4TZ0A

Dead-box helicase mss116 bound to ssrna and gdp-bef
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
508
structure length
508
Chain Sequence
SKLIHVPKEDNSKEVTLDSLLEEGVLDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLINTKFDSQYMVKAVIVAPTRDLALQIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKNSKSADNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIAKQEKYEPSEEIKSEVLEAVTEEPEDISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDKLGLSRSPIGKAMFEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords ATP-dependent RNA helicase MSS116, mitochondrial
publication title Molecular insights into RNA and DNA helicase evolution from the determinants of specificity for a DEAD-box RNA helicase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 160
structure length 508
sequence length 508
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2014-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tz0A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tz0A02
1GKIA 2C77A 3H2YA 1JNYA 4M1MA 1Z3IX 2WJGA 4D6PA 2C03A 2VSOA 4Q19A 3DKVA 4B71A 2HT6A 4TQUS 2BMEA 1RRPA 4U5XA 3GLGA 1US8A 2ZI5A 1QG2A 1HV8A 3W9YA 4D0GA 4DLSA 3AVVA 1FX0A 5JMTA 4MKFA 2R6GA 4R2IA 3VTKA 3OIWA 3A4MA 4IDNA 5CM9C 5EJEA 2BHRA 3DVLA 1TAGA 2GA8A 5FPSA 1Z0KA 5H8WA 3GLFE 1EFCA 3TAUA 1KMHB 1CJTC 2FA9A 4NTZA 4W9MC 1BYIA 1JQLB 4D81A 2Z6VA 3CF0A 3KB2A 1VHLA 2ZTSA 3LH5A 2ASEA 2XNDA 4U7DA 1ZM9A 5JSZB 1SQ5A 3KJIA 4Q9KA 4V0KA 2FWRA 2WBLC 1D8TA 1ZD8A 2A5JA 2C9YA 2ZRPA 4XSGA 1UEJA 4M22A 4XWKA 4R7ZA 4TSFD 4UXJA 1E2LA 1VG1A 3CH4B 4QBIA 5CJPA 1E9BA 1ZNWA 3QJYA 1CR2A 3CBQA 3E2IA 1SULA 1Z07A 4D25A 5HR5A 1G41A 4IJMA 1T3LA 2Z43A 4DB4A 2E1RA 2ZPTX 5G3YA 1X8KA 5JCPA 5L3SA 1ZRHA 2EQBA 2QGNA 2WWIA 4AKHA 2OAP1 3PUYA 1ZAKA 3ADCA 1E9FA 3FPAA 1AN0A 1LS6A 2IYWA 2P6NA 3GFPA 3REFA 2IWRA 5KYKA 4Q4AA 4IOLA 4DKXA 4YMWA 3FDIA 2CLDX 1EESA 2WAYA 1PVOA 4GDFA 1YKSA 4ZCLA 1FMLA 4HB2A 4OHWA 3AUXA 4ACBA 2PEYA 3OIVA 5F3WB 4BEJA 2VHJA 4Q4HA 5CB6A 3GLFA 5EE5B 3B78A 2RGEA 4YXWD 1R10A 1JXMA 421PA 4O2LA 2OBMA 4BLQA 1N6PA 1T6NA 1VYUA 3AP3A 1VPLA 3CLVA 4YDSA 1LF5A 5F9HA 4M9QA 4Q01A 1CJUC 3UK6A 6Q21A 3EAQA 4C30A 4PC1A 3ZS8A 4ERNA 5EXPA 3EARA 4OL0A 4FMBB 4ZI3A 2VSXA 1UKVY 2O8EB 5FL7D 1Q22A 1QHGA 1E9SA 1TQ6A 4AY2A 3BB1A 4MKGA 4DDWA 1S1CA 1WXQA 2IC5A 3C5HA 2GBLA 4JBXA 1JALA 1EK0A 1HURA 2V7QD 4TLDA 1CKEA 1X6VA 2B21A 1ZD1A 4RCZA 3C16C 1D9XA 3PENA 4JYBA 4ZDJA 2B6HA 2D7DA 2QN6A 4MKIA 3B1ZA 3HWSA 3CIOA 4LRWA 5FPKA 2WOOA 3AF0A 1S3GA 4PPNA 5EE0A 3WNDA 4DC9A 5J47A 3KQNA 2JLRA 1SKQA 2BMFA 1MRSA 3AF4A 1Z0DA 4M1SA 4QHYA 5TMPA 1QF9A 2GCOB 1NJFA 3QUSA 2O8FA 3RLFA 3IBYA 1N5LA 3QVUA 3CPJB 3NHAA 1KI1A 1EFUA 4U00A 2GZAA 2RGDA 2GVDC 3KB1A 3B6EA 2OFWA 1FNMA 4B47A 3SBDA 4NYIQ 1XXHB 2BV3A 3HU1A 3FFBA 5G3ZA 4EQ6B 4LSGA 3LWNA 5HKKA 1NLYA 2EFCB 3BOSA 1GFIA 3WNCA 1GVNB 2YC2C 4WOPA 1V5WA 4IXMA 4URXR 3OE7D 3MUFA 4EPTA 5JEEA 2QEQA 5FTKA 2YV5A 3FMOB 4FWTA 3FWYA 4YC7A 3C14C 2VP2A 3B9QA 1HY3A 4URUR 2FFBA 2IEYA 2XTMA 3BAFA 5JI2E 5AWFC 3W5IA 2GJ8A 1KOFA 3BE4A 4Z54A 5BYKA 2CK3A 3THWB 1RJ9A 3W5JA 3ZIAA 5P21A 2IF0A 1F2TB 4HUTA 4TMZA 2WJHA 5K8TA 1XTKA 5LB2A 3UIEA 3B13B 4P4SA 221PA 5BWMA 2YZ2A 2XOKD 4E22A 2Q9AA 2QAJA 3LRPA 1CRPA 1G64A 1LB1B 1Q0UA 1T5LA 5EXTA 3GLIB 3SZRA 1W5SA 3PITA 3KUDA 2CHQA 3LW8A 3K0FB 1AS2A 3SBEA 1TADA 3GLHE 3U4QA 3B1VA 5FUWA 2F6RA 2C8VA 2YYZA 3IIKA 5EZ5A 4Q5IA 1N0WA 1LV7A 5KSYA 1A1VA 4PC6A 3KFVA 2IXEA 4RFSA 3SJAA 4B74A 4EUNA 3Q72A 4AK9A 3CKLA 1Y3AA 2OXRA 4HB0A 1N6RA 3SFZA 1SVSA 1W4CA 2KBFA 4Q66C 3WP0A 4F38A 1GRNA 5BN4A 4PAOA 4MYHA 4QOSA 4QG7A 2V3CC 1M1YE 1IY2A 1Q3HA 2C9OA 2GAAA 4MDEA 1A4RA 1XD2B 1XMSA 1II0A 4M9XA 1F2UA 4JLDA 4JT2A 3R8CA 4KFSA 2NGRA 3QG5A 2ZUCA 3T15A 1W0JD 1R8SA 3K0AA 1W2HA 3LLUA 2CCJA 4HLCA 1E6CA 1Z8FA 1Q3TA 2ZJBA 2FN4A 4RKEA 2FGKA 1P2SA 1XX6A 3AKDA 4HLQB 4LYAA 3BGWA 4BLRA 1YE8A 1ZUIA 1O87A 3QQ5A 3ADDA 3T1QA 3RRNA 1G8PA 2ODWA 1U8ZA 3EA5A 2J1LA 2ZREA 1KI6B 2RGGA 2P0EA 4A0RA 3QI2A 1E98A 2MMCA 3SE0A 1XNJA 3L0PA 4DHEA 1W36C 2OCPA 3DL0A 4O2RA 5GVSA 4P4UA 3K70D 4TL8A 1EX7A 2FSHA 3T5DA 1KGDA 5FPHA 2ZR7A 3FTQA 1JPJA 4MUAA 3TW8B 3L8ZA 2DWQA 2GDJA 5DN6D 1U0JA 1ZIOA 5A0FA 5KDOA 4Y0VA 3GD7A 1ZUHA 4XWAA 2NMVA 5DIFA 4LCBA 4UJ5A 4NCJA 2B7BA 1P75A 3S1AB 5BN3A 3MWYW 4LJ7A 4DLXA 3ZVRA 1MH1A 1ZBDA 3NTUA 2ZVPX 4TN1A 5DLQC 4U02A 3IILA 1GL7A 2WJYA 3UATA 3VR4A 4ASUA 2KWIA 3QEJA 1OYYA 3LBNA 1G9XA 4TLEA 3TR0A 3PEWA 2NO9A 1T8TA 4IVPA 3KTAB 4A6PA 1SVWA 1KMHA 2ZRJA 3H1TA 4F91B 3RWMB 1OXTA 3EZFA 4JLMA 4FCTA 3EPLA 4ACAA 2W6IA 4PC3A 2NPIA 3TBKA 1QZXA 1AZTA 1XEWX 4MYCA 4TMKA 1KKMA 2WJIA 4JL8A 1N5KA 2ZS8A 3K9GA 4IHQA 5UKDA 2J0SA 4WIAA 3EIQA 4C7OB 3CZQA 2C2HA 3K0EA 1FL9A 4TLAA 2NZ8A 2JLYA 4JSTA 3NG1A 1G3MA 4D0LB 2O0KA 1VG0B 2XNSA 4RZUA 4QRHA 1I2DA 1TQ4A 4KV9A 2QNRA 3BORA 4JLVA 2VRWA 5FL7A 1Q12A 5E7JA 1XCMA 3QVVA 3UWOA 5C2JB 1JAHA 5TARA 1VKJA 2PJRA 2EVWX 1W2GA 4IOJA 1UM8A 1OYWA 3CRW1 4M1OA 2ZI6A 4HDCA 3QOFA 2FFAA 2HDNB 4FN5A 2KSQA 2IBMA 2QTHA 1CTQA 3LX8A 3RS2A 2RHMA 2YVUA 2JIZD 4R98A 2RB4A 1T4GA 2HYDA 1RYHA 1SXJC 1U0LA 1XD8A 2BC9A 4QBHA 2VQSA 1UDXA 5IT5A 4TYPA 4AG5A 1OH5A 5K8IA 2V54A 