5FNVB 1KQOA 2GJ8A 4Q82A 3WL5A 3WRYA 3LOUA 3CKKA 4I9FA 1KR2A 4NBWA 4TM7A 5AWFC 3RRMA 3KCNA 3TZBA 4BO1A 2P6PA 2BM1A 2ZBPA 4KFUA 2HH9A 1ZGZA 2XJ4A 2Y1FA 3EC2A 1RJ9B 3GLTA 3QW4B 4MQ6A 1M1XB 4LJ5A 3ZU2A 2E4ZA 2ZU0C 3AOEC 2AVNA 2FSFA 5IDVA 3R20A 5AOBA 5HE8A 3TGWA 2V7XA 1WXFA 2HNBA 4R1NA 1BCRA 1IZ8A 1RDFA 1UDXA 1EWRA 3ZX4A 4DL9A 3IJRA 1AKTA 3IYLW 1ZHHA 1Z45A 1FYDA 4WPGA 4BCCA 4LF8B 3ZE9A 2PLAA 4UBMA 1Z6PA 3PFHA 4OSOA 3JYNA 4MLZA 2C7QA 1MO6A 1RZRD 4YJDA 2VJCA 3IAM1 4QTXA 1Z63A 1XF1A 4FOPA 1GFWA 4BO2A 2MIIA 2Q6KA 1E89A 4FDVA 3ROMA 4PY2A 1QV6A 1LB1B 3F6EX 3V7UA 2XW6A 2FW6A 3ZY6A 4HRAA 3G13A 1ESDA 3H87A 3HY4A 5DGHA 1PLKA 2C5EA 1RI4A 3OKAA 1C1YA 2XZTA 5CDGA 1Z38A 3W8NA 2NZ8A 4DRXA 1TO1E 2KBEA 5DHTA 4Q4DA 5KPDA 1C7RA 2DY1A 3CJRA 5JDIC 2C7PA 4OI0A 3L0OA 1YI8A 2Q50A 2GWHA 3IBYA 1ZU5A 3AM1A 4HNHA 1ZM7A 4BVJA 3SR3A 3HA2A 4F2PA 1GGEA 2M1ZA 2QSZA 2IXTA 4FDUA 2C4WA 1FSFA 5BR1A 2O48X 1O6BA 1AQJA 4A26A 1M8JA 1XMXA 3RD5A 1MAAA 4L9WA 3A32A 4H77A 1CV2A 1YU9A 3HUFA 1TYZA 2GYYA 3B1ZA 4NPHA 1TQ2A 2ZAGA 2X0EA 1KVQA 5BMVF 3HJHA 3HY3A 1N0HA 3BE8A 2R4UA 4A73A 4GPTA 4AO7A 4ONEA 1CULC 4H1HA 1VA4A 4TKMA 4BWGA 1CRLA 3UOGA 3ZGYA 2ZYWX 5A7HA 3NDIA 4WEOA 2NQTA 5B1SA 4DDMA 3NOOA 3ESZA 2QM3A 3GJ6A 1GQQA 4TYPA 3B9RA 3T5AA 2X77A 3MJTA 1ADCA 4P7JA 3T9AA 1EUCA 2HIAA 2GMWA 2QZ9A 3GFRA 3P4YA 1NNEA 1V26A 2O8NA 4FI3F 3ETDA 3GVCA 4D97A 3V1UA 1GLVA 3JQ7B 3KEFA 4ZJYA 4B81A 2BTOA 4Y0NA 4PNPA 3M4JA 1AZTA 1CF4A 2ZBDA 1VJDA 4JT8A 2J45A 4OSEA 3SQLA 2YHUA 1XCGB 2QUKA 1AS2A 3KALA 4CLEA 5EUBA 5FPHA 5A62A 1A2BA 3ICQB 2OHGA 1RHMA 2BDUA 2ZBGA 3H5TA 3AG5A 4WK2B 5HQTA 2OGZA 2I9PA 4BNDA 2CUTA 4BQIA 5CDYA 5DW0A 3KJIA 1GG8A 1ZOLA 3D6HA 3K8ZA 3QK7A 4P6VF 