1WO8A

Crystal structure of methylglyoxal synthase from thermus thermophilus hb8
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
126
structure length
126
Chain Sequence
MKALALIAHDAKKDEMVAFCLRHKDVLARYPLLATGTTGARIQEATGLAVERVLSGPLGGDLQIGARVAEGKVLAVVFLQDPLTAKPHEPDVQALMRVCNVHGVPLATNLVAAEALIAWIRKGTPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords methylglyoxal synthase
publication title Crystal structure of methylglyoxal synthase from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus hb8
total genus 46
structure length 126
sequence length 126
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.3.3: Methylglyoxal synthase.
pdb deposition date 2004-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1wo8A00
4A1OA 1BXRA 4EHIA 1S8AA 1C3OA 1EGHA 2XW6A 1S89A 1CS0A 1PKXA 1M9NA 1CE8A 2IU3A 5H3LA 2B1IA 1G8MA 1T36A 2YVQA 1IK4A 1THZA 3ZZMA 1P4RA 2IU0A 2B1GA 1OZ0A 1M6VA 1B93A 2X8WA 1C30A 1VMDA 1PL0A 1JDBB 1WO8A 1A9XA 1KEEA 1ZCZA
chains in the Genus database with same CATH superfamily
2JGFA 3ZH2A 1PS8A 4TLMB 1KFEB 5ALIA 4JI4B 4LNUB 3QU5A 2DFNA 1Y81A 1W59A 3LQQA 4J0CA 4XVHA 2KLHA 4Y6RA 2ZTUA 2OTCA 1ORVA 4W1QA 3C5HA 3RHTA 2J0SA 1YL5A 1ZESA 4P5DA 4RANA 1V41E 4L8YA 1NX6A 2AI2A 1SCUA 3CSSA 4E46A 5KQMA 1GPUA 2D4AA 2C2MA 3FTCA 1VXRA 1IY0A 1RAAA 3G89A 5IDXA 4NABA 5EN4A 1EG2A 4BEJA 4DTIA 1N1EA 1WP9A 1JQKA 5LP6B 1RLMA 2V9PA 4NF2A 5IYZF 1ZD1A 2V6GA 3A3YA 2XBLA 2EF1A 2OCAA 3L7CA 3JALB 4RF4A 4PPGA 4ZOLF 3LYAA 4O4LA 1T4GA 3CF4G 3EVAA 2GM9A 3D6VA 3I2YX 1XAGA 1G63A 2BDEA 4R1SA 2Q1TA 1FYFA 1N7IA 4GFDA 4UOEA 5F2OA 3BRCA 4BJ1A 2CFIA 3RYCA 4NULA 4RQTA 5SZHB 5IUKC 4DG8A 2X86A 3ORYA 1G6HA 1JFSA 4RQAA 1V8OA 3OX3A 4YRMA 3S2IA 5CBPB 2CSUA 1ORWA 3HLKA 2AOUB 1P0IA 3TTTA 2O3RA 3C8MA 3E7FA 3IH5A 3ITKA 2XITA 2X3YA 4DWJA 1D4OA 4EGFA 1R7RA 1WNFA 3RB8A 3TZEA 4HN4B 4I50B 3ZV3A 2JCVA 3GU3A 3ZNQA 5E7JA 4OGGA 2Z6QA 1MVLA 2CLLB 1X86B 2BFBB 3AEKB 2X0RA 1D0IA 5IBQA 4ZRNA 3RBVA 2YN4A 3NH6A 1WVIA 1SUAA 2JC3A 3FTEA 1D2RA 1KQFA 5LJLA 2XXAB 2OEPA 2QYSA 3BDVA 3COVA 1AHIA 1FNBA 2GAOA 2E5WA 4HWGA 1JBEA 3N28A 1G64A 3OZSA 3DBLA 4EW6A 3FRJA 4NDAA 4UTRA 3L8ZA 1II8A 2A84A 2I2FA 1HZZA 4A10A 3KKOA 4Q37A 3A8TA 4CV3A 4PGGA 2AS0A 4B81A 3V8BA 3TX2A 1S7GA 2CLDX 1RMYA 3OCYA 4Q24A 2GUGA 3L8MA 5C8YF 1IWPB 1CNEA 1IFXA 1T0BA 2XVYA 3WKAA 4KGXA 1ECPA 2H1CA 5B2ZA 3TIXB 4CCSA 4CUJA 2RGRA 3B2EA 3ZIDA 5EPOA 1QIHA 3PEVA 1IAVA 4B80A 1EINA 2JIZA 2RBEA 5AW7A 3D0RA 2EFJA 3IPLA 1P75A 5AOBA 4MGYR 3U5TA 2WSLA 2OO5C 4CW7A 1JEEA 3A9RA 2A0FA 4RD3A 1E79A 1B0PA 1VIAA 3IJRA 5DPMA 1W85B 4B34A 1ZD9A 2E55A 1ZUHA 2EP7A 5JQGB 1LFAA 2N46A 4N8DA 1XXHA 2IHBA 1G98A 3H1TA 1X15A 4FB4A 5B6IA 5BOSA 1UKCA 2JA1A 4OHKA 4HXFB 2HLDA 4MP8A 3DVLA 4JLWA 3GRUA 4EEKA 4EM6A 1ZJYA 1MORA 3TX6A 3V1KA 1UFOA 5IN5A 4XWTA 1KRXA 1B14A 1KPIA 1QVRA 3IXQA 5FADA 4DV6B 2C1XA 1KJYA 4JVNA 3HWRA 4D25A 4OM7A 5EP3A 4FP9A 2Q9CA 4K2AA 3ZNNA 5CCBA 1SOWA 2DCMA 4O4IA 4YP1A 2XDWA 1H94A 1I2MA 4I2NA 5EPEA 3V80A 3SLRA 2F62A 3NBMA 4X1OA 5JISA 1YDMA 3ESCA 4F2GA 1AZWA 2X9GA 3JAKA 4JJKA 1TF7A 4QTTB 1TYZA 4AU1A 4IRMA 2YV1A 2XWBF 1KFCB 4M9ZA 1GG2A 2VNSA 3E61A 4RPHA 4TQUS 5IC6A 2WQ6A 1U8FO 2BKXA 5DTRA 2WZDA 3GAZA 4X93A 5DNWA 4BE7B 2A5GA 1KOFA 4QEDA 3QVLA 3CKKA 5J1SB 2B9VA 5F5XA 4ARSA 1MZPA 1HE8B 1N5DA 2VWHA 5AXDA 1WZNA 3D4OA 3ORRA 3WP1B 2XKKA 4HQNA 3G8AA 1AF4A 1GTVA 1C5KA 2DUWA 3AF5A 2HRBA 4JA0A 4NARA 3EIFA 3B9RA 3EPHA 3M89A 4AMBA 4XRGA 5EXTA 4D9IA 4E30A 1HK7A 3M5WA 3LCRA 3WLMA 4ZGBA 3FH0A 3U60B 2Q5HA 4EG7A 1P0PA 1IN7A 3KQVA 3TCKA 1JVSA 3PIRA 4IQ8A 1W75A 1A9SA 4YQFA 5CMLA 5WRFA 5JXGA 1EDDA 3IT3A 2RFLA 1ZMOA 2HHHB 2J48A 4KPEC 1OXVA 1NOJA 5AK6A 1KO7A 2PD6A 3IQHX 3ANLA 3N8NA 1ZLXA 2O2DA 1X7XA 2YXLA 3KXPA 3LUFA 4XE5A 3D6AA 4RXTA 2WNHA 3CNLA 4CQJA 4ZHQB 1CY2A 3KZNA 2GQ0A 1GCUA 1IOLA 3ZOKA 1EGQA 1UKZA 3KQWA 3A04A 4REQB 5DNEA 4I0WB 4OUKX 5DLPA 3TQTA 5BMVF 4A15A 4R1PA 1WBDA 4N1AA 5IAAA 2MJLA 4S1WA 3ZKWA 2DG2A 2BMFA 2QAIA 3A7EA 3DEZA 2X22A 3RIMA 3WNBA 5IDVA 5KPDA 4IDQA 1LH0A 2ANCA 4MKGA 4WKGA 3OO1A 1T2EA 2NM0A 4ZT5A 4B3BA 4B09A 5AM4A 3FZNA 1VI5A 3BCSA 3CR7A 4ZOLB 1N0IA 2XVZA 1L5LA 3F6BX 4UZEA 4Z9YA 4Y6SA 1EXMA 3AKEA 1FE8A 3G6WA 2OGUA 1C9DB 1L4LA 4QPDA 2NO1A 4NJMB 4BQRA 1A1VA 6PFKA 3NRBA 2B7LA 1EE1A 3OA2A 4FQ8A 3WYDA 2EIHA 3EOAI 2FZ4A 4MV1A 5LBUA 5JNRA 3OC0A 5A4AA 3QE4A 4EMUA 1E2GA 1SOAA 2WU0A 5EJFA 2Z30A 1ZK3A 1M72A 1HY3A 2C7BA 2A3NA 5JZSA 2FUCA 4NCKA 3KKQA 1YQEA 1CUVA 4TMVA 3NTXA 3OETA 5KQPA 2P4QA 5DCYA 3CF4A 2FPGB 1CZKA 2NAFA 4DLPA 5KQGA 4JEIA 3N0XA 4FR0A 2OXEA 2VCEA 5EIWA 1U2PA 5HTKA 3GCXA 1K5DA 1OT3A 3OUZA 5DKFA 1O2DA 2C00A 2VWGA 4MS1A 1T5DX 1YDGA 3GJ8A 1V3QE 2AHRA 2WMYA 1W73A 4UASA 4FNOA 3WGLA 1HOTA 1J06A 2HWUA 3OAAA 3WBKA 2NTNA 2ZT8A 5BUSA 5I9NA 2QRQA 1U04A 4WH0A 4YJ2A 1P4JA 2QI9C 3UXHA 1XZGA 2I4IA 4BOYA 3GN1A 4HFRA 3R6LA 4HPWA 2BGJA 1R50A 1XL1A 4AZ3B 2BV3A 2CD9A 2RK4A 1MOPA 1N25A 1DKLA 4OHVA 1KMNA 5B12A 2D0IA 1N1MA 1JEQB 1HFWA 4IUCS 4KWEA 2ZDGA 1R4NB 2QKYA 4P4SB 1JIIA 4RO0A 5EYPB 4O33A 3NOQA 1J0AA 2HQBA 2G88A 5AKIA 4KGZA 4P22A 3UCFA 2B8NA 4HDOB 4G84A 5B53A 2WM2A 1KKUA 2O8CB 2JLVA 4PLVA 1LLDA 