5FX2A

Comparison of the crystal structures of a flavodoxin in its three oxidation states at cryogenic temperatures
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
147
structure length
147
Chain Sequence
b'AKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTWGDDSIELQDDFIPLFDSLEETGAQGRKVACFGCGDSSYEYFCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Comparison of the crystal structures of a flavodoxin in its three oxidation states at cryogenic temperatures.
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Electron transport
total genus 44
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 1991-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5fx2A00
1CZOA 2FAXA 1AKRA 4Y9RA 4N9QA 3NHYA 3EYWA 3L9XA 1FTGA 2V9CA 4Y7CA 1CZRA 4LA4A 5LVAA 4QODA 1J9EA 4FX2A 3KAQA 1SQSA 5FA6A 4ZVNA 4H2DA 4F8YA 4QOFA 3S2YA 3EDOA 1AZLA 2AMJA 5A4KA 2QWXA 1QBGA 4ZVLA 4C76A 5BUCA 4CETA 4GR9A 4YAWA 3GFRA 3FW1A 2QMZA 3NHLA 3L9WA 4GQIA 3F90A 3NHJA 1RLIA 1YCFA 2Q9UA 4PU0A 4XDGA 2R96A 5NULA 5LJLA 1YOBA 5F12A 2Z9CA 4HS4A 4NLLA 3W77A 1F4PA 4GI5A 4LAFA 2XODA 4FGLA 4QOGA 4C14A 6NULA 1OFVA 2Z9BA 3FNIA 3W7AA 3G5MA 2QX6A 4BMPB 3FJOA 2X2OA 1H66A 1OBOA 3B6MA 3OWXA 3OWHA 5F4BA 1QHEA 2KQUA 3GFQA 3B6KA 5LJIA 4R81A 4U7HA 4YAUA 3F2VA 3K20A 4U7FA 3ESYA 4DY4A 3F6RA 1WSWA 1B1CA 1RTTA 2FOXA 1KBQA 2RG1A 4YAFA 1VMEA 1FLVA 1X77A 3F6SA 4OXXA 1AKWA 1AG9A 4LTNA 3SVLA 2HNBA 2FDXA 1YCHA 4ZVMA 2MWMA 3D7NA 2Z98A 4YAOA 1DXQA 5F51A 1CZUA 3HLYA 1YKGA 3R6WA 3NHWA 1AKVA 2X2PA 3FVWA 5JROA 4LTMA 2MOKA 3OX2A 3QFCA 1YRHA 4QOIA 1FLDA 3NFRA 1AKQA 1H69A 5EMNA 4DIKA 5LLDA 2BF4A 2FX2A 3NHSA 2V5VA 3GFSA 1BU5A 4BMOB 1QRDA 5FUQA 2OHJA 4LTDA 1ZX1A 2ZKIA 3NHPA 1C7FA 1C7EA 4M0CA 2OHHA 2QX4A 1AKTA 3ZHOA 3U7IA 3HA2A 5NLLA 1J9GA 2W5UA 4QOEA 3OJXA 2MT9A 1FLNA 3HR4A 5EA2A 3B6JA 3O73A 1AKUA 2QR2A 2OHIA 2XOEA 2OYSA 2WC1A 1GG5A 3U7RA 4PTZA 3NHFA 2A5LA 1RLJA 4N82A 4QOHA 5TGZA 1NNI1 3P0RA 3ESZA 1QR2A 3ESXA 1SG0A 3K1YA 1AHNA 1XYVA 3N3AC 2BPOA 3FX2A 3KAPA 3W79A 3OX3A 1TIKA 1OBVA 4U7GA 2QMYA 3NHRA 3ES9A 4N65A 4YALA 3RPEA 1J9ZA 2BN4A 2GSWA 1XI2A 1D4AA 1CZNA 3LCMA 3N3BC 3OJWA 4DILA 3GAMA 5B3LA 1WSBA 3KEGA 2BMVA 3KLBA 4PTYA 1CZHA 3NLLA 3O2NA 3W78A 2D5IA 1V4BA 4FGJA 2B3DA 1JA1A 2M6RA 4ESEA 3OX1A 3NHUA 3UXEA 1FLAA 2MTBA 3TEMA 1FUEA 1RCFA 2FZ5A 2FCRA 2HNAA 2Q62A 1I1OA 1XT6A 1AMOA 4J8PA 4FGKA 1JA0A 1E5DA 2HPVA 3UXHA 4HEQA 3TZBA 3JSXA 2FZVA 5LMCA 1CZLA 3QE2A 1DX9A 4XDHA 2N1MA 1BVYF 4YQEA 4D02A 1ZWKA 3OVMA 2F1OA 1FX1A 3NHKA 1ZWLA 2Z9DA 3N39C 4NULA 4ZVKA 3LT5A 1D04A 2FLVA 4QOJA 2R97A 1KBOA 2QX8A 4CF6A 1FVXA 1XYYA 1J8QA 1CZKA 3QFRA 4S24A 3TE7A 2QX9A 2ARKA 5LBUA 2FVXA 4H6PA 4C0XA 1TLLA 1YDGA 5LBTA 1T5BA 5B3KA 4C0WA 5FX2A 2M6SA 1D03A 4Y9UA 2V5UA 4ICIA 5ULLA 3B6IA 2KLBA 1YCGA 1DXOA 2BZSA 5EAIA 1T0IA
chains in the Genus database with same CATH superfamily
1MC4A 1SVNA 3AB7A 5F5XA 4BQQA 2OG1A 1VLQA 4S2EA 2DHCA 2W93A 4REQB 3ZTYA 5BV8A 1QVWA 4OQFA 1SUEA 3DVAB 3LKBA 4JUAA 4MYHA 2F1IA 4GXQA 4MVJE 4X60A 2V9CA 1E2EA 4DBVO 5KC8A 2ZYWX 4H4EA 1IY8A 2H0AA 2H3EA 5AVYA 1IZYA 1NVGA 1J7KA 3PUZA 4IOLA 4AW9A 1E1QD 3QLVC 4QODA 3N9IA 5LZ9A 4EKYA 4UBIA 1ZJWA 2YDXA 3E5HA 4MJ3A 1HG1A 6Q21A 4GI7A 2ZB4A 3A11A 5CPFA 4ZHQF 2CBZA 2H8KA 3ED1A 2YYYA 1GUFA 4E32A 4TZ0A 4O4LF 3ND5A 5DXFA 2JLBA 1OHHA 3O83A 4F8YA 4DV2B 1IPEA 5TDHA 3K0EA 2A1TS 1I4DD 4AMVA 5JRZA 1ZMBA 3CO0S 1DAFA 1TQ2A 2TECE 4Y6GB 2FEXA 3MRVA 4FFSA 1AJEA 1ODLA 3BTUA 3KKPA 3B6ZA 4BFYA 5KVQA 4AI6A 3AHDA 3H9UA 3W34A 2Z1NA 5G1OA 3MMNA 1VHJA 1D9XA 1I6WA 1MV5A 4ZJUA 2ZAOA 1LBSA 2JGIA 2J6IA 3C5WP 1JIIA 4V39A 1L8AA 3SBOA 3EGDA 4GW3A 4H1HA 1GZ3A 3E9CA 3D5QA 4FE7A 2Y67A 3DT6A 2QMUA 3AY6A 3NTVA 4JKYA 5C9ZA 2J3EA 3PQEA 4IIJB 4KX3A 2C97A 4N49A 4DCNA 2XUOA 