1I3MA 4KV7A 2VHXA 1Y8ZA 5I7EA 3M8KA 1DV2A 3A6HA 4ZI5A 4TRJA 4CNBA 4DQVA 4FB5A 3EIOA 3AHIA 3G2PA 1JLMA 2FH5B 2PBZA 4ZCQA 4F6CA 1IZ9A 5JJIA 3N1UA 3SQMA 1F4LA 1IL0A 1WQ4A 2PZEA 3LCRA 2W8BA 4OFBA 2HQRA 4PVDA 3VR5H 1P5HA 2VJKA 4M76B 1KZGB 2C4KA 2RHOA 2PXHA 1Y5MA 3RTGA 3CLRC 3RUEA 2YYZA 1M9NA 4H7HA 3ZXUB 1DRUA 1SKYB 1U2GA 4F11A 3IS3A 1JVNA 5LBIA 3H5VA 1Q6YA 4J0HA 4P38A 4MI3A 2PCLA 3WO0A 5L3QB 1LU9A 2BH2A 2J9FA 1P18A 3T7KA 4CMIB 2GCEA 3NP9A 3N0RA 3P9ZA 3Q2KA 4K6CA 3DWIA 4TWRA 4CQMB 5FORA 4MEAA 4EENA 2OGUA 4YT2A 4CV3A 3WRYC 2AOTA 2HPAA 2V0NA 4RVGA 2OHFA 1E69A 7AT1A 3AVTA 3RAGA 2B9EA 4XFKA 4BMOB 2OB2A 4WNAB 3V33A 3ASUA 1TMGE 3LYUA 1P7VA 2YHBA 2UZ0A 3DAGA 1SBZA 3OFJA 4OQZA 1GG5A 3I6QA 3GRKA 3L3BA 3IPYA 1QP4A 4B40A 2B1QA 4FP9A 4M0UA 2BMAA 3QXXA 3UGKA 3MCWA 3T5CA 3L0DA 4N5NA 3W04A 1XMVA 3LGXA 1E66A 4DSTA 2P2SA 3N7UA 5TEVA 1P3JA 3MCTA 1T4CB 4A16A 2H29A 3O82A 3DEFA 2ZWVA 4QATA 1DKOA 4QUBA 5JZSA 3TXXA 4RULA 1CZHA 4J7UA 1YHNA 1NW5A 1JQKA 2EKBA 4R8VA 3SE7A 4YGXB 4LRTB 2E3JA 4CMJA 3NOQA 2AKEA 1NZJA 1LLCA 3QEMA 4OBWA 4DB2A 1V7ZA 3V2HA 3UATA 2N0SA 1KMCA 2A7XA 1F14A 1UMDB 3A4TA 2WF5A 3ISVA 5EXPA 4J0JA 4I9GA 4ZD6A 1NJSA 2D7CA 5EG5A 4A6PA 1ND5A 4ZU3A 1O97C 2Z8YA 1M34E 4UREA 1P8JA 4PGGA 3OPYI 1T0HB 2J1LA 4P7FA 1ZBQA 4M0LA 4PPGA 2ROQA 3IX7A 1LBEA 5A71A 3IQZA 5JAIA 1CKEA 2QT0A 5IN4A 1CY0A 2VPYA 3N3AC 2B37A 3I58A 4MCJA 1KJNA 5ED4A 1ST2A 2BI4A 4EVIA 1UMBB 3EWIA 3QF4B 1W88B 1PL0A 3LDHA 3UYKA 2P7IA 5FPYA 2D1YA 2F3RA 1ADBA 2W4IA 3H1GA 3KJEA 4ZPJA 4OKIA 5DN9A 3WYCA 1IVSA 4K6FA 1Z3CA 3DULA 3SNKA 3TVTA 5IDWA 3TLAA 4DUGA 2YV3A 4OU4A 1Y3DE 2PZMA 2VF4X 3R09A 1MO4A 4NQZA 4QICA 3LVBA 2YWDA 4YNBA 4ZRDA 3DWGA 1QO0A 2R4QA 3ENNA 3TM5A 