1WO8A

Crystal structure of methylglyoxal synthase from thermus thermophilus hb8
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
126
structure length
126
Chain Sequence
MKALALIAHDAKKDEMVAFCLRHKDVLARYPLLATGTTGARIQEATGLAVERVLSGPLGGDLQIGARVAEGKVLAVVFLQDPLTAKPHEPDVQALMRVCNVHGVPLATNLVAAEALIAWIRKGTPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords methylglyoxal synthase
publication title Crystal structure of methylglyoxal synthase from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus hb8
molecule tags Lyase
total genus 46
structure length 126
sequence length 126
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.3.3: Methylglyoxal synthase.
pdb deposition date 2004-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1wo8A00
1M6VA 1S89A 2X8WA 1C3OA 1T36A 4A1OA 1EGHA 2IU3A 1P4RA 2B1GA 1G8MA 2B1IA 1THZA 1CE8A 2YVQA 1KEEA 1WO8A 2IU0A 2XW6A 1PKXA 3ZZMA 5H3LA 1B93A 1M9NA 1BXRA 1C30A 1ZCZA 1CS0A 4EHIA 1OZ0A 1PL0A 1A9XA 1IK4A 1VMDA 1JDBB 1S8AA
chains in the Genus database with same CATH superfamily
5H7XA 4BIMA 2O20A 2PTGA 4BVGA 3QENA 4N5HX 4Q9HA 2ZIZA 3ON5A 3PQDA 4PX2A 1DTEA 2YIMA 3AL0C 3TG8A 2CVHA 1BXZA 3MSXA 4KAJA 4C2TA 1XPOA 4ED9A 4ETWA 2UXCB 4TROA 3HVJA 2KB0A 4URUR 5LC1A 4NCHA 4BNHA 3DMRA 3HZOA 3R0JA 5I9NA 4RL6A 2ZRMA 5F7ZA 4QLOA 1OYWA 2QRMA 3N7UA 5IAAA 5JROA 1N0HA 4NJMB 1GNRA 1L9KA 3FLBA 5A2GA 4GOJA 5I7OA 3TEFA 1I7SB 2PKQP 1U7TA 1GAXA 4F8JA 1I4TD 4ENTA 1HTTA 5B7PA 5IX8A 5D6OA 1B76A 2GPSA 2ZXFA 1YDEA 2HEIA 2QM0A 3PR3A 3PT9A 3FETA 4PCLA 4WEQA 5EIOA 4ITUA 4LIPD 3WJ7A 1Q15A 1QP8A 2P3LA 3S8MA 3EVDA 3PHGA 4RHUA 4DV3B 4BTVA 5A7HA 4UTPA 1TB4A 3AVWA 1RQPA 2WP0A 5DHQA 2YJGA 4EGFA 3CLVA 1XNHA 5A5FA 2IZ0A 3M70A 4RSHA 1WU7A 4C3OB 4EHFA 2MSNA 1MNAA 3QNMA 3BWEA 2BFEA 5E2BA 2O3UA 1PJQA 3LECA 3WICA 5JARA 4OQYA 4DB2A 4B1FA 4ZCLA 2QSYA 4F60A 1N1EA 5DIZA 1GUDA 4CFYA 1N2EA 4OGFA 1BW9B 5D6NA 4BZWA 2OZEA 5LNK6 1VB5A 4ZJPA 1L4FA 1U3DA 1ZCBA 3DBVO 4X1YB 5AHOA 2YV3A 2HJ9A 1CUIA 3DWIA 2EFYA 1WSDA 1BMTA 3WRXC 1X39A 3B1JA 1CDOA 2HQ1A 2XQKA 1AGXA 3VUEA 3CLRC 3FWKA 3V2GA 3U4QB 1BS1A 4FKMA 4DLTA 2AB0A 4QU5A 4PONA 2XOKD 4RXTA 5TXGA 1U0EA 1RJGA 1V4VA 4KUHA 4M9XA 3V97A 5IS2A 1KU6A 4H4EA 1S7GA 4L8VA 4DSUA 3J81A 3MS7A 3A1EA 5JTUA 1ZGCA 3V48A 3I5YA 2CCKA 1O6GA 2JLYA 3LG2A 4XQCA 1A5ZA 1NVFA 1IUPA 1R5JA 2JJ8A 1T1GA 4R8KA 1ZLYA 4DSZA 3ZWOA 5NLLA 4IGIA 3N2ZB 3IHLA 4EA8A 4LXHA 2HLPA 4WVFA 2BTQA 3NI2A 2AX3A 4YHBA 2A86A 4EP1A 3G89A 1RCFA 1CZOA 3AUSA 3LCRA 3IEVA 2H2DA 2W0MA 4RD4A 4XVQA 1TJNA 2X4GA 4ZQGA 1E2IA 4P4LA 1V48A 1ZESA 5L45A 1DC7A 3K0AB 2V74B 3VSBA 5EE9A 4ZO6A 2NUPA 4CL8A 5TPWB 2A0WA 1ZJ4A 4XRRA 2Q3BA 4FCWA 1RWQA 2RGAA 4K9RA 2YZKA 3AEKB 4RZHA 5LYJA 4CLRA 2FSIA 2W98A 1KYXA 2OG2A 3AOEC 2OBXA 1SU4A 3L4KA 3HRKA 1XMQB 2Y67A 1M2JA 1TVEA 2DM6A 1NVVQ 3BMQA 3C5CA 3CEJA 4XSVA 4NJEA 4EYGA 1ZR2A 4FOPA 5G2OA 1EFPB 2ZUCA 3D0OA 3LX5A 2HF9A 4QYIB 1L7RA 5JDIA 3IOEA 1JDSA 1G63A 4IFTA 1RRFA 1Q12A 3PITA 5KO2A 1AKQA 4M0DA 4PPYA 2VHEA 4K9QA 3AVOA 3TL3A 1BX1A 4DILA 5EVCA 3BWMA 3QF4B 3HVRA 1Z17A 5DK6A 4RS4A 4HGRA 3QHAA 2Y71A 1MG5A 1G5TA 2WFAA 4FNAA 2WAMA 3HY4A 3OJ0A 1G21A 4PX5A 1XJ0A 5F52A 1FFXB 3NOXA 1MO4A 4UUAA 4XEUA 4RGQA 1K9VF 2HA6A 2VPTA 4W9MC 1F2UB 1CR2A 2BDUA 4R8LA 1R2QA 5DIFA 1TMOA 4DWOA 2BM1A 2LWIA 5ED0A 1QIMA 2QX8A 5A1TA 2ZYWX 2FRXA 2A5JA 4RA6A 1EWQA 4EWLA 3PTLA 1ENYA 4R1NA 4MS1B 1NBMD 1HFEL 1MQ9A 4ZDKA 3EA5A 1DBPA 1T36A 3IHTA 1M1NA 3O4RA 3OTIA 1YBVA 1QPGA 2ZRBA 4BNYA 1HYBA 3F0TA 4PLFA 4E21A 1P0PA 3GJQA 4E3WA 2AOXA 5CEFA 3HFJA 2JH3A 4QYTA 3WOVA 4I66A 2CXUA 3HJBA 1NVWQ 3A37A 3PWZA 2W2MA 4PINA 2H2HA 5JNSA 4Q4DA 1R5OA 4M87A 3UJ8A 2W4IA 4IILA 3GJ0A 4E2ZA 1IJKA 1PJLA 2PZMA 2C07A 2RKOA 4YCAA 3WK7A 3L0YA 3ZX4A 4AMZA 4Y2YA 3LV8A 2X6RA 3GMSA 4AYWA 4AY5A 3A9CA 3K3PA 4ZEXA 5GIOE 2WVGA 2ZSKA 4ZANA 3NP9A 3AZPA 3KR1A 5AP9A 4ESVA 1PZMA 1DC4A 4M9CA 2AJLI 4KXVA 4Q1FA 2XF8A 1I5OA 1SPBS 3S70A 3FKQA 4IQ8A 3SLGA 2F59A 1W46A 4XTCS 2DSTA 3QU2A 1Q5PA 4DLSA 3SQMA 1ZIYA 3TZ6A 1I4DD 1I2AA 2EZ8A 1V5FA 1CXZA 2PJZA 2GVDC 4EJ2A 1SQGA 4ENRA 3E9CA 1ZGGA 2OD7A 4IH9A 2V7UA 4NNOA 1DRVA 1MO2A 1NZFA 1RRKA 2K2QB 3IMFA 5FOVA 3VOTA 1G9TA 3RHFA 5EIXA 4JBLA 1SKMA 4M83A 2QTBA 2W48A 4GR5A 5DT2A 3STYA 4E5UA 2FPWA 3UMFA 1QHFA 3FTEA 2XNKA 3NBAA 3BKWA 4A15A 4HGNA 3TR6A 2R7AA 1AKTA 3VC2A 2DG2A 2W2KA 2RJNA 3KYCA 1L5OA 5CDGA 5K3EA 3RHSA 4ZYZA 4WWHA 4YAIA 1U5BB 3FWZA 1B2LA 4MR7B 2VSNA 4TQUS 4G85A 3A1FA 3KM0A 1WG8A 4YACA 1YJAA 1Q74A 3HB7A 4RJIA 2FQXA 1U7XA 3CR7A 5EZQA 2DUNA 4P5EA 2C3PA 2CZQA 2GM5A 2BHNA 4LI3X 4UULA 2V0CA 3DHWC 3EIFA 1HZJA 3A6PC 1THZA 3EEYA 4OU5A 2PNFA 2P9CA 3A28A 4O08A 4PG7A 4BGVA 5LUAA 1LSJA 2C1ZA 1V35A 3QI7A 1L7PA 1FRFS 2VAWA 2N42A 4IDPA 4QUKA 3PUYA 2C42A 5K3SA 3OAAD 1QX4A 3GL9A 1VSBA 1XZDA 2J31A 4I2NA 4EJFA 5CT9A 1KH3A 3H8WA 3RS3A 3Q6MA 1Y1KE 2H18A 2BBTA 3LSTA 1M33A 4KX5A 2FEPA 3FVTA 4NVRA 5D85A 3RFFA 4J4TA 5T6BA 4AUMA 5A4KA 4P22A 4B7UA 5KDOA 1USUA 1G1MA 1JTVA 2Z2KA 1I0ZA 3KOYA 4RKRA 1T5SA 4NV1A 5BVGB 3CN7A 4G5QA 3Q0TA 4DAOA 2WHEA 1YVRA 4NEGA 4CG3A 3FRHA 4CNQA 4JVNA 4DA0A 1WV1A 4PG4A 3REGA 1TQ4A 2R7KA 2PDAA 1I13A 4PXAA 5GV8A 