4TZ0A

Dead-box helicase mss116 bound to ssrna and gdp-bef
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
508
structure length
508
Chain Sequence
b'SKLIHVPKEDNSKEVTLDSLLEEGVLDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLINTKFDSQYMVKAVIVAPTRDLALQIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKNSKSADNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIAKQEKYEPSEEIKSEVLEAVTEEPEDISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDKLGLSRSPIGKAMFEIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent RNA helicase MSS116, mitochondrial
publication title Molecular insights into RNA and DNA helicase evolution from the determinants of specificity for a DEAD-box RNA helicase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein/rna
total genus 160
structure length 508
sequence length 508
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2014-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tz0A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tz0A02
3EASA 5TDHA 1U9IA 4XH9B 1VYVA 2XJ9A 2J87A 5K8LA 3Q8XB 4F7WA 3QXJA 3AF2A 2J0UB 4L8GA 4GOJA 1MKYA 1U9IC 4LDJA 1FZQA 4DUGD 2DFLA 4TZ0A 1YR6A 5KDLA 4R71A 1QHSA 4I1OA 4AKIA 2JJ8A 1T0JB 3RSLA 2REOA 4RCZA 2TMKA 4V03A 4ZDJA 3BOSA 2OM2A 1KSJA 4JLVA 2CXXA 3IBGA 2Q9AA 1DARA 4ITRC 1J99A 1EGAA 4JYBA 1XB2A 5UKDA 1KMHA 1C1YA 1E2GA 1Q3HA 1TAGA 2QT1A 3GJ7A 2XITA 1E9FA 3ND9A 4GMXA 3MRSA 1F2TA 2JATA 2XNSA 2WIAA 1UF9A 3SYLA 4PTLA 3X1WA 1NG9A 2C95A 2PCLA 4TN1A 2CBZA 2D2EA 1Z83A 2W58A 4TLBA 2JLUA 5CIWA 4C7OA 2FZ4A 2IL1A 3C5CA 3UG6A 4HUTA 5P21A 3WBKA 3KQUA 4WA7A 3VR1A 2F1JA 4AK9A 1AN0A 1T5LA 3AKYA 4CRWB 4DT1A 2IEYA 4A82A 4ZIRA 2D7CA 3RS5A 4AWXA 3QF4A 5JECA 4KFRA 4IOLA 4L9SA 4B47A 4B6EA 5BXQC 3RDPA 4EQ6A 4IVPA 4S35A 4NDZA 5KSYA 1UEIA 2HXSA 1YE8A 821PA 1AZSC 4Q5IA 2XXAA 1E2EA 1PLJA 4FW9A 4LSGA 1Q57A 4HB2A 4AYXA 1UKZA 3VU9B 4I1SA 1HURA 1G7RA 1OXTA 5FPSA 4QXAA 3GLHE 3BGWA 1GTVA 1UBCA 2QPTA 2NO1A 1Z06A 2LCFA 2C9CA 2O0JA 3HR7A 1DAKA 3NH9A 4A1FA 1KO5A 1S8FA 3UATA 4X8LA 1XMSA 4QOSA 4BFUA 4PAMA 3AEZA 1YJ5A 1XXHB 4IDOA 1HUQA 2BIFA 2BC9A 2B92A 3AF4A 4XD7D 5JZVA 3IEVA 3UMRA 3WNCA 1R0XA 1XMIA 2GXSA 4P4SA 4TYPA 3KB2A 3MCAA 3TBKA 3FVQA 4V02A 1KJZA 2XAUA 2D74A 2ANBA 3P27A 1Z0IA 3JVVA 4C30A 3EZ2A 3M0EA 2A78A 2P5SA 1YZGA 5G3ZA 3WYAA 1W0KA 4ZCIA 3CZQA 3H4MA 2F7SA 4KV9A 5AR1A 2O8BA 4RD1A 4OJQA 3I62A 1XF9A 1GDDA 1KI2A 2PMKA 4G5OA 5FOXA 4CT4B 2FEMA 3MMPA 5C4GB 1KI8A 2H1LA 4Q4JB 5FPYA 4FMDB 2F1HA 1JECA 1JBKA 3MWLA 5FTJA 5KNDA 2PT7A 4Q7KA 3FOZA 2PX0A 1E1QA 4RZ2A 3HDTA 1OH5A 5BN3A 4B44A 1EXMA 1TU3A 2P0EA 2P6UA 3EZFA 5FUYA 3BBPA 1XTSA 2QGZA 5HR5A 1DS6A 1SZPA 4MYTA 4P3YA 5L3VA 1CF4A 2FV8A 3GMTA 4LC0A 1Z0DA 3V4RA 4JJKA 4P4TA 1QHHA 1ZM3A 3TSWA 4URXR 4Z54A 3ZLJA 1GL9B 2CCKA 3U4QB 2ZYTX 3VR3A 2CL6X 4JL5A 4W9MC 4URUR 3NTUA 1Q21A 1Z0AA 3U3KA 1A2BA 2REBA 1NRJB 3C5HA 4DSNA 3AVWA 4DDTA 4FN5A 2IWRA 4DIEA 4KSBA 2R6FA 2D2FA 4XVQA 3C14C 2P6NA 2AXPA 5BW8A 1OPXA 2HT6A 2QT0A 2F9LA 4URVR 2A5YB 4NYJR 1S9DA 2E87A 4F93B 2ZS8A 4JJZA 1RJ9B 1FNMA 4RD2A 5HE8A 1FNNA 2OV2A 2R62A 2OESA 4HYYA 1E2LA 3OEHD 5CB6A 2ZRAA 4PZLA 3I1FA 4IDHA 2ZAMA 3IIKA 1HQCA 4NH0A 4TL8A 2JLQA 4AIIA 4M9XA 1W46A 1JR3D 4LJ5A 4D6PA 1W44A 2V4ZA 1XZQA 1W4BA 1ZC4A 3FKQA 3EPJA 4A36A 2AN9A 3W9YA 3O8DA 1W2GA 3T1VA 1QHXA 2AWNA 1KTVA 3BH6A 3QKRA 1IN5A 1O87A 2JIZD 2CLSA 3BK7A 4M4SA 1HYQA 4JZKA 2IWHA 2WV9A 1R0WA 2ZAOA 3SQXA 4BRUA 3AQ4A 3GLFA 1MABB 4MKHA 4JS0A 2R8RA 4ZPXA 4PPQA 5DYIA 1TPZA 2XTNA 4LZZA 4M9QA 1D8TA 1QHIA 5JJKA 2WOJA 1Z47A 5FR2A 1NSFA 1PLKA 4ZKDA 1U0LA 4CDGA 1LF5A 2C77A 5H1YA 3GLIB 4QHTA 2VHUA 1JPNA 5E4FA 3S1AB 3THWA 4MYCA 1KO1A 1ODFA 2HF9A 1TNDA 2WM9B 1COWA 1JQJC 4M1MA 4MITA 2W00A 5KHOC 3QKUA 2MSCB 4RSGA 5FR1A 3WYGA 3QPWA 2XJ4A 3QJYA 1LF0A 2PH1A 3A1WA 5G40A 1MRNA 3V9PA 2VP9A 2R6GA 2OAP1 4B33A 4MUAA 5ANRB 5TY0A 4TQ9A 1N3BA 2QBYB 3KFXA 4B2LA 3IDQA 5FPTA 3TSZA 1ZIOA 1MV5A 3JZMA 2WJHA 1CKEA 4NP6A 2J45A 4JMPA 4TYQA 3LBIA 4ILEA 1D2MA 1ANKA 1WP9A 4TMZA 5FOTA 5J47A 3EG5A 4POAA 2QPAA 4KSCA 1DADA 3FHCB 4EPTA 2IUUA 4WZBE 2F3TA 2OFXA 2FGKA 4HAZA 1ZP6A 3HJNA 2WBLC 4AYWA 3R20A 3IUYA 1Z6YA 4QC2A 4BLSA 2VHQA 3KUDA 3T5GA 4GL2A 1NVUQ 4KXFB 3ZVRA 2BKEA 2XZOA 1AKEA 2VP6A 4F4JA 2YYZA 4GZLA 4DDUA 2ANCA 4HZIA 4DLRA 4FI3C 2C03A 4EKDA 1DO2A 1RRPA 1D2EA 1ZIPA 1V5WA 2ZS9A 2ZVQX 4JVSB 4Q9JA 3NVAA 3CWZA 5EXXA 3QBVA 3TVDA 3KQHA 2IXGA 1UM8A 2DHRA 1LW7A 3LFUA 3TGPA 1DTSA 3HU3A 5LD2C 1NKSA 2WPDD 1L2TA 1NLFA 5F98A 3KJEA 2GXQA 3REFA 2RAPA 3NWJA 1VG8A 2WMNB 4OQLA 1W0JD 3T35A 5FTKA 1OF1A 5CYPA 2J41A 1CEEA 1RIFA 1LV7A 2WJYA 4C0JA 4AG5A 1OB5A 4OL0A 2AFIE 2GWHA 1MR3F 1Z29A 4S2EA 4HAXA 3MGCA 3VHXA 2WMOB 1JI0A 2AK3A 1IN7A 1E9SA 4KVGA 2XX3A 4W5HA 2ZI3A 1JR3E 1LY1A 4RD6A 4DCSA 4KBGA 1CJUC 4KODA 1KOFA 4ABYA 1CS4C 4KCGA 4F92B 3R9XA 4WVFA 4NKRA 4LYAA 3GJ6A 4DLYA 3W8NA 4MDEA 2FNAA 2ZPTX 2GCPA 2VEDA 3H0KA 1E96A 4LYFA 4Q47A 3RYTC 1NKTA 2DCUA 1G17A 5KSZA 2GRJA 3IPXA 3UKDA 3UPUA 3G82C 3GFTA 5GVSA 4OQFA 3EWAA 1MH1A 1R5OA 5JWRA 4NONA 1CXZA 3QKSA 1K6MA 4FWIB 1FFHA 1JAHA 4OHVA 5JWHA 5J40A 4ZKEA 1EWQA 5TB5A 1FW6A 2GCOA 4EJSB 1OXXK 3QXXA 1DAEA 5AUPB 2JDIA 