4HAWA

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1(k548a)-ran-ranbp1
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
208
structure length
196
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
total genus 56
structure length 196
sequence length 208
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hawA00
1QHGA 1XJCA 5G41A 2WWHA 3A1TA 4IDPA 1N6OA 2JLWA 4M9XA 5J4VA 4AYWA 1KGDA 2O52A 1GTVA 2P2LA 2IYXA 2QPAA 3KKQA 3OZXA 4LYHA 4Q9IA 4A2PA 4AURA 1XFAA 4EFMA 3IBGA 1SVSA 4XSGA 621PA 1XCMA 1J8YF 2F1IA 4OQXA 1PUJA 1W36C 5HTKA 4C4PA 3QPUA 1V5WA 2ZRDA 4KI0A 3LX8A 4JLPA 1OIVA 2XZLA 3EZFA 4Q7MB 3E1SA 2FFHA 1QHNA 1E4VA 2YNMA 1C4OA 2C98A 2ZRCA 1ESNA 2D3WA 1Q21A 2UZ3A 4M21A 2QBYA 1IM2A 1CBUA 1NMZA 5JSZB 1G3UA 1Q3HA 2GXQA 2IL1A 2OCBA 1CJMA 4UQOA 2P5SA 2IYTA 4ZPXA 1OIWA 5FTJA 4ITRC 4NPHA 3K8YA 2IEYA 3GEIA 4KSBA 1OH8A 1ZRHA 2QAGA 4XOIA 2OXRA 2ZYUX 4TLCA 2P6RA 3VR6A 2AL7A 2HEIA 1G8FA 2YVUA 2ZRNA 3QY0A 4S35A 3R9XA 1ZINA 2JLUA 2VA8A 1WP9A 4C0QC 2NTYC 2EYQA 2W6ID 4X8LA 4B6EA 3A8TA 4DDTA 4C7OA 2AFIE 4NKRA 2W83A 3EZ2A 3T34A 1H8HA 2GCOA 2H8KA 4A15A 1AZSC 1ZD1A 1XEFA 1S0UA 3I61A 3RS0A 3P20A 4LBWA 2G83A 4RD1A 4DCTA 4ZCMA 1G41A 1II0A 3H2YA 5FFMA 3AVVA 4C3ZA 1N0VC 5FPSA 4MITA 4F4JA 1OHHA 1TQDA 3MJRA 4KJZA 3CH5A 3UMFA 3KTAB 4PSVA 3BH0A 4WXPA 2IC5A 3CH4B 1Z6GA 4NMMA 3VR2A 4LDJA 2XGJA 4I1SA 3WMGA 3NXSA 2YWEA 2V7QA 4G01B 2YKGA 4URYR 1N5KA 3BIFA 1GUAA 1XP8A 3OESA 4BLSA 5G40A 3LXXA 4G5GA 3THWB 1RJ9A 4Q47A 4A9AA 3SYKA 3C7KA 3GLHE 1E98A 1II9A 1M7BA 1Q1BA 4M4SA 4DT1A 2ZRIA 1U9IC 4HEJA 5L3QB 2FGJA 3BD9A 4DDUA 4LC0A 1Z0DA 1N6RA 3KJEA 5AJWA 3WNDA 4JBXA 3RRMA 2OCAA 4Z1MD 2FGKA 2FPKA 3NBZC 3WMFA 3GLGE 1NJGA 4R2HA 1E2GA 4DSUA 4BRWA 1G6HA 3LQQA 2IWRA 4M22A 3QG1A 2VSOA 2CK3D 1G3RA 1RW4A 1NNEA 5DI9A 1Q20A 3DOEA 3B9QA 2VHTA 4NL4H 2JAQA 3JZAA 1QBKC 3FDIA 1GKUB 2P5TB 3DVLA 2PZEA 4MDEA 1XMSA 2GKSA 2MSDB 3K1JA 3LH5A 3CNNA 5JS8A 3CIOA 2ZRKA 4U02A 2IS4A 1GNQA 1XXHB 3ADKA 5FR1A 2FFBA 5J5CA 3RS3A 1HQCA 4G5RA 4Q02A 2QAGC 3C14C 3NHAA 4GL2A 4EDHA 4HB2A 4ESHA 2B8WA 5TV2A 2ZANA 4BQSA 3EA0A 3IBYA 3CWZA 3OHMA 5KDLA 3ZS9A 2XB2A 3AF4A 3SR0A 1ZIOA 1XCPA 4KYIB 4TYWA 4O2LA 2WJVA 2XEXA 4A2WA 4NYJQ 4V03A 4JKYA 1OYYA 5HKKA 4ZO4A 1H65A 3IIMA 3EPJA 1OH7A 4DB2A 4Q4AB 2FOLA 4W7SA 2IUSA 3VNVA 2O8BB 821PA 1Z6XA 3LD9A 2GNOA 4RCYA 4JVMA 2CCGA 4A2QA 2JJ2A 3P4YA 4TZ0A 4AG6A 1QG2A 2G1KA 3NEYA 4DXAA 1CR1A 4D25A 4LWZA 2B21A 1R5OA 3W3AA 1P61B 3K0SA 1T5LA 4DLXA 1SXJD 4Q03A 1IHUA 1NI3A 2JLQA 5E95A 3C15C 1MO3A 1A5TA 3AKYA 1F3OA 3BOSA 4OHYA 4L5BA 4L4UA 5JWRA 4JLMA 3RWOA 5HZKA 2VP5A 2VF8A 4FD2A 2XTNA 4P0TA 4D2IA 1E2JA 1E1RD 2V8OA 2ZI4A 4U00A 1E2FA 4OHZA 2FNAA 2CLDX 1OFTA 3TAUA 2ZSBA 3QBTA 3TK1A 1TPZA 1ZD8A 2JDID 2QQ0A 3NBYC 5JZVA 1VCMA 1VCNA 2BJVA 4OKSA 3WNBA 3L8ZA 3FB4A 4CDGA 3I1FA 4NZYA 2BWJA 3I32A 1EFUA 1OXSC 2ERYA 3Q72A 2QP4A 1XJQA 3OEHD 2QU8A 4NE2A 4D80A 2BMJA 1CJVC 5SZIA 1SQ5A 2F43A 2VH5R 1HH4A 3N5CA 1R5NA 1NN5A 5HPYB 1QVAA 4M1SA 4MYUA 2DYKA 4TLBA 1ZC3A 1U0JA 2KE5A 5JHHB 1H8ED 4NYJR 4RSGA 2SHKA 3R8FA 1JAHA 1RYHA 3CF0A 4PXAA 3B13B 3THWA 3FE2A 2X19A 3A36A 3BAFA 3GQBA 3O47A 3PUVA 2QL6A 4QJ5A 1P9WA 1XF9A 2CEAA 3UG7A 3UMSA 3K0EA 1LV7A 3GMTA 4I99A 2B6HA 3GJ7A 2J0QA 1QRAA 3KUDA 1R0YA 4DLVA 4AK9A 2Z4RA 2ODEA 4B74A 2H92A 4C0JA 3D3QA 3B78A 3RS4A 4M0LA 3IKJA 3SU8A 2WWFA 3KJHA 3PUYA 3TSOA 1XMVA 5KU1A 3ZVNA 5JJLA 1JQLB 2WTUA 1BMFD 2AWNA 5HZHA 1UAAA 1E99A 3FHOA 1TU4A 4HDQB 1P3JA 4WVFA 1UEJA 1EX7A 3C16C 3AGPA 4TT3A 1NBMA 4M53A 3W3ZB 2JA1A 2WJYA 4PC2A 1XD2B 4IJMA 2ZAOA 2H7VA 4L16A 2ZJ5A 3AF0A 4PPGA 2HDNB 5FBLB 4HUQB 2FPLA 2GZAA 2UVQA 1N2CE 1X8LA 3SJZA 4FCWA 4Q18A 3QE0A 5JS7A 4QHYA 2JLYA 5L3SA 5DHAA 1XJ0A 1G7SA 2C78A 2IYYA 1PLLA 5KTYA 4Q4HA 5FH9A 1XXHA 3QKSB 3D8BA 4TTRA 4UNQA 4YXWD 2VBCA 5BQ5A 1ZUHA 1KYIA 2QMHA 4V0LA 5KHOC 2H57A 1FFHA 2WKPA 3UXMA 1QDEA 4B71A 1F5NA 4DCUA 2J1LA 2OHFA 4KBGA 4GZLA 2OBLA 2QI9C 1W1WA 3BBPA 3P4XA 5FBQB 3MUFA 1JPJA 1W44A 2GWHA 2YV5A 1G8HA 1WB9A 3DZDA 1P7CA 3MG9A 3ADCA 1IN5A 4HLUC 1P72A 2PCJA 3MGCA 1GILA 4Q4AA 1OF1A 2BVNA 2J3EA 2FEOA 3AQ4A 3ETLA 5TB5A 3SHWA 2HJVA 2O8BA 4FMCB 3F5FA 1EFRA 3QXXA 1P60A 2EVWX 4P4UA 3C8UA 3IO3A 1GZSA 1DAGA 2IHBA 1OSNA 4PZZA 3OFNA 4V0KA 1CJUC 1I2MA 1S1CA 2IA5A 2ZE6A 4M9SA 2JCSA 4LI0A 3W8RA 3PVSA 1M2OB 1S96A 4B33A 4D0NA 1R10A 2ZRHA 4AKEA 2IUTA 3GP8A 3EPKA 2ZYWX 1GDDA 3QPWA 4LYFA 2RMKA 4B6FA 4D6PA 2ZITA 4EJSB 1OIXA 3I92A 4V0ME 3VKHA 2VSFA 2DY1A 1Q44A 4FCVA 2PCLA 4TLAA 2J7KA 4PC7A 1KTVA 3I8XA 5FOVA 1TTTA 1NJFA 1Z3IX 2WMOB 2G3YA 3SNHA 4HB0A 1FX0B 4F38A 3OE7A 2R8RA 1TF2A 1NKSA 3UATA 5F9HA 1FNMA 5EXSA 3K0CA 2X77A 4LZZA 2CNWA 4BLTA 2ZRFA 1T4GA 5TXGA 5CYOA 2RGBA 3H84A 1NRJB 4PSKA 1P9RA 4RVCA 4EQ6A 1RKBA 4UXHA 2ZR7A 3TH5A 2PJRA 3I62A 1SKYE 3SJCA 3LY5A 2QROA 2BMDA 2RGNC 3K0AB 5JWOA 4ZI2A 5FOSA 4LSGA 4B3GA 2PMKA 3CR8A 5DO9A 4HSEA 1LS6A 1Z0IA 4ZDJA 4KV9A 3ZVMA 3FVQA 2KWIA 1LW7A 1MABB 4C0SA 5JEEA 4M2LA 2RAPA 3IQWA 4NHOA 2RGAA 2JLRA 1ZYUA 3HYTA 1J70A 1SKQA 1VHTA 2G0NA 1KAOA 2EFHB 5UKDA 1TU3A 1LNZA 3EPLA 3GLIA 4L9WA 2Q9CA 2QGZA 1R6BX 1W36B 2QENA 