4HAWA

Crystal structure of crm1 inhibitor leptomycin b in complex with crm1(k548a)-ran-ranbp1
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
208
structure length
196
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/antibiotic
total genus 56
structure length 196
sequence length 208
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hawA00
4PHFA 4LBVA 3ZYCA 1FTSA 1G3UA 4JBYA 4HB0A 4Q4LA 3BJIC 2X2FA 1Z0AA 1KI4A 1O3YA 1G8PA 3CZPA 2ZUBA 1AQUA 1VIYA 4AYTA 3B1YA 1JJ7A 1TQDA 1SULA 2LWIA 4PXAA 1KDTA 4TYPA 3X1DA 1BOFA 1E0KA 2IW3A 3WMGA 2VHCA 1Z06A 4RY2A 3TUIC 3BB3A 1XMIA 1WDTA 1YVDA 3OIWA 5B2ZA 1A7JA 1DAGA 2FPMA 5KDDA 4XOIA 1VPLA 2J0QA 3GP8A 2IXEA 3A1WA 5A0FA 1N5KA 2D4HA 2IYXA 4LYFA 3TSZA 3WY9A 5AUNB 1LF5A 2HJGA 2YOGA 1XXHB 4DUGA 4HLUA 2UKDA 4X8LA 5JI2E 4CRWB 3ZZTA 1G41A 4MDFA 2R6CA 3SYNA 3CR8A 3QKTA 4IOLA 1NG1A 1QHXA 2QGNA 3DO6A 5C46F 5BN4A 3EZ7A 3TJZA 5TB5A 3QF4A 1N2CE 5KPJA 3U4QA 3VR2A 4WXRA 4OI2A 4V0OA 2QTVB 2P5TB 3MWJA 4CT4B 2F43A 2XGJA 5DH9A 3OIUA 2MSDB 3N2IA 2FPLA 2AWNA 3FYHA 5HE8A 4XTRA 3K70D 1NBMD 3BD9A 4YDSA 1GVNB 2FMXA 4POAA 2WSSA 3P4YA 2ZAOA 3LW7A 4CZ2A 1EX7A 1F48A 1BIFA 3TR0A 3GLGE 1IOZA 4RSGA 2OAP1 3M0EA 1NN3A 2CCGA 4QNMA 1KSHA 1Q22A 2EYQA 1VCNA 3K8YA 4EAQA 4EFLA 3GFTA 4FCTA 4LZZA 1NN0A 1IY1A 1II8B 2ZRHA 5CITA 5JWOA 3FMPB 1SXJA 3AQ4A 3KQLA 4PC1A 2V9PA 1E2EA 3AVOA 2F9MA 3RDPA 4BRUA 2ZR0A 2V7QA 2XTZA 1E79A 2NZJA 2QMHA 2AD1A 4GZLA 2X1VA 3B13B 2J41A 3QNUA 5IHPA 3GLFA 1XRJA 4DDVA 1EFCA 2GXUA 4ZPXA 4JVSB 4TTQA 3NBXX 5P21A 2H18A 4URUR 4DLUA 2JJ8A 2WWGA 4H9GA 4MGKR 5FI1B 1LS1A 4CEIA 1TADA 4Q4AB 2FSIA 3LXXA 1E2FA 5FOSA 4DSTA 4TYNA 2RAPA 4LPKA 1MO6A 2CCJA 4BEBA 1NMXA 3OF5A 2WMNB 2I4IA 1W5TA 1BO6A 1QHGA 4BFSA 5DNYB 1XTRA 3IGFA 1UEIA 3MJHA 3IPXA 5G40A 6Q21A 2FF7A 3LX8A 5JS7A 5JWRA 5M04A 3NIBA 3SFZA 5E95A 5CYOA 2BOVA 1GNPA 3EA0A 1LY1A 2FGJA 1LF0A 1FTNA 2ORVA 3ZIAA 2KSQA 3A1SA 2GAAA 2CLDX 1S0UA 2F1JA 4GOJA 2R9VA 3WNDA 4D0GA 1GRRA 1IN4A 2QSZA 4URXR 4MRNA 1IHUA 4RD4A 3TK1A 4TLCA 4D0NA 2OG2A 3TSOA 1FW6A 2FOLA 4KAXA 2HLDA 3Q3JB 3CM0A 1GITA 2FFAA 4IVRA 2KB0A 4GDFA 3AVWA 1E2DA 1Q44A 3NDBB 3EX7C 4Q48A 2ZROA 4M1YA 3QSYA 5AJXA 4N3NA 3Q7QA 4OBEA 3AKEA 4P0TA 4PPFA 2CVFA 1UKVY 2ZQ5A 3KQKA 3KXKA 4MRRA 2PZFA 1NIPA 5SZJA 3FFBA 2RGBA 1JALA 3EZFA 4LPSA 1NG9A 2VBCA 1QZXA 2J0UA 4FCVA 4OJQA 1OFHA 3EG5A 1GL9B 1U9IC 4A6PA 3Q72A 1A1VA 3K9GA 1GRQA 4FMCF 4P4TA 3EZ6A 1E0SA 1KJZA 1N0WA 1Z28A 4HAWA 2O8FB 2PH1A 2F1RA 3GEIA 3E1SA 2QZ4A 2VSFA 2PL3A 4GBMA 4PAOA 4QM7A 2ONKA 1ZCBA 4Q47A 2O52A 3EARA 1N3BA 3QKSB 1P61B 3L0OA 2GXQA 4NPHA 3AVTA 4PC6A 1E99A 3GJ4A 1U99A 4JLOA 5L3VA 1UFQA 1SQ5A 2VHQA 5JJKA 2PZGA 3HYRA 2GXSA 3LNCA 2J3EA 3D8BA 2WAXA 2J7KA 4MGIR 4QJ5A 2GJ8A 2YJTD 3K09C 1OV4A 4U00A 1N6HA 2FA9A 3U7GA 4X8OA 3FHOA 4KODA 2GRJA 2OZEA 3SNHA 1OIXA 1TQ6A 1Q3TA 1XU4A 1KO4A 2B8TA 2DFNA 3VNVA 2BBOA 3KKNA 1VG0B 1ESMA 3ZDQA 2V1UA 1E2QA 2ZRKA 2ZTSA 3RS0A 1F60A 5E7MA 5FI0B 2FX3A 3ICQB 2ZJZA 4PSVA 3LVRE 4LBYA 4C2UA 4M1MA 2D2FA 4NYIR 3EZ9A 2WWFA 4JL8A 1W0KD 3IIJA 3E70C 1UEJA 1W5SA 1ZU5A 3IO5A 4URZR 1RIFA 2R6DA 1FNMA 1GUAA 2RB4A 1EFRA 1CJVC 3I92A 1DAKA 1FMLA 4JLNA 3RYTC 2BJWA 2X8AA 1TQ4A 1Q3HA 2CL6X 4MYHA 4M1SA 1P5ZB 4Q4HB 2GHIA 4NHOA 1EK0A 2QAGC 4U02A 1OIWA 3CF0A 1E98A 4U7DA 4ZCMA 1ODFA 4KSBA 5JBQA 3QEOA 2OV2A 1F2UA 4C4PA 1W46A 1Z0DA 2JLXA 1RYHA 2XAUA 3HR8A 3QKRB 3W6NA 5EQTA 2ZI3A 4BZXA 4D6PA 5KYKA 2WIBA 4Q7LA 2F3RA 3T35A 4H1VA 1E0JA 2FN4A 2VA8A 2ZEJA 1ZM3A 4XVUA 4CEHB 3GJXC 5CIWA 1CBUA 2WJIA 4TT3D 3IEUA 2WBLC 1J8YF 1WBDA 1UBEA 2W00A 3VR5A 2JLYA 4US0R 1HYQA 3LY5A 3PEYA 4MITA 3DL0A 1OH6A 1VYUA 2A5JA 4D26A 5E7JA 4ZKDA 1T8UA 4BFVA 3R9WA 3SHFA 3QXSA 1YQTA 2W58A 1TX4B 4AURA 1YR8A 3PJRA 3CPJB 1RFLA 1T91A 4D2IA 4M1OA 3QY0A 4B6FA 3ADKA 3U5ZB 1TF7A 1C4OA 3QPWA 4JT2A 3LBNA 1OFIA 2ZI7A 3LDAA 5FBVB 1A5TA 1CR1A 4KLZA 5L8VA 4Z51A 2EQBA 2BKUA 1IJFA 3I8SA 4FXPA 2A7QA 3BC1A 1GL7A 2VSOA 1HV8A 5DN6D 3C8UA 2IA5A 3K0FA 5A4JA 5KSYA 1FQJA 1WE2A 2GBLC 4MKGA 4WW0A 1Q1ZA 1TU4A 3LBIA 1Z6XA 2IXFA 3EIQA 4RD3A 5DHAA 1TPZA 2V1XA 4RZUA 1NIJA 3SE0A 1ELOA 4CT5A 3FKSA 3KQNA 3RRNA 4G1UC 5L3QB 4NH0A 4IKEA 2FJUA 4B33A 4ERNA 4NU0A 5G41A 1VDZA 2ZYTX 4MQBA 1FUUA 1WP9A 3QXXA 3VHLB 1SVWA 2JLSA 4MKHA 3KQHA 4RCYA 2JA1A 4OK5A 2GKSA 4PQRA 3VKGA 2O5VA 1G3QA 1AGPA 1EX6A 1VG8A 4EFMA 5BYKA 1R5OA 3LD9A 1P3JA 1XEXB 1DADA 1MRNA 2IYUA 4KFTA 4CEJB 3CNOA 1S4QA 1IY0A 2AK2A 2QAGB 2CK3A 2X19A 5CLQA 2H17A 5AUQA 4DZZA 2O8EB 3DZ8A 1YRBA 4GP6A 3CKLA 4TYYA 3P26A 3OEHA 4Q66C 4HB3A 1XTQA 2OLJA 3A1UA 2FSHA 2ZR9A 1GTVA 1R7RA 2QSYA 4B2LA 5EXPA 4IDNA 1T0JB 4H1UA 4DSNA 2AHOA 2GEDA 1RRCA 4UXJA 5FPSA 4URWR 2NQ2C 2XNDA 5J5CA 4B3FX 4PHHA 1ZAKA 5GADl 1XF9A 4Q4JA 4LRWA 5C2JB 1HA3A 3KUDA 3HU1A 3O8RA 1IXRC 1TMKA 1X1SA 1XD2A 5EXTA 4DB4A 4TSFA 4ZDKA 1ZNYA 4BLOA 4O2LA 3I8XA 5CDFA 4TN1A 3EIEA 4JL5A 4DLYA 3THXB 4JYCA 3DKPA 1P2TA 2MSCB 5FFMA 3JVVA 5KO2A 1Z8FA 3U6KA 1E2HA 4TYQA 4KITB 3AUYA 5EP2A 1NVVR 1DG3A 4TL7A 4KV9A 4HAXA 3CX7A 3N2EA 2HXYA 2O8DA 2MMCA 2EFCB 2CLSA 1H8ED 1S8FA 1QHNA 2IYSA 2OLKA 4B3BA 4NYJQ 4P33A 4BZPA 1HT2E 1GNRA 