4TZ0A

Dead-box helicase mss116 bound to ssrna and gdp-bef
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
508
structure length
508
Chain Sequence
SKLIHVPKEDNSKEVTLDSLLEEGVLDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLINTKFDSQYMVKAVIVAPTRDLALQIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKNSKSADNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIAKQEKYEPSEEIKSEVLEAVTEEPEDISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDKLGLSRSPIGKAMFEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular insights into RNA and DNA helicase evolution from the determinants of specificity for a DEAD-box RNA helicase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein/rna
molecule keywords ATP-dependent RNA helicase MSS116, mitochondrial
total genus 160
structure length 508
sequence length 508
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2014-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tz0A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tz0A02
1Z6GA 2GK6A 3TUJC 4KFTA 1EGAA 2IK8A 1E2NA 2XGJA 2VSFA 3PIRA 3EWAA 1RC8A 1NRJB 1N5IA 1W48A 3LBNA 3J81k 3KQHA 1QRAA 3NEJA 2H7VA 4IEEA 4QHYA 2QTVB 3IQWA 1Z0IA 4ZCLA 2ZYVX 4XVRA 1GTVA 1SVOA 2HXSA 2JEOA 4OK6A 2OCBA 1UBGA 5DGXA 4BEBA 4LZZA 3GLGE 2ZR0A 2QQEA 2Q21A 4L5BA 1R2QA 2XB4A 3SBDA 3VR3A 2LCFA 2W2XA 1CS4C 1NJFA 4LC1A 1NMYA 4YMVA 1F2TA 2VP2A 4I99A 4ZPXA 3ZZUA 2CXXA 1G21E 1KKLA 3KXKA 2RGDA 4FXPA 1E2HA 2ZRIA 2CLCX 1LF5A 5FTNA 5J4LA 3VKHA 4HYYA 2IYRA 4DSNA 3WXMA 4NYJQ 1WXQA 1XNJA 5KUTA 3GLIE 5EZ6B 2HXYA 1EXMA 2CVHA 4JLPA 4Q4HB 4YXWA 4KLNA 1SXJE 3TSWA 3WMEA 5HZKA 2FG5A 2AFHE 5AJZA 1LB1B 2FZ4A 2ZRPA 1G18A 1WF3A 2CK3A 3B2EA 3VHXA 1M7HA 1ZU4A 1JALA 3GEEA 1XWIA 2BEJA 3KQLA 4EQ6B 2O0KA 2ZXUA 4FN5A 1P7CA 4Q4AA 1AM4D 4QGFA 3OIWA 2OCAA 1YR9A 3O8DA 4N0EA 2X2FA 2ZE5A 3TW4A 4PZZA 1E2EA 4KVAA 4C0QC 1HEIA 1IJEA 2DBYA 2YOHA 5TVKA 1Z22A 5CDFE 1DAEA 3H84A 2WWHA 3MUFA 2O8EA 4I1UA 3RWMB 2J7PD 2DFTA 2Z6VA 221PA 3I1FA 1DG1G 3T06B 1P60A 2OESA 2GF0A 4JBWA 1IAQA 1E1QA 2HF9A 5JI2E 2CLDX 3Q8XB 3PEVA 4BASA 3V00A 2FOLA 3OESA 5B58C 1SHZA 1H8ED 4B74A 1OSNA 1U99A 3I8XA 1DEKA 3K9GA 3GLFE 2ORWA 4EKDA 2R6FA 4Q7LA 1JR3A 1X3SA 3A1SA 1OHHD 4DCTA 1YZLA 2XNDD 5FOUA 1GNRA 2O0HA 1NBMA 2AFIE 1EFRD 3DDCA 3O8CA 4DT1A 2CNWA 1P73A 4EQ6A 1CR4A 1YZTA 1QDEA 2RGNC 2OAQ1 5G40A 1XMVA 2IL1A 2ZE6A 1G5PA 2ZRBA 1DAKA 3FMPB 4YXWD 5CITA 3QQ5A 4PAMA 2IF2A 1Q44A 3B9PA 1EG7A 5KPJA 2QBYB 3AGQA 1NVUQ 1Q22A 3AVOA 4HDQB 3L0PA 3LO5A 3QPUA 2BBSA 4A15A 3UWKA 3K9NA 2XNDA 4B3DA 2CDNA 2RGNA 2A5FA 1IONA 4WA7A 1XEWY 3QG5A 4TLAA 1N6HA 3TH5A 3U3JA 3GLFA 1LNZA 4PQYA 4UJ3A 4AD8A 1IY1A 1HV8A 1GNPA 2C9CA 4G5QA 3IQXA 3TW8B 4DZZA 5C18A 2IT1A 3FTQA 2ZYUX 2R9VA 1G8HA 4OHWA 4YDHB 1G64A 3RSLA 1VYVA 5BN3A 1XZQA 4HZUB 5D3MB 4CF7A 2J41A 2J7PA 2BBTA 2CK3D 3B1VA 3DM5A 2F3TA 3A4NA 4DLWA 3PUWA 4BLPA 3MJRA 3G5UA 2F1JA 1ZD1A 2FGKA 1E2PA 3K1JA 4JT2A 4TT3D 3U44A 3NXSA 3NBZC 5KHOC 5IRCD 2FF7A 2VBCA 4DLZA 5J5CA 4B3CA 1OH5A 4U02A 5EP2A 2ANCA 2QTHA 4TYNA 4MKIA 2FPLA 1KO8A 1DELA 4PPQA 5FI1B 4B2IA 3TUZC 5KSYA 1FQJA 4RVCA 1OXUA 3QPWA 3AVPA 4URUR 3DM9B 4R2IA 1FNMA 1FOEB 1DAGA 1GRQA 4LRWA 2O8BB 2OLKA 5CB6A 1Z07A 721PA 1BYIA 4RFSA 2REXB 1NG1A 1NMZA 2VSXA 2VYFA 4M1TA 4PZLA 3VR1A 1H8HA 2VH5R 5G53C 1M34E 2ZROA 3LRPA 1X6VA 3QSYA 3LNCA 3W9YA 3M4YA 4US2R 4FMCB 4ZCIA 1OLOA 1U81A 1R0YA 2ZS7A 1EFUA 5AJYA 2I3BA 2GF9A 3I8SA 2QMHA 4TN1A 3HU3A 1SQ5A 2X1VA 3GD7A 4XH9B 4TLCA 1MO5A 4AK9A 2MMGA 1Z6AA 3F3YA 1W4AA 2XTNA 5IK2D 4H9GA 5AK0A 5FBRB 2QE7A 3KKMA 3EW9A 4LYFA 2AD1A 2N46A 3P32A 1K5GA 4M0LA 4X8OA 1OH7A 4D26A 3P1JA 2QNRA 3A1TA 2GVZC 5CLQA 1G3IA 1YR6A 4HB3A 2Z83A 1CR2A 1JAHA 4DSUA 4JMPA 1UEJA 2HYIC 1QF9A 4C7OA 4BLQA 5IF9A 4FW9A 2XTMA 4Q1AA 5E7JA 1DE0A 5KNBA 1N0UA 4IXMA 4PR0A 3CX8A 3NWJA 4G5RA 1JR3D 2R8RA 2ZRFA 1CTQA 1XFAA 3LA6A 2QT1A 1P75A 1ZM2A 4F7WA 1VYTA 3MSXA 4B6FA 4LPSA 3KXLA 1E1RD 3MWYW 3THWB 1QHIA 4RD4A 2J0UB 4AY2A 1MKYA 2YOFA 3KFXA 4F38A 4WXPA 5CIQA 3UXMA 2VF8A 1DAIA 1JJVA 3L8ZA 1NVXQ 4TQ9A 2ZAMA 3QXJA 1GM5A 2ZYWX 2GK7A 2BMJA 4W5HA 2W2VA 1XEXB 4Z8YA 5SZJA 4YMUA 1ZYUA 2HT6A 3QKRA 3A6PC 1U98A 3K9LA 2CCJA 1DO2A 4KJZA 3GJXC 5GVSA 5TMPA 3TGPA 1J2JA 4RCZA 4B71A 1E2IA 2EWVA 5EP3A 4BLTA 4XWAA 1XF9A 1UEIA 4PANA 3CONA 5JWRA 2QRNA 3VR5A 4IKEA 4UNSA 3D3QA 1GSIA 4OBEA 2P0EA 4Q18A 4D25A 2R6AA 3AM1A 1ZNWA 4EPYA 1OKKD 1JXOA 4IFBA 2FSFA 3HR7A 3CBQA 1GDDA 3WNDA 4JLKA 1RIFA 3QJYA 4Q9JA 1O87A 2FMXA 1D2NA 2WIBA 1KK2A 2D62A 3OE7D 1FMJA 5G3YA 3B6EA 1W4RA 1XPRA 1GFIA 1E69A 3HDTA 1U8ZA 3TMKA 121PA 2YWGA 1M74A 2QSZA 3UANA 1U90A 4DJTA 4BGDA 3QUSA 4Q66C 2DYKA 2WSSA 4V03A 3T1TA 1F5NA 3IIKA 3IO5A 4UXJA 1OKKA 1T0HB 4HLUC 4PO9A 5M04A 1VHTA 4PHHA 1GRNA 5EUMA 3THYA 1W0JD 1JAIA 1JECA 4D0GA 1MO6A 5L3VA 4Q21A 1XTIA 2PX3A 3DMDA 4CEIA 3FVQA 3Q3JB 4S2EA 3LW7A 4QM6A 1H8HD 2D2FA 1IXZA 3SJZA 5CDFA 1X1SA 1D2EA 3L2OB 4WAUA 3LAWA 4IW3B 5HZHA 3W6NA 3AKEA 4DSTA 4EIWA 4B73A 2HCJB 3AVXA 2EFHB 4RFSB 4LHVA 4OK3A 2AR7A 3KXIA 4PTLA 4JJKA 1VIYA 1MRSA 2A9KA 3IHWA 3KDSE 3QKRB 4FMDF 5FI0B 1ZINA 3AVVA 1TQDA 1XPOA 2IXGA 3AGPA 3IKJA 4V0OA 1Z28A 2IYYA 3CR8A 2NPFA 5FTKA 3EZ9A 