3EC1A 2P2LA 1DAHA 2EYQA 4JVMA 1NN0A 1Q1QA 1P9NA 2ZS7A 5DN6D 2O5VA 3D8BA 1MT0A 1G8FA 2ZI5A 3B1VA 1BMFD 4HLCA 5AJXA 3MWYW 4PSVA 3PENA 4PQYA 4US0R 1Z5ZA 4BECA 1KI6B 4JLMA 5KTYA 2F55A 3CZPA 4UKDA 3VKWA 1CTQA 5JS7A 2KBFA 4CEHA 5G53C 4TQUS 1J8MF 1ZW6A 2RB4A 1X3SA 1MO6A 4JBYA 5HKKD 3MUFA 1VCMA 3RRYA 5E3HA 3TR0A 4NZYA 3QE0A 1XCGB 1SHZA 3EZ6A 2AD5A 2V3CC 1P72A 3C7KA 1XEWX 4TTQA 5KSPA 4D25A 2GJAA 1SXJD 5AUOB 1NIPA 1ZM2A 3PEUA 1SULA 2CCGA 1CR2A 1J70A 1TQ2A 4DLVA 2BCGY 2YC2C 3U44A 4HLDA 5BWMA 4DSTA 1OKKA 1TEXA 3EARA 3F3YA 4PPNA 4CGZA 5EQTA 1E0KA 3GEIA 4XIGS 4M9SA 2ZJ2A 3X1XA 5LDDC 2WAXA 2CVFA 3W5IA 2QTFA 4DB4A 4M1TA 4TMKA 2N1BA 3B1ZA 1CR4A 1G3MA 3CX7A 3LLUA 4JBXA 1P73A 2ZM5A 1W36D 2MSDB 3KFVA 1RVDA 5IHPA 4CF7A 1R8SA 1SKYB 3OE7A 4AKHA 1P75A 3MJRA 2ZVPX 2X77A 2O8FB 1KI1A 3U7FB 4NTZA 1N2CE 3K0FB 3FDIA 4BE7B 3OIVA 3NBYC 2G88A 2CJWB 2J9RA 3LNCA 4IXMA 521PA 2NZ8A 3UANA 5G41A 2WWWA 3CWQA 3KJIA 4PQFA 4RJLA 4MGIR 1SXJB 4E09A 3KQNA 1AS3A 3CIOA 5CIQA 2BOVA 4FMCB 2QI9C 1F6BA 1ONBA 2JJ2D 3PUYA 1OHHD 3LBNA 4FD2A 1Y63A 3T1QA 3UG7A 1NBMD 3KKNA 4BLQA 3AB3A 3CPEA 3ZQ6A 3U3OA 2J0SA 3SC3A 2W6IA 2O8CA 1II8A 3P26A 1R0YA 2IEZA 2VHCA 4M21A 5EE0A 4QBGB 1KJYA 5FOWA 4Q01A 1W36B 3H2YA 4BLRA 4V0LA 2NMVA 1VPLA 4O0MA 2PLFA 1OFIA 3CX8A 3FYHA 4Q1EA 1DAIA 4DRZA 4LV6A 4QBFA 2F6RA 3QEJA 4JLKA 1MRSA 1DAMA 3BFVA 1RRGA 3LY5A 5DHFA 1W5SA 4B3GA 2CL0X 4B75A 1PZNA 1L8QA 3NHBA 2QTVB 2ZRKA 4Q19A 4V0KA 5IF9A 2G1KA 3BB4A 3MAAC 5DI3A 4KVAA 4D0LB 3PR1A 2G0NA 1NF3A 1RW4A 2JLSA 4L5BA 4D81A 1XTRA 1XMJA 3QBTA 2QG6A 4QGHA 3X1ZA 3RWMB 2D06A 3LXXA 5IDVA 3SHWA 2HYDA 3R7WB 4DLTA 2NO9A 2GEUA 5L3SA 1JEEA 1SVIA 3AP2A 4EPRA 3FMFA 1X8JA 1YZKA 1GUAA 4Q1FA 1CULC 2WWXA 3K0AB 3UXMA 1M1YE 5FPKA 1GRQA 3A8TA 2A9KA 3K0CA 1VIAA 3NDPA 5F9FA 2RGGA 3VTKA 2Y8EA 5LPNA 3QVUA 1ZVQA 1G3RA 1YR8A 2PEZA 5FBVB 2EFHB 4LCBA 3K09A 3SQWA 1Q1ZA 4B35A 1G8PA 3VR2A 4HDOB 1YHNA 3FHOA 4OI2A 3VKGA 2HCJB 3EX7C 1Z0KA 3K09C 1EFHA 4N0EA 4BPBA 4DHEA 3U7EB 1XTJA 1FX0B 4BFZA 2O52A 1QG4A 1GL7A 4RFSB 1L4YA 2VL7A 4JL8A 2ORVA 2ZU6A 1DE0A 1N25A 3FFBA 4LJAA 4MYHA 2ZREA 5H8WA 1XZPA 1G21E 3SS8A 4QJ4A 2P6RA 1NVXQ 2YC4C 4TLAA 1QVAA 3KQKA 4PAQA 2VP0A 3DPUA 3AVUA 3W3ZB 3HWSA 4YDHB 5AWFC 3NDBB 2AL7A 1G3QA 1TTTA 3LO5A 1U2RA 3A4LA 2FPLA 1HEIA 1IBRA 4D0NA 5FUWA 2JLZA 4FMCF 1II9A 3KXIA 4TYNA 3BAFA 3AUXA 4B76A 2PZFA 4Y0AA 1C4OA 1EFCA 4PO8A 3TE6A 5A5GA 1SVLA 4P0TA 2ZRCA 2AKAB 3KKOA 3Q5EA 2AX4A 1Z8FA 2IS4A 3X1DA 2VRWA 4PZYA 3TK1A 3PUXA 4B34A 1J7KA 2DR3A 1XD2B 1JAIA 1NY5A 1XTIA 1RYFA 4PPGA 4Q00A 4FWTA 4JKYA 3OEEA 4KFTA 2FX3A 4OQNA 1E1RA 2EW1A 2UKDA 1U8ZA 2I1VB 4BLPA 1XNJA 2J0QA 3ONWA 3AUYA 4DCTA 3AV0B 1WMSA 3IO5A 3R8FA 5FTMA 3ASYA 3WYFA 1W5TA 2GNOA 4XTCS 4TMTA 2IUTA 5EXSA 4IDPA 3U61B 4B2PA 4HZUA 2IYLD 4Q7MB 2FA9A 2DWQA 3NHAA 1J8YF 5KPDA 4LBWA 2V6IA 3MJHA 4TSFD 1SQ5A 2O8DB 2FU5C 4Z1MA 1XJQA 4HUQA 1M7HA 4EPVA 4DB2A 4YXWD 1NVVQ 1XEXB 4PR0A 1OXSC 2GHIA 4QRHA 5FL7D 5EJEA 4US2R 5DN6A 5IRCD 3HYTA 4OQMA 3QIAA 2ASEA 2ZJZA 2VYFA 2GJKA 3AKDA 2A5DA 4FXPA 4QL3A 4IOKA 1II0A 3BWDD 1VG0B 3DVLA 5EE9A 3KQLA 2IC5A 2FFBA 4HATA 1YR7A 5H68A 1G5PA 3BE4A 5JSZB 3TLXA 3GLHB 3CW2A 2G0TA 4RFVA 1H8ED 4G3XA 2ORIA 4LPSA 1VHLA 1TEVA 4NYJQ 3BS4A 5DLQC 1S1CA 2GF0A 3RRZA 2QE7A 2CE2X 2KJQA 4D82A 4M0LA 4DCNA 1S0UA 3LH5A 4KLNA 2ZTSA 2IF2A 1G1MA 4R9UC 2IBMA 1T9HA 3PQCA 3AKEA 1NJFA 1CJKC 1VYTA 2YOFA 1SVWA 2WSSA 3SYNA 3LRPA 1F2UA 1IQPA 1KDRA 4BLOA 4WXRA 4DJTA 1WF3A 2B8TA 4MQBA 4BZPA 2B7CA 3T1TA 4B32A 1R10A 1OH8A 2IS2A 4H9GA 3N2IA 3ZZ0A 3GFOA 4DEYA 2Z4SA 1GSIA 2VIIA 4M1SA 3UWKA 5FUVA 3FMPB 4D4KA 4UNNA 2ODBA 1AK2A 2ZJBA 1KNQA 2VLIA 1G5RA 2VF7A 2W6JD 4GOKA 4QFMA 1WCV1 3ICQB 3EA0A 1Q44A 1U0JA 4NPHA 4P33A 3ZD6A 1EG7A 1W36C 4YQFA 2O8EB 1E79D 3K9HA 4OI1A 3LW7A 3KJGA 4DCVA 2C9YA 2FSHA 2FGJA 2ONKA 1GM5A 2QMOA 1DO0A 2J7PA 3PG5A 3AVVA 3AVXA 4LJ6A 4HEJA 2VTKA 2JA1A 2ATXA 4MRNA 3CRRA 3RLFA 5J4YA 2QP9X 4JLJA 4DLWA 2JJ2A 5L3QB 2FZLA 2K5UA 2ZRBA 2DBYA 1HTWA 4C0AC 4GFDA 1GKYA 2DYKA 2BDTA 1Q3TA 1ZU5A 2F43A 2GZDA 3N2EA 2P3SA 3SR0A 1KK3A 4ZV4A 4Q4AB 3THXB 1L4UA 1DOAA 3CNNA 3LX5A 5D3MA 1VDZA 1D9ZA 3PXGA 4YDSA 3HU1A 1HT1E 1RC8A 2CE7A 4H1VA 3K70D 3M4YA 4A8JB 2NOAA 3GLGA 2JJ1A 3GJ0A 2GK7A 3IPYA 1X1RA 2ZRIA 5HTKA 1Q1EA 3L82B 4NYIR 4BFYA 1VCIA 3KJHA 2NO0A 1T6NA 1ZMXA 4CT5A 2QSYA 2CNWA 5GVRA 721PA 3JVUA 3FWYA 2V55B 3TNFA 1ZM9A 3H86A 3GPLA 2QUZA 4LBZA 1E2MA 1AM4D 4WBSA 2CL7X 4GMDA 2WWFA 1KZ7B 5C46F 2IYRA 3EA5A 3QPUA 3RS4A 2IK8A 5TMPA 3DO6A 3RRNA 2ZSDA 4Y0VA 3KKQA 3U5ZB 1UJ2A 2RGEA 2E9SA 3QOFA 3KX2A 5FTLA 4XJXA 4LBYA 1A7JA 1QDEA 3LW8A 4BFWA 4F4CA 1IHUA 5JJIA 3QQ5A 5J4HA 1FTNA 2WKRA 1Q1BA 2FMXA 2BMEA 3T1OA 4A6PA 1P9WA 3K70B 1YZLA 1Z6TA 2G6BA 3GLFE 2AWOA 3AGQA 2VSXA 4OI4A 4TTPA 1BKDR 4A92A 1KY3A 3FKSA 3FMIA 4LYJA 3WHKA 2EVWX 2I1QA 3ZH9B 4BASA 3B5JA 1OYYA 2W2XA 5HCNA 2IS6A 2C8VA 3PEWA 3B60A 3UIEA 2QM8A 4UNQA 2A7QA 5KNBA 1E94E 5E7MA 2XZLA 3ZZUA 4LBVA 2D4HA 5FI0B 5BYJA 2ZI6A 3PVSA 5IK2D 2HT1A 3NIBA 4HI0E 1NJGA 5L3RA 3OAAA 1G6OA 2W0SA 4CEJA 2DPXA 4Q9IA 4LJ4A 1QVRA 2ZJAA 2BBOA 4BFSA 1WE2A 2BMFA 4TTRA 1T3LA 2Q3MA 4XWKA 2DY1A 5CB8A 4FCVA 4Q02A 1P4SA 4HB3A 1GL6A 1N6NA 3LA6A 4QHSA 3SBEA 4GDFA 