4E2FA 3FPFA 4X95A 3KOXA 3T9AA 2ID9A 1RPTA 4ND3A 1NQWA 3GT3A 4R16A 1NVKA 1MO3A 3ETGA 1N5KA 5FR2A 3V34A 3VU0A 1FU4A 3N86A 4HDNB 1W4AA 1JYSA 1RQ2A 2GYYA 4F04A 3TKLA 3UJHA 4D0LB 4YMLA 2NUAB 5LU8A 3K0FA 1JS1X 4NG4A 3RB8A 1B8OA 2VTVA 2ZBDA 3G9TA 2HFJA 1DT5A 4CIXA 2IHZA 3CZQA 3UMCA 1G3RA 2BCJQ 4G86A 2CMFA 1HYEA 1UEJA 2XUDA 2R65A 4K9OA 4MEAA 3Q2IA 4PZCA 3FRJA 4KV9A 1Y7PA 2HB6A 3DKKA 3I0MA 4RBNA 3OFSA 1U8YA 1UFRA 4GX0A 4WTOA 3PXBA 3FHLA 2FJUA 4I1IA 1JDUA 2BMAA 3EZ9A 2ZTLA 3P94A 4Y30A 3UIEA 4EJMA 4KITB 3O2QB 2HHJA 2QRVB 1RR6A 1U2DC 3WB0A 3WWEA 1W1IA 3DE5X 4HPXB 3X2FA 1MC5A 1YC5A 2YS7A 2D2IA 3I37X 5CVJA 2JARA 4IXDA 3D6TB 1Y9JA 3H84A 2BRUA 1ZAKA 2Q6VA 5IG2A 3OCVA 4EPXA 2Z8XA 4TZ6A 1RMYA 5AVXA 3DTVD 4WESB 2O8EB 2DT8A 2H5EA 5AW0A 1V1MA 3TX6A 1YS1X 4NLLA 1CR1A 3D0RA 5AH0A 1N0IA 1X8KA 2O14A 2CVFA 3AMVA 5I8WA 4MS3A 4R9RA 1A88A 3KL4A 5BRAA 3HWSA 4FXOA 1MJFA 3EISA 3PFFA 4KO3S 3BF7A 1QQ7A 4WY8A 3EVEA 2ZUWA 4HTAA 5E4YA 4M8KA 1GGKA 2DBQA 3E3LA 1E2LA 4LXQA 1OA0A 2V6GA 3JZMA 2G40A 5F4BA 1YZUA 4HV4A 3SVZA 2Q5LA 3HR8A 4XOUA 1B16A 3RAEC 2Y1KA 4WZBA 4BX2A 5ALOA 2QTLA 4BMPB 4XFDA 9ABPA 2F43A 1W30A 4BLPA 4C7VA 4UTNA 2ZPUA 4X84A 4ZZIA 1N6PA 1Z5WA 1GNTA 3NS7A 5CB8A 5JQGB 4EQ6B 1UFVA 2Z6VA 4D9CA 1YHYA 2QTGA 4CMIA 2F8SA 1BFUA 2FDXA 2FRVA 3BXGA 3L7IA 2CN1A 1DEAA 4LJ5A 2AI2A 5BSWA 4WN9B 4HXEB 1TE2A 1JIUA 5H5JA 1XGKA 1L6IA 1XO1A 2AK3A 1O94C 4PSDA 4E03A 3A04A 2QP3A 4X64B 4LHWA 3NCHA 1OWPA 4J07A 3FROA 2H9IA 3V32A 1R5NA 2WIGA 3KU1A 1R27A 4ZQHA 3KZVA 1M73E 3LP5A 4JEMA 4RX1A 4XIFA 5GGYA 4BUJA 3HXKA 5ALPA 3V3TA 2J32A 5BNFA 1CY2A 4WKGA 1UAAA 2O0MA 3AESB 1YDMA 2Z0MA 4NBUA 4MUAA 4PW0A 2C9DA 4B4WA 3ZW9A 1CQJB 2WZCA 5LPNA 5HYVA 2A2ZA 2QU8A 1EVLA 1V1JA 3EEBA 2Q2NA 1CP3A 4FJ2A 3GVXA 2GAAA 4BDSA 2R2AA 3K92A 4RTRA 1WHSB 1JXAA 1YZQA 1IBKB 4UBIA 1Y6JA 3TOVA 2VDLB 4OXIA 5EY5B 3QEAZ 4Y9SA 2QQ0A 1KFKB 4PZAA 4BVBA 1PZEA 5LKRA 5K3CA 1I33A 2DJ5A 2F17A 2OHOA 1OBVA 3X1DA 1GITA 2R86A 3T7JA 5JADA 3OECA 3G68A 1A96A 5I01A 4DT1A 2NZYA 1Y1TA 2G9RA 4J16C 4PQGA 2XT0A 2ZU6A 4QC2A 1NI5A 1P1BA 1AIPA 4YAFA 5AVZA 3NEJA 4ZMBA 1I5EA 2DWPA 1LQTA 1LSUA 1ZSVA 2H1WA 3F3MA 3ELYA 3NGMA 4YMIA 5JMPA 3ANMA 1RM4A 3IP7A 4MR9A 3ZGXA 3BWYA 4Z9XA 2B9VA 3UMRA 1PR3A 3DL7A 2R4UA 2VL7A 2V6FA 2WAXA 4DQLA 1T3SA 3R4VA 4P3OA 3UTDA 1IN4A 2FPSA 3B9BA 5EIWA 3FKJA 3TLKA 3VNVA 5JS8A 5K5EA 1X8LA 2PQ2A 3IEPA 3MELA 1QVRA 3A4IA 1KPHA 3GGDA 1S2MA 1G8HA 5KTNA 3H5AA 3LYAA 2C61A 1N5DA 1CIVA 1PI3A 1HLFA 4DM7A 1W85B 3I0ZA 5REQA 3BHNA 4EF5A 2WKWA 1SD5A 4CMBA 3K70B 1GA1A 2WLSA 1T4MA 1A9RA 1Q92A 3FCAA 1OWNA 5JISA 3OE1A 4DV5B 1W76A 3VPHA 2P7IA 4RHCA 3NBUA 2AI3A 3LPDA 5G40A 1QTNA 1XAHA 2VXOA 1PKEA 3KHTA 1XFAA 3E8SA 2YFQA 3PIIA 4KNWA 4LWQA 3UV3A 4DBZA 1WKBA 4G9EA 1RAAA 4KYTA 4UBOA 2BF7A 2FFJA 4UC0A 1P7WA 3L7JA 3DEFA 3BSYA 4EECA 2BI7A 1YR3A 1YZKA 2RDMA 2FGJA 1VCIA 1Z39A 2OZKA 3F2IA 1YK1A 4X93A 3I1IA 3T7KA 1KQPA 3H9JA 3RS2A 2AZMA 2YYSA 4GP6A 4DOMA 1QDEA 3AFOA 4D9MA 4OHZA 4FBLA 4YUXA 2PS9A 4NSNA 4ZVKA 4BX0A 4YX9A 2ZWAA 4WOJA 2ADFA 4D5EA 3VDMA 2IXAA 2VH1A 2G8NA 3ZJ4A 4LDZA 1UM9B 3FYCA 1F9AA 4LDQA 4G0XA 4RJJA 1IZ9A 4IMIB 3MT9A 2IK8A 2HA0A 3DDNA 3UAVA 5JQWA 1EX6A 1HGXA 4UHHA 1Z4QA 4RMNA 3L9XA 5EC8A 3Q85A 1GEGA 3R75A 4DMRA 5DGCA 1G6HA 5AI6A 4XFJA 3K70C 1ZN9A 1CUWA 3AJAA 1CJVC 4H2DA 2QTVB 4QDTA 1O9HA 2RGNA 4JOSA 4WACA 4IAOA 2IBSA 1NF2A 3URKA 3B1ZA 1QG2A 3CKYA 1O95A 4LY0A 3NKVA 2RGDA 2E6KA 3HKCA 2FWRA 3D8BA 4GM1A 2NLOA 4QUBA 1D1PA 1VG9B 2G9UA 3L79A 4OAQA 4F7WA 3WWDA 3I5XA 2WINI 1ULHA 4XB2A 4Z3DA 4FBMA 3CLSD 4AXBA 1WDMA 3EQ2A 1E2MA 4OLJA 4F6LA 2BGIA 4LTDA 4BVAA 4DS3A 4OB6A 4LF7B 1USWA 3QPUA 5AW2A 1L4EA 4X91A 2CDNA 3WHIA 2FW1A 1LK5A 1QF9A 2NYAA 2CGEA 3E7XA 1NR5A 4D9KA 1XXHA 5C1PA 1GUZA 3CCCA 5KYYB 1GL3A 5F77A 1X7YB 3KXPA 4U7GA 3A4TA 1DWUA 1BJKA 1DRUA 1Z16A 1QR2A 1EG2A 1CQPA 2XHEA 3IQZA 4U3JB 2ZUBA 4RTKA 1TUBA 3LLVA 4YT5A 2CJYA 2EV9A 1EUDB 3FFAA 4JJEA 4Q82A 5C53B 2Q5CA 4CKWA 3LF1A 2A0FA 2XLBA 3SC4A 2ZUEA 3KXIA 1SQ6A 3QTTA 3G8YA 1IULA 1E4YA 3AONB 1A7JA 4RLQA 4UNPA 2QENA 2WVJA 3A6JA 3FZYA 4NU8X 1AMOA 2JHFA 1Q44A 2NU6B 4W5TA 3H1GA 4YO7A 4AMVA 1RBZA 2FW6A 4CV3A 5KU7A 3EFBA 3ASVA 5KNCA 3G49A 1CETA 2WDPA 3UHAA 4XGRA 3EIQA 1VKHA 2YC2C 3PGMA 4OA8A 1MC1A 2FCAA 4QPDA 4BWVA 5CB4B 3V8MA 2RHWA 3IO5A 1FDTA 4TPKA 1QLJA 4KQCA 3SYMA 4NK4A 4OQZA 1QYWA 3N6VA 3ED1A 3D3JA 4YVFA 1T1EA 1DJNA 4ZCSA 2ST1A 1ZJJA 3PFHA 1TM1E 2HT6A 4G01B 4UNNA 4D4MA 4M0UA 3H2YA 2ADOA 2N3ZA 4K0RA 1BYIA 1ZW1A 4LGMA 3DZCA 1LH0A 3VUFA 1TVCA 4ML3A 2VDKB 2DPYA 2OFFA 3RK4A 1E1RA 2Z04A 4MWTA 1YJBA 4PIVA 1PJ3A 3VSEA 2AEFA 1CUYA 3KQYA 1LQ2A 4LGCA 4PTLA 1YR1A 1ZNWA 2IUSA 2ZRGA 3DMDA 4ZVRA 3USZA 3GLKA 3U3DA 2YJTD 1QKKA 3KYDB 5SY4A 4OYRA 2JJQA 4HG2A 2QRGA 1VHWA 2GLXA 4NYJQ 5LOVA 3IDFA 4QVGA 1TMGE 1DLIA 3IJ5A 4OIMA 2E4ZA 4CM8A 3U13A 1UXJA 1R88A 1Y4ZA 4Y2GA 1FRVA 1T5HX 2HSDA 3V4LA 2OFWA 3LZCA 4HS9A 4X00A 2JLQA 1TOAA 1JEQA 3ABSB 3FSGD 4TRRA 5KWEA 4TKMA 3FOZA 5JNUA 1ST2A 4H31A 1W5EA 3ZU5A 2JF0A 1IFXA 4C4OA 1E1MA 4L5IA 1BKYA 3QYJA 1DUVG 4M36A 1T8SA 5HQTA 4KHZA 1CFZA 4MW9A 4BN5A 2P67A 1DKLA 3DNPA 5LXTA 1GRCA 4OTZA 4MV1A 3H3JA 4UBKA 1CYEA 4AF6A 