4ITRC 5AJYA 1OSNA 1Z5ZA 2REBA 5FUWA 3I62A 5GVSA 5CB8A 1XFAA 5E4FA 4YMTA 4JVLA 4I1VA 1ANKA 2CE7A 1AQYA 4WOPA 4Q9KA 5AR1A 1T9HA 4B2PA 3CBQA 3QUSA 1JB1A 1KNQA 3OEED 4KI0A 3QI2A 2Z83A 4MRPA 5EXXA 4EIWA 1XP8A 1S3SA 1RJ9B 1YHNA 1XCGB 2QM7A 3PUYA 1M8PA 3C4JA 1HURA 1JQJC 1OXVA 3MMPA 5KPDA 4RD1A 5CYPA 2ZR7A 3SDZA 2AXPA 3RWMB 1E32A 4LYJA 5AUPB 1UBGA 5HZKA 1N6RA 3RS4A 3DZDA 4P4SA 5JS8A 2ERXA 4TMXA 3NHBA 3SR0A 4DCVA 1A82A 1T6NA 1ZNWA 1G3IA 3Q7PA 3HU3A 5J4KA 2XTNA 4A0GA 1D6JA 2C77A 1H65A 4BLPA 2XXAB 2B8WA 4KVGA 2GA8A 4O0MA 4RFVA 3NTUA 2OCAA 1ZUIA 2RGNC 4EDHA 1E2PA 4QOSA 3P32A 2KJQA 4QGAA 2DCUA 4JS0A 1GRNA 4ARZB 4GNKA 3TBKA 1MKYA 1BKDR 1OB5A 4RKEA 4PAMA 1Q1EA 2ZSEA 4B35A 3BERA 3AEZA 3KQUA 1FX0B 2BM0A 4UNSA 3MCAA 5DI3B 2BCGY 2GCOA 4HUTA 1YZLA 3TGPA 3KJEA 1R5NA 4C7OB 4RD2A 3X1XA 5L3SB 5DHFA 3GLIB 4QC2A 2C04A 1P4SA 2C8VA 3CZQA 4PZYA 1GAJA 4BE7B 4D4JA 2RGGA 4LSGA 2IBMA 3B9QA 1GDDA 2J59A 2ZJAA 1R0ZA 2ZRIA 4MGYR 5JHGB 1A2BA 2VEDA 1NP6A 1WXQA 4KFSA 3GLHB 3TQCA 1NVUQ 3G0HA 3RS5A 2C78A 2ZJYA 1ZD1A 3R8FA 3L0SA 4DHEA 1R0XA 2OM2A 4D82A 4EUNA 1W1WA 3NWJA 3RWOA 3TW8B 1KJYA 2Q9CA 2ZPTX 3BIFA 1KMQA 4MYTA 2OFOA 2QMUA 4UXIA 1JECA 3L82B 3QG5A 3K9NA 2VPPA 4JZKA 1JAIA 2RGXA 4OK6A 3W8RA 5JHHB 1UPTA 5D3QA 1EG7A 5JRJA 5EE3A 3THYA 3KXLA 1OXUA 1KOFA 4URYR 1MABB 1NLZA 4BLSA 4UJ3A 2NG1A 2C9CA 3VKWA 4HDCA 1WBBA 3TAUA 1BMFD 2P6RA 4MRVA 3DVLA 3ZS8A 1MV5A 1E94E 2JLQA 2O0HA 4TYWA 1NKTA 1QVRA 3UIEA 2C95A 1KNXA 3X1WA 3DOFA 3FMIA 1ZYUA 4E22A 3PUWA 4HLCA 1R6BX 2QBYB 3SBEA 3CUEF 1FUKA 3PQCA 1OB2A 3IIMA 1G20E 2CDNA 3WBKA 2VP6A 1AN0A 2AN9A 1XCMA 1N6NA 2OE2A 2Z43A 4PZZA 4B74A 4B73A 4PSKA 1XEFA 3P27A 3UKDA 3NEJA 4QGGA 1D2NA 1X8JA 3ZVRA 3AF2A 2CHGA 2ZJ2A 4ZCLA 4LUCA 5CDFE 1OYWA 2AL7A 1DS6A 4W5WA 2XZOA 4A2PA 2ZXUA 4EJSA 2F6RA 4BLQA 4XIGS 4HZUA 2I3BA 2IC5A 3FWYA 4LJ6A 2HT6A 4YXWA 4NP6A 3KB2A 4HAVA 3MGCA 3IUYA 2IYRA 1HTWA 2NTYC 3MUFA 4K8OA 2GJ9A 1L8QA 4ZIRB 4ASUA 1JXMA 1YZQA 4N1AA 3VX3A 1WCV1 1KZGB 2CJWB 2GEUA 3EIHA 1KMHA 1Z83A 3KJGA 5LDDC 2P3SA 2RGCA 2OFXA 4V02A 3K0SA 3RRMA 3TRFA 3PEVA 4MGZR 1TF2A 2ZE8A 3O47A 3RLFA 4D4LA 3TAHA 4V03A 2E1RA 4HUQB 2WIAA 1E9DA 3TLXA 5FTKA 2XEXA 3I4LA 1W0JD 3RS3A 3IQWA 1JR6A 3FB4A 4HLQB 5GVRA 1WMSA 3Q8XB 2PT7A 4QHYA 1XXHE 5IRCD 1V5WA 2NO7A 3BRWD 4DLRA 3K0AA 4ZI3A 1DELA 4E07A 2JGNA 1WB9A 3KTAA 4UQOA 3EC1A 4HZIA 4D4MA 2QL6A 4G5RA 3CWZA 3KDSE 1J70A 3V00A 4TLDA 4PR0A 1ZMXA 4JKYA 2ZRLA 1UJ2A 2JDIA 1YZNA 4IW3B 1KI3A 2JJ2A 1FFHA 3WRXC 3UG6A 4ILEA 2IYLD 2OCBA 4GMDA 1U0JA 3U60B 4RFSB 4DLVA 5IF9A 3H1TA 3U61B 1L4YA 4LJYA 2UZ3A 4U5XA 1A2KC 1NVWQ 4A9AA 2ZSDA 2W6JA 2EW1A 3A4NA 4HAZA 2JLRA 4MUAA 3HWSA 4M1WA 3KKQA 3MLEA 1ZIOA 5KHOC 2G77B 4OHYA 1N6OA 4PSAA 1KK1A 4Q5IA 4XWOA 2NIPA 5FOWA 3SFVA 3BH6A 4C0JA 3VU9A 4AKHA 2ZREA 4C0HA 4ESVA 3RS2A 4Q9JA 2BCJQ 2IYVA 3AUXA 4D81A 1JQLB 1MOZA 2REXB 2QPOA 1Z6TA 1WA5A 4MYUA 1AM4D 1E2GA 4BGDA 1TNDA 1JR3D 1KO1A 2G1KA 1TAGA 2NO1A 1IJEA 1K5GA 1AA9A 1OLOA 2NO6A 3ZS9A 1M7BA 2CNWA 3SS8A 1Z6YA 2A5GA 3TVDA 4DDUA 1KY2A 4WA7A 3R9IA 2VP5A 1E1RA 2BMEA 2KI5A 4KSCA 3FE2A 1NMYA 1AS3A 1NMZA 4G5SA 2QGZA 3QQ5A 3LAWA 4KVAA 4OHWA 4QBIA 3T5DA 4S2EA 4OQXA 5A5GA 1E96A 2ZVPX 1ZUHA 1D9XA 2AKAB 2CHVA 2MMGA 5FTMA 2WOOA 4JIMA 4XWAA 2OBMA 4KYUA 4M4SA 2C5LA 1KSGA 1QHYA 1SVSA 3N5CA 2ZYWX 1G21E 2DWOA 1CEEA 4DEXA 2EU8A 4KLNA 3U3MA 4F92B 2XJ4A 4W9MC 1BYUA 2G6BA 1RRFA 2W2TA 4IVPA 1K5DA 1M74A 1XTKA 4NYMR 1CR4A 4XD7A 3D7MA 5FPHA 5C4MA 2N1BA 2ZRNA 4WZ6A 4TQ9A 3WMEA 1E9FA 2IXGA 3CB4A 2J7PA 2JJ1D 3QG1A 1HH4A 3OE7A 2ZS9A 3AVQA 2GETA 2O8CB 4ZCIA 3R8CA 3OFNA 1T5IA 2FSFA 1ZW6A 1GP2A 4C9BA 3E5HA 3K70B 2AD5A 4AG5A 4B48A 2PX3A 2ZJBA 3TH5A 4A0RA 4KJZA 1E1QA 2JEOA 3DPUA 4PC7A 3RANA 2ZS8A 5L3QA 1IY2A 3ND9A 3MRSA 4PQFA 3SJCA 1US8B 5HKKA 5EZ6B 1E9AA 3GJ3A 2W2XA 2YOHA 2KE5A 1IN5A 5LPNA 5DGXA 2IHBA 2W6IA 4RCZA 1Q12A 4C0AC 2KBEA 4ON9A 3O8CA 1RRPA 3W5JA 3KX2A 3CRRA 1OH7A 3ZD7A 3THWB 2A78A 4ZKEA 1Q21A 5TXGA 1VHLA 4A36A 3NH9A 1OHHA 2XB2A 4Q1CA 2QA5A 2ZRJA 3ETLA 3Q85A 2ANBA 5HZHA 2ZI6A 4YMWA 5KNCA 4KBGA 3BFVA 1R4AA 2CMKA 2DR3A 2QMOA 3N70A 4LBZA 3UK6A 2F9LA 1E2MA 3UWKA 3V4RA 1HE1C 1H8HD 1ZU4A 4EPVA 3PEUA 4JLDA 3EWAA 1XD9A 1QBKC 2QROA 3RS7A 4AY2A 2YINC 5FR1A 5G3YA 2GWHA 1OKKA 5KNBA 4BFUA 1F2TB 1TEXA 4ESHA 3GJ8A 5ELXA 1KHTA 1G7SA 3K0CA 1GL6A 2NZ8A 5FL7D 3GJ7A 1Q57A 1IXSB 1CIPA 2Y8EA 2DYKA 1W4CA 1X3SA 2J5XA 5TV2A 3GLGB 4KYIB 3VR4A 3ZLJA 4NCKA 3KJHA 5DISB 4M9ZA 3B1VA 1RE0A 5EE9A 2YOFA 4NYJR 1EFUA 2V6IA 5KSPA 5FBWB 2VH5R 1Q0UA 5DYGA 4DEYA 4US1R 1PLJA 1T3LA 2G83A 2KBFA 3UWOA 2UZIR 4OHVA 2P6NA 4X8MA 2QQEA 4A8JA 2ATXA 3C41J 2GJSA 2IYYA 2FPKA 3KFVA 3LWNA 1COWD 2XSZD 4GI7A 4GMXA 3AVXA 2WPDA 1SGWA 3HP1A 2G3YA 3LV8A 4LHXA 4EPYA 4JSYA 3AM1A 1ZIPA 3SQXA 1E9CA 2IL1A 1QG4A 2D2EA 2RHDA 2FZLA 3CPHA 4Q1DA 4HLUC 3VR1A 421PA 1WF3A 3CRQA 1N25A 2QPAA 4Q1AA 1G8FA 3B78A 3F0TA 3QPVA 3NVAA 4M1TA 5FL3A 2HYDA 2D7DA 1P2VA 2GZHA 1QHSA 4IFEA 4A82A 2C96A 2OFWA 2ZRAA 5JMTA 1N0VC 3T5GA 1W4BA 2HF8A 5D3MB 1CJTC 3ONWA 4Z1MA 2IWHA 2Q3FA 4LDJA 2QP3A 2EFGA 1KKLA 1X86B 3W34A 3HDTA 4PO8A 1E9SA 3KL4A 2HCBA 1NN5A 1ZM9A 4C30A 