1TF5A 2Q21A 1DBSA 3VKHA 2YWFA 1E9AA 3IEUA 1P6XA 1KI7A 4ZO4A 1T3SA 2XNDD 3QXCA 1N5KA 2ZSEA 3MD0A 2HEIA 3EC2A 2IYUA 2GVZC 1F3OA 4OI0A 4HSEA 3TVTA 1NLZA 4C0SA 2GCNA 4NCIA 1SHKA 3OESA 3QUSA 3BH0A 3A4MA 2ZITA 1XX6A 1Q12A 1XTQA 3P32A 1OFTA 1KAOA 4OYHA 1G9XA 4Q4HB 3DKVA 3LQQA 4A0FA 2YJTD 2X1VA 4TMXA 2HLDA 4GSYA 1BIFA 2WJJA 3SJZA 4M1WA 5FL3A 2CK3A 4A2PA 2ZI4A 5AJYA 4DSUA 2XGJA 1VYUA 2VSFA 1GWNA 1JQLB 1Z6GA 1W4RA 2QAGB 5AJVB 3QENA 4LK2A 2GZHA 3KL4A 3A36A 4YC7A 5EZ6B 1FMLA 4I1VA 3A1SA 4C0HA 5JRZA 1AS0A 1ZD9A 3DMNA 4QNMA 3UMFA 4B3DA 3RHFA 2ZSAA 1US8B 1Z2CA 2J0UA 1E9BA 2ODWA 5JMTA 4WOPA 1TF2A 1JB1A 3GEEA 2H18A 5AUQA 1H8HD 1UBGA 1W49A 4Q9HA 2BBWA 2CLCX 2V7QA 3T5DA 4D4LA 3WNDA 3KTAB 4F91B 2HF8A 3VX4A 3W90A 5EZ5A 4PC7A 5CLLA 3OF5A 4PQRA 4FMDF 3SEAA 3CR8A 4EFMA 3ZVLA 1M2OB 4V0OA 3SU8A 1AQUA 1KAGA 1Q20A 2V8OA 6Q21A 2H5EA 3LAWA 1VCNA 1QG2A 3W6NA 1E9EA 4Q1CA 2YOHA 1R0ZA 1X86B 2J3EA 3CRVA 3I32A 3M6AA 3R8CA 2X2EA 5GJVC 1MO4A 2IA5A 1E99A 2KSQA 3H1TA 3LQRA 1UDWA 1N6KA 4Z8XA 1T5IA 5SZHB 3SHFA 3TW8B 4EFNA 4OHYA 3B1WA 2R44A 1HY3A 3ZIAD 1I4LD 4K46A 4DUGA 3TUIC 4BLTA 2WICA 4LJ8A 4RZ3A 5JCPA 5KDOA 4HLUA 3B85A 2W2VA 1E0AA 2OBNA 4LV8B 5FUXA 1KK2A 5DE3A 3I73A 3QF7A 1NP6A 3SJCA 4DEXA 2GXUA 4HLUC 3VU9A 4JT4A 1NIJA 2BBTA 1X6VA 1EWRA 4IDQA 2C04A 4GOXA 3UMSA 2IYXA 4CEIB 1Z22A 2R6AA 1ZM7A 2ZU0C 3AVYA 3C8UA 4A8JC 4PX9A 3A37A 1D5CA 4IOJA 4D4MA 3U3RA 2ZJOA 3AF3A 1GKIA 2QRNA 1XXHA 1WDTA 2YINC 3KKMA 3P20A 3VMFA 1N5LA 2CLDX 3VR6A 2ATVA 3EIQA 3SI7A 2ZSFA 1D6JA 5IT5A 3N70A 2GA8A 1CRQA 2GF9A 4DBLC 2GDJA 1S9HA 4LYHA 4LOAA 4I4LA 3ZS8A 3THYB 1P3JA 1HA3A 2EYUA 3B13B 2OHFA 4TQAA 1T0HB 1J2JA 3GJ3A 3IQWA 3TW4A 4QGFA 5HZKA 3KB1A 5EP1A 2WSMA 1XP8A 2O0HA 4KLZA 3ZVNA 2JASA 1UKYA 1GFIA 4TL7A 5E95A 3NXSA 4MRVA 3BC1A 1OJLA 2LWIA 1XJCA 2ORWA 3CO5A 1XBTA 4Q4JA 3D31A 4JLDA 1KMQA 3CUEF 4NYMR 4LHVA 5CDFA 2D7DA 1K5GA 3CLVA 3DM9B 5CM9C 2IYZA 4LUCA 2AK2A 4RY2A 3K70C 1JEDA 3CX6A 4D0GA 4IEIA 2C98A 5D3QA 1Z28A 4EDHA 2H16A 3AVOA 1D2NA 1FL9A 5DISB 3AP1A 4XD7A 2XTZA 4G5QA 1GILA 4BEBA 4D4JA 4DXAA 1ZNYA 4DLXA 2WWIA 1KK1A 5KDDA 4B74A 1SVKA 3B9PA 4ASUD 2HXYA 4YMVA 5HPYB 5JBQA 4CVNA 2A2ZA 1JXMA 3MG9A 2QMHA 3EZ9A 3TRFA 4UJ5A 3SDZA 3TAUA 3B8HA 4F4IA 1S3GA 1LS1A 1P7CA 1OH6A 4AKEA 1JXOA 5JLJA 2AHOA 2IS1A 1QHNA 2OILA 4UXIA 4XWOA 2ZJ5A 3RS0A 1NLYA 3Q7QA 4PSKA 3EZ7A 1ZC3A 2RGXA 4KU4A 4OK6A 5C4MA 4Q48A 2PL3A 3L43A 4Q1DA 1EFRD 4X8OA 2XSZD 3BORA 1ZJ6A 2V9PA 1IY0A 3P4YA 1Z63A 1ZU4A 3K8YA 4C0BA 4M1OA 2GVDC 4TT3D 1E9CA 2FN4A 2OXRA 1RJ9A 2A3RA 4G5SA 4ARZB 1P9RA 2VA8A 3FB4A 1KI9A 2Q6TA 3GCGA 4G01B 1NMXA 1IN4A 2V6JA 2FSFA 1HH4A 1Z0FA 1N6PA 2XOKD 3L0SA 5JJLA 3X1YA 4EUNA 2IYVA 3SN6A 2WWHA 3IIMA 2QAJA 2ZQ5A 2VHJA 3KUCA 5C18A 2VSOA 3BRWD 2VPPA 5FBRB 2QROA 4L4UA 2BVNA 5FOSA 2KB0A 4BEJA 1O3YA 2XB4A 1KK0A 2SHKA 4M2LA 4XTRA 2OE2A 5M04A 4V0MA 2ZE7A 2JLXA 2H92A 1MABA 3GEHA 4URZR 1W7AA 4J0QA 2BHRA 2A5FA 2WAYA 1YQTA 3F0TA 2YWEA 4FCTA 4UXHA 3PUZA 3HP1A 4TYWA 3OFND 2V54A 1XDBA 3O8RA 2NO7A 2Z43A 1Q0UA 2VHTA 5TXGA 2ZR7A 1KYIA 1G291 1T91A 3GLIA 3AGPA 2ZUCA 1W4AA 5BN4A 2ZRHA 1QF9A 1G8HA 1CU1A 2AD1A 3KKPA 4U5XA 3BJIC 1IOZA 1NVWQ 3S1AA 3K0SA 2GKSA 3Q72A 2BEJA 2QTHA 2F3RA 3BXZA 3OEHA 4RD3A 1PLLA 4TLCA 2ECKA 1JR6A 3QEOA 1T8TA 4QJ5A 3ETLA 2X8AA 5TARA 1JR3A 5HCIA 3LWNA 4JIMA 1V43A 3WMEA 1MOZA 421PA 4RCYA 1RRFA 2UZIR 1UKEA 4XSGA 3SE0A 3EPHA 2OCAA 2OUKA 2I4IA 1I2MA 2KWIA 2JIZA 4HDCA 4B2IA 3E2IA 1LS6A 2QBYA 1OIWA 1W48A 1XPOA 4DKXA 4DWJA 3SOPA 2VQSA 1S1MA 3EXAA 4Q1AA 1TF7A 1Z6AA 3I4LA 2HDNB 4NL4H 3KXLA 2OZEA 2DWOA 3PITA 4R2HA 3D6TB 1GNRA 2YWHA 5K8IA 3ZZTA 3EIEA 1YZQA 2R6DA 3W6OA 1XEWY 4R7ZA 2R6CA 2IYQA 2GK6A 5DO9A 1G4UR 1I4TD 4MRSA 3OIYA 1G3UA 3QVVA 4IFEA 3RANA 1A4RA 3PCRB 2HJGA 3HU2A 4DDWA 4FMBB 1S3SA 2WWGA 1Y3AA 5TV2A 3MSXA 2QA5A 5JS8A 1KMHB 4YMSA 5BYKA 4Q1BA 3AKCA 4TLDA 2ZXUA 1Z07A 2B6HA 1F2TB 2JLRA 2BCJQ 2R9VA 4BZXA 3TUZC 4TWZA 3RABA 1ZYUA 1Z0JA 4C7OB 3OZXA 3PFIA 2C9OA 4BFVA 3BERA 3B1XA 1U98A 2R2AA 4YMWA 1H65A 3RC3A 3U7GA 3EIHA 4DT1B 4JLNA 3DDCA 4ZIRB 1IN8A 2EFEB 2BJWA 4DVGA 1K5DA 3QF4B 5G3YA 1OSNA 1RRCA 1DVRA 3DOFA 1HE8B 2XEXA 2DFKB 3ND8A 4LY6A 4EQ6B 2OFOA 3SNHA 4BFXA 3THOA 1BYUA 1W0KD 2IYSA 4Q03A 3IO3A 3JZAA 2XXAB 1E2DA 1E4VA 1YU9A 1GAJA 3HYRA 4LI0A 1YZNA 2IYYA 2YV5A 3VX3A 1PUIA 4NCNA 1NG1A 2EFGA 2N42A 5B2ZA 5DSZA 2BBSA 1U94A 5LB2A 4CW7A 1F60A 2F1IA 2ODNA 3SFZA 3BFXA 4MYUA 5B57C 4M1YA 1E1QD 2WPDA 1CIPA 3EPLA 4GNKA 4I81A 4BUJA 2ZE8A 1D9XA 1CP2A 1W2HA 3AVQA 3FPAA 2GBLA 1KDPA 2QEQA 3L0OA 5E7IA 1W0JA 2V1XA 3ZQJA 2IXEA 5AK0A 4DSOA 4RVCA 1AKYA 4P4SB 4NHOA 4OK3A 4L16A 2GBLC 2WKQA 4PFSA 4WXPA 3ADBA 4RZUA 5GJWC 3RSOA 4EJSA 2JLWA 1T3HA 2ERYA 3V4FA 4MDFA 2YVUA 4US1R 3SJAA 2CHQA 1WBDA 2Q9CA 4LC1A 4LHXA 4Q9KA 2O8BB 1KDTA 1UKVY 3I92A 4JLPA 4HB0A 4EJSC 3LLMA 2VP2A 3VNVA 2PMDA 3WXMA 3F8TA 2PLRA 2QM7A 4GZMA 4LGMA 1J90A 5J5CA 1KI6A 2OCBA 3K9NA 1IONA 1KZGB 1R2QA 2EFCB 2RGNA 1AS2A 3RNLA 3IHWA 1U81A 3DMDA 2F1RA 1OB2A 5E7JA 2IX3A 2R65A 3A58B 5B30A 1FOEB 2NPIA 2RGNC 3WMGA 4RZXA 3A1TA 4QM7A 1P2UA 1ZNWA 1UBFA 4MKGA 2GEVA 2FWRA 4IHQA 5CYOA 1I2DA 2FJUA 1P5ZB 1E9RA 2P65A 1ZCBA 1PJRA 2IHYA 5LBIA 3I5YA 1T8UA 4HAWA 5JWOA 