3I32A 1FQKA 1KDPA 2B8WA 4MUBA 5CJPA 2IYWA 3CX7A 2DCUA 4QGAA 1KDOA 1C4OA 1SXJC 4TYQA 2H92A 2QTFA 2P5SA 4BLSA 4CGZA 2ZRHA 4UNPA 1TUIA 4AI6A 3QKUA 1CR0A 421PA 4LBWA 3AUYA 2O52A 3EC2A 4IOLA 5FPKA 3UK6A 1VCMA 4DEXA 1LV7A 3RS3A 4TMZA 2QSYA 1K8RA 3IDQA 1QG4A 4DLXA 3LQQA 2O8DA 1KI1A 1Q1BA 3AQ4A 1XDBA 1CIPA 3AP1A 2WWGA 1E9FA 3RRMA 3B60A 821PA 1G8YA 1OYYA 4HAWA 4HI0E 3I4LA 4QRHA 4TSFA 5LB4A 4TTRA 3H4MA 3SI7A 2XX3A 1CU1A 1ESMA 2B6HA 4OI4A 3LXXA 1FFHA 5BYKA 2RAPA 3ZGXA 5GVRA 2R6GA 3EXAA 4QBGB 1SXJD 4B48A 1AS3A 2D2EA 2GCNA 5B64A 4Y0AA 4A2WA 2GXSA 1AQUA 1E2MA 4OQMA 2A2ZA 5DI3A 4KODA 4B76A 2HT1A 2FU5C 2GBLA 1PLLA 5KNCA 2J0SA 2XSZD 3W6PA 2ZJ2A 4W9MC 4RZ3A 1YKSA 5JMTA 2BMEA 1PZNA 4AYXA 1XRJA 1NNEA 3ZS9A 4H1VA 4GI7A 3VFDA 3GFTA 4FWTA 5JJIA 2FA9A 2QPAA 3NHAA 5KPDA 4G5SA 1TQ4A 2WWIA 3JVUA 4XTRA 1NP6A 2PZFA 4D80A 5FR1A 3TSZA 3BH7A 4F91B 4PSKA 1Z29A 4LJ9A 1XD2A 2Z4SA 1R0WA 2QN6A 1GWNA 2JJ1A 2W2TA 2RHDA 2W6JA 3LD9A 1MR3F 2WIAA 4P32A 4QJ5A 2CE7A 4CIDA 4ZV4A 4L15A 2EU8A 3RSOA 3AVQA 1OFTA 4LBVA 3W8RA 1PUIA 4BFVA 4N0DA 3ZJYA 4ABYA 2FWRA 4LJYA 4EJSA 2PZGA 4RFVA 3HWSA 2NG1A 3ZQ6A 4TL9A 1JI0A 1W0JA 4B3GA 2ANBA 1K5DA 1XTRA 2XJ4A 4QFMA 4C30A 3U7GA 2NTYC 3VHLB 2W83A 1KO1A 4YC7A 5B2ZA 1R8QA 4URZR 2ODNA 4L9SA 1UKVY 1Z0AA 2QI9C 2PLRA 3B1WA 3JZMA 1FMLA 2H16A 2Q0HA 3CH4B 4TQUS 1E32A 1F2UB 1UKZA 2CE2X 1CBUA 1UADA 3EWSA 1TAGA 2IS1A 3PUYA 3QKSA 1ZCAA 1EX7A 3B1ZA 3B1XA 4OJKA 2ORVA 4HUQA 5CIWA 3K0FA 5GADl 3EPLA 2RB4A 1DAMA 2WKPA 4I1VA 5LBIA 3SE0A 1ZRHA 4M1YA 3S1AA 1ZD8A 3SJAA 4S35A 1TADA 4Y0VA 5JS8A 4DCSA 4Q00A 1Q0UA 3NVAA 4HB0A 5J4YA 2FV8A 2PX0A 4PX9A 2IHYA 3T12A 3BFXA 3WMGA 3U4QB 4OQLA 4JLJA 3MCAA 4Q1EA 4PPNA 1PV4A 3LX5A 3LLUA 5CLLA 3AH8A 4XSHA 1UKEA 2PT5A 3PVSA 4M9SA 3OIUA 3KUCA 3DZ8A 2O5VA 3LBIA 1LW7A 3LDAA 2ZUBA 4BFYA 1Z83A 2QAGB 3N2IA 2CJWB 2I1VB 5FFMA 1GL7A 5IHPA 3OEEA 4HAXA 4QHTA 4B6EA 4G01B 3P4XA 4C0HA 1HA3A 1G3MA 2AXPA 4IVRA 2QZ4A 4QM7A 3CR7A 4Q1FA 5JWOA 2UKDA 1QHSA 2AL7A 1LF0A 4EFLA 3W5IA 2UZIR 5FTMA 3GEHA 3K70C 4D81A 3OFND 4M8NE 4A6XA 3W90A 1E3MA 2O0JA 4FI3C 1E94E 1RJ9B 4B44A 5FBVB 3L8YA 3NTUA 2RGEA 2CLSA 1GRRA 3IIJA 2GHIA 4EJSC 2W58A 2ZITA 4Q7MB 5FR2A 3HYTA 2CCKA 2WPDA 3AP2A 2J0QA 5FTLA 3WMFA 4YLGA 1W36D 4C2UA 1II9A 1VG8A 1OT3A 2GJKA 3LVRE 4GBMA 4M1WA 2VSOA 5TXGA 3R8CA 1JXMA 1R5BA 4F4CA 3REFA 1QHNA 1SVKA 2OT3B 2PCJA 1GL6A 3GJ3A 3C5CA 3VKWA 2AK2A 4A6PA 4LJ5A 3PEYA 1PLJA 4F4JA 3A1VA 2P5TB 5KDDA 2CHVA 4MRRA 4A36A 3LY5A 1G16A 2ZUCA 4O25A 2BKUA 4QGHA 5FPSA 3A36A 1NLYA 2BKEA 2IYTA 3NDPA 1ETUA 4FCTA 5F9HA 4MQBA 3EG5A 3QXCA 4M1KA 1NG9A 1G9XA 2R6DA 1KNXA 1Z08A 2AWOA 4PAQA 4PC3A 4Q1BA 5FBWB 1VPLA 2GA8A 4ACBA 4C0AC 2L0XA 4HZUA 8OHMA 1G7CA 4Q7JB 3U61B 2O8CA 3OIVA 1QHGA 2VA8A 5KYKA 2OXCA 3KKQA 2WWWA 4EPVA 4BRWA 2VO1A 4JYBA 3EARA 4MGYR 4DCNA 1MV5A 3KL4A 1RW4A 1OH6A 2NZJA 3LX8A 5DH9A 4XWKA 2QEQA 3ETLA 1M1YE 2AXNA 2OBMA 2VQSA 1AS0A 4NU0A 3TRFA 1DG3A 5FL7A 4A8JB 1TUEA 4BPBA 2GEUA 4JBYA 4M9XA 1EFRA 1E2QA 1TF5A 2BM0A 3T5DA 5KSOA 1ZAKA 2ZR9A 5DNYB 3TJZA 4KSCA 4BECA 1KMHA 4O2RA 2QT0A 4M1OA 4Q02A 4P4UA 2WKRA 4W5WA 1JPNA 1H8EA 1VCIA 2IYUA 1GKUB 2BCGY 3T35A 4Z54A 2HV8A 2JGNA 4MGZR 2IYLD 1S3SA 2C9YA 2VPPA 1GG2A 4UNNA 2ZJAA 2HYDA 2JJ2A 3R20A 1KZGB 3EPJA 3V4RA 5JJLA 1ZC4A 2DHRA 1DARA 1TX4B 3AB3A 4P0TA 4UNRA 2OBNA 2ATVA 1ZM4A 4GL2A 3SHWA 1YZQA 2I4IA 3EZ7A 3BS4A 4KFUA 2QP9X 5E95A 4CZ2A 1W0KD 2GBLC 5ANRB 5C4MA 4NONA 3VAAA 3KKPA 2DY1A 4WZAE 2E1RA 4TT3A 2AKAB 2Q9BA 3B78A 3P4YA 4DBLC 4ILEA 2WKQA 4A1FA 3A37A 1XD8A 1OYWA 1RRFA 4B33A 4C0JA 2KB0A 3PXGA 2EVWX 4CEJB 2IXEA 4MRNA 5FOVA 5L3SB 4DLVA 2F43A 3EPKA 3SYLA 2ZRKA 3FMIA 3N70A 4JLOA 1CJVC 4OHZA 5DHFA 2RGCA 5JBQA 4ZDKA 3MFYA 3AV0B 4JS0A 4PO8A 1WDTA 2QBYA 1ESNA 1FL9A 4FINA 5J40A 4IOKA 1CR1A 1T5IA 1OXSC 2F6RA 1QHYA 1XEFA 1AA9A 2B8TA 4MDEA 4DLYA 1XMIA 5FPHA 2FSGA 2ECKA 5CM9C 1MT0A 4BZXA 3OFNA 1IN7A 3U3MA 1AKYA 3BH0A 4O3MA 3U3KA 4TL6A 2N42A 3QF7A 2F9LA 1UDWA 3NBYC 4DDWA 4QOSA 2NGRA 2OO7A 4GMXA 4DWJA 3KQKA 1R8SA 4URWR 4UXIA 1Q57A 2ZSBA 4LOAA 3U3OA 3JZAA 3AVYA 2NO1A 1NF3A 1Y63A 1FPMA 1EWQA 2OCPA 1N5JA 1XMJA 1XMSA 1ZP6A 3FKSA 4ZI2A 3SC3A 5AJWA 3SJBA 1KO7A 1TMKA 2ZI3A 3BBPA 1FNNA 2IS4A 1M2OB 1W47A 2RCNA 2W6ID 3REGA 4ARZB 4I1OA 2Y8EA 3KJEA 5IDVA 4LYHA 3FFAA 1II8B 1US8A 2D7DA 2OLJA 2C95A 3UATA 3CIOA 2GVDC 3PITA 1BYUA 5H1YA 4A4DA 5JRZA 2QMOA 3T5GA 3FKSD 1JR6A 3WYGA 4GDFA 2I1QA 2V8OA 1G1MA 3CF2A 4OI2A 2XZPA 2FEOA 2GAAA 1IXRC 2Q9AA 4X8LA 1NN1A 2ZI7A 2Z5FA 2X77A 3CPEA 4XD7A 1U9IA 2V6IA 3I73A 4KFRA 4P3YA 3LVQE 3UPUA 1RFLA 3WP0A 1A2KC 1AKEA 2J59A 5GJWC 3I72A 3TKLA 2QORA 3SYNA 1P3JA 4EPTA 2H57A 3SEAA 3C41J 3KKOA 1XD9A 4NCJA 3JVVA 5EQTA 5HCIA 4B47A 3Q7QA 5EE1A 3ZIAA 1T91A 2HJVA 3LFUA 4UXHA 5AJXA 5HCNA 2JLSA 3DEFA 1TL7C 2DWQA 2WOOA 2J0VA 1G19A 3GLHE 4D6PA 4XVUA 5EJEA 4KAXA 2XOKD 4LHXA 2FN4A 4DHEA 5DYIA 1X8JA 2EFCB 3DO6A 1JEEA 1KJWA 3LV8A 3IGFA 4NYJR 2GDJA 2GRJA 5DISB 2ZPTX 3RNLA 4A92A 2YC4C 2J0UA 2ZUDA 1FP6A 1GP2A 3TVTA 5KSZA 1J70A 4GSYA 3IPXA 1EWRA 4KV9A 2W0MA 4LJAA 1P9WA 1IY0A 4A8JA 5EE9A 1Q1QA 1N6RA 5C4GB 4BUJA 4PHFA 4L4UA 3RRNA 3NDBB 4KSBA 3OEHD 2JIZD 2QAJA 2W0SA 3TUIC 1KI6A 4LHZA 4MRPA 5FPTA 1VG0B 4HLUA 3HJNA 