4HWGA 2E5WA 4MWOA 4RGYA 1W4BA 1CZLA 3V1KA 4LY0A 3BMQA 2FFBA 1V43A 2AFIA 2ZSHA 5ICFA 3WMRA 5C9ZA 1KWGA 5AKGA 4GL2A 1K8RA 2YHSA 1A4XA 2Q2WA 4HZGA 5B6PA 4RPJA 3PQ2A 2BFOA 4QYSA 4KZKA 2E4VA 5HS4A 2P9QA 2I4MA 1FQOA 4BB5A 4P7KA 2AIRA 3DTTA 1G5IA 1T8RA 5FFFA 3QIVA 4LY3A 4N47A 3PNSA 4NS4A 1YA6A 4OQMA 3TD9A 3NT4A 4DLUA 4MR7A 3NJ4A 3BXEA 2VTBB 2J09A 5JQGA 1GUFA 5TMPA 1NNLA 5JYCA 5CH8A 3HCWA 2IX3A 2I3BA 1FBTA 3D4IA 4GQAA 4OFWA 2W6NA 3ZE8A 5B36A 4Q9IA 4XB2A 1E7WA 2F9FA 3HPRA 4EL5A 4PZAA 1NP6A 5K3FA 3OD5A 2CMFA 1KK0A 3PNMA 4PLWA 3TPFA 1HE2A 3ZLUA 3PWKA 1V11A 2VATA 4PBTA 1P0CA 1EZ4A 5ECYA 5KOYA 1P6XA 1CR1A 3NKFA 2IUSA 3REGA 4EI2A 2Z2IA 5HR5A 2IEYA 1KYZA 3DHEA 3O90A 1LZKA 1X7WA 2NZVG 2HT1A 2CLSA 4MA4A 4DQDA 1GKYA 2PNJA 2NTJA 2FG5A 2X7JA 1LVHA 3EFOB 3DXYA 4YWJA 5J4VA 3PCRB 1U2GC 3WFZA 3G1TA 3JWEA 1I3NA 2QEQA 4MRAA 4KUEA 2EVWX 3IHLA 1SHTX 4FU0A 3RTAA 3CSUA 3P4XA 3N2YA 1PUJA 4R6WA 4ZAXA 3L46A 3LBYA 4CI9A 1MA3A 1S2GA 2O0KA 2GCNA 3S70A 2QLTA 3E03A 3L07A 1RE1A 3MQ2A 2XOEA 4HWKA 4YB8A 5M29A 4LEIA 1IRXA 2X5NA 3P2EA 1HO3A 4WBNF 4U5XA 4CHGA 3PX3A 3E8SA 5BUQA 3FRIA 4R8LA 3T35A 3KG2A 4ZPXA 3UQZA 4BE9A 2WF8A 4GWKA 2XCRB 2HA7A 1WCYA 4BGEA 4DCJA 1EWKA 1SHJA 3BWYA 4MVJH 1XCJA 3F6CA 4LHEA 4M7OA 3RU2A 1RM0A 3NV7A 3SHVA 3AFHA 2J5BA 4H6VA 1KDYA 3TW6A 4L5IA 2C2YA 1P4JA 3QBVA 2AW5A 3EH1A 5JG7A 4PVCA 2JCXA 4A7PA 1GRRA 1JAXA 4QU9A 1GZUA 1Y5IA 4D5GA 4EBFA 2AOUA 2C8KA 3CLTD 1ZN2A 3DVQX 4Q7LA 1EJ0A 5GZ6A 4C4AA 1A8QA 3I5AA 2FPSA 4RA9A 5G0WA 3F73A 3UC5A 4C6TA 5LNK6 4X6LA 3H9BA 4URHA 1Y3HA 2PU7A 1CZRA 4GGOA 2FZ4A 3PD7A 3A0RB 2FX5A 1NVMB 2GM5A 4II3A 4DOMA 4UCXA 3AT1A 5J59A 3PT5A 3HBFA 1Z68A 5JVDB 3DLBA 2WJAA 3T1VA 2WPNA 5P21A 3ZWNA 