4HAWA

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1(k548a)-ran-ranbp1
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
208
structure length
196
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport/antibiotic
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 196
sequence length 208
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hawA00
3R20A 1AK2A 3KQNA 2A5JA 2G0TA 4Q7KA 5AUNB 4L8GA 2ZJYA 5JBQA 3SJAA 1R5BA 1J8YF 4LJ7A 2CEAA 3AVVA 4C2UA 3H0KA 3W90A 2IA5A 2C96A 1XMIA 1ZINA 3KUDA 1YKSA 4IFEA 1W5SA 4ZIRA 1E2LA 3D8BA 4ACBA 1X86B 1H8ED 4Q4JB 2O8DB 2ZREA 3EWSA 3L8YA 5FPHA 3SN6A 3RC8A 4DSUA 4I99A 1KO1A 5EP3A 3QJYA 3A1UA 3ND9A 1W48A 2WV9A 4XD7D 4YLGA 4IDPA 1W0KD 1YZUA 2DBYA 3LQRA 3NEYA 4FI3C 4A2PA 2XTZA 5GJVC 3C5HA 3RVBA 1AGRA 1D6JA 4B2IA 5JECA 4LRWA 1GNRA 3SFVA 3O8RA 1AIPA 2E1RA 1NLZA 2OAQ1 3HPRA 1L8QA 2C03A 2FGJA 4Q66C 4A4DA 2BMDA 2EFDB 3SHWA 3EZ2A 2VEDA 1HT1E 1KAGA 1OV4A 3TSZA 1G21E 2NGRA 5L3VA 3P4XA 3BORA 4DCUA 3U7HB 4XJXA 3THWB 1ZM3A 4PSKA 1CJTC 5D3QA 2IUSA 1CP2A 4C0JA 4DJTA 1Z6GA 2I4IA 4I1OA 2WKQA 2C9YA 4NYJQ 5B64A 1QG4A 2ZU0C 3QNUA 1E2MA 4Q01A 2VP2A 3R8FA 1LVGA 1E32A 5KTYA 2E9SA 4MRSA 4DEXA 3LW8A 2HJVA 4HB4A 5KOYA 2EVWX 3PUVA 1GAJA 4TSFA 1R0ZA 1GUAA 3G82C 1SVWA 1KGDA 3T1OA 4NCKA 1QHYA 4RFVA 4LUCA 2V1XA 4PHFA 3BERA 2BBOA 3CNNA 3G5UA 6Q21A 4JBWA 1Q1ZA 5EZ5A 1F2TA 1CLUA 3I73A 1M7GA 4ZV4A 2DCUA 2WJGA 3EA5A 5TV2A 5HKKD 3QIAA 3BD9A 1KNXA 4N0EA 5FBRB 3K9NA 5GJBA 1NRJB 1J70A 4MRPA 2DFTA 4M9XA 2IHYA 2VQSA 1VHTA 5CITA 1XEXA 1Z08A 3BH6A 3GFOA 1N6HA 2VH5R 2X2FA 1A7JA 3FWYA 4GI7A 2ZYUX 1CR4A 4QJ5A 4UNNA 3SJZA 4RSGA 3VKWA 3K0FB 1I4LD 2AN9A 3BE4A 2YNMA 1R4AA 3PEUA 1W46A 2ASEA 3EZFA 1SGWA 2HF8A 4CEIB 2RGNA 1RPZA 2XTNA 4Z1MA 3T06B 4JSYA 2WICA 2W58A 5LBIA 4DHEA 1XPUA 1WE2A 4LV5B 1D9ZA 4B43A 4MYUA 2XZLA 3KB2A 1NMYA 2XZPA 1I4TD 1IQPA 5FOXA 3QBVA 3FFBA 1Z47A 1G8FA 4J0QA 3ZQJA 4DLVA 4Q4AB 3R7WA 1GITA 3F0TA 3B1XA 5JS7A 1G4AE 1J90A 3V00A 3AVOA 4B2LA 2CHGA 4PZLA 4PC3A 4B74A 4EJSA 5H8WA 2QENA 1P9WA 4EAQA 2V55B 3QXJA 4LCBA 1GG2A 4P4SB 4ACAA 2SHKA 1WMSA 4JJKA 4RVCA 2ZI7A 4CEHA 3W6PA 1U0HC 3CM0A 3VMFA 4PPFA 2IYLD 5KDOA 3KKOA 3ZIAA 4DSTA 4XVUA 5LD2B 3THXB 5JCPA 2GK6A 2IYWA 1R7RA 3CB4A 5F3WB 1UDWA 3H1TA 3REGA 3TVTA 3ZQ6A 4EPVA 5A4JA 4JVSB 2BWJA 2HLDA 1NN5A 1Z63A 1SKQA 1UPTA 1HQYE 1WCV1 4LC1A 5E4FA 3HWSA 3B1ZA 1N6PA 1JJ7A 3QXSA 4JVLA 3EPJA 1KIMA 4Y0VA 4R7ZA 2GVZC 3ASZA 2NOAA 1KSGA 2B8TA 3ECCA 4UXIA 4D0LB 3D7MA 1JEDA 4MYTA 4M0LA 3RWOA 3CRMA 5FOWA 3RC3A 2FJUA 1N6LA 2KB0A 3IQWA 1PLJA 3OE7D 4TLEA 1NJFA 2GCPA 4U5XA 2HXYA 3U61B 2G0NA 5KNCA 1DO0A 1UBGA 4O0MA 1NVXQ 3K70D 4L5BA 3I8XA 3HDTA 1OH8A 2GXSA 3LAWA 4F4CA 1X8JA 1E69A 4NKRA 3ADBA 5DO9A 4P31A 2ERYA 4F4JA 4HATA 2IF2A 2BBSA 4JIMA 1F3OA 2CLCX 2ZR9A 1DAKA 3GEHA 5ANRB 3V4RA 2HT1A 1OXXK 1FPMA 1VTKA 2PCJA 3IILA 3OESA 3ZZUA 2QA5A 1X8LA 3CR7A 4RKFA 5EXXA 1NIJA 3ZLJA 1JEEA 3PG5A 3UWKA 1RRPA 1OKKD 4Q9HA 4QGAA 3RDPA 2QGNA 2BM1A 4ZO4A 2FFQA 1TMKA 4TQ9A 2AHOA 4YQFA 2BMJA 2PL3A 3KQLA 1JJVA 3K0SA 2V7QD 3BJIC 3RYTC 3I5XA 2R62A 1ZM2A 1F6BA 3CPHA 4BFSA 2ORIA 3I72A 1AA9A 1YR6A 2O0JA 2NZJA 4FCVA 5J40A 1XFAA 1P6XA 4B3BA 2BJWA 4HAWA 3DKPA 5SZKB 1IBRA 4A36A 3VTKA 4NYMQ 4AYWA 4I1VA 2P6UA 2XEXA 3QEJA 4Q19A 3H86A 4JLKA 3K9GA 1EFHA 2O0HA 5AWFC 1FX0A 5J4KA 5J4HA 2BKEA 4BEJA 3RWMB 2GJKA 2X19A 5C4GB 1T9HA 2MMCA 2CE2X 2RHDA 3CKLA 3TK1A 1JR3D 1EFRA 4RD2A 3QOFA 1PV4A 2YOGA 3K0CC 4JT2A 1TL7C 2JA1A 3C15C 4YXWD 2OXCA 3VHLB 4IXNA 1VG8A 5JEEA 3PQCA 3CRW1 2W2XA 3NHAA 1HURA 1TTTA 3GLHA 1M34E 1OXVA 3PCRB 2IL1A 3L0PA 3GLFE 2GETA 4TMXA 1LNZA 4IHQA 4DLYA 1XTRA 5FR1A 1ODFA 4ZDKA 4G5SA 3C5CA 1UJ2A 3IIMA 2GZAA 2VPPA 4UKDA 1S3SA 2Z83A 1IHUA 1YZGA 1F2TB 4WZBE 5A0FA 4CZ2A 1V43A 1DAEA 3CNLA 1A4RA 2XX3A 3RSOA 3QSYA 5DIFA 1NSFA 3W6NA 4EFMA 3FYHA 2REXB 1JECA 1OT3A 1RVDA 4JJZA 4TTPA 2FFHA 1DADA 1DE0A 1GP2A 2JEOA 5CJ2A 1Q3TA 4UNQA 1OHHA 1R8QA 1E9CA 3DHWC 3TAUA 4PQRA 1IN6A 4CGZA 4KCGA 3SFZA 4ZI3A 1KKLA 4B33A 5K8IA 2WAXA 2ZUCA 2F9MA 3SE0A 2RGBA 2BVNA 3LW7A 1J8MF 4XH9B 1RRFA 5EP2A 3TQCA 5CLQA 4YDHB 3WXMA 2V9PA 4KSCA 4MKIA 4A2WA 3CIOA 5JRJA 1QF9A 2CLDX 4M1SA 1O3YA 1XMVA 4KO8A 1RRGA 1MRSA 3R7WB 4M53A 1RIFA 2R6AA 3A1SA 4A8JC 4DEYA 2X8AA 4IKEA 3NHBA 1XCPA 2EU8A 3CPJB 3SDZA 3K53A 4DB2A 4EJSB 5AJYA 3FMOB 5P21A 4R98A 2AXPA 3AKDA 5FOUA 3SJBA 2J45A 1QDEA 3K0AA 2ZR7A 2ZUBA 1IY0A 2BCJQ 1E0SA 1EGAA 2PZGA 4NTZA 4PTLA 1R8SA 1NVUQ 1W0KA 2ODNA 4HLUC 4Q7LA 3EG5A 3MWYW 3FKSA 3ZVNA 3OEHD 3HP1A 2WJIA 3GP8A 3LX8A 3U7EB 4JS0A 5JHHB 2ZRHA 4E5UA 3TW4A 4AG5A 3AKEA 4Q1FA 1D5CA 2QE7A 1FQKA 3KQKA 4QM6A 4LI0A 2O0KA 1RJ9A 3N2EA 3WMGA 5FBQB 5J5CA 2QPOA 5CDFA 3CBQA 2L0XA 1X1RA 1S1MA 3KDSE 4LHXA 1US8A 2A3RA 4D82A 1WP9A 1U94A 3FMFA 3L43A 2ZR0A 4OYHA 3SI7A 3QENA 4JLMA 3OAAD 2WWWA 4FINA 2IS2A 4M9SA 1G3QA 1KYIA 2WSMA 1JALA 3AB3A 2ORVA 1U81A 3L0OA 4PANA 4LJYA 2VSOA 4TQUS 2R9VA 3RS4A 2Q9AA 3TR5A 5IHPA 1VG9B 2H7VA 1ZRHA 4KFUA 4TYYA 4ZKDA 3Q8XB 2YC2C 2XNDD 1TAGA 1NIPA 1XXHE 1OH5A 1XRJA 4YMUA 2QL6A 4IEEA 1AQUA 2NO7A 1M2OB 1LS6A 2P3SA 1Q21A 3MFYA 1FW6A 4QGHA 4LJAA 3FFAA 