1XTJA 2IS6A 3ZVMA 1RZ3A 1VCNA 2C8VA 4LV8B 1E9DA 1AGPA 1NKTA 1U0HC 2YWEA 1UFQA 3BE4A 4MUAA 2R44A 4PC1A 4ON9A 5JS7A 2OSBA 3EA5A 3TAHA 1D6JA 1SZPA 2BVNA 2IEYA 4LBZA 3U3RA 4OKSA 3F5FA 2ZSDA 1SKYB 2IXFA 3ASZA 3IIMA 1QVRA 3U7EB 2GXUA 1E2FA 1W4CA 4JYCA 2HJGA 2NO9A 1J7KA 4LY6A 4Q4LA 2YYZA 5CYOA 2IYXA 1BH2A 3C8UA 3D8BA 1N5LA 3PEWA 2SHKA 3IILA 4POAA 1Q12A 1OHHA 4EPWA 4LC0A 3MAAC 3T34A 1W5TA 1IQPA 2XOKA 1A4RA 4CYMA 1Z0DA 1CJKC 3D6TB 2BV3A 3RDPA 1F48A 1T4GA 4D4LA 5JSZB 2GZDA 4LI0A 4B43A 2YJTD 4UQOA 3C5HA 5FTJA 2VP9A 3CLVA 3FMOB 1E79A 3I5XA 2KWIA 3THWA 1VHLA 2N1BA 1NIJA 1OFIA 1HE1C 4Q1CA 5G3ZA 1KI8A 5AUNB 4KITB 4EUNA 1P72A 1E0JA 4UJ5A 2JLWA 2B7BA 3FOZA 2EFEB 1KTVA 2ZJOA 3CH5A 3K0AA 4YONB 3AVWA 4GZLA 2GNOA 4AYTA 1TPZA 1TEVA 2BHRA 1GZSA 4XTCS 1Z0JA 1CRPA 4C0KA 3IBGA 2FPKA 1BMFA 3LQRA 4JL8A 4JL5A 3U2QA 1QVAA 2GESA 2PEYA 1KI2A 1ZNYA 1BO6A 4QKQA 3QIAA 2BDTA 4X8MA 1YRBA 2DPXA 2JA1A 3PJRA 4V02A 2IS2A 3H2YA 2VP5A 3BC1A 5DHAA 4RCYA 4CEHB 1AZSC 3VR6A 2G0TA 4B2PA 4V0KA 3TSOA 4WBSA 4GNKA 3C15C 1OW3B 1E2LA 2JDID 3QENA 2C99A 3SYKA 2W00A 1KJZA 2ZI4A 3L82B 1Q20A 2WZQA 1NBMD 1MH1A 4C7OB 4D0NA 3TNFA 4JVSB 3VU9A 3VU9B 2GZAA 4EJSB 1WBBA 1EK0A 2GETA 4RD6A 1TU3A 3KJIA 2J9RA 2ZR7A 1HUQA 1N25A 2V7QA 4EFNA 2QM8A 2GILA 4V0LA 1S9HA 3I61A 5E7MA 5F2EA 3IBYA 5JCPA 2J46A 3SFZA 4PSVA 3FHOA 4XOIA 4OQFA 4A2QA 2GEDA 1AZTA 4CEIB 4Q4AB 4WOPA 4OI1A 2JLVA 1N0VC 3ZZ0A 3MLEA 5LPNA 4US0R 1A1VA 4DEYA 4BFZA 4DT1B 5JEEA 1G3QA 2E9SA 4HDOB 2ZEJA 1UBFA 3SNHA 4R98A 3QXHA 3CO5A 1KSFX 5TARA 4DIDA 2QAGC 3E1SA 1SVLA 1WA5A 4G1UC 2V9PA 2OM2A 3THXA 2A7QA 2IBMA 1W1WA 1ZUHA 5FL3A 2IX3A 3GLIA 5KU1A 5BN5A 5KDLA 1E9AA 4NZYA 1F6BA 3H86A 3GCGA 2CL6X 1II8A 3CRQA 3KB1A 3FKQA 4M2LA 4ZI3A 3KQUA 1KI9A 4URVR 4HB4A 5FH9A 3Q5DA 4NCHA 1AIPA 3T1VA 4IOJA 2PZEA 1NLFA 1E2DA 2ZU6A 4L16A 1I4TD 1KAOA 2HDNB 4M53A 4KVGA 4QHSA 5K8UA 4TZ6A 2IWHA 3AVUA 1N6KA 4ZKDA 4MKFA 1QZXA 1VDZA 2FGJA 4NE2A 5B30A 3CWZA 4CVNA 1EFTA 4TQAA 2QPTA 4NMMA 1JPJA 5AUQA 5FOXA 2A30A 5GJVC 1P2TA 1DS6A 3VX4A 2XJ9A 2CNWD 2IUSA 2JJ2D 2WWXA 1HT1E 4DDUA 1LFDB 2FFBA 3UIEA 3ZLJA 1XXHA 2ZTSA 1CKEA 2J1LA 1XX6A 5GJCA 4M1SA 5HTKA 2V7QD 5DI3B 3SZRA 5K8IA 4MYUA 3D31A 1B0UA 1QHHB 3KTAB 3RS7A 2OFOA 1XJCA 2GKSA 3X1DA 3K70D 1BS1A 3FE2A 4F92B 4BLRA 4MYHA 1Z2AA 5JEDA 3U4QA 1CP2A 2FZLA 4PAOA 1L2TA 2WSSD 4DCUA 2NPIA 1GOTA 1CJUC 3MD0A 5E7IA 1CLUA 2REBA 4DLUA 2FNAA 6Q21A 3CPHA 2ZRMA 3ICEA 4NKRA 4TSFD 1HE8B 2YOGA 5F9FA 4MDFA 1M7GA 1Z3IX 1U0LA 2UVQA 3B82A 1TF2A 2PCLA 3EASA 2WJVA 5E3HA 2GCOA 2BBWA 2KSQA 4A82A 2MMCA 2VTKA 2WJGA 3PENA 4EFMA 3CW2A 3M0EA 3WBKA 3NH6A 5KOYA 2VL7A 4Q9HA 1TQ6A 4BWYA 3GFOA 1XEXA 4IXNA 1V43A 2WJHA 2IUTA 3QF4B 2ZJYA 2BCJQ 3W8NA 1WE2A 3IPYA 2NO6A 2WV9A 4QBFA 1LVGA 2VEDA 1OIXA 3OZXA 3TLXA 2VHTA 5FOWA 3RABA 1E98A 2ZRLA 5GJBA 4Q7KA 4R2HA 1CRQA 1RYFA 1UJ2A 2MSDB 2VHQA 2ZS8A 4TLEA 4PO1A 4AKGA 3KKNA 4NCNA 1LS1A 1Q1EA 1Z6XA 3GJ6A 3RVBA 4LYJA 1CJMA 1S0UA 2JCSA 4RSGA 3BFVA 3SHFA 2J87A 1SVMA 2QAGA 1T8UA 1W2HA 1JEDA 1UF9A 1WP9A 3K8YA 2V1UA 4H1UA 2XNSA 1KSJA 5CK5A 4BZQA 4YDSA 1NLZA 2D4HA 5AWFC 4LJ8A 5JFGA 1NIPA 1IM2A 3AKYA 1NL3A 2RGGA 1MABB 5JJKA 1FUUA 3WP1B 1G5TA 3FWYA 5FUXA 1VG1A 2QENA 2WOJA 1JQJC 3VX3A 3KFVA 2RH5A 4B34A 1VTKA 3ND9A 1HT2E 2QG6A 2IYZA 3AF3A 3U44B 3NC1C 3ZQJA 2J45A 4C4PA 4I81A 3CM0A 4DUGA 1GITA 1Z8FA 2ZRCA 3B13B 3EC1A 3ZZTA 3BOSA 3MMPA 4QL3A 2FJUA 1D2MA 1JJ7A 3X2SA 3EX7C 3E70C 1KZ7B 3CWQA 3G0HA 4EPXA 1Z06A 1NSFA 2AD5A 3FYHA 4LJ4A 5D3MA 4ZDIA 3QKSB 2V3CC 1XZPA 1ZVQA 2G3YA 1KSGA 3AKDA 3ZD7A 1SXJA 2GJ8A 1KK3A 1SXJB 2F55A 4PFSA 1XXHB 2QRZA 2CJWA 3CZQA 5JSZA 4A2PA 1MOZA 1FTSA 2PLFA 4M1MA 1SHKA 3W3AA 2AWNA 5JHGB 2XB2A 3AVTA 3R7WA 2XSZA 1Z63A 3W34A 2F43B 3I3SR 3P20A 1R5NA 4RJLA 3FHCB 4MRVA 3V9PA 4KXFB 4Q9LA 4HLQB 3C14C 2NZ8A 1E99A 3A1WA 3AEZA 1R6BX 1X8LA 1KOFA 1KIMA 4E03A 1F2TB 4JLDA 1BIFA 1DAHA 1LTQA 3TE6A 4GOXA 2ORIA 2LWIA 1IN4A 4LK2A 3GP8A 3RC8A 2BJVA 2ERYA 3EZFA 5DE3A 3KZ1E 4KO8A 1KI3A 2JAQA 3ZD6A 2ZAOA 3GLHA 4D4MA 1G6OA 4LV5B 1ZU5A 2DFNA 1VIAA 4QGGA 2ZU0C 3NHBA 3NG1A 2OAP1 4G5GA 4OHVA 2ODEA 2C98A 5FBLB 2JLRA 3ZDQA 4F93B 3TK1A 5A4JA 5FOTA 3A4LA 3BRWD 5DLQC 3FPAA 2GEVA 2F3RA 1T0JB 2WTUA 3UMFA 2KJQA 4OQXA 3MWLA 4ZCMA 1KO4A 3FB4A 4B2LA 3EZ2A 3GJ8A 2EFDB 1NKSA 1GKIA 2IC5A 4LX0A 5D3QA 1L4YA 1XCGB 1HQCA 1KDTA 1IOZA 3GJ5A 4JT4A 5JHHB 1A82A 3M6AA 1GVNB 2HLDA 1RYHA 1Z0FA 3GJ0A 2V4ZA 1Y3AA 3TR5A 3K0FB 3NH9A 4TTQA 4YMWA 5DIFA 3RS5A 1P2UA 4D4JA 4WW0A 4U7DA 4NBSA 4O0MA 2CL0X 1KK0A 2YWFA 2ZRGA 4QJ3A 2FDCA 1AN0A 3UG6A 4B75A 1Q3HA 1YHNA 4DLRA 2IHBA 2P6NA 4GP6A 4JVLA 1XTKA 4TL7A 1BMFD 4JSYA 4M22A 1AQYA 2GCPA 3DOFA 4YMSA 3RANA 5IK2A 1X86B 4AURA 4DUGD 4OL0A 3A1UA 1KNQA 1OXTA 4LV6A 1VG9B 3OHMA 2IA5A 4J0QA 2QY9A 4HSEA 3X1WA 1M8PA 4IEIA 4DDTA 4YQFA 2WWFA 4P31A 4P4SB 1S2MA 4TYPA 1COWD 2ERXA 5H70A 2WICA 4DVGA 2C04A 3ADKA 4AWXA 1U94A 1ZCBA 4GOJA 3NEYA 4CEJA 4FMDB 2WBLC 1ZUNB 2BOVA 1E4YA 4IVQA 2JLUA 2JLXA 2ZIAA 1XEWX 2XAUA 2V1XA 5KTYA 2EYQA 1TNDA 1MABA 1OFUX 1ANKA 2Q3HA 2PT7A 3VNUA 3EZ6A 3GQBA 2HUPA 2QROA 5SZKB 4NYMR 4TLDA 2R65A 2XZOA 2ODWA 4Q19A 2GJ9A 1GIAA 2C5LA 4LHYA 4G0NA 5K8TA 2B92A 4G5OA 4ZDJA 3UWOA 2W6JD 3DKPA 1Z47A 