1KTVA 2QENA 4PPQA 2XTMA 1PLKA 5FOVA 2EFHB 1UADA 1E2KA 4BFTA 4OI1A 3AVUA 4PAQA 1CLUA 3CIOA 2XXAA 3S1AA 4XVQA 5J4YA 2DFKB 1XTIA 1JPNA 1NVXQ 4QGHA 3FMFA 3HU2A 3T34A 5GJVC 2IF2A 4HB4A 4DLSA 4V0LA 3BWDD 2VP2A 1N5LA 2RGEA 4IOMA 3FHCB 3LRPA 5G53C 3UANA 2YHSA 4ARZA 1XMJA 2WM9B 3KKPA 1W2GA 1TUIA 1VHTA 5KTYA 2P6UA 2YKGA 4OQMA 4OHZA 3TUJC 3EPKA 1IQPA 1G16A 3CR7A 1SXJC 4FMDF 2WAYA 5DI3A 4B3GA 2YWHA 5B30A 3GD7A 2J1LA 1SVOA 3IEVA 3A37A 4C7OA 2BWJA 1XD8A 5L3SA 4I1OA 2ECKA 3QVUA 4GZMA 4G5QA 2FEOA 2ZETA 3ZVMA 1D9ZA 3EPLA 4P32A 2P67A 4AYWA 4O25A 4DKXA 4DUGD 5IK2A 4E09A 2ZI5A 2O8BA 3EW9A 1JNYA 4OK3A 4F7WA 1JEDA 3SBDA 3T1VA 3C7KA 3SJZA 1LV7A 4BRWA 4P3YA 5TVKA 3CNLA 4MYCA 4Z54A 1AZSC 2XOKA 3GJ0A 4A2QA 1HQCA 5KOYA 1ETUA 1BYIA 1U8ZA 4O2RA 4GL2A 1ZVQA 1II0A 4NTZA 2VF7A 3F8TA 1JPJA 5LB4A 2OILA 2YWEA 2WSSD 2B6HA 2FG5A 2NPIA 2AFIE 2JIZA 2QG6A 2JLZA 2QRNA 4I4LA 3VKHA 4LV8B 3DMDA 2VHJA 2Z4SA 1N6LA 4XD7D 4KHZA 3QF4B 3U4QB 4C2TA 2ZRMA 1Y3AA 4EQ6A 5KNDA 3K0EA 3B60A 3EXAA 3NKVA 2CLCX 2VHUA 2XITA 3D3QA 4HDQB 4FWTA 3ZVNA 2BEJA 2QNRA 4LJ5A 3LFUA 1G3MA 1SXJD 2ZE5A 2XNSA 3DMNA 4IEIA 1QHHA 4LYAA 2PZEA 2QEQA 3I32A 4F38A 1PVOA 5TMPA 2AR7A 2R44A 2QI9C 1DAMA 3SYKA 4HATA 5JWHA 2V7QD 4C0BA 3EAQA 1E79D 2ZYUX 4AC9A 4KCGA 4C0LA 5HKKD 5IDVA 2JLUA 5IT5A 2JLVA 1ZNZA 2D7CA 4LV6A 4XTCS 3D6TB 1DAEA 3W3ZB 3OHMA 3PENA 1U8YA 3WYAA 3DM9B 1N6KA 2ZRGA 3U3OA 3PR1A 5JSZA 3ZZUA 5BN3A 2EYUA 1YE8A 4JVNA 5AJWA 4B32A 3U44A 1SXJB 3A6PC 2H57A 1KGDA 1OW3B 4AKGA 1KO8A 4MH0R 3OAAA 3AVVA 1MO3A 3QPUA 4BASA 2L0XA 2GJKA 3DKVA 5AK0A 2PCLA 1NRJB 1BS1A 1GOTA 221PA 2WJGA 1AZTA 4JLMA 5B64A 2R6GA 1KAGA 3REGA 2EFEB 2GILA 1I4LD 4II7A 3FPAA 2A30A 1E9EA 3L43A 3GLFB 3Q9LA 3ZIAD 1OPXA 3X1YA 4TL8A 4BPBA 3TW4A 4TL9A 4CW7A 1SKQA 2ZU0C 1K8RA 3U6BA 1ZC3A 4M22A 4NCNA 1G17A 4EPRA 4AWXA 1II9A 4IOKA 4LJ8A 1AGRA 4NMMA 4LJ7A 3RNLA 3BB4A 3QF7A 2HLDD 4KXFB 4JLKA 4FMCB 2PT5A 4OI4A 1OT3A 1R0WA 1Z0IA 2QE7A 4A0HA 2CHQA 2H92A 4DDWA 4RFSA 3ADDA 4RD6A 1GKYA 2QTHA 2OCYC 4KO8A 5AJVB 4C3ZA 2Z0MA 1YRAA 4IDHA 4ZDIA 1G4AE 5FBQB 1LVGA 1P73A 3WNCA 3LW8A 4WXPA 1EXMA 5F3WB 1YU9A 5JCPA 2BKEA 1N6PA 5SZIA 3RC8A 3B1XA 2OBLA 3B1ZA 2VIIA 3K9HA 2G1JA 1DG1G 1KDOA 3C15C 2W0MA 3ASYA 1OXSC 1LW7A 2G88A 1ZRHA 2ZI4A 3GQBA 4DC9A 4JT4A 2NGRA 1KI7A 3NXSA 4C0SA 2AFHE 2ZM5A 2PJRA 4L16A 2G0TA 4LV5B 5F98A 1S9HA 1ZM4A 2CL7X 3GLIE 3M1IA 2AKYA 1D2EA 3NBYC 2J0UB 3CRW1 4PHGA 1G5RA 2OUKA 5HCIA 3ZQJA 2OSBA 1XXHA 3WYGA 1VECA 5BWMA 2GESA 5JI3E 2DWQA 1L7VC 3PUVA 3HPQA 1KI6B 3ZH9B 3F5FA 3JVUA 4YLGA 4BLTA 1U2RA 2WKPA 1I2MA 1Z0FA 4C0KA 5EE0A 3UXMA 3T1TA 1UKYA 4GPTA 2AXNA 2CVHA 3BH7A 2V6JA 4TMTA 3BFXA 3OIYA 4LJAA 2B7BA 3D31A 4YC7A 2F3TA 3WP1B 2QRZA 3B8HA 3FTQA 1Z6GA 4TMWA 3BAFA 2NO9A 5GJWC 3RSOA 5UKDA 1VG9B 1GG2A 2JAQA 4YMVA 1G8HA 3MG9A 1OH5A 2FE4A 1VCMA 3EPHA 2ZU6A 5H68A 1D5CA 1P9NA 2K5UA 3U7HB 5FTNA 3H0KA 2ZSAA 3BE4A 2DPXA 3I1FA 1ZM7A 1GM5A 4FWIB 1DO0A 2C99A 1ZUNB 3W9YA 2YWFA 1EWQA 3O8DA 1Z29A 1EFRD 4IOJA 1QG2A 2WWXA 1X8KA 4Q03A 2JCSA 2OBNA 2XX3A 4UNRA 4QHTA 3GJ5A 1HQYE 2WJJA 1II8A 5SZKB 3X1ZA 4DCNA 4V0NA 4JLJA 2D74A 2YNMA 4G5OA 2FZ4A 4GRAA 5H70A 4ZV4A 4ACAA 2H8KA 4K81B 1R8SA 1VIAA 2GNOA 1NBMA 4MKFA 3SQWA 1AKEA 1J99A 4FINA 4NONA 2J0SA 2OCPA 1AS0A 3TQFA 3WXMA 1KK3A 2VL7A 4BUJA 4RZXA 3AF3A 3UATA 2LCFA 1OYYA 1KIMA 1DARA 1NY5A 2GVZC 2ZSFA 3A4MA 1SKYB 2IYQA 3CLVA 3RRZA 3TKLA 1E4YA 1JEEA 1GNQA 1X8LA 5EJEA 1HUQA 1G9XA 1KAOA 1Q1BA 4L9WA 4Q7KA 4PZLA 5L3RA 3RHFA 4EKDA 1F2UB 2J0VA 2BV3A 4Q4AA 1UBFA 4XVRA 5CK5A 1W7AA 2AK3A 1I4TD 1YR7A 1DAHA 3I3SR 4CIDA 1G19A 4RVCA 3KXIA 3TR5A 4UXHA 2WSMA 1Q20A 1P60A 4WZAE 2WWHA 1KY3A 2AWOA 2WVJA 4DRZA 4IFBA 2EFDB 2HV8A 5C18A 5DLQC 4HLDA 1XZPA 1OE0A 4HEJA 4YQFA 3U3KA 4Q01A 4R2IA 3AF0A 4M9QA 2QN6A 4IXNA 2B92A 5CJ2A 4XH9B 5KDOA 1AS2A 1FOEB 5H8WA 4N0EA 1P9RA 1XX6A 2VYFA 3QENA 3CX6A 5CM9C 5FR2A 4KFRA 1M34E 3RRYA 3B5JA 3U2QA 2RMKA 4GFDA 2C9OA 5J4LA 3SI7A 3WP0A 1QRAA 1Z2AA 5EE1A 1YJ5A 3ZD6A 1NY6A 2YWGA 2HJVA 1T3SA 1G64A 1N6IA 4OHXA 5C4GB 4ZDJA 3FKSD 2GDJA 1GFIA 2CL0X 3NG1A 3AGQA 3M6AA 3AP2A 4JSTA 5DE3A 2PMDA 3TMKA 4IDOA 1OH8A 5KSOA 1ZP6A 2PEZA 1MO4A 1OFTA 4OL0A 2IWRA 2ORIA 1S96A 2RGAA 1VCIA 2WICA 4LYHA 3K0FB 4JMPA 3L0PA 1YR6A 2OO7A 4IHQA 1E6CA 4PQYA 1J8MF 1KSJA 5CLLA 5J4HA 2ZE7A 1XCPA 3VNUA 2O8FA 2CK3D 4LHYA 4G5GA 2V8OA 3C14C 3CX8A 5LD2C 3OEHD 2GCNA 1G7CA 2CBZA 3PVSA 4J0QA 1TQ2A 2QPTA 4TQUS 3QKSA 4UNNA 3ADBA 1O87A 1J90A 3SHWA 3R9XA 4TLBA 3IIKA 1RKBA 2RCNA 2VRWA 4KU4A 1CS4C 3BK7A 3P20A 1F3OA 2LKDA 4NCHA 4TLEA 1ZD8A 4GSYA 1IM2A 3BFKA 3NHAA 1JBKA 2XNDD 4LK2A 3H84A 4L4UA 3MWLA 2Q9BA 4F4IA 4Y0AA 4PC2A 2W2VA 3MJRA 5BYJA 2ZAMA 2ZYVX 3IBGA 1R5BA 2BMDA 2ERYA 1XBTA 4TSFD 1RW4A 2N42A 4DT1B 2H16A 4Q7JB 3F3YA 3MWYW 1R10A 1UDWA 2DB3A 2GF9A 1L4UA 2KWIA 2P5SA 2R6AA 4FW9A 3LXRA 4BLRA 2NMVA 2JLWA 2DBYA 3FOZA 2FFHA 2Q3MA 1JR3E 1XTSA 2ODWA 3EA5A 1VCOA 1OFUX 1F5NA 4F93B 3BXZA 4Q4JB 1M7HA 1E4VA 1QVAA 3RVBA 1FP6A 3VX4A 3KFXA 3PCRB 4M1KA 4QHSA 5KSZA 5FTLA 2DFTA 1XD2B 2R2AA 3LO5A 2OXRA 4Q4HA 3KJIA 1KI9A 2ZRCA 4HB2A 2C2HA 1KYIA 2IS4A 1P2SA 2ZUDA 4G01B 1C9KA 2DWPA 