1MUUA 1U7ZA 3OQ1A 2VZEA 4RYDA 1RWVA 2HLDA 2ZAGA 4UBKA 2VO1A 4R1OA 1IM5A 4AF8A 4EEZA 4L5IA 2Q0SA 1JE1A 1SK8A 1WCIA 3GA7A 4BE4A 1YB6A 5DP1A 4WH0A 1E58A 3V46A 1Q95A 1ZCAA 4QT0A 4RLHA 3GJSA 2H9AA 4BP1A 4JD5A 1KHTA 3FMPB 3IP3A 2CJWB 3A36A 1CHDA 4YAIA 4P92A 5AVWA 3JAKA 4FGLA 5J23A 2B8TA 1R88A 1D6NA 3QU4A 2AJTA 3W6PA 4RH3A 3R75A 3QFFA 3R5XA 1L7NA 5CT5A 3ZY3A 4KXNA 2PCJA 3M5PA 4WWHA 4WFJA 1QRSA 1M8FA 4KTVE 2WKQA 2O23A 1XE3A 2PMCA 3TNJA 4A0RA 1AQLA 5EJ7A 1CY1A 3VTKA 5B64A 3CPJB 3K30A 3PVCA 3OOSA 2WT9A 4MKHA 3UKJA 1D2HA 1P7VA 1CG6A 2QW8A 3I2YX 3K4HA 3PUHA 5G4KB 4BNMA 2WAOA 3I37X 5L7TA 5FA8A 3K70C 5JU6A 3MBIA 3V4ZA 1Q0RA 4ATNA 4JYCA 10MHA 3K9QO 1RYHA 5F77A 1K6MA 4E07A 1B8UA 2A86A 1MO3A 2AOUA 2ODNA 3PHBE 3WK5A 4EUEA 5AOBA 1C9JA 2Z5FA 3BIOA 2NNWB 1VHTA 4GPBA 4KAAA 3VOTA 3WKCA 4BFXA 4CTKA 4MS3B 5AXBA 3G2NA 3ZE8A 2RHTA 4WGFA 2EOAA 3EUFA 2C00A 1C5KA 4MO9A 4ZAZA 4DC0A 3LTNC 4DV1B 1TIPA 4P33A 1W4LA 3D7MA 1QYRA 4B79A 2OZKA 4J4HA 4DA7A 1GZSA 1I3OA 3B6KA 2LNDA 4KNWA 3FYUA 1E92A 2GO7A 3QX7A 5AOCA 5C32A 3K53A 3PEVA 4IINA 1Y8QA 4Z9AA 3KQSA 4CEIB 3C6BA 1K27A 4WNYA 3ODPA 3DNFA 5EZYB 5DK6A 4UCFA 1DIGA 3RAPR 5H9WA 3JQRA 4OX9Y 2OGSA 1R12A 3CVXA 3GUYA 1BCRA 4TV8A 4L07A 3WQQA 1D8TA 1EAYA 4UEJA 4JL6A 4RADA 4N3BA 4ED9A 2JGNA 3BMQB 3NIWA 2RHHA 1AN9A 4EO7A 3HUDA 1NKVA 2DECA 3EBLA 3UGTA 3UYKA 1MD9A 1P4SA 3RANA 3RHTA 1EBFA 3DL0A 1FBNA 1N9GA 2WUGA 4Q34A 1FNMA 2GBIA 2GUWA 4WLVA 4F6RB 4U2BA 3CZCA 4KP7A 4LZOA 2J3KA 5BWBA 3DLPX 4BGUA 4BZWA 3ZCSA 2UDPA 2X4GA 2JK1A 4ZAGA 4JU9A 2JLZA 3Q85A 1X1DA 1XZKA 1W9MA 3L1JA 5CJ2A 4YI5A 4BLSA 1M66A 2RHRA 3OQIA 3I76A 5IULC 3ZW8A 2Q41A 1OWPA 4S1NA 1BFUA 5BOSB 2AEMA 1CUXA 4PC7A 2RGAA 4X63A 3AI7A 3NRCA 1SXHA 2X9NA 4KDEA 2Z98A 1JR3A 1V5WA 1Z4OA 3T4EA 1PEKE 3GRKA 2DX7A 4QUDA 3V2HA 5KU1A 1DIHA 3NQ41 3BRCA 1NX6A 3OZBA 3FAZA 4B35A 2B99A 3KKEA 4NE7A 4KXWA 1MR3F 2CB9A 3E2IA 2RAUA 5DHRA 3I4FA 3L4EA 4C20A 1Q6ZA 2W2QA 3LC1O 4I46A 5IEBA 3DUFA 4YCAA 2OAEA 1TCUA 2JPDA 2F64A 4GBJA 4RAQA 3PC6A 1P5FA 1V25A 2WU1A 4E0BA 4CFSA 1DJNA 1KWGA 2BOVA 2A1UA 1J2JA 1KYQA 2X2PA 4O1IA 3IE0A 4OQXA 2VDVE 3B2QA 1CUWA 5EP1A 5FOXA 2IKQA 2Y3IA 1K75A 4M21A 5CFOA 5AW2A 2AOVA 3Q2OA 1UZLA 4Z2AA 3TIFA 4Q19A 4ZGGA 4TN5A 1NQTA 1II8A 1SEVA 3L8FA 4Q05A 1UWLA 1CVRA 1EA5A 3ZWBA 3FSRA 3BT7A 1PGOA 4HAUA 4NDZA 4LI3X 2REBA 3QFCA 1DEXA 1Y7PA 3SMVA 2YZGA 1GL6A 1PJ3A 4BAGA 1CUFA 4NWIA 1JPJA 2I7CA 4I9UA 1NHWA 4KI0A 1TCVA 4ODIA 4TL7A 3WI7A 2EZ8A 2DKNA 4OP2A 4RA6A 3AKZA 3GDOA 3WNVA 3FNHA 3PR2B 5LLDA 4L95C 4QNNA 4LF7B 3WGVA 3EEFA 2F3SA 4YWJA 4K28A 3MJVA 1OASA 3VOAA 1A04A 2EV9A 2F9LA 1I5EA 4BAUA 4DDTA 4XD2A 1QS0A 4ZPJA 1YHNA 4Z4FA 3BD7A 1DAKA 1ZUHA 4JSTA 1JEAA 1Y5IA 5ALSA 1XMXA 4BVHA 5FUQA 1E6CA 2X0DA 4Q3CA 1TUBB 4BVGA 4O1MA 2HBZA 2ZBVA 1F2DA 4REQA 3I73A 2VTEA 1ZH6A 1M0WA 2JLUA 4P7GA 3DVAA 2QK4A 2VDLB 1Z5PA 3C3MA 4IMIB 4TL6A 4WERA 1TCCA 5FI1B 4MVJA 1CUCA 2PWYA 3KQMA 5TMPA 2H5IA 4QHSA 3VJRA 4DLNA 2D2VA 4JBLA 1G20B 3O75A 2ZCJA 3F8SA 1CERA 1A8SA 2AFRA 2GPAA 1Z4IA 2GN8A 4J49A 3UUEA 2C1XA 5AH0A 3ZBQA 3PJEA 5JNTA 2I6TA 5EUMA 1RXWA 1W6RA 4MUGA 3ZWPA 3E3MA 1AN0A 1KY5A 2FPGB 2VOJA 1XZEA 3KXIA 4HDKB 4RULA 3AWIA 3GYBA 4K1LA 4CXMA 3CF4A 4DDMA 3FYSA 2J5KA 1ENYA 2E1PA 2ZI5A 4HYQA 3GNQA 3W90A 1U1CA 4R2WA 4AWAA 5B58T 1FX0B 3RK1A 1ZD3A 3C3DA 3QMVA 4FEEA 3N28A 3RVQA 3RSGA 1JEEA 5KKNB 3QSGA 3VA7A 1GAWA 3E9QA 3PNPA 1T1JA 1G8GA 2WZQA 1GA6A 2ECOA 3A4IA 3WR5A 1G55A 3HR4A 3MJCA 4BMNA 1G7RA 1XZCA 4W5QA 1QH1B 1AKUA 3T9CA 1GUZA 2ZYSA 3KT0A 4NU0A 3WMEA 3OTHA 4Y2SA 2DFKB 3ZJYA 3OQNA 4NU5A 3EFOB 5JAZA 3GGPA 1VB3A 3NBFA 3RYFB 4AMUA 1RLJA 2XUAA 4E51A 4J0DA 3KWFA 1TUIA 3HJRA 4GXRA 3CTMA 1QOZA 2DH5A 3C6YA 5PGMA 1XU9A 1WUYA 2P6NA 4V0MA 7GPBA 3RS8A 3Q7SA 2CJWA 1QR6A 2DWPA 5B57C 1UMBB 