4ZIRA 1W2GA 2C78A 2RGAA 2ZSFA 2HLDD 4FMBB 2YKGA 3LXRA 4M21A 1W4BA 3ZIAD 1XB2A 3GPLA 2NIPA 3QNUA 2XEXA 1ZD9A 1VMAA 3B85A 1KHTA 3WNBA 1WQ1R 521PA 3C7KA 1DTSA 4XD7D 1N6IA 2RGBA 3N2EA 1M7BA 3O8BA 4JLVA 4PHTA 2KBEA 5JLJA 4GRAA 5L3SA 2C03A 3L0SA 5EUQB 3VQTA 1P6XA 4JKIA 2DWPA 3A58B 3U7HB 1O3YA 4JKYA 3ICQB 3RLFA 2IEZA 2CVFA 1KI7A 1ZJ6A 1ZNXA 4IDPA 3UMRA 3R8FA 4L8GA 1T5LA 1RPZA 4PQRA 1R7RA 1DBSA 2AN9A 3VTKA 5B57C 1S4QA 2FPMA 3QVVA 5J4KA 1SKYE 4IDHA 3TBKA 2WJJA 1AJEA 2ZSEA 3U5ZB 2FFAA 1FUKA 2ONJA 3WBJA 3KQNA 3TR0A 2OV2A 3CX6A 4FMCF 1E2JA 2GZHA 3IHLA 3OEHA 4IRUB 1N5KA 1P62B 2X2EA 3GMTA 3VKGA 5F98A 1HQYE 1P9RA 3HR8A 2IF0A 5LDDC 1WRBA 1HY3A 1W49A 1R5OA 2A78A 1G17A 1DPFA 2JLYA 1WB9A 1A5TA 2RGXA 3BGWA 4XJXA 4Q01A 2G83A 4NCKA 1R4AA 4PQFA 1NBME 3UMSA 4EDHA 4CT4B 3CRMA 1FW6A 1P4SA 1FX0B 1G291 2QMUA 3EIHA 2KI5A 3RS4A 1XD2B 1GL9B 1ZM3A 2WM9B 3K0CC 3CUEF 3L0IB 3TQCA 3QBTA 4HB2A 1HTWA 4OHXA 4C0BA 1E9EA 3AUXA 1E2GA 5H8WA 1IN6A 3PG5A 4MH0R 1KSHA 2O8DB 4BFSA 1RVDA 3ZVNA 3QKTA 1S96A 4TWZA 2NMVA 4DLSA 2ZANA 1E9RA 2BC9A 1UAAA 3KTAA 3SDZA 3RHFA 1N2CE 3SQWA 4DB4A 2ZI5A 1WMSA 3HP1A 3LH5A 4TZ0A 2X19A 4BQSA 1BKDR 3DZDA 2F7SA 1EX6A 4CW7A 3T15A 5UKDA 4NH0A 3U6BA 2GWHA 2ZQ5A 5CK4A 4TMXA 2H5EA 2R6CA 1DO0A 3QOFA 4GPTA 4QNRA 4KYUA 3CPJB 3SS8A 3K9HA 4AKHA 1E2KA 2ZE7A 4DKXA 1LY1A 1T3LA 1UDXA 2GXQA 2BBOA 2ZRNA 1IN5A 2ASEA 4W5JA 1G7RA 1RE0A 1QHHA 1S1MA 3CRW1 3SBEA 4HUTA 2AKYA 2D3WA 4DRZA 1AGRA 1YQTA 3PUXA 5KNDA 2CL7X 4GOKA 2V54A 1B23P 3MGCA 2A5GA 4QC2A 1KDRA 1P2SA 2O8CB 4RZXA 2K5UA 1E9BA 1N6OA 3QG1A 4Q4JB 1KI4A 5J47A 4AG6A 1NI3A 1IXSB 3THOA 3PEUA 1YJ5A 3Q5EA 4KYIB 4GP7A 1E0AA 1YE8A 4XVQA 4FWIB 1XXHE 3UG7A 2XTZA 1ZBDA 3KJHA 1XCPA 2Q9CA 3A8TA 3BAFA 3CNOA 1OJLA 2FFQA 3BK7A 3CZPA 3X1YA 2EYUA 4FCWA 4KFSA 4Z51A 4JLNA 1IN8A 4E22A 4Q5IA 1W46A 4ZDWA 2WVJA 1U8YA 5TV2A 2LKDA 2VP6A 3U6KA 4JLBA 5EP4A 4EAQA 4RKFA 2OUKA 4GZMA 3QEOA 3CNNA 3KX2A 3W6OA 5JECA 1N6LA 4MYTA 5DN6A 4Q48A 2ZE8A 5FPYA 1KAGA 2G1JA 1YZKA 2AK3A 3H1TA 3LLMA 3PFIA 5HKKD 2XXAB 5AR1A 2ZVPX 2GTPA 3T1QA 4C0LA 5P21A 2NQ2C 2WAXA 4JLAA 5L3QB 2ONKA 1J8MF 1DOAA 2QGZA 4NPHA 2WMOB 1GKYA 3EIQA 1W0KA 3K09A 1TQ2A 3B7GA 3O47A 2YVUA 3CKLA 2DB3A 2Q6TA 4JJZA 4KI0A 4RD2A 1YR7A 4ASUA 4TTPA 5FBQB 4HLCA 1YRAA 3F0TA 3ADBA 1D5CA 4BFXA 4I1SA 2W6IA 3OF5A 3N5CA 4NYMQ 2AX4A 4KLZA 1FZQA 5HE8A 3VMFA 4V0MA 4US1R 4PHGA 1G20E 1U9IC 3IUYA 3SU8A 1Q1ZA 5BN4A 4K8OA 2CHGA 2QP4A 4AIIA 3GLGB 3B8HA 1D9ZA 3PCRB 4AKEA 1S3GA 1NVVQ 4HDCA 4PXAA 5DSZA 3K0AB 3ZYCA 5K8LA 5BXQC 2JASA 3PV0A 4JBXA 4CEHA 2B21A 4LPKA 2ZETA 1SGWA 4E07A 5L3QA 2MSEB 1GUAA 5JZVA 3DVLA 1G3RA 1Z0KA 3PUZA 1K6MA 1Z2CA 2QM7A 1OH8A 4DXAA 2Z0MA 3QXXA 1FTNA 4IOMA 1OXVA 1XU4A 4OYHA 4ZO4A 3CF6R 3WRYC 1ZM9A 2IW3A 1G3UA 1NJGA 1J99A 2HF8A 2C77A 2C9OA 3GFPA 4QJ4A 1DVRA 3CRRA 2FX3A 4V0ME 1OB2A 5HPYB 5AUOB 3Q9LA 4NDZA 2O8BA 2EW1A 1KY2A 5CB8A 3QEJA 3AP3A 3GEIA 2ZRDA 1NN3A 4DCVA 3BD9A 1ZIPA 2WSMA 1FP7A 5LD2B 2A5DA 1MO4A 1CXZA 3X1XA 1F3OA 1CF4A 2A3RA 2NOAA 4Q47A 4LSGA 4BFUA 3KJGA 1TTTA 2CEAA 3ND8A 2ZRJA 5FOSA 1SVWA 4U5XA 5A0FA 2P6UA 2QPOA 4Z8XA 4A9AA 5CJ2A 2QMEA 4LGMA 1G5RA 2YC2C 3LBHA 2FEMA 2P65A 1N6NA 5EE3A 5EXPA 3HYRA 1Q3TA 3RC3A 3HU1A 3ADCA 2KE5A 1KMQA 4MRSA 1XBTA 4WIAA 4YMTA 3EA0A 4EPRA 3OIYA 1AS2A 1LS6A 5EXSA 3PR1A 4D82A 5BWMA 3DHWC 3GLFB 3BIFA 5HKKA 5HR5A 3WYAA 1WBDA 4R71A 1XPUA 1IJFA 2A5JA 4KU4A 2YZ2A 3WHKA 2HCBA 1S1CA 1OPXA 3SFVA 1XTSA 3R9IA 4UKDA 5DYGA 2F1RA 1NMXA 1Z5ZA 1VYUA 4MITA 4NP6A 3RS2A 4Z1MA 5C1BA 3BB3A 1XP8A 2TMKA 5DO9A 5EE0A 3NIBA 1KI6B 2ZM5A 1UKYA 3PUVA 3NBFA 4C0SA 1RRCA 2EQBA 2QE7D 2P67A 1XJ0A 3KB2A 5EP1A 3ZH9B 1G8FA 1T9HA 4LYAA 1I4LD 5AUPB 4K81B 3SR0A 4JIMA 4TMWA 1W36C 3ADDA 2WJIA 4FIDA 4OK5A 4WVFA 2CBZA 5SZIA 1NVWQ 4Q4HA 2VLIA 4PZYA 4PPGA 1FX0A 1E0KA 1HURA 4O2LA 4PC7A 4R7ZA 4WZBE 4LCBA 4RKEA 1R0ZA 1ZW6A 2NO7A 2WWYA 1IY2A 1ZMXA 3DL0A 3HPRA 3L0OA 2PMKA 4NL4H 2ZI9A 3CRVA 3BJIC 2VIIA 1XCMA 3F8TA 3FFBA 4G3XA 4IDNA 5H68A 3T61A 2ZJ5A 1GILA 3WHLA 2YNMA 2BMDA 2IWRA 1F60A 1U2RA 2HEIA 2FH5B 2UZ3A 1YR8A 1OE0A 3CNLA 4JVMA 2OZEA 4JSTA 1R0XA 3THXB 5KSPA 3D7MA 1N0WA 1NN0A 2XITA 2WHXA 1OF1A 2F1IA 1JB1A 3R9WA 3B9QA 3Q85A 4RD0A 3FMFA 2ODBA 2DFKB 3I5YA 1ZM7A 3EAQA 1N3BA 2PMDA 4XSGA 3WNCA 1E9SA 4AKIA 4MYCA 4X8HA 3OEED 4N3NA 3U60B 2DR3A 5DN6D 1Z6TA 4B3XA 3MJHA 2ZI6A 1W5SA 4A0RA 1US8B 1OFHA 4D0LB 2ZSAA 3ONWA 3AKCA 1RRPA 3W3ZB 3AF1A 1RKBA 2OILA 4A0HA 1X1RA 1SVIA 2R2AA 1DAFA 2H17A 3OAAA 5FUWA 3P26A 1PUJA 4P4SA 3RRYA 1VCOA 2P2LA 4BFWA 1GAJA 3MWJA 1VKJA 1UM8A 4P33A 3B5JA 1L8QA 1QHXA 2PEZA 4E5UA 1E9CA 2J7KA 4ERNA 3GLHB 3K53A 2Z4RA 3QE0A 2ZS9A 2VHJA 1GNQA 1OIWA 4DIEA 1Z6YA 2G88A 3BH6A 1JQLB 1OV4A 3U7FB 1T6NA 1W44A 2JATA 2VHCA 3QVUA 3DOEA 2JLQA 3K0SA 3DMNA 1YZNA 1JR3E 4HZIA 4QXAA 1ODFA 3BXZA 4F4IA 2EFGA 3EPHA 2VF7A 4CT5A 3K70B 4AG5A 3TAUA 1TU4A 2VP0A 3BORA 1ZIOA 5FUYA 2XXAA 5G41A 1YU9A 2ZYTX 4ESVA 3MG9A 2FFHA 4A0GA 1UPTA 3ZS8A 5F3WB 4Q9KA 4TYWA 5SZHB 3VR4A 4B35A 1DADA 2QL6A 3TVDA 1E1QD 1G8GA 4TMKA 3BB1A 4ESHA 3VR2A 4XWOA 1J8YF 2GAOA 2MSCB 4Z1MD 3AF4A 4PSAA 3GLIB 1I2MA 2OE2A 2OEPA 2VP4A 3E2IA 1I2DA 3BB4A 4IDOA 3R9XA 1KJYA 5KO2A 4KBFA 4JLMA 1D8TA 3GJ4A 2IUUA 3THYB 1JBKA 