3GEHA 1T3HA 4XSGA 1OIVA 3QXJA 4MRSA 1M1YE 1SHZA 3QKRA 2EWWA 4R98A 3WNBA 1W0KA 2O8DB 3QEJA 3MAAC 4LHWA 1NBME 3IBYA 2YC2C 2IEYA 1Z2CA 5DO9A 4OQLA 3TSWA 4DLWA 4CEHA 1DE0A 4DLTA 1NVVQ 2G9NA 5JJIA 1U9IA 2A5YB 4G0NA 4WIAA 2V3CC 3CF6R 3QOFA 1C1YA 1XPOA 4IEEA 4FCWA 2E87A 4PPGA 5LD2B 1E9BA 1UM8A 1LB1B 5KU1A 4JLPA 4BFXA 2P2LA 1OXXK 2ZVQX 3EPJA 5LB2A 2FFBA 1ZC4A 1NKSA 4DWJA 1TU3A 5ANRB 4TT3A 1B23P 1VYTA 3SU8A 4A6XA 2RH5A 4P4SB 4B43A 3K09A 1AJEA 1ZCAA 3PUZA 2GCPA 3RSLA 2YYZA 4Q9LA 3AP1A 1LFDB 4LX0A 5DYIA 1UBCA 3IKJA 5HTKA 5FH9A 2IYTA 3IHLA 5CIQA 3B1WA 5BN5A 3AKCA 1PV4A 1FP7A 1KI8A 3QXCA 1W44A 3BOSA 2XJ9A 2PMKA 3BGWA 3L0IB 5EE5B 3W90A 3EASA 1G8YA 3KZ1E 4A15A 1Z63A 2BHRA 3KB1A 4ZO4A 4CVNA 1MH1A 4EJSC 1VYVA 3K9LA 1FZQA 1W49A 2WJYA 2QUZA 2VQSA 3ND8A 4LI0A 2IS2A 3EWSA 2DY1A 4W7SA 1DPFA 2GCOB 1TUEA 1Z0JA 4V0ME 2WOJA 5K8IA 2FDCA 4LBWA 2ZUCA 3HR7A 5DN6A 2VHTA 2JATA 3K53A 2G0NA 3WHLA 4JL6A 3CWQA 3DOEA 2WWYA 1XEXA 3FFAA 1IN7A 2ODNA 4CEJA 3OZXA 4B34A 1CRQA 4D0LB 4DBLC 2QAGA 2IUSA 521PA 3TIFA 4B75A 2O8EA 1GKIA 1ESNA 2IHYA 3REFA 2PCJA 3T06B 1G3RA 3T61A 3WYFA 3KKOA 1JAHA 4N0DA 2BC9A 1S9DA 3SYLA 1CU1A 4XSHA 2WTUA 1QHIA 2GK6A 3DEFA 3LBHA 1G6HA 4LY6A 4MDEA 3AH8A 4MUBA 3THOA 3LA6A 2ZIAA 3R7WB 2FNAA 1W4RA 4B6EA 1CJKC 1XMSA 1LS6A 4QM6A 4NDZA 3EC2A 4LCBA 3CNNA 4DSUA 1ZM2A 3THYB 2GJAA 1RPZA 4P31A 4ZI2A 1P62B 5EZ5A 2BM1A 3PXGA 1J2JA 4Q1EA 4BFYA 3J81k 1P9WA 3G5UA 1T5LA 2WZQA 2F1HA 2NOAA 1AIPA 3AVPA 3THXA 3BS4A 4OI0A 3TNFA 1XB2A 3BH0A 3PV0A 4FMBB 2X2EA 2GZDA 4EPTA 4YXWD 2BMFA 1M6NA 1OXTA 4WVFA 4AIIA 1XJCA 5JZVA 5FBLB 3FHTA 1IONA 1UAAA 4B3XA 1M2OB 4QKQA 4ASUD 4DB2A 1W2HA 4BZQA 1YZTA 1RZ3A 2GBLA 1GILA 4A1FA 3LVQE 4RD0A 1T4GA 2HEIA 2ZJOA 4Q9IA 4EJSB 4Q19A 5FUVA 4HZUB 8OHMA 1PUIA 1N5JA 1RJ9A 3FVQA 4O3MA 1E0AA 3V9PA 4YMSA 1Z3IX 1R2QA 5EP3A 4MKIA 5KDLA 3A8TA 2WKQA 4US2R 1H8EA 1KK2A 1R8QA 1KK0A 1DBSA 1KI6A 1VTKA 4TMVA 1QF9A 1VKJA 3VMFA 1T0HB 1KMHB 1NLYA 3GJ6A 3SEAA 1E3MA 2Z5FA 1GIAA 4B71A 5HCNA 4TZ6A 1XDBA 4MA4A 1E2LA 2JDID 1DAFA 1N0UA 4M2LA 3OEEA 2JJ2D 1P72A 3E2IA 3UG7A 2GVDC 2GF0A 2BEKA 3MSXA 2XB4A 2I1QA 2OT3B 2C03A 4JJKA 4UNQA 2QAJA 4M21A 721PA 3IPYA 4RZ2A 4AKIA 5CB6A 3DHWC 5DI9A 4ZDWA 1VG1A 2PJZA 121PA 3LQQA 1KDRA 1SVKA 4A0FA 2QQ0A 2W6JD 2IT1A 5J4VA 1DEKA 3K0AB 1XNJA 4E5UA 4R7ZA 1IN6A 2CE2X 3KTAB 4FIDA 1GWNA 4W5HA 2XZPA 4D80A 2FU5C 5HR5A 3WRYC 1FX0A 1GSIA 1I4DD 3B9PA 3M4YA 3TUZC 1D8TA 1SVLA 1FQKA 1I2DA 3LLUA 1S1MA 4B2IA 4CYMA 3PEWA 4PC3A 3GLIA 2DHRA 3IDQA 2BIFA 2I1VB 4A2WA 1P7CA 1OJLA 3TVTA 621PA 4DCTA 4JBWA 3QBVA 1XPRA 1E2NA 3Q5EA 5F2EA 5JEDA 3AKDA 3QBTA 4TMKA 1HT1E 3I72A 3W5IA 1NI3A 2IEZA 1N5IA 2SHKA 821PA 1DVRA 2VO1A 2H5EA 4OJKA 3L2OB 3G82C 2BVNA 2D06A 1XJQA 3GLHA 4HSEA 5CK4A 3ADCA 1L2TA 4Q9HA 2GEVA 5FPYA 2REOA 5K8UA 3VU9B 1VMAA 1CTQA 2CNWD 1P2UA 2WJVA 5JECA 4Q02A 3DDCA 4AI6A 2F1IA 5TDHA 2J9RA 1E1RD 3WHKA 4DSOA 4B44A 3MWKA 1ZBDA 3ZJYA 4AG6A 1KO7A 2BBSA 1SXJE 3B6EA 4AKEA 4PTLA 2ZITA 1SZPA 2TMKA 4GOKA 2R8RA 4KBFA 2ZRPA 3GPLA 1ZD9A 1G7TA 1TEVA 3AKYA 3W6PA 3C5CA 1EFHA 4WZBE 5JFGA 1MABA 2IYWA 4PO1A 2QP9X 4TWZA 5F9FA 1Z0KA 2AX4A 2H7VA 3AGPA 1S1CA 3AB3A 3VFDA 1D2MA 4NCJA 4OKSA 1IXZA 3FMOB 5B58C 3GLFE 1Z47A 3KKMA 4QXAA 3AV0B 5AUOB 4IJMA 1CKEA 3K0CC 1XEWX 2EVWX 2D3WA 1TTTA 4DCSA 3WBJA 5FOXA 1KJWA 2PBRA 4AD8A 2QBYA 2F43B 1G7RA 2J7PD 2VLIA 3A36A 2IS1A 3OE7D 2VP0A 4NCIA 1RRGA 4TLAA 4S35A 4L9SA 3OFND 4URVR 1XEWY 4UNPA 1FL9A 2ORWA 2ODEA 1BMFA 1J7KA 1LNZA 1E1QD 4LHZA 2WKRA 2CCKA 3W6OA 1U8AA 3HPRA 3VHXA 2RGNA 1EWRA 3VR6A 5HE9A 3ZVLA 4BEJA 1JI0A 5FPTA 1Z07A 2C9YA 2HCJB 4PHTA 4QFMA 4D4KA 2ZI9A 1R0YA 4A8JC 2Q21A 2ZSBA 2WJHA 3A1VA 4A92A 1G8GA 4PX9A 1MR3F 4QBGB 4AYXA 2W6ID 1NNEA 1SHKA 4R71A 1Y63A 3QJYA 2IUUA 1GZSA 3BB1A 3H4MA 3B85A 4K46A 3ICEA 4NYMQ 2JASA 4Y0VA 2IUTA 1SVIA 2BBWA 2QP4A 4FI3C 1DOAA 2J45A 3T1QA 2FFQA 2HDNB 2V55B 4ZIRA 1B0UA 1OHHD 1S3GA 1UKZA 2CJWA 4L5BA 4Q1BA 3T1OA 5K8TA 5AWFC 4YMUA 4KFUA 1PJRA 2P65A 2QORA 3QE0A 4FN5A 4Q18A 1NJGA 3ECCA 3JZMA 3P4XA 4BECA 1NJFA 2Z4RA 4HUQA 2HT1A 3TE6A 2YC4C 3CW2A 4QNRA 1YZKA 3AP3A 1YR9A 1MT0A 1IAQA 4CEIB 3BORA 4L15A 2V4ZA 1U0LA 4YONB 1OKKD 2NO0A 5B57C 3C16C 2OESA 1GKUB 4JBXA 3CPEA 3LH5A 2VP4A 3RAPR 1ZNXA 4D25A 4BWYA 3B7GA 4ABYA 4I1UA 5E7IA 4CGZA 4DT1A 1KZ7B 4PFSA 4DXAA 4RKFA 3CRMA 2QM8A 4JLAA 1W0JA 4IVQA 3NBZC 2PLRA 4HAYA 1KDPA 1PUJA 4B47A 1CRPA 4QL3A 3GFOA 2BJVA 2CEAA 1UKEA 3CONA 3GMTA 3VTKA 5JCZA 1U0HC 2A5DA 2OEPA 2BBTA 3LX5A 4XWKA 5SZHB 2GAOA 1IN8A 4F91B 4TTRA 5J47A 4R2HA 1NL3A 4I99A 3H86A 4UJ5A 2ONJA 1CP2A 3I73A 1Q1QA 2IK8A 5FOTA 4DCUA 2WPDD 3HYTA 5FPKA 4JVMA 3FKQA 1CJMA 3OESA 1NSTA 2FEMA 2RHMA 2W0SA 2YVUA 1U94A 2PX0A 4Z8XA 2D62A 1TL7C 2PLFA 4Q21A 4FD2A 3GFPA 4M8NE 1Z22A 4OYHA 2VP9A 4BFWA 4P4UA 1DAIA 2LKCA 3OIVA 2MSEB 3T15A 1FMJA 1E2JA 1FPMA 2FV8A 1W36C 4WAUA 4DJTA 2XZLA 3V4FA 5HPYB 4A8JB 3I5XA 1W47A 2A2ZA 3NC0C 3QIAA 4LC0A 1W48A 4QG7A 4Z1MD 2ZRBA 3P1JA 2QTFA 1SKYE 3GLHE 4TZ0A 1V43A 2E9SA 4AK9A 3H2YA 3CH5A 2ATVA 2FSGA 5KUTA 2WWIA 4FMDB 4HYYA 4DLXA 2IX3A 4EPXA 3U3JA 2ANCA 3I61A 2BDTA 4TQAA 4A4DA 3CRVA 5TARA 1JR3A 1EGAA 