3W6OA 3NXSA 3AF1A 1G21E 3I1FA 1ZNYA 3QKRB 1HE1C 3FMFA 4TTQA 2VA8A 3CF2A 1NN5A 3DOEA 4O0MA 1G5RA 1X86B 2AFIE 1W36B 1NN3A 3QPUA 3IPYA 1OSNA 1P9RA 5CB8A 4JLAA 4Z1MD 4DIEA 5IK2A 5AJZA 1HE8B 2JJ2A 1WDTA 4BFSA 1IBRA 5B64A 2O8EA 4Q00A 2GXUA 1E79A 1M74A 1DAKA 3HDTA 1H65A 4PZLA 4Q1BA 4C4PA 4PHTA 3KQLA 1WA5A 4Q9LA 3AKEA 4KO8A 3H0KA 2ZI7A 3HPQA 2BIFA 3THYB 4L9SA 4PPQA 2I4IA 5C18A 5KNDA 4QJ4A 3ZD7A 3CB4A 5LD2C 3IKJA 4N0EA 3VKHA 4Z8YA 1EX6A 5E7IA 2J3EA 2GCOA 4BASA 4AURA 2F43B 3PUZA 2BJWA 3QY0A 5H68A 1YU9A 1KSGA 3RSOA 5KNBA 2NO7A 2MSEB 3IBGA 2NO6A 5J5CA 4CF7A 4QKQA 2NG1A 1XXHA 2OE2A 5E7MA 3VKGA 3MWKA 1MABA 5EXSA 1FP6A 4EQ6A 1SHKA 2ORWA 1SHZA 1C9KA 5CLQA 4MH0R 2YHSA 2XNDD 4R71A 3EXAA 2H8KA 1W0KA 2IYVA 2YINC 5FI1B 4LHWA 3ICQB 1FUKA 2FSIA 3LO5A 5ANRB 2WWHA 3QIAA 4NMMA 2GF9A 1D5CA 5FUXA 4KVAA 1R8QA 2ZUBA 5JFGA 4DLVA 3QG1A 2IWHA 3LFUA 3NBYC 3TJZA 1SVKA 1NBMA 2WTUA 5FOSA 4HUQB 4MGZR 4C2TA 2OILA 1KAOA 1XJCA 3E1SA 4GI7A 4MGYR 3UWKA 1TMKA 1E9EA 2PX0A 1P6XA 4XJXA 4CDGA 1OH7A 1I4LD 5LB4A 3L8YA 5C4MA 1YJ5A 2Z83A 3THWA 1E2DA 2CCKA 1F2TA 1RVDA 1W1WA 2CHGA 1DEKA 4LJAA 1AKYA 5EE3A 1V43A 2ZRKA 1JPNA 3ICEA 3ZDQA 2ATVA 3QBTA 3AEZA 3ZQJA 4P32A 4LJYA 1F48A 2IYSA 2HEIA 3AKYA 2DHRA 2IYYA 1OV4A 4NPHA 1SXJB 2GILA 3RDPA 3GJ4A 2WIBA 3JZMA 4JLNA 3ZVNA 2P3SA 3GLIA 3ZD6A 1E2PA 3K09C 3X1WA 4MRNA 2R6CA 2GXAA 2H17A 5KSZA 3K0FA 4NCNA 4DLRA 3KDSE 1T0HB 4LUCA 1FQKA 2J7PA 3AGQA 1ZM3A 4IDHA 2EFGA 3AP2A 4B3FX 1YZKA 1IN4A 2OFXA 3HYRA 1OXXK 1CR0A 1R6BX 5FI0B 3U3OA 4EFNA 3FHOA 4Q7JB 2W2XA 4OQXA 3HP1A 2ZJ5A 4LV6A 3LBIA 1WMSA 2YC4C 1DAEA 4LGMA 3DHWC 2A2ZA 3PR1A 2DFKB 5G40A 3PJRA 1I2MA 4OHYA 2QU8A 1FMJA 1S3SA 5EUMA 2PZFA 2ZROA 1XD2A 4ZDIA 3KXKA 4PFSA 1M6NA 2BEKA 1UBFA 3IIJA 4RJLA 1ZC4A 2EW1A 3L43A 4BFVA 2WSMA 2H57A 1GL9B 5CK4A 5L3QB 5B58C 2PH1A 3U3RA 2GEVA 2Q6TA 3B1WA 2P2LA 2X19A 2I3BA 1VCNA 4I99A 3RS3A 3NIBA 1IN5A 4TYQA 3O8BA 2BBSA 4LK2A 2G83A 2OXCA 4JL6A 2O8DB 1IN7A 1OLOA 1TUEA 2WKPA 4OI1A 4RSGA 2ECKA 4LJ4A 4A4DA 4HYYA 5F9FA 1NLZA 1KO8A 4V0ME 3SU8A 2H1LA 3H84A 1XU4A 4URYR 1LNZA 1P73A 3SEAA 5JJLA 1F3OA 1U98A 2F1RA 3RS7A 2JLZA 4X8LA 3THXB 1Z2CA 2ORIA 2NTYC 1PLJA 2IHYA 3LA6A 2JASA 1HH4A 1ZCAA 2DWPA 4TMTA 5DNYB 3MAAC 5KPDA 2VH5R 3AVOA 5CK5A 2O8BB 1Z6AA 2JAQA 2CL0X 2A5YB 4PQYA 3ZQ6A 4M1YA 4MRVA 4B75A 4PANA 4US2R 1G3UA 2N46A 1NLFA 2DFLA 2R9VA 3OEED 1U9IA 5KSPA 5CITA 5E4FA 3LW7A 2HF9A 2WMNB 4GNKA 4B2LA 2JLVA 3EPHA 5FBQB 2RAPA 2YJTD 2CNWA 4NONA 4PR0A 2H16A 5SZHB 3EPKA 2V55B 3S1AA 2KB0A 4TT3A 2HLDA 3ZYCA 2VHUA 3DZDA 4LX0A 3W34A 1OE0A 2YKGA 3EZ9A 4LY6A 2BBWA 2QBYB 4IDOA 3HJNA 3K53A 4DLYA 3QXXA 4CT4B 2CVFA 2CK3D 1EWQA 4GZLA 3GLGE 2W2VA 3ZIAD 4JLJA 2VSFA 2OESA 3KTAA 4RD0A 4C0SA 1GM5A 2EU8A 3Q7PA 2PZGA 1P3JA 2VBCA 1XZQA 3CWZA 1DO0A 4FMCF 3BD9A 2QRNA 4D82A 3FE2A 4LV5B 3EWAA 3GJ3A 4C9BA 4MYUA 4NHOA 1XD9A 1KIMA 4ZI2A 1Q1BA 3F5FA 5HZHA 2IUSA 1GRQA 4V0MA 5J4VA 3AVQA 3CX7A 4OK3A 3I61A 3M6AA 2IT1A 3B8HA 3IO3A 5FOWA 3ZS9A 5FBWB 4BRUA 4C7OA 1W7AA 4A9AA 1KY2A 4YONB 2D7CA 2KE5A 3U61B 2FDCA 4DWJA 1DG3A 5KPJA 1UBEA 2XXAA 1E0SA 2QP4A 3EIHA 1Z29A 1NVXQ 4LPSA 1EG7A 1G18A 3AGPA 1YRBA 2D2FA 2ONJA 3DO6A 1NKTA 4IVRA 4Y0AA 4QBGB 4Q7KA 1DS6A 1Q1ZA 3SJZA 2ZIAA 1ZVQA 2A3RA 5FBRB 1Z83A 2PCJA 1IN8A 3QXSA 3TE6A 5FTMA 4BFWA 4G5RA 1QHHB 4JMPA 1R5NA 3BK7A 4I4LA 2WSSA 5KSOA 1H8EA 5FOTA 2WV9A 1TF5A 2JATA 2BKEA 2Q9BA 2QT0A 3BFXA 4WW0A 3F3YA 1Z6YA 3GJ0A 5EE9A 4B48A 1ODFA 3CNOA 1BMFA 4LJ8A 5FTNA 2D06A 3IQWA 1KHTA 3SDZA 2X77A 4RY2A 3QKRA 4CEIB 2ZYWX 3E5HA 3HU2A 4JLKA 3X2SA 1XTJA 4Q03A 2D74A 1NJGA 3RS0A 4JLOA 3HR7A 2W00A 4A6XA 4ABYA 2AK2A 2PZEA 4HEJA 3IHWA 621PA 4HI0E 1G16A 2C99A 2IYRA 4O3MA 2VL7A 4TZ6A 5CYPA 1A7JA 4S35A 3T34A 2PLFA 1SVMA 5B2ZA 4XTCS 4HDOB 4JJZA 5C46F 1RC8A 3Q5DA 2IL1A 3ZZTA 1CLUA 2QAGB 1A5TA 3NC1C 3U6BA 3B85A 3GP8A 3VAAA 3THYA 3OIYA 3MCAA 3ZJYA 2ZRCA 3GJXC 1VDZA 4Q47A 4DRZA 1RIFA 1XDBA 3X1XA 3CO5A 1MO4A 2GCNA 3I32A 1SXJE 4NYJR 2F9MA 2F43A 2FNAA 3K9NA 4ASUD 2WKQA 4RD2A 5KTYA 1M2OB 1PUJA 2O5VA 1K5DA 3RC3A 3EZ7A 3BH6A 4US1R 3NDBB 2ODNA 4M4SA 2R8RA 3FGNA 3VKWA 3KX2A 2ZS7A 2C78A 4F93B 1G3RA 1JR6A 1J8YF 1NG1A 1Z6XA 4BE7B 3RC8A 3A1TA 3W6NA 2W6ID 3N70A 4NCIA 2IS1A 4UXHA 1LVGA 3SJCA 3JZAA 3LX5A 4MDFA 2AD5A 2IUTA 1NVVQ 5TV2A 3ADBA 5JRZA 1KKLA 2IYZA 2YNMA 4LBWA 4OI2A 1WBDA 4J0QA 1JXOA 2GCPA 4ILEA 2AXNA 2ZU0C 4HAWA 5EUQB 2ZSDA 1JR3A 4DXAA 3MSXA 4Q1EA 5H70A 2UKDA 2GKSA 4XSHA 5FOUA 4B3CA 4BFXA 2CJWB 1QRAA 1G8FA 1OH8A 3L0OA 3ADKA 2ZE6A 3QXHA 4P3YA 4D26A 1X3SA 1EFHA 1XCGB 5DYGA 1P2TA 3KKOA 4PQFA 2QY9A 1TQDA 2GZHA 3OZXA 5D3MA 3WXMA 1G8YA 5DISB 2QPAA 1E96A 1SXJA 3EIEA 4V0OA 1IHUA 4G5QA 3I8SA 2BJVA 1N6KA 1H8HA 1NG9A 1HA3A 3RAPR 1GNPA 1GDDA 4OBEA 3SHWA 4PTLA 5JS7A 3DDCA 4EJSB 4XVUA 2XGJA 1SVIA 3P20A 5KDLA 3FFAA 2DFTA 2ZE5A 4JBWA 4PXAA 2CL7X 2HXSA 2F9LA 5DI9A 1J99A 2G6BA 3SYNA 3BWDD 3MLEA 1PZNA 2RGBA 3L0SA 3ZVMA 1ZCBA 4N3NA 1LS1A 5AJXA 3FMIA 5IK2D 2JJ2D 2ZRHA 3K0CC 2C98A 5KUTA 4NU0A 3X1ZA 1E79D 1TL7C 2FX3A 1CS4C 3AB3A 2JCSA 4CYMA 3PG5A 1O3YA 2DFNA 2VEDA 3OEEA 4F4JA 2YOGA 2WM9B 5L3QA 1HYQA 3UMSA 4UQOA 3A37A 5HE8A 4BLOA 1OW3B 2XTNA 1U9IC 1P4SA 3I8XA 5DH9A 4LJ6A 2P5TB 5JEDA 2O8DA 2RGCA 2IX3A 