4TZ0A

Dead-box helicase mss116 bound to ssrna and gdp-bef
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
508
structure length
508
Chain Sequence
SKLIHVPKEDNSKEVTLDSLLEEGVLDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLINTKFDSQYMVKAVIVAPTRDLALQIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKNSKSADNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIAKQEKYEPSEEIKSEVLEAVTEEPEDISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDKLGLSRSPIGKAMFEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent RNA helicase MSS116, mitochondrial
publication title Molecular insights into RNA and DNA helicase evolution from the determinants of specificity for a DEAD-box RNA helicase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein/rna
total genus 160
structure length 508
sequence length 508
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2014-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tz0A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tz0A02
2G1JA 1NKSA 4IDOA 2BV3A 1G7CA 1Z28A 4FMDB 2KI5A 1Z6TA 2L0XA 5BYKA 2J0VA 1XPUA 2LCFA 2OLJA 2CDNA 2GXQA 1ZBDA 5FUWA 4ZKDA 3C16C 1RE0A 2HXSA 4TYYA 4JT4A 2JIZA 2D62A 2OT3B 1XTJA 3EZ6A 3CB4A 2XSZA 3TAUA 1R0YA 3A36A 3DOFA 5B64A 3KKNA 3V4FA 5KHOC 1NNEA 4ZCIA 5FOTA 1Z06A 3E70C 1FX0A 1SKYE 5KPJA 2LWIA 3IPXA 3O47A 5EZ6B 2F55A 3RRNA 5FOVA 4LBVA 4M21A 2GVDC 2AKAB 1X1RA 4LC0A 3BH6A 2FGKA 4LYHA 2WVJA 4CIDA 2OG2A 1VHTA 2OE2A 1NVXQ 4Q4JB 3NKVA 4AD8A 1TNDA 3KQHA 2PCLA 1J70A 2CMKA 1IN8A 1F3OA 3X1WA 4QL3A 4NPHA 3U2QA 4KITB 5KDDA 3B9PA 2CEAA 3U6KA 1DADA 2QMHA 1DTSA 4JYBA 2DWPA 1KAOA 3ZGXA 3X1DA 5SZKB 3WNDA 4MUAA 2AWNA 2GCOB 2IYRA 1P61B 3WMEA 4NHOA 2KB0A 2F43B 3K0AB 3RSOA 2ZTSA 2B7CA 2CHQA 2ZI4A 2XJ4A 4NE2A 5JS7A 3VKHA 4MUBA 3SJCA 4Z54A 3RVBA 2O8EA 3T15A 1M34E 5KDLA 1GAJA 2A3RA 2ZR7A 4C0BA 4KYIB 4MH0R 4Q4HA 3N5CA 5HZKA 5CB6A 4RD1A 2HV8A 2XNSA 4DIEA 3QG5A 1P2SA 4JJKA 3CR8A 4G3XA 4MRVA 3KL4A 3SZRA 3AGPA 2QT0A 2QGZA 4LHZA 5FUVA 2NZ8A 3IBYA 4BLOA 2AHOA 3NWJA 1E2DA 4JLDA 2BWJA 4BRUA 1YQTA 5GJWC 5SZJA 2MSCB 1XXHE 2ODNA 1FQKA 4S2EA 4HZUB 5AR1A 1QVAA 2G9NA 4BLQA 3X1ZA 4NYIQ 1Z2AA 1W44A 2DCUA 2BBOA 1YJ5A 4BLSA 3NDPA 1F2UA 1KI6B 5FUYA 4KFUA 1S2MA 2GDJA 3VNUA 4LYAA 4Q4AB 1AN0A 3TQCA 4IXMA 3W90A 3U4QA 4JVNA 4JVMA 3TLXA 1UADA 2C8VA 4QXAA 4JVSB 2K5UA 2VF8A 4LJ5A 4F4JA 1JI0A 3QXJA 1U9IA 4KV9A 3T61A 4R71A 1G6HA 1M74A 3CIOA 3EZ7A 3QEJA 2YVUA 3AQ4A 1ZUIA 5GADl 1PLKA 4BFYA 2AXPA 1XTIA 1W5TA 5L3VA 1XPOA 2J46A 5IT5A 4PPQA 2WIBA 2V8OA 3CF6R 3PUZA 1LFDB 1DO0A 1Q12A 1ZAKA 1SXJD 4KODA 5LD2C 3K0SA 2A5YB 2J7PD 2XB2A 2GJ8A 2P67A 2F3RA 1S0UA 4LGMA 3P32A 3RRYA 5K8TA 1AKEA 1OKKA 2OEPA 3DMDA 1DELA 4IVPA 4TMVA 5AUPB 1F48A 3WHLA 1ZD9A 1ZC3A 3QF7A 1NMXA 1D6JA 1ZNZA 1TF5A 3MAAC 4WZ6A 2D7CA 3MGCA 2IS1A 1XRJA 4PSAA 3G5UA 2HYDA 2VTKA 5M04A 4C0QC 2NTYC 3EZ2A 2YYZA 2OHFA 1YRAA 2NOAA 2OCYC 3EC1A 3OAAA 3BH0A 3KUCA 2WJVA 4F93B 5JI2E 1TADA 3EASA 2O0JA 2OV2A 5EXXA 3TAHA 1F2TA 2YINC 4B44A 2QTVB 1T5IA 1NVVQ 3HR7A 3LH5A 4QGHA 4ZO4A 2V6IA 4PQYA 3EXAA 3KFXA 1Z3IX 3ADCA 2ZJOA 2X77A 1RRGA 2WWXA 3R8CA 1YR9A 1Z47A 2W2VA 4NDZA 1C9KA 2G0TA 5C46F 1OB2A 4YMWA 3NVAA 2BEJA 4I1VA 4FMDF 2D2EA 3CM0A 2DWOA 2ZRAA 3LQQA 4L15A 1ZRHA 3N2IA 3VQTA 3HR8A 3LQRA 4Q9HA 5CJ2A 3FGNA 1X86B 1EFRA 2V54A 2XXAA 5JMTA 2C95A 5ANRB 5JEEA 4P4UA 4NP6A 4XSGA 3PUXA 1E94E 1K5GA 5C4GB 2BBSA 3ZVLA 1YZQA 1R4AA 2QA5A 4HUTA 1ANKA 3F5FA 3EPLA 1I4DD 2Q21A 3F8TA 1H8EA 2AWOA 3GJ5A 5AJXA 1E1RA 3ASZA 3CRMA 1D5CA 2BM0A 2N46A 3RANA 1T0JB 2FJUA 4JVLA 1G4UR 2UVQA 3C5HA 4DB2A 5HTKA 2OBLA 5GJVC 4PQFA 4C0KA 4R2IA 2D06A 3NH9A 1N6PA 1U0LA 2QM8A 2WJGA 1BOFA 3MLEA 4OJKA 1V5WA 3W6NA 3UMSA 4KBFA 3VX4A 2MSEB 3THYB 1RZ3A 1EGAA 1VG9B 2BJWA 3NBYC 4QOSA 4L8GA 5E7JA 3OIUA 1Q21A 4Q1DA 1E79A 4OQFA 1OFTA 3OIVA 2JJ1D 3GLGB 2ZR9A 3K53A 2FFHA 1UPTA 1TQDA 2OZEA 1HV8A 3LA6A 4M1YA 2WIAA 5B30A 3EAQA 2GJAA 3NBFA 2FEMA 1NBMA 3OFNA 4PZYA 2CJWA 1E2FA 1ZUHA 1DPFA 1FNNA 1RYFA 4N0EA 1OF1A 2XAUA 1NY6A 2ZIAA 4FXPA 4TZ6A 1KKLA 2BKUA 1PLLA 1E2GA 2A5GA 1R6BX 2VHUA 3ZLJA 2FGJA 4NYIR 3Q5DA 3PEWA 3UG7A 5JSZA 4MYTA 1XU4A 1HTWA 3CRVA 2EQBA 2IYLD 4A15A 2W6JA 3CX8A 3PXGA 2ANCA 4LBWA 4Q19A 5P21A 3VR6A 4HSEA 2AFIE 2A7QA 4QKQA 4DDVA 5J4YA 3EWSA 4R7ZA 1XCPA 1WXQA 1N5LA 4ABYA 1E2NA 4A36A 2EW1A 2I1VB 3NEJA 1U99A 4B76A 3A1SA 1DS6A 2PZFA 1JR3D 4O2LA 1LF5A 2REOA 3LO5A 3G0HA 3QPUA 1HURA 4RD2A 4DVGA 4EFLA 1T3SA 1KKMA 3DHWC 3FHCB 1KOFA 4Q4JA 1P2TA 4B6EA 2V6JA 2C78A 3KQLA 3NIBA 2GJ9A 1DAHA 1XZPA 1YHNA 2N1BA 3HYTA 3NBZC 1GITA 4GP6A 2GEUA 4JLJA 1JQLB 3KKQA 4PO1A 2CBZA 3DZDA 2WICA 3B6EA 4V02A 1GKIA 1YKSA 4G0NA 2J0SA 2YWFA 4HLUC 4DLWA 2HLDD 3T5DA 1DAGA 2PH1A 1CR2A 2FE4A 2YWHA 4IHQA 3U7EB 1LW7A 4EJSC 2BCJQ 2F43A 2V7QD 4CEJB 3MFYA 1S9HA 3SFZA 3ZVNA 4DCNA 2ZI9A 4PHTA 5GVRA 1WDTA 3ZIAD 3D8BA 2JJ2A 2QUZA 2J7KA 4QFMA 4DEXA 2IS2A 2GKSA 1RJ9A 1BO6A 2D74A 1U8ZA 2PT7A 2YWGA 2WWWA 3I73A 1ZUNB 1AGRA 3ADBA 3CNOA 2R2AA 3U61B 4PC3A 4B6FA 1VCIA 2AN9A 4KXFB 2B8TA 2QY9A 4NYJR 3SHFA 1HY3A 2EFGA 1NLYA 5C1BA 2RGBA 1FQJA 2GEDA 1W7AA 4DB4A 4G01B 1E2IA 2JAQA 2RHDA 3ECCA 4M2LA 3OEED 2VSFA 3RC3A 3U7GA 2H8KA 4Q66C 