1QHHB 4IRUB 2Q0HA 4QG7A 2AR7A 2O0KA 1PVOA 1KI4A 3RVBA 4ZDIA 4NMMA 2ZYWX 5DH9A 4CYMA 2CMKA 3OIUA 4G0NA 4HAYA 2HUPA 1TX4B 3B1YA 3D3QA 1CJTC 4ZI3A 4XWAA 1XWIA 3GFPA 4NCKA 2B8WA 1BMFA 1E4YA 2GAAA 3VHLB 1E2IA 1R8QA 1LNZA 2NIPA 2WOOA 5JEEA 2IYWA 4JLOA 1N6OA 4W5JA 1FMJA 4PZZA 4GPTA 3GLGE 2O8FA 1TU4A 4QGGA 3U2QA 2XZPA 1YZTA 3K0FA 1YVDA 5HKKA 1SVSA 4JSYA 1YKSA 4P32A 3SJBA 1CJVC 1N6LA 2CJWA 2FOLA 2KE5A 2J7KA 2ZR0A 4XVUA 4E22A 1AIPA 1NI3A 4M53A 3BB1A 1TUIA 5AJZA 1SXJA 3TKLA 4D26A 1ZBDA 1COWD 1E0SA 2OCPA 2RGBA 1XJ0A 2WZQA 3IGFA 3AVTA 1G8YA 2G1JA 2G77B 1NNEA 3G0HA 2KBEA 2GESA 3G5UA 1SXJC 2OSBA 3LD9A 3E70C 4LJ7A 4NE2A 4OBEA 4ACBA 3QKRB 2VH5R 2PEYA 3GJ4A 1KO4A 2A30A 4TL6A 5EP2A 3UWOA 2OLKA 3LVQE 2LKDA 4LX0A 5CLQA 3L8YA 2RGAA 5C2JB 3GLFB 1DAFA 5EE1A 3DZ8A 1QZXA 1IJFA 1R5NA 1E6CA 2NQ2C 4MA4A 1EK0A 1XD8A 4LJYA 4GP7A 1MO3A 1BO6A 1WRBA 4IDNA 4N3NA 4E5UA 4UQOA 1FQJA 3VNUA 1MO5A 3MWJA 4HAVA 3THWB 5JHGB 2GEDA 1U99A 1GRRA 1XFAA 3RRMA 1K8RA 2ZRGA 4JKIA 1TUEA 1XCMA 2NPFA 5KUTA 3K1JA 1OHHA 4UXJA 1NBMA 1LVGA 2EU8A 1GRNA 3K9GA 3R7WA 3QY0A 3I3SR 3MFYA 3WNBA 1HQYE 1OXUA 1S2MA 4JYCA 5CK5A 5AJWA 1CR1A 1A2KC 3K0AA 1DELA 1VCOA 5BN5A 2OCYC 2EWVA 2DFNA 5SZKB 4M1KA 1HE1C 1YRBA 1XD9A 4QKQA 1R5BA 1B0UA 3SZRA 4OHZA 1GVNB 4EPYA 2BMJA 1ZM4A 2EWWA 3IKJA 2RKOA 3CH5A 3RC8A 8OHMA 2D3WA 5L8VA 2ZRNA 1N0UA 4A0HA 4ESHA 1FX0A 2JLYA 3QNUA 1KJWA 5JCZA 5JHHB 1WA5A 3NEJA 4QBHA 4RFSA 1M7BA 3GQBA 3PJRA 1XCPA 2H57A 3VFDA 4JLBA 1KY2A 4IVRA 3T34A 5LD2B 4ZI2A 5EE3A 1W47A 3LV8A 2RHMA 3CPHA 3GD7A 1KHTA 3C4JA 4DLSA 2ZIAA 3TR5A 1NMZA 3ADCA 2QL6A 4C0QC 4KYUA 3W5JA 1UDXA 2ZJ8A 3B6EA 3V00A 4BRWA 3GP8A 1IXSB 1KI3A 3U4QA 1OIVA 1GIAA 4W7SA 3KXKA 1G41A 5EUQB 1GG2A 4IXNA 2V1UA 2JDID 4C4PA 1XD2A 2FFHA 1KKMA 3CBQA 2GTPA 3I8SA 2BMDA 2ZJYA 4NYMQ 3QKTA 3FFAA 5CITA 3LBHA 4JLAA 3W8RA 4M9ZA 2RCNA 4NBSA 4TZ6A 4RD0A 4P31A 1M6NA 3WP1B 1VECA 4URWR 4B3FX 3CH4B 1AQYA 3WMFA 3ZDQA 1FP6A 2IHBA 1G7SA 4AD8A 1CR0A 4MKIA 4ON9A 4YONB 5AUNB 1OIXA 4R2IA 3WBJA 2C5LA 1GZSA 4XOIA 2B7BA 2W0MA 2OEPA 2GJ9A 2PT5A 1E0JA 2MMGA 2WJIA 4FINA 1EFUA 4XVRA 2ERXA 5ELXA 2Q9BA 1EX7A 2YNMA 2Z5FA 1NN1A 3K53A 3PUVA 1P2SA 3W3AA 4PO9A 4E03A 5DIFA 2Q3HA 2O8DA 1LFDB 121PA 2G3YA 3QKSB 3QI2A 5JEDA 2MMCA 1XEXA 5GJCA 2AKYA 4B71A 1NVVR 4Q9LA 2OLJA 3I8XA 1XRJA 4RKEA 1NN3A 2J46A 4LHWA 2GCOB 2VF8A 3MWKA 4C0KA 1RKBA 4DLZA 4Q4LA 5K8TA 1N6HA 1HV8A 1OKKD 1HT2E 1R4AA 4H1UA 5J4LA 2A5JA 1ZD1A 2C78A 3QPVA 2J0VA 2QQEA 2PZGA 4G1UC 4QGAA 5JSZA 1S96A 3GLHA 4A9AA 2WTUA 1ZAKA 4I99A 2YKGA 1E69A 1ZD8A 2X19A 3OE7D 4ZDWA 4CEHB 1AJEA 2Z6VA 5F3WB 3NBFA 4EFLA 1CLUA 1XPUA 3AP3A 3CRMA 2ZANA 4E07A 3T06B 1XXHE 2F9MA 1SVMA 4WZAE 2W2TA 1WXQA 3U3JA 5FFMA 5DYGA 1F5NA 4C9BA 5FI1B 3O8CA 4TSFA 3RS3A 4ACAA 1QBKC 1G3IA 2REXB 1TQDA 3Q9LA 4YXWA 1DEKA 2ZI7A 5FL7A 2Z0MA 1YZUA 1SKQA 5CJPA 5C1BA 1IJEA 4GT1A 2OO7A 2FF7A 3U44B 2QRZA 1JJ7A 3SFVA 2QMEA 1U90A 3P1JA 2AFHE 4JVNA 3TH5A 1FUKA 4NCJA 2QMUA 2YZ2A 4DLUA 2QZ4A 2W6ID 4BGDA 4OQXA 3HPQA 4QNRA 2D62A 2ZSBA 1QHGA 2H8KA 4PC2A 3REGA 5B64A 4KITB 2ZRFA 4I1UA 3VR4A 5CDFE 1JPJA 1H8EA 3ADDA 4OK5A 1ZUNB 4RD4A 2PJRA 2O8EA 5EP4A 2IW3A 3RWOA 1JJVA 3CPJB 1ELOA 1TQ4A 4V0NA 2FDCA 2VP4A 2NO6A 1P62B 3AH8A 5DHAA 3TIFA 2AXNA 1G18A 2FE4A 2FH5B 2QENA 4YMUA 1E98A 4UNRA 1RPZA 3F5FA 1AA9A 1KSGA 4GI7A 1E2KA 2DFTA 2WWYA 2ODEA 4O2RA 5L3QA 3HR8A 1DPFA 1E2PA 2BEKA 4D2IA 1BYIA 1R7RA 4MRPA 2QNRA 4AURA 2WIBA 4BFTA 3ZJYA 1KO7A 2GAOA 4Q4AA 3THXA 2BWJA 4A2QA 2JCSA 4AKGA 1RE0A 4IKEA 3U3MA 2O8CB 1II8B 3DKPA 2W6JA 2Z83A 4ZCMA 5B58C 2ZRLA 3TMKA 4A8JA 4B43A 4AYTA 2PZEA 4L15A 2QN6A 4AG6A 4FCWA 3ZVMA 1E79A 1UFQA 2PX3A 1EESA 3CNOA 4M8NE 3C41J 2RGDA 2Q3FA 3NKVA 3Q7PA 2RH5A 2HV8A 5CK4A 2GJSA 1SGWA 4LV5B 4QHYA 2JGNA 1VG1A 3LVRE 3WY9A 5DI3B 2NG1A 3BB3A 3BD9A 4EAQA 2JAQA 1ZRHA 1NL3A 2EFDB 2C2HA 1M74A 1IY2A 1ZNXA 4OHWA 5K8UA 1G16A 2BV3A 3R9IA 3T15A 5F2EA 3AF1A 1WBBA 2WVJA 2IYTA 5L3SB 1OW3B 4A0GA 3L0IB 3NBXX 5CJ2A 4CIDA 4V0ME 3K0EA 1RFLA 2ZEJA 4PHFA 1LTQA 1KSHA 2ZRPA 3A1VA 3C15C 1KIMA 4G5GA 4LJ9A 5TVKA 1GOTA 4A2WA 1F48A 3N5CA 3CRW1 2OXCA 2B21A 3FMOB 3VR5A 3I72A 4C3ZA 1N0VC 3GLIE 1IY1A 3AF0A 3PEYA 3Q3JB 2P5TB 4OKSA 5DGXA 1N6RA 1N0WA 2ZE6A 3NG1A 2RGCA 2EQBA 1ZUHA 1M8PA 2JLVA 4KHZA 5HE9A 4GP6A 2ZROA 2DB3A 1KO8A 1KSFX 2G83A 1E2NA 2FEOA 3WP0A 3OEED 4NU0A 4KI0A 1E1RD 1N5JA 1L7VC 1G7CA 3CR7A 4PC6A 4PXAA 3TAHA 1E3MA 3IQXA 4TMVA 3GJ5A 1TMKA 3H84A 1XTKA 5FBLB 5KOYA 1XU4A 1EX6A 1UEJA 1YRAA 4A0RA 3CF2A 3NBZC 2WJGA 1A1VA 2P67A 1XPRA 3SYKA 1Q22A 3U60B 1AZTA 4MRRA 2PCJA 1I4DD 4PHHA 4L9WA 3ZD7A 4YLGA 1P61B 3VQTA 1E2QA 2PBRA 1KDOA 2KI5A 2CDNA 3NC0C 4IEEA 3B2EA 4YMTA 2QY9A 5GADl 2BKUA 4JT2A 4Z1MD 4Q21A 1JALA 1IAQA 2HCBA 4Q4HA 2Z4RA 1N5IA 4KFSA 1QRAA 1ETUA 3Q5DA 5IK2A 2YOGA 4R98A 1C9KA 4LHZA 4QJ3A 2QQ0A 1NSTA 5H70A 1AGRA 1E32A 221PA 5FOVA 3A1UA 2CEAA 3LXRA 3ZGXA 2NGRA 4B73A 2FFAA 1DAGA 1G6HA 2ZRJA 3KZ1E 4W5WA 5EP3A 5SZJA 5FBWB 4DZZA 4UNSA 2QAGA 2QE7D 4K81B 3OIWA 1E9DA 2XNDA 1VTKA 1ZINA 5F9HA 1G64A 4HZUB 1G20E 4FIDA 4X8MA 1EFTA 3TUJC 2QAGC 2NTYC 3EPKA 1US8A 5SZIA 3BIFA 1OFHA 2WSSD 3QG5A 3FTQA 4PPFA 3DOEA 4RKFA 4WW0A 5KU1A 1UBEA 4HUQB 2ZRMA 4MKFA 5JFGA 2VP5A 3W6PA 4PHTA 