3WP0A 4DEYA 4Y0VA 2H1LA 3PEVA 3RHFA 4H9GA 2W00A 3R7WB 1N0UA 4BZPA 2D7DA 4C2UA 4CF7A 2F1RA 4URVR 2ZRGA 3W6OA 1LY1A 3VHLB 3VX3A 3SN6A 1KNQA 5KUTA 4FI3C 1E9DA 1Q3TA 1L8QA 2AK2A 2QNRA 4IFEA 2VTKA 1U99A 3K0FB 4DJTA 4WZAE 3CX7A 1TF7A 3L8YA 4PC6A 2JLVA 4LBYA 5FTMA 2A5JA 4F92B 3QKSA 1ZM3A 4OHWA 2GJ8A 1E0KA 4JLNA 4URZR 2XAUA 1KKLA 2AN9A 4RJLA 2QRZA 1SGWA 1DAHA 3NH9A 4PQRA 5LDDC 4P31A 1E3MA 1G9XA 4URUR 2D2FA 2R6AA 2ERXA 1G8YA 4QM6A 5KYKA 1W0KA 2CLSA 4Q7KA 5FOXA 1RC8A 2WJGA 4OJKA 1MO6A 2PMDA 2BM1A 1U2RA 2EFDB 1ZMXA 1KO1A 3U3KA 4D0LB 4B44A 2Z83A 1XEXB 3KQUA 2CL7X 2F3RA 1CTQA 1FPMA 5JJIA 3CB4A 3VQTA 4MYCA 5BXQC 4MH0R 3A6PC 2YINC 3K0CC 5M04A 3ZJYA 4EPRA 4LHWA 1ZUNB 3ICEA 2P3SA 5C4GB 3RRZA 3VU9B 2AD1A 3U7EB 4QKQA 4DHEA 1LS1A 2OFWA 2R9VA 3SQWA 3FMFA 5CLQA 3DOFA 3IPXA 2CXXA 3D31A 4A92A 4JLKA 1R7RA 2GJKA 3SYNA 4O3MA 1UBGA 1VCIA 1VYVA 3AVPA 3CO5A 4D26A 3PXGA 2IYLD 5CB8A 1KSHA 3WNCA 4HB3A 4NCNA 2ZE5A 1NMXA 2VLIA 3EZ6A 4XJXA 1AJEA 2Z5FA 3L2OB 3AEZA 2A5DA 2IYWA 1L2TA 5F3WB 1ZM2A 1FX0A 3CBQA 3QJYA 2RKOA 2BM0A 1KI6A 4FMDB 4GBMA 1SZPA 3K53A 3H0KA 5IRCD 1E1QA 3PENA 3B85A 4ESVA 2QM8A 1AQYA 1DBSA 3T1VA 1WMSA 3CLVA 1BIFA 1JJ7A 4M9ZA 2VHQA 3SBEA 1VG8A 1X8JA 4FWIB 5JCPA 3QVUA 1QHSA 4HZIA 1U98A 1Z0AA 2YC2C 2ZE8A 2FZLA 4TL7A 4M1YA 5FL7D 5KDOA 2G88A 4RKFA 2QBYB 1DPFA 2NQ2C 5H8WA 5DN6A 1CF4A 1MABA 2BBTA 5D3MB 4N1AA 4TL6A 721PA 3RRNA 5FUYA 3KDSE 4DSNA 4PC1A 4TLEA 5EJEA 4B73A 3U7FB 2FJUA 1G7TA 4X8OA 2QAGB 3NEJA 3P27A 4QGAA 3GJ3A 3BXZA 3SDZA 4W9MC 3V4FA 5JI3E 1RFLA 2AD5A 2PZGA 1ZU5A 2OILA 5CJ2A 3LVRE 2ZS8A 5FOWA 1M7HA 4PAMA 2J7PA 2VHJA 1FMJA 1Q0UA 2HYDA 2MSEB 3M1IA 4TTPA 1K5DA 2ZVQX 5FI0B 1U8YA 1IJEA 3K0FA 5GJCA 1ZAKA 2GAOA 2GRJA 2Z0MA 4JLDA 1E96A 1VYUA 2BBOA 4X8HA 2XX3A 1KNXA 2HCJB 1OE0A 2OFOA 2REBA 2GCNA 3DMDA 4DLWA 1M6NA 1NSFA 5IK2A 3EAQA 5CM8B 1QF9A 1TUEA 3MLEA 4HAXA 1JQJC 4BWYA 1OKKD 1XBTA 4KODA 3SFVA 4Q7JB 2J87A 3TRFA 3SE0A 3FMOB 1IBRA 3BE4A 5SZJA 2N1BA 2XZOA 1HTWA 1UF9A 1UKEA 1SXJC 3CF6R 4MGKR 3SEAA 2PX0A 5FUVA 3PJRA 3KFVA 3OIWA 4KU4A 2VRWA 5BW8A 1NIJA 1Z0JA 4GZMA 1S2MA 1RYFA 3U6KA 3GEEA 3HJNA 2FPMA 2WSMA 4DT1B 1TL7C 2QG6A 4ARZA 2ORVA 4ZI3A 5B58C 3AKDA 5P21A 4KXFB 4DBLC 1OFIA 4WBSA 4FWTA 4CEJB 4TMVA 1GNPA 1YE8A 1CRQA 3MJHA 5F98A 2NO0A 3KJGA 5KO2A 1VKJA 3C41J 3TJZA 3VU9A 5BN3A 2ZYTX 1KI9A 2IF0A 3R8CA 4DCSA 2N46A 3IO5A 4TSFD 4UKDA 2OSBA 1KY2A 3EWAA 1ESMA 1DAEA 1KJWA 4NCJA 3PUZA 221PA 2LKCA 1G64A 4CEIB 3CZQA 4HAVA 3MMPA 4QBHA 4PC3A 2Z4SA 1YZUA 1JNYA 2FV8A 3CX6A 3CX8A 3L0SA 3ND9A 5BN5A 1N3BA 4IHQA 5B64A 1MV5A 3I73A 2IBMA 3DMNA 4K46A 3U4QB 1K8RA 3AUXA 1C9KA 3BERA 4DIDA 3LLUA 1UKZA 2IHYA 1MR3F 1NN1A 1U9IA 4JT4A 4LJ8A 2E87A 1XTRA 2XITA 1N6HA 1Z29A 1CR4A 2R6CA 2XTZA 2ZRPA 1ODFA 4PO9A 4R9UC 3AV0B 3B6EA 2EWVA 4JJZA 1YZQA 3A37A 4F7WA 1Z0KA 3KXLA 2DPXA 2GBLA 3CRQA 1X6VA 4NYMQ 4PPFA 4OQLA 3CWQA 1E79D 2OT3B 1LF0A 3WRXC 5ELXA 2ZSDA 4MYHA 3SJAA 5D3MA 4UNRA 1OXUA 2J45A 3A58B 3X1DA 1MT0A 3VNUA 2KBEA 2OE2A 2IYRA 2Z43A 3U61B 2ANBA 4IXMA 5DI3B 2BDTA 3O8CA 1KK2A 3K9NA 2OAQ1 4NYIQ 4GMDA 421PA 1KJZA 2CE7A 3JVUA 3QBVA 4LPSA 4FCTA 3HYRA 4RZ3A 3NTUA 5IDVA 3THYA 2DHRA 2QMEA 4NP6A 1OXTA 4JBYA 4WA7A 3H4MA 2A3RA 3GJ4A 1EX6A 2QPOA 5H68A 2H18A 2YZ2A 2C9OA 1KO4A 2J0UA 1KI4A 1NL3A 3AB3A 4D82A 3BWDD 2AK3A 2G77B 2D06A 4DDWA 3QEOA 3R20A 4LJ9A 4IOMA 1ZM7A 4OL0A 3NG1A 4OHVA 2ASEA 3RLFA 4M1WA 5JECA 2QE7A 5A5GA 2C04A 4BECA 3FKSA 5AJVB 2AKYA 1FW6A 1I2DA 4ZDWA 4GP6A 4EPVA 3DO6A 4ZDKA 5K8LA 3G0HA 1KDTA 5EXTA 1OB2A 2OCYC 2F43B 3PR1A 3BC1A 2XSZA 2GVZC 2DWQA 3S1AB 4CW7A 2P6UA 3T1OA 3IPYA 4UXIA 3ZQ6A 4JKIA 4NYMR 4DC9A 1ZNZA 1U81A 2WWXA 1VPLA 2WPDD 3FWYA 1HA3A 4TYNA 5CDFA 4WZBE 5KSYA 3KXIA 3AVOA 4QBIA 1UKVY 3VAAA 2CHQA 1NLFA 3L0OA 1JB1A 3KJIA 2GF9A 1G1MA 2GVDC 3FFAA 1G4AE 1E2PA 2QSZA 2CVFA 3PG5A 5ANRB 1SVWA 4CEJA 3OAAD 3VR4A 4ASUD 4MRVA 2LCFA 4DEXA 4G3XA 1YR7A 4HAWA 3WY9A 2GBLC 2OBNA 3CRRA 4NYIR 1T0JB 2DWOA 1ONBA 1HURA 4XTRA 1HUQA 1W46A 1R2QA 3RANA 2BJWA 3CPEA 3EXAA 2FN4A 2HXYA 4G5QA 4KO8A 4LJ7A 3K9GA 2AHOA 4DIEA 4Q1DA 2ODBA 1W0JA 4DUGD 4CEIA 1ZBDA 2TMKA 4Q1BA 4UJ3A 4PSAA 1NN0A 1GP2A 2VP4A 2OLJA 4QJ4A 4TMZA 4II7A 1EG7A 5EUMA 1AM4D 2NMVA 1NF3A 1TMKA 5L3SB 1ZU4A 2A9KA 4XD7A 1R8QA 1RRPA 3GCGA 2G9NA 3U4QA 3MWYW 3IUYA 1IXSB 1P2UA 4Q4HB 5DYGA 1W4RA 2EYUA 2KBFA 1AA9A 1M74A 4I1VA 4QG7A 4MGIR 3WYAA 3EG5A 2O5VA 2MMCA 1FTNA 3B1VA 3CNOA 3QF7A 4LV8B 2O8EB 2F3TA 3DPUA 4V02A 1RIFA 2GESA 5L3RA 4OBEA 1W5SA 3NC0C 1P75A 3IQXA 4IEIA 1D2NA 2UKDA 2V54A 4LJYA 1OT3A 5A4JA 4XIGS 5CK5A 1MKYA 2XOKA 3AKEA 4G1UC 3AP3A 2F9LA 5CB6A 1II8A 4PHTA 3LWNA 2ZIAA 1GOTA 3A4LA 4LK2A 4LX0A 3IIKA 3CW2A 3PCRB 1GG2A 2ZU6A 3PITA 2XNDA 1IQPA 2GXUA 3O8DA 1R0WA 4KFRA 3CM0A 4QNRA 1OLOA 5DI3A 2ZM5A 1ETUA 2ODWA 2W6JD 4NH0A 2DB3A 1T8UA 1ZUIA 3O8BA 1E9RA 2Q0HA 1J90A 1NLYA 3CUEF 2RCNA 2JIZA 2Q9AA 3LBIA 1F6BA 3B60A 3LDAA 4LPKA 1W2GA 5E3HA 4ZCIA 2VO1A 4EUNA 2WOJA 3LX5A 3TNFA 3HP1A 4CYMA 2AWOA 3NIBA 5JFGA 2W2TA 3DM5A 1CS4C 4TYPA 1UFQA 1YR8A 4US2R 5C1BA 4FW9A 5DIFA 1X1SA 4HLUA 4BFSA 4OJQA 4JYBA 4DRZA 2VP2A 4HLQB 4YMVA 3QG5A 2EW1A 1G19A 4M1MA 