2BBTA 1E2EA 4GT1A 2FV8A 2ODBA 4DDUA 5JHHB 2LKDA 1L7VC 4KJZA 4RD3A 4V02A 5SZKB 3VR5A 3EX7C 4GP6A 2GRJA 1AA9A 1K6MA 4DVGA 2IS4A 2IF2A 1T3HA 3GFOA 1RZ3A 2Q21A 2FEOA 5SZIA 3VX4A 4RZXA 3VR1A 4QM7A 1SVLA 4FXPA 3ASYA 3R9XA 3C7KA 3DPUA 3DM5A 2N42A 1UBGA 1KTVA 2O8BA 4QGAA 1W0KD 2A5FA 4QHTA 3MD0A 4ZIRB 1DPFA 2PT5A 3WBJA 1N5JA 3SC3A 4XOIA 2ODEA 4G1UC 2QPTA 1J8MF 4B3GA 4Q9IA 4A0HA 1NBMD 2PLRA 1QVRA 3CONA 1CBUA 4EFLA 2QQ0A 1YR6A 3PVSA 1S9HA 4RZ2A 4M8NE 3U3JA 2QBYA 3BIFA 1BIFA 4P4TA 1N2CE 4F7WA 4IW3B 2V4ZA 3D6TB 4LHZA 4NDZA 4AKGA 2Q0HA 2R44A 1XWIA 2OT3B 2WJVA 5HCIA 2XEXA 2EYQA 2R62A 4D4KA 1A82A 2J0VA 4YMVA 4X8MA 5DI3A 1TQ2A 1C1YA 4N1AA 4P31A 3U3KA 8OHMA 4FWIB 2OAQ1 1DAHA 4HZUB 4LC1A 3CRQA 1FP7A 3K09A 3SYLA 2AN9A 3PUXA 3TLXA 5A4JA 4C0KA 4XIGS 3B5JA 4PSKA 4QGGA 4BPBA 1Q20A 5DSZA 3UMRA 3CM0A 1XPUA 2J7PD 1XTSA 1P62B 4TLCA 4S2EA 1YVDA 4AIIA 2ZS9A 5CJ2A 5DHAA 1AQYA 2AHOA 2FSFA 3EWSA 4IFBA 4JLPA 3R7WA 2GHIA 4ON9A 2IYLD 5FTJA 4HLDA 1G291 2GWHA 1BKDR 1DOAA 2X2EA 4ZKDA 4CRWB 3K0SA 4A15A 2ORVA 3LV8A 4QFMA 2ZRGA 3TAHA 4WBSA 2BDTA 2AKAB 4GP7A 5K8UA 1E9RA 1VIYA 2JJ8A 2AXPA 1JJVA 1YZLA 1BS1A 5JECA 4OI0A 5DO9A 4KITB 3VR3A 4DDTA 1YHNA 1KNQA 2F1HA 4FINA 2BCGY 1MO5A 1QHHA 3HPRA 4N0DA 4BFTA 2BCJQ 5JWOA 1MKYA 3TVTA 1NL3A 2C96A 4MITA 3TSWA 4KFUA 3V00A 2A5GA 1R0YA 1T8UA 2W83A 4BZQA 3EA0A 1J7KA 2IUUA 4DCSA 1E1QA 2HF8A 4V0NA 2ZJYA 1GZSA 3AF2A 4DDVA 1RRFA 1UADA 3C15C 1OIVA 2B7CA 3U44B 4RZ3A 2NZJA 4DCTA 5FUYA 4E09A 1DE0A 2VIIA 4H1VA 4K81B 4POAA 5HPYB 1W46A 4L8GA 4Q9HA 1P5ZB 1EFRA 1PLLA 1FTNA 1MO3A 1NRJB 2X1VA 4C0LA 1G1MA 4DB2A 3EC1A 4BZXA 2BEJA 4XH9B 1YZUA 4X8HA 5JSZA 3CNLA 5C1BA 4PO1A 3TRFA 4PSAA 4LBYA 2ZJOA 1UFQA 3VFDA 2REBA 1XMJA 4G5GA 1CU1A 1M7HA 5AUNB 1Q57A 4WXRA 1GUAA 1VMAA 2CNWD 3QKSB 3KJHA 4M1KA 2V9PA 1GL6A 2IEZA 3EZ2A 1Z6GA 1ZP6A 4P33A 4TT3D 2HLDD 1LF0A 1CRQA 3T61A 1W4BA 3CRMA 1HTWA 4PO9A 4W5WA 1KI9A 1PJRA 4PO8A 2HJGA 2IYXA 4FCWA 4CVNA 1JI0A 4M1WA 4E03A 1Z5ZA 1FNNA 4D4LA 2BKUA 3GEEA 2OSBA 4GOXA 4PC2A 2AD1A 1Y63A 5KDDA 2PT7A 4PHHA 2AWNA 4I1VA 4UNNA 3U7HB 4UNPA 3NVAA 1VECA 2VF7A 3Q5EA 4JBYA 3RRYA 1XXHE 1X1RA 1NVVR 2G77B 4KU4A 3ZH9B 1SKYB 2XJ9A 3DMNA 2G0NA 4ZCIA 2OBNA 2GJKA 3G5UA 3EG5A 4IFEA 1ZM7A 2FH5B 3EC2A 4BUJA 1F60A 4BWYA 3V4RA 1XRJA 1G5PA 2VP6A 1QHYA 4QL3A 4DT1B 2J9RA 1KZGB 3A1WA 4DLTA 1GKYA 2OG2A 2FG5A 1JBKA 1XMIA 2ZRBA 1ETUA 3PEVA 1NBME 2CJWA 2FE4A 2D2EA 3LY5A 3MWLA 1FPMA 2Q3HA 1S4QA 1P60A 3G82C 1TUIA 1KK0A 4GRAA 2QTVB 3SJBA 1DO2A 2Z4RA 4EPYA 1Z47A 3D3QA 3IHLA 2CE2X 3BH7A 3KFXA 2WSSD 3SI7A 2ZR0A 2ZJ2A 3A1UA 1H8ED 2DR3A 2ZE8A 1CULC 2MSCB 4CT5A 2D4HA 1RYFA 2R6DA 1GG2A 1BMFD 4Q1CA 2JLQA 2HYIC 3PV0A 4II7A 4M53A 5JLJA 1ESMA 1U81A 1N6IA 3GLIE 1JQJC 4C2UA 1ZUNB 1R5BA 4IOKA 1WQ1R 2C04A 2J45A 2WPDA 3NKVA 4HDQB 4YQFA 5A5GA 5BN5A 1W36D 1NP6A 4QBFA 4NYIR 5EZ6B 1DBSA 2QE7A 3QEOA 4FI3C 2J0QA 3KQKA 5B57C 4GOKA 3T1TA 2FPMA 3JVUA 2W6JD 2ZITA 2OCAA 5CDFE 4EPXA 1NMYA 2I1QA 2UZ3A 2P6RA 2QZ4A 2CVHA 4LJ5A 5L3SB 2EFEB 2HJVA 3WHLA 1XB2A 2JLWA 1RE0A 3I3SR 4MGIR 4R9UC 3TMKA 1YRAA 2QA5A 2G1JA 2QENA 4OQLA 2FJUA 5AJWA 2AX4A 1UF9A 1UKYA 5JS8A 2ZRMA 1KO1A 2VP0A 3BS4A 4YDHB 2F55A 1G8GA 1S9DA 4MQBA 3PEYA 3WYGA 1S96A 2ZRFA 4RVCA 4OHZA 5EE1A 4Q4JB 1WRBA 1HUQA 1XMVA 2HT1A 2L0XA 1BOFA 3PQCA 4YLGA 3TUJC 2VHQA 3KQUA 2EWVA 3AVXA 2W2TA 4QJ5A 2IS2A 5FBVB 4Q1FA 1KO5A 3LXXA 4BQSA 1NI3A 3IDQA 3C5CA 1NVUQ 4TMXA 5TXGA 1NIPA 1XEXB 4ZIRA 1HQYE 2FOLA 4JL5A 5HE9A 3Q8XB 1DAMA 3CX6A 2ZRLA 1ZC3A 4EPWA 3R8FA 1COWA 4JLBA 5JHGB 1N0UA 5L3VA 4HATA 1IN6A 2J59A 4QNRA 4ZPXA 4G5SA 4IOMA 3LVRE 1KY3A 3T1OA 3RS5A 3T06B 4OKSA 1P2UA 1JR3D 4ESVA 1E2MA 2WIAA 2WICA 1RFLA 3C8UA 2B8WA 3QNUA 5JJKA 5CDFA 5AK0A 3IIMA 3TVDA 2EYUA 4TL7A 4TYYA 1CJMA 2JJ1A 4XD7A 3CPHA 3OHMA 4RFVA 1G6OA 4DCVA 1U90A 3I72A 1OHHA 3MG9A 4RD1A 2BM0A 1OKKA 1EWRA 1XF9A 4HZUA 4L9WA 1OB2A 2GETA 1OFIA 3IPXA 4LC0A 1SXJD 3KXIA 1T3SA 3I92A 5E95A 4ZCMA 1H8HD 3NC0C 2EFDB 5L3RA 2ZYTX 2ZRDA 1N3BA 3N5CA 1L8QA 4URVR 3U7FB 1KI3A 3K1JA 2GESA 5FR2A 1E2GA 4BGDA 3CPEA 3QXCA 3GEHA 1G6HA 1S8FA 1L2TA 2DCUA 4PPGA 4FIDA 1NVWQ 1Q1QA 1QG4A 4TMWA 1IXRC 1G4AE 1N6OA 2P6UA 4DIDA 1KK1A 1KI6A 3ONWA 4M2LA 2C9CA 4OYHA 3K0CA 3WMEA 1MT0A 3BFKA 3BJIC 4BLTA 3TKLA 1N0VC 2RMKA 3GJ5A 4KBFA 1G3IA 2C95A 1OXSC 1VG9B 1YR7A 3I4LA 1ZM2A 1UBCA 4DUGA 2TMKA 3TH5A 4B2IA 3QXJA 3VNVA 5FPTA 3H4MA 2GZDA 2AFHE 2W0MA 2SHKA 3N2EA 4TQ9A 1WBBA 1QVAA 2BM1A 3FB4A 3U2QA 3FHTA 4LHXA 4DLZA 1IOZA 4M0LA 1UDWA 4HZIA 2QAGC 2VLIA 1KK2A 2BMDA 2AK3A 3EASA 3HYTA 1OFTA 2KBEA 4B3BA 4G01B 4D80A 2PEZA 2GEDA 2ZR9A 4X8OA 5DHFA 1ZU4A 121PA 2MSDB 4GBMA 1KYIA 3OFND 3ZGXA 1Z0IA 3U44A 3SS8A 3SHFA 3OIUA 1SKYE 2ERXA 1Z0AA 4PSVA 5DE3A 5FL3A 3IEVA 2OFOA 3DZ8A 3ZLJA 1D2MA 4AD8A 3QBVA 4G5OA 1R7RA 3L0IB 4M21A 521PA 3BB4A 4PHFA 1XTRA 3WNBA 3IGFA 3BH0A 3LVQE 3B2EA 1BYUA 1RRCA 4Q4LA 821PA 1TF7A 4PX9A 3K9LA 2OEPA 2F3RA 3FVQA 2BWJA 2WHXA 1CR4A 3TR5A 1OPXA 1CIPA 3NH9A 1KI4A 3OEHA 4D4MA 3G0HA 1YZGA 2IHBA 2E9SA 2Z4SA 1GITA 2ANBA 3GPLA 2VYFA 2O0JA 2YWFA 2WWXA 4F4CA 1MV5A 4IEEA 1UKZA 1WCV1 2XSZA 3BC1A 3FMPB 3OF5A 4RCYA 2ZUDA 4NBSA 2XZLA 1VIAA 4EDHA 3UG6A 3THOA 4AKEA 4A36A 5DGXA 3BB3A 4K8OA 4DSOA 2NO1A 