2L0XA 3BFKA 1XMVA 3KTAA 1ESNA 3A4NA 5DNYB 1R6BX 1OFUX 2XTMA 4PHGA 1A5TA 1G7TA 3B78A 3NEYA 1TADA 5BQ5A 4C2TA 5GJBA 3FE2A 4OJKA 3ADKA 1CJMA 2YWGA 3CM0A 4QBIA 1CRPA 1G5TA 5FOUA 1OYWA 4P4UA 1M7GA 4MGKR 4PANA 5FH9A 3B9QA 4MH0R 3L8ZA 4PC1A 1T4GA 1BOFA 4IJMA 2GZAA 3QXHA 1E2JA 4ERNA 2J7PD 1DG3A 1DG1G 3OHMA 4KBFA 4UJ3A 3A6PC 2X2FA 4MGYR 2QU8A 4KAXA 3CB4A 2QSZA 3TJZA 4Q7LA 4TL9A 3CNLA 1UADA 4C2UA 3EAQA 3GJXC 4XSHA 4DCUA 1Z08A 1F2UB 3B82A 1H8HA 1FTSA 3O47A 3ZS9A 4JVLA 4B6FA 2QGNA 2ZI9A 2GJ8A 3PIRA 2FPKA 5EXTA 3X2SA 4DC9A 4JSTA 1OLOA 2OBLA 2LKCA 4B48A 5JRJA 2A5GA 5DI9A 4CEIA 3WRYC 4B3BA 2ONJA 4QM6A 1ZNZA 2JJ1D 2OBMA 2YHSA 2FFQA 2WKPA 1BH2A 2XB2A 2ZUBA 3AVPA 1VMAA 3CKLA 2H17A 3WRXC 1WB9A 3WHLA 3FHTA 1IM2A 1OE0A 1FPMA 4O3MA 1BS1A 1G19A 2CNWD 2ZUDA 4A15A 4A4DA 3CRQA 3BH7A 3T12A 2GXAA 4Z51A 5KNCA 4BWYA 4LWZA 1KGDA 4ZCLA 4O2LA 3TQCA 2ZR9A 4EIWA 4IOMA 4BZQA 1OXVA 2UZ3A 3FGNA 4N1AA 3TSOA 3ZIAA 1PUJA 3THYA 2IT1A 2VO1A 5LB4A 1IN6A 4PO1A 3U6KA 5FTNA 2F43B 4D80A 1Z3IX 1VKJA 3Q85A 4PSAA 3HPRA 4OHXA 4Z8YA 4ESVA 4MGZR 2OFWA 5A0FA 5JI2E 5D3MB 2DWPA 4WIAA 2ZYVX 1IXZA 2MSEB 5EUMA 2HJVA 3GLGB 2CCJA 1QHYA 4DIDA 2VBCA 2GILA 1G4AE 1ESMA 3CONA 1SKYE 1VG9B 2N46A 4KFUA 4NYIQ 4GBMA 3K0CC 4CZ2A 4AI6A 1X1SA 3L2OB 4KO8A 3FKSD 1TQ6A 4Q66C 4A6XA 1AGPA 1ZUIA 3LX8A 4URYR 4ZDKA 3C16C 4KYIB 3UK6A 3E1SA 1G8GA 4DDVA 3CF6R 4Q7JB 3ZYCA 5J4VA 4IW3B 1RZ3A 4LRWA 4B3CA 4Q18A 4TYYA 3DZDA 3O8BA 4IFBA 2C96A 4WZ6A 1SXJE 1VIYA 4X8HA 1JNYA 4B3XA 3NH6A 2OT3B 2IF0A 3J81k 3OAAD 5JI3E 1GKUB 621PA 5HZHA 3IHLA 1TL7C 2OG2A 2G9NA 3RS2A 5J4KA 3AM1A 1UPTA 3TQFA 5FPHA 3B7GA 2BJVA 1ZCAA 3PUWA 1P60A 4II7A 4U00A 3MLEA 5CM8B 4C0LA 2IUSA 3SBDA 2QP3A 5A4JA 3I5XA 1FUUA 2PJZA 3U7HB 1NY6A 2NZJA 1CBUA 4U02A 1U8AA 3E5HA 4TLEA 2E1RA 4ARZA 4AY2A 1XEFA 1OV4A 3NC1C 4HAUA 2FSGA 2H7VA 4PC3A 1E2FA 3LDAA 3P4XA 4M22A 3T61A 2WJVA 2IXFA 4ASUA 4IVQA 1X8KA 2FSIA 2BM0A 2QORA 2QP4A 3VAAA 4O25A 2ZE5A 3EWSA 2GETA 2UVQA 1Z6XA 1GNQA 1FQKA 2JEOA 1S4QA 1PV4A 4EPWA 3IBYA 2W83A 2HLDD 3DL0A 1U8YA 1FP7A 1P2VA 2FPMA 4CEJB 3I61A 1NBME 1GNPA 4PAOA 3R9WA 5KSOA 2CK3D 3ASZA 4LPKA 1VHTA 4AC9A 3CF0A 3W34A 2C99A 3GJ8A 1RYHA 3K9LA 4UNPA 5EE5B 1EFRA 4F38A 2XSZA 3M1IA 3PEVA 2J59A 3ICEA 1GITA 4JL6A 1UAAA 4HLQB 1W4CA 1OT3A 4K8OA 2CVHA 3QXSA 4U7DA 1KNXA 4TT3A 2CHGA 1Z2AA 3PV0A 4JBWA 3RAPR 5KYKA 4BQSA 3IILA 1NN5A 4WAUA 1LB1B 5KO2A 2OAQ1 1GP2A 2ZRDA 1B23P 3DHWC 1N6IA 2HYIC 1E2HA 2WHXA 2RHDA 3D7MA 4N0DA 4HDQB 2RMKA 1U0HC 3L0PA 2XOKA 4NCHA 5KPJA 3DM5A 1NMYA 2V7QD 1A82A 3EW9A 3KDSE 4EPXA 2I3BA 4HB4A 3IIJA 3ECCA 2ZYUX 1YR9A 4GRAA 1W1WA 3QSYA 3U6BA 2CHVA 1WQ1R 5FBQB 2ZETA 2J1LA 1X8LA 4KJZA 1IXRC 3QG1A 1SVOA 3RS7A 1OH7A 5EXPA 4LHYA 1KKLA 4MUBA 2FG5A 2QPOA 2J5XA 4TMWA 2BM1A 1M34E 1P2TA 3OFNA 3DEFA 4G5RA
chains in the Genus database with same CATH superfamily
2PHZA 5TEWA 2XJ9A 1GAWA 4XLTA 4EJ0A 4BCBA 1W1IA 3CO0S 1VA5A 3Q8XB 5A1TA 2XWSA 4IMJB 3QXJA 3RS8A 2VWGA 2XXJA 3AF2A 3ISTA 1B15A 2J0UB 3O6VA 4L8GA 1C8LA 5DTEA 4AMVA 4KQ1A 2VQFB 2CT8A 2E4YA 2HU5A 5ADUS 1Z36A 4A8TA 2WE7A 1X9HA 1QHSA 1B1CA 4JP5A 3P52A 1JHOA 4RCZA 2TMKA 2FW8A 3QMVA 5BT8A 1M33A 4B3IA 3BOSA 3LYLA 4IIEA 3PJFA 1ND5A 4AMGA 1KDVA 2Q9AA 1DARA 4ITRC 2PXAA 1XB2A 3JPWA 3R6GA 1C1YA 1MNQA 1Q3HA 3PC2A 1PR6A 2Y1WA 3OOJA 4XYLA 3CKKA 5IULC 2I4NA 3LRTA 3OZTA 3X1WA 1BTOA 1EFKA 3RROA 2PAFA 4W5OA 2CBZA 2D2EA 1COZA 2W58A 4PLGA 2JLUA 3K71B 2Q45A 1TI7A 2FUG6 1NUSA 4R3UC 1RWMA 2X4IA 2X6QA 3EQ9A 5BNIA 4I9UA 1V7PC 3C5CA 4EY8A 3F7NA 4HUTA 1KYWA 3WBKA 4JNKA 2D0IA 4WLEA 3T3HA 3KQUA 2F1JA 3OY7A 1T5LA 4EQZA 4N41A 1IG0A 1JMVA 2X9GA 4FEYA 4AICA 1RJGA 3DW1X 4LTDA 2GPTA 2BL4A 1SG0A 4TRRA 1HDIA 1TRKA 2X15A 2R8EA 4I5GA 1UXKA 3W2IA 4BU1A 4L9SA 1KZHA 2UU9B 5FIUA 4IVPA 4RXTA 3CB2A 3GP5A 4DCPA 5KSYA 2JVKA 3PC4A 1UEIA 3FYDA 3SOZA 1CB7A 5BOVA 4RIGA 3HCRA 1B26A 1VBFA 821PA 2CSXA 2FF5A 4Q5IA 2C0PA 4NAHA 1ZX1A 4ZCPA 4N3BA 4HGZA 1UKZA 1PJ2A 3VU9B 1HL3A 2CUZA 2COKA 2QKYA 4P83A 2Z8YA 4C08A 3SCZA 4LWPA 3M6WA 1JIXA 4PYQA 5JTTA 1TLLA 4YACA 4I4TA 3PNMA 3EVGA 1UBCA 2V9CA 1B3BA 3ZCTA 3NH9A 1XE3A 1S8FA 3M2TA 5EVCA 1BWQA 3COSA 4YCBA 3NYIA 2ZIUB 4NMHA 2RHBA 2X0IA 5CA0B 1L7DA 2HK6A 4WZAB 2Z3VA 3JYQA 4IDOA 2BIFA 4G36A 2KLBA 3T5BA 5A9TA 5EIXA 3KB2A 4LKOA 2FB9A 3EFEA 3IP7A 4B4DA 3L7LA 4TYMA 2D74A 4DDMA 3EFBA 5IT9A 1Z0IA 3P94A 4TZKA 4WOCA 4C30A 3SHVA 2P5SA 4TV9B 3TAXA 4ZVNA 5GINE 4XGNA 1NQVA 1PT8A 2FZGA 3V7UA 2B2CA 4ZCIA 5K99A 2AFHB 4KV9A 1P2DA 3NHZA 1Y5IA 2O8BA 1XSEA 4ARBA 2VJNA 1XF9A 1Z4NA 2PMKA 1UZNA 3B5EA 3EGCA 4N7MA 4OU5A 1XK6A 5FOXA 3GFVA 4CT4B 4E1AA 1TGYA 1FLDA 1P1CA 3F4KA 3EMDA 2PSSA 1V7QA 3FFTA 3LDHA 2W2QA 3FNFA 2GRAA 3H4IA 5CBPA 4DV6B 2B20A 5ER6A 3IKLA 4Q7KA 1QZTA 2I3GA 3KOUA 1C1XA 3OQOA 2OCGA 2WIGA 4WASA 1DRKA 4FDUA 3M83A 2XYGA 1OH5A 5BN3A 1EXMA 5CPFA 4TUYA 1DRJA 1TU3A 2GYWA 2QYOA 4GSKA 1T15A 3MJFA 5AVSA 2P0EA 3EZFA 5FUYA 3RTCA 2HNAA 3U37A 1U8XX 1G66A 4I4NA 1RYMA 3HVIA 2RG7A 4MYTA 2ZUWA 4G0UA 2VRCA 5L3VA 1AA6A 3QU2A 1I36A 1V4BA 3C6MA 3G0GA 1R27A 5E6RA 4BWFB 1ZD2P 3V4RA 1MQ8B 2GKGA 1T9ZA 3FCCA 1N1EA 4PFQA 1E7SA 1HE3A 1NATA 5IAKA 1SBZA 2VYNA 3VISA 4Z54A 4NE7A 4Q3KA 1VXOA 3VGJA 1PTJC 5D1HA 3SS7X 