3OIUA 1CP2A 1VG9B 4OI1A 2J9RA 4N3NA 3SI7A 4B3BA 3TVDA 3U44B 1Z5ZA 4P4TA 4CVNA 4K8OA 2BEJA 3EASA 4FIDA 5JI2E 2ATXA 2G0TA 3NBFA 1E4YA 4JVNA 4NCKA 3HU1A 1RZ3A 4AI6A 3WHLA 3S1AA 2OUKA 3DZ8A 3VR1A 4YLGA 3U2QA 4EQ6B 1OPXA 4HAZA 1UEIA 2QMUA 1WBDA 2BOVA 3Q7PA 4QOSA 3LQRA 3MWJA 2GZHA 4BEJA 5DISB 3FMIA 2FA9A 2WWYA 5J4HA 1IN8A 4MRNA 3IILA 2BBSA 2VP6A 3D6TB 2FE4A 2N42A 5CIQA 3TSWA 3TMKA 3DEFA 2ZRMA 2A5GA 2GEDA 2QTVB 2ONJA 1GVNB 4C0BA 3FOZA 4LOAA 3FHTA 3WYGA 3AUYA 4EPTA 4L9SA 2QTFA 3IEUA 4RZXA 3RS2A 1HQYE 3SOPA 3ZVRA 2DR3A 1Z2CA 2I4IA 3FHCB 2PH1A 2VHUA 2HLDA 2ZUDA 1LTQA 3NBXX 3QSYA 5CITA 3G5UA 4U7DA 1Z8FA 3EA5A 3TR5A 3AF1A 4DLTA 1AS2A 1SULA 3GLIB 4IDQA 5GJBA 4P4SA 4GDFA 3BB4A 5C2JB 521PA 1JAIA 4ACBA 3EPHA 4MDFA 4RD6A 2JLZA 1AQUA 3L0IB 4RFSB 2RGNA 3OEEA 2BC9A 1W36D 1RVDA 2NO9A 5J4KA 4B35A 3CPJB 1G7CA 2WKRA 5EZ5A 3X1ZA 4GFDA 1HE8B 3WBKA 2GCPA 4DVGA 3UWKA 4XH9B 2JJ1A 2YWHA 3JZMA 3TVTA 1J8MF 3VMFA 5K8TA 1OJLA 3WRYC 3LV8A 1JR3A 4QBFA 4D0GA 2XXAB 1QG4A 2QY9A 2O8EA 1MH1A 1KSFX 4C0AC 3C5CA 1EESA 4FN5A 1MO4A 2ZAMA 2PX3A 1COWD 2BKUA 1KI8A 3Q85A 2BHRA 4AY2A 2QEQA 2ZXUA 2WWWA 1DE0A 3UKDA 1CIPA 2I1QA 2FDCA 1X3SA 3K70C 4TQAA 4ZKEA 4TMKA 5FL3A 2FZ4A 3ZZ0A 2VPPA 3FYHA 4F4CA 2BEKA 1TEVA 4B75A 4PFSA 3MAAC 2CJWA 2BIFA 1L4YA 3MCAA 2R6FA 2QM7A 5EE1A 1FZQA 1OXVA 2FSHA 3SS8A 3ZD6A 1FQKA 2BCJQ 5JCZA 4FINA 3ASZA 1P62B 2PL3A 1UPTA 2L0XA 4WIAA 1TNDA 1X1RA 1T5IA 1XXHE 1GKIA 1HE1C 4R98A 4KVGA 1F2TB 1AKYA 1A4RA 5HE8A 4EFNA 4OI0A 3WHKA 3E5HA 1P9NA 1N6NA 4JJKA 3K9LA 4QL3A 1EGAA 1SXJB 4UNSA 3TGPA 4CEHA 1G6OA 4DLRA 2PT7A 1PJRA 3SYLA 3W6PA 2GZDA 5E7MA 1N5LA 3GFPA 2KSQA 2W6IA 1OH5A 2WSSD 3FKQA 1KI6B 4BFWA 5KNBA 4ZV4A 3U44A 2F9MA 2WVJA 5GVSA 1KIMA 4S2EA 2J5XA 4HAUA 5FOTA 5BYKA 2ORIA 4D4LA 4A4DA 2PLFA 3QKRB 1DEKA 2RGGA 3VR3A 1W48A 3CKLA 4OI2A 4CRWB 2ZS9A 3NDBB 4IVRA 4LY6A 3ZYCA 3AVWA 5AJYA 3KB2A 2NPFA 1VYTA 2C77A 4XTCS 3HR7A 3U3MA 4B76A 2ZS7A 3MD0A 5FI1B 1ZIPA 1BS1A 1T0HB 4R7ZA 3A1WA 3CR7A 2A2ZA 2OO7A 2X1VA 2ZI3A 3IGFA 2QORA 3LNCA 2F6RA 2NPIA 1CR0A 2XTMA 2BV3A 4PHFA 1XU4A 5EE3A 3B8HA 3NDPA 3Q5DA 1KK0A 4KLZA 5CK4A 4DLZA 1AIPA 2ZQ5A 5G3YA 2W58A 3T1QA 3CRVA 2IUUA 3NWJA 4RCZA 1VG1A 3KUCA 1JEDA 4TL8A 3HR8A 3Q7QA 2IYQA 3W34A 2DFLA 2ZJ2A 1DARA 2A7QA 3GLFB 3FMPB 1KZ7B 1DOAA 2Q21A 4IFBA 4Z1MA 1UDXA 4DSTA 1LB1B 4YQFA 5JEDA 5KPDA 3U6BA 1IJFA 4HZUA 2HUPA 3QVVA 2JASA 3LW7A 4A0HA 4BEBA 4RFSA 2WIBA 1B0UA 5KSZA 1Q12A 2CK3A 1CXZA 1L4UA 1HEIA 1CLUA 2IWHA 4HATA 3LW8A 3F8TA 1ZNWA 4Q01A 3W8NA 1X8KA 1Q1EA 1H8HD 1NY6A 1RRFA 4DKXA 1G7RA 1KO8A 2B8TA 2KJQA 4WW0A 3HPRA 2CCJA 2WAXA 2ZI6A 4Q00A 3TUZC 5KDDA 4BRUA 2FEMA 1KDOA 5TY0A 3RSLA 2FF7A 2XXAA 4R2IA 3Q9LA 4KVAA 1XTJA 3B7GA 5FTNA 2OLKA 1OHHD 2REOA 3LA6A 4BLRA 2GILA 4WOPA 4MKHA 5CJPA 4QJ3A 1ZJ6A 1KDPA 5DHFA 1TX4B 1EXMA 1U8ZA 1Y3AA 4YC7A 2WJJA 1DG1G 3BORA 3MRSA 1E9BA 1XTQA 3A1SA 4Z8YA 4XSHA 2V7QD 1GRRA 1XMJA 3B1XA 3BRWD 2ZJAA 1PLKA 4ARZB 4WZ6A 4BASA 2F1JA 2IK8A 3ND8A 4A8JA 3T12A 3U7GA 2GXSA 2VQSA 4AC9A 5DLQC 1YZNA 3IHLA 4EPYA 5B57C 3N2EA 4OK6A 3MFYA 4IDNA 1W7AA 3TBKA 2Q3MA 4P3YA 4IDOA 4AYTA 3AH8A 2EQBA 1BKDR 2WKQA 4L15A 2ZTSA 4JVLA 2JEOA 5LPNA 4M1OA 5EXPA 2NO7A 3I5YA 2PZFA 1IAQA 3KKPA 2IYZA 2PEZA 4NTZA 1NG1A 1F2TA 2RHMA 5LBIA 1TQ2A 1DG3A 4KFTA 4IEEA 3TR0A 2XJ9A 1SXJA 4IOKA 3VR5A 3J81k 3KQNA 4GOXA 1Z08A 2Q6TA 5EUQB 1KMQA 1W2HA 4FMCF 4EPXA 3BH6A 2BMFA 3U3RA 5J4YA 1D8TA 1HY3A 1Z83A 4U5XA 1SVKA 3T61A 4B3XA 3UG6A 4A1FA 1IN6A 2EFCB 5KNDA 4KBFA 8OHMA 1EFCA 1E1RA 4H1VA 3TIFA 2QT0A 3RC8A 3AP1A 2EFGA 3UWOA 3ZZUA 4JYCA 5AK0A 1NVWQ 5FR2A 2GDJA 4JLJA 1TADA 3TAHA 4CT4B 2JDIA 1WF3A 4KFSA 3QKRA 3RS7A 2X2EA 2VSXA 1UADA 3W5JA 3I4LA 3LFUA 2AX4A 3QKUA 2QTHA 3C5HA 1NY5A 3KZ1E 3QI2A 2VEDA 3TSZA 1GKYA 4OYHA 3OEHA 3PUXA 1XTKA 1BYIA 1YJ5A 3RDPA 1ANKA 2D74A 2WICA 4ON9A 5J40A 5K8UA 4LJ4A 3KKMA 4RD2A 3TUIC 2C5LA 2GJ9A 4HLDA 2YYZA 4Y0AA 3IIJA 5EE9A 1XEWX 4IXNA 5B2ZA 5HKKD 1NVXQ 1VDZA 4OI4A 2WAYA 3FPAA 4IVQA 2WV9A 4OQFA 3RS5A 1VIYA 5K8IA 1H8EA 3K09C 1P6XA 1JECA 2V55B 1BYUA 2OCPA 1GRQA 4MQBA 1MO5A 3ZLJA 3THYB 2CDNA 2JJ2D 4F4IA 2IS6A 1AGRA 2REXB 2X2FA 1U8AA 2WWIA 4PZLA 1Z06A 4C0HA 4A82A 1SHKA 2BCGY 3I8SA 2JJ8A 2B92A 3UANA 1G5PA 2GJSA 4E09A 1UBFA 3GLFA 4JLAA 2D62A 1RRGA 2P65A 2H16A 5FBVB 1BMFA 1T91A 4TQUS 2J0UB 1TUIA 1P73A 2EFEB 2ORWA 1GRNA 2NO6A 3P32A 4K81B 5KSOA 1Q22A 4LV5B 4A8JC 2IX3A 1G8PA 4RZ2A 6Q21A 2A5FA 2WJIA 2NIPA 2CMKA 1GFIA 1EWRA 1P2VA 2IYVA 3GLHB 5EP2A 4LC1A 4MRSA 4QC2A 3DM9B 3W9YA 1VCOA 1MRSA 2GK6A 4JT2A 2QZ4A 2DFTA 5DSZA 2IYSA 3ADBA 3BH7A 4LYAA 3AVUA 3EZ9A 1FL9A 3M6AA 3GLGB 1UDWA 1P4SA 1NKTA 4BFZA 4YXWA 4GOKA 1SVMA 3QF4B 5E7IA 4QHSA 4BLPA 1R4AA 2ZR9A 2Q3HA 1IY0A 4YMWA 1VIAA 2QPTA 4Z54A 2A30A 4X8MA 2PEYA 5EE5B 2O8DB 4WAUA 3AM1A 1ZNYA 3Q5EA 4EAQA 2FSFA 3C4JA 3RRYA 2NGRA 3THOA 1YR9A 4Q21A 1E32A 1E2HA 2XJ4A 1KMHB 4ACAA 2NO1A 3LO5A 4Q9JA 2IEZA 3GPLA 5J47A 1M34E 5AR1A 1Z6TA 4C9BA 4MKFA 3OF5A 1YZKA 3ZQJA 5KPJA 4PQYA 4JSYA 4ZKDA 1GL9B 1L7VC 5J4LA 2CLCX 4JS0A 5D3QA 4TT3D 4HUTA 1C1YA 1NBMD 4F91B 3KFXA 5GJWC 4QFMA 2O8FB 2CL6X 1NMYA 1KJYA 1OV4A 2QAJA 3RNLA 5DH9A 