2XX3A 3A36A 4LBZA 3W6PA 4CEHB 2R6FA 3CWQA 4A8JB 3SQWA 2F3TA 2OV2A 2BVNA 1KMQA 2OO7A 1XBTA 2ZVQX 2XB4A 2H92A 2W58A 2CDNA 3LNCA 1AS3A 3NBXX 4F4IA 4IDPA 3GLHB 4JVNA 4EJSC 1Z0JA 4OI4A 1TEXA 4WZ6A 4DT1A 3T1VA 1TNDA 4ESHA 1VCOA 4Q1DA 4OJQA 4LHYA 4A82A 1CR1A 1JAIA 1OXUA 3VHLB 1E2HA 1JB1A 1R0WA 2ZI3A 1Z06A 3M1IA 4JVSB 1HQCA 1FTSA 3HR8A 3KKMA 4LYFA 3A1SA 2O8CB 1NY5A 4DLWA 1MO6A 1G4UR 1JR3E 5FTLA 2ZJ8A 2W6JA 1M7GA 4WXPA 1S2MA 1E9CA 3GEIA 4JKIA 3WRXC 2F7SA 3LQRA 2ZI4A 4TLBA 2J41A 1PLKA 5SZJA 4G0NA 5GJBA 2PCLA 4LOAA 5KOYA 1DARA 4TTPA 2VPPA 2REOA 5G41A 4V0LA 3GJ7A 4EAQA 4M9ZA 5FOVA 1Q1EA 3V9PA 2BOVA 3TQFA 1E1QD 4YMUA 4XWOA 1IJEA 4NP6A 2GJ9A 3A1VA 3AH8A 5FBLB 1PUIA 1FOEB 1WE2A 1Z2AA 4EIWA 4LZZA 2B8TA 4CW7A 2FEMA 3FOZA 3U6KA 1FQJA 1G7CA 2BMJA 2J46A 3WBKA 3KQHA 1EFRD 1NN0A 2RGXA 2RGAA 3KKQA 4D4JA 3WHKA 2RGNC 2GK6A 2YOHA 3B9PA 4W7SA 5EP2A 4DSUA 1KSJA 4LPKA 1UJ2A 4GOJA 1OFUX 2LKCA 4JT4A 3LDAA 1KJWA 4DCUA 1T0JB 1G8HA 1E4VA 2FFQA 1JECA 2QM8A 1W44A 4GPTA 4CIDA 4D0NA 1TTTA 2HCBA 3UXMA 2DB3A 1R5OA 5JJIA 3PIRA 1CEEA 2HCJB 4JSYA 5TVKA 4GMDA 4HUQA 1VTKA 1K8RA 4D2IA 1ANKA 1P2VA 1TU3A 2YOFA 3GFTA 3NDPA 3F8TA 2ZXUA 5FOXA 2IYQA 1Q21A 3SN6A 1J2JA 1XZPA 2OCYC 5JRJA 1II9A 5M04A 3HU3A 3F0TA 4BLSA 3ZVLA 4Q4JA 2WWWA 2W0SA 4AWXA 1KDRA 2J87A 1KO4A 1GILA 3RWOA 3EPJA 2X2FA 3PFIA 2A7QA 3DMDA 4TTRA 3UANA 4KI0A 1GSIA 4B2PA 3O47A 1SVOA 1XEXA 1E2KA 3K9HA 3Q3JB 1GNRA 1G7RA 4XVRA 3TSOA 3WMFA 1A2BA 2ZSBA 1YQTA 2N1BA 1XTQA 4KSBA 3RABA 3N2IA 1ZJ6A 3B7GA 1BO6A 2WWGA 1AJEA 2FPKA 4HAVA 3MJRA 4G3XA 5IF9A 1RRGA 3K70C 5CLLA 3GJ6A 3A6PC 3Q85A 1VCMA 1D6JA 1AQUA 1QDEA 1ZD9A 1E1RA 4PPFA 3WRYC 5BXQC 3T12A 1G3QA 3RRZA 3VU9B 2CLSA 5F2EA 1CXZA 5FUVA 3FKSA 4O25A 1G7TA 3T5GA 4LDJA 4YMTA 3KJGA 4NE2A 1XJQA 2OM2A 4AG6A 2FSGA 1XPRA 3H86A 3QSYA 2IS6A 1GP2A 1TF2A 3R9IA 3FKQA 1AS0A 5AJVB 3I5YA 2ZANA 3NBZC 4KODA 1GIAA 3CNNA 1I4DD 3AM1A 4CEJB 5KU1A 2OLJA 2AKYA 5EP1A 1E2NA 3V4FA 1KI2A 1OT3A 1VCIA 2VP4A 1QHIA 3X1DA 4KFRA 4C3ZA 4DJTA 4AI6A 2QMUA 1MABB 3A4NA 2OCBA 2G1KA 2PBRA 3OFNA 4QHSA 2R2AA 5FFMA 3ECCA 2J5XA 2Q3MA 1WF3A 4CZ2A 2RHDA 2WPDD 3U60B 3MMPA 3GQBA 1IM2A 5BW8A 1ZNZA 3THXA 4R2HA 1NIJA 2AR7A 1U2RA 2G88A 2HV8A 1EFTA 2IXGA 3B60A 4I81A 1VYVA 2QE7D 4HAYA 2A5DA 2YWEA 2ZJZA 3BXZA 3DOFA 4DEYA 2PL3A 2VHTA 4ARZB 4QM6A 4UNRA 2XTZA 1U99A 3AF3A 1KI7A 1E32A 3UPUA 3P4YA 4XVQA 2XAUA 5TDHA 2IK8A 2WZQA 3TNFA 1KJYA 1OH6A 4Q7MB 4MGKR 4I1OA 5BYJA 4Q7LA 4BLPA 3P32A 1CJKC 3B1XA 3QF4B 1EXMA 4KHZA 3LAWA 4B6FA 1P9NA 2ZU6A 3LLMA 1AGRA 2CEAA 4B6EA 2PMDA 1ZIPA 4BZPA 1NNEA 4JVMA 3AVPA 4HAXA 4IKEA 2XZOA 1OFHA 2H7VA 2JDIA 3CX8A 1ZU5A 2LWIA 5JBQA 1U0HC 3Q9LA 1F6BA 1VYTA 1W47A 3AP1A 4UNSA 5B30A 2FFHA 2QSYA 1AZSC 1J70A 4YMSA 3RS4A 2WWYA 3JVVA 1OXVA 4Q9JA 3Q7QA 1VG8A 3WY9A 4TYWA 4HLUC 4UJ3A 3AQ4A 2I1VB 2ZE7A 1F5NA 1P7CA 2A9KA 4KYUA 3U7EB 1E0KA 2EWWA 4M9SA 2ZRIA 3K8YA 1X1SA 2P5SA 1OIXA 4JJKA 3RANA 4CGZA 3WYAA 2JA1A 1L4UA 2C5LA 4URZR 5KHOC 2V8OA 3SQXA 5EQTA 1KK3A 1R0ZA 3ASZA 4L16A 4MKHA 2FZ4A 1COWD 2G9NA 4RD6A 1D9ZA 3MWJA 4A0FA 4BEBA 3VNUA 1G7SA 2G0TA 4OK6A 3K70B 2NPFA 1II8B 3OAAA 4BFYA 2IA5A 2CMKA 1FUUA 2CCGA 1AIPA 3CR7A 1RPZA 1OF1A 4I1UA 4DZZA 4B43A 3VMFA 1Z28A 3CUEF 4W5JA 4Q21A 3TUIC 2QMHA 4HSEA 5CIQA 1ZINA 4IVQA 1UKEA 1DAIA 1W4RA 1ZM4A 2CBZA 3SFVA 1U8YA 3B1YA 2JJ1D 2NOAA 4XD7D 4KLZA 5AJYA 4C0AC 1DELA 1Z08A 3DM9B 2RKOA 4CEHA 1OHHD 2OLKA 3VHXA 4A8JA 1G5TA 1OKKD 1E4YA 2Z0MA 4NYMQ 2AL7A 3KJEA 3SYKA 1ELOA 1IAQA 2ZSAA 3KUCA 1D2NA 1NSTA 1IONA 1I4TD 2ZM5A 4B34A 1KO7A 3I73A 1GWNA 3PUWA 1MRNA 1N5IA 3RSLA 3O8DA 5CM8B 3GLHA 5JWRA 3MJHA 4ZKEA 4CEIA 3AVYA 2WVJA 3KZ1E 1YZNA 2QSZA 3CRRA 4NZYA 1ZW6A 2QMEA 4DEXA 2P67A 2P65A 1XP8A 1YZTA 2RH5A 1S1MA 4Z51A 4AYTA 3QE0A 2ZYVX 4TSFA 4HAUA 5C4GB 2H18A 2QRZA 4TQAA 4F92B 1NKSA 3ETLA 4DUGD 1WB9A 2O8CA 4W5HA 1PV4A 1TPZA 3BBPA 3TIFA 5AUOB 2WMOB 4OQFA 2REXB 721PA 4MRRA 1X8JA 3BFVA 2FGJA 4AYXA 3B82A 1KAGA 1IY0A 2PMKA 3L82B 2QAGA 4Q02A 5JZVA 3E70C 4TWZA 5JWHA 5F98A 4BFZA 2VP9A 2QM7A 2XITA 4LBVA 4K46A 3AV0B 4B76A 1GTVA 3BRWD 4KLNA 1NSFA 2Z5FA 2GAOA 2WOJA 5LDDC 1DG1G 1NY6A 1KNXA 2J0UB 4PAMA 2FF7A 1AM4D 1XJ0A 4QC2A 3U7GA 5IHPA 2Y8EA 1J90A 2VF8A 2ZJAA 4JKYA 4C0BA 3REGA 2ATXA 4PC7A 4KBGA 4WA7A 2ONKA 1ZNXA 2QG6A 4NL4H 4HB4A 1M34E 4NH0A 2IXFA 4UKDA 1ONBA 4B3XA 2NIPA 4YXWA 2PX3A 4TMVA 3FHCB 1XCPA 4ITRC 2V6IA 3WP1B 1IJFA 4HAZA 1S0UA 1GKUB 3MGCA 1K5GA 2FZLA 4GMXA 3ZZ0A 2XXAB 2H5EA 4OQMA 2VO1A 5CIWA 3WMGA 2HUPA 1E94E 2JEOA 2QI9C 1CJVC 4IXNA 4TL9A 3VR6A 4A2QA 3P27A 3ND9A 2CE7A 3PUVA 4DCNA 4ZO4A 3OEHD 2V7QA 4GL2A 1Z6TA 1HT1E 4KYIB 3U3MA 2QGZA 4KSCA 2GBLC 5D3QA 2A78A 1AK2A 1TEVA 2VP5A 4RKFA 2XSZD 3W3AA 3U5ZB 3GLGB 1US8B 5TB5A 2V1UA 1TX4B 4BECA 1XTIA 5DYIA 4B73A 1FX0B 3W90A 4KFTA 4MA4A 1LFDB 1R0XA 1HEIA 2QTFA 3CW2A 3RHFA 3KKPA 2ANCA 4QXAA 4JIMA 1GRRA 1QHXA 1QHNA 3UMFA 4ZV4A 3TGPA 2QT1A 4PQRA 4EJSA 4DBLC 1IXSB 2XB2A 3I5XA 4EFMA 4GZMA 4JVLA 2AWOA 3P26A 4A0GA 5FPYA 1AKEA 2D62A 5BQ5A 2V6JA 2CXXA 1LW7A 5EP3A 2FU5C 1G20E 3P1JA 2O52A 3OE7A 4XTRA 3GMTA 3TW4A 1E2FA 4LYHA 3QKUA 5JCZA 2F1IA 3VU9A 2VHCA 1Q44A 5IDVA 4KXFB 3CH5A 4PZZA 1FW6A 1XFAA 4HB3A 4L4UA 1IXZA 1DTSA 4LV8B 4ZDWA 4B32A 2NQ2C 