3UMCA 2OHJA 5E1MA 2GFIA 3COZA 1MORA 3BZBA 1LNQA 3QVWA 4YYEA 4F5ZA 2A9OA 4DDTA 4K6KA 3TTYA 1UXJA 4FE3A 4QXMA 1QQBA 4KSBA 2ODPA 2D2FA 4LTNA 2FPXA 3KQTA 3C14C 3DAGA 1VOTA 4C4XA 1ODLA 3PL1A 5CP8A 4CDNA 3HEMA 1ZN8A 4DCMA 3E9CA 4GXTA 4RPKA 1A8IA 1CQIA 5E8JA 3DMFA 1FC0A 1H2WA 3HWRA 2P79A 2ZS8A 1F38A 5JNLA 3S0JA 5G2OA 3GMSA 3ETDA 3O4HA 1FNNA 1FU7A 1KYTA 3PDJA 3SQOA 1E2LA 3WOHA 2ZRAA 2QB5A 3H2BA 3OLWA 2ZAMA 3D6HA 3A2KA 1KH2A 1BCRA 5DHSA 5KQLA 4M9XA 1JR3D 1JW9B 1XP5A 1W5BA 3GNTA 1BXRA 4LJ5A 3TTSA 4D6PA 4YUAA 1ZC4A 1W4BA 1ZITA 2AR0A 3FNEA 4I9HA 1WZEA 1ZIXA 4PWYA 3R3VA 4I66A 2YIJA 4CIXA 1K98A 1OT5A 1QHXA 4XRGA 4MA0A 3IQGX 1KTVA 3QKRA 1IN5A 4GAEA 3ZXSA 1RT9A 3KT3A 3MK31 1HYQA 4JZKA 2WV9A 3T9DA 2V7WA 4JB3A 4BRUA 4I55A 1EVIA 4ZPXA 1NJ2A 2CVPA 1D8TA 2X2PA 2Z5VA 4E0BA 2WOJA 3P0EA 1HKUA 5I9LA 1Z47A 2GB4A 3BIWA 3W9BA 9LDTA 3ZLVA 3FTDA 1CPYA 4J0IA 1PKEA 2QOEA 4ZKDA 1A7UA 5IKXA 1LF5A 3AHFA 4ZICA 1SXQA 9MHTA 3GEMA 5GONB 1A9YA 3HGMA 3UHAA 3THWA 1EDOA 1KO1A 2XMZA 1ODFA 3SSOA 4EKGA 3PWKA 1TNDA 4R0NA 2WM9B 2V59A 2PSFA 3FJOA 3TGLA 1RAHA 4M1MA 3VJKA 1QFZA 5ILOA 4KFCA 3PX3A 4MITA 5JNVA 3U9SA 5DCLA 1TMYA 1UFKA 2MSCB 2J9ZB 3AY0A 3NNNA 2KW5A 2P9CA 3B89A 4K87A 4A7PA 1TT7A 1DBRA 2GAIA 2PD3A 3DF7A 2G5PA 4RWEA 5I7EA 4QXOA 4RSRA 1FVXA 4MWEA 4B33A 2P78A 5FBZA 2ZP1A 3RUFA 4HCJA 1N3BA 4MV8A 4JI0B 1RM3A 5ALUA 4CQMA 4D3YA 5COAA 3KV3O 5AVTA 3JZMA 2V0GA 5L51A 1SRRA 3F6BX 4NE9A 3W5VA 5MN4A 4TYQA 2WR8A 3P96A 1SUEA 1E7QA 4WD3A 3C3AA 3EG5A 3SSNA 1JIKA 2GPWA 1DADA 1ZQ9A 5EMHA 1UWVA 4KAJA 2Y92A 2OCIA 4WZBE 5CLGA 3RBXA 4BAZA 4CUZA 4HAZA 4EW6A 2X9NA 1MQAA 2D00A 2FR8A 1H5NA 1UPAA 2WBLC 5KYNA 3OCUA 3Q2OA 2Q6VA 5CDGA 1GPJA 3N87A 2R6HA 4UHFA 3FIUA 1YB1A 4QOFA 3ZVRA 5JATA 2LDXA 2VP6A 2WJZB 1N0HA 3IUSA 3VOBA 1EK1A 2JAXA 4ZQGA 2H65A 2C83A 2I2FA 4KQHA 1H9BA 1WD7A 3FVRA 2WSIA 3BCRA 3CIFA 1RRPA 4ECEA 4QVIA 3D0RA 4I50F 4MVYA 4MK4A 3NVAA 4RPCA 4TMYA 5BSKA 2YN0A 5EXXA 1SUBA 2JJQA 2VAXA 3QBVA 4HNAB 3N05A 4FYWA 4QDZA 2DHRA 1DXOA 3Q87B 3TVDA 3KQHA 3TGPA 2DPGA 1AUPA 2OXFA 2BE9A 1NKSA 2WPDD 2Z09A 1RYDA 2IUEA 4OXRA 4MVCA 5GZ3A 3GZNA 1G20B 3IXQA 1GPBA 3NX4A 3GXOA 3REFA 4CM8A 2WMNB 2IHKA 2X76A 9GPBA 3OLZA 5L7WA 3FB1A 5FTKA 3HCOA 4MPTA 1TO6A 4CKWA 1RIFA 1AE1A 2OORC 1LV7A 3T4PA 2JHFA 3IH5A 4ZJYA 3SP1A 1GA1A 1KWGA 4NBLA 1XZGA 2CFOA 5HFJA 1VSQA 4HAXA 2HK9A 2ICAA 3JZFA 1PJQA 5CAEA 3FOFC 1JI0A 1CQXA 5DT9A 2AK3A 1YO6A 3U1TA 2A0KA 5T4HA 4OA5A 2XX3A 3M6FA 4CNBA 2GN9A 4CNQA 1Z0ZA 2UYOA 4GVPA 4B4KA 1F0PA 4ER3A 4BO6A 1CJUC 1KC3A 4KODA 4P4LA 4DV1B 4MB2A 3DHEA 4KQWA 3M5CA 4LMRA 4NKRA 3MJTA 5HM6A 3H13A 3GJ6A 3L7AA 1CY4A 3MNFA 3QHQA 3C0KA 3Q8KA 3BXOA 3P71T 1VLMA 2GCPA 3H0KA 1E96A 2Q1WA 2H9YA 4LYFA 4Q47A 3B20A 5GONF 1G5IA 4JEHA 3L8EA 5D7NA 1E7MA 2PZJA 5K0NA 4QT4A 2GRJA 4ZRDA 3NOXA 1ONSA 3LL7A 4X1YB 4EO4A 3CU5A 3BREA 3ABIA 2WILA 4DNOA 3OUZA 3CC8A 3BGIA 1MH1A 4XA8A 6REQA 5C8XA 1OFVA 3TL6A 5LMNB 3OX1A 5L3ZA 2V96A 1N9ZA 4FWIB 2X5XA 4M8LA 4C1NA 3HI4A 4P3PA 1EWQA 5TB5A 2WWVD 2GCOA 1NXQA 4FB4A 3MN1A 4MXDA 1ZGHA 2C8JA 3LNTA 3EC1A 5BSHA 1UC8A 4F6RA 1NVKA 2O5VA 4YECA 4JASB 2R6JA 1NVMB 2XMDA 2Y99A 2PM8A 3IBCA 2ZI5A 3JVDA 3BTUA 1S7GA 3FHLA 3QH4A 1UMCA 2EIXA 1DSSG 1IBSA 1IH8A 3NIDB 2NLOA 2QQ5A 3LQKA 4HWTA 4PQYA 1DLIA 2ZYAA 4BECA 4JC4A 1KI6B 4M6WA 4OXXA 3GN1A 1HDRA 4CV2A 4ER6A 2M6RA 3VKWA 4G2NA 5HRAA 1YQWA 4P38A 1Y5NA 3BHMA 2IH4A 2OK8A 4N01A 4TQUS 3IELA 3NHUA 3ETCA 1YRWA 4YDRA 1X3SA 4LGVA 1N5OX 1K63A 3BWXA 4DIBA 3G0CA 2O07A 3PYXA 5HKKD 1AK9A 1VCMA 4DSZA 2DBVO 1V6CA 3Q3IA 4HQRA 5JNUA 1MO2A 2PLWA 3QE0A 4NZYA 1AUVA 3DE4X 5AM5A 3A9CA 2OPHA 4QYTA 3AUUA 2HF7A 3O8QB 3Q6NA 3EWNA 1ZMRA 3PEUA 2Q1TA 1TUGA 2CCGA 4PONA 1D2AA 1J70A 2J9GA 1R8JA 1P33A 1XELA 2VXOA 2YC2C 3C6XA 4HLDA 4J4TA 5BSUA 4D9MA 1OAOC 2MSKA 4XFJA 4DSTA 3GGCA 3NASA 4ZT2A 4OMCA 2QQFA 3C4VA 2FQ1A 5CXSA 3EARA 1A98A 1T4CA 2WTXA 3F3YA 3PNBA 4PPNA 5EQTA 3VI4B 4XIGS 4EHIA 4JYAB 4M9SA 5TPZA 5EXEA 1LRJA 2PRZA 3QQPA 1E1MA 4E21A 1JHYA 5LDDC 1YCGA 2Y1GA 2LNDA 1E89A 4N40A 1ORHA 2I8CA 1Q7GA 3C8ZA 3GLRA 3JTMA 1QYIA 4QX6A 3TZEA 1FW8A 2MSDB 4Z2YA 5KNBH 1L9XA 2VNHA 3BHJA 5G0VA 1VJTA 1T9DA 4HBGA 4CBVA 1F8FA 1EVLA 3U7FB 2I99A 4NTZA 3J7AC 1XTBA 2IDMA 1RYEA 3CZ5A 3K0FB 4IJWA 2FSVC 3O83A 4BE7B 2C5HA 2AF3C 2IE0A 3BL6A 5HEKA 2HKIA 3TPZA 3KV1A 4FKZA 1WDWB 1B41A 3WADA 1R66A 5DK4A 3LT0A 4HQKA 2WJ6A 1ISGA 1N9GB 2GD6A 3HCEA 4N5HX 3KQNA 3FA2A 2NQTA 2NV6A 3KZCA 3FWKA 3PNSA 4FMCB 1TW3A 3OFSA 4J8PA 5A71A 1KOGA 3LBNA 1O6GA 4A8PA 3N75A 1NBMD 4OY3A 1SBNE 3AB3A 3DONA 2PUVA 1NULA 3FJ1A 3P9PA 4NI5A 5DB4A 3ZQ6A 3SC3A 3F9CA 2W6IA 4AUMA 2NU6B 3UB4A 2H4YA 2RHLA 4KJXA 1ISSA 5ITVA 2O8CA 1R0YA 2IEZA 2O20A 3ZLBA 3AU8A 5LU8A 2G28A 5FOWA 1V1RB 1AVTA 1A04A 1JX6A 1SA0B 2CC2A 2Q28A 3KYCB 4Q01A 3C1AA 4Y2RA 1DCTA 1M2JA 1SCUB 5J23A 1BMQA 3QX8A 3KSRA 3UFBA 5JAPA 4BKRA 1CYDA 3FYHA 3KSDO 4XQGA 4Z7OB 2QRHA 3DNPA 1IPHA 4BO5A 4CKCB 2P68A 5DHFA 1DAMA 4F86A 2LUOA 1MMFB 2B8EA 4D7AA 5JAUA 3QPBA 1BVHA 3R24A 5IABA 1L8QA 3NHBA 4LOIA 3IT1A 2ZRKA 4Q19A 3DG9A 4V0KA 3RAJA 5HWSA 3FF4A 2PX8A 2PUGA 1ZWLA 2F8SA 1K92A 1RPJA 3HBLA 3IAEA 2AOWA 2Y1FA 4DIOA 5J2TA 2VF4X 2G0NA 2ZXEA 3PFNA 3V8QA 2I2XB 4JLUA 2JLSA 