1RPTA 5A03A 2CEKA 2GBGA 3WKEA 2OV6A 3QBJA 5CHEA 3PYMA 4QULA 5DN6D 3GA7A 5D1NA 1Z8DA 2CY0A 5D86A 1P2VA 4D4KA 3JRNA 4LQLA 1V1MB 3T7JA 2ZBQA 3H1FA 2O1SA 3GRYA 4I81A 2YHIB 2ODAA 3KAQA 2NNWB 4JBWA 3AF0A 1I2CA 3LY8A 4KRFA 2DG2A 3BMOA 3QXGA 2R62A 4UKDA 4Y2JA 4B3XA 2JRLA 1RCUA 4UW9A 4ER3A 4LE0A 5BOSA 2XB4A 1S1CA 2NVUB 3VNAA 1G4HA 1UIRA 2XWJI 2V0GA 3SQXA 2GJAA 1E79A 4E15A 1AX9A 3Q7TA 5CVVA 3ESAA 1S4MA 1X87A 4ZT6A 4L4UA 4EJ0A 1YBHA 1EBBA 1Z5WA 4Q1EA 1GPBA 3E7XA 2AC4A 2WU8A 5G1PA 4TS9A 2PD6A 3VH1A 1V9CA 1NYTA 2M9MA 3LVRE 4J29A 4EGCB 4M83A 1HETA 4MGEA 4OQNA 3F96A 1T26A 4G0PA 1K97A 3ZCVA 4ID9A 1HMPA 1DO0A 1ISSA 5KU1A 2RGEA 3IV9A 3PQ7A 4Q3CA 3WTCA 1GT91 2VJAA 4DVGA 2YKGA 1FTWA 1GCGA 1SZJG 4LZLA 3NTUA 4U7GA 1H4QA 2VHVA 3VYSB 3MWDA 2ARKA 2IOFA 1J6UA 2PKEA 3ELUA 3GP5A 3IJEB 4PO3X 4S2EA 5KWJA 3LHIA 4MARA 3AESB 3EYAA 2VP5A 2IYQA 2OB1A 2A5FA 2GF9A 5DCUA 3RC2A 2FJUA 3MCAA 4HYYA 4JD5A 4L57A 1KJJA 1Z0ZA 1SRQA 1MB9A 1T8UA 3DLTA 4ETNA 4LFAB 3AQIA 2C0PA 3EZ2A 1UR5A 1KYYA 2OC4A 2PZGA 2XYHA 3QH4A 1LW7A 3QTLA 4Y2UA 4ILKA 1YRYE 3KLPX 5ALQA 5DHRA 1VG8A 1QDUA 2H8GA 1OIVA 2A0XA 2ZYTX 3G6WA 2FRVA 1CRQA 1W5BA 5LBTA 1XX6A 2E4XA 5HYVA 1PG2A 4WGGA 3NHRA 2J08A 4R8MA 2EJUA 2VC2B 5HP4A 4OI1A 3AEYA 4YAFA 4KREA 2DUJA 2FSVA 4PG5A 1G8GA 3TNFA 5JSQA 3ZZ0A 2UZIR 3ECAA 1RSZA 2B82A 1GRQA 2P9YA 3N2IA 2QRLA 3MWLA 1EU1A 1F2UB 3GO4A 4ERNA 4O4IB 2IOYA 1YB2A 2PK3A 3DOHA 3HCNA 3OCJA 3X1JA 1SMKA 4Z51A 1JVBA 2OUKA 5CGQB 5TARA 2QMUA 3IODA 2AXNA 1DC8A 3JALA 4E08A 1O1YA 4NE9A 1Q12A 4S24A 3ZJ5A 1U65A 3QNWA 3AZOA 4PIMA 1KSHA 1RPZA 2CZQA 1QRAA 1V95A 1Y33E 2CMHA 3IT1A 4EA6A 2BJHA 2C5LA 5IJ9A 1IPFA 4OHKA 2QK4A 1CR2A 5CFLA 3FIJA 4BV9A 4C08A 4D74A 3GQBA 