3ZDQA 2OAP1 1Q44A 4LBYA 3MGCA 4LY6A 1HYQA 5HKKA 1VIAA 5FTNA 3EWAA 2D06A 4TL8A 2RCNA 1ZCAA 3B2EA 4AY2A 1P7CA 1TQ4A 3NIBA 4P3YA 2YOFA 2R65A 3TNFA 2D7DA 2XXAA 3X1DA 1NG9A 1XZQA 4TMKA 4DZZA 1ELOA 4L9SA 4M9QA 3I1FA 5JEDA 1GL9B 2C99A 3CPEA 5EXTA 4C0AC 3HU2A 4A82A 2IYZA 3IEVA 3IQXA 1NY6A 3DEFA 1G6OA 3BOSA 2G83A 1GIAA 4NCHA 4BLOA 4F4IA 2OV2A 3M1IA 3BIFA 2C8VA 3QKSB 2VSXA 2J0VA 3IIKA 4C0KA 1NN0A 3WBJA 1YRBA 4I81A 2OZEA 5KNDA 1SKYB 2JLYA 3B6EA 3K9HA 4HYYA 1GZSA 1MO5A 2FX3A 4WXRA 4MUBA 5AUPB 1Z2AA 4PO8A 1NJGA 1KK1A 3IGFA 4UQOA 3VKGA 1TQ2A 4W7SA 2OCBA 5TY0A 3SNHA 5HE8A 1KI3A 4B47A 4Z8XA 2Q9BA 1FX0B 2YWEA 4FWTA 2YZ2A 1E2EA 3MD0A 1P9NA 4S35A 4US2R 4HUQB 1GSIA 5DE3A 4IDQA 5FOSA 1MRNA 2P67A 3CH4B 4NCNA 3QY0A 1OE0A 5TMPA 2HV8A 4K81B 1S8FA 1VYVA 1YR9A 3MUFA 2NO6A 3K0CA 4OQLA 4Q4JA 2CL7X 5CB8A 2G6BA 3D6TB 3MAAC 5EZ6B 2QM8A 4QC2A 4DSOA 4II7A 4DB4A 4HB3A 1EWRA 2IEYA 3HJNA 3KXKA 4IRUB 2ZRCA 2G9NA 3K1JA 2RAPA 3GLIE 2RGCA 2V4ZA 4Q03A 3U3KA 3E1SA 1II8A 2CL0X 3KX2A 4L15A 4LJ8A 3L0SA 1YJ5A 3CNOA 2KJQA 3A36A 1ZNWA 5DYIA 1CRQA 2C2HA 2HUPA 4GNKA 1OFIA 2ZJAA 4TL9A 4U7DA 4GMDA 4R71A 3OE7A 2ZQ5A 4O2RA 1Z0FA 4TYNA 2W83A 5IF9A 1COWD 1E2PA 1G9XA 5JI3E 3MMPA 2AD5A 2QSZA 2GTPA 2YC4C 1AZTA 3ZVMA 1VCOA 4HAYA 4XSGA 2D2FA 4KVGA 4JYCA 2GCOA 2Q9CA 4DLWA 1XF9A 2QTHA 1NLYA 3EA0A 4IOJA 4JLNA 4LZZA 3TLXA 2QZ4A 3FMPB 3FTQA 3NVAA 3T1TA 2GEVA 3PEWA 3CRVA 2ZRFA 4LYFA 4QXAA 3RS5A 4AWXA 4EKDA 4WZ6A 1C4OA 2GZDA 3VR6A 4BGDA 1YZQA 1ZYUA 5IT5A 4A6PA 1DEKA 1BH2A 1JQLB 1VCNA 1W44A 2CNWD 5C46F 1CJUC 4ITRC 2OILA 2EFHB 4C2TA 4QHSA 4A8JA 4JMPA 3WRXC 1UBEA 4KYUA 5G41A 1XX6A 2IYXA 5UKDA 2JLQA 3X1ZA 3QKRA 4LWZA 5AUOB 3R9WA 1NN3A 3W5JA 1II0A 1RYHA 2LCFA 1N0VC 2V7QA 1P2SA 4PC1A 2O5VA 3K0AB 1E4VA 4GPTA 2YVUA 2R6GA 4HLUA 4ABYA 1M7BA 1ESNA 3K0FA 2KI5A 2ZE6A 1UBFA 3H84A 2QP9X 4A2QA 2D2EA 4K46A 2Q6TA 4Q7JB 3AGQA 3O8DA 2CK3D 1Z83A 1ZVQA 4Q02A 1II9A 2ZJ5A 3P1JA 3ZD7A 3SYKA 1RJ9B 1XB2A 2LWIA 3B5JA 4DWJA 4XVRA 1JQJC 2ZIAA 3FGNA 4LHVA 4Z51A 3GLGE 1UFQA 3SZRA 1R0YA 4ZPXA 1Q57A 1SXJD 1DG3A 1US8B 1VDZA 1ZC4A 2OT3B 1XMSA 4NDZA 4V0OA 3TUIC 5HPYB 3U7GA 1N25A 1ZW6A 1JR3A 1E2DA 3AUYA 4G3XA 2N42A 4NPHA 1GVNB 4RCYA 4B3DA 2WJVA 2AWNA 2CL6X 3HR8A 4TMTA 1M1YE 4OHXA 4YXWA 1XJ0A 5K8LA 3ZZ0A 2A78A 4P4SA 1EFTA 2C78A 2WPDD 1S1CA 3PFIA 4KU4A 5BQ5A 2EWVA 4Q5IA 4HAZA 4B34A 2VRWA 2IYTA 4Q48A 1QVAA 4TT3D 3DL0A 3I3SR 4B71A 5L3RA 2C9OA 1GILA 3A6PC 4GMXA 4OKSA 4XWAA 4B76A 1YZKA 1G5TA 3A4LA 4V0ME 4QM7A 4MGIR 3KB1A 4FD2A 1CS4C 4M8NE 1L4UA 4LJ9A 4LSGA 2XXAB 1E1RD 1G7SA 2F9LA 1BO6A 2B8WA 1TF5A 1FTNA 3ZVRA 4M1OA 4DCSA 4ZI2A 3IHWA 1W7AA 3C4JA 5FOTA 1KI4A 4KFSA 5EP1A 4V0KA 1AJEA 2GNOA 2PCLA 2PT7A 5ELXA 4GL2A 2IT1A 2D3WA 1AGPA 2ZI5A 2FE4A 5AK0A 4AKGA 2WSSA 4TQAA 3BWDD 1KNQA 5DLQC 1Z28A 4QNMA 2CLSA 5H1YA 4DUGD 1ZAKA 3EPLA 2W6IA 1QHSA 3WYGA 3GJ8A 2VP5A 3QG1A 221PA 1G41A 1Z6TA 4A0FA 3Q3JB 5AUQA 3Q7PA 1MOZA 2QQEA 5K8UA 4Q9KA 4M1YA 1Z5ZA 2HEIA 5JSZB 1FTSA 2JDID 4QBGB 2YINC 1S2MA 2ECKA 5JRZA 4BLQA 2IUTA 2IXGA 2A5GA 1MO3A 4QHTA 2WWGA 3EC2A 3KUCA 2CVFA 1E0JA 3OEHA 1Y63A 1SVMA 4GSYA 1LF0A 2V1UA 2DWOA 4JLVA 4JL6A 1W47A 4AI6A 4JKIA 4ESHA 4UNRA 1XTKA 5DNYB 2REBA 2QY9A 4RZUA 2B7BA 2O8CA 4G5RA 1Q3HA 1KJYA 2XITA 4JBYA 3U3RA 1II8B 2J9RA 4QG7A 5F9FA 5E95A 1SVKA 1SXJC 2QU8A 1U8YA 1X3SA 2FWRA 2WZQA 3C16C 1N6NA 5FPSA 4LX0A 4H1UA 3Q9LA 4DDWA 1GOTA 1YZTA 1XEFA 2DY1A 3QQ5A 5JHGB 4GRAA 2B7CA 2EFCB 5EXSA 3FMIA 4EFLA 4KFTA 2B92A 3OHMA 3V4FA 2F3RA 2ZETA 3AM1A 5KDDA 2OHFA 2F6RA 3QPVA 2W2VA 4PR0A 4BFZA 2YHSA 4JKYA 4BFXA 3K70B 2XNDA 1UEJA 4BPBA 5EE1A 5F98A 2NTYC 4LJ5A 2GCOB 3RLFA 3O47A 1I4DD 3PEYA 1E2FA 2F1RA 1JR6A 3B1VA 1E4YA 3LBIA 2ZRPA 2WOJA 3RNLA 1VCIA 4NYJR 1K6MA 3GJXC 1S96A 4DCVA 3DPUA 5GADl 4US0R 4B48A 2JCSA 3P26A 3DKVA 1WB9A 3ICEA 2CXXA 1KKMA 4EPWA 3KXLA 1MO6A 4C0SA 4DCTA 4A8JB 5CJPA 5J47A 5FTLA 1WBBA 2W0SA 4LBVA 4TMVA 5DI3A 3QKRB 3GMTA 1ZIPA 2ZYVX 2XSZD 4F92B 2IF0A 3NH9A 4KXFB 3WMEA 5DI9A 3BK7A 3HPQA 5EQTA 2J3EA 5DSZA 2EQBA 2BMEA 4NCIA 4P4UA 5TB5A 1NF3A 4LYAA 1V5WA 4P33A 2UZIR 5B58C 2OUKA 3A8TA 3C41J 5FI0B 2IC5A 2RMKA 2JJ1D 1J2JA 3X1WA 1E9AA 3NBYC 4KHZA 4PC6A 1KTVA 3SS8A 3DOEA 3JVUA 4CT4B 1N6IA 4Q1AA 4LC0A 3I62A 2DFKB 4A0HA 2ORWA 3RSLA 3EIEA 1HE1C 5E7JA 4AKIA 2PJRA 4WW0A 2WM9B 5G40A 1S9DA 1Z8FA 2V6JA 1MKYA 4QL3A 1DOAA 5EE0A 3Q5DA 4JLBA 5TDHA 2QT1A 1NKTA 4DLZA 2RB4A 2FA9A 1KMHA 2C9CA 4Q1BA 1CU1A 3ASYA 4UXHA 5AJWA 5HZKA 2X2EA 4IDOA 2ZI3A 4LJ6A 2IYSA 2ZRMA 4P0TA 1UKVY 3QBTA 2Q3MA 3GCGA 4YC7A 3VU9A 3ZVLA 2EFEB 2DR3A 3PIRA 4CDGA 4GDFA 1E2GA 3CRQA 2J0QA 4RZ2A 1YE8A 1M74A 2IXFA 4BLRA 4URWR 4A6XA 1JXOA 1UM8A 1RW4A 2Z4RA 5L8VA 3DOFA 4NBSA 3D31A 5B2ZA 2YJTD 4M1TA 3GJ0A 3TR0A 3QKUA 2OLJA 2P2LA 2BOVA 1QHGA 3OIUA 4RD0A 3AVUA 2ZSDA 1IN7A 2FG5A 3SYNA 4XIGS 1VYTA 3X1XA 4CEJB 4ZKEA 2BJVA 5FFMA 4G0NA 5LB4A 4OI4A 1M6NA 1SZPA 3AKCA 4UNSA 1YQTA 3OEED 4X8LA 3WHLA 1COWA 3MWLA 4FMCB 1NP6A 1U99A 3RRNA 1TPZA 1G4UR 2RHMA 2GESA 4R2IA 5EXPA 2V3CC 2FN4A 4Q00A 3AV0B 3MWKA 4BE7B 3AF3A 1TEXA 3LFUA 2EFGA 4TYWA 2CCGA 5AJXA 2TMKA 3QPWA 2QRNA 2QNRA 2QTVB 2A7QA 4IOKA 2XNSA 