2EP5A 1E1CB 6ABPA 4AG5A 4LHXA 3X1XA 4TXNA 4M7WA 1K6EA 3HSKA 3MWDA 4AZ0B 3DVSX 3FGNA 1YI1A 3PC4A 1Z26A 3WISA 1GZ4A 4Q21A 2NW6A 3W0LB 3W79A 1XTJA 4ITVA 4JGBA 4ZO7A 1CB0A 3T12A 4D0LB 2ZYAA 2BFNA 4EUKA 1ZJYA 4C0HA 4KBFA 1ZD5A 2VSFA 2VNIA 3ETJA 3M49A 3RWBA 2SKCA 4OFBA 3U44B 4Z4EA 4N4AA 4WOPA 2XADA 4H3HB 1CRQA 1YL5A 2V5AA 2HO5A 3RPEA 5I7FA 2JL1A 3LCVB 3F96A 5K5EA 5CHEA 3EASA 1VIVA 1EEHA 3NTLA 3VNQA 1JYSA 1DKQA 3AJRA 4IDEA 3ZCRA 1J2YA 2A0WA 5KWSA 3G49A 2O8FA 1P9WA 4ZYWA 1JB1A 3RAEC 4A0SA 4RMIA 5B3LA 1Z8HA 2I4NA 4GU5A 4RZ2A 2YFYA 3TMAA 1A8QA 1YR2A 3RK0A 4E11A 1XFDA 4PTLA 1D2NA 1N3BA 5EFOA 4BRSA 4M1YA 4OXQA 3P5BA 2IHUA 1UBJS 4GZMA 3VU9B 4JYZA 5JS2A 1ZMTA 4CEIA 3PGMA 5EZYA 3FMFA 4M0DA 5BN1A 2TMDA 5DTEA 1ZD1A 4TPKA 1S1CA 2R1UA 2FN3A 2EBWA 2QPTA 2DFVA 5DTJA 4E1AA 1VYVA 4PCAA 2XHEA 5AK3A 1MO5A 2VYCA 1CUEA 4Z0NA 3BMQA 2ZB8A 4N8SA 4IUYA 4FGJA 5GGXA 5JNUA 1UH5A 3H1EA 1WY5A 3OF3A 1CRLA 2XMBA 1AKYA 3MD0A 4LRXA 4QT4A 3E5NA 1O96A 2K2WA 3BGIA 5HK9A 3I3OA 2X4DA 1TM1E 3PQFA 1E4YA 1TM2A 1ZONA 2HCRA 3PGLA 4CIXA 5HJ7A 3JALA 2OOKA 3KKNA 3MWJA 3RVOA 1AKMA 3KZOA 5CIQA 5IZCA 2WTXA 1HMYA 1P9NA 1XZFA 4KVAA 1DT3A 3MJDA 2H0RA 5AHOA 2E4AA 1AS0A 3KVYA 3TEMA 4BLVA 3E8SA 1RKUA 2V55B 3F5QA 4KIWA 4YB8A 1AXRA 1P18A 1KZ4A 4B5KA 4R0MA 2AXQA 5A4IS 4ZQHA 2W2XA 4I4IA 1E64A 1EHIA 2QYHA 5BOSA 1N0VC 2JI4A 4AQ7A 1WCXA 1T6YA 1UXKA 1VIMA 1PNOA 1XT6A 2IPNA 4JU8A 3O84A 5THXA 3KSMA 5ENDA 5JQGF 3IEMA 1DE0A 4JBYA 4TV9F 1TZCA 1NBOA 2QL7A 4FQ5A 1E5DA 3TLXA 2Q4EA 4B45A 4BNWA 2QU7A 5CVJA 5FJJA 5FJIA 3ZWQA 3GNTA 3ROMA 4R6WA 1IWOA 4R3NA 1D4ZA 3I0MA 2QYSA 1JIUA 3ODGA 1GO2A 4KR0A 4QXAA 1TLFA 1O95A 3TZBA 5C1DA 1A4XA 2FUNB 2ZSDA 3H5VA 4O2AB 2H4YA 4QTUB 2VQFB 2HF9A 2WFMA 4KH0A 5AJZA 1TM5E 4EJSA 2A0XA 4ZT5A 2WKPA 5ETJA 1DRVA 4YCBA 2CLKB 5K2MA 1H93A 2KMLA 2GVNA 3FLMA 3AR6A 1AS3A 4ROSA 5C53B 2CL6X 3WLSA 3E4DA 4JLAA 3I53A 1WV1A 1MH1A 3M6IA 1DV2A 1FUIA 4HLUA 2EZUA 3F5SA 1BVYF 2CNWD 5E1MA 3W3AD 2XCSB 4RS4A 1VCOA 5B6PA 4AMBA 3UJAA 3CEHA 4U3JA 1MORA 1DOZA 5TF0A 3T54A 1QLWA 1F0KA 1LSUA 1WCYA 3EK2A 4NULA 3LT5A 2AEEA 2FF5A 5ITZB 5EIWA 1UZMA 5EZ6B 2ZIXB 4L3OA 4MVJF 3AFMA 3PKIA 4IQ4A 1KMCA 4RPIA 4UREA 1I94B 1Y0BA 1L7OA 2G06A 1N78A 2FJ0A 2EFJA 4JWTA 1FTNA 1UZAA 1FVXA 3S8MA 2P75A 4QREA 1Z2NX 1XYYA 5BV1A 1CZKA 1YNSA 5HBGA 3AO0B 4WECA 4NQZA 3A7DA 2NMVA 3LYHA 2NO6A 3VU3A 1SELA 1TUBA 3L49A 4G1UC 3ANXA 4OY3A 2OORC 3GEIA 4YLYA 1MFZA 3W1VA 4A23A 3CLUC 4UTNA 2G4VA 4I81A 2VSXA 1ULUA 2QNRA 5B2ZA 4S3MA 2OCYC 5ARDA 3C6QA 1G20A 2I4LA 1RWBA 2BUCA 3NVAA 4KO1S 4Y2PA 3KSBC 2V4ZA 2ZWVA 4ZAFA 4JS0A 2BJWA 4ZI3A 2HV8A 4DWOA 3QEOA 2IYPA 3MMZA 1ID1A 4I1UA 3AJAA 4RZUA 2O8FB 4YMVA 4BO2A 4DCPA 4HDKA 4I5EA 3GLGB 4X6YA 2C3PA 2YN2A 3G8BA 2XXBA 3OFKA 4NS1A 4Y9SA 3B6IA 4X3OA 3OPXA 3BMNB 3DUWA 1CTQA 2WIAA 2WSIA 2J59A 5E2IA 2W7TA 5JVDB 1FX0A 3K2EA 5AW5A 4WESB 2G0NA 4I4NA 2ALJA 2EKDA 5DXJA 2FW1A 2PEZA 2DFNA 3EQ9A 3GT4A 3I1JA 4EPVA 5BR8B 3AUYA 4YLEA 2POQX 4YUYA 3GY0A 2GCNA 5CBPB 3S1AB 1E3IA 1QH1A 2NU7B 3I01A 3IA2A 3BSYA 3WTBA 3TLZA 1E9SA 1X1CA 5I51A 4FHFA 1U3WA 4TMZA 1AQYA 1JYEA 1PG2A 4EPYA 5JR3A 2CK3D 3NYWA 2I76A 3W2TA 3OCXA 3V8QA 5FBKA 3EFOA 3W8NA 4BX2A 4F2GA 2EFDB 1N1EA 2Y68A 3FTPA 3AP2A 3RYFA 4YV0A 2HR1A 3TVYA 4BNXA 3EE6A 3PFBA 1QIIA 4AZSA 5I9SA 2KM1A 1PG5A 4TT3D 1E2HA 4C0BA 4PM4A 1DHRA 1T10A 1VXRA 3VXKA 3S2YA 3CNEA 1WOYA 5DB4A 1SCBA 1K7FB 2RJ3A 4FNAA 4PNEA 3TLAA 1N8KA 3HXOA 1SO8A 4FX5A 4R2LA 1S3SA 2WDZA 3AY3A 4AZ0A 3GGDA 3UOGA 2JFFA 1RJFA 1JFFA 4ND7A 4ZT4A 4F38A 4CF7A 3PHGA 2QMZA 1OYOA 3CKLA 2X4IA 4KQFA 3GUUA 2LV8A 1JGTA 4N0DA 2HCBA 4N6NA 3SKYA 3TTSA 1BN6A 2JBAA 3FYTA 5WRFA 4RUKA 1FJXA 5AJWA 2UVPB 4DFDA 1GEEA 2Q3BA 2BI7A 3T7SA 3GFBA 3E7FA 1KBZA 2J0UB 3HI4A 3MLBA 3FE2A 4ZEWA 1BXRA 3F7MA 1S3FA 