3P9PA 1ZM9A 2ECQA 4COKA 5GONB 1CUWA 2DLCX 4E0BA 5DXFA 1YXMA 1SHTX 1YI0A 2R4TA 2UZIR 3IQFA 2NU7A 3OZFA 1MP0A 1A9OA 1VLLA 3K5HA 4D6PA 4DUYB 1XTTA 1XLUA 4KH0A 1W44A 4Q34A 2G6BA 2ECKA 1S8NA 1EVYA 1L5RA 1CY0A 1U6KA 3FCCA 1J0XO 2OAP1 4P1ZA 1MXFA 2GKSA 1HEYA 4BMZA 5EUBA 3SX2A 4JCCA 4I5DA 1PVDA 3EVCA 5EQTA 3WK9A 1Y8RB 3A2NA 4R05A 5DYNA 3ABZA 1XQ1A 3R74A 3UWDA 1U8AA 4ZIRA 1JDVA 1MAUA 5F52A 3VJMA 2IFTA 2YKGA 2IIBA 2EJTA 1OX5A 2PH1A 3CUUA 2V0CA 1L7NA 2JH8A 1CQZA 1ZMTA 2YY5A 3KT8A 2IBSA 3S2SA 1CDOA 3O83A 3HKCA 3ZGYA 2W2TA 1MXHA 3M49A 4GR5A 5EQFA 4GEGA 3GVPA 2Q3LA 5C8DA 2P3OA 3Q9UA 3HEAA 3ZXSA 1G5RA 1G8GA 2DFPA 2CJXA 3Q7SA 3OMLA 5E1BA 3UAYA 1ADBA 1E9RA 1GUFA 4M98A 3UCEA 3I4FA 3N70A 3OF5A 3IPRA 3ZDQA 3PIIA 3GZJA 4MR8B 3RS5A 3BS4A 1KJQA 2YW2A 4XW2A 2OM2A 2NZVG 3N86A 4YJGB 5ICEA 2VK4A 2YX1A 3OZAA 3U81A 4G24A 4ETWA 5T41A 4BNZA 3A32A 1P2TA 2K2QB 2WAMA 3LBHA 3QUCA 1URPA 3JVIA 4GPAA 1V3UA 4MVJH 1E8DA 4PM4A 3JAMA 3OE4A 3GF4A 3OLWA 1JUDA 2Z57A 1TFRA 1VSQA 2FE1A 2H52A 3UT6A 2I22A 3TR5A 4R8VA 4RK5A 1NZFA 1QHYA 4Q1AA 3RTDA 1I4LD 4N39A 1TM5E 4JI7B 1KI2A 3D6HA 4K81B 1CF9A 4MKXA 3EW7A 3O8OA 4OFWA 2JJ2A 4KXMA 2QW1A 2VBIA 2VWPA 1J5XA 4DZZA 5MF6A 3MS7A 4IDNA 2VJPA 4QG7A 1OXUA 2PANA 3NLLA 3DLTA 2F17A 2KQUA 4ZYZA 3L02A 5AKHA 4XGKA 2YYAA 2O9JA 2QTLA 5EZYB 2IOFA 1N9ZA 5CVUA 4KDCA 2XODA 4LVOA 2XR1A 1YMVA 4ZI7B 2P9HA 4QBFA 4J2HA 2I2CA 3GPIA 1CY6A 3AUKA 5JAQA 1EK2A 2MSKA 1BQEA 1QGED 3AYXB 1O94A 1Z83A 1LQUA 4FILA 4BO7A 3HJTA 4ZDWA 3HADA 3HZRA 2YFQA 3HHPA 4RTOA 4UXIA 1GPH1 4BLOA 4L51A 5G41A 3WWZA 4BKRA 3MD9A 1Z6AA 1G8KA 5ALWA 2FN3A 4X54A 2C78A 2YMMA 4X92A 1T1JA 5KYGA 4ZQCB 1TU3A 2FU5C 4Y2SA 4Y67A 5FT9A 1Q11A 1L5FA 3BWBA 2GBFA 3BWVA 5KWJA 1EUDA 1FP2A 1JLKA 5H16A 1RKUA 2P41A 4QG3A 3KLPX 4DLVA 4GC9A 2BMEA 4JLVA 2Q6KA 4DBLC 2OZLA 2ZJ1A 1IJKA 2A33A 3VU3A 3IMKA 3G3EA 3GFPA 3H0EA 3CG4A 1US8B 3K53A 3OWHA 4H7KA 4JI2B 3HVHA 1WCWA 1J0EA 2VYFA 1UT8A 1YUMA 2H54A 1Y1SA 3QUQA 3GRCA 3U61B 2P6UA 2W2PA 3LAWA 3QMMA 4JQSA 5A7HA 3H6KA 1SKBA 1GY8A 2WJIA 1E5VA 2AK3A 3QX7A 5E3IA 3REQB 4O2RA 1ZVMA 3G82C 2XMRA 4Y9DA 3PD0A 3RYHA 1JB9A 1ZJ5A 5IEBA 4BZQA 4DV3B 4Q6WA 4P58A 3KE8A 5TR9A 1ZD4A 2BFMA 1DVRA 3EK2A 3VSBA 2CSXA 1OWNA 3PJRA 1QJCA 4Z4QA 2Z2JA 1FK8A 4LI0A 1XZMA 3OZIA 2BEJA 1KRHA 4G2TA 2X23A 2R4QA 2O2ZA 3AUJB 621PA 2XUAA 3KOYA 2GI4A 1PTJA 1ORDA 4K0RA 5A6VA 1EAYA 2J3EA 3CBGA 5LFAA 4UBIA 2C2BA 3R9KA 2ZG6A 2A5FA 1LK5A 1Y5RA 1N75A 1ZK1A 3IQGX 3O9ZA 3KPWA 2HRCA 2ODPA 3V6LA 1UBSB 3NC0C 1M1NB 4G9EA 2EP8A 5FNVF 4IHJF 4RK4A 1HPLA 3DZ8A 1GL6A 4H15A 3A1UA 5A7FA 2R7NA 3OJCA 3L0SA 3ZDZB 1KOGA 4MW6A 4JITA 4QXOA 4F85A 3PP8A 2VP6A 4QUKA 2VAXA 1USUA 2YW9A 1T6ZA 5C31A 4N7JA 3CUWA 3QY0A 4FYMA 5I9IA 3IE0A 1ZGBA 3BORA 2FMXA 3RVMA 3ZX5A 3ENZA 1VL0A 2PZJA 2CMFA 2QRUA 5E1MA 2P7IA 3GL9A 4NJOA 2E4UA 1UP6A 1JQBA 1ZOSA 1G8JA 3M4XA 2HLPA 4PX2A 4TQAA 5FBZA 4D9CA 1UAGA 4HGQA 4PYQA 1SC9A 4R31A 5FTWA 1N5KA 1LGYA 3FNHA 3KVOA 2ESRA 5LXTF 2I4TA 3FB4A 3T5CA 2NUPA 4B0OA 2CNOA 3OCZA 3P5BA 4HLQB 2J3MA 3AZOA 3L43A 5CCEA 2C3YA 4BFVA 1WOYA 2XAUA 4O2BB 5BR4A 2O14A 1XU4A 2FFQA 2XD9A 1KIMA 2B4KA 3BK1A 1AA9A 4G0NA 1NM5A 4ND8B 3EZGA 3I05A 1WUIS 1N2CB 1SU7A 3GJQA 3OG9A 4C03A 4HVLA 4CLDA 2GPWA 1LVUA 4P5EA 1GSIA 5AK5A 1UJNA 1YBFA 3EVZA 3RAEC 5BN3B 3TPFA 4CR8A 4YLGA 4EBBA 3QH4A 2QIPA 1TO2E 2PS9A 1KMCA 1O5IA 4HT3B 5JD4A 1W4RA 1LBTA 2GPJA 2UZ1B 3U39A 4FHEA 4CODB 4CVNA 1EQ2A 2BMJA 1KDRA 4PX3A 4RF5A 3K2EA 5AK4A 3TSAA 4A23A 5AVTA 3BHMA 3QVSA 1FTYA 4HRYA 1Z74A 2E82A 4DF3A 4L78A 4LFBB 5DASA 3W9SA 1XJ0A 3CTPA 3AOEC 3R7FA 3S28A 2A9KA 3IYLW 4ENPA 1YJCA 4LMBA 5FDFA 2NSDA 3UK1A 1XD8A 4FLMA 1ZG3A 3MOGA 2EP5A 1J42A 1G55A 2NZXA 5DP1A 4ZAFA 3VPHA 4B1FA 3K70B 4JEUA 5FEMA 1DO0A 4KXLA 2PIAA 1N2JA 2JLAA 2VAMA 2JIDA 4Y1FA 1EK0A 5I47A 1KO8A 4NDNE 1HORA 2P9EA 5JMOA 3MYYA 2I2BA 5HTOA 4F84A 1O7JA 3AJAA 2I1VB 1M76A 1DIBA 2GUWA 4NK5A 4C0HA 1NGSA 2D5AA 1JR3D 4EY3A 4UDNA 3WP0A 3PKJA 3MTGA 3U7EB 2BI4A 3MFYA 3ET5A 2UYGA 1JDZA 2ZQYA 2UUCB 3ZJ4A 1JDBB 5IZ4A 1XQXA 2ZYIA 4IQGA 4NEQA 3GI1A 3OQ1A 4TV8F 3JQRA 1A5ZA 1V1RB 1SG9A 2HK6A 4L02A 4G56A 4DA9A 2ZIFA 4NYJR 4JHLA 1KP9A 1A76A 2XGOA 3RR2A 5LDGA 1PP4A 3ZJTA 1C8BA 13PKA 4UVHA 3TF5A 4EPWA 3PT5A 1Y33E 1B8UA 1Q2XA 2NNLD 2A0XA 3BVPA 3K7EA 3E48A 5BRAA 3SR0A 1UOQA 3I9NA 1IOWA 1T2NA 3NETA 3EA0A 1ZNYA 2VK8A 4KZKA 4NENA 4DNFA 4BP3A 10MHA 1PX0A 3FBGA 4RJTA 3GFRA 1Z12A 3IEPA 3RVQA 1QC5B 5AJUA 3BWYA 4BB9A 3B78A 3KKEA 2ZKLA 1CEQA 4H59A 2O8BA 1HDXA 4ZC1A 4WCVA 3K09C 1L9KA 3B20A 3LIIA 5HJ5A 5LQMA 2B3DA 3JATA 4QYMA 3BZUA 4LXYA 4UQPA 3V48A 4B82A 1E5DA 4RKEA 1KYYA 2I76A 3E22A 1JMKC 4DEYA 4Q05A 5LQRA 2G72A 4GRIA 1NWHA 3DM5A 3R3WA 4QELA 2A1UB 1RXSA 1I7DA 2Q7OE 2COEA 4JBWA 1XDWA 1SXJB 4IDBA 1Y6JA 2JKYA 2OGTA 4FOLA 4MW2A 4YRFA 5EOVA 3OU2A 4HJXA 1KYWA 3VO9A 2W8BA 3KR2A 2FW6A 4NOMA 3MVEA 4PRZA 5HQJA 4UHBA 2ZR0A 4DB4A 2R4UA 3O3OB 2EJWA 3A4MA 1CFZA 4M1YA 1VJDA 3ZIUA 3EZ6A 2QM0A 3O94A 2W37A 2JAWA 4ZYTA 3H9JA 4UUQA 2W0MA 2W6MA 3U4MA 4DS3A 1NXTA 5E9WA 4AMUA 5ALQA 2XCQA 3KD2A 5FNVB 4QXAA 1XWIA 1NFRA 2JH3A 2Z1DA 3LG2A 5J5VA 4D9GA 3AGQA 5GOZA 2FGJA 4IHJB 5JBQA 5KSZA 4I4TF 4GKJB 4IIYA 