2JGNA 2DWPA 3EPHA 4W5JA 2I1QA 4QBIA 1T5LA 1Z0AA 2F1IA 3FHCB 1W5TA 1EWQA 2W00A 2YWGA 5KSYA 4Q47A 3M4YA 5SZIA 3VQTA 2CNWA 3RHFA 1DARA 3F5FA 4PAQA 2HCBA 3VR4A 4DLTA 4YMVA 4TWZA 2GAOA 2CMKA 2OCPA 1N0WA 3HYRA 4JVNA 3RAPR 5H68A 3PEVA 3NC0C 1H8HA 2ZE7A 4OHVA 3U6BA 1PVOA 2OFXA 4PC2A 4DCNA 4JL8A 4OQXA 4JYBA 1E79A 1LS1A 4V0NA 3AVWA 4B75A 4HB0A 4IVRA 5AR1A 4JSTA 1CKEA 1ZM9A 2MSEB 5FPTA 3LO5A 1L4YA 2V54A 4MGZR 1IJEA 4LBZA 2A2ZA 1MO4A 3AVQA 3EAQA 3KJGA 1FUUA 1JI0A 2PX0A 4Y0AA 3QKSA 3LA6A 2P5SA 3QI2A 3AVXA 4JLPA 1VYUA 2MSDB 4PHTA 2WMNB 2O8CB 3GJ6A 4URVR 3L82B 3AP1A 1KI9A 4L9WA 1IOZA 1OYYA 3N70A 3AP2A 2JLVA 3X2SA 3SU8A 3SJCA 4C4PA 2KSQA 3C8UA 3KJIA 2QTFA 1ZM4A 4C0LA 1G5PA 3C14C 2RGXA 3Q72A 1MR3F 4IXMA 4NYMR 4LHYA 2H16A 4H9GA 4Z54A 1FNMA 3VR5A 4HUQA 2WPDA 3IBYA 1QBKC 2OBNA 2WWFA 3BB3A 3DVLA 1KDOA 4KV9A 4JVMA 3THYB 1DAFA 5DHAA 4L16A 2I1VB 2ZAOA 4W5HA 4MITA 1B0UA 3OIYA 5FL7D 1K5DA 3O8CA 5FI1B 1NBME 3T5DA 2Z0MA 1YZLA 4O3MA 3IPYA 1CIPA 1O87A 3EC1A 5JI2E 2K5UA 2FSGA 3HR7A 2B21A 3ZS9A 4BEBA 4IVPA 1T3SA 5HCNA 4EPXA 3GLIB 1IXSB 4PHGA 4ASUA 3ICQB 1ZD1A 4X8OA 1ONBA 3S1AA 1IN4A 2VO1A 5DI3B 3FOZA 1E9SA 4S2EA 5K8TA 1G8GA 3ZZTA 1ZM7A 1OFTA 1W0JD 2FSHA 2N1BA 4V0LA 4BZXA 5L3QA 3NC1C 4TL7A 3I92A 4G1UC 1E0KA 2ZVQX 4F91B 2IYUA 2PEZA 3CF0A 1ZUHA 2VYFA 3K70C 4OK3A 4RY2A 5FBVB 4LHWA 4D4JA 1RC8A 5FTJA 4BFYA 5F9HA 4HEJA 2GJAA 3ADKA 3GEEA 1XJQA 4FXPA 1E3MA 1F5NA 4NP6A 2VHUA 2KE5A 1IJFA 4OJQA 4HAUA 2ATVA 2X1VA 3WP1B 2VHCA 2GEUA 1XWIA 3J81k 4WA7A 2ZEJA 1NL3A 3AUXA 1G8PA 4B44A 621PA 1SVIA 1GKIA 2JDIA 4LJ4A 1UADA 1AKEA 1P2VA 1A1VA 2QAGC 2B6HA 2QI9C 4XWOA 2O52A 3BH0A 2QMHA 5LB2A 3VHXA 1E2KA 4NH0A 2R6DA 3DMDA 2QMOA 5CYPA 1KMHB 5DH9A 3DO6A 1H8EA 4C3ZA 2IYVA 421PA 3C7KA 4MDFA 2ZSFA 2DFNA 1IY1A 3CWQA 3B60A 4ZCMA 2G88A 1XD2A 3A1TA 4FMDB 4JBXA 4PX9A 1ZD8A 5KDLA 4ARZA 2R6CA 3VU9B 2ZRKA 1Z3IX 1P75A 1TQDA 2ERXA 4XD7A 4ESVA 4O25A 3ZYCA 1W4BA 4TZ0A 1F2UB 1P60A 2GXAA 2CCKA 4YMWA 2IWHA 4V03A 4AG6A 1OB2A 1KO5A 3UXMA 1PLKA 2PX3A 3RABA 4HZIA 4ZCLA 3VR1A 1WBDA 2I3BA 3BB4A 3HYTA 2H1LA 4Q4HB 1QZXA 4CYMA 3AQ4A 3MSXA 2ZRJA 4AKEA 4DDUA 2FFAA 1KI7A 2NIPA 2ZRDA 3GJ4A 521PA 4GP6A 4O2LA 4QFMA 2O8EA 2WKPA 1G8YA 2FZ4A 1KZGB 1L7VC 3UG6A 4PAMA 3IDQA 2OXRA 1Z29A 4BFVA 1X1SA 1Q12A 2AKYA 3CO5A 5IK2D 4OL0A 3SQWA 4D6PA 1P4SA 1VG1A 5FUXA 1IN8A 4QOSA 2AFIE 1BKDR 2A30A 3CR8A 5H70A 4MDEA 4HAVA 1GKYA 3I61A 4X8MA 1UBCA 1MT0A 4L4UA 1CXZA 1N5IA 1IAQA 1PZNA 3KJEA 3CX8A 4IFBA 3TGPA 4BRUA 2IX3A 3T34A 3HU3A 4P4TA 3PUYA 1ZU4A 5FUYA 3U3MA 5C1BA 3CX7A 4TTQA 1ANKA 3DM9B 5C18A 4URXR 2F55A 1GTVA 2NO9A 2QQ0A 5CYOA 1KI6A 1XDBA 3K09C 2JLSA 3EARA 3G0HA 1NVVQ 2BCGY 5DGXA 3QUSA 1OYWA 1PUJA 1NN1A 1KO7A 2JJ1A 4FCTA 2WJHA 3AVPA 4PSAA 5DN6D 1XTIA 3KTAA 3T61A 1DO2A 2G3YA 5CB6A 1S4QA 2VBCA 4BFUA 3PUZA 4EQ6A 1IXRC 1G3UA 3OIWA 4B6FA 5BXQC 2R8RA 1P5ZB 3T1QA 4U02A 3ZD6A 4LPSA 4HAXA 2PBRA 4TSFD 1CBUA 1G291 2GF9A 4UXJA 1DAHA 1XZPA 3LLUA 2IS4A 1E2NA 1SXJB 3BH7A 1D2EA 4KFRA 1KY2A 4E22A 3NDBB 3L2OB 4D2IA 1BMFD 4FW9A 1E9RA 5BWMA 2E87A 2FGKA 1KMQA 2CJWB 2QUZA 1OW3B 3LNCA 5B30A 3H4MA 3EIHA 2BEKA 4DBLC 3PUXA 4TLDA 5EUQB 2GJ9A 2OLKA 1NLFA 5JSZA 1GDDA 2VP0A 2CHQA 2H57A 1P3JA 4C7OB 2ZROA 3LVRE 2H5EA 2NPIA 1A2BA 4CIDA 1T3HA 3UMFA 2IK8A 4KITB 2BDTA 2XB4A 4MKGA 1OLOA 5EE9A 4Z1MD 4GT1A 1MH1A 5F2EA 1HT2E 3EZ7A 3MRSA 1HE8B 1DBSA 1SVSA 4OQMA 1E9EA 3LXXA 3UMRA 3FE2A 1EESA 2WIBA 3W8NA 5BYJA 3L0IB 1U0LA 121PA 3U5ZB 1NVWQ 2QROA 2VHQA 4GZLA 3LXRA 5EE3A 4BRWA 3AF4A 3O8BA 5FTMA 3S1AB 2GCNA 2Q3FA 2GF0A 4LDJA 2F1HA 5KSPA 3QVVA 1QHHA 3CF6R 4LK2A 3W9YA 3RRZA 2NO1A 5CIQA 1G3RA 2VHTA 5DYGA 5L3QB 1BOFA 2ZRLA 3LLMA 1J7KA 4YMSA 1TUEA 3CRRA 4QGGA 3OFND 3NBFA 1R5NA 2PEYA 3W3ZB 3T35A 3KKMA 4UJ3A 2F1JA 1DG1G 4PQYA 1VG0B 2BBWA 1W4AA 1XCMA 4OK6A 3U44B 5FOVA 4HB2A 1R6BX 4ILEA 4QJ4A 4JLOA 4MYHA 3SOPA 2HLDD 2GILA 4TYQA 1KSFX 5BN3A 4TMWA 1OIVA 4D4KA 1ZU5A 2IYQA 4JLAA 4XTCS 2FSIA 2AXNA 2DWQA 5CIWA 1OKKA 2ZJBA 3DMNA 3DZ8A 2CHVA 3BC1A 3BGWA 1CTQA 2OO7A 3FKQA 1CEEA 4LBWA 1HY3A 1N0UA 1YZNA 2FH5B 1XD2B 4ARZB 2A9KA 1T4GA 2GRJA 3DZDA 2BIFA 2Q21A 1B23P 4B6EA 3PVSA 2J0UA 2WJJA 2ZI9A 2ONJA 3UWOA 1G7RA 2HYDA 1P72A 3AP3A 3PR1A 3U4QB 4AYTA 3ZGXA 5FPKA 3R8CA 1BS1A 1LB1B 3CZQA 4AYXA 1G6HA 4TLBA 1T0HB 4LPKA 2GJSA 1CRPA 3GD7A 1U8AA 1W2HA 3RS7A 5JJLA 4YDSA 5JJKA 1WA5A 1ZJ6A 3CW2A 4XWKA 4KBGA 3LVQE 2DB3A 2O8EB 1QRAA 2Z6VA 3W8RA 4TZ6A 5G53C 3TRFA 2XJ4A 4NZYA 1E2JA 1E0AA 5L3SB 2JASA 5EP4A 3X1YA 3U2QA 5KO2A 1EFUA 3AEZA 4Q21A 5GJWC 4HSEA 2ODBA 2ZYTX 5E7MA 4HDOB 1WF3A 4U00A 5KPJA 4WAUA 2JLUA 3NH6A 3MLEA 2XGJA 1W4CA 4Q1EA 1BIFA 2NQ2C 4Z8YA 4KI0A 4ZCIA 4DC9A 1GNQA 1RKBA 3AKYA 1KOFA 1P2TA 4AKHA 2BV3A 2J87A 1LFDB 2FEMA 2XZOA 1XCGB 3WNCA 4CEJA 4MRVA 3B1WA 1JB1A 1Z0KA 5C4MA 4EFNA 4YONB 2UZ3A 1OJLA 2QBYB 1CJKC 1KI6B 2VIIA 3K09A 4IW3B 3TIFA 3JZAA 1DAIA 4BLSA 5JJIA 4WOPA 1HEIA 1GNPA 4TLCA 2J46A 3BBPA 3WNBA 2VP4A 3KTAB 4HI0E 3B7GA 4JLDA 1PJRA 2ZSBA 4WVFA 3WP0A 4EQ6B 2OBMA 4MA4A 5EJEA 5GJCA 1ZNYA 3OF5A 2VP9A 1U98A 4MYCA 1KDRA 5CK5A 4IDHA 4DT1B 1W49A 1OB5A 2JJ8A 4NCJA 3QVUA 4DRZA 1XPRA 4AD8A 2FF7A 4G5GA 