1SCQA 2ZVPX 3KVVA 2O8VA 2QN6A 3NHUA 3QEKA 4K1XA 4M54A 3RU3A 4XQ9A 4AECA 2JVJA 1SC9A 2HY7A 1KE1A 4LCJA 1QIJA 5AT1A 1W94A 1XZQA 1R4AA 2W98A 3ZDQA 1Q1EA 4Y1EA 2WTAA 4DGQA 2G40A 3A1WA 3MYYA 1OFHA 4LG1A 4TTVA 3SZ3A 1QRRA 1H5NA 2O2YA 1ZR4A 1ZONA 2I1LA 3QMVA 4E21A 1G64A 4JQSA 4RK0A 5JNLA 3AFMA 4ESOA 2ZP1A 2V6BA 1D2AA 1E2UA 2GNAA 1KJZA 4PS1A 5FTMA 5D85A 1FX0A 3AERB 3QJGA 4JAVC 3RRNA 4JX9A 3F9IA 1T9AA 5HWSA 1DAEA 3RWOA 3IP1A 2ZYAA 1CUGA 2O2CA 5GOZA 4F72A 2PUTA 2ZYRA 5AHRA 5EHGA 3PA8A 4M4SA 4XTCS 5K09A 1O89A 3DNFA 4LF6B 1WNFA 3U62A 4DMCA 4J1NA 5FYDA 1J20A 1I2DA 3TNLA 3WMXA 4BNUA 3C24A 3OFKA 1ZUNB 2C3PA 2AOXA 3G7SA 2R25B 3MXTA 5E1BA 5DTJA 4GUAA 5THQA 4DMLA 5A9SB 3IOMA 3NTVA 3NOXA 3WISA 2X19A 3K32A 1M6HA 4BMXA 2ZI5A 2WTUA 5LVAA 2NPOA 4HNRA 4P4SB 1RJGA 2GN0A 3BWVA 1P7PA 1YACA 4FOTA 1QHXA 2JI4A 3EOBI 1XMOB 3UHPA 2GR9A 1XLUA 1TEHA 1VL1A 3EAQA 4U63A 3A4MA 2CJXA 3NBYC 2YWFA 4OSPA 2ZT5A 3TIVA 2AA3A 1Z12A 3SYTA 4BU1A 4X71A 5AQ1A 1N6LA 2G07A 3F6YA 3DE3X 4K40A 3DZDA 5C8YF 2NO9A 4IGKA 4AJJA 1MEOA 2OCBA 1ID1A 3QHQA 1FYFA 1F3OA 721PA 1MV8A 4X95A 3ZS8A 4P0TA 5LYJA 4UDOA 3PWSA 4FJ2A 1O94D 2J3IA 2FAXA 3HXPA 4M0MA 4FM9A 4IRUB 2DR3A 4C21A 3FB1A 2C7OA 3OOEA 1DJNA 2CL6X 3FJYA 2CK3D 4IJ6A 2OG1A 5PNTA 1X1BA 2JFGA 3R3JA 4R2HA 3EWAA 3V7YA 4BQNA 3LUDA 2UYCA 1ATZA 5DDIP 1PYDA 3EDRA 4K86A 4FXPA 1GZ6A 1ETUA 3GW8A 1PZFA 4X3PA 3ZC3A 3BH0A 1C3LA 4J3JA 4QTTB 5IM5A 1SQ6A 1Z82A 2DGDA 3BZWA 5CT9A 1FXWF 1SC6A 1WXEA 4TWBA 4BO4A 4GEGA 1LLUA 1Z5UA 3MZ0A 4RLSA 3CKLA 1FK8A 2QN2A 5FNVF 1N2IA 4RD4A 2IYNA 2ZXUA 1T1RA 1Z62A 2FF7A 2XECA 4H2DA 2GX6A 2QZPA 3ETNA 2QRVA 2BFEA 2I6UA 3A2NA 3JQRA 4NLLA 1UM8A 4EHFA 1VMKA 3WGYA 5HRCA 1ULHA 1AV7A 5IT5A 