2V55B 1G6HA 4IFEA 2ZREA 2H8KA 1HH4A 1A2BA 1IBRA 2QQ0A 2AHOA 2OBLA 3LWNA 4MGKR 4ZKEA 3TQFA 2P3SA 4BZPA 3SN6A 5JRJA 4C2TA 4DC9A 3IEUA 4MKHA 3WRXC 1KK1A 2DFLA 3NKVA 4BEJA 1CEEA 1PJRA 1EESA 4LUCA 2D74A 4II7A 4HATA 1P61B 2D06A 3QPVA 4BLOA 4DDVA 1TF7A 2ZVQX 5FUVA 3ZVRA 1C9KA 4LWZA 1I4DD 4NYIR 4RZ2A 3AF2A 1J90A 4LJ7A 5BQ5A 2IYVA 4HAYA 3RS0A 2RMKA 1UBEA 4A8JC 3S1AB 2PH1A 3MWKA 4HLDA 3ECCA 1YZGA 4L9WA 2QU8A 4BE7B 1AK2A 2KBFA 4M9QA 5L8VA 1OXXK 1S9DA 4GFDA 2JJ1D 2ZJZA 4UNQA 5EXXA 3V4FA 1EFCA 5DI9A 3C16C 3LW8A 1W7AA 4B32A 3CF0A 5C46F 1G8PA 3QI2A 3QBVA 1F2UA 2QA5A 2OXRA 3B1YA 3IO3A 3BWDD 3FGNA 2FSHA 5A5GA 1WCV1 4PPFA 5JI3E 3HU2A 3BERA 4MKGA 5LB2A 2G9NA 3QXSA 2E87A 3EIEA 1XJQA 2PBRA 4ITRC 4RD3A 4NTZA 2YWHA 1D9XA 1T8TA 2G77B 2JIZA 2JJ8A 2VRWA 2G6BA 1E96A 2Q3FA 2GCOB 4AYWA 5TB5A 1KY3A 4TL8A 5JWHA 3DPUA 2J3EA 3ASYA 1KKMA 4HEJA 4Q03A 3K09C 3FDIA 3AF0A 2EWWA 1T3HA 1T3SA 4N1AA 5C2JB 3SQXA 4TLBA 1N6PA 1VECA 5BW8A 1HYQA 1OIVA 4QNMA 2BWJA 1RRGA 3T1OA 2ATXA 2REOA 2IYQA 5AJVB 2FSIA 1ZC3A 2O8FA 2O8FB 4QBIA 4TYYA 3NBXX 1UBCA 3RAPR 2H18A 4U00A 2P6RA 3P27A 4OI0A 4NYIQ 5J4HA 2V6JA 3MRSA 1NVVR 3OAAD 4URXR 3Q72A 5IT5A 1G41A 4LBYA 2F1HA 2OFXA 3X1ZA 2PJZA 3ZVLA 4Q9IA 1SVSA 4W7SA 1NY6A 4JZKA 3K0EA 1G4UR 2CHQA 4HAVA 3WYFA 3PQCA 2R62A 2BMFA 3RWOA 4CDGA 1G7SA 4TMVA 1V5WA 2ZJ8A 3VNVA 1YVDA 1R10A 3KUDA 2BM1A 1C1YA 2D7CA 4OJQA 2G0NA 3O8RA 4PC2A 2QUZA 3M1IA 4ARZA 4I4LA 1SULA 2G1KA 3TIFA 2NO0A 3IEVA 1E6CA 1U0JA 4HUQB 4WXRA 1COWA 4AC9A 4LHWA 1W36B 4M9ZA 4PC6A 4LJ6A 4V0NA 4KCGA 5TDHA 4MA4A 4DSOA 3OE7A 1ZUIA 1MRNA 2YHSA 4RZUA 3H0KA 1P5ZB 4QBHA 1CULC 4RY2A 4JVNA 4TMTA 2Z43A 5EE5B 3QF4A 1BOFA 4KHZA 3FHTA 2RHMA 4RD1A 1E1RA 2B7CA 3R7WB 2RKOA 1H65A 1NN5A 4BRUA 1E4VA 1KMHB 2BJWA 4QG7A 2YV5A 621PA 2VHUA 2OG2A 4D2IA 1KYIA 4ACAA 2PJRA 2PL3A 4CRWB 2OHFA 4LDJA 4Q1DA 4WZ6A 1KO5A 4GT1A 4URYR 1PLKA 2BIFA 2OFWA 1OB5A 4HAUA 4XIGS 2ZRAA 4FCVA 2JDIA 4IVPA 4M4SA 3WY9A 2Q3MA 2WMNB 4FD2A 4IDQA 4IHQA 1XTQA 5FL7D 2ZJBA 4D4KA 5KDOA 4C9BA 3QY0A 3G82C 1S8FA 3SOPA 3Q7PA 5E4FA 1M6NA 2GXAA 5ELXA 2F9MA 2WJYA 2YINC 1PVOA 2FE4A 3K0CA 5BYJA 1II0A 3GLGA 1RJ9A 1QBKC 1TEXA 1EFHA 4IJMA 3I62A 3GJ7A 4KBGA 1X8KA 5J4VA 2IYSA 2QGNA 3HPQA 1A7JA 1SKQA 2WAYA 1IHUA 2X8AA 4NCIA 1Q21A 5HE9A 3A4MA 2A5YB 5LD2C 2QP3A 4OQNA 2O8EB 3SJCA 1MO3A 1E0SA 2GJSA 2C2HA 5EXTA 3W5JA 5CYPA 1ZNZA 2DWOA 2J5XA 3CB4A 2WPDD 1L4UA 4K46A 2LKCA 1U8AA 4NHOA 4B3FX 4R9UC 4HAZA 3UKDA 4ASUD 1E79D 1NY5A 1G7TA 1ELOA 2C96A 4Q4JA 1ONBA 2H1LA 5L3RA 1L7VC 1G4AE 4GMDA 5EZ5A 4C3ZA 1YZUA 4DLTA 4P4TA 1JNYA 5JCZA 3RYTC 3I92A 1P2VA 2JLZA 2CMKA 2OCYC 4DB2A 3E5HA 2CCGA 3C4JA 4BFTA 4OHYA 1CJTC 4JL6A 3RRZA 3DKVA 3BFKA 4E09A 4ZIRB 1P9NA 3NC0C 4MGIR 5CM8B 4A0FA 1QG2A 2BEKA 4B3BA 3L43A 2GJAA 5TY0A 2XZLA 1NSTA 1KGDA
chains in the Genus database with same CATH superfamily
3TUJC 1U3GA 1EGAA 4KXYA 3PIRA 4PV7A 1RC8A 1QS0A 3I2YX 5CR9A 1QRAA 5F51A 4AMVA 4D3YA 4DYHA 3MHTA 3GLUA 2P7IA 2QTVB 3PYLA 1QX3A 4C05A 4RTLA 4ZCLA 1TM1E 1EUZA 3T9EA 1GTVA 2NWQA 2JF0A 2UUCB 3SSAA 1UXHA 1P0CA 2B1RA 2ZR0A 3IDOA 5DWDA 1EM6A 3FTEA 1SOUA 1WEHA 4M60A 8ABPA 3W5BA 1F1BA 1C0EA 2OAEA 4I8XA 3H3FA 3MTIA 3MGAA 1Z6ZA 1NJFA 4F46A 4F11A 1K2VN 3BE5A 2YHAA 2C7RA 3NO4A 4ZPXA 5EJFA 2FVYA 1G21E 4FXPA 3KXKA 4JB8A 4K26A 2AMYA 2C2BA 1M1ZA 2CLCX 4I55F 4M98A 4EQZA 1LF5A 2NP6A 2IDKA 4MTLA 4C78A 5T3UA 1J33A 1P1HA 2IYRA 2WG1A 4H3KB 4A73A 1N8NA 1U2DA 1FRVA 1XNJA 2Z9BA 5IN5A 5KUTA 3GNQA 2N47A 1GQSA 2RH4A 3SAJA 2CVHA 4Q4HB 3UJ6A 1WF6A 3SLRA 3JQ8A 1BWSA 3WHIA 3ZGNA 1SIWA 1V5IA 5AJZA 3AUJB 3KQQA 2CHFA 3Q7TA 4LAFA 4IFIA 2OHVA 4CUKA 1BE1A 4A0SA 2CGEA 2FMUA 3EVAA 1RAGA 3EVCA 1K8ZB 1WV1A 2VXBA 4XQ0A 4CCWA 3TB4A 1KJNA 4TLMB 5CFZA 2PUEA 2NTJA 1V1MB 4JGBA 4EQ6B 1RLUA 2J31A 4EHJA 3HA5A 5EJAA 3ONEA 3K5HA 5CBPA 1HX7A 4QGFA 2QTGA 2H7CA 1CFJA 4YJHB 3UGQA 4C0QC 1YJ8A 2DBYA 5LBTA 3SYMA 2H0AA 3SEQA 1Z22A 2WDPA 4R2WA 5CVCA 3KR9A 4I1UA 2C8KA 1Y3CE 2HL6A 2C2ZA 2QV7A 1PSZA 3WDKA 3HC7A 3TEFA 2Z6VA 5ENDA 221PA 2OHHA 3I1FA 2WJZB 5EHXA 1SJ9A 4RACA 2I22A 5DYTA 3TL3A 1IAQA 4NE9A 4CM4A 4MWEA 3GG2A 4HFNA 5CG1A 1FX1A 1D3AA 2MHCA 2FOLA 3OESA 1SHZA 1H8ED 4YAOA 3TI7A 1YB4A 2A5LA 1YZFA 2DPLA 4MZDA 3TAXA 2ORWA 1JZSA 3EEFA 3FB1A 4IIJA 1JR3A 3ZDZB 5KYWB 5IAOA 1YV9A 2Z6UA 2XNDD 4LF5B 3PC6A 13PKA 4IJWA 1GNRA 4LXGA 2J4FA 4EEXA 3EG9B 5BT9A 1A69A 3A9VA 4B7AA 2WTEA 1NXOA 5B1IA 1QDEA 1VYHA 1X14A 1B1CA 2OAQ1 2RGNC 4FT4A 4A8HA 2ZWMA 3COVA 4HXYA 4L2IB 5JE8A 1WM1A 5MDHA 3FOEC 4YUXA 2BFBB 3LHKA 4O4IA 4OKNA 4OHFA 1DAKA 4YXWD 2H0RA 3A14A 4ZALA 1TZBA 1HNZB 5DYYA 1Q22A 3V48A 3AVOA 2CV0A 2XBLA 3LO5A 3QPUA 3M6VA 2JFFA 4CL0A 1SCJA 2HHHB 4JI2B 4QBKA 3K35A 1O5OA 5LXTB 5IVKA 1RPAA 1T43A 1O96A 4JQZA 4ARVA 4BV9A 4YCJA 2AI1A 4YRAA 3P9PA 2RGNA 3AG5A 1IONA 1PJ8A 4UMDA 5JFOA 3V3KA 4KIFA 4UM7A 4PQYA 1IY1A 1HV8A 1KORA 2QRLA 4F3KA 2XT9A 3RC2A 4Y6RA 2PRKA 3MYRA 4TTVA 4DZZA 5C18A 3VZDA 2ZT5A 1JDZA 2R9VA 3H04A 4YDHB 4DANA 2MOKA 1SCQA 3QEMB 4MWTA 5GOTA 3GWGA 3E9YA 3K9BA 4TZTA 4BMPB 4BO2A 4CF7A 2J7PA 2BBTA 2CK3D 5KTRA 2F3TA 2EGUA 1Y81A 1EVYA 3KELA 3L8HA 2DQKA 4A5SA 5L4SA 5EIXA 4DLWA 2HEGA 2PKYX 3PUWA 1NDQA 3QFHA 5IYZF 3U1VA 4DE5A 1SPXA 4M6WB 