5GV8A 3ZNNA 4FFPA 4HS9A 2CLOB 3E3AA 3DWGA 2IEGA 2L82A 1VIMA 4F4FA 5BSGA 3X1ZA 1ZJYA 2G5TA 3RWMB 2D06A 2W98A 3SHWA 2HYDA 3S4YA 2WTAA 1V3VA 4QD3A 3V55A 1L5HA 1Q0TA 1UANA 2YWRA 3WZMA 4L4XA 3U80A 4F46A 5A05A 2YQ5A 4QU0A 4DXDA 1OTHA 4ZZ1A 4IGAA 3SZLA 4C01A 1M1YE 3B7WA 3R7LA 1GCGA 3KXDA 3H1BA 5FPKA 4ARSA 1NUHA 1GRQA 3K0CA 3SJ7A 3ZXYA 5A5EA 3D6FA 5F5XA 1VIAA 5F9FA 3LC1O 3VDNB 2A86A 2BFMA 2Y8EA 3VTKA 5LNK6 4XB2A 1GYPA 1G3RA 5FBVB 2UUBB 1LQUA 2PGJA 4RZSA 1TAHA 2G9VA 2NTJA 1N2EA 1YZVA 1RXCA 4NBVA 4JUBA 3VR2A 4F2GA 1TIPA 3FHOA 4WLOA 3BCUA 3VKGA 2RKWA 1B42A 3EX7C 1Z0KA 2Q6LA 1CUXA 3L8HA 1EFHA 2EX0A 1DTWB 3SYRA 4ERXA 3U7EB 1XTJA 5LQKA 3MUOA 2JGRA 1FLNA 3SQDA 3A6JA 3UOGA 4X93A 2ABWA 5T3YA 1RCTE 4BVGA 3GQBB 3VA7A 5ES3A 3IVMA 4F0JA 4B1FA 5AI6A 4AXBA 3ZLUA 3FFBA 1J5PA 2J32A 5H8WA 2JFYA 1YNOA 3RD5A 3DC7A 3SS8A 1KGSA 3MCWA 3OU6A 4BKOA 4OIFA 4EUFA 3PFKA 3AB7A 4J16A 1BWSA 4Y2PA 1M34B 3FOWA 3WTCA 4KR7A 5DKFA 4QYWA 2VP0A 1SHTX 3DPUA 1PW7A 4ZVUA 4NJEB 5AWFC 1G3QA 3C3CA 3FNBA 4RTRA 4C7VA 4H6VA 4J16C 3U5TA 1HEIA 3BWVA 1IBRA 2CXSA 3WNZA 1NF9A 1NFQA 3VU0A 3DXZA 4Z7NB 3HP7A 4FMCF 1II9A 1LI4A 1LPPA 4TYNA 2ODTX 1FMFA 2HBQA 3IDOA 1JQ5A 3U4QB 4PO8A 4OHPA 3JRXA 1FUIA 3Q5EA 4KX5A 4H16A 5AM4A 1U4SA 1DQRA 2VRWA 3AHGA 4PZYA 1DDGA 1K8YB 5CLFA 3PUXA 3TG2A 2DR3A 4K6OA 1XD2B 1JAIA 2P30A 2I6QA 3JASA 4OSOA 4H27A 1OZAA 1XTIA 2PKWA 4PPGA 3N0RA 4Q00A 4EG0A 2Q5IA 4JKYA 3ILYA 3OEEA 1U1IA 1E1RA 4J90A 5JQGA 1K4MA 2BEUB 2XA1A 4DBZA 4QDOA 4BQRA 1UPUA 5EIFA 1JEJA 3T1YB 2P9ZA 4JLSA 1IG3A 3CXUA 4F71A 3E3NA 4JBIA 3ASYA 5K3DA 4YUVA 3W4JA 3WYEA 5CB0A 1W5TA 5I47A 1PIWA 2M32A 3D8TA 5B4TA 4X66B 1A2QA 4WUVA 4B2PA 1IM5A 2QGFA 3KS9A 4R5HA 3ZU4A 4AUNA 4F45A 2FA9A 4X3PA 3RSQA 5E2IA 5LDHA 3EG9A 4GC9A 4LF4B 3DBLB 2NXNA 4I8DA 2J6IA 4WOJA 1UZMA 1QIFA 2ZYGA 3I6ZA 4TSFD 4YP1A 4UAUA 4FYJA 5B1SA 2FU5C 2VJPA 1XXLA 3TPCA 1XJQA 4RTJA 4EPVA 1Z12A 2ZJ1A 3DTTA 1Q77A 1XEXB 4LXIA 1OXSC 2GHIA 4PR0A 3W2HA 2FEAA 1XAGA 2IZ1A 3CRZA 3P0HA 1R74A 3HCFA 4J0GA 4F2WA 3WLLA 3MAGA 4WDQA 5ALNA 3AQIA 4OQMA 2ZJZA 4PZAA 2AMYA 2VYFA 2GJKA 4B6SA 5L6MB 2O2DA 5JAZA 1C3XA 3SBOA 1KDYA 4IDEA 2JHCA 5EE9A 3OX3A 1KARA 4FFOA 5TNXA 2QX4A 1I6LA 2HJ9A 4LQ4A 4YK7A 3G0DA 2ISQA 4NDAA 3TLXA 2J30A 2JCBA 3CW2A 1EVYA 1F51E 1K6IA 1SU6A 2A6PA 2PSEA 2QZZA 2V9ZA 4RFVA 1R8YA 1VHLA 1PJAA 2FETA 5EN4A 4CKEB 1N4DA 3WB2A 1ZJJA 3BS4A 4Y2TA 1QFXA 1PKXA 3PF9A 1VRCA 1UODA 3RRZA 2CE2X 2OR3A 2D8MA 2OHIA 4DCNA 4TVSA 1FU8A 2WVAA 3N6VA 3OZFA 2OKCA 4M87A 1NOKA 4ND7A 4R9UC 1ATIA 1D03A 3WGKA 2IOYA 4ALKA 2J3DA 4LI3X 2XUFA 4EA9A 3DJYA 1XDDA 2F4NA 1VYTA 1RWQA 1RCFA 5CTJA 4DIUA 1QX4A 4CCYA 1JE1A 3LRPA 4IXWA 2XWJI 4DJTA 1QYXA 5JH7B 2CWDA 1FP1D 1DKNA 2J85A 1XQ6A 3OPQA 4YAIA 3MERA 4L72A 5EJ7A 2IS2A 3N2IA 3ZZ0A 2WUDA 3QUQA 4FK8A 2NU9B 4DGQA 4M1SA 2ASVA 3COPA 2K2QB 3PD0A 4RGBA 5FUVA 3RVQA 2GZ3A 1LZLA 3FMPB 5DBOA 3FGOA 3O9VA 2EBUA 2ODBA 4YMGA 1XTTA 1NQOA 4EG6A 1O95A 2P75A 3DCYA 1A2OA 2QRUA 2YUIA 4GOKA 4IDBA 5DP1A 2Z9DA 3BD8A 4KXUA 4QFMA 4DMRA 4X61A 3HFRA 3D2BA 4OU4A 1R50A 4WHMA 2P9QA 2VXBA 1U0JA 3R3WA 4NPHA 2YZKA 1FFSA 2H6EA 1W36C 4IIJB 4YQFA 3C39A 3H5LA 5EWMB 2JBHA 3KJGA 3LW7A 3ER9A 1EVQA 4LVUA 1T9CA 2FGJA 2ONKA 2PVSA 1GM5A 1BX3A 2J7PA 2QAIA 3BGDA 3SC2A 2A7XA 4F7DA 3NGXA 3Q1KA 1NVEA 3AVXA 5A4KA 4RL4A 4YWJA 4BCCA 2JGDA 4TXMA 4X85A 5BMVF 5BR4A 1AKMA 1QO0A 2JJ2A 4OHKA 2BP7B 3K94A 2G1AA 4X6XA 4IJQA 1HTWA 3D4OA 2JRLA 3OQIB 1YT5A 4AZVA 4KQFA 4BBPA 3PWTA 1U0OC 1E58A 1DQNA 2PGOA 3FVVA 4H3SA 5KYUB 1ZISA 4ZYVA 1PGNA 5LA6A 3H16A 1L4UA 5L95A 2OFPA 3VH1A 2PTGA 3WLJA 2GUGA 1QK5A 2ZKLA 3QTBA 4JC5A 4QLAA 1LC3A 5E38A 2Q7XA 3K70D 2NOAA 3GJ0A 5SYNA 1YBFA 2DUWA 3OZ7A 2YFQA 3HKBB 1QYVA 4DADA 1U6KA 4BFYA 5KBYA 1WHSA 1VMDA 1NYLA 1OILA 3WYCA 1WF6A 1IUNA 1SRQA 1XRSB 4O6VA 1IY8A 4RACA 721PA 3DVQX 4X6YA 3TW6A 5DEOA 1VBNA 1ZM9A 4GE0A 4L08A 3OCXA 5DHRA 3U3XA 1M2FA 4LBZA 4OQDA 3TRHA 1Z15A 2R68A 3PA8A 4FONA 4HWKA 3UJ9A 3ZCPA 5K6AC 1XRNA 3QLJA 3DUFA 3K35A 3QPUA 4W8OA 4DV0B 1PWHA 3RS4A 2JHPA 4BEWA 3Q88A 1HE5A 4YBRA 1MXHA 2J0EA 2ZSDA 3C1UA 3GVPA 3P9SA 3WLAA 3ZV7A 4FB5A 4TTTS 5I8PA 1R5JA 1LDBA 5FTLA 1UL1X 5K3FB 4J0KA 1BZYA 3EXEB 2UV8A 4OP1A 5I9TA 4GR9A 1SY7A 4F4CA 3ZBPA 1SXPA 1FDOA 1ZOLA 1SD5A 3C3XA 5J4HA 1QS0A 3OPNA 1Q1BA 2BMEA 1PFYA 4P4GA 1NXWA 3I30X 5DRTA 4A6PA 3NTXA 3K70B 3INTA 1YZLA 1Z6TA 3FOBA 3L6RA 2ZWVA 2AQKA 3C3JA 1PEYA 4YJ2A 2FE1A 1C80A 1NUQA 4U0JA 5I01A 1L7QA 2VSXA 3T7EA 5L4SA 2M1XA 4CDMA 2OQVA 1ZA1A 2QR2A 4A92A 1ADFA 1DC8A 3FMIA 1PBNA 2OZLA 4N9QA 1DJQA 1XNRB 4JEIA 1H1LB 2I1QA 4YO7A 5JH7F 1XALA 1OYYA 3L18A 1D1PA 1MJFA 4YP7A 3UIEA 5C52B 2GPBA 5KNBA 5E7MA 3DCIA 2PD4A 2W9XA 4FYKA 4LBVA 1S8AA 4PG5A 2BMWA 5FI0B 4HG2A 5BYJA 1L5KA 3LPMA 1WEHA 5DYNA 3VC7A 2DPXA 3GRYA 1N7HA 4Q9IA 1CS0B 2NVWA 2IBTA 5FWAA 4ZCSA 1WE2A 2BMFA 1DIGA 1T3LA 3JSAA 1PQWA 1HYEA 4IIJF 4XWKA 3AF6A 3FUTA 4IS3A 3HTXA 4X54A 2ECFA 4IUDS 1JHDA 5AXBA 3WKEA 3SBEA 2Q1SA 4YYZA 2GYYA 4IIDA 1QIDA 1E7RA 2YWFA 1E9AA 2GX6A 1P6XA 3IEUA 3E5RA 4U7WA 3RYIA 3UMGA 4ZO4A 5AM2A 3NZEA 1QLWA 3QXCA 1N5KA 5JNWA 3ZY5A 1UR5A 1DIOB 2GVZC 2XOEA 5E3IA 4OI0A 4HSEA 4L28A 4MSUA 4YB8A 1JBEA 4F97A 1L4FA 4FFVA 4XGIA 1W6RA 