4PAQA 4FMDB 2GNOA 3VX3A 4TYNA 4ZDKA 3M4YA 4IRUB 4NYJQ 4BFUA 1W5TA 4CEJA 5FR1A 1FFHA 1YR8A 3GJ8A 2KJQA 5GJVC 1Z22A 4MRPA 3KL4A 5E3HA 1NMZA 1T91A 3TUZC 1ZYUA 1UEIA 1YR9A 1OB5A 4C0JA 3TQCA 1P61B 2XOKA 2QPOA 3CF6R 2ZRNA 5AUQA 4OJKA 2FMXA 3UG7A 4Q4AB 2VTKA 1E2QA 4FMCB 4LJ9A 3QKTA 1JEEA 2OBLA 4LHVA 4WZAE 1R2QA 1G17A 2RGNA 3CZPA 3R20A 4EKDA 3TSZA 4KCGA 2GJAA 4OQNA 5HZKA 4KAXA 1DVRA 4Q4HB 2R65A 4MUBA 5G53C 3PCRB 4Q1AA 4ARZA 1KDOA 2OZEA 3GLFB 1NN1A 4WZBE 4L15A 2JLXA 3RVBA 4H9GA 1KZ7B 4E5UA 3TK1A 2ZI9A 2JLSA 3A8TA 2NO0A 1GNQA 4QNMA 5LBIA 2ZAMA 1KSFX 4GSYA 2XJ4A 3W8NA 5AUPB 2F1JA 1E2JA 3QF4A 5ELXA 2G3YA 2QP9X 5J4HA 4AKIA 3CRVA 5K8LA 4Q18A 3L2OB 1LY1A 2DBYA 4FCVA 1L4YA 3IQXA 4IEIA 4WAUA 1E99A 5J4LA 1VHTA 1XEWY 1WP9A 1N25A 2X8AA 3LD9A 2IYUA 3D31A 4JZKA 2YWGA 4C0HA 2ZYUX 1OIWA 4AC9A 1LTQA 4NKRA 1DAFA 1E0JA 1R4AA 5D3MB 1B23P 2ZSFA 1KJZA 1N6HA 1XEFA 2DY1A 1JEDA 3R9WA 1W0JA 2IYTA 4FD2A 2GF0A 4RD4A 1E0AA 5HCNA 3W8RA 1CF4A 3I62A 1SGWA 3D7MA 1T5IA 4OK5A 5H1YA 1Z63A 3AUYA 2RCNA 3D8BA 1N6NA 3DKPA 4DLUA 4A2PA 5LPNA 1U94A 1A2KC 2O8FB 1W49A 1X8LA 3LQQA 2R6AA 2A30A 3AVUA 4L5BA 4WVFA 3SNHA 5KNCA 4A8JC 4QJ3A 3CR8A 2WKRA 4Z8XA 3IO5A 2HXYA 2O0HA 5EP4A 2OHFA 3NH6A 3VR2A 5KO2A 3AVWA 3NWJA 1N6LA 4LYJA 4QGFA 4EPRA 1TU4A 2Q9CA 2K5UA 4BRWA 2FPLA 3EW9A 4Q48A 1II8A 1BH2A 2ERYA 2QMOA 5GVRA 4MRSA 1ZMXA 4UXIA 1XPOA 1CP2A 1JJ7A 1QHSA 3A4LA 3BERA 1M8PA 1E1RD 1KI8A 2ZSEA 5DN6A 4MYTA 2PJZA 1EGAA 5GJWC 2J7KA 3LBHA 4GFDA 5J4KA 5LD2B 2KI5A 4P0TA 3C41J 4B3DA 3FKSD 3M0EA 2Q3FA 4NCKA 2MMGA 1M7BA 3WYFA 2BBOA 3RRMA 3DEFA 4NYMR 3NEYA 1NMXA 2WJJA 3FYHA 1Z0FA 3ZZUA 2GXSA 1P72A 2GVZC 1QBKC 3VQTA 4US0R 5JI3E 1RJ9B 4JS0A 1KDPA 2CLCX 3QF7A 3IUYA 4P4SB 1FZQA 3O8CA 4A2WA 2YWHA 5J4YA 1SZPA 2OUKA 1MOZA 5HKKD 4B44A 4E07A 3C4JA 1T9HA 2DYKA 4URWR 5GADl 3ND8A 3RYTC 1D2EA 3MFYA 1DADA 1E9DA 3UKDA 5FH9A 3RNLA 4TZ0A 4EPVA 3U4QB 5CYOA 4A1FA 2ZAOA 3NBFA 1AGPA 3SOPA 2V1XA 4AYWA 1IQPA 2QP3A 2XZPA 4FMDF 4H1UA 2E87A 2QROA 3A58B 4PZYA 3EZ6A 1UAAA 3MRSA 4LI0A 4RFSB 1KSHA 3X1YA 4C0QC 2ZRAA 3NEJA 4A92A 2IW3A 2QORA 4IDQA 1P9WA 1RW4A 5TY0A 2WWFA 1MR3F 2QUZA 3QKSA 5AR1A 1G19A 4FW9A 4QGHA 1ESNA 4DSNA 3AKCA 2DWOA 5HTKA 5DI3B 1F2UB 1HT2E 2GK7A 3PEUA 2EFHB 1YZQA 1DAGA 2J0UA 2JDID 2JGNA 1OJLA 1RKBA 4KVGA 2GTPA 3AVTA 2JIZA 2QL6A 3PXGA 4B33A 2UZIR 2JLUA 1E3MA 2DPXA 4NCHA 3LXRA 4HLUA 3K0AB 4OHVA 4V03A 1E2IA 4OHXA 1GOTA 5EXXA 3J81k 4UNQA 3QENA 4B35A 3KXLA 3P4XA 1GAJA 2ZEJA 1UPTA 2CHVA 1E9AA 2QQEA 2D3WA 4TL6A 5L8VA 5J40A 4LWZA 3R7WB 3QPWA 5GJCA 1KDTA 4JYCA 3O8RA 4PHGA 1B0UA 4Z1MA 3NHBA 4DSTA 3QPVA 1IY1A 2GXQA 1W4AA 3SR0A 2LCFA 1C4OA 3T35A 3OESA 1W48A 3OAAD 1E69A 5IRCD 2GJSA 2ZQ5A 2B92A 2WAXA 3IEUA 2CL6X 3GCGA 3W3ZB 2UVQA 4I1SA 1NF3A 2ZETA 3KKNA 2GEUA 4M1TA 1U8AA
chains in the Genus database with same CATH superfamily
4D6PA 2WJGA 2MSKA 2C03A 1SOVA 3O0DA 3G2KA 3JYLA 2VSOA 5FIUA 3KV3O 3GLGA 2BMEA 3GG9A 3LKBA 1D4ZA 1T9ZA 4RBNA 1U1IA 3RSGA 3WKDA 5BN3B 1RXSA 2P41A 4HNHA 4IJ5A 1HV8A 5LCXA 3W9YA 4FYHA 5HF6A 4MIYA 4MPJA 1Z5PA 2H54A 5JMTA 4AQYB 3DTTA 3GHHA 4GMGA 2DUJA 3Q0EA 4IDNA 5BR1A 5MN5A 2BHRA 3DVLA 3ZOZA 1NDUA 1ZXBA 1Z0KA 2UUOA 2VBIA 2C2GA 2ZQZA 3EIFA 3ICVA 2GPWA 4LXYA 1CJTC 1O94D 1U6IA 4MP8A 1C4XA 4NTZA 4E4TA 1JQLB 4IO0A 1O9HA 1AD2A 2G9VA 2PFGA 2WFAA 2XNDA 4F2PA 3STUA 4DV1B 4CKCA 3H9GA 4YT5A 2Z95A 4HDMA 3QVGB 1X7ZB 4R5MA 2AOXA 4G81A 4FQ7A 4JC8A 1LDYA 1QYVA 1L5FA 1FP2A 2A5JA 2P6OA 2XMPA 3PXDA 2QN1A 5C34B 4XSGA 1Y5LA 1UEJA 4IXWA 5KTTA 1ONNA 1QORA 3F3MA 4TSFD 2Y1KA 4UXJA 4QBIA 4PYOA 3R23A 3E2IA 1SULA 1XLUA 3JATB 3EWNA 2JVIA 2NSYA 4PFKA 4P3KA 4RTQA 4AJ2A 2E1RA 1XAJA 1JMYA 1Z75A 2WHRA 3GLTA 3R5FA 4HNAB 4LOKA 1K86A 4J43A 4YRZA 5HUHA 5JCPA 2XCTB 3E7PA 5I9SA 4K26A 2QGNA 1NA5A 2B83A 1BSVA 2FOIA 4DXDA 2RBKA 2OAP1 2QZJA 3D6UA 3PEEA 1KHHA 3PUYA 3H8VA 1ZAKA 2HSWA 5BNFA 3VI4B 1L4LA 3JQPA 1Y33E 1E9FA 1AN0A 3WXBA 3UJHA 1GEEA 4BO0A 1ES9A 5AVRA 2O2XA 4ERXA 4HY3A 1YTUA 2Y1EA 2MYUA 1OA0A 2ETXA 4IOLA 4QUHA 1FMCA 4YMWA 3CV3A 2O2DA 1BD4A 1F6WA 1XMOB 1EESA 1NDHA 1MJ5A 1QFXA 5BUQA 4F6RB 1YKSA 1ZLXA 1AO0A 1U1FA 4OHWA 4DA9A 2IH5A 1UOPA 4ACBA 1M6EX 2PEYA 3IAEA 4KH1A 4UE6A 4HVLA 1YRLA 5DCLA 4Q4HA 4RJTA 3HKDA 2BP7B 2PH3A 3PS9A 5EE5B 5AW1A 2AI2A 2ZR8A 5KTMA 1JXMA 4QECA 1SEPA 4WFJA 1P77A 5K6TA 1N6PA 3P9NA 3AP3A 2VFAA 5INTA 4A2CA 3AFGA 5F9HA 5JDCA 1L5WA 1I2AA 1TT5A 4E1VA 5AVTA 1V95A 1GU0A 1U3TA 3PFCA 2FZGA 3OICA 1M76A 4OL0A 4BYMA 1AQLA 8ATCA 4FMBB 3JQCA 2ZYIA 2ZBQA 3VR6D 1Q22A 2Y0DA 4QU5A 3KE9A 1C80A 2CY0A 3CCBA 1KH2A 4D9FA 1HDXA 1S1CA 2IC5A 3ZLUA 1BDMA 3MOGA 4JBXA 5LN1A 3PGMA 4MKIA 4Y2UA 3W1VA 3PC7A 2BHSA 3ZX5A 4DMLA 1SOAA 2R87A 4JELA 2TSYB 4JYBA 3DXXA 4UW9A 4CL0A 1NLMA 4CCSA 6LDHA 2D7DA 1RLJA 2B37A 3OZIA 1C1XA 2XVXA 1NVFA 2Q5LA 2QT9A 1CNEA 2JHFA 4LVOA 4E2WA 3W3AD 2Q4BA 3R3SA 1ZSVA 2PNFA 5CT8A 3AF0A 5DM0A 4DC9A 3L0DA 2G70A 3WMWA 4C5AA 1UWLA 2DH5A 1SKQA 3AF4A 5K3DA 5TMPA 5DZSA 3WLIA 5EIFA 1NJFA 1Q1GA 4POOA 2JGDB 1TUBB 2ZZKA 3MTEA 4ICIA 4Y9DA 1EIWA 4WOCA 2AXEA 4WLOA 4MNTA 3RVMA 1E58A 3UUEA 1KI1A 3LHIA 1LLQA 1Z38A 2RGDA 3PXCX 3K5IA 2HA5A 3T7IA 4C04A 3C8MA 3T7AA 1KS9A 5DGHA 4GICA 1MEOA 2AOTA 2PZLA 1K08A 4GQIA 