5FOSA 4HZUA 4XOIA 4EIWA 4V0ME 3W3AA 2RHMA 4RFSB 1NIJA 5EQTA 1XWIA 3I92A 2CK3A 4OK3A 1NVWQ 1QG4A 1SVMA 2CL7X 1KI6A 1SGWA 4EAQA 1HH4A 1SVWA 5HR5A 3CF2A 4POAA 4JL5A 2NO7A 2JLVA 3DPUA 4Q9JA 4Q4AA 4DLSA 4RFVA 3TUZC 4W7SA 3TRFA 3ZQ6A 1JPJA 1X1SA 3EX7C 2KWIA 1G7RA 3EPHA 2RH5A 4H1VA 4LJ6A 2H17A 2WBLC 5TY0A 4JBWA 4RCYA 1KI4A 4BFUA 4K46A 5C4MA 3AKCA 5HKKA 5FOXA 4NH0A 3RS5A 5FH9A 3IIJA 2RGAA 2HCBA 3A8TA 4A6XA 5HE9A 3IO3A 4BFTA 1FNMA 1BMFA 1K6MA 2NG1A 2R9VA 1M7BA 5E3HA 3QUSA 4BLTA 3MG9A 4M1SA 4F38A 5C2JB 2QM7A 4K8OA 3THOA 4I99A 1YRBA 5K8IA 2QNRA 2ASEA 3QXCA 4DIDA 5KDOA 2FDCA 2SHKA 5EP1A 5FTLA 3EIEA 4NL4H 3AF3A 1IN7A 2WMNB 1XMIA 2VP6A 4HYYA 3FFBA 2R62A 1IOZA 3TVDA 3IPYA 4A8JC 3H86A 3AVPA 2GZDA 1KSFX 3R7WB 3KKMA 3AF1A 4UKDA 4LV8B 1W0KA 1YR7A 1E9DA 1TUEA 1FPMA 2Z0MA 1MABA 2ZJ2A 3RLFA 2QBYB 5EZ5A 4LHYA 5IDVA 1W2HA 5LB2A 3QNUA 1ZM9A 5BQ5A 3OE7D 1J2JA 2ZYVX 4PHGA 2VSOA 4D6PA 1CS4C 4XTCS 2ZRHA 5TV2A 4DUGD 2WHXA 4Q18A 4M53A 1P62B 2OILA 4IDPA 3ZZ0A 4F4CA 4XH9B 3MJRA 1HE8B 1E9SA 1J99A 2QRNA 4HZIA 1KZGB 1J8MF 3MWYW 4XWOA 1X6VA 4Q7KA 1GRNA 3WBKA 4UNPA 2G88A 2AL7A 5ELXA 1N6KA 1II9A 4TQAA 2IXEA 3LX8A 1FP6A 3RS0A 1LY1A 4TWZA 2QG6A 4MRRA 1KJWA 3LV8A 1UM8A 3RABA 1G3UA 3T12A 4A4DA 1ZJ6A 1G7SA 4IOLA 3AM1A 5KSOA 4FINA 3BFKA 4JLAA 4ACAA 4MDEA 4D25A 4JKYA 4Y0VA 1Q3HA 2OXCA 1NG1A 4IKEA 4B3GA 4JSTA 1U98A 2ZS7A 5JZVA 3B7GA 2R44A 1VYUA 3W6OA 3Q85A 3FFAA 3TJZA 2QL6A 4HLDA 3F3YA 3QKRB 2REBA 3DZ8A 2MMCA 3UANA 4QHYA 1OE0A 1E32A 3RWOA 3THYA 4CVNA 3ZYCA 4B47A 3T1TA 1CRPA 3KTAB 3CPJB 3IBGA 1QHHB 3W8RA 5JBQA 5LD2B 1VCMA 2FNAA 2J5XA 4US1R 1R2QA 4GP7A 4ACBA 3MCAA 2OUKA 2WZQA 4GDFA 3C4JA 1PZNA 4JKIA 1G5RA 1EXMA 2BC9A 1S9DA 2B7BA 1US8B 3IQXA 2WPDD 1IN5A 3RC8A 4LJ7A 3HU1A 4EPTA 4P4TA 3AUXA 3L0SA 1H8HA 2F3TA 3OZXA 3E2IA 2ZE5A 3B1VA 1VKJA 3EARA 1NP6A 4IOKA 5JEDA 4QRHA 3UK6A 1GNQA 4M9ZA 4ZCMA 5BN5A 1SVLA 2YC4C 3CPEA 2R6GA 2RGGA 3SJBA 2BMJA 1G8PA 4OKSA 2ERXA 3N70A 3UWKA 2BMDA 3RAPR 3KXKA 1MO5A 1GWNA 2IHBA 4X8HA 1N0VC 1Q0UA 5TVKA 4JBYA 4H9GA 3NBXX 1KDOA 1KI9A 1SZPA 2FWRA 3W5JA 3U7HB 3BJIC 5F3WB 3R9XA 4EQ6B 3VR4A 1OV4A 2I3BA 2QSZA 4E09A 4DLUA 4A0HA 4CYMA 1Q1QA 5FPSA 3UXMA 5B57C 1N0WA 3BIFA 1RC8A 3NHAA 2H16A 3VR1A 1N5JA 1TQ2A 2H7VA 2NPIA 3CRRA 3DM5A 4RKFA 2FMXA 4A9AA 1NL3A 4OI0A 2OBNA 4JJZA 1E9AA 1Q57A 3THXB 2HT6A 3SN6A 2A5FA 1HUQA 1N6HA 5DHAA 4RZXA 2ZU0C 2VP0A 3PG5A 4OI4A 1I2DA 4JL8A 5HCNA 1G291 3GPLA 2ZAOA 4O25A 4EPXA 2Y8EA 3HPRA 5FL3A 4A0RA 4EPWA 2J9RA 2JIZD 2ATXA 3I8SA 4CEJA 2EFHB 2XSZD 1OXXK 3BFVA 2GAAA 2HJVA 4NZYA 2O0HA 3QKSB 4R9UC 5KO2A 2QQ0A 2KE5A 4GZLA 4M1MA 1ONBA 2ZRBA 2IXFA 1EWRA 4EDHA 4WXRA 1JR6A 2ZRNA 3P1JA 1G1MA 4EFNA 2O8DB 1NKTA 2IUTA 2QE7A 2RGNC 2FPLA 2PBRA 1GKYA 1Z83A 1E4VA 1UKVY 1E1QA 2DR3A 5KYKA 4Q48A 1E0AA 3OIYA 2ZS8A 4V0KA 4Q1EA 1AZSC 3C15C 5G53C 3VFDA 1XCGB 4KCGA 2IF0A 3E1SA 4N1AA 3VKWA 1KIMA 1T8UA 3WMFA 4DJTA 2ZSEA 2OAP1 1KMHB 2QTHA 5EE5B 2B8WA 5AJWA 3GLGE 3VU9B 2P0EA 4YDSA 3C5CA 1II0A 2ODEA 5EE1A 4A92A 5CM9C 2EYQA 1SHZA 2IYZA 1MRSA 2PMKA 1SVKA 5F2EA 2FZLA 1EX7A 3OESA 1COWA 2E87A 4NMMA 3U3RA 1N25A 3K9HA 2XX3A 2VLIA 5FOUA 3ND8A 4NBSA 4DZZA 5IK2A 4QBHA 4ZPXA 1JALA 1E9BA 5TXGA 4BPBA 1KO4A 4FD2A 4N3NA 3UIEA 4C0SA 2CCGA 3D3QA 1PVOA 3NG1A 4NCKA 3LX5A 3QXSA 3REGA 4DLVA 2A5DA 1KGDA 2XTMA 4NKRA 4DSUA 3MJHA 3AP3A 3L82B 3RS7A 3U60B 4KYUA 2Q9CA 1OIXA 4LJAA 4C7OA 2KJQA 1KMQA 2B21A 4JS0A 2J0UA 2GHIA 1LF0A 4TMKA 4X8LA 5GVSA 4LV5B 5CYPA 4NCNA 3NH6A 2RGEA 4ILEA 5DI3A 1GILA 2DYKA 4OQMA 2BOVA 2VBCA 3T1QA 1KY3A 5HPYB 2XJ9A 3R7WA 2QTFA 4EJSB 3BB3A 4US0R 4QM7A 3UKDA 1OSNA 4QC2A 5K8LA 2ZROA 3EZ9A 1NIPA 1CIPA 1NMYA 2RMKA 4GRAA 4B35A 4WA7A 2ORVA 3DM9B 3U3MA 2QBYA 5AUQA 3LY5A 2Q3HA 3P26A 2ZVPX 2AK2A 2NIPA 4Q9KA 4DDUA 1M2OB 3K0EA 4TQUS 2ZI5A 2ODWA 4D0GA 4V0OA 5EXSA 2QPOA 2IK8A 1HT1E 4P4SA 4I1UA 5DNYB 1G4AE 4HATA 3TH5A 3PJRA 2GVZC 5J4VA 1T5LA 5CK5A 1W46A 2PX0A 1KDRA 2UZ3A 1OKKD 4CW7A 5AJVB 2QP3A 4R98A 1G41A 4D81A 2P6RA 1GL9B 1YZUA 2C9YA 3FKSA 1DAMA 4PR0A 4KI0A 3WMGA 1Z08A 3K70C 1F6BA 3R9IA 3GCGA 3LW8A 2IL1A 3UMFA 3TR5A 3NEYA 1E0JA 3TSZA 4QGAA 4D4MA 1FMJA 2IYXA 3TMKA 3OAAD 3K8YA 4MGZR 1W5SA 4IW3B 3CZPA 4YXWA 1G3RA 4BGDA 2AX4A 1KJYA 1GL6A 1Q1EA 2YOFA 2FSIA 1GZSA 4M1KA 5H68A 4PC2A 3T34A 4F91B 3TW4A 4LK2A 3CRQA 1ZM7A 3QKRA 1VYTA 2ZRKA 3B78A 1HA3A 4MRNA 5L3SB 1VIAA 5E7MA 1PV4A 4AYWA 1BS1A 3LRPA 4DBLC 3NHBA 2ORIA 4ITRC 4RKEA 1V43A 2XGJA 3KTAA 3ZJYA 2J87A 3REFA 1IY1A 1KSJA 4AKEA 3ADKA 1QHHA 1QHSA 4TTRA 2IX3A 3BE4A 4Q02A 1EESA 4MITA 3W34A 4ZIRA 1HYQA 1ZNYA 1EFRD 3I1FA 1RW4A 1GP2A 2X1VA 3QXXA 4GOXA 4W5WA 1Y3AA 4CZ2A 2JLXA 1N5KA 2C9OA 4EPYA 1OXSC 2ONJA 3K09C 3PUYA 1W36D 4A8JB 1W49A 2CE2X 2W6IA 3G82C 4LSGA 3L0IB 3ZZUA 4OBEA 5G3YA 3C14C 1IXSB 3UMRA 2OFWA 4DLXA 2EVWX 1H8ED 3U44B 1CJKC 3GLHB 1VMAA 1A7JA 1E1RD 3B1ZA 1JAHA 2VHJA 4M9XA 3F0TA 4TN1A 5K8UA 4EUNA 2XZPA 2F6RA 4I1OA 4PQRA 2DY1A 4AKGA 3WRYC 3QG1A 1O3YA 2NMVA 5JECA 3EIHA 2VHCA 4D4JA 3L0PA 3PV0A 2ECKA 3SBEA 4YMSA 4DT1B 4IXNA 3SBDA 3D7MA 4LJYA 4QBGB 3TK1A 4DCVA 1TUIA 2BHRA 4KLZA 4TYNA 1E79D 3M4YA 4B73A 4HB3A 1G16A 2IYQA 3BC1A 2DFKB 2PCJA 5B58C 3RDPA 3GQBA 3WP0A 2VSXA 1NBMD 1KHTA 3OFND 4NYJQ 4NONA 