1T3LA 1VIYA 1VPLA 4I1UA 4IOLA 4IDNA 3UIEA 2V6IA 2ANCA 4C30A 2OBLA 4NMMA 1SKYE 2NZ8A 1BYIA 2ZPTX 5JWHA 5SZJA 4HUTA 5BN5A 1OHHD 4M9ZA 3W6OA 2H92A 2AR7A 2F3TA 3AGPA 2FFBA 1TX4B 3NDPA 4N0DA 2MSCB 5FBLB 1T8UA 5FH9A 3AVTA 3QKTA 1CR1A 1KK0A 1KSJA 1SVOA 2JLRA 2VHJA 3I4LA 1P9RA 1T8TA 4DDTA 2WJYA 2IHBA 4TYPA 4M22A 2O8FA 2D7CA 2AX4A 2ZI4A 4I1SA 5AJVB 1VMAA 4RCZA 1T5IA 4DIDA 2ZTSA 4JL5A 2ZE8A 1GL6A 3VR2A 1FL9A 2J7KA 2FMXA 3U3JA 5JZVA 3OAAA 3BFVA 3SC3A 3JZMA 2Z5FA 2OEPA 5JLJA 3GLHE 1QHHB 2DFLA 2QT0A 1FMLA 1HH4A 2Q0HA 3KKPA 1S9HA 1W36D 4DLRA 3NKVA 1T91A 2P6NA 3BFXA 1Z0JA 5IK2A 4BLTA 1TQ6A 2QAJA 2A5YB 2Z4SA 2OE2A 4OQFA 3THYA 1OH6A 1F60A 3FKSD 1TU3A 3AF0A 3I32A 2WWIA 4QGFA 3GQBA 2CVHA 1CR0A 2F7SA 1NG1A 1PUIA 3MG9A 3GPLA 4MGYR 4AURA 1GKUB 3MJHA 3TVDA 2QE7D 2HYIC 1WXQA 4RD3A 1D9XA 4B3XA 4KVAA 2XTMA 2BKUA 2GK7A 3EW9A 3GLIA 4LV6A 3GLFB 2LKCA 2WBLC 4TN1A 2DYKA 1YR8A 2QAGB 2ZRGA 2FV8A 4DLUA 1ETUA 1ZIOA 5BN4A 5KNBA 1KSHA 1N6OA 5DN6A 4M1KA 3SYLA 1FQJA 3K9LA 2ZUDA 2J0SA 2ZE5A 4PPGA 8OHMA 3HU1A 3U3OA 4D0NA 5KUTA 1LV7A 3I8SA 3KQHA 1ZNXA 2J0UB 5EUMA 2DPXA 1FP7A 4QBFA 1Q0UA 2VTKA 2ZJ2A 4URYR 1LY1A 2J41A 4D0GA 3TW8B 3KL4A 2P5TB 3VNUA 1DELA 1BMFA 1G8HA 3TAHA 2HCJB 2RGGA 1R2QA 2PLFA 3EIQA 1S0UA 2BHRA 2QPAA 2ZU6A 2NG1A 2W6JD 4D26A 3CF2A 1ZUIA 2YV5A 4HLQB 4W5WA 3QPUA 3WBKA 4OJKA 1FNNA 4FN5A 1SHKA 2O8BA 2J1LA 1TNDA 2OSBA 1OFUX 1W4RA 1DAGA 2H17A 4EPTA 1DVRA 1KJZA 3QE0A 2G1JA 3AVYA 2ZAMA 3E5HA 3KZ1E 1YHNA 2AFHE 2AL7A 2QGZA 1IY2A 3IPXA 2UKDA 3NBZC 1AS3A 3QF7A 3PENA 5CDFE 1G19A 3ZS8A 2ZRNA 2XOKD 1QHNA 3E70C 4KODA 4B3CA 3ADCA 4OHYA 3Q5EA 1F2UA 2WIAA 2ZANA 3NWJA 3MJRA 1E9FA 4Q9JA 4BZPA 3EX7C 4EPYA 3SR0A 1DPFA 3LBNA 1VKJA 5KU1A 1N2CE 4PHHA 1JAIA 2ZS7A 3NEJA 4RFSA 1U0JA 5FR2A 3LBHA 4KLZA 4Q4HA 4QHYA 1U9IC 3GFTA 3TJZA 1AS2A 1Z6YA 2J7PD 3A4NA 1W36C 3A58B 2FU5C 4RD1A 1M8PA 1GM5A 1OPXA 3GJ7A 2OFOA 2VLIA 1UKYA 3OFNA 3GLGA 3BS4A 2OCAA 3KJHA 2JIZD 1KK2A 1Q1EA 4GP7A 2XAUA 3ZH9B 2GA8A 3IKJA 3QEOA 4QBHA 4DXAA 3U7FB 4OQNA 1UKZA 1W1WA 2VF7A 3KFVA 1Z6XA 4IVQA 1D8TA 1E98A 2G77B 3LX5A 4IOMA 4IEIA 4IJMA 3B8HA 2OG2A 2P6RA 2NMVA 4LV8B 2HT6A 1U2RA 2WHXA 4KAXA 3QXXA 1K8RA 3UK6A 3Q7QA 3REFA 2RH5A 4KYIB 2REOA 4RZ3A 4CW7A 1G16A 4XOIA 4JZKA 1R5OA 1XXHB 1ZNZA 3P27A 5M04A 5LPNA 3SQXA 1DS6A 4QJ3A 2EYQA 4Q18A 4URUR 1NBMD 4V0MA 3D3QA 3VR3A 2IS6A 4HZUA 2GZHA 3UANA 4PSVA 1CJMA 2IWRA 3VNVA 5JMTA 4ZDIA 3LWNA 1EFCA 4I4LA 5IDVA 2PT5A 3SBDA 4BASA 4A0RA 3RS0A 3W5IA 3I5YA 1SHZA 1EG7A 5HE9A 3FHOA 2PMDA 2YYZA 3MWJA 4KSBA 2CDNA 4E07A 2DHRA 2GWHA 5FUVA 4EDHA 2CK3A 4DSNA 2EYUA 2BM0A 2G1KA 2NO0A 2IXEA 2IS1A 3DM5A 3N5CA 2ATXA 3LDAA 4M1MA 1AN0A 5FL3A 2O8FB 1T0JB 1KI2A 1N3BA 3WYAA 4D80A 1SXJA 3QF4A 1DTSA 3NBXX 3U4QA 4M1WA 2IUUA 4ZIRB 4AK9A 1FOEB 2CJWA 4EUNA 1N5LA 1T6NA 1E96A 2J59A 4F38A 5J4YA 3BXZA 1Z6AA 2ZI6A 2ZRAA 4HLDA 5HR5A 3P4YA 1GRQA 5J4LA 4C7OA 1YVDA 4GOKA 3R9IA 4EPRA 2GXUA 2ZRIA 3B82A 2ZJZA 3N2IA 2FZLA 2H8KA 4TT3A 3K8YA 2D4HA 1IONA 3ETLA 4OBEA 2KBFA 4KLNA 4HDCA 1JBKA 1QHIA 4CVNA 1JPNA 2WMOB 3SBEA 3VX4A 3EZ9A 1KK3A 2QRZA 5E3HA 3A4MA 4WXPA 2VF8A 1A82A 1MABA 1G5RA 1DAMA 1E1QD 4AIIA 5EE5B 4EIWA 3MCAA 4V02A 1XD9A 1E1RA 1Z0IA 2OCYC 4PZYA 1CF4A 4OHWA 3T1VA 3SEAA 3LRPA 3CH5A 4MRNA 1TU4A 1RFLA 2PH1A 2QSYA 1Q1BA 2WVJA 4KBFA 3F3YA 4W9MC 1HUQA 2QPTA 4A92A 4LHZA 1RRCA 4Q4LA 2QG6A 2PJZA 3TMKA 2QN6A 4PC7A 1P62B 3RRMA 2ONKA 2D74A 2IEZA 4K8OA 1VHLA 4TMZA 1TEVA 1LF5A 2A5DA 1AQYA 1QVRA 3LV8A 5HCIA 4ERNA 1JNYA 2ODWA 3U44A 4DUGA 2JLZA 3VKHA 2QP3A 2IW3A 3T5GA 1Y3AA 2QMEA 3CONA 5HTKA 4D81A 5G3YA 1UF9A 5A5GA 1C9KA 5DHFA 3EPKA 5BYKA 5D3MA 4G5QA 3CX6A 3ND8A 4D4MA 4BWYA 1GRNA 3CZPA 1EXMA 4OHZA 1XEXB 2EWWA 1HQCA 1WQ1R 3B1YA 4MRRA 4DVGA 4Q9IA 2PZEA 2J5XA 2O8BB 4XSHA 1GWNA 2JJ2D 3TH5A 3P32A 4QKQA 3CLVA 3V9PA 2C95A 1SVLA 4H1VA 1OIXA 1JAHA 2GAAA 4P32A 3VX3A 4B35A 4BUJA 3THOA 5JWOA 1Q22A 5DISB 1KDPA 1WDTA 2GDJA 3L8ZA 1Q1QA 1VECA 4FWIB 4A0GA 3GEIA 3BRWD 721PA 3UG7A 2RGDA 2RGEA 2PLRA 2WSSD 2ZS9A 1J99A 1OXSC 1E2IA 3E2IA 1JR3E 3TUZC 1YRAA 2ZITA 3AF2A 2R2AA 1E94E 2W6ID 3CUEF 4UJ5A 4PO1A 4A9AA 4DLSA 2ZM5A 5CM8B 5TVKA 5KSOA 2QP4A 2UVQA 4E09A 3TSOA 1IM2A 2RKOA 2Q3HA 5LDDC 5E7IA 1ZP6A 3FHTA 2FSFA 3KXIA 4RFSB 2KBEA 3A1VA 3WHKA 3BAFA 3T15A 1U9IA 1N6KA 3VAAA 2H18A 5KHOC 4ZDJA 1KAOA 1NMXA 2ZS8A 3K0EA 1ZMXA 4MKHA 4M4SA 3JVVA 3GLGB 4CEHB 4CF7A 1N5KA 1MV5A 4TTRA 2A5FA 4BZQA 5L3SA 4BLPA 5JCZA 1G3MA 2BC9A 2QMUA 4PQFA 3EXAA 2GKSA 2GBLC 2VA8A 2Y8EA 3WNDA 1EX6A 1YR7A 1U8ZA 3PXGA 3UMSA 4FMCF 3B9QA 1GRRA 1E9DA 1U90A 2WWHA 1WRBA 1G7TA 4GOXA 3RS3A 4MQBA 1RE0A 3FDIA 3LQQA 1I2DA 3UKDA 4E03A 1R0WA 1CULC 2FNAA 4RJLA 3RS2A 1NSTA 3A1WA 3WRYC 2XSZA 1IN5A 1KHTA 3T12A 4HZUB 4PFSA 2YWHA 4YMTA 2QBYA 4RZXA 1AM4D 2R6FA 3RANA 1ZCBA 3TUJC 1KO4A 3TSWA 5TXGA 1FP6A 4C0QC 4DKXA 5JWRA 2X77A 4JT4A 1XNJA 4G5OA 1NVVR 5CLLA 5LD2C 2ZJOA 1PLLA 1E99A 2N46A 3ONWA 2AK3A 2KWIA 3WMFA 1L2TA 4BFWA 1OIWA 1G7CA 1XMJA 1X6VA 2JLXA 1XJCA 4BQSA 3GFPA 2W6JA 4JLJA 4DT1A 1R10A 2ZSAA 3B9PA 1E2HA 2C5LA 2MMGA 3B78A 4XTRA 1XD8A 3QF4B 1QHXA 2ZJ8A 4MUAA 1OXTA 2QEQA 4OI0A 2AD1A 1G64A 3IHLA 5TARA 