1YL5A 3G5UA 1XKQA 4JC0A 4LW8A 4ZGGA 4FX2A 1E2PA 4JT2A 4LYYA 4TT3D 4C07A 3N8GA 1EJ0A 1EUYA 2XUJA 1C7IA 2RHLA 2VDKB 3OC0A 1M5RA 2ZSJA 1N33B 1CUWA 1DV1A 4UBKA 3F96A 1OC2A 1H3NA 1H69A 5IAEA 1VL6A 4B3CA 4B6PA 5A4MS 1VE1A 5B1YA 4U02A 3K31A 1NYTA 1WB5A 2Z95A 4R1OA 2ANCA 4UD6A 1E5LA 3QI7A 4L08A 4ZCRA 2CXUA 1KO8A 2FK7A 4B2IA 3TUZC 3HA7A 4IS3A 3OM1A 2V0CA 4Q05A 3JCZA 3SQDA 2UYGA 3FCCA 2AOTA 1O6FA 2HWKA 3R0ZA 3AVPA 4H4EA 1CZHA 2OG1A 1ZMBA 2I54A 3CEMA 4URUR 1CD5A 1MB2A 2FHSA 4R16A 2OLKA 4M0PA 3JQ6A 1ACJA 1Z4OA 2X1LA 4C4ZA 721PA 1JKXA 5K99A 2UYHA 2QD3A 2V6MA 2C2OA 3CC8A 4RFSA 3VZBA 5A4DA 3RJTA 4AO6A 4H6XA 2VJQA 4PZLA 5BUCA 1IN1A 1V4BA 2VH5R 1V96A 3PBKA 4JMLA 5G53C 4ZOLA 4DW8A 5L45A 5ISMA 1L5HB 3QVXA 1MNAA 3MTDA 3LRPA 4KE8A 5IDWA 3K9QO 3QSYA 1I1OA 3LNCA 3W9YA 3CF4G 3PI6A 5CA0B 2H4ZA 2ZS7A 4QUHA 3HHPA 3I8SA 3TD2A 5BWLA 2QMHA 2VP3A 4O0LA 5BVHB 5LDGA 4K87A 4EEZA 4JSRA 3HU3A 1H5NA 5LQUA 3GD7A 4NZZA 2Z5GA 1OI4A 2Y92A 1PJ3A 1JHXA 4XH9B 2MMGA 4EJFA 5BN4B 2ZB4A 3O4JA 4G0UA 2XTNA 2OHGA 4H9GA 1RHMA 5FBRB 2QLTA 2QE7A 4PGHA 3ITDA 3KKMA 3ORYA 3EW9A 2DR0A 4TQGA 5DTRA 3BUSA 2QVCA 4E1VA 4QX6A 1RHRA 1VBMA 2HHLA 1EJBA 3PWTA 4GL4A 3GF4A 4X8OA 3H75A 2PQ0A 1FRQA 4D99A 4DCJA 1PGNA 4HB3A 1NQWA 4EH1A 5CFRA 5BSUA 5ED0A 5DM4A 4P98A 5K05A 1PUXA 4HR7A 1QF9A 4NI5A 4WN9A 2J8ZA 5LQNA 4C7OA 3CN9A 4FW9A 3I6YA 2OB1A 1VE6A 2GPTA 4MWGA 1PK8A 3VV2A 1CUUA 1GTMA 1W8DA 4IXMA 4PR0A 2UYYA 4U7GA 4G5RA 1UFRA 1JR3D 2H9AA 1EQ2A 2EAUA 2R8RA 2ZRFA 4OYLA 3HQ4O 4RL6A 1UBLS 4E11A 5B36A 1ADYA 1BHQ1 2QT1A 3ACDA 3DBVO 3T3GA 1OFUA 1P1RA 1VYTA 1XZCA 4L1KA 3D81A 1E3IA 4LNUA 1P5HA 3KXLA 3THWB 1QHIA 4QSMA 3R75A 1GV0A 2J0UB 1W5BA 4MB0A 1G38A 1KVQA 5EPEA 2YOFA 2PH5A 2AIRA 4PSUA 3KFXA 2G63A 1A97A 4F38A 3DHNA 1KEKA 1SELA 5FWAA 2OGUA 5CVJA 3JYOA 1HMYA 1L7DA 5KQPA 2RGWA 3L4BA 4JJGA 1T9AA 1KVUA 3TLYA 1NVXQ 3GRVA 4DF3A 1RM3A 1UC5B 3CNQS 3QXJA 4MPTA 2IGTA 2GK7A 4HF7A 2K2WA 1M1XB 2VT6A 4E6EA 4Z8YA 5SZJA 3DJYA 1WSAA 5AW4A 4XQ9A 1N5MA 1DKMA 3G2NA 5DTIA 1QU3A 4UUAA 4MXDA 5TMPA 1EP3B 1ISPA 2B82A 4DWVA 4YMIA 3ZBTA 1JHZA 3FN4A 3D6FA 4QTTB 3H5OA 5EP3A 3RG2A 1IE3A 4F71A 3PPVA 4PANA 4BKOA 4UCWA 4L02A 2AT1A 5LKAA 2NUPA 2IOHA 5CFNA 3DD5A 1RWKA 2R86A 4R5HA 1ZFNA 2QXTA 3PR2B 1Z25A 1CUYA 3O91A 4MW6A 3RBAA 1HXHA 1XE3A 4IFBA 4LRQA 1DCMA 5KTNA 3EGXA 5CFOA 3N6XA 1L4NA 4OHCA 3VVCA 1O87A 3VUEA 1D2NA 2I99A 2VHZA 1JIXA 3T5BA 3FTCA 1I6KA 1USUA 4FHFA 5G3YA 3VKUA 4BVAA 3LZCA 4BB9A 1K9VF 4NNPA 4ZCQA 5JASA 3C24A 4ISCA 5B7NA 1K89A 3TMKA 4FDAA 2YWGA 4FNMA 4Z0HO 1NOKA 3EDMA 2WK1A 1U90A 2CLEB 2D54A 3LWZA 3UK7A 4AWBA 4M0MA 3V8RA 4FJ0A 1VMIA 1GQ2A 1YQGA 2OO5C 1IZ7A 1PW5A 2F9FA 1F5NA 1R4NB 3I4CA 1ULTA 3AR8A 1OKKA 3B2QA 2JGJA 3L5KA 4PO9A 3UHPA 4ZI7B 4AF6A 2DECA 5AW9A 3O5AA 3UCEA 1QPGA 1JECA 1OYOA 3NNNA 3P2JA 4PGGA 2DBZA 1E3WA 3FVQA 3Q3JB 4S2EA 1SWVA 5KU7A 1FSFA 2R4TA 4QM6A 1C1XB 4WD3A 1H8HD 2VS1A 3MA0A 1C3XA 4KPUA 1IXZA 3OLYA 4RK5A 5HW0A 5FCDA 4CLRB 5ITZB 1ZZEA 5AESA 3DONA 3ZWYA 1LK0A 4IW3B 5D6NA 5H82A 4XZ3A 3ROMA 4WCFB 4AQDA 3RKRA 4BNKA 4B73A 2FZEA 4DSTA 2OXFA 5CRIA 5C53B 5B1DA 2AR7A 2YS7A 4WX2B 1MRSA 5FI0B 1JEAA 1U3UA 1ZINA 3AVVA 4N39A 1L4KA 1PS9A 3AGPA 4INOA 1F8XA 5J23A 1AURA 1I80A 4V0OA 4DJFC 2IH2A 1SK9A 3CT4A 3EMVA 2PWZA 3NRCA 4IJUA 4NESA 1YIAA 5IAGA 4B4OA 5BQXA 3W9UA 2GSWA 3L8FA 1S7GA 2HMTA 1PJZA 5CJPA 3L1KA 3HY3A 4LFAB 2IYWA 1NW4A 2QNBA 4YRLA 4QGAA 1KDOA 1SUEA 1C4OA 2J3MA 4D6YA 3V55A 2C2XA 2P5SA 4DR1B 3L8MA 4HDKB 3GLTA 2ZRHA 4UNPA 4AI6A 3O0DA 2RHTA 2D2VA 1SC3A 3O1LA 3RVDA 4YRKA 1BDIA 2O52A 5HSGA 3VR6H 4IOLA 1MBZA 4QYIA 3TPCA 2WHPB 4DY6A 4EW6A 3OOWA 4JI4B 3K7EA 5EIOA 2FK8A 3LQQA 4L5YA 4YACA 4K9DA 1XDBA 2XV1A 2D13A 3WIBA 2CUTA 3R5TA 4GMGA 4DA8A 1Z0ZA 3ED5A 3JQEA 1U6IA 3R77A 4B8YA 1NAHA 2OLEA 4QRHA 4Q3BA 3Q3EA 1AKUA 1N3YA 5EESA 2JHCA 1UANA 2O2SA 1UMBA 1RJEA 3WWPA 5CA0F 2XCTB 2FUNB 1WHSA 2UZ1B 3UXYA 1JXQA 1GT91 2NUBA 3SBOA 4Z4QA 3RC1A 2V97A 4B48A 4B4DA 1JDSA 4A2WA 1EWTA 4O4HF 2G1AA 4IHJF 2EHDA 1EX1A 3VHRA 2O14A 5DI3A 2R8OA 1S2GA 2HT1A 5CNIA 4TWBA 1MTZA 2IV7A 2ZBQA 1PLLA 5C3UA 1XFDA 4X44A 3I34X 5DT9A 3W6PA 3P9SA 2RD2A 4LVOA 1ZA1A 5HK8A 3HR4A 2OZLB 5JMTA 4M54A 2ZTUA 2ZSUA 4GMKA 3KSDO 1PZNA 1ISIA 1FTYA 4AYXA 4ZV7A 3WNZA 4AZTA 3ZS9A 3TMYA 3W4KA 3KXDA 2EJVA 3BWYA 3KIPA 4GI7A 4HSGA 4YJ2B 3ZC3A 3NHAA 3RT9A 4OB8A 3SPXA 1TQ4A 3BM5A 2WWIA 4PZ0A 2XNJA 1XJWA 3B3GA 3FPLA 1U1CA 1YVUA 4XTRA 4OM8A 3FTNA 1EB9A 1BVHA 4TS1A 5LQKA 4KAFA 4F9TA 4J2HA 4F91B 1IB0A 2AVDA 3TGLA 3THSA 1TZMA 1BVYF 4DPKA 1FLDA 5JNTA 1XD2A 1YONA 2DXIA 2B2XA 2ZYIA 2HSGA 1QPBA 1NKVA 2W2TA 3T99A 3WO1A 1NJ6A 2R4QA 2Y1CA 2B34A 3QU5A 4QQRA 1M1YB 3LD9A 3IC5A 4KI7A 1HL3A 1JBEA 3JS5A 4P32A 3HVHA 2X6TA 2B6NA 2QTLA 4L15A 3RGWS 3V8BA 3RRBA 4LBVA 2NZUG 3JV7A 3ACBA 1PUIA 1LPSA 3PGJA 1YI0A 2C9ZA 2BFEB 3WGMA 3WJAA 3A1EA 4RVGA 3FNIA 3R44A 1PFKA 1ZWLA 2NG1A 5HIJA 3ZQ6A 4KTVE 3JASB 1VPWA 1GARA 4UEJA 4IX1A 1COZA 1I4WA 2ANBA 1XTRA 2P1RA 1W25A 3D6VA 3ZI0A 4CF6A 4EAAA 1A9XA 3U7GA 2W83A 5TMBA 2LE0A 3PQ5A 4GO1A 1R8QA 3O1IC 2VDMB 5FORA 4GWLA 5DBFA 1UKVY 2QI9C 3N6VA 3R23A 1QIHA 3SC2A 3WNVA 1HLDA 4EGQA 5E0OA 4XGQA 3EJWA 1S8NA 2Q0HA 1OVGA 1UP7A 3AESB 3CH4B 1F2UB 1UKZA 