1XBTA 2X2EA 5CJPA 3A1WA 4D2IA 5L8VA 1TEVA 1IM2A 2FH5B 2YOGA 3NXSA 4Z8YA 2GXUA 3OF5A 2IW3A 3W6PA 1VYVA 1KDTA 2WOOA 5FL7A 2ZRLA 1QG2A 1R0WA 3PEUA 1QF9A 1II8B 1T3HA 4URUR 3LXXA 4DC9A 4PZZA 3J81k 3GLFB 4LOAA 4GI7A 1UKZA 3DDCA 2W6JD 3A1UA 1WBDA 3HU2A 2FPKA 4JLOA 3CBQA 4U5XA 5D3MB 3SDZA 4HI0E 1M6NA 3KJEA 2E1RA 3LBHA 1ETUA 2YWEA 3QKSA 2ODBA 1Y63A 2GF9A 4TLAA 1M7HA 4ZDWA 5LB4A 4LRWA 3I3SR 1B0UA 1KI8A 3O8RA 4LY6A 2ZI6A 2JATA 1IJEA 3AVOA 3QF4B 1OYYA 1PLJA 2JA1A 3I72A 3U7FB 1MKYA 4CRWB 2O8DA 1HEIA 4LHWA 2BCGY 3FTQA 4TYPA 1IN4A 4E07A 2J59A 3B1YA 4XSHA 2G83A 3WBJA 2GZHA 3RWMB 1OH8A 1S96A 4Q9IA 1AK2A 1AS2A 4V0MA 3KX2A 1WCV1 5FI1B 2IUSA 5J47A 2D4HA 4HAVA 2FA9A 1ZW6A 1EFCA 1SXJC 1YU9A 3S1AB 3DEFA 4ZDJA 1JEDA 1YE8A 4M0LA 5JLJA 1KMHA 2YHSA 1RPZA 2XNDA 1J8YF 1Z8FA 5H8WA 1ELOA 1OIVA 3PIRA 4C3ZA 2VHTA 4IFBA 1G64A 1PUJA 3DVLA 4JLBA 2QENA 2RKOA 4B3BA 3ZZTA 1EK0A 4A2WA 2GBLC 1MO4A 4US2R 5AUNB 3AP2A 4JSYA 5FI0B 2JJ2D 2VEDA 1GTVA 3I5YA 3B9QA 2HUPA 4JLKA 2H92A 4XD7A 1KAGA 121PA 1VG0B 4DLZA 1Z6YA 4F7WA 5KNDA 2GK7A 1FTSA 3R9WA 5F9HA 3TQFA 2WJIA 2QU8A 2A9KA 4LJ8A 2AKYA 3KQKA 3W8NA 4IEEA 1XX6A 2C5LA 3ASYA 1AA9A 1JECA 2FSHA 1CR0A 1E96A 3AH8A 4UXIA 3H1TA 4KO8A 1Z6XA 3V00A 3TBKA 3PVSA 2ZRJA 2QAGC 4HAUA 2VP9A 4OHXA 3AVWA 3BXZA 1Z5ZA 2XOKA 2A5JA 1E9FA 2CK3D 3QVVA 1D2EA 2FV8A 1CJVC 4HLUA 1UFQA 3WP1B 5DN6A 5EUQB 1OYWA 3WYGA 4D0LB 3RYTC 4CT5A 4XIGS 1TF2A 2ZPTX 5IHPA 2JDIA 4EJSA 4I4LA 3AV0B 3DMNA 1Q44A 4RJLA 2O8CB 1WP9A 1YZTA 2CE7A 2JLSA 2ZRPA 4RVCA 4B3XA 2FF7A 2D2FA 1K5DA 5HKKD 3N2EA 4FN5A 1XJCA 2IYUA 3RRZA 1P5ZB 1Z0JA 2GCOA 4ZCLA 2P3SA 4LYFA 1A82A 4JZKA 3K0AA 1BMFD 3LWNA 4MKHA 3BORA 4BWYA 3RS4A 1FW6A 4B3CA 4DCSA 2OLKA 2GWHA 3GJ8A 4BZXA 3ZD7A 2R6FA 2IWRA 1N2CE 1PJRA 3BGWA 4M4SA 3MMPA 2IYVA 4MKIA 4TL7A 3C7KA 1A5TA 3L43A 2BIFA 1CR1A 2DFNA 2ZETA 1G17A 5L3RA 1NN0A 2J45A 4KSCA 1H65A 1W0KD 1P7CA 1X3SA 3HYRA 4JMPA 1KO1A 1LS6A 1AQUA 2CLSA 4PAQA 1ZCAA 2Q9AA 5CLLA 2J1LA 3K0FB 4HAZA 2F1HA 3CWQA 4C0AC 4WBSA 5KPDA 2RGDA 2EWWA 2WKQA 4HB0A 4L9SA 1QHNA 1WB9A 1LB1B 1DBSA 2R6CA 2A2ZA 4CEHB 1T8TA 2WKPA 4URVR 1GRQA 1G9XA 1E0SA 5L3SA 1O87A 3HDTA 2AR7A 5G3ZA 2QGNA 1IQPA 4BFVA 5AUOB 5F98A 4GMDA 4QNMA 2D7DA 5HE8A 3FPAA 4UNRA 2PLFA 1EFHA 1YR6A 2IWHA 1R8SA 4Q9LA 1TPZA 3QJYA 5DI9A 3QE0A 1WA5A 2GJSA 4AG5A 4YDHB 3W5IA 2VPPA 1XEXB 1YVDA 4A8JA 2CVFA 1XDBA 2R8RA 3ZD6A 5UKDA 1IY0A 1GIAA 3M0EA 3B60A 2Z4RA 4HB4A 3V9PA 1T0HB 4AG6A 1E9EA 2F9LA 4QHSA 4WXPA 4DRZA 1E2PA 5D3QA 4GZMA 4D82A 4UJ3A 5FUXA 2ORWA 3GLHA 4DEYA 2ZR0A 3BH7A 4AURA 721PA 5DO9A 4AIIA 5KNBA 2O8BB 2CXXA 2ZSAA 3NDBB 1ZYUA 3AVQA 2REXB 1GFIA 4C2UA 4L5BA 3TNFA 5J4LA 3AVUA 4Q01A 1E98A 4OI2A 2GTPA 2JJ8A 5J4HA 2NO1A 4KSBA 5JWOA 3TSWA 2GJKA 1CJUC 3CKLA 3GJ6A 3RSLA 3KUDA 4DT1A 3BB4A 4D0NA 1VECA 4LZZA 4LC1A 1A2BA 1E4YA 2FU5C 4OK6A 3GEIA 4TT3A 4OQLA 2OBMA 2HEIA 2VF7A 4NCJA 4PFSA 4YMTA 4QJ4A 1CRQA 4Y0AA 1G6OA 1N5IA 1ZC4A 4UNNA 3K70B 4B71A 4ARZB 1CTQA 4RD4A 2Z4SA 3TGPA 1T4GA 2Q9BA 3GEEA 2H1LA 3LVRE 2O0KA 3QPWA 4WIAA 3GFOA 3UPUA 1FFHA 2WWIA 3B8HA 1H8HD 4HB2A 1WQ1R 4ASUA 4GOJA 1KNXA 2O52A 3EC2A 5KSZA 4Q1FA 1G3IA 5F9FA 1N6LA 1II8A 2YKGA 3QPVA 3QY0A 2WOJA 3MRSA 3GLFA 5GJCA 5FPTA 3VR5A 2Q3FA 3CF0A 3M1IA 4KVGA 4KHZA 4Q1CA 5JHHB 3QBTA 4TLEA 1D8TA 5D3MA 4M8NE 3FB4A 4QBFA 1XZQA 2YNMA 3GMTA 4DCUA 5SZHB 3AGQA 2WMOB 1DO2A 2VIIA 1R7RA 1R5NA 2VP2A 2JGNA 1G8GA 4TMZA 4Q4HB 2OO7A 2ZANA 2A30A 3KFVA 3KKPA 3PCRB 4PC7A 3UG6A 2PT5A 3QF4A 2BEKA 2DFLA 3FMIA 2ZRCA 3SS8A 3SYLA 5JS8A 3LBNA 3T06B 1OLOA 4TYQA 5L3QB 3I5XA 1WMSA 5DE3A 1G21E 3H84A 4TLDA 3I61A 2OFOA 5AWFC 4GOKA 5JI3E 2FEOA 2GEVA 4AKIA 1JR3E 1OFHA 1UEIA 2YZ2A 4GL2A 5FBLB 3GLGA 1KY2A 1UF9A 3ZS9A 1OXTA 2P6NA 1OH5A 5KUTA 2NGRA 4N0DA 3Q9LA 3S1AA 3OEHA 1K8RA 5JFGA 4BEBA 4PPNA 3U4QB 5CM8B 5J40A 2QPTA 5BN3A 2ZM5A 2O8FB 1A2KC 4UNQA 4Q7MB 2DBYA 4FMCF 4A82A 4QGGA 2OXRA 4Q1BA 1MRNA 2OFXA 2HT1A 1TQ6A 2ZYWX 4M1TA 1VCNA 3BD9A 5J4KA 3WY9A 1IAQA 1UBCA 1ZM4A 3GLHE 2GXSA 2YJTD 5FBWB 2ZSDA 1DAEA 4PX9A 2FFQA 2QE7D 2Q0HA 1EX6A 1QHYA 2PMDA 1JJ7A 2GRJA 5LBIA 4E5UA 1E1QD 3UATA 1Q22A 1ZM2A 1Z63A 2ZUBA 1T3LA 5CIQA 1KO7A 3IEVA 2W00A 3LVQE 4HAXA 1E3MA 3ZVMA 5JJLA 4AI6A 3JZMA 2GZAA 4F4IA 4CT4B 3I32A 1HQYE 3QQ5A 1OPXA 4M22A 1NY5A 2GCPA 1XD2B 1LS1A 2OESA 1YZGA 2OM2A 3NC1C 3FHOA 5E95A 2VHQA 1VCOA 1W4RA 1XTKA 3LLMA 1G20E 2WM9B 5EE9A 4UJ5A 3UWOA 4LV6A 3MWKA 4P33A 1Z2CA 2R6AA 5FPKA 1L4YA 4EFMA 4C9BA 4FIDA 1COWD 1F2TB 1S8FA 2F1IA 3SFVA 1FUUA 4DHEA 2QQEA 1QRAA 4K81B 2O8CA 2QMEA 3CR7A 3RNLA 2HF9A 4PO9A 1WBBA 5IK2D 4NU0A 5JJKA 2P2LA 1DVRA 1XTSA 2XITA 2OCBA 3NC0C 4TL9A 4Z51A 1N6NA 3PEYA 2RAPA 5TMPA 3IKJA 2WTUA 1QZXA 1U8AA 1GNRA 3FMFA 2WAXA 3U3OA 1ZINA 5EUMA 2BKEA 3MWJA 1E9CA 4KBGA 3VX3A 3GLFE 2YV5A 3KJGA 2RGNA 5JWHA 2GF0A 3CX6A 4TYWA 4RZ3A 1BKDR 1W0JA 2VP5A 1M8PA 4PSVA 2QORA 4ZDKA 1CULC 5CITA 2C77A 1KO5A 4H1UA 3ZS8A 2V1XA 2ANBA 4G5QA 1F60A 4KAXA 2YC2C 4DLTA 3GP8A 4PPGA 2JLRA 1SHKA 5G40A 3W9YA 1W36B 2Z43A 2ZSFA 1AZTA 3EA5A 4JBXA 4B2PA 3V4RA 1OH7A 1P9NA 1SXJB 3MUFA 4B32A 5CYOA 3KQUA 5A0FA 4RD3A 5TARA 2I1QA 4YONB 1IY2A 3U5ZB 4TMTA 3GEHA 4TSFA 1ZCBA 4AK9A 4FWIB 2BJVA 1U2RA 2XTNA 5EJEA 1HQCA 1TL7C 1XP8A 821PA 2PL3A 