2XE6A 4ND5A 1U2QA 3ITEA 1JALA 2PZKA 3P4YA 1ZRMA 1ZRSA 3PWTA 3PKZA 4O4HF 3OY7A 1Z45A 1SC6A 1SVMA 2VP2A 3CJTA 5DI3A 5LP6F 3RVJA 2R3SA 2TMYA 3K0BA 4XPZA 4L5JA 1LS1A 4BFYA 5BNTA 1DJOA 4I5FA 3OEED 1NXWA 4L5AA 3INTA 3CVYA 4XD2A 2YIJA 4M9QA 5HJ7A 2P78A 1XTVA 2C4TA 3FOAA 3KSMA 4A9AA 1YULA 4HAXA 2ZQ5A 4LYJA 5EL0A 4LFAB 1LY1A 2DC1A 2Y0PA 2VNJA 3CLUD 1Y48E 5BT9A 5KYTA 4UHDA 3HJFA 4HRXA 1GT6A 4ZQEA 3HDHA 2NO6A 1X9IA 4QPZA 1UADA 3H2JA 2BKAA 4HFMA 4JP2A 4ZJUA 4AO6A 2HUPA 3CR3C 3QMMA 2A4MA 4Q7QA 3DHEA 3AYXB 1ZO8A 1MTZA 4F2PA 3VR6A 2QLLA 3ET4A 1RU3A 7GPBA 2TRSB 4IIEA 3PG5A 2VZ0A 4B2YA 1DZ3A 1KI8A 4X90A 3TO5A 5DU2A 3QVOA 4IUYA 1J70A 3ZKAA 1LBEA 5BN4A 3AINA 4U02A 3GVCA 1YVUA 2GCEA 4P3XA 3I39X 2AFHE 4TYWA 1VI2A 1H05A 4MVJH 4V0OA 2D59A 1EWKA 4QGGA 1O97C 1E6UA 4R68A 4Q3BA 4B3DA 2YX1A 4CKEB 2OV2A 2VYND 4ALLA 2HEGA 2XB6A 1XU7A 1IM5A 1I10A 1PS8A 2H1HA 3F67A 4MV5A 5AK0A 1BRTA 4RH0A 3A4MA 1Y1QA 3A14A 5TVGA 3RIHA 4UFPA 4X66B 1MHTA 3IAXA 3E7FA 4ZK6A 3DP9A 1M1XB 1KA9H 1YMVA 2IELA 4NY1A 5ITVA 3B13B 4XH9B 1I1OA 2VHVA 3LF2A 4KLZA 4K6FA 1ES9A 1H66A 3K0EA 3BQMB 2IP1A 3F97A 4PLVA 2ID8A 4Y1RA 4YRTA 3BGDA 3SD7A 3SZ3A 4BN4A 2J3DA 3ZVMA 1TJ4A 2CNWA 5L6LB 2OBLA 4A4DA 1MX9A 2JFFA 1TF2A 5FBLB 3RSGA 4FJ1A 1SKBA 5ESXA 3PJEA 3PT5A 1U6KA 1I1NA 1Q2XA 3C3MA 4QDUA 4BVEA 4WBNF 3U4DA 2YHSA 4CQJA 1J5XA 4KEAA 3TVTA 3VH4A 2WYHA 3JALB 2I4MA 3SQWA 2LVBA 2GEDA 3OPQA 4FXPA 1QUFA 3WYFA 4P36A 3ETEA 1YZHA 1V95A 5KOHB 1YQTA 2JGEA 1JKMA 1HRKA 2XAAA 1C8BA 1IDN1 1M7HA 2O0JA 2NTNA 2XB4A 3NBYC 5JZOA 8GPBA 4NCAA 1CRQA 3U2QA 2G28A 1YZFA 2LGJA 2NV6A 4R3UC 5FJIA 5KHAA 2OXIA 2J0QA 3NLLA 5CM8B 1UBKS 1ZI9A 4RH3A 5L7YA 1PT5A 3FYUB 2HLDD 4NECA 2EX0A 2O2DA 2NQTA 1UC9A 2H06A 5BR4A 3P2JA 4LBWA 1QZ3A 3OU6A 5F33A 2ZRHA 4ER7A 3PXUA 4MNTA 2G25A 2ECOA 2HV8A 2QTNA 3HU1A 1MD9A 1WVGA 1WXXA 2H4WA 3LUHA 3UMYA 5DX1A 1F1BA 5JAMA 1DKMA 5FIUA 3RVKA 1UP7A 3LUGA 2VF4X 1D6MA 2PWBA 5TJHA 4BVHA 4JI0B 2PQ0A 4MW4A 4MYRA 2CSXA 4AIRA 2CHUA 1TX4B 2P3QA 5ES3A 1NTRA 1HYHA 1UK9A 2RHCA 4W5NA 3A36A 3ZZUA 3LC0A 4PYJA 4UFOA 3K1AB 1JQ3A 5TMEA 4IO1A 3U4QA 1SG9A 2WZQA 3LBFA 2ZREA 4BWYA 4E14A 9ATCA 2ERYA 2EX4A 4LJ8A 1Z5GA 1O89A 1X9HA 4DIDA 1FXWF 4B7CA 3FCYA 3WGYA 4Y1EA 4UM8B 1Y9EA 2BMWA 4LVOA 5FWYB 5LD2B 1QLHA 1BVRA 1CLUA 1SCAA 3GUVA 4N8SA 4PQFA 4KVAA 1NSFA 1P75A 3SNKA 5EMLA 3GPDG 5KBYA 2QXYA 4YAUA 4DSTA 1PD1A 1ZUHA 4M6WB 2Q7OE 3FTPA 2PZJA 1CVIA 2P69A 4I46A 4ARZB 3U5ZB 2ZTUA 1IONA 1W0JD 1EEHA 1Y1RA 1YK0A 2AJBA 5B1DA 3WLIA 2MINB 1XZGA 1KZ1A 1Y63A 2VTKA 1PHRA 2ZQZA 3EIWA 3LBHA 4FCCA 5CX4A 5B3AA 4AMGA 5F2OA 2HO4A 2NPFA 1VJGA 3TPZA 1XN1A 3ICPA 4Q4JA 4WDRA 1W35A 1XSEA 4FYXA 3ML1A 4LMRA 4N7JA 4OKSA 1WL8A 3ZDXB 2ISQA 2Z4SA 5KSWB 2J3EA 3I6BA 4V24A 3PPVA 5E1DA 1QF7A 2BDEA 5FEUA 3R7WB 2ZYSA 4C7JA 3EB9A 5JE8A 5JCOC 2XZTA 3ROEA 2GD1O 3G8BA 3A4VA 3CVWA 4OK5A 5ICSA 2A7XA 4WZAA 3M4NA 4L0MA 1CDZA 4HTFA 2YJ6A 4PVDA 2H2IA 4G0MA 1YRQA 2NTYC 4M1ZA 4RIGA 5EUBA 4JYZA 3KEOA 2CLLB 3BHMA 1EFPA 1MAUA 2DHQA 4MWDA 4YI5A 4YXWA 2WU1A 1DWPA 3OPMA 3PXGA 4RTQA 2QN2A 2OLKA 3KHSA 3WLQA 3QVGB 4EY3A 3VU1A 3QF4A 1G17A 1JR3E 2EGGA 1E0DA 4OJYA 5BSKA 4X3OA 4CM9D 4E30A 4F5DA 3L4SO 1Z3IX 1VLVA 2I66A 2BH9A 3DYBA 4WXYB 5DHTA 1CW2B 3V1YA 3UK7A 4ZO7A 3BZWA 4GWGA 1FFXA 4UCQA 5F5XA 2Y2UA 3UW3A 1UBUS 2G4LA 1U7HA 3FDZA 3KR0A 5BNZA 1XZPA 2FJPA 2FETA 1F2UA 4IRUB 2DFTA 3RVMA 4AUKA 1WVMA 5IH3A 1E3SA 2HPVA 3TW0A 3WQHA 4C5AA 1K66A 3R0XA 3RS9A 5AO9A 5DGDA 1UKBA 1TZKA 3PDUA 5DKFA 4WE3A 4BJ3A 4DLPA 1KZ6A 3HN2A 3ZU6A 4C3UA 1EP1B 4MS1A 4ZPJA 2RAVA 1U0JA 2RGRA 3LTNC 2B35A 2GTPA 4AZWA 1MNQA 3Q9NA 3VHRA 4FB5A 4OU4A 5D3MA 3VHXB 5EJ4A 1FCJA 3T7EA 1EGMB 1WXHA 5J2TA 1YR7A 4RHFA 1R8JA 2G04A 2O8CA 3VMMA 4C7XA 4TTTS 5AJHA 2QLBA 2O3SA 2WI8A 2VHQA 1K86A 1QIDA 1ZGHA 5BSUA 3SE0A 1CLEA 4R71A 4HKTA 1M8KA 2ZSFA 5TY0A 3RYHA 3CPEA 3QKUA 5BSMA 1U28C 2A1IA 1N4DA 1KSGA 1WNFA 3MBKA 3T7TA 4I4CA 1I80A 5K3DA 2VA9A 2O48X 1RIIA 5JVDF 1H93A 2JGIA 1O4WA 2OGZA 4MGKR 1MV5A 4KSBA 5DYIA 3II6X 2ZE5A 4AZ0A 4RTNA 4JP8A 1NOIA 4Q4HB 3EVTA 4GQBA 2H4HA 3FB4A 4B9EA 1USGA 5I9BA 5L3ZA 1BMDA 1L4YA 2CKMA 4QTUB 4QJIA 4QBHA 4RZ2A 2VHCA 1ZMTA 2P0EA 3A27A 3EQZA 3P20A 3IAS1 4JJIA 2ODPA 4X1KB 3V9PA 2K87A 2C96A 5A4FS 3QLVA 4RVNA 2FN7A 2BH2A 2CLEB 1HZZC 4LQCA 5TPZD 3I5MA 4XGNA 3RSOA 4BP3A 2JEZA 3GH3A 4JLBA 1XZJA 2YICA 4KE6A 3W77A 5AXBA 5HRAA 4JBGA 1JSLA 1UC4B 3BX1A 2SHKA 5K3AA 1UMCB 4IL5A 4HVCA 5JCZA 1S3GA 1UF9A 2FUKA 2QU7A 2G08A 4D97A 4EHJA 1KWGA 3RG2A 3IC5A 4OHWA 3GR6A 4KO1S 3L43A 4YV2A 4HGPA 3CB2A 1LPMA 4MR7A 3CB4A 1ZONA 4PSKA 3N3BC 4OMCA 5EJAA 4B80A 3BB1A 3ZU2A 1PBNA 3GJZA 1PGPA 5ELXA 1W48A 3B6EA 5AUPB 4HR7A 1G66A 3BA6A 3HDVA 3MD0A 3OJOA 4RKWA 4GH5A 1POXA 2A0UA 1JUDA 1N5LA 4IZHA 2XBMA 3PFIA 2UKDA 2WIJA 2WSMA 1T0PA 3NM5A 3RUCA 4AJJA 2NVUA 5AVJA 4BRSA 5NULA 4C0QC 1UDAA 3OBIA 1SUCA 3E9RA 1PX0A 2IXBA 4I1OA 3A2NA 1PAUA 1KVQA 2H5JA 4YCMA 2IYYA 5M34A 3F90A 4TS4A 1ZNZA 3EBOA 3QVVA 4I9HA 5L7TA 1KS2A 4D3ZA 1ESZA 3ZWNA 4FGJA 5MHTA 4MYSA 4WHMA 4ALMA 3D2CA 5AM4A 1M34B 3IXMA 1HDCA 4FP9A 1K7FB 3WHLA 1XKQA 2PUAA 3CN9A 4HQ6A 5EMKA 3R7AA 1EK0A 1W47A 3FNQA 5BVGA 1BFDA 3WYBA 4QDKA 3T5DA 2W0SA 3K30A 