3SBDA 5A04A 2JJYA 1Q95A 4XJTA 1QQAA 7MDHA 1M0SA 4PS1A 1EVIA 5H3HA 4XCXA 5LMUB 3IAS6 4QPNA 1NLYA 3C7AA 3D4NA 3SU8A 4UHKA 3DCYA 4H77A 1YSCA 4F21A 1GDHA 1P91A 2F4VB 1K27A 5DTEA 1EFVA 1KYYA 2XTAA 1MFPA 3OE7D 3W2HA 4CR6A 3U4MA 3PWSA 5JEEA 4FUTA 3BGSA 5FTKA 3LSTA 3HUUA 4QYXA 3ENWA 5BT8A 2R84A 3UC5A 2REQA 4FWTA 5A3VA 3C14C 4BQPA 2VP2A 1YCGA 4EHBA 4XIJA 4AIRA 1K98A 1TD9A 4U8GA 4MXDA 1C9NA 1PEDA 3IERA 5K0JA 5EZYF 4H3SA 2Q4TA 3WL7A 2CK3A 1E60A 3O75A 3THWB 3H9QA 1TZBA 1A3CA 1L7DA 3OZDA 3D1VA 1LCIA 4P4GA 4X7RA 2AEFA 1RYEA 1TI7A 2IF0A 5K8TA 4QVKA 1KWGA 4KTTE 1XTKA 4KV7A 4ZCQA 4LOHA 4QXRA 3MBOA 5EJFA 3WJ2A 3CG4A 2CV2A 2V96A 2Z3ZA 2P0YA 1GZ7A 1SQ6A 221PA 2HJRA 2XOKD 1ZN9A 2FPXA 3W4KA 3G0IA 3UK7A 1E6MA 3KR2A 1JX6A 1RMYA 1Q74A 4O29A 3MQ2A 5DGTA 3GI1A 1ZONA 4F5WA 3PR3A 1Q0UA 2R4UA 5EXTA 3SQLA 4EHHA 1QG0A 2NAPA 2SCUA 1I6MA 1NXSA 3LW8A 1ENZA 3K0FB 4QPJC 2ODTX 3U4QA 4E4RA 2ETVA 3KHTA 2PGJA 1C3VA 3H3FA 4KKVA 2XKAA 5EZ5A 1L7MA 1SRRA 5C5CA 4CMEC 1UXOA 1YI0A 3HUTA 4BV3A 4IZHA 3RVLA 4PC6A 3WZMA 4QXMA 2FW9A 2GDZA 3NHYA 4DBZA 1HYEA 4AK9A 1UK7A 1UWCA 2QLLA 3SFZA 4J4TA 4F38A 5F64A 5BN4A 1RQLA 1N2HA 3PWTA 1O58A 2EHDA 3Q3IA 1JE1A 3U0BA 4PAOA 4HEHA 5LBUA 1K7EB 2R7LA 2PRSA 2C9OA 2GO7A 3PA6A 4FHFA 4I6GA 3BHJA 3WGIA 4MDEA 1C8KA 3HI4A 5BNTA 1XMSA 2HQRA 4M9XA 3BXPA 3RT1A 3D43A 3DBRA 1XTPA 3A6JA 2IZZA 3W04A 1H2EA 1AQNA 3PEFA 3TCXB 3V8QA 3K16A 3R8CA 4KFSA 4NY1A 5IBCA 3DBHA 5DTMA 5CXXA 5AW6A 4ANFA 1R8SA 2IH2A 4QT4A 4OIFA 2PGDA 3LLUA 4HLCA 4O4JA 1PRYA 5TQ2B 3O4IA 1F2VA 1K7SN 3ESAA 4RKEA 5J2TB 2JEZA 4FDAA 2FGKA 1P2SA 1XX6A 4O33A 4X5OA 1VPTA 1SOWA 4YY3B 3BXXA 3EA5A 4GYWA 1K3UB 3VU1A 2F00A 3TTUA 2ZREA 1BTOA 2PL1A 4J07A 3DE7X 4Q3DA 5IBPA 4D3DA 4R0MA 1O77A 2P0EA 3FH0A 4QTZA 4S1VA 3RC7A 2D2IA 4A0RA 3L4EA 3LLVA 3GGOA 5TT1A 1CDDA 3PYLA 1JDSA 2OWDA 4W8HA 1BXKA 3V1NA 1CW2B 2J08A 4P4UA 3VC2A 5IABA 4TL8A 1EX7A 5AYVA 3MINA 3LZ6A 4KXNA 4YO7A 4G9BA 2ZR7A 3R3YA 4G4IA 2UXDB 3N86A 1IZ8A 3L18A 4MUAA 5KVSA 1U3UA 2QD5A 3L8ZA 4HDAA 2HQOA 4LXGA 4QXOA 2DQZA 2TMYA 1T0IA 2GYUA 4KYVA 1ZUHA 2QSJA 1Y8CA 3KZXA 3EYAA 4YI5A 5DIFA 4LCBA 4BP1A 1VZ2A 4WL0A 4CQJA 3ZDDA 4UJ5A 3QYFA 4Q9AA 2N0SA 2B7BA 3GMIA 3H5IA 4LRQA 3HKCA 1X38A 1PX2A 4RESA 2B5OA 3EA4A 2PUAA 2K2WA 2GBPA 3CJRA 2JW5A 2AQ8A 2PD4A 4H7FA 5DHUA 3UATA 5FWXB 3FOBA 2W6MA 4WNIA 4NAVA 2E89A 1R00A 3K15A 3TR0A 4TLEA 1ETHA 3C6MA 4DMRA 3PEWA 2Y1DA 1OFVA 2NO9A 2PUVA 1T8TA 3HV2A 3I9LA 3PDIA 3AUAA 2D0DA 1QIFA 1VFNA 4W6QA 2A67A 1SVWA 1T2AA 1KMHA 2ZRJA 2EKLA 2YFYA 3HFGA 4DNXA 4BO6A 1L4BA 1VQ1A 3EZFA 3R6GA 1QWSA 1P7PA 3C5EA 4FCTA 4L6AA 4A27A 1X80A 2QW8A 5I4IA 1LGYA 1YA8A 3PLNA 4ACAA 4CU5A 3QEBZ 3ZY5A 3IH5A 2X8LA 5MGNA 2P27A 1GG9A 4XRGA 1QZXA 1QOPB 5CFLA 1EM8B 3BZUA 3KQWA 1TW3A 4MYCA 1PCXA 2D1FA 4RGVA 2FLWA 2A0WA 4RQUA 4TMKA 2WJIA 4LGYA 4W5OA 2VAMA 4L5IA 1LTHR 3H1BA 3PJDA 4GQBA 4JL8A 1N5KA 2ZS8A 1T36B 2OKCA 3K9GA 4RGYA 5IN5A 1J21A 1MV8A 3V2IA 2O23A 4IHQA 3VOAA 1FDUA 4BNKA 4RHTA 2HPAA 1RLTA 4FZRA 3D1LA 3CZQA 4C7OB 2VTVA 5COAA 1FL9A 1I10A 1PKEA 2MT9A 4RWEA 3TD9A 5H80A 3OQ1A 4JSTA 3NG1A 4EB6B 2G04A 1SOMA 3OSZA 3EAGA 4P3PA 4TROA 1TZCA 1ZJYA 2AFHB 1VG0B 2YMMA 5EIAA 1P0PA 1I1HA 3G5TA 1I2DA 4CCWA 2Y76A 4YR9A 3OFSA 4HH1A 1YNSA 2HM7A 2J31A 3ITNA 4JLVA 4U4AA 3R7LA 3SR4A 5HEKA 1V1MB 2E4VA 1E1CB 5I7RA 3OC0A 3UWOA 1JAHA 4FGSA 4DR5B 2PJRA 1W96A 4O2AF 1W2GA 2X76A 4JC5A 2C3YA 2DKFA 1HMYA 4H7EA 3IQEA 2RHLA 2JB9A 1M2NA 4HDCA 3NONA 3QOFA 2FFAA 1SIWA 2ZWPA 2IBMA 3HTXA 1CTQA 2DG2A 4EZBA 2XUAA 2JIZD 3DXFA 3MWEB 2RB4A 2J3MA 3B1FA 1SXJC 1RYHA 1YDMA 1XD8A 4NZ9A 4R81A 1N9KA 2ET6A 3ENQA 3O74A 5KOIA 4ZRNA 2SNIE 4P7GA 3N7UA 1HGXA 2V54A 3TYXA 3SC2A 3W6OA 5K8IA 1RTKA 2DAPA 1KTIA 3E6AA 2VYND 2VNSA 2VXYA 1HE1C 1Q2XA 2R8BA 1CJSA 2VA8A 5TQ0A 1JKFA 1DKPA 4N01A 5ENVA 3S2SA 4BVKA 1X86B 2FUKA 4TKUB 1NN3A 4A8TA 1B8VA 5HXAA 1OSNA 1PTJC 3PGLA 3O5AA 3T9FA 5IK2A 2ERCA 1WY5A 2MJLA 1HE8B 3KYCA 1WDTA 3EIOA 1XRQA 5E6RB 4YQZA 3WGMA 3W5DA 4Q00A 3LUBA 4YGXB 2GXUA 2QL5A 3Q1LA 3HDTA 1D6NA 3D8NA 3PRJA 4TVOA 4UHFA 1H65A 1FLDA 3FTPA 3D7SA 4KR9A 1R88A 2C0QA 1WL8A 4AJIA 4C4PA 4EHFA 2XH8A 3KQLA 2X0JA 2XBLA 3JYOA 3TIVA 4WHMA 4DR3B 1U1EA 1S89A 4EAAA 3JAKB 2JJMA 2WI8A 3HE3A 2JGLA 4O4IA 4PPQA 4R3UC 4QJ4A 4ZHQA 2QD4A 4RJ2A 4YJ2F 4ZI5A 3L6OO 3LNTA 5LD2C 4IIEA 3VKHA 3VPXA 1QV9A 2A35A 3BSYA 3N0RA 3LVBA 3N8GA 3ZWDA 2PA3A 1JA9A 2P2NA 3P9YA 3UFXB 1RYMA 2J3EA 4FYWA 4A16A 5HGJA 4EG7A 1JH8A 1E1LA 1IM5A 3QY0A 1A97A 1EBUA 2C59A 3CUYA 1NQWA 1BEEA 2CYBA 1DC7A 1OZAA 3MXTA 3IBGA 2NO6A 4MMYB 1IY8A 1R12A 2NG1A 4X90A 4XPIB 2D5IA 4BNJA 3JYHA 4QU0A 4EQ6A 1SHKA 2QIOA 2QJFA 2YHSA 4N6OA 2IY8A 2MINB 3EXAA 5LQCA 1UQRA 1WZIA 3FZGA 5FI1B 1Q0PA 4LE0A 4B4KA 3SSNA 1FUKA 2FSIA 3LO5A 5FUXA 2GF9A 3ZWMA 5KWVA 5CNJA 2AFIA 2GBCA 4ZQEA 3D5TA 3NBYC 1LLUA 2XCQA 1U5CA 1F9EA 1KIAA 3H83A 3PPIA 1PK8A 1B43A 3U19A 4QRDA 2MDTA 5SV2A 3VU0A 4C2TA 2F17A 2CWDA 2JGKA 2OHGA 4JB3A 4JFRA 2EF1A 1YDHA 1KE1A 3UWKA 3NEAA 4CDGA 3T95A 4WK6A 4L57A 5AI8A 1NT4A 1YJ5A 2Z83A 3TOCA 2PUWA 3T99A 3K4PA 1XQWA 1I1OA 5CNKA 1W1WA 1B6TA 1QTRA 1V43A 2ZRKA 1GN8A 3SJUA 2RHCA 3ZHBA 3AEZA 3ZDQA 1P4AA 3G8CA 2AB0A 4BBZA 4NBKA 3CZCA 1ICIA 3AKYA 5CAEA 