4RFSA 3QI2A 3CUEF 3O8BA 2ZRGA 4MGKR 1SVSA 5DSZA 4JL6A 2DWQA 4PZLA 4E22A 4CF7A 1OXVA 3FYHA 4LJ4A 1JB1A 4OHVA 1CBUA 2Z5FA 5EE0A 4EKDA 1RKBA 4MYUA 2TMKA 4QGFA 1QHGA 1ZU5A 3PQCA 1VDZA 1VHLA 2WJJA 4IDQA 3TUIC 2EWVA 4NCIA 4OK5A 1GVNB 3FOZA 3IHWA 1L4UA 3ONWA 2FX3A 1U8YA 1NI3A 2VQSA 3FKSD 4JLNA 5FR2A 4C30A 5EP2A 2QAGB 3HPQA 4BFXA 4BE7B 2CNWA 2JASA 4GT1A 4DCTA 2WJYA 1U0HC 2IT1A 1E2KA 2XTZA 2QP9X 4A2PA 2WWGA 2ZJZA 3BWDD 3IQWA 4MA4A 1VG8A 3AVTA 1IONA 3HWSA 4PAMA 1UJ2A 4ESVA 3ZDQA 3TIFA 4YXWD 1JJVA 3A6PC 2Z83A 1N6RA 2B92A 4LBYA 4QHTA 5AK0A 3KJHA 5JSZB 1NJGA 2ERYA 2HDNB 3PITA 1E99A 4JIMA 4TLBA 1E2MA 3SC3A 2O8BA 1M7GA 4ZV4A 4LPKA 4B75A 1KI1A 3Q8XB 5DH9A 3PEVA 2F7SA 1NG9A 2QPAA 4B48A 2BM1A 1C4OA 4BFZA 5FBVB 3B85A 4ZKEA 3BK7A 2QMUA 3VMFA 4UQOA 3FMPB 3ND9A 2WSSA 4LHXA 3SNHA 2A78A 4I81A 3LDAA 4TTQA 4C0HA 1Z0FA 3NTUA 5DGXA 1F5NA 3IHLA 4V03A 1T91A 2YOHA 1NN5A 2XZLA 1P75A 1HT2E 1Z0KA 4DDWA 4ARZA 4IEIA 2O5VA 3AKEA 2W6ID 1ESNA 4ON9A 4KFSA 2IBMA 2PEZA 3T1OA 4B74A 2C04A 1NMZA 3K0CA 4Z1MA 4BRWA 5A4JA 1NJFA 3TSOA 4G1UC 1RRFA 1RRPA 4I1SA 4KFTA 4P31A 5DYIA 3VHLB 3LFUA 1OHHA 4BFSA 4PHHA 3FKQA 2WJHA 3K0CC 1XPRA 1GG2A 4TL8A 1XJQA 3A4LA 1XTRA 1OT3A 3GJ7A 1W47A 3L2OB 2FZ4A 1RJ9B 3EW9A 2IYWA 1ZIPA 2NO9A 1NSFA 1G8HA 1JXMA 3K1JA 5EP4A 3TKLA 2HYIC 1UEJA 2JLQA 4IDHA 1GRRA 4ZI2A 2IYTA 5JCZA 3LNCA 2VA8A 3D31A 3P27A 1J90A 2BBWA 2XB4A 4Z8XA 4KVAA 521PA 1CF4A 3B1XA 1TF7A 3QKTA 2BMFA 3K09A 3SYNA 3AUYA 2OCPA 3RRMA 4J0QA 5L3QA 1KK1A 1OH6A 4MRSA 5JRZA 4Q7LA 1RVDA 1U90A 2W58A 2ZYUX 3DKPA 2ZQ5A 2G0NA 1QVRA 5JJIA 1XD8A 4KFRA 4M9QA 1EFUA 2BDTA 3KDSE 4X8MA 5FL7D 1JXOA 2BMEA 5FTNA 4X8OA 1W4CA 2ZRMA 5CDFA 2GK6A 1NVUQ 3TE6A 2O8FA 4CEIB 1US8A 2ZYTX 3SJAA 1P2UA 1S1MA 5EXTA 4YC7A 1FOEB 2JLYA 4MQBA 4BUJA 1LTQA 2ZJYA 1EFTA 4L16A 3SE0A 3PUVA 1OJLA 1YZKA 2GCNA 1U94A 1W2GA 221PA 2ZRIA 3B2EA 2HJGA 3EA0A 3AB3A 4NYMR 1UDXA 1GM5A 4WAUA 2Q3MA 5FOWA 1Z22A 2OSBA 1NN1A 1IXZA 1U9IC 3SU8A 4LPSA 3MD0A 1ZNXA 2ZVQX 5FTJA 2P5TB 1GOTA 2C99A 1AS3A 1SKQA 3EPJA 1DE0A 1N6IA 1P72A 4ZDIA 3JVUA 4RD6A 3X1YA 3TR0A 4AYTA 4W9MC 5BYJA 1OFIA 3QKUA 4B2LA 2IC5A 3VR2A 1XTQA 1LVGA 2J3EA 4W5HA 4EQ6A 1IBRA 3A1VA 1BH2A 1XD2A 2ZUCA 3GJXC 4V0LA 4YQFA 1DAKA 2C98A 4FCTA 4O0MA 4Q1AA 3LXRA 1KI2A 4IOJA 3C8UA 2XNDD 1CEEA 2D3WA 1TTTA 5CB8A 1MABB 4XJXA 2V55B 1AJEA 1MR3F 3DO6A 1ZD8A 5FBQB 2OAQ1 1PUIA 3IEUA 4LJ9A 3WYAA 2CLCX 4DLYA 1P9RA 4LBZA 2Q6TA 4QBIA 1DAFA 2ZS9A 3OIWA 1FZQA 1ODFA 1D9ZA 5BW8A 2AD5A 3THXA 2ZJBA 3AF0A 1C1YA 4XD7D 4KU4A 4Q00A 3IIKA 4HEJA 2PJRA 4R2HA 3THWB 1VPLA 2PX3A 3H0KA 1ZNWA 1X8JA 1Z0AA 2Z6VA 4HDCA 1GKUB 4JLVA 4D80A 2B6HA 421PA 2ZREA 2IHYA 1GSIA 1OXUA 2RGXA 5JCPA 4IRUB 3ICQB 2IUUA 1E0KA 4RZ2A 1YR8A 1JQJC 2EYUA 2CHVA 4URYR 3AVVA 1P60A 3KQNA 1TEXA 2QEQA 3Q7PA 2QT1A 4M9SA 3GJ4A 1DARA 2N42A 1MO3A 4MYCA 1G19A 1Q1BA 1DAIA 3JZAA 4RCZA 2XOKD 4CDGA 4MDFA 1E2LA 1Q3TA 1SXJA 2J7PA 3AEZA 1RFLA 4DWJA 5H70A 4Q47A 5DN6D 1FTNA 3BERA 3IILA 3A1TA 1JBKA 3SQXA 3VNVA 2CCJA 2JDID 3GLIB 4B43A 3KJIA 3T5GA 1W36C 3QENA 4AY2A 4O2RA 4EPVA 2W0SA 3CH4B 2GBLA 3WNBA 5EE3A 2J41A 1KK0A 2WWFA 1DOAA 4NTZA 5FPHA 4FCWA 3VU9A 2JLWA 1GDDA 4A2QA 3SHWA 2IEYA 3GJ0A 4FWTA 5CDFE 2H57A 4XVUA 4WW0A 2V1UA 3AVXA 3Q7QA 4B3FX 3A4NA 2P6UA 1UBEA 3R8FA 2GNOA 4OQXA 3SOPA 1TAGA 2CL6X 1EWQA 4L4UA 1IN6A 1OFUX 1MT0A 3AF2A 3DKVA 3BBPA 4OHYA 2NO0A 2GESA 3ZVRA 4OI1A 4HAYA 3FDIA 3B13B 2WV9A 3T35A 5BWMA 4XWKA 5H1YA 1U81A 1WE2A 4WZAE 2KBFA 2QAGA 5KOYA 4D4KA 4AYXA 1CXZA 4DSNA 1MV5A 1TU4A 2ZSBA 1Q20A 1HE1C 1I4TD 4A6PA 1P6XA 4TMWA 5KTYA 5TB5A 4FMBB 3QSYA 4FI3C 2IYYA 3KKOA 5JHGB 2E9SA 2P65A 3WXMA 4GMXA 2G3YA 3KXLA 3RHFA 1BYUA 3M6AA 1W4AA 1XEWY 4BASA 4HUQB 1R10A 4Q21A 1JPNA 3DL0A 1FP7A 4II7A 1P9WA 2HCJB 4PXAA 5DHFA 2X8AA 1DG3A 1KK3A 3AKDA 4HDQB 3SEAA 1IJFA 3B5JA 2DB3A 3QVUA 3WNCA 1XD9A 1SKYB 1NLZA 2ZE7A 1TQ4A 2OCAA 2FG5A 2VO1A 4IDNA 4YLGA 1JEEA 3VHXA 4BECA 3I4LA 2EU8A 3IO5A 4BZPA 2C2HA 1G8YA 2HXYA 3SI7A 1XMSA 4XVQA 3T1VA 4V0NA 2JEOA 4URZR 5AJYA 2V3CC 1KSHA 4WOPA 5A5GA 1KJZA 1UBGA 4AC9A 4EPRA 1NF3A 2EFEB 4RD0A 2G77B 3TVTA 1AM4D 3H4MA 1VIYA 4Q03A 1D2MA 3PFIA 4FMCB 3CONA 2JJ1A 4IVQA 4B34A 3BRWD 3KXIA 1XMVA 1WRBA 3CZQA 4XWAA 1RYHA 5FBRB 2QMOA 4C0JA 2BVNA 4W5JA 1E9RA 4BFWA 1G7TA 1XNJA 2IEZA 2FPMA 2ZRFA 1NSTA 2VYFA 1R8QA 3CO5A 1X8LA 3IDQA 4P32A 3ICEA 1MH1A 1SXJE 2QSYA 2ZXUA 2C9CA 1P2VA 1Z6AA 4C4PA 4RZUA 1N0UA 2DPXA 5J5CA 1CP2A 5FTKA 2X2FA 3CRW1 3RS3A 1NVVR 3HP1A 4PC6A 1AS0A 2BBTA 4TT3D 5EP3A 5KU1A 1S1CA 1JAIA 2IF2A 3B1WA 5DIFA 1EG7A 3IIMA 3KB1A 1BIFA 1LNZA 1XFAA 5IRCD 4GSYA 4DXAA 1KSGA 1DG1G 1DEKA 4XTRA 3L0OA 2FOLA 1NRJB 4P0TA 1YZLA 5EXPA 2CCKA 3BFXA 2H18A 3SJZA 1XXHB 1ZVQA 4KLNA 4TTPA 4MKGA 1JR3A 2NQ2C 4TLCA 3TW8B 1OW3B 5CK4A 3LAWA 1QDEA 4OQNA 1UBFA 3A37A 4IFEA 3U3KA 4ASUD 4C0LA 4ZI3A 1R5BA 2QP4A 3AKYA 1Q1ZA 5DLQC 2W2TA 1N6OA 4IVRA 4QM6A 3CNNA 1S3GA 3LD9A 4JLMA 4JT2A 1KTVA 1NBME 1Z07A 2IA5A 4GBMA 4CEIA 4Q4LA 5SZIA 2ZUDA 3MWLA 4BLPA 1I2MA 1Z6GA 1QBKC 5CLQA 4UXHA 3SQWA 2KSQA 3P4XA 2HF8A 4LHVA 3FVQA 2QZ4A 3QBVA 2JLZA 3U44A 5DYGA 1QHXA 3ETLA 4OL0A 2HLDA 3CH5A 2ZITA 3CW2A 3RS2A 1IXRC 4PSKA 1SULA 1P3JA 4PC1A 2H5EA 2V7QA 1KK2A 1CU1A 3KB2A 4TZ0A 