3MFYA 1AKYA 4NZYA 5FUXA 1FNNA 2HYIC 5DSZA 5H1YA 4DIDA 3GCGA 1NSFA 4PO9A 3A58B 3SJBA 4NKRA 3ASZA 1G4UR 1QDEA 1XJ0A 3AF4A 4IRUB 1P75A 1ONBA 3BBPA 4L8GA 2NPFA 2QT1A 1KI1A 2VSXA 1U90A 3W3AA 3S1AB 3CO5A 4G3XA 2FGKA 3QKUA 2ZJ8A 2C98A 2IYZA 1F6BA 2O8CA 1KSFX 5LBIA 2GTPA 2CXXA 4B3DA 4RZ3A 2Z6VA 1EFTA 3NC1C 3CF2A 4QRHA 4B3CA 2X77A 4LJ9A 3SJAA 3UMSA 4PPNA 4ACBA 5IK2D 4HAUA 4LJ4A 3K1JA 4HDOB 1KO5A 3T12A 1US8A 4Q00A 5EXSA 3KUCA 2O0JA 2WMOB 4NYIQ 1X1RA 1XMVA 2QMEA 1NN1A 1W36D 1PZNA 3A1TA 3PITA 3NH6A 4Q7MB 4I81A 2YZ2A 3SN6A 2P0EA 1G6OA 2J87A 2JJ1A 2W83A 2XOKD 3WMFA 3FDIA 2H1LA 3ZQ6A 2OXCA 2HUPA 2Q9AA 2WV9A 1SVMA 2EWVA 3C5HA 3L8YA 2ZS7A 1Z08A 4IXMA 3PFIA 3UMFA 1P6XA 5GJCA 3W8NA 3THWA 4LWZA 4DVGA 2N46A 3VQTA 1YZUA 5BW8A 4NE2A 2UVQA 2OHFA 5EP4A 1JJVA 5DIFA 5FTJA 1CJUC 2O8BB 3NDPA 4JJZA 4C0QC 4LC1A 1HE8B 1NLFA 1JXOA 2JIZD 1W36B 2FWRA 5JRZA 4W5JA 1G291 3IO3A 3QXHA 2DFLA 3RC3A 1IBRA 5FUYA 4QGFA 5EUMA 1TF5A 1G18A 3SOPA 3PUXA 4M9XA 1CULC 1W4AA 5CM8B 4QBHA 3R7WA 1DTSA 2R65A 3NBFA 1KI2A 2Q3HA 3U7EB 4JLBA 3A4LA 2A9KA 1F2TA 2BMJA 4F4CA 4B76A 5CJPA 3RABA 3U3RA 4DDTA 5AJZA 1RC8A 1E69A 5JLJA 4GT1A 2PEYA 3UMRA 4XJXA 3SC3A 2HF9A 4QJ4A 1E2IA 2GK7A 2ZANA 4WBSA 4TTPA 3GLGA 5K8LA 1OF1A 3U7FB 3IHWA 2F7SA 3DM5A 1CF4A 3LLMA 1H8HA 1CR2A 3CH4B 1CXZA 1S2MA 4Q1FA 4V0MA 1BH2A 3PIRA 4EQ6B 4M0LA 1G1MA 2B7CA 4IDPA 4BFZA 1RYFA 3AF1A 2QT0A 4GP7A 3IILA 5EP1A 1MRSA 4I1SA 2HXSA 1Z6AA 5JJLA 4IDQA 1XTJA 4TL6A 3HJNA 1RVDA 4QBFA 4R9UC 5TY0A 2VTKA 1EESA 1QHHB 1E9RA 1CR0A 4DIEA 3OAAD 3SZRA 5FL7A 2RGDA 2YV5A 4OQFA 4TMZA 1A4RA 4GOXA 3PG5A 4M9SA 3MD0A 1XPUA 2WHXA 2ZE6A 1NF3A 4YDHB 2J46A 2QY9A 2R6FA 2ZRFA 3Q5DA 5G3ZA 1UDXA 3B82A 2IF0A 4RJLA 1WRBA 3B2EA 2ODBA 3O8BA 5F9HA 1YZGA 5JSZB 1DO2A 3U44B 3QVVA 2WWWA 2GXAA 1HY3A 4LOAA 2Q0HA 1G5TA 2A3RA 3JZAA 1HEIA 5D3MA 1COWA 2XSZA 2V54A 3VR3A 4F4JA 5JEEA 4CF7A 1XZQA 2OAQ1 4JKIA 3R20A 2IS6A 1ZJ6A 2R62A 2Q6TA 1M7GA 4EPWA 1T8TA 4LHVA 1ZINA 3L8ZA 5FBRB 1WQ1R 4Z8YA 3EZ2A 2QE7D 4EFNA 5BXQC 3I5YA 4PANA 1YKSA 1PLLA 2VF8A 1U98A 2F55A 2ZRDA 1UF9A 4JLVA 5GJBA 4NL4H 1LTQA 2O0KA 2QU8A 4M53A 3X2SA 4BQSA 2FH5B 4UKDA 1KKMA 2A5FA 4HI0E 5C1BA 5EUQB 1XWIA 1MO5A 3NEYA 4V0KA 4NBSA 3ZZ0A 5E3HA 4OQNA 5BQ5A 1AK2A 5FOUA 3IQXA 4CDGA 2RKOA 4X8HA 1K6MA 3FGNA 3VAAA 1G5PA 4QJ3A 4DLZA 3AVYA 4E03A 3UPUA 5J40A 2ASEA 4JYBA 4LGMA 2ZJ5A 3ZGXA 3K70C 3GEEA 1X6VA 3LQRA 2B21A 1U81A 2GZAA
chains in the Genus database with same CATH superfamily
4LBVA 2VUHB 1FTSA 1U9CA 1THZA 5IXJA 2AMJA 5IUNC 4MQLA 4MCAA 3OA0A 5JAOA 1EU1A 2PVCA 1Z5PA 4BNDA 5GINE 1LLCA 1GEGA 4JC8A 4MUIA 4P53A 4BEVA 3K2EA 4R1LA 2ZUBA 3T5BA 1Z5WA 3DEJA 3A70A 1VIYA 4DHWA 4XWWA 3B1YA 1TQDA 1SULA 3OWOA 1RC0A 2I54A 3IAFA 4TYPA 3LKZA 1ZXXA 4E5YA 4E2ZA 2GCEA 1CUJA 1J1ZA 3IBTA 3GQBB 1M2JA 2DE0X 3EQ7A 1W8IA 2P69A 3Q8LA 2OK7A 1YVDA 3OIWA 4B09A 3NVDA 4G5XA 4R1SA 1A7JA 2JJQA 4P0PB 2FPMA 3VVLA 3VH2A 5JC1A 3FWPA 3RIGA 3E7WA 1VPLA 1AKRA 4MHSA 1C81A 2IXEA 1VI2A 3PGA1 4D44A 1IG3A 4UBMA 1V8BA 4LA4A 1C4WA 3STYA 2XUHA 4AU1A 5IT0A 4HLUA 3SJ7A 5JI2E 2FF5A 3HSKA 1G41A 1ULSA 2NWQA 4Y2QA 3CR8A 4GXQA 1EUQA 4GQBA 5DM2A 5G2OA 4C4XA 2FZVA 4FGWA 4OU4A 1CQWA 3DO6A 5I9NA 3NWEA 2R00C 1XZCA 2YFQA 5JNLA 1WKBA 2O1EA 5BN4A 5IG2A 1TK2A 1UINA 1UXHA 3VRHA 1SG0A 2DTXA 3IKVA 4NFLA 3P9RA 4WFKA 1T6XA 3BAZA 5BV0A 3K2IA 4C6TA 3HJRA 3P9IA 4L3VA 4U7PB 4BAGA 4MHTA 1TLFA 5JU6A 1QDLB 1TYEB 3COVA 3PT9A 2W2PA 4CU2A 8LDHA 4ZQIA 1NBHA 2RIPA 4N6GA 1U7XA 2PUWA 4L4RA 4POAA 3N2LA 2WSSA 3H0CA 4F6RA 3M33A 3LW7A 3NBAA 3NHZA 1AXEA 4H35A 3TR0A 3NPAA 4CMEC 2NP7A 4YAUA 4Y7CA 3A7DA 3GLGE 2YVKA 3JQ6A 2IOQA 4CLRA 1AXGA 1NN3A 4QNMA 4KO4S 4G07A 4KW7A 1Q22A 1JEQB 1AQIA 1P3DA 3GGDA 5DNVA 1DTWB 1Z0SA 2PGOA 3GFTA 2Q0QA 4FCTA 5JCJA 4EVQA 4I66A 5G1PA 3RARA 2UYOA 3CCFA 5CITA 2PX5A 2QUKA 1Q16A 3AQ4A 3WQRA 5FWYA 3KQLA 2GTIA 1E2EA 4BXOA 1L9XA 4DIBA 1QRRA 1BD3A 4I50A 5G4KB 2DPLA 3SSNA 2ZR0A 2DU8A 2QTMA 3OCZA 4FOSA 1F8YA 2C5FA 1E79A 2NVUA 2REQA 3PE6A 3WKDA 3TBHA 2J9FA 1IUPA 1D09A 2WU0A 1PS9A 2AD1A 3H2BA 1PR4A 4NJOA 3LVFO 1ORWA 3GLFA 1XRJA 3DMRA 1EFCA 3LUCA 2AV6A 2X2OA 2Y27A 2EKPA 3PNOA 4MW5A 5TT0A 4JVSB 1FA9A 4TTQA 3RGGA 2FWIA 4BNXA 3NBXX 4URUR 4H9GA 2WUFA 1ZIDA 4I36A 4E46A 4HPXB 1TADA 3LHIA 3RF6A 1E2FA 4RK5A 1C7ZA 2RAPA 4LPKA 5LP6C 3I28A 1E5LA 2B2XA 1IRXA 2JZOA 3OCXA 5ILQA 2WMNB 2I4IA 4BQFA 2OPBA 1W5TA 5D87A 4UAGA 1BX0A 2I2CA 5IHXA 1XTRA 3IGFA 1G21B 4OF4A 1MMFB 2HA4A 3A14A 1PBTA 5E95A 4RXUA 1ESZA 2FMHA 2VJQA 1GNPA 1QKJA 3C3AA 5CYOA 3L1VA 3WO0A 2HJWA 1AU9A 1FYWA 4GPBA 2YN0A 3FG9A 3R3YA 5ADUS 2CLDX 2F1JA 3RJTA 3WNDA 2R9VA 4QUEA 4NLLA 1SHUX 2HWYA 2XV1A 4FSDA 4KMSA 4D0GA 1GRRA 1B8PA 3W0LB 3ESBA 4RGYA 2ZSHA 4FLMA 5LZ4A 1Z2PX 3OUZA 5BVGB 1X87A 3ESZA 1IHUA 3HXTA 3TK1A 4R40A 2BMAA 2PZLA 4TLCA 4TTTS 4D0NA 3TSOA 4HEA6 3GUHA 3TFOA 1FW6A 2HLDA 3RIXA 3K0BA 1Y5NA 4RHXA 4B0PA 3AVWA 4BO6A 3KUUA 1CJBA 4N5DA 4GAEA 1MGOA 4NC9A 1JJBA 2EARA 1WMAA 5D84A 5AJXA 4N3NA 1U4OA 4PPFA 3DKKA 4WV3A 1XSEA 3NJRA 5HF5A 4ZHQF 3OPYA 1UKVY 3GP5A 1TRHA 4XQEA 1HDYA 1NIPA 3GN1A 5SZJA 2I2FA 1BMDA 1H9AA 2JHGA 4GPAA 3F9RA 1KQPA 