3A37A 3TQFA 5JFGA 2XJ9A 4RD4A 3BB1A 4OI2A 1UDXA 2WOOA 3QXHA 3PUWA 4C0BA 2OM2A 3KQUA 2W0MA 1KJWA 5GVRA 2HJGA 4DIEA 2XOKA 4URZR 2YWFA 2NPFA 1XEWY 2F43A 4N1AA 2ZRBA 4PO9A 4NE2A 2FOLA 4NU0A 1K5GA 1Z07A 3W34A 4UNPA 1CR2A 1OSNA 2OFWA 1P73A 1EK0A 2CBZA 1KI8A 3M6AA 1IXZA 1JXMA 5FUWA 3Q85A 3U6KA 1A5TA 4X8HA 1MABB 3WYFA 2IYRA 2J7PA 1S3GA 1ESMA 3OEEA 2ZXUA 4RKEA 2BBTA 1Z0DA 3FVQA 1FMJA 4HDQB 4TLAA 4PAOA 2JLWA 1P61B 3IBGA 3GJ5A 4LOAA 3WY9A 2JIZA 3KKNA 2FPKA 3TBKA 1RZ3A 1ZC3A 1JPJA 2O8DA 1KI1A 1R0XA 4PZZA 1AZSC 4NHOA 3EZ6A 3FB4A 3GJ3A 1P2UA 2C98A 4US1R 4LYHA 3GLHB 3SHFA 4GBMA 3P20A 4MGKR 1RYFA 2P65A 1CJVC 2P0EA 3QG5A 4FIDA 5FPYA 3ZIAD 1XTQA 4WZAE 2LKDA 5CM9C 4B73A 4PPQA 3IEUA 1E2QA 2AWOA 2BEJA 4M21A 1A2KC 1N6RA 2CE7A 1GL7A 1HA3A 1NBMA 5D3MB 2QM7A 5JS8A 1BYUA 4B32A 3KFXA 3PV0A 1NY5A 3FPAA 4R2HA 2GHIA 3PJRA 3F8TA 5GVSA 3GLFA 1KO8A 3THWA 1N5JA 3B13B 1HV8A 2QAGA 4D4LA 1VCMA 1OH7A 2WAYA 4B3GA 1G17A 4DDVA 4Q1CA 5AJZA 1H65A 1G3IA 4PPNA 1G18A 1Q20A 1ZBDA 2GVDC 2ZYWX 4MH0R 3IUYA 1KZ7B 4N3NA 3IO3A 4QRHA 2FPLA 2HF9A 2PMKA 3QXCA 2HXSA 3KKQA 1SQ5A 1UKEA 2JATA 1FZQA 1TF7A 5IRCD 2C04A 4C9BA 2IBMA 4R9UC 2RGAA 1OFHA 2VSFA 1D2NA 1ZD9A 4LGMA 1UEIA 4OI1A 1M7HA 1SULA 1OF1A 4D25A 2WWXA 4GFDA 1I2MA 1TADA 2GJ8A 2FEOA 4Q1DA 1H8HD 2FDCA 1Z2CA 4FMDF 4M2LA 1AKYA 1E79D 1W36B 3M0EA 2R44A 5KYKA 1NI3A 3EASA 1E9BA 3NTUA 1UAAA 4BECA 2V8OA 5KPDA 5J4VA 2BMFA 2IYYA 2ODEA 3IO5A 2WWYA 2WTUA 4NYIQ 3ZJYA 2RGNC 4CEIA 3NXSA 5FL7A 1D2MA 1XEWX 2GBLA 2EW1A 2GXQA 2WKRA 4NYIR 1KY3A 5SZHB 3LD9A 3UPUA 4CRWB 2YOHA 4OK5A 4XVQA 3DDCA 2QORA 2VP6A 4CT5A 3TKLA 1E1QA 4GZMA 5HZHA 4ZDWA 3BFKA 3VFDA 4RD6A 2W2TA 1YU9A 4Q4AA 4WIAA 1XBTA 4TL6A 1W2GA 1LW7A 1XTJA 5B57C 3OIVA 3RRYA 4NONA 3AH8A 4FMBB 2Z43A 1EX7A 4EJSC 4G01B 3B85A 4A1FA 4Q7MB 5FTKA 1FUKA 3ADDA 1X8KA 1W0JA 3NG1A 1OXUA 1NKSA 2PZFA 3UATA 2YKGA 4WBSA 4HLCA 3PITA 5CK4A 1EFRD 1TUIA 2OESA 5KSZA 1Z06A 2VL7A 1AS0A 1E6CA 4LYJA 3THXA 4PXAA 2HDNB 4AC9A 3CWZA 3H2YA 2ZSEA 3IIJA 2FPMA 3W3AA 821PA 2JAQA 4C0HA 3U60B 4NL4H 5G3ZA 4QNRA 4F7WA 4A15A 2AKAB 1GFIA 4DLXA 1XPOA 3R9XA 2ZVPX 3AF1A 4F93B 4KJZA 3TE6A 4ASUD 2C77A 2CCJA 1QG2A 4B2PA 4BFTA 4FCWA 1G1MA 1XXHA 2ANBA 2JJ2A 1C1YA 1FFHA 1HTWA 4POAA 5C2JB 5FBWB 1Z22A 1XP8A 1XTSA 2GEDA 3OZXA 5BW8A 1XU4A 1NMZA 4ON9A 3LH5A 1G20E 1KDTA 1ZUNB 4Q9LA 4B3FX 3LY5A 2XB2A 1SXJE 1TF2A 2AK2A 1F48A 2F43B 4GOJA 4MKFA 1NNEA 2D62A 1LTQA
chains in the Genus database with same CATH superfamily
3R20A 4LSMA 3GHYA 1QLWA 1NQOA 4WLNA 3E2PA 4L8GA 4F9EA 2MDTA 3HY6A 1EKXA 1W25A 2P75A 4X7MA 4L5IA 3UC9A 4EK9A 5LMNB 1ZVMA 2FX2A 4XM1A 1J8YF 4LJ7A 2CEAA 2HTFA 3OLZA 1QYIA 2ZIXA 3Q3IA 1LX7A 4D9CA 4D4GA 1XZIA 4Z3OA 1QC5B 1T5HX 1YKSA 5ESXA 4JBIA 1XRNA 2WSLA 1RWBA 2FZEA 4LC9A 1AKMA 3QTTA 4RDXA 3AUSA 1Z7WA 3LCVB 5EN4A 1VPWA 4Z4EA 1X86B 4REQB 4Q4JB 4ETNA 2C84A 5KOJB 2O8DB 5ITVA 2VJPA 2PZLA 2CFTA 1BFUA 1NVFA 3RU9A 4AX4A 4DSUA 4UBIA 4OMUA 3AC0A 3HNPA 1ONPA 2O6LA 3E9NA 3GLUA 5EP3A 2NAPA 1MH9A 1TFRA 4B46A 3ND9A 1OZAA 1G55A 1MG0A 2O3UA 2WV9A 4XD7D 3VH3A 3KJNA 3W06A 4NG4A 4IDPA 1W0KD 4UPEA 3O3MB 4BJ1A 4YRKA 4PYJA 1PDWA 2BTQB 3NEYA 3R6TA 4FI3C 3IEKA 4NE7A 4CLOB 5ITZA 1ML4A 2WU3A 1GCUA 3UBMA 4P9NA 2OGTA 1TGYA 2H0QA 3ZIDA 4IUYA 2IP2A 2BKLA 1I5OA 1UT6A 3SFVA 1TECE 3VXKA 5KKCA 1EQUA 4XYBA 5KQGA 5MN4A 2CV0A 3RCBA 2Q27A 1Z45A 3KYCB 3BULA 2FGJA 4U6SA 3X2FA 3UPTA 1JL3A 4XA8A 3VPSA 2FXIA 1VRCA 3A1NA 2VEDA 4P83A 1CY7A 1PP4A 2Z6UA 2JIOA 1E62A 5FBKA 4O1MA 4G07A 4A6EA 3D7SA 4IUBS 2OWDA 2JC3A 1TTPB 3IYLW 3P4XA 4UW9A 5L3VA 3DC2A 3G23A 1DCKA 4NZZA 4C0JA 1CP2A 1E7SA 2L18A 4D0SA 2AZXA 1T9DA 1ZJJA 2I4IA 3FPLA 3UAYA 4I1OA 5KX5A 2PH3A 3FR8A 5C5IA 3A2KA 3BE6A 2Q1XA 3Q40A 4FDMA 2QUJA 3C3XA 1F8XA 1E2MA 3QNUA 4TXNA 4BIIA 2VP2A 2ZIZA 3I6QA 1LVGA 1E32A 1TUBB 2E9SA 3BWVA 3B1KA 5EVCA 4C14A 4CU2A 2YFQA 4IF4A 1I4WA 3OWOA 1GUAA 4V3BA 1KC3A 3UJDA 3T1OA 3G2LA 4GIBA 1UUFA 4PHFA 2PZ8A 2CHEA 2IYFA 2MJLA 3W3AH 4LE2A 5IDYA 3KJFA 3M6MD 1HWYA 1JHUA 4M54A 4I5GA 4D44A 1XZ8A 4RGBA 3QLTA 5IG2A 3TGLA 1KGSA 1NRJB 1Q2UA 4CETA 4M9XA 3WGKA 3P9XA 2IHYA 2VQSA 2HDOA 3E4DA 3GGOA 4LFAB 1VHTA 4LEIA 3WB0A 4DC0A 5CITA 3DPSA 1N6HA 1JVBA 2NYRA 2R7KA 3IJRA 4HQRA 5MFPA 2J32A 4ZVLA 4RSGA 2WP0A 3K1TA 3TOVA 2V0NA 3IUNA 2DJIA 1V9SA 1I4LD 2V5AA 4JI7B 1JS1X 2YNMA 3SC6A 3EZFA 4Z2AA 2NZVG 3L18A 4Y6QA 2RGNA 5DK4A 1I0LA 1M0TA 4N03A 3QBDA 2WICA 2W58A 3OLCX 2GQ0A 1LK5A 2DBVO 4U1RA 4DHEA 5CXUA 4YJ3B 1R0KA 2PBZA 5LA6B 2XZLA 3VNBA 2FUEA 1E7WA 1J0XO 1IQPA 1CQWA 4TV8B 2HU5A 4E5YA 3QMVA 5KNDD 4G0VA 2H31A 1G8FA 1YL5A 2Q49A 1RYZA 1ZNQO 3H1BA 2ORED 2C0QA 3PS9A 4KQIA 4TPKA 1Z6QA 3F0TA 5A06A 2W2KB 3BSFA 1IM8A 4IGIA 1JEQA 5IJXA 3IUPA 4IDAA 3QELA 1DJPA 1XJ5A 2AEEA 4EJSA 3BXOA 1ISRA 2OV3A 5AK3A 1YMVA 2QENA 3JASB 4BV9A 4EAQA 5C35A 4JI4B 3QXJA 3TIGA 2DQYA 1JVNA 4NULA 4DG9A 4Z49A 3JWIA 4DV0B 3C3DA 1QHFA 1DHRA 2M6RA 3H99A 1WMSA 2DRIA 2XQIA 2ZI7A 5BVHB 4KWIA 3I5UA 1Q14A 2IDJA 1LD3A 5H9WA 2GTHA 4CEHA 4IIGA 1RTTA 1EA5A 3VMFA 3IBCA 2IYLD 4R68A 3TQRA 4DSTA 1VCHA 2PSFA 3E6AA 2HSGA 1QMPA 4PGGA 5TEVA 2CLFB 2P27A 1A7KA 1ZJYA 2Z1NA 3EXEB 