4P33A 4BO6A 4F3RA 5J4LA 2E87A 3CX7A 2I22A 5MN4A 4JLMA 1SUWA 2ZVQX 5LQMA 3EZXA 1ZUIA 3I1YA 5IJAA 3TXXA 4A5SA 1FS4A 3DTVB 1W2WB 4DV7B 4AKGA 4D43A 1OLXB 3SM9A 3HADA 5JWHA 4EFKA 1HK7A 3WADA 4BFTA 1CY4A 3LUAA 4ZOQI 4HDNA 1K88A 4OHYA 3IP6A 4OQMA 4IEIA 5ALMA 2JIOA 2A59A 2JLAA 4GPTA 5KTOA 5KX5B 4B3CA 3E1SA 5EE3A 2E4UA 1SUPA 1LTQA 2FKNA 2AG8A 2XNCA 1UZLA 3OU2A 4GMGA 5DHFA 5C5IA 1R16A 4PCUA 4DXAA 2IY9A 2QUAA 2V7BA 4GW3A 4I4NA 1X0XA 3LZ6A 3PCRB 4YRCA 1BFKA 2WB4A 3F98A 5A6SA 5EUMA 3KJZA 1PUIA 5DH9A 2YQ5A 3QHQA 1UT6A 3RQIA 3KLPX 3HN6A 1JQLB 4RFVA 2V6JA 2Q7XA 1EFVB 2ODTX 3HVIA 1X15A 1EBUA 4G1BA 5DW0A 4Z9YA 3VKFA 3G3EA 1F14A 2WW8A 3I34X 4HUQB 2YWFA 3I2KA 1E77A 2OEPA 1B14A 4UW9A 3T4PA 3SZLA 4U1RA 4FIDA 1SIOA 1UJNA 1N3LA 4I50F 5C9ZA 1OI7A 2XCIA 1KMHA 3OICA 5E4TA 16PKA 5EJFA 4BJ5A 5ALSA 2NTJA 4WESA 5CCXA 2HHAA 2O8EA 2AXPA 4RAQA 4MWGA 1F3OA 1KY3A 1V3UA 2G9QA 4G1MB 2E37A 3EUFA 1YZTA 3AJ9A 5AVSA 1HH4A 4K6GA 2HQSA 3UT5A 3X1KA 1R18A 2R68A 5K45A 3RSLA 2ZP1A 5H4GA 4N9QA 4QM7A 5H3HA 4JJ8A 3KXDA 4HQKA 1OVGA 5AM0A 5GJBA 1Z6ZA 4EPRA 1JFTA 4OJTA 5K3OA 2PXHA 4HX2A 3CZAA 3OEHA 1VYVA 3V5NA 2BTOA 2B4AA 1B41A 3CONA 1L3BA 1P2BA 1J8FA 4DV4B 1M6YA 1KE2A 2BEWB 4HD8A 4DNQA 4XIGS 5JQGA 1G8MA 4MHOA 4UMFA 3KQHA 4OUKX 1PF7E 2R85A 4DE5A 2BZ1A 2LIVA 3GB9A 3VHQA 3MA0A 2YHUA 4K9KA 4ENVA 2Z5FA 3H17A 4LOAA 4XPIA 2GI4A 1OAOC 3IOYA 4I6EA 4WN9A 4EMUA 3JRNA 4NENB 5DBEX 3TLMA 4IKOA 3VU8A 3EH2A 5DM60 3O4IA 4RK4A 1UWLA 3SJCA 3L05A 4EQZA 3B85A 3DE1X 1HORA 1E62A 2NZVG 3GD7A 1PEAA 2WAYA 1IXKA 2QJRA 4HLQB 1Q83A 5KNCH 3V80A 5BYBA 3T54A 5EJ6A 3EDMA 1E7QA 4BAZA 3KZMA 4PLZA 5ENDA 2ATVA 1K7XB 4WL0A 3OQBA 1QH1B 2R79A 4RF4A 4D56A 5KJ1A 3C6QA 4H7EA 3UCFA 3BJEA 3OIDA 3IVCA 2SNIE 2DQYA 3P97A 1WV0A 3RREA 3PNQA 2FX5A 4RA9B 4XARA 3UG6A 2GN1A 5CXXA 3HDGA 3L6BA 3QLTA 1R0YA 4U9HS 3VYUB 4FFNA 5IWAB 1M5RA 3ZHCA 4E22A 1R0XA 2WF9A 5D3QA 1GGMA 1M2VA 2AHOA 4PSUA 3SLRA 3AERA 4KQ2A 3TH5A 2X7JA 2D8MA 4UM5A 2WQZA 3KSAC 3GFOA 2H9AA 3VZBA 1E63A 1I2MA 2GRAA 2ZQYA 3DUWA 4P4UA 5JHHB 1DQPA 5JYBA 4LVUA 3OIUA 4UJ5A 1PWEA 3S29A 5A04A 3TR5A 3RPEA 3CVXA 3MJCA 3OMXA 2G09A 3I62A 2B30A 1L4MA 2J5KA 4FX5A 1JB1A 4JLAA 4GX5A 4LCEA 4RETA 5A0FA 5TT0A 1E9EA 5LZ7A 4AC9A 4DIKA 3VTKA 4KPYA 4ZEVA 3KSZO 3QFFA 5EWMA 1RAEA 6LDHA 4HADA 5SICE 3KV1A 3IFSA 1YUMA 2QUIA 4B46A 4YT4A 4QEKA 2GESA 4LC0A 4MI9A 1R4ZA 4P2GA 3ZLUA 2PUWA 4KHPB 3EXHC 5DBFA 4I99A 4ZJYA 4DY6A 1JR6A 2XAUA 2QTMA 3SPXA 1G7TA 3ENVA 3HO8A 4ZDJA 1VJDA 2PYZA 2E4YA 3OPNA 1A76A 1XDGA 1W93A 3GAAA 3HL0A 4BMDA 4DF3A 3A2KA 1E5TA 3ETNA 1GWNA 2FHPA 3NCTA 3FSJX 1U4OA 2R25B 3HCWA 3ZGVA 1BCSB 1T5OA 1SIWA 2CLIB 4HP8A 4Z3OA 5T4HA 2DT5A 3D59A 4G8DA 2PX2A 2FW7A 2BHLA 1ZJZA 2CLHB 2O3RA 2V98A 1WA5A 3DXYA 3IAM6 3ZCQA 5TGDA 2Q1XA 5GONF 4O0MA 1D03A 1JR3D 1GRVA 1HEIA 3B36A 4I1SA 3SIPA 3EEOA 1IQUA 3EGVA 2XVYA 2QV0A 1NP3A 2AI1A 2YJ3A 3NHZA 3SDBA 2HCBA 3O2JA 4RMIA 3UJDA 5JS1A 1KJYA 3JVIA 3WX0A 5A0VA 2QE7A 2Q9AA 2DP4E 5AYVA 4DC9A 4MJXA 2AJTA 4OHRA 3BRQA 4BEBA 4W9NA 1CUGA 2O7NA 1VM6A 2DYKA 3WYGA 4DLAA 2EL7A 3Q8WA 4A0QA 4N82A 3FUTA 1QRSA 1JSCA 1RYYA 4GE3A 4RF2A 3H04A 2HBRA 3R0IA 4IMRA 4NWIA 1C7RA 3A25A 2JIZA 3L1KA 1Z8DA 3GN2A 3OFJA 1V7PC 4XW2A 3V2HA 1OASA 5MFZA 1JFFB 1EUYA 2PSHA 2ODQA 3MJ4A 2DF8A 1SC1A 1Z4MA 2ZE8A 3HJUA 4GEGA 4LE0A 1XROA 2X8JA 3NWJA 4YFYA 5KTTA 1B42A 4Q7JB 3BT7A 3LDUA 2ZI6A 4IVRA 3COZA 4RM2A 4XQ0A 4G2TA 3VR6H 4YJ2F 1ZM3A 4QGBA 3BXFA 5CYPA 3W5VA 2Y1GA 1Y3DE 3SYRA 1FK8A 3UMVA 2GPAA 5KVVA 4V0RA 3K72B 1Q7GA 2PH3A 4IDDA 4XR4A 1A50B 3IB6A 2YWJA 4G0NA 4QFBA 1Q95A 2ES4A 1YWGO 1HKUA 2OO3A 2I33A 4G4SO 4DJDC 4Y9RA 2C2OA 2R62A 1CF4A 1Z0FA 3DFMA 2QUKA 4O5OA 1V8ZA 5JJIA 1SD1A 1BS9A 1M9NA 1IY0A 2DRIA 1K5DA 2WWVD 3RFVA 3W8EA 1E2HA 3UJCA 4QVIA 4HXYA 2AQ8A 2BWJA 2QP4A 3WIDA 5CFOA 1OILA 1KJQA 2DQKA 1E1KA 1G9SA 1M5UA 2H51A 3C87A 3OFKA 1V0JA 4WVLA 3RAGA 2CF5A 3I73A 5B4VA 1X7YA 2ZT5A 2OB2A 3HGTA 1GKLA 4NBNA 3SOZA 1ISHA 2XVMA 4G6ZA 3E9NA 3TLEA 1ORVA 4OMDA 4XB1A 4BZPA 2XUGA 5JXIA 2PX4A 3R77A 5H80A 3I1JA 1DU4A 1PFGA 3OHMA 3LVQE 1XEFA 2WU4A 1WUKS 2HSGA 1EIWA 3D3QA 4RQBA 1ECBA 2XGGA 2JCBA 4MRMA 1BMFA 2B8EA 1ZKDA 2QVBA 2CVOA 3OJEA 5IAEA 4RXUA 1KK0A 4NC9A 4AP5A 3O1HB 4AKIA 4R2HA 4O4IA 2A5FA 1OZHA 2NU6A 2XNHA 1GR1A 1NXXA 2H16A 2QI9C 3ANXA 2W6ID 3LQRA 3NANA 4AKEA 1M6WA 3MWDB 5BMVB 5KKNB 1M83A 1N6LA 2DY1A 1N8NA 1N6IA 1MR3F 2C8JA 3P19A 2WNSA 4IO0A 4MRPA 1Z0JA 3Q2KA 2IEAA 2HCTA 5BYAA 2HYIC 3IJEB 3KJQA 4DR5B 5C4MA 1W49A 3DQQA 3PXXA 2Q1YA 3H8VA 4QBKA 4Y2TA 3ZXIA 4F5EA 1SCIA 1PSDA 1HBJA 3FA2A 7ADHA 1M1UA 2Q6IA 3UATA 3FTQA 4MUEA 2II6A 3UGQA 3IEKA 3QELB 3V4RA 2OLEA 4I1VA 1GZ6A 3THXA 3AF3A 3DAFA 4QO8A 1SQ0A 3PBKA 1KGDA 2WU0A 3D3WB 3QVMA 3F73A 4F8EA 2Y1FA 2JB9A 2HQRA 3L40A 1DPFA 2ZIWB 1Y5RA 1PCXA 2YV2A 5F3WB 3ORRA 1T2DA 3KQPA 5BUQA 2O8BB 1U98A 2PRJA 2X3YA 4KWHA 3VR3A 3RJTA 2QZSA 4HWOA 4FHGA 5B4UA 1D2MA 1I32A 2Z2JA 3L7OA 3R0VA 3ZYZA 5C18A 3S8EA 4EY8A 1JAHA 1RP1A 3B1FA 3Q3HA 4Y7DA 4B76A 2Q4BA 4JUDX 4PTYA 1S01A 3L8HA 3QEJA 4EH1A 4IEFB 4Z3KA 3L7CA 2ONJA 4JSRA 5HG0A 3E3NA 4EZBA 3PTAA 3WDMA 4YP5A 5B1SA 1ONNA 3GDOA 5ALKA 4AWBA 4RXMA 4KQJA 1FX0B 1UQUA 3KFVA 2R8PA 