3BOSA 5G41A 2NZJA 1Z29A 2GA8A 4KJZA 4C7OB 3Q5EA 3ZIAA 2J0UB 3EG5A 2FN4A 4G5RA 2ZU6A 1T9HA 3IUYA 3CPHA 3VR3A 3O8CA 1FX0B 4RSGA 1OB5A 2ZE6A 2AD1A 1ZMXA 2VH5R 3AVYA 5DI3B 1G3QA 621PA 1G3MA 4TQ9A 1W4BA 4HAWA 5BN4A 3Q72A 2AK3A 1CKEA 4HDOB 4MKFA 3X1XA 4LUCA 1CLUA 4FW9A 3K9NA 2QAJA 3OEHD 3WHKA 1AKYA 3FMOB 5E4FA 5LDDC 3OEEA 1U0JA 4AWXA 2LKDA 2ZEJA 1ZP6A 4G5SA 2W2XA 4QJ3A 1D9XA 1ZIOA 1B23P 4QJ5A 1ZU4A 2R65A 3OHMA 4LCBA 3GFPA 4GNKA 3FHTA 4LWZA 5KSPA 1W1WA 3ZQJA 3AP1A 5GJBA 2JCSA 3L8ZA 1S3SA 4F92B 1AGPA 2IYSA 3HU3A 6Q21A 1KI3A 2C03A 3P4YA 4P4SB 1VTKA 3K9GA 4WZBE 3SR0A 2MMGA 3AF4A 1UKYA 2I4IA 1G5PA 3JVVA 3K9LA 4JYCA 4OHZA 3EPKA 3FE2A 3THWA 2EFCB 1Z0DA 2QROA 4D26A 2O8EB 4GPTA 1J7KA 3TUJC 4B2IA 2JLUA 1E6CA 2IS4A 1LV7A 1CR4A 5JRJA 4D4LA 1CJMA 4ERNA 2UZIR 1L8QA 4U02A 2ZJ5A 3PUWA 3A58B 1YZNA 2FFBA 5BXQC 2GXAA 2KBEA 4Q7JB 2J0QA 3QOFA 4PPFA 3WRXC 2V9PA 3E5HA 8OHMA 4JLPA 4UXJA 5AJZA 4CGZA 1XCMA 2AFHE 4MGIR 2G1KA 4MYHA 4UNSA 3IGFA 3DOEA 1RRCA 2FFAA 2F1JA 1E2JA 2PZGA 3GLIA 2PEYA 1GNPA 3LLUA 3QXHA 4OHWA 5FR1A 2PLRA 1F2UB 4BZQA 1G18A 3P20A 1XEFA 1I4LD 4E03A 1Z0IA 4S35A 2CLDX 5HZHA 4HLCA 3O8DA 5C18A 4URXR 3VAAA 3EWAA 2QN6A 4YMVA 1SVIA 5FTMA 1T6NA 4P3YA 3QEOA 1QHIA 1W0JD 3I8XA 3OE7A 1ESMA 2R6DA 5B2ZA 4ZIRB 2PJZA 1RIFA 1R5OA 1UAAA 2ZI7A 4DUGA 2RGCA 1MOZA 2WSMA 4Q5IA 4TMXA 1A4RA 1E2QA 4DDTA 4MGYR 2VP4A 3Q3JB 1UDWA 4G5OA 4BLRA 2F1RA 2CVHA 2ONKA 4PTLA 1ZD1A 2VL7A 1R0ZA 4OYHA 4TSFD 4LX0A 2PZEA 1XMJA 2ZAMA 1JNYA 2WWHA 3CLVA 5CIWA 5TDHA 3KZ1E 1XF9A 1KDPA 3I62A 1XJ0A 4HUQA 3CWZA 4DSOA 4O3MA 2W83A 2AXNA 4A1FA 2WWYA 4YMUA 3D6TB 1M1YE 4QG7A 2DHRA 4NCHA 1N3BA 1TMKA 1XB2A 2MSDB 4IJMA 4RY2A 3BS4A 4QNRA 4DSTA 1IHUA 1KO8A 5KNCA 3U6BA 2XZOA 4A0GA 1GL7A 3W3ZB 5JWRA 4B33A 3SYKA 1W48A 3MSXA 4PHFA 1KNQA 4XVRA 3CX7A 4B3DA 1FMLA 2QI9C 1KYIA 3B82A 4OJQA 4C2TA 4PAOA 3PENA 2CNWD 2IS6A 3L8YA 4PANA 1UKEA 2RB4A 1ZM3A 2QRZA 4DKXA 2WAYA 3EIQA 3EZFA 1TU3A 1A1VA 2XXAB 3R20A 4M1WA 3GD7A 2W0MA 1TX4B 4WVFA 2GAOA 1L7VC 2LKCA 4LI0A 2GILA 3WYFA 4FCVA 2F9MA 4LDJA 1NLFA 3LW7A 3CNLA 1SQ5A 3ZH9B 1KZ7B 2WPDA 4ESHA 4MRPA 3A4MA 1OIWA 4TL6A 4U7DA 1R0XA 4BEJA 1AQYA 2IXGA 2UKDA 2ZJAA 3VKGA 4M1OA 2DFTA 1WF3A 4BQSA 2ZI3A 1NN3A 2C96A 3K0FA 5E7IA 2XEXA 4AKHA 2FSGA 3X2SA 2WSSD 2NPFA 1G8FA 4HLQB 1S4QA 5HCIA 1X8KA 4G5GA 3U3JA 4NYMQ 5KSYA 2GETA 3GLIE 3ADDA 3LBIA 2NO6A 4IOMA 1SVOA 2G6BA 4LYJA 2FSFA 1XEWX 2ZJ8A 3PR1A 4L9WA 2ATVA 2CHGA 4URWR 5FFMA 4CEHA 1VG1A 1BYIA 3GJ3A 1G5TA 1GUAA 2ZE8A 4GFDA 3K70D 1E2EA 1P4SA 4DLRA 2EFDB 2ZRDA 5LPNA 4A0FA 1XXHA 1L2TA 1E69A 1P73A 5FPYA 1CJTC 1KI7A 1D2NA 3QIAA 3BAFA 3GFTA 1MO6A 1FUKA 5DISB 2X19A 4Z1MD 3FWYA 2P5SA 4PO8A 2V4ZA 2CL0X 4U00A 1FL9A 5IF9A 1AIPA 2CJWB 3VTKA 3HJNA 1XEXA 3C41J 2WKRA 1OHHD 3BB1A 2VRWA 1E2HA 3H2YA 2RCNA
chains in the Genus database with same CATH superfamily
3QA9A 2HMVA 2GUGA 3G7NA 1EB9A 5LZ7A 1C9DB 1T36B 5DCYA 4Q4DA 2BV3A 4BB5A 1B43A 2YQ4A 1Z28A 5F2OA 2QX4A 3TD6A 1KOLA 4TTJA 1ZI9A 4PZ0A 4KWIA 2M1ZA 5CBPB 3U16A 1GZUA 4ALIA 2ZYHA 4LMAA 2D62A 3PPWA 1QB7A 4KXVA 2B5VA 1QIDA 1SUCA 4ND8A 2Q6IA 4PZUA 2WKSA 4QUHA 1U8EA 4EYSA 3E0QA 1OD6A 4C87A 4E31A 5J2UA 4BO7A 4JXKA 3O8NA 2OBFA 3AHCA 3V4FA 4IHJB 2BP7A 2G4LA 4L5CA 5HQTA 5DM60 3BTVA 4MQ4A 4TZKA 3W1WA 3MOGA 1Z33A 3STHA 5CEEA 2VUIB 4ZPJA 2C8KA 3IPXA 5EZ6B 1EZ1A 5CFLA 5CNMA 4FUQA 4M21A 2AKAB 1U7HA 4FM9A 3VDXA 4CIDA 5J23A 4AD8A 4Q4JB 3L8GA 2PGLA 5DYYA 3EN0A 2B94A 2X1LA 4MLZA 1TNDA 4MYRA 2PCLA 1E7YA 5B3JA 1BCRB 3D3WA 1J8FA 2CMKA 5AVJA 4ENQA 1RYMA 5JPDA 4J7AA 1D4FA 2WF6A 3I4FA 4HDSB 3K15A 4KQJA 2G25A 4KITB 5IZ4A 5KDDA 2XKKA 1K4MA 3I5UA 4RL4A 4RBNA 2QS9A 1R6UA 4KUHA 4DDMA 1MAVA 5SZKB 4MEBA 1K6XA 4O4HB 4RAQA 4ZAFA 3ZDYB 3U3ZA 5HF6A 4RUKA 4P83A 4H0CA 3OFVA 1XZIA 4NHOA 4GXTA 1ATZA 3NOOA 2ZTSA 4E2YA 2Q29A 3NIDB 1PCXA 2PWBA 3TJMA 4I9FA 4YJ3F 3MTQA 3FRJA 4AO8A 1PBTA 3H7IA 4AB1A 5JS7A 3ZHZA 3VKHA 4BNMA 1DWQA 4N5HX 3X1JA 4REQB 5TJ9A 3W5BA 4E5SA 1M34E 4DARA 1GAJA 3HDYA 4LZOA 1E9VA 2YHIB 4G86A 5TJHA 4C0BA 3SSMA 5AVVA 4KYIB 2ISCA 3VTAA 1A77A 5T4FA 2UVPA 5HZKA 1COZA 1A5BB 2HV8A 1SBCA 4QYMA 1SOAA 1OU4A 5JXHA 1UXHA 1P8JA 5CX4A 3QUTA 5HQJA 1P2SA 4G3XA 1CP3A 3L0YA 4C08A 3OQOA 3AGPA 2FW6A 1XZHA 2O3TA 3DFFA 3NWBA 1RWMA 4IIHA 3CLHA 1DXOA 1YS6A 2AHOA 2A9QA 3PFCA 1RT9A 3K30A 5GJWC 3SCZA 1XXHE 4YRTA 1H2HA 1P0MA 1K7YA 4S2EA 4YP1A 2HPHA 4G5FA 2G9NA 3RFTA 4D3DA 2WRZA 2P9ZA 4NYIQ 3CINA 5C3MA 4A8PA 1L8AA 2JHCA 1DZ3A 2DCUA 1NQXA 4CM9A 2EZ8A 1SCAA 5KTNA 3TLZA 1F2UA 1R6XA 4C22A 1ISRA 1ORHA 3AXTA 3DYIA 4TTTS 2VDVE 4UDYX 1YC5A 2FMKA 4LYAA 1AN0A 1SC6A 2EKLA 1VZ2A 2WVGA 1VLMA 2UUBB 2YWDA 3DUFA 1UANA 4F4JA 1NNLA 2PLAA 2IU4A 2VF8A 5KTPA 2FWJA 1SN7A 2QLTA 2HX1A 3ETCA 1G6HA 2ZPAA 4U7TB 3RSZA 3CIOA 3EZ7A 3HKDB 3AQ4A 1N2XA 1X9GA 2FKNA 4MV4A 3IVMA 3L7LA 4I14A 4FZJA 4BFYA 3T0IA 4RLQA 1XTIA 1W5TA 2VZLA 3DOJA 1M8FA 2FSSA 4LRSB 2J46A 3UXYA 1WETA 2V8OA 3CF6R 1QOZA 3WLHA 3EFOA 1JU4A 3N2YA 1DO0A 4KYTA 1JYEA 3IA2A 4QBKA 2A5YB 3GJQA 5DBHX 4S2UA 2P67A 2F3RA 5IBRA 3RRYA 3GAAA 5K8TA 1NTRA 1N77A 2OXFA 4TMVA 4EF5A 1XVTA 5HOQA 3LHKA 5J1TB 1GKLA 4ZVKA 1D6JA 2WFAA 1TF5A 2QT9A 4QOEA 4ANFA 2D7CA 3A70A 2F9FA 2ID9A 3S2EA 4AXBA 2P9YA 