3GVCA 2V5AA 3GDFA 2CLOB 3IURA 1AKMA 4FNMA 1QRTA 2I0FA 4AMGA 4KQWA 5DBHX 3U13A 3PQ6A 4NHOA 5JOQA 1N6OA 3ADPA 1KO5A 2JATA 5A2QA 2QNRA 4YMIA 2XDQA 5KHOC 2OY0A 3EFOB 2YRXA 2I4RA 4DANA 3LFHA 4IVQA 4XM1A 1XRPA 1H5QA 4ATNA 1E2PA 3W5JA 3UEOA 4L4RA 1E66A 3ADDA 5JSZB 1KORA 1F12A 3IESA 2X9QA 3MPOA 3AHIA 1XTPA 4ZI2A 4II3A 4NMXB 3GFBA 5LXTB 2R751 5DB4A 1KF0A 4FZ5A 3EBPA 3WFIA 3EH2A 1ENPA 3U3RA 4RU1A 4PC6A 1SKUA 1UC5B 2CLMB 4N3BA 3I2JA 4UQLA 4JDPA 3DC7A 1PT6A 2QZPA 2IWHA 3G0IA 3B13B 3QNMA 1RC8A 3PNSA 4J4BA 3G68A 3EGCA 3B3GA 5DX1A 1J99A 5T6BA 3KYIB 4AZVA 2Y67A 4JC4A 2FMKA 1E3QA 3OPYI 4YJ3F 4BZPA 1U8CB 2HW8A 2IDJA 3U3XA 3QVGB 5HBGA 1GPBA 1M2OA 3UF0A 3WVNA 1V7ZA 2FWAA 4MA4A 5JXIA 1G20A 2AYYA 3GEIA 1P1KA 5KS2A 3N05A 1EFRA 3C39A 1GGMA 2KW5A 5FQOA 4AXBA 4FR2A 1VSBA 2NVUA 4MCIA 3OICA 4C6TB 2H4XA 2QD5A 4GO1A 4D9EA 2X0NA 2ZDHA 3JPWA 3N87A 1NJ6A 2P40A 4OHBA 1H4VB 3T9FA 1M0EA 2NZ2A 2QJFA 4BXOB 2ECOA 3RUCA 1PW5A 1QFYA 2XSZA 3JRNA 2WIGA 4DAEA 2FX5A 3W5BA 4O1IA 3RIXA 4MUBA 3U3DA 3DHEA 1QMPA 3AHJA 3LGXA 1DAFA 4YRTA 1QTQA 4FI3F 1I4EB 2XWQA 4O4JA 4R68A 2J87A 2K6GA 4Q9IA 1VKRA 4OJTA 3L7NA 5FWXB 4RHYA 1WQ3A 4CGZA 4UMEA 3RFFA 1JLSA 1E7YA 1QV6A 2WTAA 3GA7A 3OPYB 1C7IA 3LQ2A 3MYRA 1ZM2A 5BSEA 4WCFC 2R6HA 1WUTA 3NWJA 1E2IA 5AKJA 5TQVA 3DSRA 1SOUA 4EFKA 4GSKA 3V4RA 1CJBA 1QFSA 3SEQA 2IHVA 1E6WA 2RH9B 2YUIA 3I30X 3T0FA 2X3UA 2ORIA 5HSGA 1W6UA 2FH5B 4F3TA 1GUZA 1ZLYA 1QH1A 4G6ZA 1NU6A 3J81A 2ZUFA 2H7XA 2B9EA 4FBLA 2Y6VA 4OA5A 1P1FA 4EY6A 3U09A 1LRKA 4TV8B 1DT3A 1R88A 4X60A 3O4JA 4KGVA 2CZCA 1Q83A 1WP4A 2XMCA 4HY3A 4BWFB 4KLNA 1J8YF 1T2FA 4OGLA 4LSZA 4F8YA 2B8WA 4I19A 1K0UA 3DZGA 1RWQA 4NS1A 2OFOA 2H06A 4B3RB 3G8CA 5LIPA 2W4MA 4G0QA 2B5WA 1V2GA 3FBWA 3KQOA 5KZMB 3GHYA 4XAQA 1E3JA 5SYAA 1OXMA 3ROMA 5MDHA 4TROA 5CVDA 3R2JA 3TL3A 1SQSA 2KBFA 2XYGA 3QPVA 2XI4A 3MFQA 1W0CA 2BHTA 4DJTA 1WB4A 4WVFA 1OWMA 4G0ZA 2CNBA 3B5EA 4PG4A 5KTTA 2Q5FA 4U7TB 3UXMA 1KVUA 3DDHA 1OI4A 3KTAB 4ND1A 3WWOA 1TIPA 3AXTA 4QGAA 3RSGA 3EXHC 1L7MA 4OQ4A 5HM8A 2R48A 3DL7A 3FDFA 4H0CA 3LYLA 2RG7A 1E79D 2AFIA 4Q1FA 4BTLA 2XNDD 1KQGA 2OXFA 1OUMA 3HR7A 5DM1A 2V8BA 4CI0B 4MA5A 4MAAA 2GVNA 3AP1A 1XZHA 4Y2TA 4LAFA 2B78A 4FFNA 1KYZA 3UJCA 4D4IA 4ARVA 4IDOA 5J4HA 2NUAB 1A5BB 4QFMA 5AM2A 2E4YA 2EFDB 3B6IA 3C6ZA 3NDPA 4GMXA 3C7AA 3BREA 5AI6A 2NP7A 2VK2A 4EP1A 3KB1A 2PWBA 3CLUD 4B47A 5J4KA 2FNAA 2PGLA 3VPXA 3MJVA 5D01A 1UC4B 2D2IA 5E4TA 1CIVA 3EXG2 5BQFA 2FSVA 4LV8B 3UAGA 4I4TB 5A9TA 4LC0A 1W96A 4F9EA 4OQFA 1IDOA 5E38A 2PUFA 4G25A 4FZVA 1IXKA 2EWMA 3CCCA 2QN7A 4FCWA 3IQDB 1HNWB 1UODA 3KYCA 4ZCRA 1NN1A 2H4WA 2VBFA 3NVAA 1Y4ZA 4ENSA 1GG5A 1X19A 3QYJA 3TZLA 4CCWA 3R41A 1ZVVA 5ER6A 3WRYA 3ODGA 1ZOPA 4HNSA 4C22A 3WR5A 1CTQA 3AFIA 2BP7B 3ENWA 3EVBA 4CKWB 1K6IA 2Q0HA 5KX5B 3IKMB 3IE1A 3RT9A 3GNTA 1H0RA 2YC4C 3GCDA 3C8DA 1FFEA 2IZ7A 4CDRA 3PTAA 1USVA 3H2BA 5IAGA 2QX9A 3HY4A 3TB4A 4YMUA 1I1HA 1D1TA 1NXOA 3SPXA 1FFWA 3OT1A 3RSLA 2BUAA 1CRZA 4JGIA 2GD2A 1LRJA 4HGRA 5EP1A 4DGQA 4F6RA 2JD0A 1EH5A 1V6SA 3IAEA 2IKSA 5TQ0A 1T8TA 2QTTA 3KV1A 4V02A 3ASYA 2SHKA 2ZE5A 1L8QA 1T5LA 4BIIA 4DC9A 4MWDA 1Z2PX 3MWFA 3OJ0A 4YJ3B 5JS2A 1E4VA 3BGOS 1CX9B 1KMQA 3MAJA 3TSZA 1YZFA 1FMTA 3GX1A 1R6TA 3ONWA 3F8SA 1TUEA 2AR7A 2CFCA 5HMMA 3LVFO 4L7VA 1GPAA 1Y9AA 3D8HA 3VYUB 1H3NA 2XKJE 2NO9A 3NP9A 4KVAA 4TSKA 3D8UA 3TOXA 5KMGA 6REQA 1CR0A 2OOKA 3V8MA 1BEZA 4AS2A 4YCCA 5J4LA 2EJBA 2ZRJA 3GYGA 3M83A 1BRMA 3PPYA 4KODA 4E7OA 2GARA 4AWAA 3RRYA 1W1UA 1GAXA 1I2BA 1XTRA 1FPQA 4H1VA 1MENA 1DELA 3EXG1 3AETA 1R3UA 3R5TA 4OHZA 2QMZA 3B1XA 3Q15C 3BOSA 2CMGA 3W1VA 4P33A 4OQYA 5F4BA 1H6BA 1L4BA 1N3LA 1NYLA 1TPZA 2OD9A 3DNMA 2PSHA 3BULA 4K6HA 4Q01A 1FBNA 3TFQA 3IEKA 1NW9B 3T5DA 5KYXA 2JLSA 3O47A 1H8HD 1SB9A 3R7LA 3V1LA 1THMA 4FHCA 4UXHA 3NATA 5K99A 1LS6A 1VHQA 3W8DA 2C4VA 2LP4Y 1H8EA 1PGJA 4Q9HA 3TE6A 4LCBA 3GEEA 1C0IA 1KIAA 1WOMA 4GXRA 5GOTA 4F8JA 4V1CI 2BHNA 2FQQA 2ZRKA 3U4QA 1CIPA 2PCLA 3HLYA 3R75A 2Y0EA 4LY3A 4UKDA 3WLIA 5T3YA 2JFVA 5JI3E 1V4BA 3OC6A 3L1UA 4U00A 1OLXA 1TW2A 2XYVA 3AF1A 4LHXA 4KR0A 5ILGA 3UAWA 2EGGA 3O8CA 4N0PA 5DTQA 3GEHA 3L1KA 4DIUA 4V0RA 4H3HB 2H5LA 3F5SA 1A71A 4MK4A 4XVUA 2EC5A 4WSOA 1IEVA 4NH4A 5H3LA 5E9QA 1HQYE 4L5CA 1YVRA 2UYQA 3P8ZA 4AK9A 2B8JA 2O8VA 4B75A 1XN1A 4B43A 3HJBA 2I4OA 4MWZA 4DDMA 1V96A 4RD0A 2CJYA 3T3OA 3F46A 1JALA 3GIDA 4ZTBA 4F11A 4CMGA 1MEOA 3IAUA 4GPEA 4ZOBA 5F73A 4V1CB 4EJFA 5B4TA 2ODEA 4S1TA 2V8OA 3NZEA 5CFRA 3EXAA 5BW4A 4HH4A 3VC2A 2ZZMA 4X91A 1UT6A 2IITA 1N0WA 1UBRS 4C78A 3FCYA 1DWOA 4D6YA 5J47A 1GPKA 2PZKA 2QLBA 3H4MA 1JIJA 2ZJ3A 1H1LA 1RRGA 3BE4A 2JHCA 3BK2A 1TAGA 3TLMA 4AB1A 3DDWA 2ZWAA 3B9PA 3L6CA 4LJSA 1SO8A 1SG0A 2CZQA 3OOHA 5G53C 3R8CA 5CW1A 2ASEA 3OZUA 4ILEA 1TADA 2EFHB 5F7ZA 2I67A 4UAVA 3Q7TA 3UAVA 1K2VN 5JH7F 4ZCIA 1MTOA 1T9BA 1FYEA 2P9YA 2RHCA 1YRHA 1N6PA 1P9WA 3BFXA 3R5HA 5F35A 5KHLB 3VYVA 1UC9A 3G5TA 1IQRA 1DG3A 1FUYB 1R6VA 1O96B 3ECSA 4E2XA 1AB6A 3IB3A 3PC4A 1JG4A 4OV6B 5D51S 1V5WA 5LB2A 4JSTA 4MB6A 4R7ZA 1D4ZA 2PCJA 2X8LA 4E2FA 2QVZX 3IODA 2GCNA 1PWEA 1R2QA 2IEDA 4MCJA 4XR9A 5EESA 1EQAA 1UF9A 3QF4B 3U9SA 3BA6A 2VNAA 2BMWA 3NM6B 