5EZYF 4YX9A 2QTVB 2QPLA 1W36C 4ZGBA 1SD5A 4WJKB 1R15A 3KSUA 2ZYIA 3OF2A 4PLYA 2OV6A 1A8IA 3H2ZA 3K9BA 3EMDA 4KVGA 1LS6A 2D59A 5ALFA 3TNDA 3U37A 2DR3A 5E6SB 3SY8A 2O1SA 3IV6A 1DFHA 4E4TA 4H15A 2GT1A 3R3SA 2FZ4A 1PYOA 1NUUA 3ND6A 3UJPA 4BKMA 4PLHA 2XT6A 4W5RA 1VMDA 3BXZA 1N7JA 3WJ2A 2A92A 4QOGA 3CCFA 3L7JA 1I24A 4J91A 4XX1A 2IBMA 4CL0A 5L53A 1H05A 1YZHA 4MDFA 1Z4KA 2OHXA 1HETA 3A31A 3VU9A 4RTJA 3U3JA 4IH1A 3U26A 1OFVA 2R8RA 3TFWA 3KPWA 4JYMA 4QFBA 3QHAA 2CYCA 2XGSA 4UQOA 2ZVDA 3AX6A 3RTGA 2AW5A 1KY4A 1L6IA 4V2IA 5FLEX 4RQUA 2C5FA 1KU0A 1ZC4A 2Y4NA 3KKMA 5ADVA 4FE4A 1X7GA 2IRWA 621PA 1BCSB 4IEFB 4HNUA 3CVUA 1GCUA 2G9UA 1DBQA 1U81A 3P32A 4BO5A 3X1KA 3C7KA 1KKUA 1DXHA 1JJ7A 1LDNA 1N9KA 4NX2A 1OBOA 1ADYA 4XIGS 3RYCB 1E5TA 2AVDA 2IVZA 2XMPA 1UKBA 5MHTA 3SZRA 1U98A 4HDRB 4RK5A 4ENPA 2RHJA 1YE8A 2BGWA 3P2IA 1DTWB 2QXYA 4UHDA 1MT0A 1XRNA 2GM5A 4J94A 4EENA 1L9KA 3UT0A 3PJDA 3VZQA 1X2EA 3PQCA 4NK4A 3ZCPA 3QK7A 1PEAA 3BUSA 4MV3A 2WB2A 3FWZA 4D56A 3QMWA 5FO0A 1X3SA 5FUBA 5HZKA 4IQ0A 4D4MA 4DMKA 1JLMA 4ARAA 3SHOA 2HKIA 3REFA 4CKXA 1RIIA 2YYSA 4LQLA 4BZXA 4M6WA 1QO0D 1B1CA 5F2NA 4O4HF 2X77A 3GFPA 3OECA 4WIAA 1P75A 1E18A 1SJ9A 2VI5A 4NCXA 2C92A 4DSUA 5IC6A 5IG2A 4G5OA 2C2WA 3E48A 4PZAA 2IPOA 1FFWA 4QBHA 5DPMA 3RKUA 1OT3A 2RG1A 3U61B 1IM2A 1OI3A 3CZ9A 2KE5A 4BB9A 4EJFA 1PDOA 4RK7A 3IUSA 3T9AA 1EM6A 4WQMA 7ABPA 4M1KA 4LTNA 4O2AA 4XYLA 1DJPA 3I5YA 4HXYA 3VNBA 3BIXA 2BC9A 2O7RA 3RNOA 1X19A 2LR0A 2ZJ3A 5LC1A 3LVRE 4YR9A 3NKLA 3DEHA 4RCZA 2WUFA 4XDZA 2QUIA 2VSYA 2E9SA 4LDZA 1FXUA 4U7JA 4P53A 1B23P 1R3UA 1YR6A 4OHFA 3UWSA 2JAPA 3VOBA 1NJ2A 4GPIB 2DJ5A 1E32A 4Z8XA 3PFGA 2P69A 1RRVA 2RJNA 1M2EA 3A6JA 4PIMA 5JJBA 3V8PA 2E82A 3JAWB 3JQ9A 4JK3A 3GLHE 2CDAA 4NSNA 4YIKA 4Z8YA 3TQSA 2XB9A 3GLHB 2IU3A 4GRIA 4UHHA 5ITZA 4ZOAA 1PZXA 2ZG6A 3A2NA 2ZIXA 3QE4A 4IEEA 2C4MA 4P08A 4Q00A 1N2BA 1Y82A 2IL1A 2OLJA 3QE0A 1E3LA 4HEA6 4I2NA 3HDTA 3OT5A 4WEQA 3SR4A 1DNPA 1MF7A 4QSHA 4QFMA 1I01A 1DFIA 3BWBA 1EUDB 3LSYA 1NN1A 1K92A 3DLAA 4HQFA 4K3UA 1U2GA 2CXPA 1QDUA 1ZH4A 3D8RA 1OI7A 2HSJA 3IDZA 1EFPB 1RBYA 5FT9A 2XMQA 3TNFA 4BMDA 1ODKA 5AKJA 4MW5A 2A59A 1EM8B 3CSSA 4M0KA 5A3QA 3OWOA 3LBNA 4PINA 3RGWS 3ISVA 4G5HA 4RF5A 4OL9A 5JYDA 3SR0A 3OX2A 4LYAA 1D3AA 3IQIX 3FG9A 3AW8A 3M3PA 2VF4X 2CXNA 4PLWA 4S1PA 3M70A 4Y2XA 5GM2A 4MW2A 1ZOPA 2AXNA 1PTJC 3F8TA 1P5RA 1EXMA 3GMIA 4UAUA 5BQPA 1MA0A 1VKJA 2Y1XA 1ZH8A 4AJNA 5CB4B 1BH2A 3OPQA 3LKZA 4GR5A 4TLLB 5KREA 3PI6A 5LMNB 1VP3A 1THGA 1HT2E 3PXAA 4DLBA 2C5BA 1M2KA 2E5FA 2JARA 3PEFA 5FPHA 4G4SP 1RQPA 3SYKA 4CVNA 4MUXA 3LQ4A 1Q3KA 2QRQA 5AK4A 1BAPA 1IUNA 4LXGA 1MH9A 4LVCA 5F2KA 1TM4E 2F17A 4KPUB 1I2ZA 4MIYA 3OSUA 3BMNA 4CV3A 4MJLA 4BQFA 2ZI6A 3GPBA 3JQ6A 4M99A 821PA 5JVDA 1Z88A 3L7AA 5I7EA 3U4DA 5HP4A 4WESA 3ELBA 3HUFA 4RFSB 1NPYA 2EJBA 4OFZA 5DNYB 1ONBA 1X13A 3FNRA 3V6MA 4HDMB 5B4TA 1NXWA 1F5NA 5IPFA 1CUUA 3PEYA 1SUBA 1Y1LA 3WJAA 4D9NA 1Y8RB 1F6DA 3CX7A 3S1AA 2QSYA 1TJNA 2NU7A 4FTWA 4W5TA 3NWPA 4GOOD 1J2EA 5KSWB 2ZTSA 4I55A 1D7OA 4FINA 2QLJA 4D4HA 4JC0A 3ACCA 1ORIA 4G1MB 3QLEA 3Q7QA 5I48A 1U5CA 4G4IA 5JJCA 4KX5A 3LMKA 2QL5A 4C6RA 4L0CA 3QLTA 4ZQCB 4C88A 1OJLA 2XITA 1PZGA 1EFKA 3BCUA 2Q0XA 3ZWMA 4FYXA 4OHKA 2WBLC 2H1HA 4H1UA 1TKCA 5G4LA 4JCCA 3IMCA 4MJ7A 4F4JA 1C9DB 3P1JA 4TYQA 4XEUA 4QOEA 3PD7A 1W5BA 3W5AA 2VNHA 4NFLA 1P39A 1O4VA 4BLOA 4EBBA 2ZJ6A 4N3NA 1W1UA 3H2JA 3VH1A 1XRRA 3O2QB 4DARA 2VSOA 1A9PA 4OUKX 4QAJA 1L8OA 4UBOA 3IT0A 2P5TB 1QTIA 2XGJA 4UDNA 3WO0A 1ETHA 1A4RA 3AFNA 4Z4CA 3UGJA 5C8DA 1FS5A 2G40A 1GARA 4LC0A 3UTCA 3MTEA 4F9TA 2UVPA 3T7TA 4EH1A 1N7IA 1JV2B 3T0GA 5AW6A 1VG8A 2J0UA 5F4ZA 4LZWA 3CY6A 4JR2A 5H02A 4MB2A 2QTVA 3U7RA 1KK0A 2ZJBA 2UUOA 1APBA 4B4WA 4JI7B 4QXMA 1VG9B 3ZNNA 1B6TA 2DFDA 