4PSAA 3G5UA 2HYDA 2VTKA 1L8OA 4PYIA 4D9GA 1X39A 4QTUB 2YWXA 2YYZA 3HVRA 2OHFA 4WECA 3MS7A 1YRAA 3EC1A 4U2CA 4PYJA 3SS9X 1GG5A 1RAGA 1EMDA 2WAAA 3AI7A 3ZCQA 2XMRA 2ZIXB 1DC6A 2E1PA 4KXYA 2A7XA 3MILA 3C1UA 2YVLA 3EASA 2PXHA 5CCXA 1F2TA 1FYWA 2OD7A 3CUYA 3O9ZA 3ZKAA 3SYMA 4B44A 5K7SA 3HO8A 4LXIA 4RXTA 4G41A 4TTVA 3HR7A 4N4AA 3IVRA 1FDOA 3AR3A 3GBPA 3G0CA 3ADCA 2X77A 3WFIA 1M2WA 5IJ0A 2WWXA 3EBPA 5AOVA 5GV7A 2Y1OA 4AZTA 1Z0SA 1GZ5A 5C46F 5J2TB 2FR8C 2M98A 3S27A 1MGOA 4NBUA 1XP5A 4IPTA 4ECEA 3PSHA 4PYMA 4EJ6A 1L3BA 2R8OA 2OB2A 1E92A 4FMDF 1PRYA 2D2EA 4I1VA 4OHOA 4UUOA 3RVRA 4MICA 3WQRA 3I12A 5ITZA 1QRRA 4I8IA 4Q9HA 5CJ2A 4R5HA 5C5IA 4MQLA 5BWCA 5DNVA 5JADA 3QE3A 5ANRB 3L4KA 1AZWA 3HKEA 2OPHA 1V4VA 3EY9A 4XSGA 3DULA 3JQFC 1JEYB 1VI5A 5I7FA 3FETA 3SXUB 5CD9A 1R4AA 3RR2A 3UPDA 2O2DA 4Y2SA 2X76A 3QVGA 2PR7A 3HB7A 4ZZIA 2X4GA 1UMBA 3IE2A 4JI3B 1W30A 1QH0A 3OLYA 3G2IA 1Y0BA 2G67A 4HCJA 4LQCA 3EPLA 1H8EA 2AWOA 3GJ5A 4FS8A 4NDNE 4B4DA 1D5CA 2BM0A 2C5BA 2DH6A 2NXWA 3LUAA 3TLBA 3FYSA 1GLGA 1DO8A 1HRKA 3ESYA 1UINA 1G4UR 2UVQA 4GYWA 2AFVA 2WNIA 2O57A 3DZIA 1R6DA 1TZJA 5AVWA 1L5MA 5AOBA 4X71A 2CXNA 3WISA 5HXAA 1HMPA 1C1DB 3N58A 3QBJA 4KEAA 4DR2B 3UMSA 3G5AA 4KBFA 2C54A 2ZB7A 4XWTA 1VG9B 1DIHA 2P9TA 3TBFA 5HHTA 4ZU3A 1NQOA 4G1CA 2XRFA 1LBEA 1TGYA 4DNXA 3LZDA 5DIZA 4EW3A 4Q1DA 3GLGB 2ZR9A 1N8SA 2VKTA 2QHXA 4O2BA 4MOWA 1BCSA 1CZHA 1G63A 1JT9A 1UPTA 1XA4A 3QK7A 3UAYA 4IUYA 4FGLA 1BEZA 1W87A 1H3FA 1USKA 3FPCA 1ZUWA 4PZYA 5BN3B 5G4KA 4KJXA 1VKRA 2MHCA 3KV1A 2BH2A 2ATCA 4DPKA 1CQZA 3BGDA 1REQA 3LT4A 1NI5A 3ONFA 2NU8A 3MM4A 1NY6A 5ALUA 3GVIA 4CQLB 4LQDA 4G0QA 4KDRA 4X6LA 3WK8A 5E6RB 2PYZA 1T29A 4MX8A 2JGKA 3Q5DA 2WC1A 4EW2A 4NXNB 1QH9A 3H75A 1DKNA 4F45A 3EEIA 5CBKA 4HQRA 3MCZA 4GLFA 4GPBA 1P1FA 5EJ6A 1I9CA 3MFQA 4QKQA 4LFCB 1M10A 3JYOA 4FWBA 5BQ3A 5L4NA 1CQXA 5TE9A 2GFIA 3O4JA 4ABYA 3IQZA 2Q8PA 4XXHA 2EW1A 4IX9A 3W1EA 2A14A 3NEJA 4KIJA 3W9UA 1F8XA 1JR3D 1UXGA 1HWYA 2OENG 3CURA 1ODJA 4LXTA 4KXNA 4ZCTA 1B6SA 2REOA 3DBHB 3G0HA 4P84A 3T4XA 3SZ3A 3RSSA 2BFBA 3ACCA 4LOJA 4JVOA 1SIWA 2WIFA 2AG8A 2Z5VA 2XT9A 4OQZA 2V6JA 1DAHA 1LDNA 1ZQ1A 1OVGA 1NDHA 2Y99A 4OXKA 1NX9A 4GP6A 5CT8A 2GEUA 1JFTA 3KKQA 3NCTA 3DZDA 4UM9B 2PSHA 1IBCA 1WMAA 2WICA 3PXXA 4V02A 3QU9A 5BSRA 4BO0A 4Y1FA 2AI1A 3CZ9A 3AJAA 4LIPD 1I2ZA 4HAOA 4LNUB 3TRJA 3HYLA 1QP0A 3DTVA 2PH1A 4B3SB 4IHQA 4WBNA 4W5NA 4NBLA 4O5AA 1O57A 4EJSC 3OQIB 1YIDA 4DMMA 3ESRA 4HF7A 1PIWA 1R6AA 1GXSB 3MFYA 2C7BA 3D3JA 4CMEC 3ZVNA 4DCNA 2ZI9A 1JHQA 1KWKA 1WDTA 2QUZA 4K9NA 2ETXA 4EG6A 3GRRA 4AMYA 3O4HA 4ZGWA 1RJ9A 1BO6A 1FJ2A 4NFSA 5BQPA 1W52X 5DBIA 5LXTF 4YNBA 1MJGA 3DT9A 5DNAA 1HLPA 2Z6AA 3HRKA 1L5WA 4PTYA 3AL0C 3UCXA 2WU3A 3ON5A 4IJ6A 2PKQO 1C4KA 1NVFA 3A06A 4FC7A 4KXWA 3C87A 5DWDA 2W6OA 2ODTX 4I1PA 1HY3A 4Y8VA 1NU8A 4MWGA 1Q5PA 3A9SA 5JVDF 4P6VF 3Q7RA 4XAQA 4DB4A 4OYYA 2JAQA 2J6CA 2BKLA 2VSFA 2VVTA 4E14A 5JS1A 5FOSA 2CHFA 1DIRA 2WLSA 3ANYB 3GA5A 2PX4A 3K05A 5D6OA 5HEKA 4EIWA 2RHMA 4D9BA 5K03A 1J0BA 1NXVA 3Q7TA 4RV9A 4X1YB 5EQTA 2A59A 1FNCA 3DLHA 1G4HA 1RXUA 1SVMA 4BNYA 1UZMA 5B1SA 1OR8A 3EVCA 2IZ5A 2JLVA 4CM8B 4Q4AA 3TUZC 2M6RA 1SNYA 6PFKA 4OJTA 2IUUA 2KWIA 3LC2O 4QOIA 1NUQA 2RHJA 5F7OA 4H0FA 2BUAA 1JDBC 2BTQA 2H17A 3KQYA 5TY0A 4IWXA 3TRDA 4RCYA 1KI4A 2ODQA 4RHEA 3GDWA 2BFFA 1KJJA 4LF9B 2C9ZA 3RS5A 2PGNA 3LPDA 3N7AA 3OPMA 4JBHA 4XR4A 2YW9A 4EWLA 3ZY4A 4EX7A 3IIIA 5IHXA 1CG6A 2HWYA 2RI6A 1TC1A 4A6XA 3IO3A 3KKLA 1FNMA 1L1EA 1PWXA 3K5WA 3KR0A 2R9VA 4DJEC 1QO0A 2YJZA 3PEFA 2XXJA 4ZEXA 3QUSA 5E3HA 3PC8C 1LDGA 1D0SA 1N2BA 2PZ8A 3GDFA 3DNMA 1XKXA 1CUZA 1O89A 3R3YA 4KGDA 4XYMA 3STYA 3MWDB 4G4IA 4I9NA 3CTPA 4UUQA 2SHKA 1N1MA 1V3VA 1PV1A 3EHDA 4HDRA 3AF3A 1OTYA 2PSEA 3HE3A 1XMIA 2V5AA 3FFBA 3LPNA 1P0FA 2CNNA 4G9GA 3K0BA 2C9BA 4A8JC 2VOJA 5DDIP 4MS3A 2Q62A 3M6IA 3CLTD 1MQAA 1N7IA 2AQIA 1E5XA 4URVR 2K87A 3TL2A 3HUEA 2HI0A 3R7WB 3TOCA 5L3SA 3QEBZ 1YR7A 1ZCJA 2FPSA 2NYUA 2PPVA 3KT6A 3DD5A 3LY9A 3MBKA 1H4VB 2Z0MA 1S2IA 4FTWA 1XNRB 2HMAA 5AJWA 3ZWYA 2PZKA 2QBYB 1NJ1A 2NU6A 5EZ5A 2PRJA 2VG8A 2YMLA 1W2HA 1Z25A 3P9QA 3RIYA 4RM3A 5LB2A 3NHMA 2QTRA 4XLLA 3UJHA 3OE7D 1ENPA 2R8PA 3A1CA 1DMRA 5AW5A 1WL8A 3OU6A 1BDMA 2W2NA 4FBLA 4RIIA 3TZKA 4ZA2A 1Q19A 4JR2A 1AE1A 2BGNA 5ALDA 1LLQA 1Z17A 4Z4QA 5ENDA 1P62B 3PFGA 4AMVA 3SX2A 1VSUA 4XOUA 2CVOA 1VI2A 4FHZA 4YGYA 2PT9A 1S3IA 1J99A 3JYPA 3QITA 3TZEA 1J8MF 1H3NA 2PGJA 3NQ41 5EQJB 1C1HA 4Q7KA 4TXJA 4UNPA 5AM1A 4YP7A 1EFPB 3Q41A 3FJOA 5ELXA 4GX1A 3PI7A 5HX7A 2BFCA 4KH1A 1DIOB 1K7SN 5BP7A 3OZFA 5JFTA 3SF0A 2UYOA 1TIKA 1JQEA 1QYRA 1OLXA 1MW9X 1OASA 4J4HA 1H2FA 4UMEA 3L04A 1PVVA 5TMEA 4YIHA 1V3QE 4MRRA 1Y8QB 4GIBA 1KJWA 4Z0HO 5GOZA 4BO4A 2XUAA 3HVIA 5T4BA 1MT3A 3HB0A 4OL9A 5CB4B 4K6HA 5C52B 4FINA 5CG2A 4BHTA 4CUJA 1HDCA 2QF7A 4ZCSA 3H83A 2PQMA 3BHJA 2Q5QA 3SQMA 3T5CA 1GUBA 4J07A 6CHYA 1Q3HA 2DR0A 2EKPA 2ONZA 2DVMA 1NG1A 1TO2E 4Q82A 4ML3A 1ZRMA 4JSTA 2ZS7A 2QK4A 2QR2A 3IAEA 4PE5B 3FPKA 5CM2Z 1J23A 4D42A 3QXGA 2Y1CA 3ZUGA 1L7MA 5JY1A 4HLDA 3F3YA 2AEFA 3PHIA 1V1MB 3F67A 2XZTA 2HH9A 3TLKA 2YNMC 2C0CA 1JIXA 1VHQA 4ZT3A 3OBBA 3RWOA 3ZYCA 3KTAB 3LOUA 3WQHA 4L3VA 5KJEA 