2XWPA 3CLHA 1K8YB 3MTQA 3KOXA 4EYQA 3X0DA 4XFJA 1RYZA 1RIFA 5HDQA 4PE5B 2I6GA 2FMTA 3EA5A 2YXPX 1USWA 4W63A 3K4HA 2IEZA 3K0HA 3KETA 5AM5A 3PUWA 2ZXFA 4RSRA 2PZ8A 5EPUA 5IDYA 3RUFA 3HA5A 2ZBEA 4ITRC 4ZRMA 2X8BA 1LA2A 4FOSA 5LQAA 1NMYA 4Y9SA 2CLCX 4NNJA 4F4HA 3H65A 5DM0A 1ANKA 4D0SA 4TT3A 5DI3A 4GECA 4H6WA 2IK8A 4AX8A 1TQ8A 5KEIA 3K0AA 4I99A 3I34X 4V0KA 3PKZA 2Q2WA 2MYNA 4MCAA 5BWOA 4FE7A 2BGGA 3DL4A 4L50A 1Z7GA 4KNVA 3V7NA 1NJ1A 2CK3D 2EHJA 5B3JC 4OJYA 1Z0IA 2WA1A 4P86A 2KJQA 3DR3A 3PC3A 2JA2A 5JECA 4L4UA 4ZGWA 1MA0A 2AQHA 3TD6A 3DZFA 3RTGA 3AY0A 3AJ9A 4YP7A 1T36B 4AG5A 4CIWA 1SN7A 3LLCA 2WKRA 4JNCA 5IK2D 4GZMA 1E6EA 3D7SA 4EMTA 2Z58A 3OEHA 4MVJG 4OQMA 3W3ZB 4LS3A 4M8SA 1HE4A 4FC6A 1T6YA 4Y2HA 4AWXA 3D02A 2HSZA 3SQMA 5HUJA 5LKAA 2W2QA 2PKRA 2XEDA 1HYQA 2O3SA 2R8BA 4IDEA 1THGA 1YZLA 2DH6A 3IRVA 3R0XA 4HTAA 4F1WA 1V6CA 1BVRA 3BIFA 1WG8A 3AY7A 2W6ZA 2ODQA 4Z53A 3RAFC 2HFKA 5EKSA 2YMLA 1S9DA 3DR5A 3KOMA 4URXR 1ULHA 4FLFA 4C20A 3BEDA 3PCRB 4IS3A 1M8KA 1SBYA 3PRYA 1FS5A 2BUBA 3H9QA 4L8LA 3NC1C 3WLLA 1CQIB 1G5FA 2EAUA 2J9FA 2CNWA 2PZLA 2GAAA 3GGOA 5CBKA 2ZRLA 1NZJA 1VHWA 1WCIB 4YUWA 5FXMA 5AI4A 4J94A 2GAJA 4Y3UA 4QIHA 1Q1QA 3C6YA 4MWGA 2IIQA 4IIXA 4Q4HB 4FSXA 4C4PA 2OHVA 3KEQA 1K7XB 2G9RA 4RMIA 3IUEA 4ES6A 3HKEB 2XUOA 3SFVA 4YV0A 2Y4NA 2QV0A 1EGHA 4KAFA 3EG9A 3H75A 1RLIA 1IZ7A 1SPXA 1W76A 3FM9A 4EGQA 5ITVA 4YJHB 5JDIA 3QX3A 2ZBFA 1UJMA 3WGVA 4YAWA 1GN9A 4XDYA 3U7IA 1A9ZA 4I4CA 3VFDA 5FIUA 4JQZA 3WISA 3LOPA 1QRRA 1V5IA 3B53X 4C7OB 3ZDRA 3KZXA 3PEYA 1U3FA 3A7DA 2OHJA 3QHQA 4ML3A 4OQLA 4RY2A 5JD5A 3BJZA 3FW1A 1P5RA 3MSCA 4LA4A 3BKXA 3LGSA 2A5YB 3AI2A 3AM3A 3KT3A 4LPSA 3A6EA 4EJSB 2AEFA 5L3VA 2E3JA 3QI2A 3UXEA 3TSWA 2WHPA 3DZCA 2V54A 3X2FA 1HTBA 1DJMA 1NLFA 3G79A 1M34E 4E6PA 3Q5DA 5D3ZA 1QIDA 4GLFA 1OWPA 3WL5A 4XQ0A 1D2GA 3VU8A 2FPLA 2KHZA 1Y7HA 5LMCA 4KREA 1W19A 2ZR7A 3QTTA 2H8GA 1NWCA 3Q41A 1KH1A 4GM0A 1KSJA 3SX0A 4KHPB 3GT7A 1UADA 2Q1XA 2VFAA 3TTSA 4M0FA 3WL8A 1K8QA 5CEEA 3MQ2A 1I3KA 3EH1A 1DJLA 1EGMB 5LA6A 4AKHA 2IU4A 4TYMA 1I7QB 5DN6D 4B7AA 5KCZA 3WGYA 1TK2A 1YJ5A 2YICA 1CVIA 1ZQ1A 2J09A 3PSHA 3RO7A 5FBHA 1Z4NA 4UNRA 2FETA 4P93A 1U0BB 1FZQA 2QSYA 2NVBA 2WNSA 3M3PA 4KLAA 1T25A 4M7PA 4DRYA 1AHPA 1Q14A 3LQFA 1OZ0A 3L18A 1X1RA 4ARZB 4G1MB 4ZO4A 2WYHA 4PS0A 3VVBA 3NNNA 6LDHA 4AN0A 5JC1A 4D5EA 3PLAE 1MH1A 2CVPA 2BMDA 2PZMA 5ALOA 4BNGA 4MV4A 3OLCX 3ONDA 3P27A 1GRRA 3ZLUA 3H4VA 3VKWA 3UBMA 3SZLA 4JB3A 5C7YA 3ROGA 3R7AA 2RE8A 5F98A 3ZWXA 1QVWA 3F1LA 1GLNA 3IP3A 3RFVA 1BW9B 4GZLA 3KBOA 5TPZA 1GPDG 2P2NA 3NBQA 4YT2A 4EKIA 4L85A 4EHDA 1JZTA 3AX6A 3G2KA 2EBFX 2JBWA 2ID7A 4BV3A 2VQSA 1ZONA 2R1VB 4N6GA 3DVAB 3L8CA 1C8KA 4JQYA 5TT0A 4CLOB 3F6SA 3GRRA 1ZNXA 2E4WA 3IUPA 1DRVA 1CR4A 3UO8B 4WZAE 3L0ZA 1UZMA 2ERCA 1EWYA 5JWRA 1C30A 4U9HS 3WRWA 4G4JA 2Q5IA 1KS2A 1PJZA 1RLJA 4G0OA 4IOJA 4QULA 5CFOA 1NBMD 3I1JA 4M0MA 4PANA 4TTJA 4XGRA 4IDCA 5EXSA 3TNFA 3E7DA 1Z6GA 2H08A 4L95C 4UVIA 3T7DA 5HHTA 4RZ3A 3S1LA 2OLKA 1HLDA 3ZHSA 3A58B 3N8HA 3MRXA 1VKNA 2ZANA 4G5SA 2BFDA 1UDBA 4QOEA 3SZOA 3HEBA 1T6XA 2BFWA 3Q7QA 3IR5A 2VCYA 1LPBB 1BG6A 2JD2A 4HGPA 2Q0SA 4FBMA 4E15A 3W6OA 2B35A 2ZRHA 4J0JA 5JRJA 3IDZA 4LQ4A 3BWCA 5E4FA 5JFOA 1TXGA 2R7KA 1T9GS 3U3ZA 4DR7B 4AJ2A 1GKUB 2B36A 4GVLA 1RKBA 2O23A 3QELA 4UTPA 1M2VB 1O6CA 1YRLA 1MJGM 1SCAA 2WG2A 4KZPA 3VH1A 2FZLA 2ZSIA 3IOYA 4J0HA 2ZUVA 4CM7A 3D4NA 3MWJA 2IS4A 3OBIA 2VF4X 4BNVA 3HI6A 2Q8QA 4ZVPA 1C1XB 2CV1A 2Y9MB 3ECAA 3N2IA 1DTEA 1FSPA 2XB6A 2YWCA 3C48A 3HDHA 1VBMA 5C52B 4FS8A 5FUBA 1V7CA 3P0FA 5HKLA 3GAAA 4K8RB 4CQNA 4DEVA 3MINB 3ZWPA 3T5BA 2CLKB 2QG9A 2G9QA 3NJ4A 4PZPA 5COBA 3HXQA 1QPBA 1OOEA 4A73A 4YMGA 4I6JA 4YBZA 5U4QA 3PFHA 1EVZA 4IHQA 3UM9A 3N9IA 1NRIA 3AEXA 4RELA 3ZVLA 2BY4A 4YRDA 5LWHA 1TM7E 1H2WA 4ETIA 5E8RA 1RC1A 5JBNA 1J1UA 3LK7A 2CFRA 2QLLA 4J3JA 5LQUA 1T5SA 1T9ZA 2ZB3A 4F9GA 1IN1A 1WKCA 3O8RA 2H17A 2C8KA 3T3GA 3E23A 5B3KA 4AN1A 2JBAA 4XUCA 3W6ZA 2FN8A 4AYTA 4H7FA 1RXWA 3SZMA 3AJEA 2RH4A 1XPJA 1JG2A 4DRXB 2PMBA 1A8UA 2RG1A 2E7ZA 3D3WB 3TEFA 4ARUA 2BDUA 1NP3A 5A6SA 1NV8A 1H22A 3QXHA 3MT0A 1J9ZA 3UCXA 2I3GA 4KE9A 4LXIA 1QR2A 4BS9A 5JCJD 3K0FB 3G85A 4RDIA 1YTUA 2F00A 1I0IA 2QYOA 2X5XA 5JARA 4A91A 4CL3A 3C6QA 4TZ0A 1JRLA 5TRTA 2AN9A 4QICA 4F9TA 4OX9B 1GTSA 1J9EA 4RETA 5EA2A 3A1SA 1CWUA 3GYBA 4WE3A 5BSKA 1Y6FA 4P53A 3EXFA 3B8EA 4PLGA 4Q3LA 4DCMA 2HJ9A 1MV5A 2FUG6 4KMRA 3W1EA 1OB5A 2QX6A 1WV1A 3TRJA 4N8EA 4ZYYA 4MRAA 4NXMB 4ZEOA 1ZR2A 4I9NA 3G0GA 4LJ9A 5CJPA 2PBZA 3E35A 3ZGXA 4B73A 2H1RA 2O7VA 2P3LA 3JQPA 4R51A 5AVJA 2R86A 4KYIB 2POQX 2EKQA 1TM3E 2R6R1 4Y2XA 4AKEA 4K9MA 2AN1A 4N41A 1RFGE 4CMHA 5LOVA 3QW4B 2QQ5A 3WK5A 5JZOA 3REGA 4PBRA 2PMWB 2H65A 1U0OC 4EECA 1IBMB 3PB3A 2ZVJA 5I4KA 5CDFE 1VL2A 1F8XA 2QUZA 5T8KA 3ZBUA 2BM0A 2HPVA 3P26A 4EKGA 3OLVA 4Z3OA 1VOTA 1H05A 3HCNA 4FGWA 4JOBA 4MRMB 4AF7A 5GVSA 5EHIA 4X66B 3GLFE 3IAHA 3ZCVA 1FJ2A 1ZO8A 2LCFA 4C4TA 3WA7A 3V4SA 1T4MA 1ZCBA 1JTEA 1NPYA 4L28A 2A86A 1MIOB 3L6RA 2I71A 1R9MA 5ALRA 1VL8A 3SC2B 1K7CA 3ZIAA 2HF8A 3NPMA 4I3HA 2PIDA 1WE2A 3TOVA 1ZK0A 3FGPA 4RLFA 1GV0A 3ABOB 2BW0A 3F7OA 5IT0A 1I1QB 