3Q3VA 3X1KA 1JSRA 2I5PO 1GRCA 1UDWA 3H1TA 1GFZA 5HNKA 3BK1A 3JAKA 4DV6B 2HEGA 2WMDA 4R1TA 1UBHS 1SKQA 1PGJA 1UPTA 4RA9A 5E4FA 3HWSA 3B1ZA 1N6PA 3ROPA 2QF7A 2EQAA 1W5FA 5PNTA 1XNRB 5IUNC 1SHUX 2B4AA 4FUQA 4G0YA 3ASZA 4FGSA 4EI9A 3JTMA 2B8TA 3ECCA 5DM60 2A7XA 1JQ3A 4FYPA 4D0LB 3N7AA 2IPNA 4E3WA 5EIOA 1JEDA 2CUZA 1L4MA 3CRMA 1U0RA 3CISA 3O0DA 3RC3A 5T7BA 1WZEA 1Y5RA 4GXRA 3IQWA 3FWHA 3DEAA 4E31A 3LUCA 3HJUA 1A71A 1ZDMA 4LRSB 4YRCA 1NVXQ 3DHEA 3ZWWA 4DOMA 1AK9A 4E3ZA 4BZZA 1OWMA 2QRHA 4UHJA 4XCVA 4CUJA 4QDOA 2X8JA 1BDHA 1K0UA 1X8JA 4P31A 1OAAA 2A0YA 2G7MC 3ILXA 4KXMA 4MAMA 4EB8A 4W7IA 3I09A 2JFVA 3DTVB 2BUAA 2VAVA 5BNTA 2OB1A 5IN4A 3MJCA 3E8MA 1P17A 1VHWA 3CA8A 5AI0A 2PZJA 3AR5A 4OGWA 4JI2B 4HQ6A 3AETB 5ALPA 3O0TA 4Q82A 3SQOA 4AUNA 4X3OA 3LYLA 1XTVA 2WJPA 3PG5A 2C5HA 4XJTA 2LCQA 5L40A 5K6AA 1AX9A 3H11A 3PGMA 3SYTA 1SH7A 3E9RA 1M6VA 4P84A 3UAGA 5EIAA 3QU7A 3WLFA 4CKWB 1TMKA 2HSEA 4TQ9A 1FYWA 2BMJA 2GBGA 4N18A 5DTMA 5JAIA 2R62A 4YUYA 3H3XA 3HJGA 1FU7A 3NP7A 3FCXA 1RAEA 2P1DA 1AA9A 1YR6A 1Z62A 2O0JA 4RVHA 3WKBA 5J40A 1JEOA 1XFAA 5GPBA 1XZLA 2HQ1A 3ZN2A 4EGAA 2YYYA 4HAWA 1AO0A 3P9NA 4M0DA 1IBRA 1ZN7A 1L7XA 4A36A 1MAAA 3H8SA 4G1BA 3UFBA 4X65B 2GZMA 2RHLA 3HBMA 1TYDE 1WXWA 2OBFA 4PW0A 4X97A 2CSXA 4HJRA 4JP8A 4XUEA 3FPGA 5AWFC 3ZU2A 4KR6A 3QFFA 1SPXA 2HUNA 2N3ZA 3FCYA 3ZH2A 4IO1A 2R4QA 4ESOA 2CMGA 4NPAA 2XDAA 1T9HA 4ADSG 1BS2A 2MMCA 1T4MA 3IURA 3PC8C 1LJUA 3IPRA 4DIFA 5JSQA 4IRXA 1EFRA 1OWNA 5JXGA 3QOFA 1Z0ZA 3GMSA 3KE8A 1LUAA 4ER5A 4JT2A 2JA1A 3KFLA 3V34A 4FYXA 3CFYA 1EK5A 3WNQA 4N0MA 4JI3B 4NENA 3AR3A 2C7RA 2Z95A 4O4LF 1HURA 1M34E 5HRAA 3KEOA 5LOVA 2VDVE 1E64A 1JQBA 1I1QB 1CD5A 1UKAA 3S2YA 1Y9ZA 4BGIA 2WKWA 3JRNA 4TMXA 1AO3A 3TXYA 3TBHA 5DTJA 4JT8A 4L3VA 3TD2A 4DLYA 5BV2P 2X22A 4ZDKA 4G5SA 1FTGA 4Q7EA 4G9BA 1ZD4A 3ZE2B 4OUDB 2VPPA 4HXFB 4UKDA 2Z83A 3HCCA 1EDEA 1YZGA 2QXYA 3ZNOA 1F2TB 5U9CA 2E1PA 1XVVA 5A0FA 1BHSA 1GG9A 1OLXA 4JJ7A 3U7QA 3IQDB 1D5WA 3MC1A 5DZSA 5BXYA 1DAEA 4P81A 2VHYA 1PYDA 3VNSA 4KLCA 1BSVA 3LKBA 4MW9A 3QSYA 2HO4A 1E63A 2BDUA 3AT1A 3PPWA 3BGSA 1JTFA 4EFMA 3KAKA 3GGGA 1ZMRA 1Q1GA 2FFHA 2WIGA 4IZOA 4JHLA 3MD9A 4UDNA 3OKPA 4B84A 2BCEA 1V4VA 1OBHA 2QU7A 4O4HF 1R8QA 1E9CA 2BHLA 2JI9A 2XYPA 4G1VA 4LJRA 1BRTA 1J8FA 3ZJUA 1YMQA 4TVKA 3H3FA 5IYZF 1Y3BE 3L0ZA 1GGFA 4ZI3A 4ML3A 4BE9A 4PV7A 1RPNA 2C9ZA 2REQA 3KEQA 4Y9DA 2IZ6A 1J8MF 4YYEA 4YJFA 2HPZA 1Y4UA 4L8FA 1RZVA 1CF2O 5CLQA 1X7XB 5IJWA 2XRYA 3QYAA 1GPKA 2CL5A 3RKUA 2V9PA 4IRMA 4KSCA 3WLMA 4MW2A 3CIOA 4Y6OA 4ARSA 4D56A 4X64B 1O3YA 1QCZA 3R7WB 1RRGA 1MRSA 4B40A 3A1SA 5LXTF 4A8JC 4C5BA 4JQOA 1EFVB 1R0RE 1TA0A 2X8AA 4IKEA 3PRHA 1VZ2A 1J0AA 3GG2A 3NHBA 3CPJB 4YJHA 3SDZA 3O3OB 2VDUE 1W88A 3MTDA 4DF3A 3GZNB 5EYPB 1UMKA 3DTNA 3IB3A 3RFTA 2GSWA 2BFEB 2E82A 1X77A 1EWYA 5CLJA 4WK2B 3A7EA 1QDEA 4K28A 4JDUA 4O8ZA 5EY5B 3E27A 5F12A 3L05A 4C22A 1IY0A 1GY8A 1EGAA 1RWOA 2QW1A 2HJWA 3O2NA 4Z0HO 4LDNA 3WAGA 1QFSA 2ODNA 3EG5A 3IJPA 3MWYW 1SKBA 3PFGA 1H1LB 2HPHA 3QUAA 3D1JA 1ESZA 3OEHD 3HP1A 4UC0A 3DO8A 3FUWA 2EL9A 3TW4A 4NK4A 2DFVA 4AG5A 3AKEA 1QORA 4JODA 4QM6A 1QQ6A 4KMOA 1FTYA 3VSEA 4HNTA 1NR7A 2O0KA 4EA6A 2CLLB 4KAJA 3QWIA 3WMGA 2EC5A 2EKDA 2QPOA 3V1MA 2OMKA 3RAEC 4HDAA 3RYIB 1US8A 2JK0A 1KFEB 2ISQA 1U94A 4OYHA 2NVOA 2W6CX 1CUAA 2FUKA 3FNGA 1RXWA 1T4CA 3F96A 2Q3EA 4WEQA 16PKA 1JALA 4DCJA 2ORVA 4F8YA 1FBTA 4YP5A 2P5UA 1P29A 1VI2A 1K6IA 3TR5A 4TQUS 3R3YA 3NR2A 3I05A 1RYBA 5IM4A 1JKFA 3PC7A 3Q8XB 4XE5A 1DUSA 5E6UB 1J2EA 4OHKA 1QG0A 3OX2A 3DQZA 2Y1CA 1RXCA 5LZ2A 1KA9H 2YN0A 2OV4A 4KQ9A 1ZAYA 5FULA 2C4NA 1M2OB 2SNIE 5EEHA 1Q21A 5JWRA 5LUAA 2CMFA 5E4TA 2EX1A 1Q7GA 4LBYA 2I2WA 3OZSA 1WCIA 4X00A 1QIKA 4P54A 3BTSA 3B2EA 5A2QA 4P3YA 2YOFA 3D81A 2XADA 2QSJA 3K6JA 3X1DA 1Z74A 4ATNA 4BRSA 3M4XA 5KCZA 3SX2A 1EIWA 1YU6A 2WZDA 4QPZA 1ELOA 2AC2A 3RYHA 1ZH2A 2QIPA 3HBNA 5KNBD 2ZYDA 1UDRA 4C0AC 1GZVA 2IYZA 5ITSA 3MINA 3BOSA 4F4IA 1NU8A 4NRDA 3NYQA 1CUSA 4JB0A 1MX1A 1MEEA 1XUOA 2VSXA 2J0VA 3RVQA 4Z6KA 3Q0TA 4DJFC 1NN0A 4BNDB 5DMHA 3BN3A 5J59A 2VXBA 2WUWE 2ZSIA 4MVJI 3RRFA 4I81A 3D1VA 1SKYB 4L5AA 3B6EA 1GZSA 1MO5A 2F90A 3A1CA 4WXRA 4ER0A 1S3FA 2D0DA 3OQPA 4JEUA 1WXDA 4ZREA 5G1PA 1GQQA 3IGFA 1V8BA 4UQOA 1TQ2A 4GGPA 2HQRA 5TY0A 4MR9B 3QMMA 4JUFA 1ZCZA 1P3Y1 4MZXA 2Q9BA 3QYPA 4ZGWA 1I2AA 1LPBB 1QO0D 1UIMA 3GFGA 1RKQA 4WDRA 5F5NA 3MD0A 1DBPA 4B0OA 1KIAA 3KR1A 2IYPA 5AW4A 5DE3A 5ARCA 1ORRA 3IOMA 4NCNA 3QY0A 2Z5VA 2JD1A 4B1FA 1P1JA 5EPUA 1Y4SA 4AZ3B 3MUFA 2ZZKA 1MZVA 2ZJ1A 1XRPA 2IXDA 4Q4JA 1MVNA 1OWPA 2CL7X 4REQA 5KOJA 2G6BA 5EZ6B 1WW2A 1H3NA 3C6QA 3MAAC 4ZQEA 5E8RA 4MKZA 5LQJA 1WXEA 1GSOA 4I8DA 4NMLA 4II7A 2C4MA 3FNBA 4DB4A 2IEYA 4UTRA 3EDYA 4AB1A 4Q3KA 3K4PA 3U3KA 3E1SA 1II8A 2PG3A 1K8YB 3KX2A 4W6QA 3SNKA 3Q8MA 2RHJA 3GRRA 4FLFA 3AM3A 3PC4A 2KJQA 1XQXA 2JFNA 4FE7A 4RH1A 3V8QA 5ADVA 5DYIA 4DL9A 3W4KA 1CUVA 3A6JA 2XYHA 2PH7A 5ALEA 3F9IA 2I34A 5EOVA 3RSHA 2HIHA 2RHBA 1OFIA 2ZJAA 3KYCA 4TL9A 3SHQA 4B82A 3S2IA 5HIAA 4U7DA 1S5PA 2YIDA 3OE7A 3PGA1 4G4GA 4J6FA 2UUAB 2W83A 3RD5A 4YJDA 4YNBA 2XOXA 2FB9A 3K8QA 