2OORC 5JANA 2G40A 1CETA 3W8RA 5JBQA 4ZVMA 4KRXA 4EHKA 2J5XA 1MPXA 4ISCA 5HM6A 5LQAA 1IQUA 2J9YB 5CEFA 2W2PA 3RV3A 4BV9A 5EJ5A 5FWXB 2WB4A 4E30A 4W5RA 4Z53A 2HU5A 1P3DA 1QTNA 3N2KB 4GDFA 5ADUS 4E46A 3L4EA 1U3VA 3M9LA 2VOEA 1NOKA 2BC9A 4ZAWA 2JFXA 1WS6A 1J0CA 1S9DA 3OZVA 2B7BA 3QVSA 3E22A 1US8B 3F3KA 2WPDD 3F4BA 1Z15A 3OZEA 4NOKA 2I4RA 2Z58A 4QXMA 3HU1A 5HKLA 1EGMB 2GFHA 1FPQA 2F3TA 4GM1A 2ZE5A 5CURA 1ZPDA 3SKVA 3B1VA 1T43A 4EYOA 2C1EA 4ND7A 2FUG6 3AOEA 2BEUA 4F60A 3LX4A 1JEOA 2HSWA 3I6BA 5PNTA 5FLEX 2B2XA 4L4SA 2PL1A 3ZTWA 3ZHRA 3BMNB 5BN5A 5JC8A 1J1UA 4OMDA 1F0KA 2Q0SA 2RGGA 1H0HA 2BFMA 5KVVA 1NBOA 2ZVJA 2BMJA 4B6SA 1JIQA 2X1HA 4KQEA 3P2OA 3KXKA 1MO5A 2J5BA 3MWEB 3AZQA 4X8HA 1Q0UA 1XAJA 2DT5A 3FZGA 3N86A 3RFUA 4JBYA 4INJA 1SWWA 3N0WA 1JFLA 4W6ZA 1Z4QA 5LUBA 1D3AA 3I9JA 2FWRA 3L49A 2PWZA 3BJIC 5F3WB 3VH3A 3ZX4A 4EQ6B 2LR0A 1FVHA 3ZCSA 3SEFA 5K45A 1TA4A 1K68A 1PNVA 2QSZA 5DBEX 1W9HA 1LRLA 1WCIB 3ZYZA 1OXKB 4YRRA 1GCIA 4E09A 5FWNA 4X41A 4A0HA 4GLLA 1VL5A 3UXMA 5B57C 1S01A 1N0WA 4MI9A 4X6UA 3NHAA 4Z4IA 2J08A 3VR1A 1JV2B 4GVLA 4GR9A 2NPIA 2JIQA 1YQQA 1ZBQA 2RD2A 4R1LA 4JJZA 2Y0CA 1HFKA 3UAOA 4RTQA 4KK3A 2DFDA 2CYAA 1G8SA 2FPPA 4RZXA 2V58A 2H2AA 3PG5A 3KLPX 4OI4A 4YCLA 1G291 4ER3A 4DOMA 2DR2A 4GI2A 4MR7B 4XQEA 3OZCA 5ICMA 4F2HA 3PD7A 3ED1A 2J9RA 5AHWA 1F0PA 2QE6A 2ATXA 3PQFA 3GGPA 1R0SA 4NZYA 4UULA 1R9NA 4LZLA 2XGOA 2O0HA 4LRQA 2M9MA 3F5DA 4MK4A 1OI4A 1ZN8A 1ONNA 2A33A 4OP3A 3LSTA 4EOGA 4W5TA 4DYVA 2J6IA 2ZRBA 3FPJA 3JASA 4E5NA 4X84A 1YI0A 1JR6A 3GCXA 1G1MA 1WLSA 4TLMB 3ELWA 2PBRA 2PSJA 3KJFA 3O1HB 1ZZEA 4GZ5A 1ECJA 5JALA 1E4VA 1Z4PX 2DR3A 2OOKA 4BKRA 4DE5A 4Q48A 3ZWAA 3FCCA 5KYKA 2ZS8A 4V0KA 5EHIA 3HCNA 4GXQA 1CUYA 1KOJA 1SVNA 3PR3A 4AN1A 1F2DA 3JQRA 1PJZA 2M1XA 3B6IA 2REQA 2IZ0A 3RVMA 5BR4A 3CC8A 2RHGB 3LYUA 1TJ4A 1TYCA 1KIMA 3RTEA 3VKWA 4DJTA 2DUMA 2R85A 4EFKA 3Q8LA 2C7PA 4JLSA 4RJ2A 3JAMA 4ZOLB 2ZYRA 4A92A 1WY7A 2ODEA 3OM9A 3PJGA 5F5NA 4BMNA 4JOCA 1BJKA 1KE1A 2PMKA 3RE1A 1G2IA 2AZDA 3C5EA 1SVKA 2WUDA 4R1QA 1TU0A 5EWLA 3U3RA 1A2OA 2E87A 4C7JA 4RSMA 1N25A 1GTL1 4KQ1A 1K6JA 4ZO9A 3KSAC 5IM4F 1ARZA 1E9BA 1VZ3A 3Q3HA 2XYVA 4IIUA 4KVFA 3LDUA 5TXGA 4ZFNA 1UXJA 1N0IA 2J32A 2N9UA 1A4IA 4WXMA 3NORA 4XLZA 2IXDA 2P8SA 1U31A 2DY0A 3M7IA 4DC0A 1J22A 1TVMA 5CNKA 1JDUA 1FE8A 2A5DA 1KGDA 2XTMA 1T13A 2OZVA 4OUKX 1R9GA 3U60B 2JFVA 5EIEA 4NZ9A 2ZBRA 1R9MA 2KJQA 4QFBA 4UHHA 1OLSB 3MUOA 4JS0A 2XCRB 3BMCB 4TMKA 5BRNA 2Q2VA 4G24A 5CYPA 4MMYB 2FSVA 2EG9A 5E4TA 3GAFA 2HIAA 4MCJA 3BXOA 1SBTA 4X64B 1NVEA 1Y8CA 4CF4A 9ABPA 5DHTA 3HNPA 4WGGA 4WUTA 1K3TA 4U2GA 3V7FA 1U2ZA 4O4JB 5BN1A 5E6UB 3K4HA 2VBCA 2QNBA 1DZIA 2Z57A 3RG8A 3PYXA 4CM9D 4Y6GB 3VNRA 3HHEA 5K6RA 4JEMA 2AN3A 1VPEA 1XQVA 4QQKA 2AV6A 1LSJA 4MJXA 1M33A 4C7XA 1B6TA 2O05A 2F8TA 2F17A 1CIPA 1T25A 2VBGA 3C0KA 2ORVA 4GD3Q 3DM9B 5FFNA 4CMIB 3GLQA 1L5KA 2OPBA 1G2PA 5AUQA 4LDZA 4O4IA 5B53A 4CLHA 3E58A 1U9JA 1W1IA 2RHRA 2RONA 2P3LA 3KZCA 5HKAA 4YPVA 4Q6WA 4QUJA 3NIFB 1P0QA 1T1EA 3CNHA 1C7FA 4MVJH 1THTA 2IFTA 4KSYA 3U09A 2ODWA 5JT1A 1EQ2A 3QNWA 4G5HA 5DNYB 3H6KA 2AUNA 4CKCA 1VL0A 3DOOA 2G5CA 2GVZC 1OC4A 5JSKA 1OUMA 4QEDA 3EXEA 2ZGVA 4CW7A 1KYXA 1VL2A 4AS1A 1E3EA 2YJ5A 3GRKA 3F4KA 3FKSA 2C9YA 2C94A 1BHJA 1BGWA 3I6ZA 3WMGA 3RADC 5HP4A 4ZV7A 2ZSJA 2IL1A 1DKQA 2QSUA 3LCVB 4GQAA 1PX0A 4WN9B 1E0JA 2YWBA 1Y82A 5ERXA 4J76A 4QGAA 5CLHA 1TTQB 1FMJA 4D4MA 2DG2A 2PU7A 5JQWA 3BJRA 2WUFA 2Y0DA 4LW8A 1XHEA 4R81A 4Z9FA 4GPD1 4GWKA 4YXWA 3ZK8A 1G3RA 3O21A 1ETHA 4BGDA 3ND6A 5HJEA 2AX4A 5K8CA 1HKUA 1GNLA 1GL6A 1K3UB 1Q1EA 2YOFA 3EGDB 3H42B 3K4PA 4HYTA 3FPSA 1RAFA 1GZSA 4M1KA 4JP2A 1MF7A 4EP1A 3VV2A 1L7XA 2Q41A 2QVLA 2P9GA 3PA6A 3BL6A 3P9XA 3UMVA 4GX0A 4LK2A 4WJKB 4WZZA 5JW6A 4PN7A 2MJLA 2J07A 3CRQA 3KUUA 3O8OA 3OLXA 3QKRA 3L0BA 1VYTA 3B78A 4GZ6A 4MRNA 3O92A 5A1JA 5K0LA 2EXXA 3HDQA 3RJZA 3WGYA 4DUYB 1BS1A 1SZCA 2H0RA 1CQJA 2YN4A 1T9DA 2J87A 3REFA 1KSJA 4P4LA 4Z86A 4AKEA 3MUEA 3GLUA 4NF2A 2WU0A 3OT4A 1U63A 1KDYA 3L4SO 1E3LA 1S02A 4J1TC 1XLWA 3M6UA 4CM6A 1GCAA 5IMSA 4X5OA 2SKCA 4KQFA 4V2IA 1KVRA 1GP2A 3ZKWA 1QORA 2PT6A 4HNGA 3FX2A 3H3JA 2C9OA 1PQ4A 2B7LA 2JKVA 4RSRA 3K09C 3D0OA 1CE8B 5FCDA 5AXCA 2ONJA 4EI7A 5C8YB 1W76A 5I7RA 2BF7A 3ZTYA 5H0IA 3K94A 1EFDN 2PKWA 3E9EA 3MJVA 2O9JA 4PU0A 1PX2A 3OZBA 1XUOA 3FVWA 3N2ZB 2I8AA 4Q93A 4XW2A 3KQSA 4OAQA 2WPNA 4LN1A 2DBVO 1DHRA 1JHXA 1M75A 2P2ZA 4AP5A 1Z5PA 2O14A 1H8ED 5LMUB 4YJ3A 5JNRA 2QUHA 3LCMA 3B1ZA 4BPRA 4J0JA 1UPBA 2I54A 2C8LA 1L5NA 5IAEA 5IFLA 1E2UA 2AMJA 2ZAIA 4M9XA 3F0TA 1QGED 2Y9MB 2AFIA 2F6RA 4B7AA 3D3KA 2R97A 1TVKA 2DY1A 1VRCA 1RXWA 4AKGA 4AQYB 2MU1A 3CN7A 2NQTA 4K88A 3MTBA 1O3YA 3RRBA 5JECA 4MQ5A 5J5VA 1MIOB 4Y2GA 2FR8A 3LCJA 4RHUA 1Z26A 2PYDA 4DT1B 3SBDA 3NPAA 1OQAA 4HV4A 1NUHA 5DWVA 4XPIA 3TK1A 2JD2A 5FHQA 1DT3A 2H65A 1JQDA 2QN1A 4IXTA 3IV9A 2EHDA 2IYQA 2GEKA 3JW8A 1EWVA 3L6UA 1DBPA 2V7EA 2VT6A 2VYVA 3AFNA 3GDGA 3GQBA 4MIOA 5EMKA 3WP0A 4EGFA 1PGNA 2FFJA 3JQFA 1K3FA 1KHTA 4CL0A 3KSMA 5JARA 4NONA 4HQ0A 1XBTA 4GQIA 3T0GA 2IQIA 2AMVA 4GZ3A 1GGEA 3T3DA 3ZV5A 4D2IA 4DN6A 4PSCA 1MW8X 2HMYB 3VSEA 2RHLA 3EZXA 3THSA 4ATNA 4BNHA 3UHOA 