5E6SA 3H6GA 2NUAB 2GESA 3EZYA 5K8LA 5HKLA 3EW7A 4C04A 2YMMA 3GJTA 3IHTA 2HSZA 2Q5JA 4OK5A 3GVXA 4PZDA 3A4VA 2BGJA 4Z51A 1PL6A 1N8NA 1YWGO 2BFMA 1W581 3ESXA 3K1YA 3P0FA 2NSJA 3L43A 1FVOA 2FR1A 2YY6A 3V3TA 1A2OA 5B5SA 1SUIA 2G07A 1P91A 1GRCA 1Z73A 3DSRA 3EIQA 3ZKWB 1JQ5A 3CLRD 3C4JA 4YP7A 4O0MA 4OQYA 3HM9A 1B4DA 3BGWA 4I1OA 4ETMA 1DAHA 2BEVB 2PZKA 3OEHD 5IKOA 3AT1A 3H6HA 1ZOLA 2B2XA 3OX3A 4BEWA 1R10A 1G8AA 3QU9A 4LOKA 5J1TB 8ATCA 2VWQA 4XXHA 1JEJA 2JFZA 4OM7A 1NDQA 3UBTA 2VCHA 2YQ5A 5LMUB 2W6JD 4GXNA 2GN2A 1BCSA 5KYTA 3G5UA 3TQTA 4UVIA 3A37A 1JVSA 2DMRA 4PWZA 5F2OA 5BNTA 4BWGA 4RO0A 4QYTA 4AY3A 2Q1SA 1GU0A 3OQOA 5DN6A 1QQ5A 2CXOA 2RSLA 2FR0A 1J2RA 3SDSA 4C0LA 4BUZA 4CRWB 1AQNA 4F84A 4HDRA 5BPHA 4YV2A 1NM5C 3SM3A 1ZYUA 2A3NA 2ZDQA 1DTWA 1QLJA 2RGEA 2QJWA 1Q0SA 3AGQA 3M7IA 4IF6A 5JS6A 3P97A 1QH8B 2BGRA 2QD1A 3KLBA 3LHKA 4UJ3A 5ELMA 5HS4A 5HTOA 3V7WA 3OO1A 1U1FA 1ZRMA 1MOZA 1G21B 4BNZA 6REQB 3CG4A 3N2ZB 3RREA 2BKXA 2J1LA 3W78A 1A9TA 1J07A 1QG4A 4BMZA 2P3LA 1YDHA 2QLTA 3R5HA 2GAJA 5FOVA 4QL3A 3VKVA 3HRKA 4O2RA 4DJ5X 3OE1A 4FFVA 2IH2A 1ZQ1A 1U2QA 3PYLA 4FEYA 3HKCB 2YX1A 2VBIA 2FQ1A 2H29A 3W2IA 2AXPA 2FEOA 3OZRA 1XDGA 3WMXA 1XOIA 4MH0R 4EB3A 2XKJE 3CLTD 3NNSA 4QWWA 4FNOA 3RWMB 3ZW9A 1TAHA 2JKZA 4RV9A 1OC4A 2PKQP 1KP3A 1X7YB 3MJRA 1BXGB 2PIDA 4RL6A 1Q16A 3BE4A 1ZGJA 2OESA 2FW0A 3CH5A 3F6YA 4KBYA 1CD5A 1BX3A 1Z56C 3LWBA 3T5CA 1GJRA 3EAQA 5LSAA 1R5NA 3FJYA 4B8ZA 5E8RA 4IX9A 4D8WA 4G0XA 2EEZA 4OI0A 2BCEA 2C7BA 4CU2A 4FYHA 1SB8A 2QRLA 2I34A 2X3FA 3JAWA 4I99A 4JQCA 5U4XA 3LL4A 1U8UA 3DXYA 1L7PA 1N5DA 3GLHA 3R7LA 4B3DA 3M6AA 4C7OB 1TW3A 1JA0A 3GFTA 3ITKA 5IHXA 3P2YA 5JFTA 3ADBA 4FGWA 3QLJA 3PC7A 1JL3A 4HP8A 3BBLA 1NL3A 1A71A 4HEQA 2QZSA 4YCMA 2X9QA 1SG6A 1EUDA 2C3OA 5CVTA 4QQNA 4GSLA 3IPAA 2EJWA 4J0HA 5IZ4A 2QTGA 1EFPA 3HWX1 2G71A 4LJSA 7ADHA 3J80A 3OD1A 2WWXA 1MVLA 3FZQA 2BMWA 3P4UA 3PQ7A 2E5LB 1EM8A 3QPWA 3I8OA 4ZVOA 4CE6A 4D8UA 1ZAYA 1PVOA 4URVR 1ZU5A 3KVRA 1PL0A 1A3CA 5JVDF 4KFRA 2D0PB 3ZQUA 3DDHA 3HQ4O 1IEXA 4R2JA 2B0JA 2CWWA 3L5KA 2MMGA 1IIBA 3WK7A 2COUA 1Q7CA 4LF6B 4YQEA 1KETA 4F2PA 2ZUWA 1WDLA 4AL4A 5CB4A 1JVBA 2ZS7A 3FPEA 1KAHA 1GGKA 3RS5A 3SJ7A 4XI9A 1NI3A 3SQMA 4F5ZA 4WJLA 4F9FA 3RIGA 1G1AA 2YYAA 4YUAA 3UK0A 3T5MA 4QSMA 3BXXA 3PIIA 5TY0A 5JJLA 4JNCA 3EQZA 1VBNA 3WGYA 1A98A 4I55F 4KPUA 4QBKA 4QNRA 3RGGA 5KJFA 3MRTA 4DN6A 1G2OA 1D2CA 3F7TA 4OMDA 1J20A 1KVUA 3H18A 3IP8A 4NMXB 4DV7B 3STTA 1P4GA 3T7CA 3DV9A 4LXXA 1NN0A 3NVMB 4RFSA 4DYVA 4Z4QA 4QEDA 1Y6FA 3DAPA 5DBHX 1M2FA 1BGWA 3I45A 1DQSA 2ARKA 3GI1A 2IYRA 3KXLA 4HDMA 4CKZA 4DM4A 3DKKA 3WYNA 3ZPXA 5EPOA 4H6PA 4XVUA 1Y8RA 4IOMA 2GN1A 3ZK7A 5KNDH 3U7HB 2ZBRA 3B1FA 3PDCA 4KLRA 3ID6C 3NC1C 5AJHA 4ENSA 4IWYA 1OC2A 2WIKA 4IVNA 4Q1DA 2O54A 3HJBA 3G5AA 3WGQA 1T2FA 4R01A 4DEYA 1A8PA 4Q4AB 2J41A 3BZUA 4XVCA 1QE0A 1ISHA 1QPBA 4MP8A 2X7JA 2BEUB 3A2MA 3ICVA 3F98A 4HXEB 4OVKA 3MINB 4CM4B 4EG1A 4R1MA 3I28A 2Y99A 4LJKA 1KRHA 3LVBA 4KXQA 4XM0A 1CEYA 2VFAA 2DR2A 1ENPA 3FPGA 2YWCA 5BR4A 4TTVA 5K01A 5FADA 1Y6GA 1UKZA 3U4QB 1IVNA 2VA9A 3BF7A 3GLRA 4CIWA 3HFSA 3ZUGA 3B51X 2X23A 2YS7A 1B0ZA 4ZAVA 4D42A 4OB7A 2K7ZA 1M33A 2YICA 3DB1A 1R7RA 3R3JA 4Y18A 1Z5UA 1VJRA 3CIFA 1NW8A 3NDJA 4L8GA 3AF1A 1P33A 4MW1A 1NJ8A 1ZHFA 2QL9A 2DBYA 2C2YA 2QYTA 1EP3B 3O3MB 3WE7A 2UZIR 4G97A 4J0KA 4GX5A 2K87A 1UPUA 1E2FA 1ODIA 3BFJA 5C5EA 1IWBB 4OYHA 1DEAA 1QAMA 3FN4A 3KYCA 4C2TA 3DDOA 3Q10A 3WJ7A 3H16A 2WYHA 1HTBA 2F3PA 4JLVA 3MPOA 4XSHA 2ECPA 1VIYA 1YQWA 4URFA 4BAZA 4H7EA 1HYEA 1AB6A 2F1JA 2XCIA 3O7MA 3GF4A 4FCVA 4PW0A 3C8DA 3K1TA 2GS9A 4QEZA 5BN4B 4D9KA 1OH8A 1K7YA 3V55A 2ZBDA 4C06A 4RDXA 1F9EA 1A5BB 1VYHA 4WOKA 2WE8A 4ZHSA 1EZ4A 5BW8A 1NYTA 3L8CA 4AZTA 5BUCA 3B3AA 4NCJA 1JA9A 5IK2D 