1JIQA 2XSZD 4QJIA 3EDMA 3N59A 4P33A 4WNCA 3AJ8A 4A23A 4BNLA 2ESRA 3IRVA 5E6UB 1UFKA 3TEJA 5FEUA 2HGZA 3VJRA 4KMOA 2AYXA 3CM0A 3HKBB 4FFBA 3NVMB 1NF8A 3TG2A 1CB7A 2FSVC 4ZEOA 3EIXA 2JBWA 4UHFA 2YBEA 3QX7A 4UMEA 5F12A 3SF8B 5A3JA 4A8JB 1VI6A 1CUSA 2E1PA 3MB8A 4CTJA 4CEHB 3DDCA 2QTHA 3C5EA 5LNK1 2ZAIA 2Z8XA 3UKJA 4D5EA 4TMYA 3PXAA 1E9AA 4DDTA 2R6GA 4R7ZA 1LSOA 2M6RA 4ND6A 1U9YA 1TKAA 3PT9A 4BXOB 5EHXA 3DNMA 2PRSA 2QX4A 3C8UA 3CF0A 3JD0A 3W8FA 5AJHA 3ZKAA 2BMVA 2JIDA 4PHFA 4QXAA 3T6KA 3VPAA 4YCNA 3CVXA 2P65A 1VG9B 3AHHA 3IBTA 3OCWA 4WBXC 1LNSA 3PFIA 3HZRA 2AXEA 3PHCA 2FSHA 1TUEA 4IZOA 4TYYA 4GZLA 1OAOA 1C7JA 1THGA 2G4LA 5K3SA 4FFPA 1JAHA 3D6NB 3HFSA 2QJWA 4IWYA 4D8XA 2CYCA 2X5OA 3I9FA 3ZD8A 3BJEA 4OU5A 1DIHA 4PPQA 4U8HA 4YCBA 3ZHOA 4K0KB 4Q5IA 1VLVA 1TQDA 3KQOA 3OLCX 1FDVA 3SC4A 2CXHA 1RWBA 1J7JA 3NBAA 4ENWA 2H2AA 2A1UA 3DMRA 3EGXB 2VSOA 1RAAA 1L7RA 4GR5A 5L45A 1X1TA 2EZUA 4DLZA 1H3NA 3AC0A 3PKZA 5LZ5A 3UT5B 4HFMA 2QLNA 3FOWA 3AM4A 3JATB 3IV7A 3KZXA 4Y6GB 4Y6RA 1AJEA 4UHKA 3W3AD 2HCRA 3OLXA 2VJDA 5FWNA 2X41A 1LK5A 4JGGA 5EWJA 3K2IA 1Q77A 1WB6A 3QUAA 4CMGA 2IX9A 2O2EA 3ORRA 2BI7A 4YT8A 3RC7A 4V3BA 5F5XA 3NX4A 3CCFA 2HA6A 1JIKA 4NMLA 4ZU6X 3HGTA 4KLZA 4ROSA 4FOLA 1FDWA 5EXEA 5IS2A 1DARA 1XDGA 2QGFA 3BL5A 3QMPA 1VP3A 2IUYA 5FBLB 1TEVA 1WHSB 3ZV4A 5ERYA 3CVUA 5LP6A 1MNQA 1S0UA 3AFNA 3A1FA 2V1UA 2J0QA 1XDDA 4XWWA 1KGSA 2NTNA 1JQJC 2JGRA 3KZVA 2IW3A 3WL7A 4AX8A 3F98A 1XEWY 1KC3A 5KMGA 3V1YA 2CL5A 4Y9DA 4OVKA 1G20E 3FPAA 4DDWA 3G8YA 1QFSA 1Z2OX 1Q2UA 2AC2A 4FE4A 4YX9A 1RJWA 2WIAA 3TUZC 2GPBA 2AKAB 2AMFA 2G9UA 3O31A 2WKQA 4OHRA 3WMFA 4P3PA 1A5AB 2BH9A 3CSSA 2QAJA 1EVIA 1UBUS 3A1EA 4LXUA 1E1LA 3UOAB 1G4AE 