4QXAA 2QN6A 3BFXA 3R9IA 1GIAA 1W4BA 1ZW6A 1XPOA 4E07A 1YU9A 1QVRA 1T8TA 2MSCB 4US1R 2YJTD 4DDVA 2ZRBA 5F9FA 4MA4A 5GVRA 4F93B 1E2MA 4QNMA 2ZJZA 3AKCA 1P2TA 5JHGB 1US8A 1D2MA 3AP2A 4BZXA 5KNCA 1TQ4A 4L8GA 3WXMA 2RB4A 3QUSA 1DAFA 2Z6VA 1II8B 3PFIA 4M1TA 4PANA 4TYQA 3U3JA 1VMAA 2AKAB 2DCUA 4GT1A 3KKOA 4GNKA 4FMDF 1DADA 1RE0A 5HCIA 2GK7A 2W0SA 1IXRC 1G3IA 3RVBA 4DZZA 4ZDIA 3M4YA 3TQFA 2GEVA 3PV0A 1EFRD 1EFHA 3VFDA 2V4ZA 2LKDA 2YC4C 2ZUBA 1UKYA 1Z6YA 1S3SA 4KHZA 2FU5C 3OFND 3T5GA 3ZVLA 5C4MA 1CULC 4QGHA 3PUWA 4UNPA 4DSOA 4M9QA 3W5IA 4GOJA 4GMXA 1IY2A 3KQKA 1FTSA 1N5IA 1N25A 2ZU0C 4PPNA 5FUWA 2IS1A 4UJ5A 2HCBA 4B48A 2O8CB 4JSTA 2GETA 4ZCLA 5H70A 5HE9A 5JRJA 4TN1A 3K70B 2CBZA 3AF3A 5FPKA 4E03A 3A1VA 1MOZA 4LV6A 3QEJA 4PAQA 3SHFA 1NG9A 3GLHA 3B2EA 1WDTA 3DL0A 5AUQA 2FFAA 4NCIA 3E70C 2ZVPX 4KSCA 4MRPA 3OE7D 1CEEA 2WZQA 4NONA 2GAAA 2OESA 4AG5A 1IN7A 2CNWD 3GLGA 2GEUA 2B7CA 1FP7A 4HB4A 3EW9A 1R0ZA 2QP9X 2ZETA 4AKIA 4YMUA 1ZNXA 3P1JA 3K9HA 3QF4A 3EWSA 1XWIA 4TMTA 2KI5A 3Q8XB 2Y8EA 4G0NA 1ZCBA 3BB3A 4AYXA 1XX6A 4G5SA 121PA 3KX2A 5CM9C 5GJVC 2PBRA 2QSYA 2HXSA 2Q9BA 3W6NA 3ADDA 2O8DA 4UNNA 5LD2C 1QHHB 2ZRAA 3LBHA 3PEWA 2C95A 2J41A 3EARA 3T35A 4BFYA 1WXQA 2ONKA 4N0DA 4HI0E 2ZJ8A 5JWHA 2OG2A 1RRCA 2F7SA 2I3BA 4Q1EA 1KMHA 1WCV1 2VHCA 2JATA 2ZSEA 4C0KA 1O87A 2W2VA 3A4MA 2RGDA 5FTKA 3X1XA 2FSIA 4P4SB 1KY3A 1QHYA 4W5JA 5L3VA 1J2JA 4XVQA 5AWFC 2GJAA 3QPVA 4EFLA 2W2XA 1Q1ZA 3IHWA 3JVVA 1CJTC 3HPQA 1FP6A 3QXHA 1JBKA 1QHXA 2IW3A 2Q3FA 1E2DA 3GJ6A 2O8FA 4YDHB 1E0AA 1FOEB 4PPQA 5KSPA 1ZD9A 3KKNA 1XCGB 1YQTA 1YHNA 2RHDA 2ZROA 3MWLA 1CKEA 2JLSA 4LJAA 3BJIC 5L8VA 4C0LA 4DB4A 5CDFE 3IDQA 1Z07A 1E9AA 1DAKA 3DDCA 1ZC4A 5HCNA 1M1YE 1Z6AA 5AUPB 4EKDA 2NG1A 1TQ6A 3T5DA 4NDZA 4CT5A 1XDBA 2IXGA 1D9XA 3WBJA 1S9DA 1UJ2A 3UIEA 2WOOA 2ZJBA 2FSGA 2E9SA 1OFUX 4M1KA 4E5UA 1TEXA 4JL8A 2A78A 3BGWA 1A82A 2ATVA 4IVPA 1FUUA 5TARA 1Y63A 1W0KD 1P5ZB 1N6PA 3H1TA 3TE6A 3TW4A 1F48A 4A6PA 4BFTA 4D4KA 1T3LA 1EFTA 4XVRA 3SZRA 5LB4A 2IS2A 2XZPA 3KXKA 1R0XA 1DTSA 1DVRA 3B1WA 3EC1A 4PO1A 2CJWB 4XWAA 4O0MA 2YOFA 5FL7A 3B9PA 1F2UB 3U7HB 2GXAA 1AS3A 3E2IA 4YONB 4LUCA 3U5ZB 2FX3A 4J0QA 3HU3A 4D4MA 4V0NA 4EPWA 2VL7A 4HDCA 2G6BA 1NIPA 1MRNA 5JSZA 4CEHB 3N70A 2HF8A 1NSTA 3AVQA 2J59A 5A0FA 3R9WA 1SKYB 2CE2X 2WJHA 3L0PA 1QZXA 5TMPA 1E2IA 3PEUA 1A2KC 2O0HA 4R71A 2GHIA 2E1RA 2OZEA 4QGGA 2O8CA 3HWSA 1Z2AA 2IT1A 1YZTA 1E9CA 5TDHA 2OEPA 5C46F 4QM7A 3BK7A 3M0EA 3X2SA 4IRUB 1NN3A 1YRBA 1SHZA 4MUBA 4PO8A 3X1YA 2H5EA 1W47A 2YOHA 5FPTA 4QGFA 1ELOA 2FWRA 5EP1A 1OH6A 4IOJA 5F2EA 3NC1C 4QRHA 4G5OA 5EXXA 3BFKA 2ZREA 1E1QD 4Q9HA 4XWOA 3O8RA 4I1OA 2PT5A 1Z0FA 1IXZA 4B2LA 3ONWA 5AUOB 3T06B 1KI7A 1S3GA 3WP1B 1AK2A 1E69A 1OKKA 1XMIA 2OFXA 1OYWA 1S1MA 2C96A 2HF9A 3RYTC 3FTQA 1D9ZA 2ZI7A 3KTAA 1QHHA 3EIHA 4MKIA 3BFVA 1G18A 5DN6D 1UM8A 2XNSA 1NVUQ 1TF5A 4LGMA 5DGXA 4A0RA 1A7JA 4Q7LA 4TMWA 5BWMA 5IHPA 2J46A 2YOGA 4FXPA 1HT2E 2C8VA 3AF2A 3ECCA 3NVAA 3BB1A 2HT6A 4HDOB 4ERNA 3CRMA 2WBLC 2D7CA 2P6NA 3ZGXA 3GJ5A 1WRBA 3QXCA 4LBZA 5L3QA 4HZUB 4Q4LA 3RABA 1ZVQA 1GWNA 1W5TA 3RAPR 1G291 2C9CA 1B23P 2XB4A 1U94A 4DWJA 1VECA 1CU1A 1YKSA 3GEHA 4TSFA 5GADl 2EWWA 1G8GA 2J7PD 1D5CA 4JLVA 3T15A 2KB0A 3CONA 3GJ0A 5BN4A 3VKWA 4AD8A 1O3YA 2J0VA 2PJZA 4JZKA 4LBVA 5CLLA 1KSGA 5FOUA 3ZIAD 1DELA 3T1TA 1G5TA 1CRPA 4KAXA 2HJGA 4DCVA 1GNRA 1S9HA 4B47A 2G1JA 2IF2A 2BMEA 3BS4A 2GA8A 4MGZR 5IK2D 4RZUA 4IKEA 4PQFA 4Z51A 1DS6A 5JMTA 4GSYA 3G82C 2ZR0A 4PX9A 2ZSFA 1KDRA 2ANCA 1IY1A 1TAGA 1GSIA 1JJVA 1FNNA 1NP6A 3GFOA 3UMRA 1NBME 4JIMA 5FUXA 3EIQA 1J99A 1Z28A 5H1YA 4A0GA 4B3CA 4A8JB 1BH2A 3RWMB 3KL4A 1T3HA 4TL9A 4V0MA 1YZLA 1E79A 2R6DA 3A4NA 2X8AA 4D81A 1W4CA 4NBSA 4Q4JB 2PLRA 3ZS8A 3LBNA 4OQMA 1XPUA 4DCNA 1F2UA 5EP4A 3TLXA 1HT1E 3THXB 1G17A 4IDHA 3PEYA 1UBEA 3QXSA 2DWPA 3EX7C 2HV8A 3QQ5A 4LCBA 3I3SR 1AN0A 1AS0A 4B43A 1E2EA 5TVKA 2RGCA 1PZNA 2F1HA 2C2HA 2VYFA 3OIVA 5DNYB 1JR3E 1GAJA 2P0EA 2ZSAA 1DO2A 1AGPA 4B2IA 1E6CA 1HYQA 3FFBA 4MYTA 4KLNA 1G3MA 1EWQA 4NCHA 4GPTA 4Q5IA 3PQCA 1KSJA 3HU2A 3ZH9B 4MKGA 3WYFA 1RPZA 1KO5A 1ZM9A 2HT1A 2WMNB 1OB5A 1DAIA 2R6GA 4JLOA 3CNLA 3QOFA 1GITA 3PIRA 1LVGA 1DAMA 1G4UR 4OHXA 5G53C 4GP7A 1N5JA 4Q9KA 3SJBA 1KO7A 2CL0X 4IOLA 4Q1AA 4US0R 4GI7A 2D2EA 2NZ8A 2WWGA 1N6KA 2ZRJA 3DKVA 1E2NA 3AVXA 5JJKA 1T6NA 2QQEA 2FH5B 4JVSB 4URWR 1OW3B 2QT1A 4D4JA 1IOZA 1XD9A 4KITB 1E2KA 3SC3A 4MRRA 2ZJYA 2NZJA 3LLMA 4LJ5A 2ZPTX 4LYJA 4FMBB 1Q57A 2IXFA 1NVVQ 5CIWA 4AKGA 1EK0A 5JBQA 1M7GA 4BFVA 2WPDA 1OXXK 5FBRB 2CVHA 1KHTA 4MUAA 1E94E 1ZM4A 1F60A 4OQNA 4EIWA 4ZIRB 4CGZA 2R44A 3V9PA 1XRJA 4H1UA 2V6JA 5AJZA 4RFVA 1W49A 3HDTA 4LRWA 1KK1A 1XB2A 5LB2A 5CYPA 3OAAA 5EZ6B 4ASUA 3KQHA 4B34A 5DYIA 2JGNA 2AXPA 2P67A 3F3YA 4PZYA 3KQLA 1KKMA 3LVQE 1R8SA 4BFUA 2AFHE 2DFNA 3RC3A 1D6JA 3X1WA 2IXEA 2VP9A 4PR0A 3QIAA 3ZDQA 4O2RA 1YRAA 3B5JA 3I5XA 4P33A 1PLJA 5BYJA 1FMLA 4C30A 3Q3JB 3GD7A 1GM5A 4W5HA 4AWXA 4LHZA 4DUGA 2MMGA 5EP3A 2H17A 1A2BA 1XNJA 4CIDA 1JALA 1PUIA 3K09A 4RD0A 2J0SA 2O0KA 1XD2A 2QE7D 5FTLA 2AR7A 4LHVA 3FKSD 4NU0A 2JLXA 4HUQA 