2YC4C 4F6LA 4RTNA 3ZVMA 1UPFA 2X4GA 4ZTUB 2OK8A 1UBMS 1E5TA 2G9UA 2OENG 4HAYA 3IIEA 3R7BA 3HO1A 2QT9A 3EVEA 3FWNA 1FCJA 4ZQFA 2GCOA 4DLWA 2NO5A 3CU5A 3C5EA 3K1ZA 3U1TA 2Z4TA 3EA0A 1LRKA 1L5HB 3D6AA 4C43A 3FOFC 3OWHA 3FMPB 3FTQA 2IEDA 3T1TA 5G0UA 3D3EA 3KPJA 4OXNA 1TUBA 2G9VA 3QUCA 4LYFA 1J0DA 3RS5A 3T0FA 1N34B 1NLMA 3QW2A 4OXYA 4WZ6A 3S44A 1C9NA 3L92A 5F7ZA 3VZBA 4BGDA 1NU6A 1ZYUA 4I3GA 3ISTA 4RH3A 4U7JA 4JITA 1BH2A 2FP4B 1A9ZA 4A6PA 4ZYTA 4PS0A 3OLWA 4ITRC 3RADC 1FS6A 4G09A 2WYWA 2WF7A 2XMGA 4C2TA 2JIBA 2ON6A 3HDJA 3R3ZA 3IOEA 1UBEA 2VJQA 2W5UA 1XX6A 2IYXA 2XBLA 3CXRA 3MGAA 2VUSA 3FY4A 2Z1DA 3IR6A 1TW2A 1WXXA 3OPXA 3QKRA 4U7GA 3R9WA 1SUWA 3OOJA 3PQFA 4OOEA 1EXVA 2XUHA 4RACA 2NQTA 1N0VC 2PZBA 4UQPA 4CM8A 3OD5A 2O5VA 1E4VA 3ZLTA 2AOTB 5IZ4A 3L8GA 4IIJA 3GRZA 1DJMA 4GI1A 1DOZA 2YVUA 1ECBA 4F85A 1E20A 1H69A 1T9KA 1Z5GA 2R6GA 5AVJA 1QGUA 4IQGA 3U4DA 2Y2UA 3G02A 1UBFA 2FR1A 1UFOA 3LYUA 2AI2A 1HG0A 1N2GA 4QQKA 4A2QA 2HA4A 1WZNA 4XR9A 3FUVA 4HMPA 3TTTA 3CLSD 1O6FA 4ESEA 3O8DA 2H11A 2CT8A 1Z4KA 1RC1A 3P1JA 3H2JA 5LA6A 2IYOA 4G9EA 3F97A 1RJ9B 1XB2A 3FRHA 5CB0A 2CDRA 4XVRA 3WV5A 2ZIAA 4Z51A 5AYVA 2B25A 3OBIA 1J2TA 2GN0A 3ITNA 4PCVA 5CA0A 4R6WA 2IOQA 4NDZA 1XMSA 1ZITA 4ZYUA 3GLKA 4GPZA 5JFTA 3OCCA 1RRMA 5FJJA 1GVNB 1DL5A 1RHJA 3F5DA 3WKCA 4BJ5A 1TU0A 5T57A 4EB6B 1U8TA 1CYDA 2CL6X 2HNAA 2MYUA 2A94A 3HR8A 1TVCA 4KMMA 3ZZ0A 2A78A 3HV0A 3UHJA 1OZFA 1Z8HA 2Q5OA 5COBA 2Q3JA 4MR7B 3DWFA 5LNK6 2EWVA 1XLUA 3ZOKA 1Y7TA 2VRWA 4NBNA 1Y33E 4HDKA 3FROA 3I3SR 3ZI0A 4L7QA 1ZA1A 4EHBA 4TYWA 3EXEA 4I50B 4WN9B 1KQFA 5CR9A 4QECA 3F6PA 2IPXA 1TMGE 2RK3A 1ZGGA 3H9QA 4D3XA 1XAIA 4QM7A 1Z36A 1JIVA 2PMBA 2I33A 3KJXA 3DL7A 4I8IA 1MB9A 3ILVA 4M8NE 4E12A 4HNAB 3QEMB 1SBNE 4LJ9A 2PSEA 4AIRA 1NUPA 3D3KA 2GBPA 4GYJA 2QOEA 5GONB 1BXRA 4JIGA 4KMSA 5AESA 1E1RD 1YMUA 3WA7A 1G7SA 2OWEA 2CMDA 1SBYA 1ORHA 1BO6A 1SC1A 2B8WA 2BL4A 3SC2A 4EENA 4F3KA 1FTNA 1JTVA 4MAFA 4ND6A 4ZI2A 3ZC3A 3IHWA 2YS7A 3VZCA 1W7AA 5LKRA 5IZCA 2FR8A 5EP1A 2QTVA 5F1PA 3V4VB 3ETHA 4V0KA 4RTKA 2WT4A 2XKBA 3UJ7A 2G71A 5CA1F 1TCCA 1VRVA 4GL2A 5GIPE 2IT1A 5AHOA 2CV1A 1PQUA 1XQ6A 4KI7A 2ZI5A 2FE4A 3BRWA 4AKGA 3N1UA 2WSSA 3CC8A 2HMYB 2XWJI 4EF6A 3KB6A 2CLSA 1XL0A 1ZAKA 4YRTA 5FKJA 2DQSA 3A7DA 5B5SA 1RQ2A 5CFMA 3IEXA 4N7MA 1LSSA 1LJ8A 2Z2ZA 3MAJA 3QLUA 2E3JA 3DTVA 4PBTA 3OZFA 3SQNA 1A97A 3Q3JB 1TJYA 2QX9A 3AI7A 4M7OA 4PRYA 2QQEA 3LY7A 5HW0A 2HJSA 2PRIA 1YOVB 1I1NA 4HDSB 4C78A 3PDIB 3P4UA 3ZV5A 1YCDA 4RTOA 3EFHA 4AZ0B 4YT8A 3LDFA 2YHUA 5HOEA 2IUTA 5AM5A 1MFZA 4C2AA 4DNQA 3OTWA 2C4VA 1FDRA 2MSKA 5J3JA 2JCYA 4QHTA 1TTQB 2VWGA 3KUCA 4R8RA 1E0JA 3G9QA 5IDXA 4J1NA 1Y63A 2XUIA 3B36A 3LDUA 4JLVA 1YE3A 4JL6A 1ADCA 4AI6A 2HK7A 4JKIA 3IAS1 3ACBA 4N8SA 2QY9A 3N0TA 3V1KA 4G5RA 1Q3HA 1KJYA 3U3RA 5GY7A 4ZVSA 2IP1A 2P5YA 2FSSA 5F9FA 1SOVA 3E81A 1SXJC 5TJHA 3A6ZA 1ICEA 1QGYA 1PJ4A 3UKJA 1REQB 5JNVA 1X3SA 5BN1A 5KJEA 2ZUUA 1HMPA 1N6NA 5FPSA 1KARA 4PX2A 2I8AA 2V45A 4H3KB 4WASA 5J1SB 5JHGB 3UTCA 1F4PA 1TT5A 2XDQA 4MV8A 4YV2A 4L7VA 4L07A 5DM0A 2O57A 4EFLA 3SLKA 4DDHA 2B92A 3U56A 4MPTA 1JWBB 2GUWA 1EBFA 3AM1A 1PE0A 1W8IA 2FWAA 2O8VA 3O1JC 3TPCA 2ZUVA 4QELA 2XT6A 2Q5LA 5I7AA 2YHSA 3MW8A 4BFXA 5B3JC 5AW5A 3S99A 4FFWA 1UEJA 1GSHA 1G8SA 4JBHA 1QGAA 5EE1A 2NTYC 4EHKA 2R751 3DV2A 3FIJA 5JD4A 2F1RA 4X60A 2C7QA 3ZCVA 1RT9A 3AU9A 5A0VA 1W0CA 2C8KA 4BN4A 1V35A 3ZEAA 4EECA 5C8YF 2A1UB 3H5IA 3QIVA 1U1FA 5EIXA 1IZZA 1UBRS 2ZJ4A 3L7KA 1T2UA 3PDHA 1E3TA 4B48A 1WB9A 3EMVA 4INPA 4QTUB 5JS2A 3ZTYA 1MO6A 2H65A 1A95A 3NWBA 4N5MA 4O1IA 4C0SA 1AOXA 3G2QA 4Y2GA 3AW8A 4ND3A 5T6MA 4HFMA 1EG2A 2BUBA 5CJPA 5FTLA 5DBOA 5ERXA 5DI3A 1QNFA 4CV3A 3JQCA 1Y42X 4F4DA 1YJQA 2ZW9A 1J8DA 3ZV6A 3FCAA 3BXXA 1WUJS 1C3JA 1X7ZB 4IWXA 3WMEA 3JYLA 4D3YA 1EXNA 6REQA 3BK7A 3X44A 2TMYA 1XRSB 1JBEA 2FUG6 3I28A 4OMCA 2CXNA 4P4UA 5DSZA 5HUHA 4P33A 4BGEA 2JLCA 3VV3A 5B4VA 1P44A 3UMYA 1JE1A 2DQKA 3W9SA 2RMKA 4ZVTA 4HNRA 5BMVA 1JU3A 1M2NA 5IAGA 1JLRA 1E9AA 1QIJA 2ATCA 3JPYA 3DOEA 3QHAA 4IQ8A 4CT4B 4W5RA 2IGTA 1MJNA 4C4AA 2UYQA 3OLYA 1ESEA 4G9GA 3H4VA 1GADO 5IDQA 3RUPA 1HE1C 2FMHA 2WM9B 4TS9A 1N1EA 1S9DA 1KEZA 1DOAA 4QSHA 3Q5DA 2Z30A 3HUUA 1SCUA 3G8YA 4BQIA 2HH9A 4JLBA 4YUZA 5M7EA 2R60A 1SBZA 3KOUA 1EFVA 4Q3LA 1L5RA 3B7WA 4DLPA 1KMHA 4M76B 1JYSA 2X0JA 2FPPB 1W1UA 4K9DA 4MUJA 1QQ7A 5HZKA 4IDOA 2WT8A 2BFEA 2FQXA 4P5EA 3NHKA 4F5EA 4DR1B 4DR6B 1UKVY 3I58A 5K0EA 3ABSB 3BZWA 1N4AA 2OFFA 3SE7A 5A5DA 2EFEB 3TFOA 3G0GA 1KWGA 2NXCA 1J0CA 5EERA 3AI1A 2ENUA 4JCOA 4JASB 2LTAA 3LQKA 4V2UA 4UD6A 4A6XA 1NP7A 2APJA 1H1LA 4UBJA 2GM4A 1YZHA 2WYOA 4COKA 3EDQA 3ONFA 4BMVA 3EF1A 3GJ0A 3BXFA 3Q7IA 3MTEA 1P3DA 3OJCA 4R81A 4BX0A 4F6CA 1UODA 3AVUA 1V95A 1Y6RA 1KAQA 4QPDA 5HM8A 4RJKA 4XIGS 1VYTA 3SYNA 4ZKEA 5LB4A 2DM6A 4DNPA 3FD8A 4G5XA 4UNSA 4F21A 1COWA 4FMCB 4J7AA 4OLBA 1NP6A 1U99A 3H0CA 1QRUA 3RRNA 1TXGA 4PG6A 2GESA 4R2IA 2V3CC 2FN4A 4BZWA 1AA6A 3DW3X 2H0AA 1EHCA 2AOUB 2HWXA 2VZ8A 4G4SO 3LCJA 5D7NA 4DAOA 1X7YA 5KYXA 3Q2OA 3R2JA 4FKZA 2ZBDA 5AJHA 2CCGA 1EJ6A 2QTLA 2TMKA 4IGKA 3STHA 3W2GA 