4NPHA 1OV4A 2IYYA 1ZX1A 1SXJB 1T6ZA 3CSSA 2WIBA 3HGTA 4YYEA 5FLYA 3GLIA 1WZCA 5KSZA 4DMMA 2JK1A 2YXDA 3HGMA 3A2MA 4LUCA 1FQKA 4LZWA 4HX9A 4CIAA 4UQLA 1L5VA 2WTXA 4OM8A 4YJ3A 2EFGA 1IN4A 3HYRA 2DUUA 1WDKA 1WHSB 4EFNA 4TMFA 1NXXA 3A7DA 3N6VA 3F8SA 1P5HA 5A9TA 1KR2A 1B00A 4Q7EA 5DBIA 3A3OA 5JQGA 4L28A 1GA6A 1WMSA 5AVQA 3MWDA 3UA4A 3ZV6A 2BR3A 2A2ZA 4BWFB 2DFKB 4DC0A 3PJRA 3ZN2A 3ZYZA 4LX8A 1FW8A 4J7XA 3KU4A 3R5XA 1FMJA 2ZT6A 4ZRMA 1E18A 1VL0A 3C3KA 2ZROA 1XD2A 4CL3A 4L75A 3UTDA 1JVBA 1MU0A 4J91A 2BEKA 3WS7A 1RKUA 2EFJA 4TTVA 4B3IA 2QIPA 2CFCA 1GPDG 3I6QA 3OFKA 4GMHA 3LWBA 1GL9B 2ADFA 1E63A 1FVOA 2DFDA 2H2AA 4TX1A 4WCFC 3O84A 4EY4A 4O4HF 4ZQHA 4KN9S 3D3JA 1SUEA 5G0SA 1RM0A 2GEVA 3I2FA 2Q6TA 3B1WA 4UM5A 5KHAA 3RS3A 5HZGA 3I9NA 3NIBA 3TTXA 4IHAA 3BJRA 4WMLA 1XLTC 4JUDX 4YV0A 4LK2A 2G83A 4YYZA 3UB3A 2WF7A 4EW1A 1TUEA 1TVCA 1NRXA 4TN5A 2C4NA 4Y2JA 4RSGA 5EAIA 2LRHA 5C53B 2ECKA 4F4UA 3AJ8A 4Y18A 4OU5A 1JIVA 1NLZA 4Q4DA 1RP1A 4V0ME 3QI7A 1OROA 1XC7A 2YVKA 3SEAA 1UXHA 1U98A 3DFMA 1YFJA 5HMLA 4OJTA 1G8KA 4RDCA 2NTYC 3H4IA 4CKBB 4EARA 1JV2B 1ZICA 2XRZA 4RZHA 4OA5A 3QU9A 5AD1A 4W8OA 1I3NA 2VYVA 4E6PA 1AKVA 3FNGA 2VDWA 3MW8A 2CL0X 2R5WA 4M1YA 1VSQA 1TFUA 2CVPA 4MRVA 1G3UA 2N46A 5B53A 3WVNA 2DFLA 3Q0IA 1GRCA 1U9IA 2Y1XA 4KNYA 2E4YA 2Q5CA 2G4VA 3LW7A 4EELA 1RJWA 2JLVA 1UMKA 4FB4A 5FBQB 2DHQA 2VHZA 3W8DA 2YJTD 3OPVA 1DJOA 3ETGA 3TLBA 2V55B 2Q1TA 2FB9A 2C3PA 4IJVA 2KB0A 1BG6A 2PLWA 4TZKA 3ZYCA 3WAKA 2VHUA 1W88B 4MPTA 4ARCA 3W34A 5MHTA 1RI5A 4JBGA 2GEBA 1IQ0A 3EMDA 1IUNA 1OGJA 2ISSD 1BHJA 2PK3A 5KTPA 1JB9A 1PV1A 2YS7A 4RIFA 1J8QA 5JO9A 4J6EA 1SKUA 4M7RA 4MMXB 2IU0A 4DLYA 5JC1A 1SZCA 4C5BA 3ZLTA 3ZIAD 3KTAA 3TZEA 4NZMA 1YS2X 2W2OA 1GM5A 3RG8A 2EU8A 1L4FA 4CTJA 3Q7PA 5HKAA 3FCYA 3VU8A 1QQTA 3ISVA 4ZOLA 2PKRA 2PZGA 3KAPA 3FNRA 4BATA 1S8NA 5CXUA 4KWTA 2PUCA 3A3KA 3H2BA 3TGWA 1YL6A 1JJIA 5AVOA 5JANA 4EG4A 3GL9A 5K0SA 1MDFA 3FE2A 3EWAA 3QUQA 5EHIA 1SHLA 3JSAA 4XVHA 3I34X 2RK6A 2WTEA 1EDZA 2CXPA 3I61A 1Z9BA 5KPJA 3IVAA 2X13A 3M6AA 4FYKA 1ONPA 3B8HA 1QF6A 2AG5A 1SU8A 5H0IA 4FQ5A 2M6LA 4ITUA 4L8VA 3COJA 2P30A 4HX2A 1PVVA 4BRUA 4MV6A 2V7UA 3K5HA 1KY2A 3B51X 5DX1A 4A6EA 5F4BA 5JD4A 1FYXA 2LE0A 2ZYGA 1PSWA 3GUUA 1R0CA 3L40A 4PYLA 4DLAA 2QI9F 5BRAA 3EIHA 2GM4A 1NR5A 2R0QC 3A3PA 4PCUA 1EG7A 4U2GA 4C4XA 2YBDA 3ORQA 3DO6A 5BVGB 4EG1A 1Y4SA 3ZBQA 3COVA 3BHMA 2EDAA 8ABPA 2ZRQA 3IODA 2ZIAA 4PX2A 2HRDA 2HIHA 3BXEA 2PCJA 3QXSA 5FBRB 4ZZ2A 2F48A 4NS1A 1JQEA 1JHQA 3OJEA 3BK7A 4TRRA 2K4MA 2ZJ7A 3RK4A 2WV9A 4RTOA 3AUJB 3E03A 4MIEA 4PO3X 1ECPA 2PZ8A 3MUEA 2BKEA 5DASA 4JC4A 1Z6YA 1WU7A 5AP9A 3GEGA 4OGFA 3FYDA 5TF0A 1ZRMA 4ROSA 3CKYA 4CKEA 1HK7A 1V5FA 1ZJJA 1KHTA 1TJ5A 3SDZA 5EJ9A 3QKRA 4CEIB 3AESB 1VLQA 3HU2A 1HFEL 4JOSA 3STWA 3DMHA 3HQ4O 3GDFA 3QLTA 1W29A 1YFLA 3HR7A 4LY3A 3AI7A 3DQQA 2PQ0A 4DCCA 1QU3A 3KJQA 3KT0A 621PA 3KLMX 4HI0E 1G16A 1OTHA 5FLKA 1XQXA 4GZ3A 4UUOA 4KR2A 1EVYA 5E8RA 1A7JA 3T34A 4EGQA 1BU8A 3PCXA 4CM8B 2I22A 1RXIA 2Y1CA 4DV4B 3G2LA 5F21A 5F2KA 3VR3D 5IHXA 5C46F 1BE1A 2QY6A 1RC8A 4UUAA 3NOOA 1CHNA 3Q5DA 1R4MA 2EG5A 1CLUA 1NFFA 4R83A 3NC1C 1CQJB 2B20A 3G1TA 3B85A 3U6BA 4Q1VA 9ABPA 3THYA 5DBGA 3OIYA 4N39A 1FZTA 3ZD9A 3ZJYA 1JKMA 1A7AA 1WPQA 3FMGA 4FMPA 5F76A 3RGGA 2BPOA 1VDZA 2CXHA 1AGNA 1RIFA 4D74A 1RABA 1XDBA 2E21A 3CO5A 2IZOA 2GO1A 2E3JA 3BXFA 5GTDA 5KTNA 3OI7A 1SXJE 4NARA 2F9MA 4NYJR 4X20B 2F1KA 3UFBA 1WQ3A 1WXFA 2F43A 1Z4PX 3K9NA 4ZQCB 4ASUD 1EXVA 5KTYA 3GA7A 1REQA 3AL0C 3E4DA 2G40A 4FFRA 4MZDA 4NOKA 5ICMA 3EZ7A 1DRWA 3CRZA 1A9YA 1GAEO 4MW5A 2ZT8A 1QTNA 3IDSA 4OFWA 1ORDA 3VKWA 3V4VB 1C9YA 2C97A 1XLWA 5DTJA 4F93B 1X1AA 2VAWA 2VJDA 1JR6A 2QMQA 4OFXA 4BE7B 2WKWA 4S1PA 4UPDA 3JQ9A 2XUQA 4N6GA 5D51S 3N70A 3W6NA 1Y1PA 4NCIA 3QSGA 4MQMA 1HE4A 5KQLA 5IKOA 4RVUA 3QEMA 4RJKA 3QITA 1QQBA 2IUTA 2Z08A 4Y3UA 5IANA 1RKXA 3ADBA 5CFNA 2V9ZA 2YNMA 1KC1A 3HJCA 4GC5A 5GOZA 1LKZA 4GOND 4Z9XA 4C5CA 1WBDA 4NXNB 3DVQX 2GNAA 3KWJA 3F1LA 1Z5UA 4YIKA 2ZSDA 4N7JA 3DL2A 1JR3A 1KH3A 1U4NA 3GRYA 4Q1EA 5EY5B 2O2SA 5H70A 2CV1A 1T35A 2PAAA 1W6UA 2JAHA 4BFXA 1FF9A 2CJWB 4AM8A 1OH8A 1TCVA 3AM3A 3QXHA 3RSSA 5JSFA 2P9CA 4D26A 1E66A 3FZEA 4EO9A 4GM0A 2XQVA 1EFHA 3PD0A 1T24A 5DHRA 2BKLA 5AM1A 5IAJA 3DLBA 3EMVA 4QYIB 1J5EB 2G0AA 2RK4A 3WXMA 5KJ1A 1S4MA 4H1HA 3BKWA 4MV1A 4V0OA 1IHUA 2G82A 1WZNA 1N6KA 3VZSA 1H8HA 1RWVA 4OBWA 1QGUA 1HA3A 1WHTA 4O4JF 4DPLA 1GDDA 2QN3A 3U9SA 3ELDA 4OBEA 5EIBC 4KQGA 4YCNA 2WMDA 4LRUA 2IGBA 2CFSA 1T2EA 5JVDF 3NHLA 1NM5A 2B98A 4G09A 2XMSA 1T5DX 1W25A 4XVUA 4Z7OB 1V45E 2JKYA 1B15A 1NJ8A 3FFAA 3FDZB 4I5EA 1H5UA 2AI3A 2DFTA 2ZE5A 4FXOA 2HMVA 4JBWA 4PXAA 5DN9A 2G6BA 2X4LA 1TMGE 4AKSA 4TKVA 4YCSA 1FYVA 4NZPA 5B1EA 1I4WA 1SFRA 3GGCA 4KREA 1LK7A 3ZVMA 7REQB 1XZGA 4EGJA 5DYNA 3K0CC 4MVWA 2WNHA 1Q77A 2V7XA 4Y2VA 4NU0A 3JAWB 3AHDA 1E79D 4I3FA 1PFYA 1U0OC 2GPNA 4O0LA 1DWQA 4X1KB 1K9SA 3U9TA 4CYMA 4KXWA 3E7XA 2DFNA 2GJ4A 3OEEA 3FTFA 5AVUA 3H2SA 3WWOA 1FS6A 3RYCB 1WMBA 3A37A 8AT1A 2XCOA 4K6FA 5DH9A 2I9PA 1V3TA 4D9KA 3G1WA 4RVFA 1H9AA 2PIAA 4YT8A 1M10A 3I01A 1U8EA 2Y77A 2RGCA 2BBTA 3WLJA 1IG0A 4GT1A 2FJ0A 2X5KO 3IA2A 4CUKA 4V2UA 