3AQ4A 4JLWA 2VUSA 1S1MA 3GLFB 2JHCA 2Z6QA 5EWMA 4C21A 2LKDA 2A9OA 3I6IA 1YONA 3QJYA 3X1ZA 4H35A 4UZFA 3HHPA 3RNLA 1RLIA 2EKPA 2BEVA 4UVHA 4IAOA 2XMDA 1V48A 2HWWA 3SD7A 3UAVA 5KQSA 3THXB 4AYWA 2YC2C 2WSYB 4R6XA 3KTOA 5EXEA 3BTSA 4B85A 5ALMA 1MXFA 2YJ4A 5LJLA 1H6AA 1P73A 3OCYA 4X64B 3WGKA 5AK0A 3ZI4A 3OP1A 3R9XB 3C15C 4KLZA 1YC5A 3RRFA 2J3MA 4NKRA 2V3CC 4C4PA 3HWRA 3U0VA 4C4SA 4Q7MB 5CUQA 3H9CA 5E2BA 3I1IA 2ZYVX 5FV4A 1ZOIA 2IOHA 4UMVA 3B38A 3Q1KA 3JR3A 1X9IA 3KKQA 4OQZA 2C4UA 2BKVA 4BN0A 2XE7A 3NUGA 3ETHA 1YRWA 3K5WA 5LLTA 1QH8A 5BV7A 1NXPA 3W3AA 1IZZA 1MG5A 3D3EA 1TL7C 2GM3A 1U3CA 1U1DA 2IYTA 3E7WA 4IRUB 3EWSA 2XVZA 3O93A 1ZCFA 3OQPA 4HAVA 4TTJA 2XCQA 4E21A 4MVJP 3CXUA 3DMTC 4AICA 1GSAA 3HNOA 4EPRA 3SS7X 1NQWA 1P60A 2I4RA 1P0QA 2PY6A 2ZJOA 4LYGA 3ZD6A 2HK9A 1XLUA 3ABIA 1PJQA 3M2TA 4ARBA 1FQOA 1F8XA 2A1IA 5AIAA 1JKXA 4V0SA 1SIBE 5B30A 3DZBA 4RK1A 4C3ZA 2E4XA 2YL2A 3AHJA 1QBKC 1DRUA 4DMRA 2VT7A 5ICCA 3HKCA 2X2OA 3A6ZA 3ETGA 2QDXA 3K5PA 2PLWA 1EK6A 3BMCA 4NICA 2G67A 5JYEA 3QPCA 3THOA 5IXYA 2N9UA 3TD2A 2CZQA 3SX2A 1X7YA 3A05A 2I5PO 1BXGA 2X8BA 3EXG2 3PE4A 4M0EA 4QXQA 4YGYA 3Q1LA 4EJ0A 1TECE 3F46A 1BFKA 5CT9A 3W6UA 4DMMA 4LQCA 2G82A 1QHFA 5KTRA 3HDGA 4FE3A 4PLTA 4K40A 1HZZC 4IL5A 3MSCA 4CN8A 4DPLA 4JMLA 2BEWB 2QGNA 3OEED 4I4CA 3ZGZA 1MRSA 5LOVF 2NT4A 3MWKA 4ZMSA 1KH1A 4Q7QA 1DBIA 5AKHA 1EXDA 3JQCA 1IU9A 1UBUS 2O1WA 2QY6A 1KAQA 4QAQA 3AJDA 3NKFA 2Q6OA 3H05A 2ZTVA 1MB3A 1ZIXA 1YJ5A 4PHFA 1VKRA 1G3QA 2BRUC 5EEHA 1WDKA 3STXA 3OQMA 3B89A 4P54A 3ESCA 2PMFA 2V97A 2D2EA 4DMCA 5GTDA 2AKYA 4NR0A 1PVVA 4P22A 4YQZA 3OU6A 5E4YA 5GVRA 2PO5A 3O38A 5KJ6A 1JLSA 4WN9B 1KA9H 2HF8A 2EKQA 2XY4A 4KQ2A 4LXQA 3ED5A 5FBZA 3SHTA 2VVTA 1FFBA 2CBXA 3GCDA 3V42A 4BQSA 3QH4A 3ORQA 5C31A 1LD3A 1G0NA 5HK8A 2CK3A 4BE9A 1RC0A 5BV2P 2I2WA 2RGNA 2Q2QA 4FFBB 4IIEA 5JE8A 3UXYA 5J40A 4RESA 2AKAB 1E89A 3DP7A 4UARA 2ISSD 4FOPA 3QYAA 5CCDA 3NIFB 3EBOA 4F4IA 4EJ2A 3WB0A 3VISA 3BEDA 4A6DA 1Q44A 2INGX 2FSVA 3P0JA 5IJ9B 3LUFA 3I5XA 5EJIA 1JXAA 3HLYA 1V8DA 4PYRA 4GOND 5IAGA 4DWWA 4ISBA 1A96A 2GGSA 2V7TA 2OWEA 1C4KA 3IJEB 3KOZA 5DSZA 2VYNA 3IOYA 5DGXA 1Z35A 1EP1B 3HR7A 2PO7A 4K8OA 3RVKA 3T41A 1C1DB 2LRHA 1ZL2A 2QP9X 1EVEA 2X8WA 4KGDA 1YVUA 3LNTA 1EVYA 5K3AA 2R6DA 1MRZA 2B2NA 5FTMA 2O0MA 2ZT7A 1WDTA 2RCYA 4RLQA 4GFDA 3UN1A 4EARA 3KLPX 3IXMA 3QFTA 2WSLA 4G0QA 4WKNA 2BI8A 2C95A 3CR8A 2C8KA 1GTZA 4G1BA 1UP4A 4NYIR 4UE6A 4CIAA 1A8HA 3TTVA 2H85A 3TECE 3EOBI 3U9SA 3K9NA 4BNHA 4R1TA 1TYDE 4YRKA 3R5TA 3WB2A 4Q4AA 3TN7A 4PNZA 1IUOA 3SN6A 4CM4A 2BEUA 3GMDA 4GQAA 4NZOA 4LE1A 3MINA 4JXZA 3C7DB 1TX4B 4MP3A 4HOYA 4D8TA 1K7SN 3LUBA 4YJFB 3HBJA 1VJDA 2A5JA 3O8BA 5LKRA 1GFWA 3TW8B 2EKZA 4W9NC 2BONA 2NZUG 4KI7A 3Q9UA 4L0DA 4YGXB 5ECWA 3WL4A 1ZGBA 3HY6A 4IF4A 5UKDA 4NL4H 1UKCA 4EPXA 1NULA 3FUXA 4DCGA 5IF9A 4OEHA 4LNUB 1GKIA 1DBVO 5EE3A 1BXKA 1I6LA 3QXSA 3HL0A 4QJIA 1XJWA 1U8EA 1EE1A 1MNAA 1XJCA 4UXJA 4EUNA 5EVCA 3V1KA 5KTSA 1FMCA 4FLFA 4LIPD 1G5RA 2O2IA 4TKZA 4W1RA 5DHFA 2FDCA 1X1QA 3C16C 5EJ9A 4EBFA 3QBJA 4H7KA 2IEYA 3KXKA 4XUEA 5BN4A 2HO4A 1Q1GA 1DWQA 2Q6VA 3WLPA 5BXYA 5JSFA 2GYYA 3A26A 4W6QA 2IX9A 5KYNA 5EMLA 2HWUA 1FSSA 1ZIYA 5JSZA 3I83A 2YIVX 3VAZA 5EIXA 4HRVA 4QD3A 4A2PA 4GX0A 1FBTA 1CCWA 5BSFA 3LK6A 4YRTA 3L1KA 4LQ4A 2I2FA 1I2BA 1XKTA 2Q4DA 3GP8A 2YZKA 2AH5A 2QM7A 2SKEA 3AP3A 3G85A 1Z2PX 1QG2A 3N07A 2WJGA 2A57A 5CVCA 3HJUA 3OZVA 5BYAA 1QO0A 3O4VA 1P1BA 2D4HA 1E1NA 2NP6A 2BM8A 1UMDB 4LJLA 3WRXC 3THXA 4R3UC 3VKHA 1GUBA 5C1PA 1T3GA 3RBXA 1MA3A 1U2ZA 1BROA 3RVPA 4MRSA 2WU0A 3WYCA 1IAQA 4BNKA 3I32A 4AB1A 4IIUA 1DBPA 3I4LA 2QVBA 4BMCA 1XPOA 1CUDA 4URWR 1HE8B 2PJRA 1FXSA 1XELA 5GAJA 3JS5A 4TYPA 1FXWA 1X7DA 3G1WA 4HLNA 3RKSA 1EGAA 1O7JA 2ZJ5A 1EQUA 3EARA 