3OF5A 4IGKA 2AA3A 2RHWA 3BQ9A 1VYVA 1N7HA 2E21A 4H7KA 3OURA 2QYHA 5NLLA 2C5AA 1GN8A 3PEUA 4C88A 1QF9A 1T3HA 4TUYB 4URUR 4DC9A 4LOAA 2X8LA 3G9UA 3PNSA 4EMBA 3A1UA 3P9KA 4F4HA 3EH1A 3ZDAA 2PS0A 5C5EA 2ZIVB 3CBQA 4U5XA 4DL9A 2O2XA 4KWTA 1IIBA 1ZMRA 5BSGA 3EQ7A 2E1RA 3UA3A 3LBHA 1FJGB 4OATA 3NBMA 3QH4A 1Y63A 1X7HA 2GF9A 4PRKA 3W05A 4ZDWA 4BQRA 5LQDA 1HFWA 3I3SR 1B0UA 1KI8A 4QU9A 3U6BA 4XWWA 4JLUA 1NVBA 5F78A 1XN4A 5AKXA 3AVOA 4NR0A 1QTRA 4QYSA 3V2IA 1PLJA 2JA1A 3M6MD 1MJNA 5JSFA 5KYWB 2O8DA 1HEIA 4LHWA 3FTQA 3SC2B 1IOLA 1T6BY 1U7TA 4KZKA 1YHYA 2Q5EA 4C05A 3NBKA 3WBJA 3RWMB 4BN4A 1JDPA 1M2NA 1ECLA 1W73A 4K7JA 4TZTA 1AK2A 1SAYA 4JR0A 5GQSA 3S8YA 1NBIA 1XNQB 1PQWA 2CUKA 5D3KA 3PBKA 4RKQA 3KX2A 5T8KC 4IYRA 2D4HA 2FPWA 3T3HA 3VMMA 2IYPA 2FA9A 1V6AA 3R0ZA 3UO8B 1F7UA 1ULBA 1V71A 1ZW6A 3KSDO 1YU9A 4D5GA 4MMXB 3RTDA 4M0LA 1VYHA 5AQEA 3V46A 4QPDA 3DTVD 3OQVA 1H0KA 1MJFA 4OBBA 5TMDA 1Z8FA 1YZFA 3UOWA 1NDUA 3AO0B 1YL6A 3HUDA 3IOMA 3PIRA 3FM9A 4U3JB 4CFZA 4JLBA 2RKOA 2QN9A 1YWGO 3ZZTA 1W581 4MJ7A 3R6TA 3PC6A 3HVUA 2GBLC 4D3FA 1MO4A 1OI2A 2BFEA 3DV9A 2VEDA 2DF8A 1GTVA 2R1TA 1F4VA 3N87A 3PXEA 1TD1A 3B9QA 4XB6B 5G0UA 3ENVA 3V1NA 5AM2A 4F5WA 4Z0NA 1KAGA 1RYZA 1VG0B 5KHAA 1Z6YA 4DLZA 4F7WA 3ZHTA 2VT7A 3VZRA 4ND2A 2YCLA 1Y7LA 3R9WA 2IDZA 4UPDA 4RGBA 4ERXA 2XCIA 2CXUA 2QRGA 1ZD4A 4AU1A 2NNLD 1UJ4A 4IEEA 2H2DA 4LGCA 4RZQA 1E96A 3BZWA 4LVUA 2VQEB 4QU0A 4X00A 3SVLA 4FOOA 5AJUA 3KEQA 3UK0A 2D00A 3AM4A 3PVSA 1KQPA 2PUGA 1DINA 3LT2A 5LC1A 3FFXA 2ECOA 2H7YA 3REQB 4BMZA 1YZVA 3LKDA 5ECWA 2X5JO 4YRAA 1GNTA 5BURA 4LRTB 3E84A 2IV7A 1D2EA 2AEJA 3WYGA 1UFQA 1FTWA 1D0VA 1J49A 1TE2A 2VJAA 4AIRA 4BAZA 4EJSA 3EFHA 4L8LA 3O93A 4I4LA 4WXEA 1Q44A 2CMDA 4RJLA 1XAHA 2IXAA 1YZTA 5A3RA 1N1GA 5K3DA 2ZRPA 4CMEA 5IN4A 5AESA 3GJRA 4B3XA 1K5DA 1PT5A 4NOMA 2BSQA 1TCCA 3N2EA 4FN5A 1K4YA 5KWSA 3NOVA 4J75A 4ZZ0A 2C31A 2LVBA 2JFZA 2CN1A 2GCOA 2R1UA 3OQ6A 5SYMA 4IVNA 1RPAA 3L79A 4LYFA 4RTLA 1PG2A 2QTZA 4AO7A 1QO0D 3AJEA 2GD0A 2SNIE 4J0FA 4IBOA 2OLKA 3KOXA 1PU2A 1RMYA 2P3QA 1N2CE 2PBFA 1D4AA 1L4KA 3GLSA 2XB9A 3PGKA 3PUHA 3HA2A 4JFAA 4ZXFA 2HN9A 3ITKA 3MMPA 2X15A 3AJRA 1GDTA 5JAHA 1XQ6A 1FQWA 3QVTA 1WU7A 4RKWA 4Y1RB 5H9VA 1CUEA 4C01A 5JCOC 5K99A 3N7TA 1NJSA 1IVSA 2ZETA 4A6EA 3REQA 4RZHA 2B8EA 4YACA 1NN0A 2J45A 3IUBA 1JLMA 4KSCA 1R18A 4FEAA 3UF0A 3LBFA 1WU8A 2OB1A 3PDIA 2IZOA 1P7CA 3H5AA 5BR7A 1N3LA 1FY2A 1U5BB 2CLSA 4LOHA 1YD7A 3KWLA 5DTJA 3K0FB 4Y2TA 1PJQA 2O50A 2VC2B 3GRFA 3MQ2A 5LP1A 2EWWA 1KVQA 5D6NA 5E0KB 5IW8A 3RUDA 1V0JA 2X5KO 4A23A 4RLHA 3N8KA 3AHEA 4LY9A 4ZVUA 1LB1B 3H11B 2EZ4A 2MIIA 1JEQA 5KOHA 2V6BA 2FN8A 2X9QA 3W5VA 5ADWA 1KAEA 4C04A 3OHPA 4ONEA 4OMUA 1G55A 1H5NA 1RI3A 2I1WA 3HDTA 1E6MA 3LDHA 1IQPA 4QJIA 1TCVA 2C5GA 3WB2A 4QNMA 4AQDA 5AUOB 3OD5A 4CGYA 1S6YA 5HE8A 4B3MB 4IXWA 4N47A 4UM8B 1CQWA 2DMRA 3PC8A 4JB0A 1QF6A 1LSUA 4LOKA 2C07A 1P1RA 3V2HA 5IYZF 1DCTA 4JBNA 1ICIA 3DB1A 3BWMA 3WL7A 4LF8B 4YDHB 1DXHA 2XWQA 1GUFA 1EIZA 5CHEA 3G59A 1SOUA 4OF4A 4RM2A 1OTHA 3ZEAA 2HSZA 4A8JA 1JYFA 1JE1A 1XDBA 2NTVA 2AVNA 5BXYA 5KZMB 2R8RA 2JANA 5UKDA 4IUDS 4D4HA 4HB4A 4IMJB 3AEUB 2Y2VA 1IRIA 1XK7A 1UP6A 4W99A 4TYMA 4UJ3A 4X95A 3QLUC 5KTTA 2WM2A 2O8BB 1OWOA 3I2YX 4AIIA 4K05A 4D8YA 4GBJA 4CUZA 4Z3OA 2CJXA 2RIPA 4CHTA 3IAM6 1RSZA 1GFIA 4KP7A 5LXTA 4XQ9A 4JJ6A 5HOEA 1E98A 1NU6A 3GT4A 3GRZA 4CMHA 4BN5A 2GTPA 3M82A 3SR3A 3SYTA 3D1VA 1J0EA 1SM4A 1VC2A 1DMSA 4B4VA 2G8NA 3OTWA 1AQLA 2BP7B 2JI7A 2OHHA 4OFXA 2XUGA 3KUDA 2FEXA 1D6NA 2FDRA 2XVAA 2FU5C 2AJLI 3TS1A 4FDTA 1HEYA 2OBMA 3QTTA 4QNNA 4PFSA 2X9GA 4KOEC 3EOZA 4QJ4A 2EQAA 3DMGA 4N3AA 1WSDA 3RASA 4Z2AA 1AMUA 3K1AB 4UNNA 1L5YA 3NHPA 4URHA 2G1PA 2CB9A 3M6XA 4ARZB 2RDMA 3C1AA 3KELA 1CTQA 3JV7A 1GSOA 3IMGA 4Q3LA 3EODA 2XYGA 1T4BA 3GH3A 3CRNA 3FY4A 4OHPA 4W8GA 3TN7A 3DH0A 2Q5JA 3D3WB 4TOIA 4MQFA 1DT5A 2C4WA 2PVSA 4L7QA 4BMCA 3B8HA 4KWCA 4CV1A 2FEKA 1A5ZA 4HB2A 1T2UA 1WQ1R 3DNPA 4I66A 5M29A 2BGTA 1U7UA 4ASUA 4GOJA 3ROKA 2YIVX 5JO9A 1RWXA 4ZOAA 1KNXA 1J25A 1R8JA 2O52A 2Z5GA 3EC2A 3QFCA 1ZD3A 1TDJA 3CWCA 5CGQB 3E35A 5FJJA 3P71T 1N6LA 4C07A 5ITVA 5DP1A 5C1DA 2AB0A 3FNFA 3QPVA 2YKGA 2PUJA 2WHQA 4N0MA 3VR5A 2Q3FA 3M1IA 2HQOA 4UREA 2XXBA 1AF4A 1BXZA 4XUCA 2V7GA 4LSWA 2YNMA 4ESOA 3ZV6A 3RT7A 2WMOB 2P9QA 5ED4A 2HRCA 2OXTA 1A9YA 1R7RA 3ZZMA 2OORA 2Z9CA 4X65B 1G8GA 1LQTA 3JWHA 5D01A 1WDMA 3II6X 2OO7A 3R3VA 4U9UA 2ZANA 4WMLA 5T41A 2UVPB 5B4TA 2FMTA 1Z8HA 4ZEOA 2BEKA 3H0EA 2BEVA 4LFBB 4G1BA 1KP3A 3SX4A 3SS8A 2UXDB 5BNTA 4NWIA 4IV5A 3I5XA 5L3QB 4PZCA 4GPZA 3BFJA 1OLUB 3QFFA 1G21E 1RZVA 2L19A 3O94A 4TLDA 4UEQA 3PL1A 4HGOA 1G8KA 1D1QA 1I9GA 2OFOA 5AWFC 3K35A 4ZVTA 3VR6H 4QLBA 2FEOA 5TQ2A 5REQA 1Y4SA 4ZYLA 3U56A 3QVJA 4B7CA 1SVUA 5C5DA 1BNCA 3EDCA 3VC7A 2EDCA 3TRKA 4GL2A 1NUTA 1E89A 2VWQA 3OJOA 4P08A 4MGHA 4XGIA 2HF2A 2P6NA 3WLKX 3EDMA 1NYRA 1U2DC 3O4GA 2OMKA 4FJ0A 3S1AA 5H9WA 5H82A 2ZSUA 3FI9A 4EEZA 2Q5OA 1K8RA 2J4DA 1XDUA 5CM8B 2AJCA 1LZKA 1NYLA 3ZNPA 2Y0EA 2YV1A 4O5OA 4YTEA 3PCTA 4QYTA 4EY5A 2DBYA 4FMCF 4A82A 1W88B 1O94C 4BU1A 4RVFA 3KR2A 1MRNA 3GFGA 1ULTA 1ZJJA 3O9VA 2HT1A 3ELDA 1TQ6A 3KQQA 2XTAA 3F8WA 1R4MB 3L1KA 4MR9B