4DLSA 3OIYA 2OAP1 4TLDA 4Q9LA 1YR6A 2D4HA 3W90A 2XSZD 2QA5A 5AUNB 2VIIA 4IW3B 4B3FX 1M8PA 1E2QA 3WMEA 3I72A 4O25A 4ABYA 4POAA 3ZZTA 5DE3A 4YDSA 4DLYA 4TZ6A 1T9HA 3GLIE 1NVVR 1Q1QA 1E0SA 1J7KA 3FGNA 1JR6A 1WQ1R 4N0EA 4JMPA 2R65A 2QGNA 4CZ2A 1XTIA 1T3SA 4KFUA 2RH5A 4BLOA 1D2EA 1I4LD 3DKPA 4HLCA 4Q4JA 4PHGA 1XD8A 4QHTA 1WE2A 4PTLA 1K5GA 2WM9B 2AXNA 3SFZA 3THXA 2ZI9A 1E9SA 4BZQA 2V6IA 2DBYA 4JL6A 4BUJA 1GL7A 2V1UA 2RGXA 1W4AA 4YMSA 1CR2A 1G21E 3LRPA 4LJ6A 2W6JA 3KB1A 2IYUA 3NH6A 4BGDA 4YMTA 4RD4A 1W0JD 1A1VA 1XZQA 2VF7A 1N6IA 2RGEA 1LFDB 1SVLA 2FMXA 1GL6A 2QMOA 4I4LA 2GF0A 5LD2B 2O0JA 1XZPA 4XD7D 4Q1CA 3EIEA 1VG0B 5IT5A 5C18A 3AVYA 3GFTA 1P2SA 1JXMA 1SVOA 2WIAA 4RY2A 4W5WA 5B30A 1VHLA 1I4DD 2WHXA 3QXJA 4EJSA 2K5UA 4KYUA 4PHHA 2F55A 1US8B 1KI1A 3GJXC 4TTQA 3QKTA 2ODNA 4B32A 4QBGB 4A0FA 4TYYA 2CCKA 4I1UA 1E9FA 2I1VB 2R62A 3VTKA 4BE7B 3ZD7A 3B82A 2XOKD 1G5RA 2C99A 1YVDA 4WXRA 1OFHA 3MWKA 3D7MA 1SXJE 1WBBA 4ZIRA 3UK6A 3V4RA 4BLQA 1Z47A 1BOFA 2V9PA 1Z22A 2XNDD 5EE0A 3K0AA 4HYYA 2ZI5A 1SVIA 2BBWA 2QP3A 4PAOA 4A6XA 2VP0A 5HR5A 1KK3A 3SBDA 4DLUA 1E0JA 3LXRA 2A5YB 3DHWC 2ZYVX 3TUJC 2JIZD 1Z63A 2YWGA 5KOYA 4Q48A 3AVTA 1AKEA 5EQTA 3SQXA 4XVUA 4BPBA 1KI2A 3TKLA 2FG5A 2EU8A 1G16A 1XTSA 2ZJOA 2QRNA 3H86A 4URXR 3LAWA 4JLBA 1E2LA 3VX4A 3QNUA 3K70D 1KAGA 2CHVA 1LF5A 2ZRLA 2ZUCA 2OM2A 4UXJA 1E9EA 4M8NE 4B3DA 5IF9A 1XPRA 2NOAA 3R7WA 1ZCAA 4C7OB 5AJXA 5SZKB 1KI3A 1PVOA 4Q19A 2GCOB 1AZTA 2YWFA 5FPYA 4HAYA 3ZIAA 2CHGA 1N6LA 1G20E 1ZP6A 3QENA 3TQCA 4C2TA 4AKHA 4OK5A 4P32A 5E4FA 1VTKA 4OK3A 4I81A 5G3ZA 3CZPA 1QHIA 2LWIA 3B1ZA 4V0OA 2V3CC 1COWA 1I4TD 1FQJA 3GLFE 4Q66C 4KCGA 4BFXA 1IN4A 3UPUA 2OBMA 2W0MA 1X86B 4JBWA 4RD3A 1WA5A 1G3QA 3ASYA 2ZEJA 1YZGA 2ZE7A 4ILEA 2HYIC 4JL5A 1JPNA 2DFKB 3U60B 3NKVA 1PV4A 1V43A 3EZ7A 3N2IA 3NHBA 1JXOA 4EJSC 3TW8B 3CPHA 2UZIR 1HV8A 3P26A 5JLJA 1RJ9B 4A36A 4TQ9A 3U3OA 2ECKA 1CJKC 2C03A 2HLDD 2B7BA 1R5BA 2BKEA 1K6MA 1XEXA 4Z8XA 4E22A 1NLZA 3EC2A 3CRW1 3A1UA 2FFQA 1U90A 2OV2A 1IONA 1S4QA 4TMXA 4XWKA 3AGQA 2V1XA 2YHSA 3REGA 1JI0A 3GJ8A 1U0HC 2OXCA 3REFA 5SZHB 5E7JA 4AIIA 3OEED 2QUZA 1JEEA 5FPHA 3L43A 5JRZA 1BO6A 3F0TA 4LHXA 1KZGB 2C9YA 4GRAA 5FBWB 3L82B 1FUKA 3V00A 2JJ1D 4TWZA 3B1YA 4B2PA 1KOFA 3CF2A 3VKGA 3ICQB 2GTPA 1U0LA 1XEWY 3VHXA 1S8FA 4MGYR 3MSXA 4Q1FA 1JR3D 4LHYA 1N0WA 2WSSA 3IEVA 3RSOA 2R2AA 1DO0A 4RKEA 1UBCA
chains in the Genus database with same CATH superfamily
1VSUA 3ROEA 1I51A 3A1TA 2GN6A 3O1HB 4BKUA 8GPBA 1T2EA 2QPAA 4ARIA 2IYXA 4IJWA 4Q9IA 1NZJA 4IL5A 3HP4A 4A2PA 1Y80A 1XFAA 1B1AA 3TWOA 1J8YF 4PFQA 3LWDA 1X1CA 3DOUA 3SY8A 5HTKA 4GLLA 3AM5A 2IZ6A 5E6UB 4C4PA 3EFEA 3LX8A 4XGNA 2OKCA 3EOZA 3EZFA 4KR2A 2V7WA 1Q5PA 1QHNA 1YOBA 1U65A 1MX3A 1ESNA 1KEVA 1Q21A 2J85A 2NM0A 1BE1A 2UZ3A 3MBOA 2Y05A 1DRKA 1Z6PA 2P1RA 1CFZA 3A6FA 3AM3A 1W1UA 3C8ZA 4N5NA 3WGZA 4XCXA 1IM2A 1CBUA 1YNSA 4ENUA 1EYZA 4E5PA 4FYMA 4UQOA 2I22A 4AUKA 2GFQA 1VJGA 4ZPXA 2X4GA 1E5DA 2PBLA 2OA0A 5FTJA 5AVKA 3GEIA 1YNOA 2FXIA 4LZNA 2V7BA 3NWOA 4WZBA 3FWPA 4XOIA 4LISA 1DTWA 2QT9A 3L6OO 3P9IA 5HKOA 3LWBA 4RK5A 2PGIA 2ZRNA 2VT2A 2AOUB 3KWFA 5K0GA 5AI0A 4XYGA 3ZWYA 1Z4PX 2W6ID 4LY0A 1QX3A 4B9EA 2ISSD 4NKRA 2W83A 3EZ2A 3GD5A 1Y89A 1OILA 1U2TA 2H8KA 1JTVA 1ISIA 4A15A 2JGIA 4FYWA 3MN1A 3NCHA 1FJGB 4JGGA 4RPKA 4FVTA 3LL4A 1GR1A 1S0UA 3KCNA 2A6PA 1SN7A 3P20A 3KSRA 3LIPA 2XUPA 3DVQX 4DCTA 1EX9A 1N2OA 2QJTA 3GFFA 1II0A 1M6VA 4URFA 3JQRA 4D42A 2O7VA 2X7HA 3EUFA 4NJMA 3BMOA 2X6RA 5FPSA 1TRHA 3ZK9A 3ZBUA 3NM5A 4F4JA 1OHHA 1YB1A 1TQDA 4OAQA 5EQJB 4X1KB 2FDRA 3FCSB 2WUDA 4MA0A 2C57A 5DLEA 4AJNA 4CM4B 2ZT5A 5KMGB 4COKA 1TJ5A 4JODA 1GSOA 4S1PA 4LDJA 3VR2A 4OX9Y 3LC2O 4I1SA 1ADFA 1F8GA 4B46A 3PNKA 2Y3IA 1FYFA 2YWEA 4ARBA 2YKGA 4GXNA 5DV9A 4URYR 1OBHA 4DPLA 4FD3A 3ZXIA 1LK5A 3FAZA 4UEOA 4ZI5A 5A02A 4Q47A 2WB4A 4II3A 3SYKA 3F8WA 1R9GA 1SAYA 3PF9A 1E98A 1MF7A 2HSGA 3I64A 1NQTA 3KWJA 4M4SA 4C06A 5BPHA 1I1OA 4CKEB 3DMYA 2XV1A 3FI9A 4PV7A 4DDUA 3VPBA 3R5JA 1N6RA 3UWMA 5KTKA 5P8WA 3DEZA 3N0VA 5JARA 1P6UA 2FGKA 3WMFA 3GLGE 1NJGA 4RIFA 1E2GA 1LKZA 1TYCA 3GRZA 3LCVB 1JLKA 3QOYA 4PRYA 3NTQA 3R6GA 4RA9A 5CRIA 5AI4A 2GVNA 4D3XA 4LF7B 1U9JA 2QRGA 3NBQA 2B25A 4FHZA 2YN0A 1ACLA 3F6BX 3O83A 4G2NA 1SG9A 5EZYB 1HRKA 4D97A 1Q20A 3IXMA 4ROSA 4R1LA 1S6YA 4P3XA 3BJRA 3N76A 4M0PA 1UJMA 4MSUA 3FDIA 4MA5A 3DVLA 1QP8A 4FT4A 3K1JA 3MTGA 4UM5A 2YJZA 2BHTA 3SF8A 4EZIA 1Z2EA 3ADKA 2P9ZA 3T3NA 4GSKA 5FR1A 4QULA 3H9QA 5J5CA 4DJFC 4OHMA 4J1QA 3C14C 4DA7A 4D9FA 1C30A 4EDHA 4HVCA 1WULS 3VNAA 2ZANA 1WUYA 3EA0A 2W4IA 4C5CA 5JQGF 1TVKB 2JAUA 2VTEA 3SAJA 3SZOA 4ZGBA 5F7OA 1ZAYA 1NNUA 2O7QA 2XCIA 1KXJA 4INJA 1WOMA 1K6IA 1S2IA 2AMVA 3IVCA 3TD2A 4EKNB 5JMWA 1Q0QA 4PLYA 2XEXA 4HZGA 4RSMA 1XZJA 2NZ2A 1VBMA 4JKYA 1PRYA 5ITSA 3H9JA 3I23A 2I03A 5TT1A 1OH7A 1RZRA 5SYAA 1KR5A 5SYMA 3DG9A 2FOLA 4BAUA 1R3DA 1JHYA 1BHQ1 5JMOA 2QK4A 4ZJZA 1D4AA 5A05A 5B3KA 4PNZA 1Z6XA 1P1IA 3LD9A 3UAXA 3C1TA 3ML1A 1QG2A 2Z95A 1TYBE 4BJ5A 4LWZA 4BB0A 1T0BA 4ZICA 3BSWA 3OC6A 5KYTA 1P61B 2X8JA 4K1LA 2C97A 4OLHA 4ZYUA 2FZKA 