2MR5A 3ZTTA 1FQKA 2HBRA 2VRCD 3I72A 3KZCA 2A59A 2GH1A 3WLRA 4YUAA 3PRJA 3RABA 1JF8A 2ISSD 4YIKA 4D9MA 1SXJE 2YR0A 2QT0A 1XALA 4GG1A 1NXVA 3OTGA 5LSAA 3M82A 2YHBA 1IUOA 2PUJA 2WTEA 3LBYA 1T4DA 3C85A 1M9NA 3K5WA 3DTVA 4B4KA 4M6WB 1V8PA 1BJTA 2JZOA 2FF5A 2VSFA 2OFPA 2V6MA 2YOGA 1RDFA 2BGNA 3CBQA 3D1VA 3HKBB 4I4IA 1ORIA 2PUTA 3L1HA 3HR8A 4GSYA 3DMPA 3IDFA 4UMFA 4ZICA 5TIIA 3G5MA 3H42B 3RCBA 1M5UA 3CVUA 1KFBB 3PFCA 3F7MA 5CDGA 2P2YA 3B7PA 2I9KA 1ISHA 4GBED 2O8EA 1HQKA 1ZN2A 1MC5A 1GN8A 4HLCA 4CQMB 2WMNB 3JVVA 2V45A 4PPFA 3WHPA 2DHEA 2FQ1A 1OLUB 3VNQA 5KYWA 1X42A 3W5CA 2J5RA 5JZ9A 1NQTA 3AL3A 3HEMA 3IVAA 2HQ1A 5EXDA 3WGMA 4BMXA 1EBFA 4RMJA 4MQEB 1YGYA 2WF6A 1JIVA 2ZWPA 3CW9A 3OTHA 4MINA 1IZ0A 1MZVA 3FCOA 5JJ5A 1M6HA 4NY1A 2A9OA 4AM8A 3FMOB 2NU6B 3LSYA 1J8FA 1E3MA 1BGXT 3TSOA 4S1VA 5BUQA 1EP1B 3QFSA 2AG8A 2WKSA 5IAJA 2IHTA 4R16A 4RTKA 4N5DA 1NQXA 4RWEA 1KZ6A 2IDMA 1YZQA 2HNKA 4CLXA 1XMJA 1PD1A 3VKUA 1RI2A 2GHRA 1KPHA 1F14A 4Y2GA 1U2QA 5JMWA 1VCNA 1P60A 2CZGA 2C82A 3GVIA 4JK3A 2LD4A 1O94C 1WEKA 3GWGA 4MGHA 4FGLA 3H1BA 1G1AA 5AKYA 2HJHA 4NMLA 5AW4A 1IVYA 5E7MA 1TQ2A 2R8YA 1LPSA 2VDWB 2QEQA 3IJPA 3H0KA 2ZWVA 3LWBA 3EDYA 1ELOA 4OGKA 1O1YA 2C2ZA 3RW9A 2A5DA 3GGSA 3MS2A 3OEED 5AJHA 5E6SB 4NEGA 2DLDA 4YQYA 3RTAA 3WFJA 4DIFA 2IOHA 2O05A 1XVUA 1BVYF 2DUUA 2G3YA 2WWHA 2GRUA 3H3XA 3K2QA 1KK2A 1LTQA 2EU8A 3RRMA 5FV4A 3V8RA 3PNBA 1TIKA 2LRHA 5M7EA 2I8LA 1KTVA 4FW8A 1QX3A 1Y7PA 4ZQHA 2JASA 1XK6A 4N12A 2H4HA 4N7BA 3L4SO 3RARA 3DMNA 4ER5A 4B6OA 2IZ1A 3GDHA 4LC9A 1N57A 1CR1A 2P0EA 2X0DA 3T4EA 1CUYA 3J7TA 2WQ7A 3OPMA 3ZI4A 1RJDA 1IOVA 4MRVA 3JWHA 1W0JA 4HDRA 1TYBE 5ALKA 3A14A 2JI4A 5AKLA 1YULA 4QPJC 5G4KA 3DLBA 1A8PA 1BD3A 4INAA 4KNYA 2REQA 2WJ3A 2ODAA 1KR5A 4PIVA 1SUEA 5DYYA 4HDKA 2Q3CA 1G4HA 4NJEA 1HGXA 1FSZA 3U4CA 3A4IA 1MX9A 3ZX4A 4TL9A 1E6LA 5LQJA 4D9BA 2PAFA 1VRCA 3AB8A 1P1HA 4OYHA 2MYPA 2AQ8A 1HETA 4R2HA 1YIDA 5KC9A 4OAQA 3ZDDA 4YO7A 4Z0TA 4XZ3A 3BGSA 3EHDA 2B6NA 1PWXA 2NIPA 4JLAA 2J9RA 1OI2A 1JHPA 1PR1A 2H00A 3DZIA 2RONA 1M8FA 3A6GA 3BQMB 2AOTA 2JGEA 3PVSA 3SS8A 2ZSEA 1EHIA 3Q8WA 2ZJFA 4UCWA 4YDQA 2AVNA 7ADHA 4JBGA 3TQIA 4R9UC 2MIIA 1T2AA 1JT9A 2D1QA 1C9JA 2Y1EA 3GJ4A 1U3TA 1TM2A 4YTEA 1H2XA 3ZWMA 1G2IA 1GGNA 1ZUNA 2FPPB 4Q3DA 4J43A 3NVKI 5DW3A 1Z16A 3T94A 1CQJA 4G8DA 3GGGA 1GGHA 2PG3A 3CF6R 3SIPA 3A2KA 2RD2A 3KXKA 2ZAMA 4RIEA 4RKYA 3ICVA 1T8PA 1EB8A 2PX2A 2C31A 3ISVA 5K3CA 1SIOA 3V3TA 1QK4A 4MDHA 5JZVA 2PDAA 4B3JA 4D99A 2NU9A 1GG8A 3N2GB 4D92A 1JIKA 1H2YA 3RROA 1UK9A 3GBPA 1JHZA 5LYJB 2WT8A 1R0YA 3EXHB 3HZOA 1NW3A 2R1UA 4FEGA 4JT8A 4NCNA 4WPGA 1HUQA 2JFUA 5K8CA 4DR5B 1O0SA 2WIFA 1CU1A 1KNXA 2B30A 2BFCB 5IG2A 1AKRA 4RX1A 4FDVA 4U9IS 4CZ2A 2H9AA 3G2MA 4X00A 2D0OB 2JAOA 1OBCA 1PN3A 2YHSA 1E99A 5I9MA 5HGXA 4HX5A 1M1XB 1YFKA 2GK7A 5DGTA 3CIOA 1R27A 2WAYA 1U7ZA 4LE2A 4MR9A 5HP4A 1N34B 1BCRA 1P72A 1TKCA 1YK1A 1ULSA 3UK0A 1L1FA 3N2NA 4CF6A 3D1JA 4C4SA 4JLDA 1LDNA 5IVHA 1ZW1A 3EBOA 4BU1A 2CVHA 3QP9A 3BMQB 4CM4B 4H7DA 1S3GA 4TWJA 1KEPA 2YDXA 4O25A 1SVOA 1KH3A 3FXAA 4PN7A 2JG3A 2P9QA 2R7AA 1OWLA 3BQ9A 3FOFC 1JQAA 3DQZA 2DFDA 1NR5A 4Y18A 3RAJA 1K7EB 8GPBA 1YI8A 2FR1A 3V9AA 1MV8A 2GM5A 1WUHS 3OX2A 2ZRMA 5DT9A 3T12A 4E2ZA 2ASVA 3H13A 4PRLA 1JHVA 1EBBA 3A0RB 4K9OA 4GOND 3OQPA 2VJCA 3VR6D 2P91A 5F76A 4C0SA 3RYIA 4AAYA 1GPLA 1XWFA 3FB1A 3NBZC 2ZIUB 3O5AA 3IDQA 4UVEA 4IH4A 1ZHFA 5BWMA 1WHTB 3DEKA 3L7KA 2JIQA 1L1RA 3BH7A 3CSDA 3LC2O 4LZOA 4UUBA 5IP5A 3SFZA 1DG1G 3ESQA 3AR9A 3K6KA 4C6RA 5HR5A 5JCZA 1WETA 3D3EA 2MSLA 1N3BA 4W9MC 2IYEA 1RM3A 1G41A 3KJEA 1P61B 2BT4A 4KITB 1VKJA 4O4LF 3I1YA 4GVXA 5CT8A 4JVOA 2NQTA 3SVZA 4LGVA 3H5AA 1K06A 3PHCA 4HXGA 1WLSA 4PHGA 1PHRA 4CTNA 1C4KA 3KEGA 3H8WA 4QHYA 3BB4A 1QK3A 3L3BA 3TW4A 1TW3A 4LFCB 3ZHUA 4CV1A 2BGWA 4CEHB 2QVLA 2WNIA 4DT1A 1ABEA 4IXTA 1CUBA 4X7MA 2OZKA 3QHPA 4EHLA 4ZOQI 4U6QA 1RKQA 1WU7A 5EJ6A 3SM9A 1WW2A 2CLIB 4PAGA 5BUZA 4GAEA 3QVWA 2W2LD 4P7KA 3KKKA 4W5OA 1X7ZA 2AZ4A 2FZVA 3FWYA 3IERA 3NR2A 4DCTA 1W36C 1J07A 1QMGA 1V2HE 5JSFA 1O95A 4E88A 4O2AF 4HAVA 4YJDA 5IZCA 1FU7A 2VXBA 3DA8A 3T35A 2IU3A 4NMWA 4URHA 3ES9A 4ABYA 2PBLA 4LNAA 5JD3A 2O8NA 1DAMA 1QG4A 1I5EA 3L8GA 4QKQA 4Z3DA 1DJOA 4WUVA 5LR6A 2FFJA 1V3TA 5KCMA 1FS6A 5TQ2B 3SY8A 1FB5A 4I8XA 3L6BA 4OATA 5F1PA 4AZTA 1WXFA 3LBNA 4CETA 2QQEA 4V0QA 3TR0A 4PGMA 1ICEA 4MCHA 3R9XA 1N6RA 4H08A 3P71T 1JFVA 1IXZA 2ZLBA 1JA0A 3OF3A 3R6WA 2BJWA 1ZH0A 4OJQA 1X1EA 1VA4A 4PCAA 1BH2A 1SBIA 4F4FA 4C2TA 2Q9BA 2WILA 2PRSA 3NYIA 1PT5A 4TV9A 4KDEA 2IGTA 3QZUA 5BYJA 3I9V1 3MWGA 2VG8A 3NHBA 1ZPDA 3WGTA 2NTJA 4MLDA 1A96A 1PR0A 4JFRA 4E5YA 2WMDA 4FX2A 1Z68A 4LVCA 5F77A 5THQA 2B7CA 2VUHB 4R1OA 3U48A 2VHXA 4UCQA 3ANNA 4EG4A 3EQ7A 5JFGA 3LJKA 2J7PD 1SCNE 2JFXA 3EJWA 4R2JA 1X2BA 4LTDA 2AWNA 2XZLA 4M7RA 5TMPA 3LT2A 1P4GA 4JELA 4KVFA 4L2IB 2V4ZA 4CKCA 3UPTA 3AB3A 3GBSA 1KI4A 2Q7XA 2ZB8A 3KB6A 1PL6A 1ADJA 1J0BA 2C4MA 2GD0A 3GCZA 3HYRA 4Z4GA 5EKUA 3ZVMA 5H3HA 4A0SA 1L5OA 1LLFA 2BSXA 1WB6A 4DZTA 4LF9B 3SYMA 2O2HA 1DRKA 4N03A 1IMJA 1RMTA 1PYGA 4UZSA 2XGSA 3NBFA 3P2MA 1LC0A 2DBZA 2HWYA 3OHPA 4LQLA 3SF8A 3KLBA 3TB6A 4CFZA 4PAQA 