4J0IA 5ERGB 2R8XA 1QRTA 2X1LA 1ZHFA 2X5OA 1U90A 4B5KA 2FP4A 5GVRA 4C0SA 4YEDA 3JQEA 4EGQA 4Z4EA 4LZNA 1LLUA 4J1SA 2BFPA 4AJLA 2CF6A 3QITA 3F5DA 5BV7A 3BCRA 1W4RA 2I6TA 4KAXA 3ZWXA 2VP5A 2VUHB 1YH3A 4F5WA 2E5LB 2F3SA 3M3HA 4UEOA 4B71A 2J5BA 5T8KC 3L0SA 1XP8A 1Y4AE 3RHZA 4UBJA 3W7BA 1G5HA 4JJGA 1U8CB 3ASUA 2IXEA 3QP9A 2B8WA 1PL8A 2BIFA 2GKOA 3PE3A 1N9GB 1TU3A 1R9JA 1F2TB 3ORHA 5EZYF 2AOTB 3Q72A 5I9MA 1O0BA 4A36A 2HA2A 3FFWA 2ZETA 4OREX 1PS0A 4QLBA 1E59A 3IH5A 4YMUA 1EB8A 2ZK7A 3UMGA 1XCBA 3Q6NA 3O75A 5AMXA 4IOJA 5HOEA 1GO2A 3MQFA 1WW2A 1NJSA 3KWLA 4OQNA 2RHDA 2GK4A 5J1SB 2UYCA 4DQVA 2FPGA 3OKAA 4UQPA 4Z7OB 2BISA 4MVJF 4ZAFA 1CCWA 3NUGA 1LPAB 3RKUA 2IDZA 4ZVQA 4DUGA 4RZSA 5JASA 4BWFB 3KQUA 2R66A 4C01A 2HCJB 1Q1QA 5DCWA 5FV7A 2UU9B 3D5TA 1Q84A 2BKLA 1PE0A 2NX2A 3NGXA 5IAGA 4HAUA 5CA0B 2ICAA 3AM4A 2R97A 1T26A 1TAGA 4MMYB 3ZHUA 4CV0A 2PUCA 3PNKA 4HAZA 1OYVA 2DQ4A 4OGKA 1FPQA 3B2EA 1NR1A 1KMMA 2ZRCA 3GRFA 3QFCA 4KIFA 4L08A 4P32A 1THTA 2H8GA 2RD2A 4YS6A 3RADC 4BX9A 4UHEA 3QKRB 5DHRA 3RWBA 1UOPA 421PA 3R24A 4XWKA 1JDBC 2H3EA 3KELA 3EXEB 3PTZA 5EVJA 2XUZA 5BXYA 1H2AS 2WF7A 3M2TA 3J80A 4S0ZA 3CSUA 5TNXA 1EVZA 1KPGA 1GSOA 1AZWA 1XF9A 3M6XA 5IDXA 3Q7PA 5K8UA 3TQCA 1S2OA 3B9RA 4BNGA 4J0QA 4O5AA 1PV4A 1UMDB 1HDOA 3GYGA 3K7EA 4QRIA 1E58A 1N2SA 1XD9A 1NUUA 4P92A 5FEMA 5HQJA 4AYXA 5AM1A 4G5GA 2XOXA 4OO3A 1ORWA 2PSSA 1WQ4A 1G5IA 2UDPA 1NVGA 2Q4DA 3OZUA 3GAMA 4IS2A 1WSAA 4RVHA 3ZUGA 3EWNA 2CLMB 4JSYA 3H13A 4XCXA 5CXQA 2IZZA 1DMRA 2HADA 4K9LA 2JFBA 5E2AA 2Q0XA 1K6EA 1T35A 4CF5A 1H3EA 1ZMRA 3BTVA 4Q00A 1J2YA 3B3JA 2INGX 5EXPA 1US8A 3JALA 3VPGA 3A6FA 4RJTA 4MI3A 2G3YA 5IEJA 3HB0A 5JLAA 4IHKA 3DLBA 1D1QA 1USKA 1U7UA 5BOVA 1CRLA 5FWXB 4P5PA 2IFTA 2JJYA 3LBAA 4NI5A 1BJTA 4RNCA 4I3HA 3ZQ6A 1KOJA 5KWSA 5H3CA 8MHTA 1RLIA 2OR3A 3MMNA 4O59O 1ECCA 1OPRA 2QXTA 5F1KA 4X8OA 3OT4A 1AOXA 2WWGA 2WBLC 3JXEA 3CBQA 2YJ4A 3PGXA 2QTWB 1DINA 1TGYA 2HV9A 1C7IA 1WZUA 3GJ8A 3LS2A 3L6DA 4JIMA 1KNQA 1CEQA 5BVHB 2NVWA 3TR0A 2I2CA 4F93B 1PG2A 3F1KA 2PD3A 1SUIA 4G5HA 1IE3A 4B3MB 5JECA 1J5EB 3NHUA 3JQBA 1AQIA 1IXSB 1DEOA 2F1IA 4LS3A 5JDCC 4W5QA 1FS6A 2SKCA 1O08A 4HAWA 4L95C 5I5GA 1YBFA 3KWMA 2FY8A 1KJZA 3K1AA 3SFVA 4CKBA 2IPXA 5ADUS 2Z3ZA 2XMPA 3DBLB 3SAJA 5LP1A 2TYSB 4KI7A 2XPCA 5AI9A 4UZEA 1VDZA 1P0IA 5DLDA 1CNEA 5HUJA 2GKSA 2BYTA 5FWYA 4JI4B 2EATA 2ZB8A 2GETA 3ENKA 3ITKA 2C31A 2C59A 4LJ4A 3JQ8A 4YJ3A 2OFPA 5T4BA 3V4PB 1I36A 2IGTA 2X8AA 4ARVA 3R4CA 4HS4A 1EDEA 2QW8A 5A3SA 4CQLB 2G83A 4AP6A 5ITWA 2A3RA 1KI4A 4ZOBA 1ESEA 3E18A 2XA2A 1L5NA 4EY5A 1JIIA 1NY6A 4NEQA 4RDCA 3CURA 1QK4A 4ZREA 4BRUA 4ZYUA 3F8WA 1E2KA 1RQRA 3I4FA 5ES4B 2MINA 3RUFA 4CMJA 5KYXB 3NTRA 3JZIA 2O5EA 2A0KA 2D1RA 2PCJA 3NONA 3W1WA 1OPXA 1WB9A 3KR9A 1SUSA 1E2QA 1MJGM 3PHJA 2QIOA 3PUHA 4TXMA 4C20A 4N48A 1G18A 1YE5A 4G5OA 3HVUA 4LJRA 1K7EB 1OF1A 2ZBUA 5A03A 3TLBA 1J2JA 3WQRA 1DBWA 2FNAA 4S35A 1TRHA 1BVYF 1E69A 1NBMA 1A5BB 1QVWA 2P2DA 3A4NA 3JRXA 5CNMA 4MV9A 4JFAA 4BUZA 4AX4A 3WLFA 5MF6A 2ZT8A 3FG9A 4E4RA 5IAJA 2A9OA 4CV2A 1BEEA 1JLLB 4AJKA 4JT4A 2FA9A 5ITZB 3LDFA 2PZBA 3QKIA 4TMFA 2JJMA 2GRUA 1I2CA 3ZE2B 2G77B 2YWBA 1N92A 9GPBA 4HHEA 3E4CA 4ZOLA 3I61A 1II0A 2ZJ8A 5LM3A 3D4NA 1D2NA 3QVGA 3TQQA 2PUFA 4FSDA 5AOAA 4BEVA 3OT5A 1VL1A 2OENG 5LLSA 4KH1A 1ISSA 1X87A 3ABOB 3E53A 1KDVA 5TDHA 5AVVA 2I5PO 1U1FA 2VRWA 1SCUB 4NX2A 3AUXA 3AEYA 4R2MA 1TYBE 2QYTA 4YJFA 4CMCA 1CF2O 1SXQA 2B21A 1S5PA 3N8KA 5L8VA 3OOEA 2WA1A 4N5DA 2GM9A 2OZPA 1DQYA 1YIOA 1CG6A 4PVCA 1YU6A 2HMSA 3DG9A 3TECE 3I2YX 1KC1A 3FYDA 3M81A 3VAZA 3PC8A 3GNLA 2BSAA 1XRNA 2BFFB 3D3KA 1QS0B 4G0YA 2EKBA 5ALGA 2NYVA 4HJRA 4ZT3A 4XM2A 2ZEJA 3AVQA 1PJ8A 1PGQA 2JGRA 3UV6A 5B6IA 4ARCA 3O47A 3IE1A 1UWCA 4Y2QA 1L7QA 3VHXA 1F6DA 1B1AA 1OFGA 1XK7A 2FPMA 3GEHA 5CNIA 3E5RA 3IUEA 4KCGA 3B5JA 1NNEA 1DSSG 1C3LA 3KKPA 3MAAC 1WW8A 2WTAA 4Q19A 5T5QA 2ETVA 5CG1A 1VZ2A 4ZT5A 1GVNB 1AE1A 5AM3A 3WQSB 2RFLA 5FYQA 2R9VA 5LB4A 1NE2A 2QD1A 2XMDA 2E3JA 2ZYIA 2WM3A 1TLTA 1GJRA 4Q4HA 1A2OA 4G1UC 4G23A 1XVAA 3PDIB 1Z08A 3TRDA 3O4GA 3PXCX 2QD5A 4BV8A 4X60A 4ZVUA 4C4ZA 4JODA 2NTVA 2FPPB 2OCPA 2TMKA 1H6DA 1W88B 1Y6QA 3F46A 1Q1BA 3OAAA 2YV1A 2IZ1A 4X1KA 3WLOA 2F1KA 4AJHA 5JAHA 3KXKA 2YN4A 2P79A 3JTMA 4RHXA 5DMXA 5DP1A 4BIIA 5GM1A 1CY1A 1RP7A 2XADA 2Y8EA 3PQ4A 5HF9A 2NP7A 5LQCA 1WZEA 1UUFA 1AKYA 3W9UA 1PL6A 1EXWA 3EC7A 2BEVB 3AF2A 3H1EA 1OX5A 1BXRB 1QQ6A 3HKEB 3LIIA 3N8GA 1NW8A 5IVDA 3L41A 1FW6A 1ZGBA 5F9HA 1ZNYA 1J7JA 2G7MC 2JKZA 3F3KA 4L6CA 4RPHA 5DYYA 4B48A 2BUAA 2HUNA 3PR2B 4PG6A 2QRQA 1VCNA 3VXKA 3SNHA 3UQYS 2OPHA 3KSRA 3G2QA 1QIEA 4XDHA 3M6LA 1FFHA 1VRWA 3BPSA 3UW1A 3WIOA 1L3CA 3QWFA 3FCSB 3P26A 3GDGA 4B6OA 3T5AA 4FONA 3SVTA 3VV3A 2R1VB 1YBHA 2B4YA 4F5YA 3ELUA 1C4KA 1F2VA 2X8WA 2JI9A 3OLYA 1TYEB 3AJRA 2CHQA 1XDBA 2DJIA 4U39A 1UKYA 1LDMA 2HQBA 3RFCA 1Z22A 2NWQA 2ON6A 4GI3A 5JATA 3O83A 4Z1OA 3I23A 2PMFA 1UC8A 2HRZA 3LGXA 2XMZA 4OMFG 4GDFA 2OCDA 1Y34E 2ZBQA 4KXLA 5HF8A 5EP2A 4QPPA 1UKAA 4P58A 5FUVA 5CFRA 3ZY3A 2QR3A 3OZWA 3F5FA 2VP6A 2XJ9A 3O9MA 2R00A 3DMGA 2AFHB 2G72A 3O8CA 2IDMA 2PU7A 4LRSB 3UT6A 1A4IA 3WBJA 5I5EA 1D8TA 1T9GR 