1SXJD 5JXHA 2JLQA 4UDYX 1Y9JA 2CLLB 3AKYA 1PR0A 3VU3A 4KDEA 4ALMA 1DBPA 2Z8XA 1N5MA 4L5BA 3N2LA 5JWRA 1Z5OA 4WKNA 3FOAA 1TVEA 4TS4A 4FD2A 4P0TA 1GHTA 1E3SA 3NANA 1E2JA 1HYGA 2W4MA 1E1RD 1K3UB 4MARA 4PLVA 2HL6A 1ISPA 2FMIA 4J0FA 4OHZA 4GMKA 5A6VA 2ZSBA 1IXYA 4UMDA 1ZH8A 2QQ0A 2RH9B 4FYKA 4YCAA 3W8EA 2B1IA 3QPAA 2DTEA 3R77A 2EARA 5JZVA 3DR5A 4DV0B 2YCBA 5L7YA 3PXXA 4HQLA 4CDGA 4CKZA 2YW9A 4L7QA 4NZYA 3WJ1A 1Q0RA 1EFUA 3Q72A 4ZCRA 1L8LA 1XJQA 4JA2A 1C8KA 1NZFA 4NE2A 4ZV7A 5T4BA 1BXRA 2WMYA 2DULA 3JQPA 3EGDB 2VH5R 1H2AS 1HH4A 3NRCA 1JHMA 2HSJA 5JZOA 2X40A 2VC2B 5HPYB 2FP4B 1MAWA 4WA8A 4F1WA 1Z18A 4MR8A 4MQMA 3IE1A 4UTRA 1ZC3A 1TJPB 4AY6A 4MKXA 2KE5A 1H8ED 3DP9A 4NYJR 4RSGA 2ZIXB 3R8FA 2E4YA 3DBHA 2JZNA 1PHRA 3DLHA 1S8OA 3FE2A 4QTTB 3O03A 3PIIA 3QFCA 2QL6A 4QJ5A 1XF9A 2CEAA 1U1CA 3EF0A 3INNA 4I46A 3UG7A 3D0OA 2CMFA 1LV7A 3K0EA 4BV9A 1KWGA 3V80A 2B6HA 3HDYA 1QRAA 3KUDA 4Y7CA 4DLVA 3TTUA 4LS3A 4X0EA 1O6BA 3WRVA 1SUAA 5AXAA 3SC2A 3RS4A 4C0JA 2HJHA 3IKJA 1HDRA 4DG8A 3W2GA 1I5EA 3DHVA 3ER6A 2QL7A 3HVKA 3PUYA 2BM9A 6CHYA 1DIOB 4Y6PA 4I36A 1RBMA 4FSXA 2P62A 1OAOA 4QEDA 3TB4A 3D5EA 5JUWA 3OZGA 1BXGA 1XKXA 4Z2YA 2BFNA 4HDQB 1P3JA 4WVFA 1W96A 3W3ZB 1QF6A 2JA1A 3QYFA 5ES4B 2G9ZA 3ZHBA 1CZHA 2J6CA 1E7RA 1LDEA 4D3YA 1AC5A 5C8XA 4Y6OA 3FWNA 2EL9A 2HDNB 4TXNA 4DNFA 2FY8A 4XPIA 4WJLA 2P6OA 4Q82A 1QYDA 4E08A 1EJ0A 3DMTC 4MO9A 4GU5A 4WHMA 2JLYA 5IJ9B 1L5OA 1VA5A 3KTOA 3MM4A 5AW3A 1BOOA 4IMJB 3OICA 5DHAA 3T5BA 4YCBA 1GPWB 1PLLA 1XRPA 3VR0A 4Q4HA 5FH9A 1XXHA 4H16A 2W2LD 3WDKA 4F56A 5K4GA 3I1IA 4O4JB 4LN1A 3K0KA 4J4HA 4G0UA 3M4JA 1HNWB 2PPLA 3IP7A 2HJWA 2J48A 3KXPA 3OPMA 4RQTA 4RM2A 1QZTA 4V0LA 4DWOA 2H9YA 1FFHA 4P34A 4W6QA 3TLYA 1T34A 4BNFA 3ANLA 2J1LA 4WEQA 1YFZA 3IEIA 4GZLA 3RU7A 4RU1A 4N3CA 1U3UA 2FR1A 1JEJA 1HL3A 2Q2OA 4L3VA 1L6RA 4ZI7F 2JAHA 4C3OB 2IH4A 1KE1A 2YV5A 2OK8A 1G8HA 3TQOA 3DZDA 1P7CA 2RHJA 4KLAA 2C8JA 3ZCPA 2E4UA 1NBEA 4KKXB 4DA8A 8AT1A 4AF6A 1IATA 3OZAA 3WL4A 1I2CA 4Q4AA 2VPQA 4X3PA 4BVAA 1Z34A 3CLRD 1OI4A 3GX1A 3N2KB 2BL4A 5TB5A 5IM4A 1Z5GA 2O8BA 4FMCB 3F5FA 1EFRA 2VYCA 3IAUA 2DLCX 2XQKA 4GVLA 1HK7A 1QS0A 1MJNA 3G8AA 1GZSA 3G79A 3L84A 4ZD6A 4V0KA 2WT8A 9LDTA 1SY7A 2IA5A 1CG6A 3NEPX 4N4AA 4OIFA 4ILKA 2A84A 4LI0A 3DOIA 4RIHA 3W8RA 3IQHX 3L7MA 4E7PA 4D7AA 2XPCA 1YA4A 2QSUA 1ZESA 2VOJA 3D43A 3G8DA 4NBWA 4I3HA 2FSPA 4B33A 3N53A 3CVWA 4CJXA 4DBVO 3ADOA 1TPYA 3Q7TA 3D5TA 1AKWA 1ECBA 2ZYWX 3GY0A 4CQLA 5JPDA 2DMRA 2RMKA 3I2JA 2IDJA 4D6PA 5T3YA 2Y6VA 4XM1A 3VPFA 5KJ6A 4DV6B 2VSFA 2DY1A 4FCVA 1P7YA 4TLAA 1A4IA 1KTVA 3AMVA 3I8XA 2V9ZA 1XZLA 1Y6JA 1YVUA 2QTZA 2WG2A 4YCJA 2G3YA 3SNHA 5JS2A 1TM2A 4BGVA 5K0ZA 3KR2A 4FW8A 3NR2A 1SCDA 1TLTA 2DC1A 4K6HA 1NC3A 2A92A 2I78A 3GFVA 1TF2A 3RYFB 3BQ9A 5A4AA 3SR3A 2OCDA 2I71A 3TZBA 1CV2A 1NOKA 2POCA 4JAVC 4ZXPA 1SHTX 3WIVA 1ZJYA 2IUYA 3PHGA 4HC4A 1J0CA 4PW0A 4WERA 1VIDA 2BI8A 3RT1A 4MKRA 5LDGA 4PSKA 3A9SA 1W4ZA 3ZNNA 1MVOA 1RKBA 2PJRA 4CUZA 1QLHA 3EQ8A 5DBOA 2R2GA 1DOZA 5L7WA 2V5AA 3LY5A 4HADA 3RKRA 5A7FA 4Z9BA 2RGNC 2TMDA 2FAXA 3P8ZA 5JWOA 4CF3A 1JFSA 1SBCA 1IMJA 2C2YA 1LPOA 3VGJA 3I1YA 3TZ6A 5JDCA 2C5AA 5DO9A 3FY4A 1KHHA 2V59A 4RTOA 1LS6A 1U7ZA 2H4WA 2TMGA 5DX8A 1E6UA 3LQFA 4C0SA 3C6XA 2B2XA 1F06A 1ULHA 4X1IB 3QXGA 5JEEA 1AHPA 4D9MA 2RAPA 2PJDA 2LIVA 2XGGA 1ZH4A 4WBNB 5GINE 4CIBA 1A9XA 3IT0A 1JWBB 1O94D 1ZGCA 2DUUA 2I1WA 3HYTA 1B0AA 3DV2A 3KJFA 4KB5A 4QELA 4CIYA 4DA4A 2WINI 4G0OA 2G0NA 3H9GA 4AS2A 1A2QA 5BRNA 2XMCA 1QTQA 5I7UA 5DGCA 2V58A 4AS3A 1RXSA 2VDNB 1EB8A 3GEBA 3RF7A 3UGTA 4UM8B 3WP0A 4HX9A 2F4VB 1SRQA 3RHFA 3R7WB 3GCDA 4UVGA 1EWVA 2F1RA 1R0KA 1UOOA 1YJCA 2Q3JA 1WEKA 3ZNOA 1MPXA 3BD6A 3IQIX 1F2DA 3NHUA 4BO6A 5KUTA 1FFYA 1Q3TA 2Z04A 4BQQA 5AW1A 3K0FB 4DJTA 3EW7A 4KQ9A 4WZAE 3MQ4A 2BGTA 2R85A 4NPCA 2OD9A 1MHTA 1ZVKA 3F46A 5AHKA 4DV7B 4M88A 3OUUA 5KQPA 3AY6A 1L8OA 2VVTA 2YCLA 1YQXA 4HFJA 2XAUA 4JLNA 4URZR 3W4JA 1UXKA 1DP4A 1KDYA 1AB5A 3NXKA 5HZGA 1DAHA 5LP6A 1SKAA 3O2NA 4AMZA 1PNQA 2EQAA 5LDDC 3CEAA 4HDAA 4NBKA 4P31A 1G9XA 5EYPA 1H0SA 2D2FA 3RTAA 2OVFA 2R6AA 4DILA 4S04A 1G8YA 3U4GA 2RKBA 2DKOA 1W0KA 1U5BA 3KQOA 3KYCA 4Q7KA 4RKRA 4ZQGA 5LN1A 3OJLA 4OJKA 2IHKA 3I9MA 5K3FB 4EG7A 3OQMA 2O59A 1P4JA 3CZ5A 4L1KA 4TXMA 3B1KA 1GUFA 5IKOA 2C2OA 3DR3A 1Y37A 4DMHA 2ACVA 1QLWA 3EY4A 3FMVA 3U3KA 2XYGA 3V4OA 1FJXA 4LF6B 2Z83A 1P0IA 3U17A 2CL7X 1QB7A 1FPMA 1TTQB 4UMEA 4D79A 2B20A 3R2JA 2YINC 5AKLA 3K0CC 4M0UA 3HV0A 4DE5A 3SXUA 4U2EA 2IYNA 1M83A 4LHWA 4KR0A 1QTIA 2NN3C 1JDBC 3DMPA 4NF2A 1KOLA 5C4GB 3LQKA 2ACKA 1WU8A 3U7EB 4QKQA 4DHEA 3QEKA 3V33A 2R9VA 1M2OA 1KU0A 3DOFA 2J6HA 1RLMA 2E5WA 3E8MA 3JU3A 5FPQA 4FQ7A 4C87A 3D31A 4IIJB 4QUIA 2A0YA 1RWWA 5DWVA 4JLKA 5FNVF 4A92A 1RBZA 3SYNA 4PLHA 5I7SA 2EJWA 1JE1A 4E1AA 4LRYA 3N7AA 4JY7A 1VCIA 2D2IA 2VPYA 3AVPA 1H2EA 3OU6A 1YRLA 1SCKA 2RAVA 5CLHA 3CZ4A 2LGJA 4U3JA 3VAZA 5JS6A 3B3AA 2VLIA 3GN1A 2BUBA 1QYXA 2Z5FA 1AJEA 1DDOA 1M2KA 4X20A 5HIAA 1DBIA 3QTBA 2UYCA 1RRMA 5ILGA 4BU0A 1B6RA 3CBQA 3IBCA 3QJYA 2RKOA 3RRJA 3IKMB 3ZI4A 3ZV6A 2Y0PA 3S7ZA 1SZPA 3LPAA 3DO5A 