4DJFC 3WB0A 1K89A 2YIDA 4TGLA 4DDKA 2B4AA 2JGLA 2QXYA 3JR7A 3KKNA 4O4IF 2ZJ0A 4CLEA 2VHCA 3L0BA 1I0ZA 5AVQA 3WL3A 3AR6A 4DM4A 4ESHA 2I8AA 3L05A 1UMBA 3LP6A 4F6CA 5AW9A 2O2JA 1NXPA 4OHPA 5TV2A 1YQUA 4D45A 4O3MA 4DA7A 3NYRA 3WLAA 1WSWA 1ZIYA 4GQBA 5JALA 1O89A 4L27A 4OXQA 4CEJB 1HL7A 1N8NA 5LNK1 2XMGA 3LF1A 1XYYA 1I4TD 1C3LA 4OLJA 4I5IA 1DBVO 1YV9A 5D3MA 2WJAA 2O4CA 1VMIA 4G0PA 1DKMA 3A0UA 2K7ZA 1KYQA 4OLFA 3TDNA 1OGYA 4RZIA 3ZE0B 1RJGA 2FRDC 1DCKA 3DQPA 4ZFNA 1AVTA 1KEZA 1HKHA 2CHQA 1XO1A 5GTDA 5K5EA 2ZYTX 1I6LA 2P5UA 4R84A 1VMAA 3W34A 4IZ6A 4XGIA 4Z9AA 3C8UA 4KTVE 1BIFA 1VPDA 2V6IA 3BL5A 4HRVA 4TT3D 1GRVA 1EX6A 3Q7IA 4GZ6A 3S2ZA 4HDMA 3JX9A 4HXEB 2H0QA 5BVGB 1H2RS 2R6FA 2X7XA 3BMXA 3OWXA 4UUAA 2PLWA 4CIYA 1B26A 3FNFA 3UA4A 5LLTA 1WSBA 2QPLA 3AW8A 4YI5A 3GFGA 2ZVPX 4BASA 5CAEB 2VPYA 2O7RA 2WINI 3KB8A 4Z5XA 2P69A 1AUVA 2RJOA 2OK7A 2Q3HA 4P3XA 2X5KO 2RGWA 4P83A 1E58A 1SCUB 4YUYA 3DONA 5EHZA 3STWA 1I32A 1PRYA 3DOOA 1FTGA 4J76A 5K0SA 1YBVA 5AQ1A 3WDKA 1X8KA 1YU9A 3KCNA 1TA4A 1X9HA 5JO9A 1PFVA 1R4AA 1G3QA 1X1CA 2FWPA 4N47A 4PICA 1P0QA 4EARA 1YASA 5IAOA 2W6NA 3NHYA 4QFDA 4DJEC 5J63A 5IWCA 2OV1A 1M2JA 1FVOA 1M74A 1U9CA 1ZMXA 2CNDA 2A8YA 2PGDA 3RYCB 2XHEA 2YJGA 3NTUA 4LGYA 5FTJA 3ZZNA 5EIEA 5AW1A 5K0CA 4ZO9A 2P6MA 4KO3S 2BTQB 4A8JA 3MA0A 3MGBA 1H85A 1W1WA 3DV0A 4G37A 1WY7A 1XRQA 4M9SA 4PWYA 4TVOA 3V4FA 5CJJA 5F9HA 2GJSA 1SWWA 1QTRA 1RWOA 3PE6A 5AVWA 1ZC4A 1XZIA 5JT1A 4WADA 4Y1EA 1Z9BA 1FFYA 1NVEA 3OT5A 4AJIA 2P30A 3RVOA 4PC2A 1K3TA 3CEAA 3IEUA 3O9VA 4IH1A 3FGOA 4R9RA 3CPSA 2X8WA 4TRJA 1XG5A 4RH3A 4R0MA 5U9CA 4MWOA 4BAUA 3SQDA 1PJAA 4EAQA 4WJLA 4GMFA 4ALJA 4EELA 4D9HA 5CIYA 4YT4A 3RIYA 3I64A 3K20A 3SEZA 3E2MA 3U4GA 1U5CA 1V6AA 3EZ2A 5CYOA 1DTWA 1RZRD 1KYXA 3ND7A 4YWJA 1WTCA 3FRIA 1EFTA 2OUKA 1XVIA 3R3VA 4I2VA 2IXTA 2ZU6A 4RC9A 4YJ2F 2TYSB 1ZVKA 2E5FA 4E5DA 2A6PA 2CL7X 1WQ1R 2VJAA 5CK4A 1E7QA 3T1HB 1MIHA 1JGTA 2ZT6A 1RCFA 2BL4A 1DO8A 2VJMA 2XHZA 3AHDA 1XD9A 2FQXA 1DB3A 2D00A 2MU1A 1HSOA 1YB2A 3HCCA 4GGPA 4LDZA 5K0FA 4V0OA 1LX6A 4PIMA 3QUSA 1N2ZA 3ZY5A 3AFOA 2WF9A 2FG6C 1IM8A 4EPXA 1ZA1A 2OKCA 2AC4A 3EUAA 5J2TA 4TN1A 1MB3A 3BZWA 2XCSB 2VUUA 3MGAA 4QUHA 4PLFA 2Y8EA 2C2XA 3EIUA 1CEEA 1E69A 1UEJA 5IMSA 2WSSD 3DGFC 2HIMA 4D98A 1Q95A 1V47A 3MIIA 1MCZA 1RRMA 2C99A 2WA2A 4X8MA 1XV5A 5DXJA 4EUNA 3EEBA 1I01A 3SG0A 1CJKC 3O82A 3W2EA 4D56A 4CBVA 1BE1A 1SMKA 1XXHB 2BOVA 3G2IA 3HZZA 4YAOA 3DMFA 4U5QA 4KR9A 4C4OA 5BOSB 5L6LB 4NTZA 3N7UA 1ESMA 2OAEA 2XTZA 5IBPA 2IY8A 1Y48E 2Z0MA 2CL5A 3N2EA 3Q5GA 3QMWA 1RQGA 5LBTA 3T4PA 1B93A 3IHKA 2VOEA 4I5GA 4R1MA 2CE2X 2PN1A 3DNPA 3DE1X 4FX5A 4G36A 3A1NA 4O4IB 5TPZD 1EHCA 2X5NA 3AILA 1NVWQ 3PJDA 2FSUA 4GLLA 2NXJA 5LLSA 3TTUA 1XDZA 4F6LA 3BD8A 2GETA 3LU1A 5KNBH 5H68A 1QVAA 2I9PA 4OL9A 3F6CA 4EOGA 4CXMA 3JAKB 1YCGA 4YRCA 1DBRA 5KJEA 1TAQA 3RJMA 1A04A 3DXFA 3PWTA 3TQQA 4FKMA 1L5NA 4DQVA 3CVOA 4L0QA 1DIAA 3CLVA 4G5HA 1Z63A 2A5JA 3VI4B 4QX6A 1VCOA 3L8YA 3C3PA 3ZWDA 3QFRA 4IJVA 1F51E 1P1JA 4QPPA 2XGJA 2YV5A 3PC6A 2C2WA 3DPUA 3LDHA 4CT5A 3EDRA 1S1CA 4P6VF 2BI7A 3T7CA 4X3PA 3LWDA 4QFCA 2PGOA 3IKTA 3G17A 1KY4A 1ABBA 1MJGA 1AO0A 3CNOA 4PFKA 2WYIA 3WXBA 2OM6A 1SXPA 4S05A 4TS4A 5CLFA 1QGUA 4G5QA 2H11A 1UJBA 4ASUD 1OMOA 3NHLA 1XCJA 4BQFA 2EZTA 1PD0A 1VFPA 2G63A 2MMCA 3KP1A 3EHEA 5K6TA 3T1TA 3L6DA 2W4IA 3WAKA 4J29A 3W6PA 4G09A 1ZISA 2GCOA 2WEKA 1LBEA 3RS8A 3UJAA 5JFTA 2F1OA 4F5WA 3FHOA 2CT8A 3JQ6A 3ZWCA 1Z4LA 1JPVA 4LTNA 5I3CA 4LZWA 1X7XB 1JT2A 4HL6A 3U26A 1E9CA 1T2VA 3LWNA 4ZCSA 2BZSA 2WC1A 4WCDA 3H2IA 2OPBA 1RQ7A 1UZNA 3HXTA 2KLBA 1DXOA 4J07A 5GPBA 3I3OA 3ZKWB 3KTOA 3ELBA 3L41A 1A4IA 1YCHA 4F4DA 4ZI3A 1D07A 1DXQA 2G5GX 3W7AA 1N5MA 2FYTA 3FFXA 2R1ZA 4ALMA 1T6BY 3F2IA 3AQIA 4DMMA 4ITVA 2B5OA 4P82A 5F51A 2C2HA 1AKUA 1E5LA 1LJLA 1QYIA 3VPAA 4DA4A 2ZULA 1UR5A 4LDNA 4R3UC 4HEQA 5AW5A 3UYKA 5EJ4A 5JTUA 4LF5B 4X6YA 3UHPA 5AKKA 4OLBA 1N5JA 1T8SA 3VGJA 1ZP6A 3QLEA 4Q7LA 1G0NA 2YZGA 2Q27A 2VHYA 2Q8NA 1A4UA 2GOYA 3AFHA 2DWCA 3DDUA 4MVJD 3C3DA 1TF5A 3FIJA 1HMPA 1WHSB 4Y2UA 5EFZA 3AUFA 3R9IA 2EX0A 1FX1A 3EIHA 3O2JA 1QX4A 4HLDA 3TEJA 1J5EB 1BNCA 1IBSA 3AWIA 4TWAA 5ALTA 4D4MA 3AKYA 2JK0A 2WUWE 4EYEA 1FFBA 1U8TA 2Q5OA 1ISPA 2ZYHA 3HE3A 4IXDA 3EVFA 4QYXA 1CJVC 3DLAA 4FFWA 4N0EA 1GM5A 4JQOA 1EM6A 2DPXA 3OIYA 4D26A 4MUMA 3GARA 3K32A 2L2QA 3FOBA 3ZLTA 1EU1A 1ENOA 4KK4A 2JFZA 1G6Q1 4F72A 4Y2PA 1Q3HA 3NEYA 1HEUA 2OG2A 3A9SA 2Y9PB 4MS1B 4X61A 3WLEA 3UGJA 3IVGA 4OUDA 3FD8A 1RBYA 4OL0A 5TGZA 4AJNA 4ZMRA 2ZB4A 2VQEB 1ZC3A 3LRXA 4YJ2B 5DCUA 1XVAA 1N2XA 4OXRA 1BXRA 4X94A 2RGXA 4X62B 3BTOA 3MBIA 4GLBA 4UEJA 4ZYUA 4P4UA 4HSGA 4D9KA 4OQXA 4CU2A 2QLNA 3SQOA 4DCSA 5CVVA 3MWEA 1Z34A 4KIGA 1T1IA 1CC1S 1WUJS 2H2AA 2W2XA 3B85A 1HI9A 4NU5A 4M1OA 4ZA2A 4ZVRA 2VA8A 3Q7EA 1JAHA 3ZS9A 3OEYA 1TZ2A 4M8KA 4C3UA 4AN4A 1DIHA 4YQZA 1R37A 4ZGGA 4H4EA 4G0UA 3C5VA 5GV8A 1Z0JA 4DUGA 4EG3A 4EFDA 1ODCA 4JVSB 1S01A 3MCAA 5FI1B 3UW3A 1W35A 3ANSA 3IMCA 1JU4A 1Z25A 2D7JA 1KVTA 1PLLA 1ZI8A 2W6QA 4CF7A 5DZSA 3FI0A 4BFZA 1FMLA 2NU7B 4LMAA 4EWLA 2JLYA 2ADMA 1S96A 3T95A 1Y5IA 4FSHA 4ME6A 4BQOA 5C7OO 2DF8A 1CV2A 3GJTA 