2Z98A 1UADA 3D3WA 3FBWA 4JP3A 4M1EA 5EJ6A 4OJKA 2ALJA 1ZCAA 3GIDA 3B1XA 5JH7A 3T3EA 5F2KA 5CLFA 4F1WA 3RIEA 2VF2A 4JLUA 1QVWA 5IJXA 3ZU2A 3HP7A 2WKPA 3NHPA 3G89A 5LBIA 1ZRHA 5ALHA 1SCKA 4IL5A 1UBSB 1WJGA 1ZD8A 3UH0A 2YFHA 5FOQA 1TADA 1DC5A 2A9RA 2OV4A 1ZMTA 1C1HA 1O7JA 3IPLA 3MYYA 5JS8A 3HB7A 1PNRA 2VPIA 3ER6A 3CNHA 1Q0UA 1JILA 1R3UA 3LFTA 3MLBA 1RCFA 4HB0A 4HC4A 5T4BA 4DQUA 1D0SA 2EQ5A 2BFOA 3T12A 3L5OA 3BFXA 3WMGA 3U4QB 1D0VA 2BGUA 3LSTA 4CIVA 1X8XA 4JLJA 3VR3D 3WK8A 3W3AD 5F35A 2OGSA 3ABSB 2QG4A 1CVRA 3LBFA 2I2XB 4IIXA 4XSHA 4CMIA 4BRZA 3L04A 1F4VA 1Y5MA 4M9SA 1RMQA 1AK9A 4CQLB 1TDJA 1CT9A 3JQ9C 4ZQEA 4B6GA 4BFYA 1YVEI 2C31A 2QAGB 3L06A 5JD6A 2DHEA 2I1VB 2YV1A 5E2AA 5IHPA 2HJHA 4KYTA 1PZXA 1Y9AA 2AXPA 1IQUA 1ZW1A 4Q1FA 1LEHA 1M9NA 5JWOA 2UKDA 2AL7A 5ALYA 1HG0A 2Q07A 2X4DA 3OZFA 4S2UA 4TSRA 3EODA 1PJTA 4TLLB 3HBMA 3IA7A 5I7VA 5JI2E 2WHQA 3OFND 3WICA 4QFBA 2QLFA 1KYVA 3W90A 2Z8ZA 2PGXA 4C4XA 4MW2A 1O96B 1H0RA 3NHJA 4UUNA 1RJ9B 1RAIA 3R3JA 3ZTYA 5FBVB 1EU1A 3B70A 4RQTA 4UTOA 1WDKA 2CLSA 3ZHOA 1FNBA 5EWJB 3HZZA 2I1WA 1WQ4A 3KBBA 2BFDA 1ST2A 1UODA 4YAKA 2P3OA 4GGMX 5FR2A 4YB8A 1FLAA 3BK1A 4TXMA 2BFBA 1OY1A 2PD3A 3GJSA 2YFYA 5FTLA 2HSJA 3JQPA 4C2UA 1VG8A 2GJKA 3LVRE 4R84A 3HB9A 3LXMA 4MI9A 5FX2A 1LPNA 1R5BA 5JCJD 2OT3B 5IWAB 4ZJPA 5EMHA 3ENQA 4GS5A 1V71A 5HBRA 1U3CA 4YP9A 1CY4A 3A1VA 5IFKA 3TQHA 4IFTA 2CHVA 3LY5A 2ZUCA 3V4LA 5FPSA 3RVJA 1QU2A 1K98A 5AHOA 5KTTA 2IYTA 3FCUB 3H9UA 4XYLA 5LU9A 3FLAA 5A3JA 3QXCA 4EJ0A 2VPYA 2R6DA 2A67A 3HDVA 1U6KA 3LYUA 1JQDA 4PAQA 1VPLA 3URKA 2IODA 5TNXA 4QDKA 5LR6A 1V6AA 4MULA 1G7CA 2YNMC 3U61B 1I24A 2WD9A 2F17A 2O8CA 2W2KA 3G8DA 1T0PA 1ID8A 3DGEC 2BSQA 3FETA 2W7TA 3KKEA 3NT2A 5BSGA 1YRHA 1A8PA 4HPXB 5KBYA 2JAWA 1JUDA 1WHTB 2A0WA 2IDJA 3O2SB 3ROTA 3VNRA 3ZHCA 1UEXC 2RGRA 2YN0A 4E51A 1QZ3A 2FWJA 1CB7A 2NXNA 2AXNA 3TRFA 2EP8A 4ODIA 3IVCA 1ML4A 5FL7A 3OHSX 2HZBA 4ZAFA 2WFLB 4RVFA 1YCHA 2RDMA 3DKIA 5KSOA 2VK1A 1Y33E 1ZAKA 4N49A 5FEUA 3TJZA 4BECA 5IU6A 3ORFA 4M1OA 3SICE 3HWRA 3KLMX 1L4BA 2P69A 1KFCB 3G17A 3BVPA 1VCIA 4TM7A 3T95A 4DXDA 3T35A 4Z54A 5IJ0A 2HV8A 1IATA 2JGNA 2NU7B 4HVTA 1R0RE 3IULA 2Q4RA 3R0IA 4MPDA 3RODA 2V98A 2QSUA 1OR8A 4CTOA 2QTAA 3ENVA 1O5IA 3OJEA 2JJ2A 3EMBA 3KZXA 3TW6A 3PC3A 1PJQA 3W1WA 1XZNA 3MXOA 1TX4B 4E46A 4EI7A 5KVCA 1UJCA 1WZUA 3OBIA 4NFYA 3RBVA 2XNHA 1YZQA 1ZICA 5E95A 1XMXA 3FLBA 3UUEA 2GBLC 3BMQA 4GW3A 4QU9A 3VTFA 3CZ9A 2ACKA 4NONA 3UEOA 3KKPA 3VAAA 4UULA 1R6TA 2DY1A 2Z1NA 1O89A 1REQB 2AKAB 4P5EA 2LCQA 2C2YA 2W6PA 1Y4UA 1U0EA 3KS9A 3I6IA 2YR0A 2C4VA 3C4QA 3EQ6A 4JWKA 3WGQA 3BIJA 3DVRX 3ZV6A 2QVYX 4F1KA 1RRFA 3PXGA 1ZAYA 1UBKS 4JJFA 3L93A 2BDUA 3B1JA 5FOVA 3BWEA 3GG9A 1FW8A 1Z56C 3SYLA 2QRHA 1L5FA 3FMIA 2AOTB 3N70A 1VB5A 2AFVA 2PJDA 3BG5A 4KK4A 5ARBA 3EGCA 3ONDA 5DHFA 1FFAA 2PSFA 2RGCA 3FNRA 3C3CA 1U4NA 4XLZA 2B1QA 3BHJA 2QBYA 2Z9DA 1FL9A 3IRVA 4KGZA 2E4WA 1WVGA 2D1TA 3NIDB 3OJOA 4JOCA 3BWMA 1K7XB 2F6RA 4PYQA 1AA9A 1CCWA 1ZONA 1JEOA 2D5BA 4UOQA 4FIZA 2MR5A 4WNYA 4BPRA 1DJLA 4L5JA 1J2YA 3WVNA 4IV8A 2LP4Y 2ECKA 2GLTA 4NR0A 5COAA 2X0IA 3RF7A 1NF9A 4P0PB 1MT0A 4K6FA 3OFNA 3G49A 3M3HA 4YBRA 3WIDA 1AKYA 4DMGA 3U3KA 2E82A 2N42A 1E62A 3VYWA 2F9LA 1UDWA 3NBYC 1ZUWA 4KIUA 2NGRA 4RK7A 3ANXA 3N05A 4ZOAA 3AM4A 3N8NA 1AB6A 3GXBA 2DUWA 3KO8A 3GRAA 3P9YA 1Q57A 4HNRA 3NTXA 2J3DA 2ZSBA 1Z4MA 2OENG 2H4WA 4EHAA 1OBFO 5BMOA 3IBCA 4E31A 4JCOA 1SXIA 2RG7A 3WDLA 1XYVA 1EWQA 4IGFA 1N5JA 2XKJE 1XMJA 3A6HA 4WE3A 2QN9A 5KWIA 3FKSA 4LXXA 4NZPA 2QZZA 1OX4B 3IP5A 1VLHA 3QUBA 1KO7A 4RZSA 1QFYA 1FNNA 3AOEA 4FSDA 1RTTA 4ARZB 4I1OA 2OV1A 2Y8EA 3OT5A 2HM7A 4JBIA 1II8B 1A72A 3KRTA 2Z2XA 3LA8A 4O4IF 5CHEA 4FLFA 4RTJA 5L7WA 3HJGA 4HWGA 1H6CA 2VN8A 4WKGA 3UATA 1KZ6A 1RQRA 3PITA 5ALRA 2GCIA 2UAGA 4V0RA 4XDGA 5A7FA 3T5GA 2AUTA 5E1DA 3OM8A 2O0LA 4J1QA 3TOZA 3GEPA 3CF2A 3UA4A 1AXRA 1N9ZA 1XNQB 1IXRC 1KFBB 5FWDA 2OOSA 4X8LA 2ZI7A 2G7ZA 1N0IA 2Z5FA 3IBFA 3DA8A 4HWSA 4BKPA 3ECSA 3IP3A 4RL4A 4EHNA 1XKXA 2V6IA 4P3YA 2JI9A 3LVQE 4NECA 2HBRA 2J59A 3JPWA 1DC4A 3PNYA 2PSHA 4I6JA 1ENPA 1P3JA 1F8UA 5DEIA 3EBPA 1KEZA 1VBKA 1T2CA 2EDAA 3VU0A 1L3CA 4YAIA 4QARA 3UV7A 4YT2A 5JS1A 4D8VA 2EBFX 5HCNA 3C0KA 4UXHA 2EG5A 4EHLA 4KB5A 1WHTA 2PFSA 3DEFA 3F67A 3HL0A 1TL7C 4X1IB 4C5AA 2OK8A 1G19A 1PDVA 2R96A 3WJ2A 4EB3A 4WLEA 4Q3LA 1E1CB 1RRMA 5J2TB 1ZEMA 4BEWA 2VCEA 1SBYA 3UJDA 4MJ3A 1K3UB 4OFWA 1NNUA 3BSFA 3V4ZA 2EFCB 1J1UA 5T67A 1JEEA 1XZJA 3ICOA 3LV8A 3O03A 2DSTA 3PNPA 1QFJA 1TTQB 2BEUB 4RKQA 2XYVA 5DISB 4YEDA 2GHQA 3AUFA 2O0MA 3LLSA 1V8PA 4MWZA 2COKA 1HQDA 1E4OA 1IEQA 3MMNA 3RNLA 3UH1A 3WAKA 5BVGB 2FKNA 2BZ0A 1AB5A 3QP9A 3M6FA 1EUDA 2UZ4A 1EI9A 3HCEA 5GWXA 3AHCA 3IPXA 4NC9A 1T0IA 4KV9A 1X13A 1ESEA 2G09A 5KC8A 4LHSA 1B0AA 1IY0A 2WJWA 3NAZA 2BLNA 3HADA 3UAVA 5JZOA 2Y1LA 2O07A 5C4GB 4BUJA 3T7JA 1SA0B 3M6MD 4DHWA 1A4UA 3NDBB 4KSBA 3LHFA 2JIZD 1FB5A 3ICWA 2W0SA 3D3JA 1QIMA 3JQ8B 4LHZA 4RO0A 5FPTA 2CDAA 3AF5A 4EATA 3P2OA 1SURA 1KE1A 2IS6A 4XASA 3D64A 1ATZA 4E6PA 3LL4A 4K05A 3PCTA 4UHFA 4I55B 4LV8B 5FTWA 1JYSA 1E9DA 3LPDA 1SIBE 1AGPA 1U2PA 2YWEA 3MMXA 1G6Q1 3P0IA 1YCDA 3ELDA 4QODA 4JROA 3DT8A 4AKSA 