2I9PA 4LPSA 4MW6A 3AESB 5LMCA 2WU1A 3FW1A 3BQMB 3KUXA 3MOSA 4CNBA 1OFHA 5IDQA 2C0QA 2VNIA 4OMFG 1A1VA 4L5AA 2NSYA 3EZ6A 1E0SA 3F98A 3WLPA 4HAWA 1NLMA 1Z28A 2L18A 2PH1A 2HK9A 3D0OA 3D81A 3GEIA 1T0PA 3E1SA 2QZ4A 3O2NA 3WX0A 4F8YA 4OU5A 4PLYA 2QQ5A 4QM7A 1E89A 3AUSA 3EARA 4K6GA 3JALB 3QKSB 2VAPA 3AVTA 4JEUA 3ZDFA 1E99A 4JLOA 4JUAA 4GI3A 1Y34E 1SQ5A 4IO0A 1SXQA 3PC8C 4MGIR 4RLFA 2WAXA 4CMAA 4N6OA 4EDFA 1ENYA 2G9RA 4RSHA 1OV4A 4JR2A 1VLZA 1ONNA 1YAJA 2AG1A 1YKGA 3K8QA 3OPNA 4RY0A 3CVWA 4EKGA 2YHIB 3TNLA 2GRJA 2H4HA 1X9GA 4MRMB 4PSCA 4WOJA 1ZUNA 3BE8A 3CE6A 3ETNA 3A32A 3HXQA 4HNSA 3LYAA 4JT9A 2VPZA 5J2UB 1P4AA 1OLUB 2HMUA 5FFFA 2FCAA 3IYLW 2NV6A 3NAGA 1XK7A 3VDMA 4C5BA 2BBOA 3KKNA 3OWXA 1D0VA 1VG0B 3WWOA 1U8TA 1C7RA 4C89A 3V8RA 1B15A 5IYZA 3ZDQA 4ISBA 3RS0A 1X70A 2VWHA 3HQ4O 3URMA 1VL6A 3QV1A 1NMSA 4LWPA 2ZWPA 5C7IO 2VSNA 5L40A 2AIRA 4M1MA 4NYIR 2BKAA 2AMYA 1WHTA 2WWFA 3PR2B 3X2EA 2OZVA 4DYHA 1SKBA 3LYLA 3PJGA 1UEJA 4TWAA 3H11B 5CD1A 4W9NC 4FDUA 4PEVA 3TSAA 3GXOA 3IVGA 8AT1A 4JLNA 1CJVC 1EFVA 1KE2A 3QJGA 1JHAA 1Q3HA 1TQ4A 2QM3A 3KQOA 3DE7X 4Q4HB 5CFRA 2VJLA 3ZVMA 2IZ5A 2QTNA 5F21A 1E1DA 1Z62A 2C54A 3DYVA 3HNRA 4NHOA 3TSYA 1CUBA 1JKMA 1AGXA 4JROA 2E4XA 1ODFA 3W8DA 5BMOA 5JBQA 4UAJA 3QEOA 3T0FA 2OV2A 1F2UA 4B3JA 1S3FA 5AW9A 3JCZA 4YCNA 2XAUA 3QKRB 3M5WA 3QI7A 1Q3KA 3DH0A 5CA1A 1JJIA 1SXGA 1MVLA 2W71A 4G25A 2Q3CA 3L46A 4C6SA 4RMJA 1FU8A 2PH5A 5DYWA 4DDHA 1JIJA 3K5WA 3K8ZA 4Q7LA 4KFCA 1F8UA 3W04A 2VA8A 4Y1EA 1VRWA 2ZEJA 2VUTA 1BEZA 4XVUA 4J0DA 4PLHA 1VL8A 4IQ4A 4TT3D 1P1HA 3FHJA 1GZVA 1W52X 2WBLC 3EVNA 4RZIA 3KSZO 1WMDA 1HE4A 4NNOA 2OHGA 2A0KA 1HYQA 3GFBA 5H83A 3PEYA 3DL0A 5EIEA 1VYUA 2G9VA 1XUOA 2A5JA 5DNWA 4DPKA 5JAPA 4ZKDA 4QQFA 3RSQA 1NRWA 1QH8A 3RQSA 4ZDIA 2BEVA 1XMQB 4P4GA 1YQTA 1PFKA 3G88A 2NAFA 2W58A 1YR8A 5GM2A 1B14A 4X6LA 3FPJA 3PJRA 1LJLA 3CPJB 1MJGM 4R8MA 1YJCA 5BPFA 1XRPA 4ZGBA 5ITZA 2KX7A 3GO4A 1J9ZA 4UVEA 3FXAA 3QU4A 4B6FA 3PXBA 5D5QA 3QPWA 1DX4A 1OFIA 2ZI7A 4NG5A 1TU0A 3ABZA 3LDAA 4D3SA 3DL7A 4CL8A 3OVMA 4C6HA 2ES4A 2IHJA 4KLZA 3SSOA 4YUZA 4ARVA 3PC3A 3GRAA 1VB3A 2EQBA 2X0KA 1J06A 4WK0B 4RJ2A 4E4YA 3NALA 5HFNA 2OO3A 3VO1A 2WD7B 1ENZA 3I8SA 3IP8A 4FXPA 3G9XA 1XZ8A 3U4DA 3C3EA 3ZU6A 1HV8A 3H5NA 3HDYA 5AW2A 1QYVA 1CWUA 2DX7A 2JJYA 2NSDA 5A4JA 4BIMA 1MDFA 3GELA 3N9IA 1ZVKA 4RLSA 4YRQA 1ZL0A 1TU4A 1PN3A 4N82A 4ADSG 4IXWA 1Z6XA 4RD3A 3Q10A 2FMTA 3S55A 1ZI9A 3KQNA 2V1XA 1RCFA 4OMCA 1PQYA 2IGTA 3E03A 4AB1A 3GNLA 4G1UC 2R6HA 4ETMA 5ADWA 2H63A 4I5GA 2FJUA 1T2FA 4NENB 3VC2A 4NU0A 4R2WA 3VI3B 1UQUA 4X41A 4KMOA 3EGEA 5C1PA 4MKHA 2DGDA 4TM7A 1WVGA 2JA1A 4JA0A 4RCYA 2JK1A 3KQHA 1UXJA 4RPLA 5KHAA 4D9EA 3E82A 4RTLA 5AVKA 4EVRA 4OY3A 2Q5FA 2AOUB 1NBIA 1AGPA 5NLLA 2C1EA 4IEFB 3LD9A 2L69A 2VF5X 3ST7A 3GRVA 1VYHA 2PH3A 4V38A 2GM3A 4CEJB 2QUIA 4WEOA 2QAGB 2X19A 4DZZA 2O8EB 4ZYXA 3L4BA 1M8GA 4MR8B 1JDPA 1IY8A 2I87A 2B20A 1LPMA 4CUKA 4OD0A 1GZ6A 3K4QA 1WV1A 2ZSKA 3DDHA 4EW1A 4UHCA 1ZXBA 3DUFB 3O82A 4R83A 4DZTA 1GTVA 1R7RA 2BH2A 4FLFA 2LNDA 3EXHA 3LCRA 4MUNA 4NF2A 3BKXA 2UUBB 3UOAB 1U2QA 3PYXA 4E1AA 1E63A 1SEVA 1W94A 4UXJA 2ZXEA 5ESWA 1ADFA 4X1IA 1UXOA 3I3OA 2DBZA 4UD6A 3L7NA 3STUA 2W9XA 2XNDA 2QLTA 2O8NA 3ZHYA 1DWQA 2E7ZA 2I80A 3JAKB 3ZDAA 1JH8A 3U4HA 3TB4A 1R6VA 5GADl 2V65A 4ZEOA 3FPEA 2Q1WA 2EHDA 3ZE7A 1IXRC 2O05A 1TMKA 1X1SA 1XRMA 2IPNA 2PU7A 3NTLA 1ULUA 5EXTA 1XALA 3FOBA 4BMPB 1ZNYA 3B6ZA 4UHBA 4C21A 4O2LA 1UQTA 1UC8A 4I0WB 4R54A 2GYUA 3IOBA 4KR9A 1PJ8A 3FFWA 5JD6A 4WADA 1X94A 2C3OA 2MSCB 5KO2A 3PXUA 1HYBA 4FJ2A 2WKSA 4TYQA 2X9VA 3DOHA 4IJKA 1DHTA 2R7NA 3KYCB 4RK0A 4KITB 1T35A 2QJWA 4S1OA 4KO3S 3TD9A 5HW0A 5BT8A 2EIXA 4JJGA 4TL7A 4C3UA 2ATEA 2O8DA 5I7FA 2GFHA 3A9WA 1LPBB 3MD9A 3PQ7A 1H8ED 1YDEA 2OWDA 1G8SA 4MQFB 5K0NA 4BNGA 4NYJQ 3MJVA 4J91A 5KQRA 2E5WA 4BZPA 1NW6A 3O9VA 2PRJA 3CEMA 5AJYA 1ZCJA 2OVBA 3DP7A 1Q92A 2CE7A 1AQYA 4YJFB 1P5JA 2PQ6A 3H8VA 1FBTA 1T9HA 4PIMA 3CBQA 3BRCA 5JDCC 3OEED 3GFSA 1K68A 5ULLA 1PJ4A 3TYXA 3QI2A 5JW6A 1Q19A 3IQIX 1DJQA 4FE7A 5J2TF 1V8FA 4XUEA 4AZSA 5IVHA 4OFZA 3I0ZA 5LQDA 1NR5A 1WS6A 3C4JA 3LUDA 4JP8A 5CVDA 1B8NA 1HURA 1OXVA 5KPDA 1RWKA 2VK2A 3PYMA 3LPMA 2IE8A 3GT4A 2AXPA 1JMYA 2Y71A 4X7BA 1P33A 1GPWB 2UZ1A 2WK1A 4B3SB 2WIFA 2C7QA 1Y4SA 5AUPB 1AB5A 1ICIA 1YOBA 3KYDB 5AKXA 1N6RA 5H9VA 5F5NA 5FUMA 5HQ3A 4RELA 5IBPA 3DZGA 3PGLA 3MTAA 1Z34A 2PRYA 2ERXA 4JWTA 4ZQCB 3WGOA 5BSGA 2ATIA 3V48A 3SR0A 1QJCA 1DHRA 1ATZA 1G3IA 3HU3A 5ENZA 1T9GR 5LKRA 3NVKI 1D6JA 4XB6B 1FVFA 3N8DA 1GLGA 2BKLA 4WN3A 4EDHA 2YW2A 2OCAA 1E3WB 2RGNC 1E2PA 3ZLTA 4U4AA 3LPLA 1CIVA 1GYPA 2LDXA 4L9AA 2EP5A 3V1MA 4ZGWA 2KJQA 4QGAA 3MT8A 3MRXA 5ESXA 1KAEA 5ALSA 3FCUB 2EDCA 1MKYA 2YWBA 3VZRA 5E2AA 5IXYA 5EXEA 1N2ZA 4B35A 3AEZA 3UQZA 4RF4A 3ZKWB 1RZRA 2BM0A 1UMCB 3O0DA 2VNKA 3VJLA 4LXUA 3P2EA 3A9CA 1WB6A 1ZLXA 3HJCA 4LECA 1PTJA 2GCOA 2H31A 3DFKA 3GA7A 4OBXA 3IALA 1X14A 5DM0A 3KJEA 2VPTA 4RD2A 2F64A 4QYTA 1BXRB 3GLIB 4QC2A 3ED1A 4DEVA 4F9EA 1L5ZA 1GSAA 1GNVA 2YASA 1BAPA 2QUAA 2D5BA 3FYUC 3E81A 3H6KA 2LCIA 4COOA 4L6IA 1VIDA 2AX3A 2W90A 