1YQUA 2R751 5IRCD 1E1QA 1E3DA 5T5QA 1H9CA 3B85A 1E0DA 2UUAB 4P4LA 2D5IA 1WZ2A 1VIMA 1RWMA 3S2FA 1OCEA 5K2MA 3C98A 3M1LA 1XELA 4HBZA 2COKA 1VG8A 1X8JA 2A59A 3D7RA 2IQ5A 2HCTA 1UMDA 2H5IA 4EOGA 3ZXUB 4H59A 1I2BA 1U98A 1H05A 2NPOA 4TL7A 2YC2C 4JI5B 2FZLA 4B7UA 4M0MA 2F1KA 3F96A 4H1WA 2Y66A 1GQYA 3ILXA 1NTRA 2BF4A 4LRUA 4O1MA 5FL7D 5INTA 5KTSA 4RKFA 5MFPA 1NXSA 2PL1A 4G86A 4KQ1A 4Q1VA 5H8WA 1RT9A 2NZUG 2R1ZA 2SKCA 3SIXA 2AMFA 1QWOA 2BBTA 2QXUA 4N1AA 5DDIP 1CF4A 3PGVA 1BX1A 3E3NA 2WHPB 2WAAA 4MUMA 4Q3KA 2D1TA 4W7IA 4YAJA 4DSNA 4MV3A 3ORSA 2QJWA 4J0EA 1EX1A 4BX8A 4PC1A 1KJIA 4ID9A 3UMVA 3BMQA 2FG6C 3WK8A 2IYAA 3IP9A 4LXTA 1N1DA 2VEOA 2Y2VA 4E5VA 4CLOA 1KJ8A 2FJUA 4I6GA 3NMUF 3P27A 4U5QA 1J39A 2B1JA 4QGAA 5IAEA 1JU3A 1D1TA 1GADO 1E92A 3G0GA 3LQ2A 3ICVA 2BFDA 1V26A 3JWJA 5DTQA 3H9BA 3PVCA 4BQEA 5HUJA 1HLDA 5EZQA 3SLGA 2ZUVA 1HI9A 1I94B 2PGOA 3LVRE 5FOWA 3WV5A 5REQA 4UHDA 2VQ6A 3UY4A 3VTAA 4NH4A 5L53A 1RQPA 3TM5A 1K5DA 2Q6VA 2ZVQX 3VV3A 2FQQA 1JHAA 5JXWA 3ZWMA 4V1CA 8MHTA 1ML4A 1E7QA 2E1PA 3D3WA 2OWEA 4PYLA 4KNYA 2ADMA 4CMEA 2CUTA 3ILSA 2VBFA 4C07A 1E96A 1JEQA 1VYUA 1V6SA 3QRWA 3DKRA 1WZCA 4TV9B 1YS7A 2XX3A 1KNXA 2LIPA 1Q77A 1OE0A 2OR3A 4IHAA 4NJMB 2REBA 3D1JA 3UHJA 4DLWA 5CFNA 1NSFA 2G7MC 1BWPA 4PX2A 4C05A 5JNSA 2G1UA 4I08A 1E1KA 1TUEA 4KP7A 4TPKA 5K0LA 4A10A 1NAIA 1OKKD 3AJEA 3L06A 5ESXA 2P9HA 3R5KA 2C58A 2ZWIA 3NEAA 4X7PA 3BJMA 3ONVA 4QE3A 1K97A 1UKEA 3SEAA 1SMKA 4ODIA 5KX5B 4RH1A 3NHWA 3RHTA 1L4HA 2XNCA 4H4EA 1PZGA 1RYFA 1PFVA 2GQ0A 2YIDA 4KXMA 4Y1FA 2PSJA 1TYAE 3L0DA 3MB8A 2H4YA 3K72B 2EX0A 2VDJA 4KXFB 2B2CA 1OFIA 3V7WA 3CKYA 3A2LA 4M60A 4FWTA 2O2DA 2XQJA 4C08A 3GP3A 1V39A 2JARA 3EIUA 2E6KA 3MJHA 4BJHB 2ZB3A 2NO0A 3KJGA 3KLNA 3LGXA 4UCQA 4DWWA 1N2XA 5BSFA 3RYHA 4GLFA 2Q50A 2RKWA 3MIIA 1T6ZA 3SC4A 2VJCA 2OSBA 3OCWA 1C2TA 1L4LA 4P84A 1KJWA 1KIAA 1GEGA 3NUQA 4ZHQA 221PA 2LKCA 4BOYA 3RFXA 5JH7B 1QGYA 1Y6QA 2G36A 3IHKA 1RWVA 3MJVA 5AKJA 5H02A 1YZUA 2CMDA 4PXSA 5BN5A 1D7AA 3HYCA 3W5DA 1DIBA 1G5HA 2X58A 4FGWA 1NE7A 3I73A 3WLMA 2IBMA 4JOCA 3WWOA 4K46A 4M7WA 2Q2WA 2B8NA 3NW9A 5IARA 4IJKA 2CUNA 4DIDA 3SF8B 3LLUA 1TIKA 2HSWA 4TTAA 5DM60 1U9IA 4JBGA 5E3JA 5H0IA 3O6VA 4AAYA 3DAYA 3F8SA 3M2TA 2L19A 5GZ1A 1CR4A 1IBMB 4TYMA 3B6EA 4O2AF 3HN6A 4RM3A 3TNDA 5AK5A 1W5BA 1OGIA 1DQSA 2FHSA 1LK7A 2GBLA 1DG9A 4JDPA 3VVBA 4BVJA 7MDHA 4DR7B 2Z3ZA 1NHGA 4J2OA 5AW5A 2FDXA 2HWKA 5JZMA 4RZQA 3PHCA 3A1EA 1WM1A 1XG5A 2VDKB 2OGUA 3SZ3A 3FNGA 4ZQHA 5J23A 4BNZA 1DDIA 2FWJA 5FQNA 3B8EA 3GH1A 2DR0A 3ESXA 1WAMA 3L6RA 4L74A 3WRXC 4OYYA 2HA5A 1PBTA 3AR9A 5BUCA 2BEVA 3QX8A 1P2GA 2AUMA 1BJTA 3CIFA 4MYHA 4GKAA 2DWUA 1A8PA 4ND7A 4TWJA 3ACCA 3DDNA 4KX5A 1OXUA 2J45A 4KMSA 3A58B 4O4IB 4XWYA 3TI7A 1VE6A 2OE2A 2VUIB 3RKSA 1T43A 2ECQA 1YA8A 4UDNA 5F5XA 1H2HA 1T6BY 3UXYA 5DI3B 1SOAA 1VM6A 5JCOC 1OX5A 1KPGA 4NG5A 4AULA 2OAQ1 2IHUA 1GGMA 3DL4A 5HQ3A 3D6AA 4FCTA 1HQKA 2ZTUA 1Y5IA 2YJNA 2HKIA 4NP6A 5DGTA 4JBYA 1MVLA 4IYRA 5F98A 4HPJB 2LR0A 3PFGA 3GGCA 3UUWA 3GU3A 4E2ZA 4HAIA 2DG2A 4GZ6A 4OBBA 5FBWB 3K4QA 3DDOA 5B6PA 2IY8A 2YZNA 1W85A 2HIMA 2C9OA 3DAHA 2B0JA 3I2FA 4RLQA 4WBXC 5FORA 5EIWA 1MW8X 5BSRA 5IDWA 1K7FB 2AK3A 3A9VA 4G0PA 2AG1A 4DDWA 3N8NA 2BEUA 1I1QB 2ADOA 1ZM7A 4IOMA 1KPHA 2JBAA 3NG1A 3NKLA 5BQFA 1JAZA 4RQBA 3CXRA 4M1WA 4RWZA 3I2HA 4PZ0A 3KYBA 2QE7A 5A5GA 2C04A 3A7DA 1NFRA 2AI3A 3E5NA 4YAWA 1W9HA 2PNFA 1X19A 4V0RA 3HZRA 5K8LA 3NPMA 1MEJA 2FN3A 2CLIB 1N33B 3BC1A 3QVXA 5BOSA 2BP7A 2DWQA 3CRNA 4ZOEA 1UP7A 2AYYA 4DYDA 3ESCA 1RKVA 3N7TA 3ZQ6A 1FS5A 4GQAA 4JGIA 2OCLA 4RJIA 4WK4B 4NYMR 1ZNZA 2YJ4A 1GZ7A 1VPLA 4CDRA 2JBHA 3T0GA 3UA3A 5ERGB 1JXAA 3DBHB 1S3IA 3B7WA 1SUDA 2PRJA 3IJPA 4WZBE 3QU5A 1N9GB 2WP0A 1KYXA 4D9EA 2H2IA 3MJFA 5EJ5A 5KINB 1QGAA 3UXHA 3D8RA 1HE4A 5G0WA 2GF9A 4G9GA 2X23A 3LYLA 1G4AE 2QYOA 2QSZA 3RE1A 4F2PA 3QPBA 1FNCA 3SC2B 2ECPA 4HDKA 2ZDHA 1OV6A 2LCFA 4MUEA 4S0XA 1MB9A 1M2FA 1VLJA 2CC2A 1DGQA 1UJ4A 3O8OB 2OBNA 1CB0A 3CRRA 3UT5A 4L4RA 3VVCA 2DWOA 4CMIB 1ONBA 4TVKA 2H8GA 3B2QA 4LCEA 1W46A 6AT1A 3Q9NA 1CUXA 4KO8A 4ZXFA 2IIQA 1VE7A 5K99A 3I9JA 4TKVB 1QGDA 4Z3KA 4DIEA 1WCYA 2IEBA 3ABOB 1FRFS 3BKXA 1PSZA 4NDNE 4TKMA 2TMKA 5ITWA 1XZBA 4PSAA 1KDZA 2WIJA 3Q3IA 4CMGA 1Z0UA 4TMZA 1KMIY 4II7A 4C89A 2ZYIA 3VU8A 1L7XA 4XQGA 1CE8B 3NT4A 5B1EA 1F5SA 1AVTA 4XD7A 5IJWA 4KIJA 3U4QA 5TEWA 5ALUA 3IE0A 5JTTA 3AONB 1F8YA 4Q4HB 5JPCA 2EYUA 4YGXB 3ZHRA 5K3DA 1MC8A 1AA9A 1M74A 4PQEA 3ST7A 2WZCA 4QG7A 1R5JA 1SO8A 3EG5A 2O5VA 1WW8A 1DJOA 2CYAA 3B1VA 4Y8VA 3NC4A 3ZE9A 5DTRA 1A8QA 3RAEC 1RPAA 1T2NA 1T4CB 3PP8A 5HF8A 3CZMA 2BISA 4W8GA 4V02A 5FAXA 2PX2A 2GESA 5C34B 4OBEA 5JISA 1YZFA 2CDAA 2REQB 5E9WA 3J80A 4AZSA 5KVCA 4U6QA 2XUKA 3NC0C 1EDBA 4IBOA 4B7AA 2NSJA 2PUJA 3AESA 1E3JA 2V54A 4JI4B 4YAKA 5A4JA 2WC1A 4NBVA 3BICA 4PVDA 2FVYA 1P9LA 3V42A 2R1TA 4POOA 1DBVO 2CLFB 2XCUA 3O1JC 5BMVA 3I6YA 1Z38A 2X5NA 3MAGA 4JUFA 4LK2A 2ZIAA 5BQOA 2XY4A 3OLYA 5LQRA 4RXTA 1RWKA 2ZK7A 3PCRB 8LDHA 3SBXA 1QQ6A 1QO9A 4FNMA 1WJGA 4MV1A 1YMVA 4QXOA 3VRHA 5KJCA 1GG2A 3PITA 1PKXA 4XYEA 2HADA 2XNDA 1IQPA 