1XXHE 3Q15C 3ZWDA 4B31A 1F0NA 3IIMA 5AOVA 1AMNA 1XXHB 4CF5A 2WUEA 2JCSA 4DG5A 1LC3A 1Z6ZA 2GZSA 1CHNA 1WUTA 2CKMA 1ZGZA 1Y3BE 5HVNA 3DO8A 1NF2A 2GTPA 4QC2A 3NWEA 1Q91A 4IIBA 4R40A 3FNFA 3B1VA 4E03A 1COWD 4YXFA 3CHYA 1NC3A 1Q7GA 3GJ3A 4HFMA 4UEQA 3N3AC 4WBNA 1CJKC 3IMGA 3PD1A 3I9FA 1G63A 5E6RB 4PRKA 3KAPA 4XCQA 3QPAA 4OOEA 1YO6A 4KMOA 2IGTA 3DWGA 1V7PC 1JG2A 3FXAA 4LOJA 1MDBA 1NONA 2R65A 3PUVA 4EP1A 5DNCA 2DKOA 5GOZA 1L7RA 1KGDA 3HPRA 4X6UA 4UDYX 1J9ZA 1XKQA 1ZNZA 4BZQA 1LV8A 2BN4A 1HGXA 1HUQA 3CNHA 4UOQA 1E7SA 4D45A 4OH1A 1JI0A 2ATCA 4TWIA 4I6EA 4HQ6A 1OTHA 3SK0A 2GYUA 3ISTA 1ORRA 3K0BA 5JCOA 3KUKA 1LLCA 4RHCA 1P8AA 3JQAD 4CQJA 4ZYXA 3PFNA 5TQ2B 2ONJA 3KEGA 3T9EA 2B4KA 2BMVA 2M2IA 3N70A 1P2DA 4XH9B 1UAGA 4N12A 1ZBDA 4TTPA 1E1MA 1CZHA 4I1VA 4UBNA 4BX3A 2BEWA 4I1RA 5FORA 1L1RA 2DLNA 1B0PA 2QIPA 3H5LA 4PS1A 4XOIA 4W8HA 5DW3A 5AWFC 1O77A 5DBEX 2WW8A 1UXOA 3O4IA 5CFZA 3CV3A 1J56A 4TXJA 4UXHA 5KQGA 2HA3A 5F1YA 3ZVRA 5ADHA 1OU0A 5FNVF 3PC8A 1FDWA 1KY2A 1E3TA 2YIDA 5LP6B 3PDWA 5KQRA 5CX4A 1TA4A 5GOTA 3KQLA 2WT4A 2ZKLA 3L5OA 3KE8A 4I4TB 3TH5A 1G4HA 4Z54A 4A8JB 3K6SB 5C4MA 4QU5A 2VQ3A 1GPLA 1PWEA 5JAIA 4REOA 3VPAA 1ES9A 2W6CX 4ENRA 1CLEA 1KOJA 1I5RA 1VRWA 3E0QA 3O8LA 4C7KA 4ESEA 3OX1A 3UKDA 2OHGA 1AXEA 1B42A 4G86A 4ISCA 4LN1A 1TQHA 4II3A 4CHTA 1YUBA 4TMWA 3T7RA 4D6XA 4D98A 2MTBA 1JZSA 3N8KA 1Y4AE 4NARA 4RQTA 3LUKA 3ZX5A 4DC1A 1WMDA 4ENQA 1OFUX 1U2PA 2O8NA 2AI2A 2GNPA 2NQ8A 4EJSC 5J43A 3GJRA 2YV5A 4R2XA 4WXHA 4U7PB 2AJLI 1SKYE 3VO2A 5ELXA 1SKYB 2IP2A 5FUXA 1T8RA 1UFQA 2JDID 1UC4B 2HJHA 2ZSUA 1CKEA 4D0GA 4D5EA 3ECCA 3IAS1 3QVOA 3AZQA 1T9KA 4MR7B 3X1JA 1K8XB 1QK3A 3GFGA 2IV3A 2W8BB 5BWCA 4EUHA 2B30A 1RHMA 3FOAA 4EK9A 3B6EA 1NVVR 2WV9A 2FR8A 4LFCB 4TL8A 3PYMA 2HA4A 3KR0A 4X1IB 3D1JA 3E35A 1ORHA 1YBAA 1YS9A 4DSOA 3ADPA 3MK31 3O91A 4M98A 1OIWA 2PXCA 2OMKA 2ZDHA 4NC9A 2OVBA 4HGYA 1RYEA 4YHBA 1IHUA 2FN4A 3TLEA 3PIDA 5LZ7A 3SQXA 1S8NA 2HIHA 3DZCA 5I9NA 1MC1A 1I7NA 3DHWC 5J5AA 3O0DA 1LCIA 3HJCA 1TQ6A 2BH2A 4MPDA 2PS1A 3F3KA 3OUZA 2FCAA 4YECA 5LCXA 3WZMA 3QLUC 1OBCA 2B35A 4TMXA 1OH7A 2MJLA 3GQVA 4BLQA 4QLAA 1UIMA 2MYTA 4BY9E 3HGMA 1PT6A 3GLSA 2E48A 3KCQA 4LISA 3ZDYB 1NQOA 3ORFA 5KVCA 1Z82A 3OIFA 5LWQA 4P6VF 4G5SA 2EQAA 4Y2RA 4AJEA 5IX8A 5JSYA 5JC8A 1EX6A 3AYZB 1Q12A 3DWFA 1G7SA 4N7RA 4YJFA 5H7XA 3RTDA 3RVNA 2HF7A 1HLPA 3N6VA 3TW8A 4JVMA 4OB6A 1YR3A 2YCBA 4RXMA 4YROA 1Y3AA 1KQPA 2ZTUA 4ZOBA 4YONB 1CY6A 4WKBA 3QNMA 2ODWA 3E61A 5E1DA 4OGGA 4KDFA 3VDXA 4K3VA 4EMSA 4HWKA 4LNUA 1QIFA 2IHNA 1PG0A 3OAAA 3DTTA 1QF9A 3N7UA 2ISQA 4HGZA 5K8IA 5F9HA 2G4CA 5AHRA 5EE0A 4GL2A 1HDOA 4M49A 2P4SA 2QI9F 2FFJA 1XKXA 5F52A 1YDGA 3RIXA 3LT2A 5EVJA 3VDNB 1KTIA 2WHPB 3C4QA 3IV9A 4FILA 2IZ7A 1PGQA 5KSZA 2ZAMA 2ZUVA 1W0CA 1SC3A 2DUNA 4XWGA 5JMWA 3V1MA 1U5AA 2G1PA 3IR7A 3BVPA 2QPOA 2GZHA 3ZHSA 4E30A 3VNSA 1N32B 1HDCA 1XVIA 4IO1A 5TC4A 1WM1A 1IQUA 1ECFA 1D03A 2FFQA 3N2GB 5K3FA 4CDRA 4EW2A 1NZFA 3DB2A 2QY9A 1RKQA 4MHOA 1EVKA 4UM5A 1P0CA 2Q5EA 5J1SB 5AVQA 2X14A 4TS4A 3OUTA 3QELB 4KXFB 5AVKA 1XQYA 3RRJA 1FXWF 2WUWE 1N2CB 1TEHA 2H06A 4RK4A 3ROQA 2UYHA 3ORRA 5GZ3A 1HNNA 2RARA 3MT0A 3MS4A 3BXGA 2FX5A 1KZ1A 3DV0B 5AQEA 1O03A 3R0VA 2X6TA 2DBQA 2VH1A 2SBTA 1PUJA 2N47A 3VBCA 4XWTA 1UMDA 5FWAA 3LNCA 4JUFA 2NUBA 4M87A 4JLOA 4JMPA 4ZOLB 1DRKA 3ASUA 4G07A 3ZS9A 4K9SA 4MLCA 3RE1A 3BDAA 5JJ5A 2E55A 1Q2XA 5HW0A 3EXFA 3UPUA 1KPHA 2R1VB 3W5HA 1BKYA 5COBA 4WOCA 2QTHA 3WGUA 3AUSA 1QLHA 3DL4A 3GGSA 5M5BA 1BQ3A 1P2UA 2PS9A 3OQHA 3P19A 2IHTA 3KT8A 1XXHA 3RD5A 3RHZA 1B76A 1QB8A 4S2UA 4CYMA 2XGGA 3IDOA 4RE5A 4X62B 2ZXFA 4DCSA 4WHMA 4MRPA 2X9LA 3DEJA 4X8OA 3RM3A 4EMTA 5JECA 3MHTA 4Q01A 2PFKA 4ZN6A 2XWQA 2JG3A 3KBBA 1HOTA 2VHQA 1B93A 1P1HA 1WXXA 3G0BA 4PHCA 1MJ5A 