4C0WA 4CM6A 1ZJ4A 3MTJA 5SZKB 3LX8A 5KJ1A 1DEOA 1JG6A 1G0OA 3PQ7A 2ZYAA 4P4GA 3QIVA 3E3NA 5CLJA 5AH0A 2TECE 1AN9A 4IYRA 5B6PA 2JKVA 2QW8A 3DF7A 3JQQA 1NTOA 2GYWA 4O5AA 1OT5A 4OKNA 5F9MA 1DX4A 1JLHA 2YCLA 4DMCA 3KQQA 3CPEA 4EA8A 1IOZA 4IGEA 5L53A 2HPHA 2P7HA 2QTVA 5JLAA 2P1ZA 4ZIRB 2F9LA 1EJ0A 5B1SA 1X94A 2F1HA 3ZU2A 3GUYA 3NX4A 1PL0A 2PGIA 2BEWB 4BNDA 1ITZA 2UVDA 3AXSA 3W3AH 1EK5A 2FR0A 3I9V6 3QEMA 1CZUA 3HKCB 1D3AA 4BRSA 1JZQA 3H7AA 4D8UA 5J4YA 5K0GA 4DV1B 4BWGA 5AVZA 3EMDA 3ORQA 4UEOA 1Y82A 5TT1A 5G0UA 3LBIA 3A06A 1NW4A 3D8BA 1NQ5A 5HWSA 5TGTA 3SHOA 1BKDR 3PXBA 3RRXA 2BBWA 1YGPA 2I2DA 4G8JA 4QHSA 3H84A 3TZBA 3MJRA 2J3QA 4HNHA 3HYLA 2NUTA 3VPSA 1XTZA 1P44A 1BYIA 2LKCA 4ZI7A 4D41A 2O2IA 3SOZA 4W7IA 2WWRA 2BR5A 4M0KA 1JLRA 4O0LA 2B2CA 1LNZA 4PYLA 5K51A 2DZDA 3ANYB 1KJ8A 3K6JA 4UW9A 4HXYA 1VHLA 4HUJA 5G0WA 2PRIA 1MRSA 3R6GA 3AQ4A 4FD3A 2A94A 5CB4A 1M34A 3BAZA 3KZKA 1JFFA 2NTVA 1Q1GA 4P2GA 5DNDA 3TM5A 4FINA 4IV8A 2QVCA 3SU8A 3TBHA 2QX7A 1Q0LA 3EQZA 4JSRA 3I61A 2PXAA 1RXCA 2KBEA 4L6CA 4XQEA 5K8IA 1KEUA 4FZ3A 2G09A 4OJKA 3KL2A 1G5QA 4URZR 3RC3A 3WTBA 3DDSA 3OZTA 2DHCA 3MXTA 1Z0DA 1ZSYA 4MULA 2JGDA 3DD5A 4Q3EA 4OBXA 3DKRA 5CG2A 2FQYA 3GELA 3T3NA 2OENG 1Y37A 4Q12A 3X1WA 4HFMA 4DQKA 3I45A 4G89A 3PFWO 4FDTA 1MO6A 2X9LA 5LNK6 5EIBD 2O4UX 4BIMA 4DM3A 6ABPA 4AD8A 2O1WA 2HXYA 3OP4A 1VHJA 4C4ZA 5JJKA 1PJRA 5CD9A 5JDIC 4KH1A 2GF9A 1LSOA 4BVGA 1ZICA 1WDTA 4NZZA 5ETJA 5ERXA 3PS9A 2WRZA 1SWVA 4Q39A 1NHGA 3BJEA 1F20A 1JAIA 2AOVA 5DBOA 5G02A 4PHFA 2A0YA 1NQAO 3T34A 1WF3A 5HKKD 2AXQA 3R3SA 3Q9SA 4V24A 2OP0A 3E3LA 1FX0A 1SKQA 4ZVKA 3ZGNA 3ADCA 2E4AA 2YNMD 4PYOA 4NOKA 2FJPA 4KR2A 4Y6LA 3H11A 3OLYA 3SZRA 2OV2A 1EUDB 1XROA 3HCOA 3ZK7A 1N2SA 4KFTA 2Q9UA 4HEA1 4NPAA 2OZLB 3BERA 1Z5VA 4WZAA 3TIFA 4A2QA 3KZ1E 3UGKA 5CH8A 5K6AA 3IA2A 4KXYA 3PHBE 3RGWS 2OWDA 4BQSA 5CFMA 3I8XA 4HR7A 1IH8A 1G8PA 5IASA 3SXUA 4NYJQ 4EHAA 5IW8A 3LDGA 3ZHYA 4F9FA 1CUIA 2Z4TA 5DISB 1Y5MA 2A0WA 3DYVA 4MW0A 2IYNA 3LRTA 4FJ2A 4A3SA 3SVLA 1LLQA 1TUBA 5AKGA 1KARA 3JTMA 3ECCA 5AVKA 2IYZA 2XMPA 2HRQA 2IF0A 3P9RA 4M46A 4MWSA 1Z2EA 3P9XA 3CS3A 3FYTA 3WLSA 1FDRA 3T41A 4C05A 1KEEA 4R7TA 2UYOA 1Z0UA 2CB0A 4AQYB 1O6FA 1U3DA 2XD4A 1VG8A 1YI1A 4N7RA 1BN6A 2WIKA 3PFBA 4PTYA 1UKEA 2NOAA 2QTWB 2R00C 3A31A 3LTEA 3W5VA 2V59A 3KR1A 2AN4A 2CC2A 2OSBA 2EBWA 5C5EA 1AS3A 1QLWA 1JEAA 2BEVB 1YJAA 1ONBA 1LD3A 2R5NA 3ONVA 1JTFA 3DCYA 3ZTWA 4W1PA 2O2CA 5ALZA 5IKOA 4R69A 4AL4A 1R4ZA 1ULUA 1UWCA 3OIGA 4S35A 1MMFB 3ZD7A 1L8OA 2X6TA 3TZKA 1XP8A 4HC4A 2IW3A 5JS7A 3RC9A 4PNHA 1W88A 3ZHZA 4B6SA 1PT9A 121PA 3HH8A 5ALXA 4RFSA 4D3YA 2FN7A 2BGRA 2DPYA 3K8ZA 4HWKA 4ZQBA 5AM0A 2A9QA 3ZR4B 3ORSA 4FDUA 4C43A 2FEXA 4MZXA 3ZG6A 1NG9A 1P3Y1 1PFQA 4J1TA 3JYLA 4P3KA 2QTNA 2QP9X 2PLNA 1KC3A 3B1ZA 3QWFA 1G2OA 4PR0A 2QZSA 4K03A 3QEBZ 1EEHA 4XWAA 1H1DA 1UJ4A 1ZGAA 1OSNA 2OVBA 1XZDA 1TA0A 1U4NA 2XUPA 5HA5A 3V1NA 1HNNA 3TW6A 5ITZB 4CFYA 3GRAA 5AP9A 4DG9A 1N7GA 1QR6A 4MI1A 2VHTA 4RYDA 3RJ5A 1MO2A 2R2AA 2JLUA 1T5IA 2NUPB 3ROQA 2ZZKA 3E5HA 4RESA 2ROQA 2RJNA 4BX8A 3EWIA 3ZGZA 1SCDA 3RSZA 4R6WA 4QLOA 3IV7A 2TSYB 4BO9A 3RVSA 4C6SA 5HNKA 4F1KA 2XUHA 4K87A 2ZSFA 1UPCA 4CG2A 4EQ6A 2W6OA 1R8QA 4QGFA 5B36A 1KSFX 3MG9A 2C95A 1JE0A 4M9XA 3GLVA 4EKDA 5B6JA 5EIXA 2P5YA 2IEAA 3IEXA 4MR7A 1PFWA 1TTQB 5DX0A 2FPMA 4RTLA 2O50A 1EVEA 4QYSA 2HJRA 1GNRA 3E9QA 5E2AA 4B74A 1GRNA 2G77B 4MMXB 4WW0A 3SNHA 2BHRA 1TUGA 1Z7YA 3WWPA 2WU8A 5EJMA 1WD5A 1BDMA 4TWZA 3VVLA 4Q7EA 1TKRA 1JQEA 2YC2C 4LYFA 3MRTA 4TXLA 3UMFA 2PR2A 1YQWA 3ML1A 1AD2A 3ER8A 4CL0A 4GSLA 3TFWA 1S2GA 4BTEA 3W8FA 1BWQA 3FHCB 4HNAA 5FBKA 2BH2A 4IY1A 1R18A 2YYYA 3VX3A 4JN6B 1HQDA 2RAFA 1CYEA 2WD9A 4XSHA 5EZQA 1IB0A 3KYBA 3PF8A 2B99A 4KLCA 3B89A 2VT3A 2XF8A 5KKAA 2FJ0A 3AHGA 5FLKA 3HPRA 3M2PA 4ZU6X 5CDFA 2OBMA 5EE0A 1QKJA 2EDAA 1RW4A 1T1GA 3SBDA 2ZSAA 3S29A 1HT3A 3MQ4A 4K9NA 5A3RA 5BQXA 4YRNA 5F23A 2GMWA 3GLFA 2CCKA 4DIEA 4QECA 2IBTA 3VPBA 4QU9A 1UBNA 2P2GA 2WJGA 3GNQA 4OHRA 2Z9CA 3HB7A 1EHYA 5EERA 1M54A 1FF9A 2JCGA 3FOWA 5B7QA 1BHO1 5CXUA 1C4OA 4OHMA 2BISA 2TMGA 3TECE 2JIRA 4X24A 1O95D 1I94B 1CB0A 3FLEA 3WIEA 2G9VA 4DLZA 2CXHA 1OFTA 3Q88A 5D8DA 1ML3A 1F4VA 1UMKA 2HIAA 4IZHA 5BR8B 3TW0A 3GLHB 2QZJA 3BFKA 3HL4A 1UQRA 3ENNA 3DW1X 3OPQA 2CUTA 1SXJA 4GMHA 4QSMA 2ZBPA 2PBFA 3FRHA 1FRQA 4M0UA 4IJ5A 4K3UA 5J58A 3ZLJA 1SBZA 2BMVA 3VAYA 3V97A 4WEQA 1HE3A 1Q15A 2PD3A 4GWGA 1FYDA 3EBLA 1C7ZA 4NENB 1P9LA 1CIJA 3NGMA 4UPVA 3FWHA 1Z0ZA 3TGPA 3AVYA 1C0LA 1ZEMA 3QFFA 2GM4A 3TN7A 1X7WA 3KPYA 1NLMA 2Q8PA 2Y2VA 3AK4A 1XVVA 4UHCA 1XIVA 5EKDA 2PUBA 2PUVA 2O8BB 4OIMA 5JDCA 1BEEA 3KEFA 5HFAA 5A4DA 5FEUA 3OM8A 5BYKA 2II6A 1E1LA 3B1JA 3GGPA 3JATB 1DAIA 3QWAA 1LDMA 4R81A 3X1JA 2Z43A 1OH7A 1F4LA 3E22B 3KUXA 1U0FA 1BQ4A 5BVHA 4GKKB 4ZYLA 3DCNA 3ZDYB 3T7RA 1P62B 4DQUA 1XEAA 2X3FA 1I80A 2PJDA 1WPXA 2INGX 3V2IA 1L4YA 3MWLA 2H6EA 3JQBA 1BMFD 4RPLA 3HUEA 5DNAA 2CDCA 2O1XA 1A7AA 4CN9A 2W8BB 1ETHA 1O57A 3EISA 4KJXA 1RZUA 1FUEA 4JB0A 2L69A 4CMJA 3QHAA 2F4VB 2C4TA 3GZTB 3FLAA 2LKDA 3JTEA 4JJZA 2DWOA 1R64A 2GD1O 3QUTA 3MTDA 4EEXA 2GXSA 1Y8CA 3WGIA 3KEOA 2OQIA 2B1QA 