5BNWA 3ACBA 2VUSA 2V6MA 4ML3A 4GP6A 4IX1A 2XE6A 1AZLA 3N59A 1UWVA 2ID4A 2IF2A 3GFOA 3RJTA 5CXQA 3E05A 2FG7C 2Q21A 3DBIA 4DAEA 1N57A 2J6HA 2C61A 5IC6A 4YPVA 2QLNA 5BSRA 2A14A 1SVLA 2GFIA 3KOYA 4NEGA 3X44A 2GEJA 3TW0A 4C6RA 5HM6A 2NX2A 3ITEA 3IFSA 2ZSHA 3ME5A 5TEVA 2BT4A 2N42A 3RVNA 2W42A 2P9GA 3GUZA 1GVHA 4EVQA 4N9WA 4ZIRB 2RKWA 2W93A 4QHTA 2GUWA 1TYAE 2PT5A 5DLDA 4KGDA 3SC3A 4XOIA 2QPTA 2Z56A 5ALRA 3HNRA 4WKBA 5DULA 1QH1B 1J8MF 2DRIA 3Q9UA 4KH0A 4XYGA 4B3GA 4Q9IA 4A0HA 3ER8A 2YFQA 1NBMD 3NWEA 3HCWA 4GEGA 3IV9A 2PLRA 1JDJA 4U39A 5K0LA 3WK5A 3NYWA 1AHNA 3ZWYA 2MSLA 1CBUA 4EFLA 4RTKA 3HV0A 4M60A 1UBRS 1F4LA 3FCUB 3PVSA 5T6BA 3EPRA 3ZXYA 4RZ2A 2QBYA 3C7TA 4FLFA 3BL8A 1E6LA 1PEYA 1XL0A 4WJKB 4XX0B 4E5SA 1N2CE 3BD6A 1AK1A 2Q1XA 3KR1A 3R0XA 3OQPA 1J2YA 4LHZA 2Q0HA 1Z33A 2NYRA 1VRWA 2OT3B 3F97A 5HCIA 4ZTZB 4D4KA 2HSJA 4B4UA 2D00A 1V11B 2Z5VA 4N1AA 5SYMA 1YHYA 3JQRA 4FWIB 1N3LA 4HZUB 1FP7A 4X00A 3PUXA 5A4JA 2TYSB 4FN4A 4C0KA 1C9EA 1W87A 4EZEA 3B5JA 4UCWA 4PSKA 1BN6A 1LTKA 4BPBA 1RBMA 4OXIA 1EGVB 2X4IA 3X2FA 1XPUA 2JS7A 1G38A 3H0CA 4FGZA 3VNSA 4RPIA 4IHKA 1Y89A 1ECCA 4AIIA 4Z5XA 4K9KA 1GFWA 4HDKA 1E0DA 1L6IA 1KMIY 2C58A 3HDVA 1Q5PA 2FAXA 3BGOS 5L53A 5DHAA 4JX8A 3EWSA 2HDWA 4JLPA 4A26A 4ON9A 1E8MA 1DIOB 3PK0A 5FTJA 4AY2A 1G291 1Y8QB 1FYWA 3GCZA 3QUCA 3STVA 3UMJA 1DCTA 1O96A 2ORVA 4GPEA 1GR0A 1SCDA 2ZRGA 3BXGA 2BGJA 3LRXA 5K8UA 2D13A 4DRYA 4E88A 2AXPA 3EHEA 3D3KA 4RVDA 5B3JA 3A6ZA 3ZDZB 4OI0A 6YASA 3R3WA 1SBNE 5DO9A 1YHNA 3I0NA 4DLLA 4XARA 4FINA 3GARA 1MO5A 1QHHA 3HPRA 3L6UA 3L8CA 5AJUA 3GW8A 5G02A 4FVTA 1W8DA 1ZHFA 3U09A 3T3DA 3C4QA 5BO5A 2C96A 1V8FA 2XXBA 5K6AC 2BRUC 4EG6A 5EIXA 3V00A 2A5GA 4KGXA 3RVDA 4YJHA 3U5TA 2C4UA 5TPZA 3DDNA 3CRNA 2QYTA 2VBGA 1Y6GA 5FKJA 2ZJYA 1JZTA 4KZKA 3FF1A 3B8EA 3RAGA 2QNBA 4DDVA 2BHLA 1SZJG 4M86A 3WIUA 5JALA 5L4NA 2FW0A 2QX8A 2W2PA 2UVPA 3LCUA 4MI9A 4DCTA 1CERA 4PQGA 4JHXA 4H1VA 5E0OA 4I9NA 1MH9A 4L8GA 4EJ6A 5I5EA 5DW0A 2OYRA 1H4VB 1FTNA 1MO3A 4GZ5A 1KYXA 5U4QA 1IATA 4ZN6A 1K6IA 2R96A 4C0LA 4DB2A 4TS4A 2O07A 2F8LA 4MJLA 4QUJA 4EW3A 1FFSA 2PGXA 5JSZA 2I6TA 2ZUWA 5C1PA 2JLBA 2OYSA 3GMSA 5AMXA 1V16A 3N2GA 3VFDA 1K5HA 1UFQA 3FFWA 1J5XA 2REBA 1XMJA 3EEFA 1W5AA 4FC6A 3RF7A 3V8RA 4ZICA 1HPLA 5MGBA 5AUNB 3HDJA 3OMWA 1YVUA 5BNIA 2HI0A 3KJZA 4M1KA 4Q3AA 3NBQA 5HK9A 4BVHA 3D2AA 3KKLA 4MUJA 1W1IA 4PLZA 3WKBA 4TT3D 1BU5A 2DBRA 3MYRA 1X7WA 4CWAA 4PO9A 1KI9A 4CV3A 1KZ9A 3I9JA 4I5IA 2IYXA 3BMNA 2DKOA 3IRVA 4I46A 4XRRA 5HW0A 2AC2A 2EC5A 3DULA 2O8NA 1QIMA 1UPAA 1YMUA 3EGCA 5FNZA 2WB4A 4D4LA 4PX5A 1QYRA 4F8YA 1X1TA 4P2BA 1QPBA 4PBTA 5HUJA 1RI3A 2L17A 2F4NA 2AD1A 4KIUA 2HNBA 4R1OA 2EQAA 4F8EA 2YVAA 2JLCA 2PT7A 5JR3A 4I1VA 1ND6A 2W90A 3FNFA 4NDAA 4UNPA 5H4GA 4HNTA 5L4LA 3U7HB 1V48A 1WCXA 3DPIA 1DQZA 2VF7A 3LS2A 4L5AA 1T0UA 1SUFA 1XXHE 1X1RA 1NVVR 1XU7A 2G77B 3RRYA 2XPCA 1SKYB 4I08A 1EQAA 1DC5A 3D54D 4L5CA 2RGWA 5FPPA 1RHKA 4YJFB 2OBNA 5TMBA 1NJ2A 1C4WA 1OOEA 2AEJA 3A28A 4GVPA 1ZM7A 4IFEA 2I8LA 4BUJA 4EL5A 1F60A 3TPFA 3I04A 3K73O 4UAVA 4W4TA 4BWYA 1G5PA 2VP6A 1SBTA 2OG2A 5ARDA 4EYOA 4IHJB 2ZTLA 5AHXA 3J81A 2Y93A 1OREA 2JNWA 4FUQA 3LY5A 5AM3A 2C94A 5A4MS 4UE2A 1GGNA 1T8YA 3GCXA 2EJUA 3OCJA 4JT8A 1FSGA 2ESRA 3V1UA 3GUCA 4R68A 3I58A 4EPYA 3UJPA 1N2SA 5COBA 4ADSG 3I45A 4UASA 5AQEA 3CHYA 1I7DA 3TLMA 5MF6A 4MJ7A 2W8BB 1F51E 2CE2X 3BH7A 2Q49A 1TQ8A 3AJAA 3KFXA 1UKBA 3EIWA 4LOIA 4TSKA 2XQKA 5HBRA 3VTZA 5A62A 2V8BA 4ZMBA 4OAOA 1AC5A 2MSCB 2V58A 1JG6A 3IQHX 4CT5A 5JDIC 3V42A 4OP1A 3BA1A 3GWGA 1N1GA 4JV5B 3DZKA 5KX5F 1R0LA 4OLFA 2XBUA 4IG4A 3PV0A 3NCHA 5AT1A 1B1CA 2I29A 1M34A 1ESMA 3A9RA 3DTVB 1IUPA 1C14A 1JQJC 2C7GA 2AZXA 1ISGA 1R5BA 3H87A 4JQCA 4ZEWA 2J45A 2NU9A 5BR4A 2Y0EA 4YQFA 5BN5A 5C8DA 4DR4B 3KK0A 4QBFA 2DC1A 4NYIR 5KYGA 2O2YA 2GD2A 3LC1O 2PPLA 2QE7A 1L4KA 2QMYA 1YK1A 5A71A 1NATA 2DQKA 3O4RA 3WGGA 3WLQA 1YHZA 1HZZA 5LVAA 4RA9A 1S2NA 3OFVA 4AZ0A 2YICA 2A94A 2W2NA 3OUTA 4L3WA 3T1TA 3A2KA 1GO2A 4KKXB 4UHDA 4WXHA 3U7QA 3GGSA 2VJBA 2W6JD 4Q3CA 2OCAA 4DC1A 4DV7B 1NMYA 2I1QA 3CUVA 3HCBA 4UHJA 5ETJA 2BH9A 4HH0A 4OSOA 4U5QA 4LJ5A 2G09A 5AXDA 5AW4A 2VRCD 4XB1A 4JJ8A 5D3KA 3WHLA 4OM7A 3HL0A 3FYUB 4MGIR 3OQIA 3TMKA 2G9UA 3SHQA 4F5YA 5GZ3A 1WLYA 5ADVA 1J0BA 1G59A 1YQ9A 2FJUA 1FTWA 5DNEA 1HM5A 2AX4A 1UKYA 2O0MA 2NUAA 4BFLA 2Z1DA 4YDHB 2F55A 1S9DA 3P9RA 1IZYA 2JFFA 4KXUA 3QYAA 1UZMA 2ZRFA 2W11A 3MSCA 5I8PA 4ZQBA 2GKOA 2ONCA 3PQCA 1BOFA 5LDHA 3KQUA 2FE1A 3FBGA 4ZOLF 3SSOA 4QJ5A 5FBKA 5LUBA 3D6MA 3FUCA 4AF8A 1NI3A 2Z2IA 3L9WA 4MK4A 4OKNA 4YRFA 3L7NA 3GQVA 3N6RA 4INZA 3IJEB 1V4VA 1NIPA 1U04A 1NE7A 2JHCA 3A9CA 3GGDA 1QCYA 3ZHRA 2VYQA 1DAMA 1PWXA 2HSGA 2HWYA 3CX6A 3ZW8A 1A9QA 1SPXA 1ZC3A 2BLNA 2FQXA 3A9VA 3OY2A 2SBTA 2GAFA 1WG8A 2C9DA 3FLBA 4AXBA 3UENA 4YRQA 3T3MB 2GCGA 4G5SA 4E3WA 4IOMA 4D41A 1V7PC 4RAQA 4O2BA 4CFSA 1L8OA 2HQ1A 2UXCB 4ESVA 2ZYAA 2WJ3A 2JL1A 3EW7A 2WIAA 3GLQA 3P5BA 1U2SA 2B8WA 3QNUA 4FPXA 5ENZA 3JWEA 3ZTYA 4GECA 4GOLD 3RUIA 3GYBA 3ST7A 1EWYA 4BN4A 5BY2A 2P79A 1LV8A 4M0EA 4ECAA 4KMRA 4QASA 1YS7A 2EYUA 4TL7A 4BNUA 4UBLA 3T3PB 4EMBA 1T25A 3G6WA 4FS3A 1UDCA 1OY1A 1XMXA 1G6OA 4FDVA 3VR0A 4OHRA