3L3BA 1KOLA 2YYAA 1I7NA 1IWPB 2OCXA 2VPIA 3A4YA 2RGWA 4YV1A 2CV2A 2GN9A 1A1SA 4PZ0A 5J59A 5JS2A 3MMZA 4GFDA 4GI7A 3LT4A 5B2FA 1YE3A 4I3GA 1J9EA 2YY7A 1ECJA 2RGGA 1E2DA 5GOZA 4P7GA 3KKMA 5ALVA 1OLXA 4WXMA 3E9DA 2FPXA 2JAUA 3BGIA 3RRYA 2O7VA 5LN1A 3C1OA 4AJOA 1CEEA 4A8JB 1XZMA 2FP3A 3I1FA 4HH4A 2IUEA 4S24A 1NG9A 1NUQA 1RVDA 4R81A 3JWHA 3ZD9A 1IN8A 5FH9A 3BWDD 4JQOA 3PICA 4B6FA 5HKKA 5IBQA 4HLDA 5KX5A 1FOEB 5IZCA 3GLFA 2IOHA 3IR7A 3OTOB 1N77A 3MB8A 2Y99A 4EL5A 4LXGA 1PNRA 1VIVA 2P6PA 4FMDF 2B1JA 4XJSA 4YWHA 1KDYA 4FMBB 2BGMA 4RE5A 2D74A 3H1FA 2C4WA 1ZWLA 3R6GA 2F3PA 2BFDA 1NI4B 1WPRA 3QVTA 4B75A 2X0KA 4M0LA 5IUNC 1SEPA 4M49A 2E49A 4OKNA 4BO9A 3L46A 2H48A 5EUQB 1EFVA 5DHAA 1DEHA 3PNVA 2UUAB 1E8MA 3B60A 2DBRA 4RMJA 2PKEA 3LHKA 4Z54A 5E6SA 3RC8A 1XZEA 1Q14A 2WHPA 4FMPA 3O03A 1H3NA 3SICE 3GEGA 4JLKA 2HF7A 5GY7A 1TW2A 3L06A 4EHNA 5CDHA 1R50A 2RAUA 2D5CA 2Z4TA 3SGLA 2XDWA 1Q19A 1NF9A 2EVWX 1F0YA 2QE6A 2ZWVA 3W5HA 4FFWA 5K0ZA 4MR8B 1TCCA 1HR0B 1C14A 1Z4IA 1QIJA 5H9VA 4BUCA 1GV0A 1S8FA 1YR6A 3NVMB 4DGSA 1NJFA 1Z5VA 2A1TR 2QMOA 3R5FA 4PG5A 1A2QA 3I76A 3GEPA 5CAEB 1UBEA 1T9ZA 2V7VA 1VLZA 1ZBQA 3OD1A 3KBOA 1WCIB 4GPD1 2HBYA 2WF6A 4JN6B 2WDZA 3EVZA 4LMAA 4LCBA 3HBMA 2WOOA 3DB2A 4PF1A 2OKCA 1N5RA 2IYWA 2ECFA 4BYGA 4F06A 3IOBA 5EYPA 1IBMB 4TQAA 3WA7A 5HMLA 1INLA 5AVOA 1KAEA 3TL2A 3VAYA 3KOOA 4LY9A 3REQA 4MUFA 4E07A 2CNDA 3LC7O 3LPLA 1QGAA 3JQPA 4BNNA 4CM5A 3R0ZA 4OP3A 5ARBA 3IAHA 1GL9B 3CH7A 1NVEA 2HWUA 1YSCA 2QSUA 3GQVA 2OAEA 4M9UA 1OWLA 2I71A 4X7PA 5KZMB 3GW8A 4AJ9A 2J85A 1U7PA 4BP1A 2V03A 2OORC 5J4YA 4WCVA 3UMMA 3NT5A 3NTUA 4RSMA 4H9GA 3T41A 4LF5B 3K35A 4ZV7A 3I09A 5HK8A 1Z4KA 2XY4A 3S8YA 1RHJA 4AB1A 1L7VC 1O6BA 2MYNA 5IAKA 3TIIA 1EVIA 2IOFA 4REMA 1FP1D 4OFWA 2H1CA 4I4TB 1LCIA 4U7FA 5HCNA 2ZJFA 1MVOA 3M33A 1HDRA 3H9CA 5CBKA 2UZ3A 4PYLA 3DV0B 3GJ3A 3N70A 3SIRA 4KQGA 1GNSA 2NU8B 4F46A 3HO1A 4B34A 3DF9A 3AUAA 3EASA 4CEIA 1QH1A 2YXLA 1JMVA 2JL1A 3FWYA 4GM4A 3RABA 10MHA 1ZCJA 2RI6A 2AOVA 3P9NA 2GLTA 5FTLA 4V3CA 5FPSA 4MMXB 3FXAA 1WSBA 2YW2A 1K7SN 1XQXA 4RA9A 4PAOA 1T29A 4I6GA 3ZTWA 1IZ7A 4Z0PA 1YKSA 5HJEA 3V1LA 4E15A 5CK5A 1HEUA 1Z0SA 5JH7F 3TJZA 4MZXA 2YZMA 4KN6A 4H1UA 4HAVA 4CDNA 3P8ZA 5AVTA 3UJ3X 1WTCA 1NDQA 1AU9A 1QK5A 2KW5A 5TIIA 1SVSA 1YRBA 3CW8X 3WJAA 3L1UA 1ZWKA 1LW6E 1KJ9A 3MLEA 5ILGA 1N9ZA 1DDIA 4OSOA 4R5HA 3G82C 3D4BA 5JIBA 1KJIA 3KUUA 1F38A 1E6MA 1T6YA 2QUJA 3IP9A 3AU9A 1CD5A 3C48A 3LMKA 5P8WA 4N03A 1FLDA 4C1BA 3C7CB 2DKNA 3AY6A 3D6FA 4XWTA 5THXA 3UUEA 3ZHBA 1KR5A 1U99A 3H9QA 5LXTF 4CGZA 1PTJA 3T9DA 3T3GA 1F5SA 4C4PA 1CZRA 4H77A 1G21E 3E7WA 3SZGA 4LOJA 1YJXA 3GLHB 3P9PA 1AXGA 4PR0A 1PFKA 3UHOA 1DIGA 2NYUA 2XQVA 3EF0A 4PX9A 5E6UB 3STTA 1W4ZA 4YJHA 3V8RA 3IELA 1GYPA 2J7PD 4LXUA 5DGXA 3SHQA 2P2YA 3F5MA 2V7WA 3QU7A 1JZQA 3OTWA 5JFOA 4I55F 4MO2A 2FDCA 3AV3A 1E2PA 3Q8LA 3NJ4A 1RQNA 1EVQA 1W6RA 1ZK3A 1MEOA 2HA5A 3HSYA 3IQGX 1KOGA 3HV0A 1NRJB 4CDGA 2YR0A 1W2GA 1SOUA 1BCSA 9LDTA 2YYYA 4MVJE 3EF1A 3VZQA 1AS0A 2OTCA 1IM2A 2YJNA 3F3YA 4G09A 3N2YA 3N76A 1XJ5A 4H6VA 1M2KA 1TAQA 4MUBA 3EW9A 3RBAA 5JYDA 3AXTA 1XXLA 3GA7A 4BCDA 5TMPA 1DBRA 1N7JA 1XDDA 2EBHX 2O0HA 2H4ZA 3GOQA 4UUPA 4GEKA 1M2EA 4KXXA 3T3NA 4R1PA 2V7XA 2E4VA 3VTZA 1SBNE 4FLMA 3KPYA 2GAIA 4ZI5A 3RSHA 5I7RA 5HW0A 3H2KA 1TZJA 5C7IO 1OLSB 1TYZA 4L0DA 1ESMA 4M0KA 4UOEA 2M6RA 2V65A 1WCYA 2VQFB 3BIXA 1QZUA 2FWAA 2RSLA 4P82A 5M5BA 4DM4A 2OXFA 3RSCA 2FW9A 1EXMA 4LK3A 4BFCA 4HB3A 2O1XA 2PKXA 4OAPA 4X85A 3R7LA 4C0BA 4OGGA 4LZPA 2HAEA 5AD1A 4M8IA 1WVIA 1CZKA 1Z75A 2BF4A 3PLNA 3QPWA 2B4KA 4YDSA 5KINB 3KK0A 4UVEA 1SXPA 3DC2A 4URVR 2FPIA 1GSHA 2X5JO 4CKCB 3A11A 4AS1A 1EIZA 1QV7A 1E1NA 3JWPA 1JWAB 1D2AA 2WHYA 2XQFA 4D9GA 3JYNA 4E32A 5J2UA 2DEUA 4C6TB 1S89A 3ZLBA 5CFNA 1PYGA 1JFFA 5EESA 1X13A 3QEBZ 2HF8A 2P6MA 3FFTA 4WFQA 1WP4A 2QQEA 5KYKA 3C5HA 2CW5A 1SXIA 1X1AA 2H52A 4DTIA 1W7AA 2VDPB 1QHHA 3SF8B 2BVNA 3FNEA 1DFIA 1M6HA 4QA9A 3UUFA 3K71B 1N34B 4P31A 4KQ9A 3ZVNA 1A7KA 2YQZA 1U8EA 3A2LA 3O1LA 4MGEA 2VYVA 1SBYA 4KWIA 4US1R 3VTFA 2FR8C 3EX7C 3FNRA 1YQGA 2AX4A 4C03A 5G1NA 1G5QA 2I76A 4NYMQ 1Z6AA 2WJHA 3OZDA 1TUGA 3QVLA 4P54A 2QN6A 4ZP1A 5BUZA 2QI9F 2VDMB 2WM2A 3TXAA 4ZMRA 3F78A 4MW7A 3UGJA 5AKJA 3P9QA 3ICOA 1L5HA 1LLDA 2X9GA 1TM5E 1BCRA 2KBEA 3C3DA 2NYRA 4LJAA 3LOUA 1WXDA 1ZD8A 2NACA 1GYQA 1S7CA 5KOYA 1SCDA 2FUCA 1OSNA 4IVQA 4LBZA 4AY3A 4MWBA 4Q4LA 4G5XA 2W58A 3STVA 4HZGA 4E7PA 4EUNA 2E5FA 4GBJA 4Z53A 3RVLA 2GZRA 5DNEA 3WP1B 3W34A 1VOTA 2ZJOA 3LWNA 3MF4A 1Y7TA 2WJ6A 1KPIA 3SZRA 3AEUA 4RCYA 1RMQA 3TS1A 1R4MB 1UAGA 3S68A 4ECAA 1RE1A 2JVKA 3WL8A 4TL8A 4REQB 3UWPA 2RI0A 3LHIA 3C4JA 1PP4A 3GEDA 3MWDA 4F2GA 5BMVA 5JMOA 4KRGA 1W1WA 1RXYA 4IX1A 3I8OA 3W06A 4P6VF 3C1AA 1N2XA 1J56A 3IAFA 2YBEA 3FSGA 5AM2A 1ISMA 1QRDA 4FEYA 1RZUA 4HYEA 4K5QA 4LK2A 4DYDA 2YNMD 2HNBA 3R3UA 5DM1A 3PNBA 4CI9A 3OQ1A 4JHLA 3NG1A 4TQ9A 1DAGA 2W6PA 2EQAA 3TZHA 3BC1A 3RUHA 4F4IA 2AEJA 2ORED 3V8BA 1PDVA 1C0PA 2P1ZA 4PC2A 5DRTA 1QB8A 3WGKA 1D2HA 3KNZA 3UB2A 2PMEA 2OBYA 2XE7A 4S1NA 2MSEB 4IHJF 3I6ZA 3ZI7A 4EFLA 3QELA 3RHTA 1ENZA 4B3SB 1YL6A 3ZHTA 3GDWA 1V25A 3R7NA 4NZPA 