1QH9A 2OCLA 3KS9A 1G9XA 1XZCA 3L82B 1IYZA 5K09A 3SKVA 3ZU5A 3GLGE 3NBAA 4OHYA 1KVQA 1ATIA 3QFCA 3GP3A 2JVJA 4M9QA 4TWRA 4P84A 4MWTA 4PZ9A 3HZHA 2KYRA 5K3SA 4LVUA 4FDAA 2Y27A 2Y0BA 2UDPA 2GD6A 5HIMA 2O19A 5I4CA 2XDQB 4JL5A 3I28A 3ND6A 3C8ZA 2C2GA 3FHLA 3IUJA 1JSZA 5CYGA 1FIUA 2OR3A 3L4BC 5AI5A 5GJVC 5EVJA 3TIGA 3WB2A 1AUOA 1MC8A 2VQ3A 1THTA 2J30A 2XBUA 2FWJA 3MJFA 2GX6A 1CRLA 3JPYA 2JKZA 5L4SA 1ZH4A 3VJRA 2G4VA 3P2KA 2VYVA 4MITA 4P92A 1CLUA 2FKNA 5JO0A 3R3ZA 3NTVA 5FP0A 4BZZA 2F3RA 4F60A 3BMNA 2DQYA 3GROA 3HJGA 3S8EA 2G67A 4KB5A 4MDFA 2Z1NA 1TO1E 2BJHA 2R3SA 4K6MA 5JG7A 3ZW9A 1QDUA 1RJFA 1ZRSA 4KQ1A 5TS2A 4QVIA 1HE5A 2JCXA 4WBXC 1FQOA 3U9LA 1KBQA 5BUCA 3I2GA 3UMGA 4O1MA 3OPYA 3RS3A 2DYKA 1EXNA 1SUCA 3U3OA 4CWAA 5DTEA 4E08A 5LQDA 3R0QA 1HT0A 1BXZA 2BGIA 2I1QA 1EYZA 1M2OB 2P78A 3NWPA 3QVTA 5HF9A 6GPBA 2W48A 3QTBA 5BW6B 3UWOA 4C0KA 5ADVA 5IJ9A 4OQPA 2HB6A 3W4JA 3WX0A 4V3CA 5K3EA 2NVUB 2AW5A 4NBVA 3SHTA 1R5JA 1R5OA 5D7BA 4R1UA 3WC4A 4D80A 4PINA 2Z4SA 4AP9A 1FMJA 2WQZA 3SJAA 3EGDA 2XBMA 2BGTA 2D13A 2HRZA 1MAVA 2QR5A 2WAAA 2ZSJA 3E2IA 3F9IA 3GXBA 4GPBA 3OM9A 2RAPA 3VDNB 3M5DA 3NU1A 1E7RA 5NULA 1W29A 4O4JB 3I5UA 1CUFA 2J6IA 4I1UA 4LGMA 4R1TA 5EJGA 2GFIA 4D0NA 4LJAA 3P9IA 1GNSA 4M88A 5CB6A 3JYHA 1XBTA 4EBFA 3CN9A 2V4MA 1BDIA 3LBFA 3PWZA 3LQKA 4WOBA 4WZZA 4Z4FA 4UFNA 1VL5A 1Z6XA 2FZWA 4A82A 3M1LA 5ICCA 5COQA 4ZAXA 1E4EA 1YAHA 1I0LA 2P90A 3T9DA 4KQJA 3EQ6A 1CR6A 4QZVA 2Y71A 5H70A 3TBFA 2LVBA 1QH1B 3HU3A 1YZHA 5C37A 4FFMA 1IHDA 4JVLA 5DSXA 2F8LA 4NBTA 4U2EA 1OROA 5I7AA 1RE1A 3EODA 3KT0A 1B42A 4R9VA 1FUIA 3N2YA 3FVRA 2GJ8A 1UC8A 4DILA 2YN2A 1NYTA 2F6RA 4MPDA 4YECA 1JDSA 3SFTA 3VKVA 3ZVNA 2RCNA 4L9AA 4B85A 4EUSA 3FLMA 4E3ZA 1HR0B 1AIPA 4IIFA 5EL0A 1KZ9A 1ODKA 2W6JA 3C24A 4FHFA 3B12A 4LJ8A 4FYHA 1LPPA 1DLIA 5F3RA 4ZCLA 2WIAA 4I3FA 4RM3A 4A26A 4TMXA 4BMPB 2JH9A 1LBHA 5ESRA 1FP6A 1F60A 3MN1A 1MOZA 4O08A 1ENZA 4G0XA 4N40A 4FB5A 2JJQA 5AYVA 16PKA 1K88A 1EAMA 3I04M 4BQQA 5AUPB 1D6MA 3DE5X 1IG3A 4PFJA 2CD7A 3WKDA 4AROA 4P0PB 1JHYA 3NRCA 5A5VA 2JARA 1W4AA 1WA5A 1XWWA 2I54A 3MEQA 1RWVA 4EYKA 2C4UA 5E6RA 4LHEA 4B33A 3PICA 2RK6A 2DQZA 5CR9A 2G9UA 4YR7A 4QOFA 2XQVA 1UH5A 4RD4A 1C1DB 3UMMA 3DNFA 1P4SA 1QGZA 1XTKA 5C32A 3DLPX 1B8NA 5EMHA 3WMFA 2AFIB 1SD2A 1GUYA 1MO5A 1V8BA 3BQNB 1D7OA 3GMDA 4MGEA 2B8TA 3VNBA 3D64A 5CIWA 3RSCA 4BC0A 2C92A 3EIXA 3LX4A 5KX5A 1VMKA 1XNGA 4EB0A 1IHYA 1EFLA 1O6BA 2IP2A 5JEEA 2PK3A 1GFWA 3RHSA 3N53A 5JQWA 4LY0A 5AUQA 1MPTA 1Y4UA 4NCBA 1QP8A 3OY7A 4ZCPA 4OO3A 3C3WA 2IQ5A 4M86A 4N6OA 4P0TA 1VPVA 3N2KA 4K28A 3RIGA 3TIVA 2PLAA 1OA0A 4X7PA 3W9YA 2XCRB 2H1SA 4UMVA 4E07A 3QXXA 3D6FA 3O75A 3QLUA 1NUQA 2XT9A 4BQPA 3AUXA 4YWHA 3BXHA 2J8ZA 4PO8A 4WFKA 4J7AA 3BX1A 3UC5A 3N6RA 3WMRA 1QH8A 7MHTA 4URYR 3A1TA 3QKSA 3U44A 2C9OA 1JXMA 2E1RA 4MW5A 5E0OA 4YN3A 1PBTA 1QUEA 5FJIA 1CUCA 5K0ZA 1SK8A 3C4JA 3MT7A 1TTPB 4HGYA 4WD3A 3R7SA 1U1DA 3NHSA 4UMDA 4D9JA 2X8AA 3E8SA 3RSHA 1E77A 3CB2A 3UJBA 2P5TB 4BGVA 4CMAA 5JV5A 3ETJA 3NDBB 1BX1A 2OVFA 2R65A 4PONA 1AY0A 4U0KA 2B1IA 4BDSA 3U5ZB 2JJYA 2J33A 3CM0A 3A4YA 4EVSA 4I6EA 1VLHA 1WPRA 3NV9A 3KHSA 1JI3A 2YJZA 1BC5A 4L3OA 1HKUA 2GS9A 3DZBA 2DU8A 4Y6PA 2DHQA 2HMAA 1RAEA 3X1YA 1EUZA 2PUHA 4H6VA 1UKVY 4FGUA 3OKFA 4HD8A 4RF3A 1YS1X 4ZI5A 1K8XB 3Q3VA 1DIGA 3UFBA 1GYQA 2FW8A 2FG7C 4F6RB 4YXWD 5TQ0B 1K4MA 5F3DA 3WLNA 4UJ5A 2YFKA 1BD4A 3MCWA 3MERA 4KP7A 3U2QA 1W4LA 4L57A 3GT4A 2V65A 4C07A 1NRWA 3V4OA 4AJ9A 3ZHQA 5CDYA 3T6KA 3O31A 1VSUA 1A7JA 3U17A 4COOA 3T1NA 3ZW7A 1WMEA 1JPNA 1NP6A 3M5PA 3M7IA 3RU7A 3NORA 4AP6A 1A5SB 5HKBA 1X2EA 4LXXA 1B73A 5DI9A 2Y1GA 1JMYA 3KUUA 5KMGB 4UVDA 6REQB 4NESA 2WKWA 4WHMA 1JW9B 5F78A 3UWSA 3RLIA 1YIAA 3ZWNA 5JASA 3R7DA 1SBHA 5K3AA 2NYUA 2V7GA 4WLFA 2QUHA 2OCYC 3C87A 2X2OA 5KTYA 3AETB 3Q12A 5AXAA 2Y1LA 5SY6A 4YRJA 3RUPA 5K05A 3CX4A 2ZTMA 3FF1A 4L8GA 2X8JA 2H48A 1N8TA 5JI2E 3OFJA 3UJ7A 2XRFA 5EUMA 2FPRA 2J3LA 2OO3A 3MLEA 4DWOA 2ODTX 5KYXB 3VR0A 2IUYA 3UPUA 1E0AA 3O9MA 5GINE 1P7CA 1F1JA 4QOJA 2C9BA 1QZTA 2JAXA 5BSVA 4V1CA 4MS3B 4Q6BA 4WLEA 2O2EA 4MH0R 5F5NA 5IHXA 1BS1A 2QX4A 3ACDA 1A9YA 3M1AA 1ZVQA 4JR1A 4C7BA 4D3ZA 3CZ4A 2IYXA 5AVXA 4ZT3A 3PT9A 2H57A 2Z5FA 4A0HA 1GU0A 4U3JA 1OLXB 2I91A 3JR3A 1ABFA 3QWBA 2CHEA 1E92A 4M9RA 4EO4A 2ERXA 1UZAA 4QEZA 2W71A 1XTJA 4R8SA 1MO3A 4D82A 1CSEE 2VPZA 2IHZA 2E85A 2PMCA 3I6MA 3LCVB 5AVSA 1D8AA 3QKTA 3L93A 4YRRA 2G5TA 2XUQA 3MZ0A 1FZTA 1VMEA 2JBHA 3IUQA 4P7BA 4R1LA 3TSYA 3HP7A 4WK0B 1NF3A 1XSEA 3E2PA 4RPKA 3H7IA 3MNFA 5ALGA 3SJCA 3TPZA 4EG8A 1KL7A 3KXLA 4S1OA 3NHFA 3KHUA 1KDOA 2HH9A 3ONFA 5E1OA 1FDOA 3IRUA 3QNWA 1J24A 3B36A 1N4AA 3UWKA 2JIBA 3FAZA 3R3UA 1DPFA 4ZTUB 1B6GA 1QZ3A 3H9UA 2UUPA 3U4DA 2OC9A 3QKUA 4LOAA 4BO6A 1O4WA 2FDRA 3H2HA 2GHIA 2JRCA 2IUFA 2NG1A 1XEWY 3NAMA 3OSZA 3IA7A 4Y0AA 5LA6F 4FGJA 3EDOA 3F49S 2Y3IA 3LSTA 3EZ9A 5B64A 4Y2QA 1TYCA 1QOQB 2GVZC 3BKWA 3GUZA 1XOIA 5HDBB 1H1LB 4JT9A 4ZDKA 4DZRA 3KQHA 2D6FA 3EUFA 2CYBA 2H7YA 3NOXA 3TTXA 4KAAA 3UB2A 4CF5A 4DUGD 4YMHA 3GAMA 1SC3A 3NCHA 3TXXA 1AK1A 5LZ5A 5EE5B 4C5AA 4G5GA 2DR3A 2PL1A 3EY9A 3ILSA 2BGMA 4MUJA 1PLJA 1VZ2A 4RLQA