4UVHA 4BHTA 4D4GA 3DOOA 1SOAA 2EJBA 4TYQA 3REQB 2QLMA 1CE8B 2JI6A 2OXEA 3VYUB 3ZVNA 1MLDA 1OH8A 5EJ9A 3VOTA 3BWEA 2ATEA 3UJAA 4WUVA 3KLMX 2P9FA 3COYA 3PGVA 3C6KA 4PLGA 4UFOA 4BFCA 3VAZA 2VCEA 3RSHA 2QRJA 5DWDA 1NAIA 2XWQA 5I9BA 3SLRA 1FPQA 4DCNA 4EKIA 9ATCA 3Q8LA 4WNYA 1JH9A 2EWMA 2IY9A 3KCQA 3TLCA 1OB2A 3CLUD 2ZETA 4XVQA 2DBZA 4B4OA 2WJHA 1GUYA 4N1AA 3GBPA 3KEQA 4QBGB 4I36A 4J3NA 2B4TO 3FKSD 2XCSB 2OC9A 1SHUX 4ZU1X 4RK4A 4BNVA 3A3NA 4NK5A 2C2XA 1HG1A 1L7XA 1V3QE 4Q4AA 3N76A 5LZ4A 1D8AA 1GITA 2EFDB 4HDRA 1YSCA 5BVHA 1XTBA 5FCDA 3FHOA 4TVBA 1XN4A 2XKAA 5K8LA 1GYRA 1J2TA 4ARAA 1FVFA 4LC1A 2OPBA 4R68A 3B2EA 4CVNA 1N9GA 2P0EA 3ESBA 4NOLA 1G21E 2XXAB 3EIHA 1C9JA 3ANTA 3NDRA 1PFUA 3S2UA 3QQ5A 5T41A 1IUOA 4W6ZA 2X3FA 4BX0A 1R5JA 2ZUWA 2P5UA 4RW0A 1HL3A 3L6OO 2YCBA 2H85A 3EG9A 5HIMA 2GOYA 3C6MA 5F7ZA 1PR2A 3N8KA 3FNIA 3REOA 4BKUA 5JTUA 3UWSA 3GYGA 3H3XA 3F7NA 3PNPA 1NR1A 1W35A 4LSMA 2ZDHA 3AKZA 3IERA 1OAOC 4PR0A 4G25A 3UA3A 1GPH1 3P0EA 5FADA 1NBOA 1VQ1A 4EHIA 4YPVA 1RXSA 1X1SA 2VF2A 2KPOA 1WJGA 3GAFA 1PD0A 1F48A 2P6UA 3GP8A 4NF2A 4URZR 3WJ2A 2H48A 2QVXX 1WABA 3T9CA 1TT5A 4LECA 1VE5A 4ITRC 1V6SA 3ASYA 1CZUA 1SY7A 2MSKA 3QLJA 4LV5B 2P5SA 1DO8A 2R8BA 3GFVA 3OI7A 4CKEA 3HK2A 1FFEA 2FMUA 5EMKA 3UANA 4ARUA 4KXMA 3U4AA 3LT0A 2VPIA 5G4LA 1W1UA 2PQ2A 4DIFA 3PXDA 2IU4A 2AXQA 3AEQB 3RREA 4NFLA 4KSBA 4MV5A 3NHWA 3OVMA 4ND8A 1OSNA 1NVAA 5LUAA 4YY3B 5JJLA 3MWKA 3V8RA 2EWVA 1J5EB 3U7GA 1ONSA 2GTIA 5ALUA 5AVXA 5KQSA 4MNTA 1JDZA 5KYKA 5KNDH 3AVOA 2E18A 3RIMA 4BTVA 1PZXA 4RA6A 5FAKA 2HQ1A 4JP2A 2B2XA 3WXMA 2JW5A 1KQFA 2YQZA 3RAEC 4A6DA 3ZCRA 1JECA 3AK4A 4QDKA 3QKSA 4CRWB 4P3YA 5L3VA 1QONA 2G0NA 1KPHA 3RUHA 4BGUA