3O9ZA 3D3WA 1W2HA 1XIVA 2P11A 3JAWA 1VTKA 2JH8A 3H4MA 3H97A 4OOEA 4BQNA 1OLUB 4CPDA 1QKIA 2VZ8A 3SJZA 4HDRA 1IEXA 4ZAGA 3ANSA 2DR2A 1QQAA 1GKKA 1A2BA 1GN9A 4OHCA 2DPMA 4Q05A 4EG0A 4EAQA 5CITA 2H5LA 4NCKA 2YQ4A 3H6KA 3THYB 2BZ0A 1O3YA 2G6BA 3COWA 3FVWA 2H7YA 3UJ9A 5GADl 3ECCA 4MW0A 2R1UA 4K46A 4MX8A 1RRGA 2XQGA 3PPXA 4YP1A 4O4JA 1ZOSA 4UVDA 3W5AA 4PAGA 3JQAD 3TD6A 2FI1A 2OHXA 3DVAB 4MUNA 4B31A 1YDGA 2RB4A 4OLBA 1K8QA 4B9AA 2FSVA 1GTVA 1M6EX 3G0BA 4KE7A 8ABPA 1F17A 4JJ4A 5DXFA 4D45A 1FX0A 1DL5A 4WZBE 1KDTA 1ITZA 4QVKA 1I7QB 4NARA 2FXIA 1TLLA 2QUZA 1T3ZA 2EG5A 2AC2A 1QBGA 2YBDA 1Z47A 2WKSA 2ZRDA 2PT7A 5KWJA 2X9VA 4KG7A 1KI6B 1UDCA 4UEKA 4HB4A 2HZ7A 4CTKA 1LZLA 2VS1A 3ENNA 3G79A 3R7SA 5B3KA 1Y80A 1C3VA 4EO4A 4ZOCA 4D9BA 1DRWA 3EIHA 1Z0ZA 3LY8A 3OLVA 4WCFA 3EZ6A 5KNBA 1Z6TA 1EB9A 1QMGA 2EARA 3D43A 3NJ8A 5AKHA 4Y98A 1XDZA 2AYXA 5C5CA 2GK6A 2AWNA 1L4KA 2ZIXB 3ZE6A 1F2TA 1ORTA 1JJVA 2QN9A 4RACA 1IIRA 4ZT7A 1EWTA 4GOLD 1N36B 1N6NA 1JJBA 1LTHR 2VPXA 3LT0A 3DMTC 1GPYA 4JUCA 4WT7A 2BONA 2ZG6A 1TCVA 4RZ3A 2PSEA 2PX3A 1KJ8A 3BAFA 2RH8A 3KKZA 5LJLA 3UCXA 1E1DA 3NHKA 4IJ5A 4OXKA 4UTZA 1PQYA 2DPHA 3HUEA 3ZVLA 3TUZC 4FINA 4NICA 1KEZA 3DJYA 4MWEA 4R2WA 1V96A 5CEEA 2ZYUX 3F49S 1GAJA 2BEKA 5CLLA 5J2TF 1X1EA 1C8LA 3CF6R 3H0KA 4CTMA 1XTIA 3K53A 1NXOA 3AZOA 2J6BA 2R0QC 3I58A 4HZIA 1HNXB 3GRCA 2FQYA 5HRCA 1U3CA 3ANLA 1UFQA 3VVCA 3DXFA 1WETA 1Z4NA 3E0QA 4TYMA 3GDFA 1JIQA 1GDDA 1YHNA 2IDKA 3LUKA 5CNJA 3RU3A 1RM0A 3EVCA 1ZM4A 3IS3A 1Q17A 5IFLA 3UOGA 4RFSA 3MINA 1IY9A 3FOBA 4G0UA 4M21A 4QIHA 3PUKA 5LP6B 3BEDA 3QXSA 5K3FB 3QKRA 2Y0BA 2JD2A 3L49A 5CMLA 5DTIA 4F45A 4QXAA 3SSOA 1E32A 3EXEA 1T9CA 1GCOA 1EP9A 1HXHA 2WMOB 3V00A 5EKUA 5CD1A 3G5TA 4R9VA 4LF4B 5AW8A 2CMGA 3L6EA 4N54A 4JI1B 4D3SA 5JS7A 3OQ6A 2AN4A 2A92A 1OI3A 1S8AA 3D5QA 1RJWA 3K9QO 4UAGA 1W25A 1WU8A 2FRDC 1P3DA 1K2WA 2V3WA 2Y77A 121PA 2WJYA 3AJ8A 1TQ2A 1G5FA 4EBBA 1IZ8A 3DT8A 2NQ8A 1J9GA 4U4AA 4BHTA 5JSZA 3WO1A 3OM9A 1KBQA 1OU4A 3VYTB 2CMDA 4RDIA 1MENA 4LNUB 4OMUA 4YQFA 2VLBA 4ZV9A 2PH5A 2FVXA 2RGXA 1WBBA 5FHRA 1XD8A 2HHLA 5EXEA 4FZJA 3ICCA 3VX4A 4DVJA 4XYLA 3ZBTA 1TMYA 4Q9AA 1B8NA 5AWFC 4R41A 3OPYB 1G6Q1 1JPUA 2FSGA 3JY6A 2NU7B 4MW1A 1ATIA 4R1SA 2B20A 2PXXA 3PFKA 2JIDA 1UOEA 3FPLA 3P27A 5ULLA 3SIXA 1MJGA 2XDYA 4FZVA 2DWQA 3SC2B 4QREA 1GZHB 4C0KA 2NOAA 3O1JC 3UMBA 3U16A 2H3HA 1BD3A 2GARA 4AYTA 3PFWO 6REQA 1HTBA 4NE2A 1MMFB 2G1KA 1B74A 4YREA 3Q0IA 2HMYB 1HDZA 1NP7A 3AI1A 3OPYI 3WKDA 4E5NA 4E70A 3SC6A 3X43A 1FFBA 3PLAE 1VJTA 2XCRB 4F97A 1CRZA 1J06A 1KFJB 3IR6A 3WK4A 1WOYA 3FPGA 2VZ9A 5BVHA 3IA7A 5TRTA 3FPHA 1K63A 1WWKA 5A7FA 1NMEA 1EGAA 3BWXA 3T06B 2JBWA 1NBWB 2WTEA 1E8DA 5KJEA 5JAPA 1XN4A 2RONA 4DMKA 4DIUA 2CUZA 1ZVKA 1I1HA 2BRUC 3C6XA 3M9LA 1HTWA 3Q9UA 4ZHQA 5KPJA 4MVJD 3QBDA 2XUAA 4OLAA 1P7VA 3KOMA 1XL1A 1TTHA 1VA4A 1JVBA 2V54A 4OG2A 5D5HA 1Z2CA 2ZVJA 2C8KA 3NNDA 4GBED 3VYVA 3DDOA 1YACA 5EWLB 2YRFA 1KKLA 3IIMA 3TSZA 4Y2PA 3K1YA 4FDAA 2JFWA 5CRIA 4R8SA 1L5VA 2FLWA 2Y0EA 5GJCA 2GFQA 3UBMA 1PG5A 5M04A 1Z56C 3W3AH 1MXHA 4MWOA 4RSRA 4HQLA 1GFSA 2Z3WA 4PLYA 4HH3C 4UUQA 1Q0SA 5DOVA 3OC0A 3ODPA 2ZYDA 1FDOA 1H2RS 4CF3A 1YVDA 4CM9A 1TLFA 4ZRDA 1RPAA 4BFUA 5LZ2A 2FXVA 3LFHA 1QHNA 2WSLA 2WYIA 5G1OA 1UAYA 2JLWA 2OXRA 4LYYA 2ZIFA 3VR5A 3F7TA 4AECA 1R0SA 1MJ5A 1YJQA 2C9ZA 1FDVA 2NZ2A 3CHYA 2Y9MB 4OHKA 2I1QA 4EARA 4B3GA 1PFVA 2IHNA 1H5QA 2HJGA 4KUEA 4H6XA 1E5XA 1XXHE 2K4MA 3C3WA 4MW6A 4ZYLA 4IDHA 1VLQA 3AI2A 4JLWA 2I7VA 3HR7A 1D9XA 1R3UA 1VGQA 1IXYA 1I4LD 2B0CA 4F85A 4P7KA 3JQ7B 1XEWX 4HSEA 3T8YA 1JX6A 5C1OA 3O84A 2CLSA 3O9VA 3HFRA 4N0DA 2VTBB 1JFVA 4NMWA 4URFA 2RK6A 1D2RA 4HYTA 3GCGA 4LWOA 1SUEA 2IEZA 4DPMA 3ZVKA 5ITZA 1T9AA 2C04A 4TV8B 3AEQB 4IV0A 4ZYVA 3N0VA 5THKA 3T1YB 4JLJA 1QGED 2JFOA 1WABA 1DJMA 2BKXA 3C70A 2VDOB 5I3ZA 2LTAA 5CDFA 2E18A 4H3HB 3FGOA 1Z4LA 4KVGA 1DEKA 1DBQA 3OH8A 4Q9KA 3RU7A 3HKBA 4K9NA 3OJCA 4NXMB 1QPZA 2VAVA 2WUFA 4TUYF 3HBFA 3BRWD 2XA9A 4HAIA 3OTHA 3HXPA 3GV0A 4IUDS 1F2DA 4QEZA 1SCUA 1AMUA 1E3JA 2P30A 3GROA 1Y8QB 4FYKA 2XCLA 3QW4B 2EIXA 1RJ9B 3HI6A 4UZSA 3JARA 4C08A 3KLBA 1TCBA 1UR5A 2IYNA 3E7DA 4QUJA 1SCNE 3ZJ5A 1QYXA 4OV6B 3GZNA 1RXSA 4XEHA 1FTWA 4C7MA 1U02A 4QOEA 3GT0A 5TPZA 5CFLA 1X77A 1OCEA 3HYRA 5F1PA 3OPVA 3DB1A 2B4RO 4URZR 1KQFA 1BMQA 2GPYA 4GLLA 2AN5A 3EMDA 3WV5A 4Q3LA 4C2AA 2OUIA 5LWQA 1P7ZA 4M46A 1PWHA 1T1JA 2B61A 4R05A 3ZW8A 2YJZA 1KOFA 1TKBA 3QKWA 3S6JA 3TQOA 5LZ4A 1G38A 2K5UA 3G2MA 1Q0PA 1LA2A 1QSGA 2B2NA 3AHCA 5C8YF 2ZSIA 1N1MA 1U2GA 1QTRA 4BFSA 3FE2A 3GFGA 2ZBPA 4FX2A 4AJ1A 4ZVTA 5EMMA 4EO9A 5KJ6A 4KIGA 3WR5A 1H5NA 3NWEA 4HYYA 1T4CA 3OZAA 3KU4A 3OY2A 3TBKA 4KLNA 4EI8A 2XMGA 1CQIB 3SBDA 3WGNA 4TYNA 3PUIA 4IGKA 2QTRA 5IN5A 4E31A 4JS0A 5TARA 1J1IA 1NE7A 1I24A 1R7RA 1SAYA 1VC2A 3AR5A 1R0CA 4HZUB 4RLFA 5KOJA 1XPRA 5ICGA 2IUYA 3ORYA 4IVPA 2EHDA 5EHNA 1Q11A 4UFNA 4ISCA 2BKEA 3P52A 2B37A 5HE8A 1R0BA 1GPDG 1X1BA 4N5IX 4N76A 2Q62A 1RHRA 4NQZA 4KFCA 2AZ4A 2CB0A 2XTZA 5EZSA 1W9HA 1TPZA 5F3RA 4LX8A 5A9SB 1O5OA 3NVKI 3LWDA 4QTTB 1O0SA 1H6AA 4J90A 3KLMX 4E5PA 2UXBB 4BKRA 3TMYA 5LKAA 1DT3A 4P80A 1R00A 1GZUA 3TZKA 