1DX6A 3HFRA 2OUIA 3IP1A 2QUKA 5BN3B 3IIMA 1JQAA 1QVRA 4RYDA 1E2FA 4LY6A 1CS0B 3VH1A 4BX2A 4DWJA 2DERA 3D8BA 2ETXA 2VFAA 4JY7A 2BGKA 4KN6A 3RIMA 5CBKA 4FYYA 3PEWA 1U9ZA 4QPZA 3CUUA 1ODCA 2QRPA 5KQSA 4MKXA 1GQFA 1OQAA 4RENA 1X74A 2GEBA 1RM0A 3AR2A 3KZMA 3TTTA 3WL3A 2XOKA 3AHDA 5BYBA 4CYMA 4E5KA 1Z0DA 1SHTX 2WD7A 2C0CA 1NAIA 2YMQA 1SIUA 3D6TB 5GONF 5ICCA 4QOFA 2QN8A 4CTMA 2RHHA 1QH8A 2AQIA 4EA6A 3EOAI 2OFFA 1T4GA 3HZOA 5M2QA 2EWMA 5J43A 3KTOA 2WR8A 3COWA 4LI0A 2A84A 3PDUA 3I2FA 1ZVMA 4B43A 4AJ9A 5HRUA 2BGWA 2COUA 2VP9A 3QFCA 1GYRA 4G4IA 4PW0A 1ACLA 1L5GB 3NAQA 1VHLA 3LJKA 4HADA 2VHWA 5BSTA 5BPFA 4UW9A 4DMHA 1AKRA 3QA9A 5LSAA 2C5HA 4N6NA 1KI8A 3ILYA 3ESAA 1Y5RA 1ZO8A 5AUNB 4Q9AA 1P72A 5ES4B 1Q1AA 2B7BA 4FNAA 4HDKA 3JAWA 4KIWA 3JQAA 2EFEB 1GZVA 4V3BA 1WW3A 4YONB 5LP6A 3GAAA 4M0KA 5DHTA 4AYTA 4DKJA 1GG9A 4E30A 2TRSB 1BQEA 3C1TA 1KS2A 3UMMA 5U9CA 1PT8A 4MV3A 4JL8A 2HWYA 1EGMB 3E8XA 4RPIA 2EEPA 3U2QA 3KVVA 4HGPA 2JS7A 4KE7A 1HO3A 4JI6B 1CLEA 3FOAA 2BFFB 1X2EA 1ZNYA 1BO6A 1J7JA 1HKUA 2LW7A 3PICA 4I6EA 3QIAA 1DZ3A 2Q0XA 4N3CA 4EA8A 3L7DA 2JA1A 2F3SA 3NWBA 4D8XA 1XLTC 4V02A 3V4VB 5IASA 3H2YA 1BW9B 2AZTA 4NCAA 4KKXB 3K5IA 4RCYA 1GZ6A 1AZSC 4CEHB 1PRYA 1N2IA 1Z4LA 4JNCA 4RVUA 1Y6RA 3KZVA 4AJLA 5AHKA 1PDWA 1MVOA 3CHYA 4GNKA 2QMYA 3HXLA 4GEGA 3C15C 1OW3B 4J91A 5CD1A 2JDID 3N2LA 1TIPA 2B69A 5DP1A 5ECGC 3SYKA 4Z4EA 2ILVA 1K63A 1Q20A 1Z5WA 2X76A 1NBMD 5KAPA 4D0NA 5FWXB 5DGCA 3VU9A 4EJSB 3O1JC 1EK0A 3EXG2 3WB1A 3AFMA 3ZE2B 1DSSG 1JPUA 4NE7A 3CNEA 4ABTA 4X3CA 2J9RA 1VPEA 4OGKA 2G9UA 2XGMA 5HA5A 1F9AA 2JFNA 4EFNA 2QM8A 4MQ4A 1U0NA 2APJA 3BBLA 1FP2A 2QW1A 5E7MA 5F2EA 5JCPA 3WKBA 4IDAA 5AVSA 2J46A 1X70A 3SFZA 1N9GA 4X85A 3ESXA 4Y6SA 4BX0A 1YZVA 2YZGA 2ZYHA 3MGBA 3O83A 4JKOA 4XWGA 1AZTA 1OZAA 5CXXA 4GSLA 4KQJA 4WOPA 3TB6A 2P2DA 5C34B 3L1IA 3LKVA 1UIRA 3MLEA 5FB3A 5LPNA 5TMEA 1J2RA 4BFZA 5JEEA 4PWZA 3DGFC 3E3NA 1TIBA 2OV6A 4IGKA 4ZAVA 3PUHA 3SNHA 2ZEJA 1PD0A 1GZ3A 5IZCA 3F46A 3WL8A 5HBGA 3IQZA 3A1NA 4QGBA 1UXGA 1WMAA 5TARA 4BP9A 4DIDA 7YASA 4D96A 2HZ7A 2V9PA 4FZJA 5D86A 2A7QA 4NU8X 3U40A 2PG3A 1L5SA 1ZUHA 2BUAA 5FL3A 4MQUA 4QQFA 5BN5A 3KE8A 4NZYA 5KDLA 3GLIA 5KKCA 3H86A 3AIOA 1J07A 3JYQA 1II8A 4MAMA 4ZOLB 4EHDA 2JIOA 4EB6B 3NTOA 4NOJA 4URVR 4HB4A 1CY8A 3HDYA 2O3SA 4NCHA 1H2XA 2GT1A 1CQJA 1V4NA 2JGDB 3AFNA 2V5UA 4KSYA 1N4DA 1C0PA 3SSNA 4DLBA 3QE4A 3D43A 3W7AA 4QHSA 2YHIB 4Y1FA 5G0SA 4OP1A 4ZKDA 2OSVA 4MKFA 1QZXA 1T2VA 4NATA 4O2BF 4QSHA 4R3UC 1VDZA 4B80A 3CWZA 5ETJA 4TQAA 2IEIA 1TCVA 4NMMA 5AUQA 1P4AA 2B98A 3UYKA 1PNOA 3IE0A 5GJVC 3BGOS 1Y5NA 1W75A 3UHJA 1DS6A 2AN5A 2XOEA 1JE0A 4OJNA 1RWNA 2JJ2D 1HT1E 3BULA 1GU7A 4G81A 3ENKA 1EINA 4MIEA 3UIEA 2EZ4A 4YDQA 2XZDA 2FLKA 3Q1LA 2PZMA 4WJKB 5AMXA 3QHAA 2V7QD 3BFJA 2V7XA 1OU0A 1B0UA 4RIIA 3LGXA 1QHHB 4YQYA 3KTAB 3DYIA 3X1DA 2DPYA 3FE2A 3GRFA 1K2WA 1S89A 5JEDA 4JUBA 2RGUA 5AKLA 3H5TA 4MVJG 4ZCPA 2G9VA 3WS7A 2FZLA 5KQMA 2JCGA 3B7PA 4G67A 2JFPA 3S68A 4ZMBA 2QZPA 5CW1A 4QWMA 1CLUA 2REBA 4XYBA 2G9ZA 1GKKA 2PYIA 1KWKA 2QD2A 2FZWA 3A10A 3LG2A 2WABA 4QUBA 3CG4A 4UVGA 4YRPA 5JWRA 4MDFA 5A4FS 3DOJA 1KOJA 4OUKX 4PIMA 2JZCA 4L4ZA 3B82A 2PCLA 2Y1FA 2WJVA 3E3MA 3ZJUA 3FBGA 4DV2B 2BBWA 2H2HA 2KSQA 4EY8A 4ZRDA 2VTKA 2JFVA 3PENA 4O1HA 1N32B 1V8FA 3WBKA 4N5LA 4QIHA 5FV7A 1JMVA 2VL7A 3EMDA 4FUTA 5KNBH 1B0ZA 1SOAA 1SUSA 4G0YA 2AZXA 4HH0A 3AK4A 4N6GA 5FNVF 5LQJA 2BCJQ 3S44A 4WY2A 4OQYA 4B8ZA 1T6YA 5CLGA 3UK1A 2WV9A 2XMZA 2XIQA 1SG0A 3TLXA 1NVEA 1YDGA 4FYWA 5I4BA 4WDRA 3KU1A 1T9GS 3A6ZA 5HF9A 2MSDB 4TLEA 1G8AA 4UZFA 4G0MA 4C4YA 3GL9A 5CH3A 1Q1EA 3AUUA 1GGKA 2A8YA 2WE7A 3RVBA 1CJMA 2JCSA 1Q0QA 4N03A 3F6EX 4MVJD 2ONZA 2YV4A 3SHFA 1QFSA 4LMAA 3GLKA 1PV2A 1E60A 2DM6A 4LJRA 1W2HA 4G86A 2JC3A 3EQ2A 4JXXA 1BEUB 1UF9A 1V3UA 2VPWA 2BHSA 3EGXB 4QYWA 3D3EA 4TV8A 4EB8A 3LT2A 5AK6A 4RMHA 3B3FA 3HUDA 3WWCA 1ZIDA 4WLVA 3K8QA 5AWFC 3FBTA 1NIPA 3AKYA 4L0CA 3EIFA 3TDNA 4GWKA 2VSYA 2ZVJA 2RGGA 2DEUA 5AI9A 1G5TA 3FWYA 3WI7A 1LJUA 5AXBA 3A3KA 4ZGBA 3QUQA 2H1FA 1FXUA 2O50A 3AF3A 4ED9A 1DC8A 3A4VA 3B1KA 3MCUA 4J0EA 4KN8A 4NMXB 5AOAA 3U4DA 3MUOA 4I81A 4GVLA 2P68A 4ZEOA 3NHSA 3ZQJA 4C4PA 1Z8FA 4CLOA 2I9PA 1DXHA 2FJUA 4G07A 3X2SA 2W37A 5KNCD 1KZ7B 4QLOA 2AX3A 1E5DA 3SQNA 4EPXA 4POOA 1XDUA 5D3MA 3VOTA 1NXSA 2IUEA 4ZDIA 8ATCA 2V3CC 1IEVA 5BQOA 4CUZA 4UHCA 7MDHA 1ZVQA 2IHJA 3UC5A 1MXHA 2NT3A 1SXJB 2I5PO 3IL2A 1G66A 3AUAA 5E4JA 1J9ZA 4PFSA 4N54A 3IV9A 4BWFB 3WRYA 2C94A 2CJWA 2Q1UA 5DCYA 5AK3A 4E94A 2YUIA 4M1MA 5REQB 5IUJC 5JHGB 2W42A 2PU5A 1Z63A 2D1RA 1U11A 1KRHA 4LG1A 4HV4A 3FHCB 4KXFB 4HLQB 4AB1A 3JQ7A 4MW7A 3C14C 2IZOA 2CV2A 1JU3A 2JGFA 3H4TA 3LCVB 2GAIA 2HI0A 4E03A 5BNZA 4YAUA 1CNFA 3BL6A 5FAXA 4JLDA 1KERA 4FFPA 1DAHA 1KZ1A 3TE6A 1TLLA 3G5TA 4Q34A 1I51A 4LK2A 2XGOA 5EYPB 3GP8A 1E7MA 3C43A 2BJVA 3O92A 4L2IA 2DG2A 1PP4A 1FSZA 3O90A 5L53A 4JHLA 2BRUC 1I13A 3KZ1E 4MJ7A 4MINA 5DYNA 5LN1A 4RHCA 4QVIA 2JAQA 1GYQA 3ZD6A 2FW1A 3PXEA 1XLWA 4KGXA 1NW9B 4BMNA 1G6OA 4Q3OA 4RK6A 1QMPA 1FDTA 3ONVA 4ZVVA 4BMOB 1ADGA 3IFSA 2ZU0C 3DVAB 3NHBA 4L6CA 4RHXA 2UUBB 3GDOA 3GOQA 4G8CA 5C0OE 1JA0A 3VPXA 3DJFA 5A4JA 3BRWD 4QXOA 4R8SA 3UMFA