4BQPA 2JC3A 3WMWA 1RR6A 2VYVD 3LFTA 2VEDA 4PQEA 1WUJS 4MVJA 3ME5A 4OYLA 3B36A 4H6VA 2ILVA 1H22A 3L9WA 1WCXA 3JRWA 2A9QA 2P2DA 2WHPB 3A6FA 3L0SA 2PD4A 2VHYA 2IHTA 1R0XA 3K20A 3W3AH 2QWXA 1U0FA 3JQ7B 4KNYA 1PHPA 3SM3A 1R37A 4X90A 1NW8A 2Q9CA 1WCIA 3NOXA 3IMGA 2HWWA 4QUAA 3L82B 1L5MA 1OC4A 1JZQA 2WU8A 2H0RA 3ZV6A 2Z9BA 3CUUA 2JGFA 3BIOA 2OXTA 4LQDA 2XKJE 4BNWA 5JHHB 3DS8A 1XAHA 1G63A 1P4JA 5IDWA 5A5DA 4CTJA 4URYR 4NJMB 3RRXA 2PTGA 1VJ1A 3O2JA 3R3JA 4MW0A 1SM4A 1E3SA 2NG1A 4TUYB 1P4HA 1WBBA 5AP9A 3DVLA 1KOJA 3SDBA 1J2EA 3ZS8A 1E94E 2I6GA 4TYWA 1NKTA 5JT1A 3V7NA 4RKRA 5L7TA 3SF0A 1QVRA 1KNXA 4F3YA 3E53A 1I6LA 1DU4A 1DKOA 3OH8A 5KYTA 3EFHA 3NYRA 2Y0CA 1POXA 1ZYUA 3OHSX 1L7BA 1S89A 3K9QO 3U0VA 4OB8A 4RABA 3UH1A 3ZGNA 3U9LA 2V0NA 5F64A 5JAHA 5JD5A 1W1IA 4HLCA 1R6BX 4HDKB 4R3NA 2QBYB 3I6QA 3TLYA 1T8PA 2Z04A 3SBEA 4GH5A 5LKAA 4XM0A 1E6KA 3EVDA 1A5BB 1AN0A 1UKBA 1M33A 2PRZA 1GNSA 3LWBA 2J4FA 2OE2A 4PZZA 1NXVA 2A35A 2P35A 2Z08A 2GJ4A 1KJNA 3WLFA 1X7ZA 2QZPA 3JR3A 3A04A 5BSUA 1X8JA 4JFAA 1PG0A 1RPAA 2DH6A 5DGHA 5CT4A 2CHGA 4AJIA 5C5IA 3O26A 1T0UA 4MVJG 2AL7A 3OG9A 4A2PA 1Z5VA 1OA0A 4WLVA 2O7RA 3TQQA 1BE6A 2F6RA 4DV7B 3VTAA 3DNMA 2WMDA 1FYXA 3KZMA 1H66A 4NQZA 1P1KA 1N75A 4IIVA 4LJ6A 5IEBA 4D45A 1QMGA 2HT6A 4HPWA 3I23A 3KB2A 4EB6B 3GVHA 3PGJA 1M6EX 1Z45A 2IE0A 2IYRA 4Q82A 2JFNA 2JHCA 4HPJB 4ZOAA 2GJ9A 2ZOSA 5MHTA 1SC6A 3F7OA 1QTRA 4YS6A 4GBGA 1WCV1 1Z83A 4R5HA 1CB7A 1SU4A 2DQYA 3AFIA 4MKXA 1E62A 1BDHA 3SSAA 5J59A 3M6MD 4L5JA 1MGPA 5EIXA 1TF2A 2H5LA 2OBXA 2OC4A 2ZE8A 3BL5A 3O47A 3MELA 4JYAB 3UNXA 2E4WA 4ZVOA 3QXGA 1E6LA 2FR0A 3Q11A 4HUQB 3GZ4A 4PS0A 4X7MA 1Z7GA 5LN1A 2NZXA 3A9VA 4IQ8A 2BONA 3I4LA 2WPNA 1UP7A 2YXDA 4URHA 4E4TA 4CKZA 2GBIA 2FRDC 4RA6A 3L6RA 5MN5A 3JWHA 3G2HA 1SXPA 3FLBA 2C5AA 5AKEA 4YJ2F 1NBAA 4PVDA 1A7UA 3C8HA 4DV3B 3O1IC 4Z7OB 4ZI3A 4AXBA 2Q7DA 4YREA 3KTAA 3FPGA 3MM4A 4FWBA 3ZI7A 4DSAA 1EJ6A 4TKLA 2A5LA 1J70A 3IODA 4YBRA 5EZSA 1HLDA 3H18A 4PR0A 4ZCSA 3KXPA 3V4PB 2ZRLA 4CUZA 4ZZ0A 5U9CA 4IW3B 1DWUA 1IZ8A 1V1MA 1I01A 1WL8A 2JJ2A 1AK9A 3K35A 1ZWKA 3WRXC 4B6OA 4CM6A 2IYLD 1EGVB 2OCBA 3E1KA 4MV5A 4H31A 1SCNE 1N7IA 2CKDA 2X6RA 3OKFA 5IANA 1YZVA 2OORA 5I5GA 4AIRA 2QYOA 4YRSA 1A2KC 1ZI6A 4KAJA 2O2GA 4MO2A 4MUXA 3I9V6 2QW1A 5KYNA 2VNJA 2HMSA 1OVGA 2JARA 2XGSA 2JLRA 3A4NA 4A27A 2WSLA 1O96A 4HDAA 4BX3A 3KFLA 1ZIOA 3VNQA 3NHSA 5KHOC 4OHYA 5E0OA 3OY2A 3E3AA 1SUBA 1QC5A 4HWPA 2XUPA 4D8YA 3HGQA 3SFVA 3BH6A 3WIDA 5K3DA 2PKWA 2EG5A 3ROZA 3VU9A 2QVBA 2ZAGA 3DHNA 1PR0A 1XLVA 4ESVA 3KZNA 2AB0A 4PN7A 1MXFA 2I0FA 1FP4B 3KOOA 2FQQA 1FDSA 2EFYA 3M81A 1JQLB 1K9SA 4NEQA 4EVSA 4RYDA 4QUJA 5I8ZA 1YNOA 4Z4FA 2REXB 1TZJA 2QPOA 2O9JA 5LYJA 3HWX1 5CFMA 2JFWA 1KEUA 2ZTHA 4KB5A 5ALNA 2QZSA 3HYNA 4KQMA 1JEAA 4BGDA 2B2CA 1JR3D 1KO1A 3HZHA 1TAGA 5L4SA 1QAOA 3TL6A 1RKQA 3KM0A 1OLOA 2JIMA 4DNPA 4LF4B 3KAQA 4NBTA 4XJVA 1UZNA 3KLNA 3WK7A 4TS1A 1LI5A 2E82A 5JZ9A 2P27A 3OP1A 4QQKA 1XJ5A 4GRDA 2NVWA 4X93A 1ZVJA 2R8OA 5F77A 5DU2A 4F3RA 1AZWA 1N9ZA 1YJXA 3A05A 3ANNA 2A5GA 3TVDA 4NICA 1K8YB 2ESRA 4WA7A 3KPUA 3R9IA 3G6KA 3UVEA 1PQPA 3X44A 1NMZA 1SVUA 3TAXA 3LAWA 1T5OA 1A9XB 4OHWA 4OJNA 1VZ3A 2AC2A 3DOCA 1XTUA 1LH0A 3FH0A 4OLBA 4KK3A 2ZVPX 4AJ4A 4JXKA 1E5XA 1PFVA 1WZIA 4JIMA 1BX3A 1U2GA 2H9YA 1KSGA 4BCDA 1CEEA 4KLNA 3U3MA 2GD1O 1DQSA 1K3FA 4HYQA 5EMKA 4CF6A 1NDHA 2W2TA 1EVJA 1G2PA 2C3MA 4YJHA 4EHJA 3M2PA 4B3MB 4NYMR 4YUXA 1CR4A 1ZOPA 3QWAA 5C4MA 3NNSA 4JC5A 3L1IA 2VRCA 1E9FA 2VAXA 2ZZKA 3CB4A 3VVCA 1N3LA 1KXZA 2J7PA 1VGVA 1ZKMA 2JJ1D 3FUWA 3HBAA 3QG1A 3OE7A 4RAQA 1DCTA 3AVQA 2GETA 4ZCIA 3K6JA 1T5IA 2ZP1A 4DIFA 1ZW6A 4E3ZA 5DNUA 7REQB 1Z8DA 4X9XA 3E5HA 1YQWA 4JEIA 2YZMA 3K70B 2NO5A 1RYBA 1Y1PA 2IZ7A 5CXQA 1E1QA 3STTA 4LAFA 4PC7A 2X1LA 1ZHOA 5AKZA 2F48A 3MRSA 3RB8A 4PQFA 1SCJA 4DUYB 2V5VA 3SJCA 4AFNA 2BTEA 3GJ3A 1IVNA 1K3UB 3ZV4A 2C5EA 3CEHA 4OJYA 5IM4F 2H11A 2W2XA 3RUFA 3JQFC 5KKNB 1GPYA 4K9MA 4E5NA 1SZJG 4S05A 1YKFA 1FIUA 1Q12A 5H7XA 1RYDA 5DLEA 2C61A 3N8NA 4PGMA 4QT0A 3NIDB 4ON9A 4Z9YA 2CXTA 2FAXA 4EBFA 3O8CA 1RRPA 1KEZA 2H54A 3M4NA 3KX2A 4IV5A 1IULA 4YRRA 4MUYA 3EHDA 4ZKEA 1P7ZA 2I2DA 4X0EA 1YL5A 1IQ0A 5HUJA 1D1PA 4AF7A 3B51X 1KDYA 5MF6A 1JNXX 2IQ5A 3C85A 4EG8A 1S2OA 4BP1A 3CX3A 3BGDA 3ETLA 4F6LA 5BV8A 4GO1A 4NAVA 4L75A 5EFOA 4OHRA 5FLKA 5JH7A 4HGYA 1R4AA 2CMKA 4IYRA 4DBLE 1N32B 1IOVA 1DPGA 1V8DA 3L6CA 3EXG1 2NLOA 4EW3A 2LDBA 3B9BA 2HQBA 4HNHA 4JLDA 1CEXA 1U3TA 1WD7A 1BZYA 3A26A 3ESCA 3G2NA 1EK5A 3JATB 1DWPA 4C4RA 2ZYHA 2AZ4A 1QO0D 3MJTA 4Z4IA 1OKKA 2RGYA 3P2OA 1DKMA 4HWTA 3R3UA 5HCUA 4BFUA 2NT3A 3ELDA 5ELXA 1KHTA 3K0CA 4DR7B 1N1EA 1CS0A 3TRKA 2CMHA 3Q88A 4MP8A 3GJ7A 3HB7A 1L7RA 5CGQB 3ZHOA 1ZXLA 1BOOA 1D4AA 2DYKA 2FQWA 2BGUA 3VOTA 3DE1X 3NP7A 2XYRA 3L9XA 2EGGA 3ELBA 5DISB 4L8FA 2PAFA 3IMKA 4ZODA 4N5IX 1IN1A 5KI6A 2BR4A 2FEAA 3JAWA 1RE0A 2FWBA 4NYJR 1EFUA 2V6IA 1TVCA 2JI8A 3OZBA 4MARA 3TPCA 1ZD5A 3UH0A 4B9AA 3C1UA 4AMVA 1PEDA 4J2TA 4US1R 3GEPA 1UJCA 3NAMA 3GW8A 1PT7A 2G83A 4JOBA 2YUTA 3ZNNA 4CN9A 2NVOA 4JXZA 2X3YA 5JCOC 1VQ1A 3BIXA 2QQEA 2QN2A 2A57A 1LQTA 