1MIOB 1GPLA 5JBNA 1OB2A 1W52X 3UENA 1ESDA 1OT5A 4MCHA 2BP7A 3O0DA 1MDFA 3KT3A 1AQ6A 5D01A 5L95A 1M2NA 3L4BC 1T9HA 2EJTA 1OA1A 3R5KA 4LCJA 4GNKA 1B3RA 1JKFA 4HMOA 4MPTA 3ZY5A 1QVZA 4G0PA 3CNQS 5AJZA 2NP6A 4QASA 3OF2A 5E3JA 4KR7A 3VZSA 3O38A 3TTUA 1Z7YA 2XIQA 2M2IA 2B99A 4E1AA 4Z4GA 1V3QE 1GLGA 2FUEA 2G67A 3AI3A 3P9KA 4LF9B 1QWOA 3RVRA 1MHPA 1GRRA 2GBLA 1IBSA 1VMKA 1SRRA 2Q2OA 3E2PA 2CD7A 5DE3A 1ODTC 1RHQA 4TVKA 2OHJA 2RGNC 3GA0A 4JVLA 5CCBA 1KDOA 1VA5A 2NG1A 1KYVA 1R3DA 3VKUA 1MP0A 1ZU4A 3MMSA 4KPUB 1IN1A 2W90A 1LJ8A 2LP4Y 3BD8A 1ULBA 1F0KA 1OFUA 4ZC1A 2QQ5A 3U4GA 1BWRA 2AFHA 2WHXA 3D4PA 4EAAA 1N5MA 2XZPA 5AFSA 5GINE 4BMZA 2JLCA 4CM6A 3QUQA 1C29B 3D8UA 4GRDA 4C4YA 4R2JA 4CIBA 1LNQA 3SC3A 3EQ8A 1ZLXA 2Q28A 3O6VA 3PCXA 4LRQA 1YFJA 1NVUQ 3FMPB 4BNLA 4ENPA 4RESA 1HT3A 1OC2A 4H3VA 5L3QB 2ZUFA 1CK4A 2AEEA 4P98A 5LSAA 1OYOA 3LYUA 3BDIA 2OZLB 3LUDA 1C30A 1M6VB 1V9SA 1W94A 2FZLA 2IW1A 2XVZA 4GO1A 4D8VA 1JJIA 5IUJC 5FWNA 3CZCA 4NL4H 2XYHA 4CF4A 2JHPA 4BKPA 2VJBA 5K4HA 3K9CA 1UZNA 4KDFA 4EJSB 4JQYA 4JI6B 1XU9A 1KMIY 1NVVR 1P0MA 2WTNA 3DKPA 1JYFA 2DHCA 2VWHA 3OI7A 2EHJA 3QUAA 3NDIA 2ADMA 4A23A 1JF8A 4KW7A 2ZIGA 3ZR4B 4Q4CA 5CJJA 4YRKA 4OHFA 5D86A 2ZAYA 2WP8J 4YQEA 3T4UA 3OLCX 3FM9A 1A9PA 5BSGA 3I92A 4R4JA 3IL2A 1QBKC 1XDUA 4KSCA 1N0WA 1MT3A 4KR9A 4A6XA 2UVPB 4G4GA 1SCKA 3K4QA 4IIHA 5U1PA 1R6UA 1RQGA 4CMAA 3VVLA 3D8NA 5KYGA 2CNKA 4M9RA 2GHTA 2XV1A 5D8DA 1EZZA 3RS0A 3OQPA 2EJUA 4R5MA 1YDHA 1QU3A 4BCBA 1MB2A 2HT1A 2YZGA 4H7KA 4U2DA 1GFWA 1V8PA 1O96B 4O2AF 3R40A 1NULA 4PZYA 5DYWA 2NUTA 1UPUA 2GHIA 2P2NA 3LX8A 2FMIA 1GZVA 2PNJA 1NYQA 4PZPA 1K6IA 2R4QA 2P9ZA 4FU0A 4IIGA 2C20A 2VBFA 4LJ6A 4MXDA 4ERXA 5IVKA 5E9QA 2ZIUB 1A9YA 1DO8A 3BE8A 3CEAA 4MR8A 4WASA 1NUTA 1RHMA 4Z7NB 1GUYA 1KYZA 1Z0DA 5AHWA 4ZARA 2WR8A 3KUCA 5ER9A 5FOSA 4A8PA 5KIAA 3H5NA 3CLTC 2LPMA 2VA8A 5CAEA 4NBSA 3B7WA 5JD4A 4DVGA 2DHEA 2F1OA 2ZUTA 4LWPA 1AY0A 1SU7A 3GJ5A 4R84A 1L5FA 4WKCA 3RS4A 5KTSA 2VSOA 3BGVA 1FTGA 1DGQA 1J2RA 4QOJA 5BORA 2WSIA 2CUNA 1OJLA 2A1UA 1NC3A 3QLUC 3R8XA 4FFMA 3U31A 5C7LO 3F8SA 1FJHA 2QTZA 1ZMOA 2WILA 3E27A 4A0HA 1QYDA 2DFNA 1RJDA 3Q3IA 4Y6GB 4D4GA 5ECYA 3FMGA 4ND2A 1HE8B 5KDDA 2AN9A 1VPDA 3HCNA 2FYTA 1DX6A 4M7PA 1BHQ1 1ODIA 3BD7A 4PGFA 2KS6A 5E4FA 3HB5X 3RUEA 3TIXB 4DL9A 5H0IA 4PYIA 4GVPA 2FSFA 4KVZA 1HOTA 5TQ0A 2J07A 4QSMA 1GGHA 3SCZA 1WF6A 1EP3B 1BDBA 2WVAA 3CBGA 5AQEA 1N5IA 4YCSA 1R1DA 1ZINA 1KYTA 1AKVA 1CUVA 1KK1A 1HA3A 3IVGA 4L9AA 4LGVA 3BF8A 3RK0A 5TMDA 3M1LA 3VYWA 5SY9A 1SVWA 1H3FA 1XZIA 1SFRA 4MJLA 2IW3A 3A9UA 1CJSA 2JEOA 2ZVDA 2ZIAA 3AW8A 4ZQFA 4D42A 1Q1NA 3EC2A 4INJA 2XNDD 4R31A 2ZWIA 2JFGA 4OFZA 4FQ7A 2DETA 1NBHA 1UZUA 2P4EA 4B81A 1JB9A 3AVTA 1VIAA 2EZTA 1H8HD 3P2MA 1RAGA 3CX6A 4QAQA 3VHLB 4AO8A 3PIDA 1OBFO 1TCUA 3MM4A 2VF7A 5LA6F 4E09A 1CQWA 1KY2A 2CNOA 3TNDA 3U9TA 2VO1A 3AF0A 3RT7A 4WZAE 4RTSA 3KL2A 4D80A 4A73A 1O95D 3ZDCA 1V39A 1RT9A 1UP6A 1XQ6A 5MGNA 2EERA 3FAZA 4MVJG 2EQ5A 1QQ5A 1SOMA 4MQMA 4DWWA 4EMSA 4TSRA 3F6PA 2QAGC 4ND8A 1FDUA 2DPXA 2Y1XA 3ZWMA 5B4TA 3P0RA 4X92A 1NW5A 4KIWA 5FCDA 4XDZA 1BU5A 1J24A 5JTTA 3P9CA 3OZVA 1FUUA 3U7JA 4TV9A 3WISA 3PFBA 3TRFA 4FYPA 2QX9A 1XFDA 1LPBB 2HWKA 3GLHA 1D3AA 4K8OA 3Q7SA 1AUPA 1A04A 1ZUWA 1EUCA 4NMXB 4X24A 2CCJA 5CURA 5E6UA 3TRJA 2NXJA 4EG6A 2PJRA 4D5GA 1KI1A 1KSHA 1G4AE 1EX7A 1QGUA 4RE6A 1V11B 1IK6A 3QE0A 5EGNA 1FRNA 1E79A 4NBLA 1JA0A 3O26A 1ODFA 1I7DA 4XWOA 3TUJC 2B4TO 4LECA 4EI7A 4Q93A 3I9JA 4X8MA 3FVVA 1Q20A 5HQ3B 3GUYA 3DFIA 2GN8A 3RGWS 4BOYA 4DMFA 3DOEA 4QZVA 1CY7A 1DAPA 5I7UA 1MX5A 1FDIA 1KIAA 1LC3A 1P1HA 1V7CA 2VP0A 1ZUNA 1G60A 1QCDA 4EY4A 2L42A 3T5MA 4CKYA 5KS2A 3A7EA 3MXTA 5IK2D 3A05A 1N6KA 5T41A 3WGVA 1PR5A 4RPCA 4ITVA 1AS3A 3TLYA 2C9BA 3ZHOA 1T8RA 5DV9A 1F0PA 3PHHA 3K9GA 3AETB 5IU6A 1GGVA 4QQKA 2G80A 4JYPA 3WKCA 5A5EA 5KNBH 3DKIA 4PRLA 3TPFA 3BQ9A 4YDHB 3FN4A 3U62A 4HRYA 3OM0A 4FE3A 3R3YA 1LVGA 4ZI7F 4P4SA 4MAAA 2ROQA 3HABA 1C7QA 1XZQA 4LMPA 1DTWA 2R6AA 4GMFA 1OGJA 2ZJ3A 3A7DA 2VI5A 1T25A 4DRZA 4CM4B 5ALQA 4ZAXA 4LQLA 4BB5A 3LAWA 1L8AA 2ZS8A 2VQEB 1PTKA 5IWCA 4RYLA 1BKDR 3NDJA 4FDVA 4BRWA 4C6TA 1IY8A 1E1RD 3ROTA 4FYHA 4YRGA 4WKOA 4KQFA 4LJSA 2PFKA 3LUCA 4IF4A 4XXHA 3ZDBA 1G42A 2UZIR 2WD7A 3AJEA 1P5JA 3RVDA 3K8YA 1AO0A 1EM8B 2RE8A 2VQDA 4GHWA 1E7WA 4G24A 4MQLA 5A4IS 5ADWA 2G1PA 1QIFA 5C7OO 1DVRA 2ACWA 4OI4A 2GZMA 1I3KA 4ZVLA 2IV2X 1XNJA 3U7QB 2HXYA 1W29A 1FNBA 2EFHB 2R6HA 4NFSA 1KAHA 3SP1A 4PFKA 4FI3C 5HMMA 2W6IA 4CNBA 4FDUA 5I45A 2D5AA 3CLKA 3F3SA 2PH1A 4KPFC 4KGXA 5GONB 4M1OA 2FMXA 4TTQA 3DL4A 4QU8A 1G8FA 3D1JA 1ZIDA 3RRZA 4AICA 5B3JA 4MQFA 2R7NA 2X4LA 3EFHA 3K96A 3ROFA 1E5QA 4GRAA 5IDQA 3CVVA 3NTQA 1HE1C 3ANYB 3H6GA 1VIYA 2QMZA 4H7HA 1DIAA 1LDGA 2WG1A 2UUCB 2PBFA 1KARA 3M89A 1T15A 5TLSA 4NMMA 2DUMA 2H11A 2Y1OA 2QGZA 3NBKA 5JWOA 5AI8A 3GZJA 5LCXA 4Y7CA 1H0KA 1S1CA 4QFCA 3TQSA 3U3MA 1S3SA 3MT0A 4ACAA 1YBMA 4BVLA 2VYCA 4F86A 4MDYA 3T0FA 3VDRA 3AGQA 4H08A 3LA6A 2J4CA 4IR7A 1H42A 3ZKWB 2GZSA 1TA0A 1AKNA 2I2DA 3OCCA 3ZK9A 3MJRA 1N3BA 2XCQA 4PAMA 3W90A 4AQYB 5AW3A 5AM5A 3CUUA 1IHXA 1PG0A 2NO4A 2WSSD 4YJ2B 1UM8A 1IOZA 3BHJA 3FCEA