3GRCA 4P0PB 4IOKA 3OU7A 4YRPA 3C1TA 2GYWA 4W5JA 3ZHYA 3K2EA 5JTTA 1T5LA 2YWRA 1K6XA 3FHCB 4IIXA 4LHEA 1HZJA 3N76A 4RHFA 2V7PA 5CDYA 3M3PA 1JLMA 1JA0A 2HMVA 3G8CA 3WK9A 3Q7RA 4NCBA 1ZIYA 5SZIA 4M86A 1MFPA 2CNWA 1FXUA 2H7YA 4JROA 4MI6A 3HCDA 4GKVA 5FLKA 5AIBA 3KVNA 1ZSYA 1A8SA 2IEAA 3FXAA 4G0ZA 4TWZA 4DVJA 4YMVA 2CMKA 5C1OA 2IH4A 1Q6ZA 2A9PA 5TE9A 2BGMA 2C1ZA 3EOZA 3S70A 1J2UA 4JVNA 4OH1A 2J3IA 3PEVA 3VOBA 4LYEA 5KVSA 2ZE7A 3U4IA 3ELWA 4EY8A 3U6BA 3IV7A 1FMTA 1SQSA 5HKBA 4OQXA 4R5MA 3OJFA 1TVKB 3SF8A 1Z16A 3TIXB 4JC8A 1I32A 1L5OA 1MD9A 2CBXA 1R16A 1WNTA 1T5DX 2PLNA 2O19A 1NNUA 1I10A 2X7XA 1DX9A 2PFGA 1IJEA 5GOTA 4LCEA 1UPBA 3HUEA 2BI4A 4PCUA 4ZTZB 1AHNA 4A5OA 5KINB 3H5RA 3KJGA 4E51A 3B3FA 4Y0AA 4YI3A 1JG3A 4KRXA 1Y4ZA 4B6JA 1YVEI 1O94C 1UOEA 2P9QA 3JX9A 2HW8A 5EPOA 5IW8A 4JR1A 2QX6A 1E66A 3GJ6A 4JJIA 4ZJZA 3U1BA 1DQRA 4XR4A 4URVR 4R8VA 1C1XB 2QVGA 1NQWA 3RSCA 1KI9A 5ERYA 3E7DA 3SU8A 4C4PA 2KSQA 3C8UA 3EBOA 4RVNA 1U9CA 2QIOA 3GC6A 5FAKA 3UJ6A 1G5PA 1HOXA 1TZBA 3C14C 3MT8A 3JQ7B 4MR9A 1BMQA 3MSCA 5DB4A 4UE3S 3L6RA 4ZAWA 1RJFA 4RK1A 5CB4F 2BGJA 4CKCB 4Z4FA 1X14A 3C3MA 2N47A 1K63A 4JA2A 3ZE7A 3UB3A 4QASA 1ABEA 1QBKC 2DPHA 3BB3A 2CC2A 4KXXA 3SD7A 5DHPA 4JXJA 2DVMA 4PN7A 2ZAOA 3DB1A 5AT1A 1UEXC 3SS9X 3R8XA 4FNOA 4MITA 5CHEA 3OIYA 3HJRA 3LTEA 3T1HB 4ZC8A 3GQBB 3GOQA 5B36A 4H7HA 2HNBA 4AJ2A 1NBME 1MDFA 1K3UB 1C9DB 2XUPA 2Z0MA 3FJ1A 3IPYA 4AJJA 1O5OA 1I2ZA 1O87A 3EC1A 3K96A 3SGLA 2FSGA 2JGKA 4RPLA 1SUBA 3KT6A 1Q17A 4L75A 5E1MA 5T6BA 4JFRA 3OEYA 4AVYA 1RLIA 4EA9A 2Y68A 3TTSA 1FVOA 2YJ3A 3H05A 7AT1A 1BEZA 3TRJA 3L6DA 4BEBA 3GLIB 4WFKA 1IXSB 1YB1A 1MTZA 2AB0A 2XODA 1PFGA 4FIZA 1Y4AE 1ONBA 1IN4A 1M8KA 1QLHA 4PIPA 5HYVA 1Z2OX 3PIDA 3DCYA 4S2EA 1YTUA 1VL5A 4WKNA 2A14A 3ZZTA 1PW7A 4BZXA 1W0JD 3HEBA 4KXLA 4R5HA 3NC1C 1N7JA 3A2LA 3C1OA 2AE2A 1E0KA 1PS9A 2YV1A 1EZ1A 4G1UC 2IYUA 1NW6A 3QLJA 1L5NA 5F2NA 2CJXA 2FPIB 4QDZA 4ONEA 3ND6A 4ZOEA 4X6XA 3G5MA 1EFKA 2O2CA 4H7FA 5K2OA 3WIOA 3IUJA 2BM8A 3CW8X 4FB4A 3BCRA 3OUTA 4HEJA 5T4HA 1L5HA 3ADKA 1XJQA 1Y1SA 2DUMA 3MGKA 1E3MA 2VHUA 4MVJG 4D6YA 2UUCB 2PT6A 4TKVB 3EXG1 3W0LB 3WP1B 1LPSA 4LVOA 5WRFA 1QIEA 3HUTA 3AUXA 4BB5A 1G8PA 1L4LA 1PWZA 1EBUA 2FP4A 1W94A 1YHYA 1GKIA 2HD4A 2Y1FA 3NPMA 3TGWA 5HJ5A 2I91A 1P2VA 2A35A 1SG6A 1FSGA 3UFXB 1A1VA 4WZZA 5I9BA 5KAPA 2B6HA 4XWOA 1PD1A 4MQ6A 4BX9A 4R2KA 1J25A 1W85B 2A9QA 4NH0A 3ZV7A 3MWDA 2QMOA 4CMIA 3I6ZA 5DH9A 3DO6A 1H8EA 1OAOC 2IYVA 5JBNA 3IPLA 4EZBA 3IALA 1DKOA 2DFNA 1X1TA 1JDZA 4RJIA 2FW1A 1VE3A 2HM7A 3A1TA 4JBXA 1X2BA 4JX9A 5BSGA 5KDLA 1V5GA 4CQJA 2R6CA 2WMYA 3D0QA 4N5IX 4RL4A 4MMZB 1TQDA 4ZRNA 3I23A 1NXVA 4ESVA 5ARBA 1SY7A 5A4AA 5L4LA 4Z4IA 1W4BA 2Z2IA 2X0RA 4TZ0A 3DUWA 4YP6A 4BO3A 4YIKA 1L7DA 3ZY4A 4CLRA 2GXAA 5C8XA 2UYYA 1Z25A 1U04A 4AG6A 2J8ZA 2HC9A 1SB9A 5DBFA 2ZOSA 4BMZA 4ENPA 2XB9A 2W71A 3IVXA 3VR1A 3ENWA 2G06A 2I3BA 3HGQA 2VOEA 1UBKS 3H42B 3ROZA 3AJRA 3PC2A 2WZCA 4OY3A 5D1HA 4Q4HB 1QZXA 3WKDA 4NCXA 1FRNA 1FFSA 2OXIA 1YV9A 2FFAA 3GJ4A 2BFNA 5CCEA 5IEJA 1ECPA 4KR7A 3DHNA 1CNMA 4R1PA 5AW8A 3NT4A 3LF2A 4MYRA 4O2LA 2O8EA 3UV7A 2WKPA 3ANLA 3VVMA 2KYRA 3M5WA 1OVMA 3LUGA 2Y4NA 1SZDA 4QDXA 2HL6A 1EFPB 3PX2A 1CRZA 1Q12A 1L4FA 4EO9A 4MR7A 1W5EA 3SQWA 2GEBA 4HGYA 4BNGA 3BHNA 1Z7BA 2AFIE 2W70A 1R9MA 1BKDR 1F7UA 2W2OA 2A30A 3CR8A 4ZU6X 4MDEA 4X90A 3NEPX 3NHMA 2C4HA 5BSRA 2D7DA 2BD0A 3I2FA 1CZKA 4PLZA 5BORA 4JJEA 4BRUA 1DUVG 2FMUA 2IX3A 3FYDA 3PUYA 4C7VA 3FETA 1O5IA 3R40A 3RS9A 5HDBB 1PQPA 1HSZA 2ID7A 5EJ4A 1ANKA 1HK7A 3NU1A 4FDAA 4HH0A 4HNAA 1E7QA 3L4BA 3AOEA 1GTVA 2NO9A 4MLCA 1L3IA 4Y30A 3UWMA 1QV9A 1R6VA 2QX7A 3HA3A 2D0OB 3U4AA 4WCFC 3TS1A 4QG3A 3EARA 5C8ZA 5EJAA 4G65A 4YPFA 1PUJA 5IAEA 4AL4A 2C3UA 3EG9B 1V96A 1KH2A 2EZ4A 3CVYA 5DN6D 4MSUA 3T61A 3HNOA 1U2DA 3C6ZA 1G3UA 3ZD6A 2R8RA 2V03A 3N8HA 1VIDA 3V2IA 3L84A 2VTBB 3QUQA 3E9MA 2EGGA 4A5SA 5KVCA 3F78A 4IDCA 2GF9A 5D2CA 1DAHA 1XZPA 1MENA 2Q5JA 1USWA 3AB8A 5KTTA 1WXIA 3UK0A 3L2OB 1N3IA 1FFGA 1CFZA 1ZOPA 4IGFA 4PZAA 4UPVA 3TB6A 1FDSA 5A02A 1G59A 5E8JA 1GLVA 1O1YA 1Y9EA 5L53A 3ECAA 1YUBA 1P8JA 4CPDA 3WLRA 3NAQA 5B30A 1PYOA 3EIHA 1RS0A 3WZ2A 3RC7A 1YOVA 5EUQB 3VH1A 4LRUA 2JFHA 3TCKA 1PRYA 1K88A 1R9JA 1JHVA 3LLCA 3PHBE 4MQ4A 3COSA 4L3OA 3VU0A 3LVRE 3UHAA 1C7JA 3FMGA 2JFQA 4GWGA 1FP4B 5HUJA 1T3HA 4KITB 1GFSA 2YNMD 2C82A 3TR6A 4F2DA 1IZYA 1RPJA 3CH6A 4PLFA 1G6Q1 3FYUA 3LECA 4GT1A 2MSWA 1MH1A 5F2EA 2KLBA 2PGXA 1SHTX 2J08A 5AQ1A 4FKMA 5KWIA 4XWTA 1E9EA 3W2IA 3F74A 2YDYA 3I6IA 5ISMA 3AJDA 3IPAA 4NOJA 1J33A 4JJFA 5F51A 1K5PA 4WK4B 1UFRA 3I9LA 2TRSB 4GZLA 2ARKA 3FGZA 2IZZA 2BY4A 3FWZA 5FTMA 3S1AB 5KX5F 3LCUA 2Q3FA 2GF0A 5CA0B 4L2IA 1MUUA 3O31A 1QZUA 2QY6A 4EG1A 3CF6R 5IKXA 5ECGC 6GPBA 2WF8A 2NO1A 1D8AA 3LI2A 1GAQA 1DC8A 2CJPA 5L3QB 1BDJA 1BOFA 4K9MA 2CXSA 1TUEA 2G4LA 2WB4A 1KZ6A 1BD3A 4HGZA 5DM4A 1J4AA 1R5NA 2PEYA 3NBFA 5E0OA 4BMNA 3KKMA 2CXOA 3QJ5A 1MOSA 3T8YA 2BBWA 1W4AA 2X6TA 5FOVA 2AR0A 2OPBA 4QJ4A 3O1IC 3L4JA 1EAMA 3SOPA 3G5LA 3ZYZA 2OMEA 2B82A 2GILA 2PTGA 1NC1A 3HRHA 2WHYA 3P19A 4HNHA 5LQKA 4P7GA 5BN3A 3OH8A