4GMXA 4L51A 4GI7A 1XHFA 2OHOA 1COWD 2VUIB 4RUKA 5EHQA 3AVXA 1C3OB 3PNQA 1SGWA 3LV8A 3VNBA 3BDVA 2D4AA 3JXEA 2AOTB 4KGVA 4OXNA 2MTBA 1E9CA 4O29A 2D2EA 2Q4OA 4F84A 2UUAB 4F71A 3IC5A 4H6PA 4ZVTA 3VR1A 2QPAA 3VBEA 3WK9A 4UUAA 2WSYB 3G6WA 2FSUA 3ZE6A 1OWNA 2CN1A 1EQUA 4XDGA 2GN0A 3R5TA 1PGNA 3WE7A 2AG8A 1NDQA 3SAJA 5KJCA 1U28A 1QFJA 1I32A 1EB9A 1LLFA 1TW3A 3C48A 2IYOA 3ZD8A 4BLVA 5JMTA 2Y0BA 1MIOA 2HF8A 2Y66A 3DD1A 3H4IA 4LKOA 4QPPA 2WHRA 3ONWA 5D3MB 2PX6A 4Z1MA 4YGYA 3SIPA 2Q3FA 4BMVA 4ZHSA 2XA1A 4LE2A 2P2NA 2X8LA 4UCFA 2YRFA 3HCPA 2FP4B 3W34A 3C7DB 1PK7A 4MP3A 5B4VA 1NVKA 4HXEB 5F5XA 3AI1A 1NN5A 1JHUA 1KTVA 1CZRA 1RP1A 3G13A 2QSUA 2C9BA 2PM8A 4BFTA 5CXUA 2DPGA 3I2FA 1CLUA 3WWZA 2XXAA 4KREA 3SXPA 4XVQA 2PDAA 3O9ZA 2D1SA 2G67A 1I2ZA 1ILWA 1CUGA 5GOZA 1NA5A 3EY4A 1ZESA 4XJTA 5TX7A 4V0LA 3FPHA 1N5LA 3E8SA 4IOMA 2AG6A 3CU5A 4G0ZA 2GTHA 2LV8A 3GOHA 1Z12A 2IY7A 4G8DA 2W2KA 1W2GA 4JB3A 4LF9B 5KTYA 1VHTA 2WSIA 2J4CA 4OHZA 1IQPA 2QIPA 3EVBA 4FMDF 2AUNA 2WAYA 2OV8A 4LDZA 4D99A 4B3GA 1AQ6A 3FR7A 4H6XA 1HOTA 3RAGA 4B7CA 5CDFE 3GD7A 1EUDB 1MFPA 2RHCA 3C6XA 3DWIA 1MEOA 4M9CA 4C7OA 1DL5A 1FRVA 4Y67A 3IB6A 3KQQA 2HB6A 4ZWNA 1C8KA 2YJNA 1H2AS 1YULA 4GZMA 1XKXA 1LVHA 4MV6A 4NK5A 2HDOA 4OHUA 4OIMA 2FWJA 1W4ZA 2I4RA 2IXDA 2A94A 2FEOA 2HSEA 3H1FA 5LXTA 3K16A 3F1LA 4MEAA 4W1PA 1OWOA 3KT3A 3EPLA 5TVGA 4EUKA 2P67A 3WB2A 1QP8A 1A5ZA 1JSZA 2QYHA 1NW9B 2Z8ZA 4LVOA 5SYAA 1P2BA 4E09A 3CUVA 2VH1A 3ED5A 2GPSA 3P0FA 4BVLA 4OK3A 1NWCA 1JEDA 3T1VA 3MWDA 4LZLA 3SJZA 4BRWA 4P3YA 1FY2A 3OPQA 3W4JA 2CGEA 3CNLA 4J3JA 3U7JA 1PWXA 2GCIA 3UW3A 4EWLA 2XOKA 4B4OA 2R84A 3GJ0A 2HRRA 2YXPX 3HCWA 1ETUA 1BYIA 4O2RA 4F9FA 4Y7DA 4FC6A 5JSQA 5MN6A 1W73A 2UYQA 4YFVA 3LQ2A 3UT0A 1H2EA 2PKCA 1RT9A 2H8GA 2QXUA 4ETIA 2WDZA 3IULA 4EKNB 2YY6A 2ZB8A 3L4KA 1XFDA 4EX6A 2WAAA 3MGBA 5HK9A 4EUSA 2GH1A 2FHSA 3TDKA 4K9RA 3MW8A 4YRGA 3OZUA 3PE4A 2QRNA 1L4EA 3R5SA 1P18A 1KWGA 2VHJA 4BOYA 2ZDHA 3AT1A 4WDQA 3Q0TA 4KHZA 3QF4B 5I9SA 3U4QB 2ZRMA 5KNDA 3ICOA 5EJ5A 4LXHA 4UVDA 2JFOA 2QL9A 3HCCA 3A6LA 4HDQB 2VHUA 4A1OA 4CQLA 3FNFA 2QNRA 1XA4A 2M2IA 1HNWB 1GN8A 5TJ9A 3OQIA 3PUJA 1FLDA 2IIVA 1QHHA 2PZEA 3LHFA 3RSHA 3OE1A 4F38A 1HSZA 2BFCB 4QVIA 1PVOA 2R44A 3M8KA 2QTBA 2BP7B 1E6MA 4OH1A 4XDHA 4HATA 1QQ6A 3MBIA 1RLIA 3GIWA 4C0BA 3CXRA 1DXYA 2CFCA 5CEEA 5I8PA 1BDBA 1X2EA 4PXSA 3T9BA 4XDYA 2XQVA 3Q7SA 2P9QA 4XTCS 1U31A 3D6TB 1JDBC 3DVSX 3MJ4A 5CDUA 3OT1B 1DAEA 3SFTA 5CCDA 3W3ZB 3OHMA 3PENA 1VB5A 3WLIA 3DM9B 2XR1A 2NADA 4AECA 4O4IF 5BN3A 2E5FA 1N7GA 4JVNA 1TVKA 2JH8A 5TQVA 2W2MA 1PEKE 1OW3B 1XKTA 1HXHA 5IKPA 3ETJA 3RFUA 3AVVA 3W1VA 1MO3A 2O2ZA 4EW6A 1R5JA 1UAYA 3AM3A 3H04A 1TMYA 3LQFA 1MAUA 3TD6A 3DKVA 2FPGA 4GIBA 3H2ZA 1ADYA 1GOTA 1QM5A 1QGZA 1AZTA 1AMOA 2V0CA 4M0KA 1KZ9A 1L4NA 1D2GA 1IDN1 2EFEB 3PXEA 5FHRA 4U2FA 3BF7A 4XGKA 1ZZGA 3BL6A 5BWNA 2A30A 5LA6A 5K6AC 3LUPA 5E6SB 2V4UA 3PL5A 3ZG6A 5F73A 4ZHQB 1T2VA 4H6WA 4CW7A 1EVLA 4BZZA 4M22A 4EPRA 1XT6A 2FR8A 3O6VA 4V39A 2DUUA 1FVXA 2VTBA 1JG1A 2FB9A 2W4MA 4IOKA 1AGRA 4N01A 1WXXA 1BMQA 1G20A 2NU7A 3B1FA 3BB4A 4LJ7A 4P7GA 1K7YA 2J30A 4OXXA 3RNLA 4PBSA 4RTJA 3J81A 4N7MA 1UBTS 1PFGA 2BSAA 4OI4A 5B7NA 1SK9A 3UWDA 4Z7QB 5LU9A 3I1YA 4O59O 3UA4A 2H92A 3D1LA 4DLNA 4DSZA 4DDWA 4ZAWA 3RCBA 1QANA 4QJIA 1BTOA 2YHBA 3NX4A 2Z0MA 4G6ZA 4D1YA 2H2AA 3OO1A 4CIWA 1R6TA 4RVGA 4LXIA 2C5BA 2DQKA 5HBGA 2AHRA 3T7RA 1LVGA 1Y33E 2NNLD 1I4WA 1I7NA 3CZ9A 3GYBA 2UXDB 3BMCB 4WXPA 5YASA 3MNFA 4AMUA 1FJHA 1WXHA 5KQGA 3DCJA 2PKQO 2PY6A 2G1JA 2VJAA 1KDOA 4QXQA 2FZKA 4KGZA 2W0MA 3ZX4A 3WMXA 5LL6P 1CQIB 3L40A 2VT2A 3RIYA 3T1NA 3GQBA 3GT3A 3UJAA 4DC9A 3ND6A 4DS3A 3OJXA 3NXSA 4C0SA 1DC5A 2ZM5A 4X24A 5D8DA 3WGYA 3WLEA 5CB4F 1ZM4A 3FNIA 4E5SA 2OO5A 3E7XA 2F67A 3C7AA 1K06A 1M1NB 3OJLA 2AKYA 3G79A 4QPCA 3VH3A 3B9RA 1LBHA 5A5EA 2ZJ0A 1VBKA 2C07A 3ZQJA 2CLLB 2C4UA 2OSBA 4Z4QA 5BWMA 2GESA 5JI3E 2IP2A 3UB3A 3HPQA 3NDJA 5EFZA 3ZH9B 4MXDA 1I6WA 3JVUA 4D02A 2ZSJA 3BTVA 3JARB 1TZBA 1I2MA 1U0TA 3Q6NA 4FLEA 3UMJA 1F7UA 1B3RA 4TMTA 3ELYA 1D6NA 1ZN8A 4R7TA 2OAGA 2Q3DA 4CIVA 5K0GA 1QG0A 1NJ1A 3IAEA 3BAFA 4I55A 2KMLA 5DTQA 3DB1A 4UFNA 3U7QB 1XA3A 2OCIA 1JR2A 5I7SA 4KXNA 4MWEA 4EGQA 3EPHA 5IF3A 4ID3A 1LZKA 2OB1A 3ITDA 4BGUA 1R6XA 4F5WA 4QULA 1DBQA 2AZMA 2ZSAA 2DPXA 1T2EA 3I1FA 1X0XA 4LSMA 1QHEA 3SVZA 7MDHA 4UW9A 4EI2A 2RE8A 1LDEA 3W9YA 1UBMS 1EWQA 5A0VA 4ALKA 1ISHA 3O8DA 2F1OA 4ZC1A 1EFRD 1T2AA 2FDRA 2BHTA 2FDXA 5DHSA 5A9TA 4NZPA 4MB6A 4B4DA 3OM0A 2OBNA 3DNPA 4RJTA 1E1YA 1JEQA 2X41A 2CMFA 1DTWA 1MVNA 2EJTA 3D3EA 4EY6A 4LRXA 4V0NA 2VDLB 4R2KA 5DRYA 4XRGA 3NTOA 5HZGA 4DCPA 5H70A 1OTYA 1RTKA 5BQPA 2HMWA 1APBA 1KU0A 1USUA 5J63A 2GNOA 1RIIA 4MKFA 4BTEA 2D5CA 2W2OA 1J99A 4KX5A 5G4KA 2VWGA 4FINA 4NONA 4YA6A 2R1TB 3FF1A 2XWPA 1GFZA 4KIGA 2V8BA 3TQFA 3QJ5A 4XYGA 1KK3A 2VL7A 4QOFA 4BUJA 3H5WA 1LA2A 2VZ0A 1ZIXA 2WFLA 1OYYA 3GZNB 3NFYA 4WLUA 2PYIA 3UATA 2X22A 2NYRA 4MVWA 3TKLA 1J1IA 1JEEA 4HC4A 3WJ7A 1BFKA 4I1PA 13PKA 2WUEA 1HUQA 3FUTA 1G8JA 4PZLA 3DT9A 3OBIA 1U9JA 4UEQA 2YIMA 5CK5A 5AK4A 2JCYA 1K89A 1XN1A 3FX2A <