2OECA 4Z3DA 4HH1A 2FCRA 4KFRA 3CJQA 4BC1A 2ZM5A 1LWOA 1ETUA 2ODWA 2W6JD 5DX1A 4J7AA 5HFAA 1ZUIA 1MP0A 5IBCA 1FIUA 4UM9B 1RJEA 2ILTA 3S1LA 5DNVA 1J90A 3E9NA 4OMDA 5IAKA 1TMOA 3LDAA 1MJ5A 3LBIA 3NAMA 4ML3A 3FSGD 4QXRA 4ZCIA 5JD4A 2HMAA 2VO1A 1TCVA 3VO1A 2UXBB 1BQEA 4R6XA 2C3UA 1ETHA 3IOCA 1RM0A 4CQLB 5C1PA 3PNVA 3WK7A 1CYEA 4G09A 2WT4A 3DM5A 1CS4C 1Z4OA 1UFQA 2A1TR 1CS0A 3M8KA 3PHHA 3N0RA 1YR8A 2NU7B 4KZKA 3WHPA 3KE9A 2Z2YA 5DIFA 1X1SA 4BFSA 4OJQA 3MWDA 2VP2A 1SUIA 3WB2A 1G19A 4D96A 1X7WB 3EMBA 3FROA 3WLAA 2PFSA 1VG9B 5F52A 2J9RA 4OI1A 1XU9A 4OFXA 4GPD1 3VKUA 4N3NA 1XMQB 2CNDA 4I0WB 2QW1A 3GUZA 1IL0A 1QIHA 3U44B 4P4TA 3U9SA 4C4XA 5KC9A 2BEJA 3CINA 3EASA 5JI2E 2ATXA 1GUYA 1E4YA 4JVNA 2AFHB 4XGKA 3RIEA 4DABA 3D6HA 3I1JA 1RZ3A 1JG7A 3HMQA 3KEFA 4L9RA 2OUKA 2H0RA 3OM8A 1V47A 3RYIB 1G5IA 2FMKA 3S1AA 1OPXA 4HAZA 5ECGC 3S27A 3WLFA 4DCPA 3L1KA 1QBGA 1WBDA 5IVHA 1YK1A 3R5TA 3ZJUA 4KX3A 3FTDA 3UWSA 4UU1A 4N5HX 4QTUB 4GSLA 1YOVA 3OWHA 4BEJA 3HR4A 2PWBA 2FA9A 4D9BA 3LECA 2WWYA 2B1GA 3ZGVA 2VP6A 5DEIA 3P9SA 4J1SA 4MYSA 4BQFA 4QPPA 2A86A 3NZEA 3PK0A 3GG9A 3DEFA 3MEQA 4GKKB 2A5GA 2GEDA 4C0BA 1GVNB 3UJBA 1UBTS 4FBMA 3PC4A 3I0NA 1HE3A 1PT9A 2AJBA 4W9NA 3WYGA 4EY4A 4HYTA 5DM1A 5AOBA 5CT8A 4EPTA 1A5AB 5CT5A 3LYHA 3IEUA 4RZXA 3SOPA 3TFOA 3TOSA 2I4IA 2HLDA 1WMFA 1UPXA 3IMCA 3WQQA 1P3DA 3O0TA 3F97A 1VLHA 3G5UA 5G1NA 5THKA 5CITA 3EA5A 4DLTA 2C92A 2COUA 5GJBA 1KC3A 4IDQA 5EERA 5DBIA 1XSEA 1VB3A 4RK1A 3R7BA 2YV1A 5J2TF 521PA 1JSCA 1CK4A 3A9RA 4UTXA 5C2JB 3PXAA 1GGFA 4OEHA 4ZO9A 1U3TA 3TFWA 1K6JA 3W4KA 4RFSB 4Q3CA 3MVEA 1W36D 1RVDA 2VLBA 4B35A 1LX6A 1JJIA 4QARA 1XI2A 1PS8A 1G7CA 4XQEA 1QDUA 2AX3A 2OZLA 2WKRA 4X1OA 5AK3A 4FEGA 5F5LA 1EGHA 5IN4A 3RYCA 3WBBA 4TLMB 3GFRA 4OLFA 2AFRA 2WU3A 1AE1A 2DR2A 4YACA 1X42A 4B3JA 2BH9A 3VMFA 1OJLA 3BXEA 4PQGA 1THTA 4ZT6A 2V74B 4AX8A 2ID4A 1RLJA 1T9KA 1PL0A 4DRXA 3G23A 3D3JA 4QBFA 2QY9A 4KAFA 4LE0A 1REQA 1JR2A 4LTNA 1L5WA 1KSFX 4C0AC 3ZX5A 3RFFA 2JI4A 3EXHA 4FN5A 4MWSA 1MO4A 1RI2A 1X94A 2IPXA 3JPWA 4I5GA 4J94A 1COWD 4DM4A 4GH5A 2BGGA 4RUKA 1IHXA 3KYCB 4GVXA 4WY5A 2CJFA 3RSQA 5AKEA 2RH8A 4P1ZA 3TX2A 4MQUA 2WYOA 4DVJA 4YUWA 1DE0A 3HBFA 4WFKA 2H9IA 1CIPA 1JFLA 4LW8A 4B17A 2FDCA 1X3SA 3NONA 3K70C 5CDSA 3NT5A 4ZKEA 4OAOA 3O38A 3M5WA 2I87A 5DYWA 5FYDA 1R12A 1WO8A 1YHYA 3JRNA 3LA8A 1X2BA 2BELA 2FZ4A 1XYVA 1J5PA 2V6FA 3B7PA 3DT8A 3FYHA 2V7GA 4PFSA 4NY1A 3VC3A 4F97A 5JPIA 2R6FA 2QM7A 3E1KA 3R3ZA 1NVBA 3AUKA 4O5OA 4RIGA 3ZD6A 3SS8A 1BDBA 2BCJQ 4F3TA 1P62B 1LGYA 1P39A 2PL3A 3M6IA 1PR9A 4TUYA 1LBSA 4YQEA 5LQJA 4J90A 4WIAA 1TNDA 4IPTA 5KSWB 1V7ZA 1VL6A 1X1RA 1T5IA 2JHPA 3QX7A 1XXHE 2MHCA 3UHOA 4XDYA 1HE1C 4JP3A 1VLMA 4KVGA 3NYRA 4PN7A 1EUDA 3PQ4A 4A0GA 4RTKA 2OMKA 1N6NA 3OZWA 1INLA 2B4TO 1EGAA 2Q9UA 4I55A 4BE4A 4R71A 5K8JB 4WE3A 3HJTA 3GZNB 1OFVA 1X13A 2QLNA 2YWJA 4NV0A 5CR9A 4YRJA 5I6DA 1TYZA 4QOIA 4Q0MA 4G4SP 1PJRA 4NK5A 2GPSA 2VWHA 5E7MA 3NETA 3G2LA 1N5LA 3VU1A 4B83A 3JQFC 1CC1S 3T1HB 3ZUGA 1MC4A 3TTXA 1QNLA 2F9MA 4BV2A 5M2QA 4DPMA 3RS8A 3PYLA 4D4LA 4KWEA 4EUFA 3GT3A 1K66A 1YE5A 2C00A 3D64A 2V4MA 1OUMA 3QKRB 2J30A 4MUKA 3NDBB 4IVRA 5CMLA 3AVWA 4OGWA 1P7ZA 1SD2A 3TMYA 1TFRA 3H6GA 3HO8A 1OJ7A 1DUSA 4G1EB 1VYTA 4MVJA 3SM3A 1O0CA 1ISSA 2GK3A 4ID3A 2ZS7A 4XE5A 4ZWNA 4B76A 3OLWA 5L4NA 1L5HA 1UZNA 2GJ4A 1FCJA 1GCUA 3T4XA 2FPRA 2ZG6A 5LZ4A 3IGFA 4KO3S 1FU8A 3TZCA 1DL5A 4K9NA 3ZU3A 2F6RA 3PGJA 4JNCA 3SXPA 2XTMA 2JGDA 4PHFA 5JG7A 1IEQA 5BUQA 2CD7A 3R4VA 3B8HA 3HA7A 3Q7RA 3AG6A 5DM70 1EDZA 3W3AH 4CODB 1U1DA 5C8YB 3AT1A 3BXFA 3BMQB 4YUVA 1Z7EA 1G20B 1T6XA 3CRVA 3DEKA 3PRHA 3DZBA 1YB5A 2YWXA 5DCUA 2IIBA 4RCZA 3RIXA 3KUCA 3HUEA 3QUQA 3KAJA 3W1VA 4ND6A 1J25A 3HR8A 3F1KA 3HV2A 4UD6A 4MI6A 4EMUA 1AQNA 5T8KA 3U26A 3QVOA 3GLFB 1OLSA 1IIBA 1KZ7B 1V3QE 1X80A 4BKOA 4DSTA 5JRDS 1UDXA 3P52A 1E3EA 1AQIA 2HQOA 3VR6D 4JQCA 5JEDA 1T26A 2O4UX 5REQB 1YS4A 3QVVA 1ABFA 2JASA 3LW7A 2PTGA 4BE9A 4CU2A 2FTKE 1D04A 1ZRMA 5CX1B 3T7SA 4W5OA 1CXZA 2PPVA 1YQGA 5BOVA 2FMUA 3F9RA 5PNTA 3SQMA 4Q4CA 2OTCA 2FPXA 5B55A 2WU4A 1H8HD 4IQ8A 1EA5A 2EEPA 4UPEA 1QTRA 1KO8A 1DXYA 4PY2A 1JUDA 4C0XA 2IYPA 1SZJG 3H8WA 3HCWA 1CP3A 1O5TA 3KQYA 4CFYA 3UGKA 3IAS6 1Z7WA 3T9DA 1QPGA 2UUPA 3SSOA 4P81A 3I37X 3B7GA 1MT3A 2OLKA 2REOA 1CDOA 3LA6A 4NLLA 4BLRA 4YUZA 2L17A 4MQEB 2H4ZA 2DQSA 1TX4B 1UODA 2LNDA 3WJ7A 1BU5A 3BORA 1DG1G 3LQ4A 4N3BA 4FFSA 2VRCA 3PNOA 4QO8A 2VBGA 2I67A 3DF7A 4FDTA 5AVUA 1QZ3A 2FR8A 1N8KA 2I5PO 4KE7A 2ZJAA 3CC8A 3T4EA 4WZ6A 4A03A 3EFOA 1HX7A 2X5OA 1C9NA 4Y6GB 1AXEA 3U7GA 3ASUA 2AN4A 5DLQC 1YZNA 3BQMB 2O1XA 4EPYA 4ETMA 5B57C 1QYWA 3HL4A 4XDGA 3VPAA 4IRXA 4YRKA 2OQ2A 4EG5A 1YL6A 2Q3MA 3HE3A 4P3YA 3ZV4A 2WD7A 1IOVA 2ADFA 2VYVD 3EEQA 2W9XA 4CM9A 3ZWWA 3HI6A 3UCXA 1YI1A 1SWWA 4EHBA 3Q3HA 3CJTA 3FZNA 4RMJA 2KHZA 3GVCA 1PZHA 2JGRA 2X3FA 3KKPA 4C6TB 1WW2A 2IYZA 1XU7A 3T7IA 3G9ZA 4F2DA 2PEZA 3K31A 2DRIA 1F2TA 3IMFA 1Y42X 2ZQYA 3M5DA 2A9QA 3TR0A 1F20A 3LC0A 5BN5B 1Z08A 2J9GA 3UT0A 1W2HA 2WF6A 2WM8A 4FC7A 3BH6A 2QYSA 3DNMA 2HN9A 1Z5PA 4HNAB 3WMWA 3KHSA 4U5XA 3BD7A <