3CSUA 1SHKA 1TA0A 3ECAA 4NCIA 4Z0TA 3ZW7A 4B0PA 1KQGA 2G40A 4WTOA 5EVJA 4N5DA 5AJTA 4OYHA 2BFDB 1G9XA 5AW6A 1K3UB 3CLSC 3IUBA 1VE6A 5DM60 1E6MA 1RFGE 2YJTD 1MAHA 1YWGO 4ZFNA 4YJFB 5SY9A 3TW0A 2FX5A 4NLLA 2FLWA 3X1MA 4CKYA 2YX1A 2YY6A 1VYHA 2RJNA 1TYEB 3EVBA 3D1JA 4XRRA 4MCAA 3L8MA 4R1MA 5TSDA 3S8EA 1S8OA 5AJYA 2O1XA 4UW9A 4EMUA 4DSUA 1MIOA 4X44A 5CYGA 3O94A 1C7ZA 4JJEA 4XQ0A 3L7DA 4BNXA 3SX0A 4F6CA 1Z6GA 4CKZA 3HO1A 4U2GA 2PJDA 3MC1A 7GPBA 1MX1A 1IN1A 4LK2A 4A23A 1O96B 5ERGB 2CFRA 3LIIA 4Q3CA 3CX3A 3IULA 1YL5A 5EZ6B 4V1CA 1FMLA 1SU7A 3N8GA 1JH9A 3KTFA 1SCNE 3DT6A 1AS0A 3LUJA 2H4HA 4OA8A 3UMFA 3KR9A 1WTAA 3RHFA 4AF7A 5A3RA 3ESBA 2XCUA 5H16A 5MGNA 4XYGA 4LRXA 5JMTA 3KWLA 4X95A 4J1QA 3CT6A 2W90A 3GEEA 4BVLA 1UBGA 1W49A 3E7FA 2I0FA 3OCVA 1N33B 2Y0EA 1Z68A 4N3AA 1LJLA 4EABA 5JFOA 2DUNA 3SLRA 5M7EA 1MEJA 3GC6A 4ND4A 3WNDA 1RLUA 4F91B 1FXWA 2C9DA 3W90A 3WKAA 4UHCA 3EVZA 5KYWA 4YCAA 1ODJA 4UFOA 5EZ5A 3OZEA 3OQJA 3HB5X 3FY4A 3WB0A 1T1GA 3CR8A 1O4WA 1QYCA 3FLMA 1GQFA 4FYYA 5IUNC 4INZA 2HR1A 2JLBA 1SQSA 3V8RA 1L5MA 4IIVA 2PTHA 1J0CA 3FSGD 1BMDA 4C21A 1QO9A 2J6BA 1PEDA 1RNLA 1GZHB 1W9HA 3LAWA 1VCNA 4BGVA 4FN4A 4GZ3A 2I2AA 2WNSA 4IFTA 1BDMA 1E9EA 4Q1CA 2YOHA 4MCIA 5IKPA 1JG2A 4PY2A 5JISA 1R0ZA 3O3OB 1QVVA 4D6YA 4L5YA 5GJVC 4RK0A 4S0XA 4H60A 4MUFA 1KEVA 5KNCD 1E99A 3LQRA 5FUQA 1UDWA 1EM8B 1T5IA 3NHKA 3O1HB 4OQPA 3TW8B 3KYBA 4EFNA 3F5MA 2H1HA 3B1WA 1EWVA 2HHLA 4D9NA 1GFWA 1I4LD 2RGWA 5B36A 4BLTA 2WICA 2LP4Y 3T0FA 4HLUA 5TMBA 3LUDA 3OLCX 1KH1A 2OBNA 3E7WA 2VT6A 5FUXA 4MOWA 3LI2A 4I3GA 5EZYA 3JALA 3QF7A 2OKGA 3SJCA 1IRIA 5KJ1A 1C9MA 2WTNA 4CM9D 4DEXA 2GXUA 4HLUC 4M0CA 3C3WA 4YP5A 5THXA 5IG2A 3L7CA 3IT3A 3VPHA 1V1MB 1EWRA 2ZBUA 4P22A 3M33A 5F35A 4LK3A 4D42A 3DLHA 3DTNA 1C9JA 1UP6A 2ZU0C 2WG1A 3C8UA 1NT4A 3G2PA 4KIFA 5BYBA 2IU0A 4A8JC 5K0BA 1V71A 1TVMA 3TX6A 1AKWA 1NLUA 2CVOA 4IOJA 4MAMA 3E6AA 4D4MA 2B4QA 1PDWA 2G4CA 3LK6A 1N5DA 3HFGA 3P20A 3KKMA 5ABPA 1RRMA 4M36A 2QTZA 1IZZA 1GSAA 4MKRA 1CE8B 3HCNA 4DEVA 3H6GA 5LBTA 3RG8A 1D6JA 3LQ2A 3WJ7A 2JIOA 5IT5A 2V7UA 3N70A 3SIPA 3UW3A 1CRQA 2GF9A 4G63A 1AY0A 1LSJA 3ET5A 4LDAA 4HVTA 4XM1A 2O4UX 4GW3A 5BSTA 2NUTA 3VPSA 1FSSA 1VJGA 2EYUA 2OHFA 3B13B 3D7SA 1THGA 4TQAA 4XD2A 4QGFA 1NQUA 5EP1A 1XP8A 2HA3A 3QY9A 3RRJA 3SZOA 2O0HA 1GHTA 4WXMA 3T5TA 4ZN6A 2JASA 3ZVNA 3GT3A 2HUNA 3NBQA 3PGLA 4N54A 4NENB 1KFEB 2REQB 1NJ8A 4Y6GB 1OJLA 2LWIA 4LSZA 3WXBA 1XBTA 1DJPA 4JLDA 3ZXUB 4ALMA 3FNHA 2D7DA 3DM9B 1R4NA 2B5WA 3BSWA 2IYZA 1MOSA 1XNQB 2YVQA 3BXHA 1M0SA 2OYCA 4MS3A 3CX6A 1B0ZA 1DHTA 1FQOA 2C98A 4LWQA 4O4LB 4BY9E 5HS4A 5K4GA 4DV3B 4GSLA 2VSYA 4C3UA 3HO6A 2J3IA 4Y3UA 4LDQA 2ZUEA 1HEUA 2MT9A 1KKUA 3AVOA 4UCXA 1FL9A 1N8NA 4JQYA 4XD7A 4EVSA 1GILA 2C1EA 3JX9A 4UBNA 4D4JA 5KEIA 4DXAA 3E9ZA 1E61A 4DLXA 3ER6A 4DIKA 1ZDMA 1SMKA 2WHQA 4D41A 5DGHA 4WECA 1CV2A 3DWFA 2D2XA 4ASUD 1P4GA 4G1VA 2Q6OA 4CVNA 4PSDA 2PUEA 4TT8A 5FWXB 1E3QA 1PT7A 2QMHA 4IEFB 4UJ5A 3TRFA 3B8HA 3NYRA 1S3GA 3UHFA 5EZYB 5B2EA 1BWRA 3E4DA 3V7FA 5JLJA 3F1LA 1P81A 4M9RA 3O26A 4PG7A 3ZHXA 4KG7A 3WQQA 1U0EA 4UXIA 4H1WA 1XRRA 2NTEA 2KX7A 4MVJG 2AE1A 4OKIA 2F1KA 4JXXA 1ZGZA 4BO1A 4QATA 3I2JA 4PSKA 3EZ7A 2BM8A 3B70A 3ZWYA 4E46A 4TM8A 3RTGA 1Y1QA 4X6UA 1M1XB 1KDZA 1ZJ6A 2V9PA 3DOUA 2YMLA 1IY0A 2NU7B 3MS4A 1U8EA 4PYNA 3S2IA 4CG3A 1ZU4A 3GLVA 3V97A 1ULBA 3OD1A 2KQUA 4A91A 4QFCA 3HWWA 1MT3A 1I6KA 3I2YX 1RJ9A 4Q0MA 2JNWA 1P9RA 1ZKDA 4CQJA 4RA9A 4X1IA 3GCGA 5IT0A 1I2BA 1V3UA 2ZSJA 3HUFA 2WJPA 1Z0FA 1Z5NA 2R8BA 1X7YB 1C7QA 3HN6A 3I01A 2FHSA 3IIMA 2ZQ5A 3ABSB 2Y9PB 2Z95A 4BMSA 4O59O 1CEXA 3EBPA 3S2YA 1GD1O 1YDFA 3AI7A 3CSSA 3LTNC 2FUEA 5JJ5A 3DKIA 1Q14A 4BEJA 4NR0A 2XB4A 1KK0A 4M2LA 5JG7A 3R3JA 3AYXB 3ZCVA 1M1YB 3EXIA 1MABA 3GEHA 4URZR 3PFCA 4HYTA 4V38A 4J0QA 2B9EA 3BA6A 1RXYA 3AHDA 1YQTA 3WGQA 5FOQA 2YWEA 4FCTA 3LBFA 3I0MA 3HP1A 3O4VA 1EKXA 2B25A 4YMLA 3CVWA 2KM1A 4W5NA 1YB7A 5KQRA 1JFLA 1FDVA 3QPAA 3LCVB 1KYIA 1T91A 4G9EA 5JZMA 1I2ZA 3AGPA 3H99A 4HFRA 3BXFA 4BNFA 4EBFA 1JMKC 3D8RA 5BN4A 1G8HA 3NM6B 4P7GA 4U5XA 4OX9Y 2VYQA 2W8BA 2ZWIA 3K0SA 2VCEA 3TPFA 3I1JA 4TLCA 2F3RA 2L2QA 1B8OA 1PLLA 2MSNA 2MOKA 2ZZKA 4U9HS 3RUDA 5ICMA 3BX1A 3R5KA 1FK8A 3SDBA 3MUEA 3R0IA 3ETLA 4IFIA 1RYYA 4EJ2A 3ZDAA 2XQFA 3D5EA 3OLVA 3WMEA 1KE1A 5L9AA 1VRWA 2QG4A 5F76A 2IPXA 1PW5A 2UZIR 3HUTA 3H75A 1UKEA 1K68A 2PX5A 3S1LA 2P77A 4XSGA 3SE0A 4MQ6A 3VUEA 5C7YA 2OUKA 3TRIA 2V4MA 3EPHA 2KWIA 1T9GR 1QBGA 1Z5GA 2JIZA 1KC1A 4HDCA 3T3EA 4CLDA 4O4LF 5TPWB 4ISBA 1LS6A 1Q91A 2D54A 2NN3C 3AMVA 1W48A 1EWTA 3CKMA 4DJEC 4GO1A 4DWJA 5C8YB 5TQVA 1SK8A 1MPTA 5BY2A 3VJRA 1W8IA 1U3WA 3OJEA 2JFBA 4PR3A 4Q4DA 3AFOA 4GM0A 5FI5A 1PX2A 3TD9A 4B4VA 5LOVB 1Z6AA 3PRYA 4LYEA 4C03A 1YBAA 2B0JA 1EK2A 1H6AA 4XQEA 3BG5A 4FT2A 3AR6A 4HPWA 3GG9A 4FQ7A 4R7ZA 5DO9A 4IJKA 2PKYX 4LWOA 3DLPX 6AT1A 3T9AA 3GCZA 1G3UA 2QD4A 1CY7A 3QVVA 3ABQB 1T5SA 5KVCA 3PCRB 2HM7A 4DDWA 2XCOA 1S3SA 3F6YA 4Q05A 4BEVA 3H6HA 4J7UA 4AWBA 3ZE8A 3DO8A 2Q7DA 3ZHSA 1TC1A 3HZZA 1ZVMA 3RC8A 1W2WB 1ONNA 1JU4A 2EFYA 3W5AA 1T4MA 1KJNA 4J7CA 5EJ5A 1X8XA 4XWYA 1VL1A 1NM5A 3GG2A 3ON5A 3CVUA 3P9ZA 3ENNA 1LQTA 1W88A 3TUZC 3IP9A 4MMZB