2F7SA 4UFNA 4ZO6A 3SZ3A 1KIMA 1GOTA 1HDRA 3K6KA 3N7AA 4YR7A 3NM5A 4YYZA 5G1PA 1NWCA 5DCLA 5JS8A 3Q7IA 5E6RA 2DY1A 7MDHA 5KNCH 1WUJS 5LFAA 3NPMA 4CGZA 1MPXA 4RSGA 3W6ZA 1E61A 2PWAA 3VR3D 5FFNA 2VPZA 2PKCA 3OEWA 1VZ3A 4HLCA 4EHDA 4UXIA 4AKIA 4RTOA 2YJ6A 3IXQA 4YRAA 5TIIA 4S0XA 1YTUA 4HPWA 1PRYA 2PFSA 3GRCA 1F3OA 3PSAA 5MN5A 4RTQA 4BFZA 1ISJA 1XCJA 4TSFD 4ZCMA 2HDHA 4Q4CA 1XWIA 2JH3A 4GYYA 3FHCB 2QTLA 4RVCA 3H5RA 1RZVA 5EG5A 1YS2X 2GDJA 1FNCA 3HYSA 3P4YA 5TQ2A 1JQAA 3VNAA 4B3TB 1LI5A 1TMGE 3IE2A 1PHRA 3AHIA 1MKYA 4IJQA 3QE3A 1WKCA 1RAAA 4YUWA 3V7FA 2PSFA 2WP0A 3NP7A 2P2GA 3NAGA 1K8QA 1RC1A 1GKUB 3KVNA 1QMGA 5LUBA 3WHPA 1LBQA 2J9XB 3WA6A 3VBEA 3WAGA 5HOEA 3KQUA 3H1TA 3KKOA 3ZHZA 4BB6A 3SSOA 4X3PA 3KYJB 4Z3DA 2ODBA 3WLNA 1WD5A 2F3QA 4X54A 3K6SA 4I4TA 2Q1XA 2I3AA 2BCJQ 3GA5A 4A8JA 4MUJA 1FYWA 2F3RA 2A9QA 4B6QA 1ENOA 5CYPA 1T9DA 2VDWB 5AHXA 4AUMA 2AD1A 3V8EA 3INYA 4CLDA 1LPSA 2FMXA 1XGKA 6ADHA 4K0RA 5M3BA 4G5XA 1DFGA 1PP4A 4OSOA 1O9HA 3KO8A 3SEAA 1BX0A 2FHPA 3FNQA 4P3OA 3NTOA 1JKMA 3EG5A 5DISB 2QQEA 2QYOA 3D4BA 1SZCA 4DXDA 4EFDA 2FPWA 4ESOA 5C8XA 2CFCA 4RJLA 1ZY2A 3U6BA 1L5HB 721PA 2YKGA 4QTXA 1KOGA 2FPIB 5IJ0B 2KSQA 4OFWA 2C1EA 3H4VA 2GQ0A 1EVZA 4QDJA 2PZEA 3O9MA 3SX0A 3BXOA 1ITZA 5M29A 1KAOA 3LQ1A 1YTLA 3CPHA 2D5AA 2J6HA 3WIUA 1NMXA 1K98A 3FMIA 5KDOA 1QCCA 2ZYHA 4P86A 4Y7DA 5BSVA 3TMKA 4LZZA 3NT2A 4TQGA 4MR7A 4PZUA 4FGUA 1MQ9A 1XV5A 4GBGA 3L84A 4YEDA 2ATXA 1FRZA 1T5OA 3MT9A 5DN9A 3FMGA 1NJFA 3HV0A 4OXXA 5AFSA 1CDOA 4RSRA 4JJFA 1OFUA 3ABOB 4FIDA 4GPEA 4JGGA 4PPGA 2UU9B 1QE3A 4JUDX 4MGEA 1J49A 3DD5A 5AK6A 1JJBA 1ZZGA 3DDNA 4GMGA 1KRXA 2JGMA 2P8JA 4IGKA 3LUHA 2FPRA 1USUA 2MSDB 2R1ZA 2CUTA 3G0GA 1GG2A 2CV0A 3OJFA 5ITVA 1KK2A 4CIBA 3VX3A 1G5PA 4NF2A 4RNCA 1G60A 4MRMB 2YJZA 2RAVA 1A5TA 1QE5A 2V3VA 4KACA 3SMQA 1R37A 1ZNXA 2RK3A 3MELA 4OHUA 2Q9BA 2Y1WA 3ZCXA 5C5CA 5K4HA 5LD2C 3OTWA 3IEVA 1SUWA 2Y1KA 4GR4A 4YAOA 1V96A 1PGJA 2J3LA 1JEQB 1TCBA 3AERB 4NU8X 4F6CA 3VH2A 1W49A 4YQYA 1KDRA 3ZNPA 1ZDMA 3HWSA 1UKEA 3E8MA 3IMKA 3THSA 1Z0JA 3OLQA 1Z5WA 2AC4A 2G1AA 5AVSA 2DHEA 4E33A 2HADA 2WHRA 1X80B 4G0PA 5F7OA 4NMMA 2XNCA 1J0AA 3D7SA 4COKA 4HX2A 5L4NA 3FVQA 4V0LA 3LWZA 4N5NA 1QO7A 3DYIA 4WNCA 3Q8KA 1M5RA 4BQNA 4FB5A 1EUQA 3F71A 1FC0A 1OJ7A 2FQXA 4ESHA 4EO9A 3KHKA 3ZDEA 3ONEA 4F9EA 4EUSA 2WHPA 5MGNA 1Z25A 3K0FB 3TXXA 1G3IA 1ULSA 5A3VA 3RU2A 2JFHA 3L4JA 1E0JA 1N77A 3PJRA 2X13A 4KDRA 5A7FA 1DJQA 1S8AA 4I9GA 4WZZA 5E9JA 2ZRBA 1NE2A 4MQMA 1TU0A 2R79A 3LCRA 3P9RA 2ONCA 3Q6NA 5AI6A 4CW7A 3N2GA 4ZYYA 4AKEA 3G0HA 2ZYRA 4G25A 4XQCA 3DE7X 2IYYA 3ZYZA 1E2LA 1WXIA 2JJQA 2NV0A 2RK4A 1SBTA 4HN9A 4LHEA 5K1ZA 1XAIA 4OLJA 1Z39A 1ZVVA 2F67A 3IP6A 5AM4A 3QQ5A 2AE1A 3IOEA 4IKOA 1JSRA 3E2MA 1MOQA 3VZDA 3GFSA 2C0PA 2CUNA 3G7SA 1XPJA 3EPLA 1GNSA 3LHSA 4LYHA 2G63A 3DV0A 3RYHB 1PK9A 5K6AA 3M6FA 3N74A 2BMDA 3KNZA 4JIMA 2LWIA 5HJ2A 1W4RA 5ALOA 2H17A 1QK5A 3KZXA 3DHNA 5CM2Z 4YDSA 3V5NA 1PQYA 1OBHA 2WKRA 2VP9A 1SC1A 2MINB 1EVIA 4KIUA 3EIOA 5T4EA 5BUQA 3E81A 5JCJD 1DWPA 2CLOB 3A06A 5T5QA 3AF2A 3OKPA 3OMLA 4DR5B 4ZOLA 1RAGA 2GAAA 1G0OA 1NU6A 3CNLA 4K6FA 1JJAA 3MJHA 1WIWA 1UM9B 2A2ZA 2AS0A 4W5OA 2G6BA 4H4DA 4R0VA 3CINA 2R1VA 3D2AA 4FR2A 4C4OA 1K7CA 1W1WA 4DTCA 3GJ8A 1ONSA 4IZIA 1VRCA 4RHTA 1Z4MA 4JI6B 3B9RA 2ZCUA 4G36A 2XYRA 1Z22A 3IAS6 5AVZA 3SM9A 3VC2A 2IH5A 2BE7A 2JFGA 2DULA 4NZZA 1GSIA 1PFYA 1XZLA 3EY4A 2R7NA 3DDCA 3CCCA 1Z4QA 4B82A 4QPDA 2XYHA 5ED4A 1ZCZA 1VKHA 1I51A 1W52X 1CUJA 2PUHA 1I4OA 2OGUA 2PGJA 3FCAA 3HYNA 1XHLA 4I6GA 2AT1A 1FLNA 4FSXA 4BATA 2VBFA 5BNIA 1JIVA 1NVMB 3KEQA 1WMSA 2E1RA 3KPYA 2QRKA 1P2BA 1WZIA 4FN4A 4TLEA 4A27A 3D3QA 5IT5A 1VHWA 2C0QA 1I3LA 2BFCB 1V6CA 3OCCA 3UQZA 1KFBB 4WXYB 2UUBB 4PAQA 1AIPA 3VJKA 2O3UA 4JY7A 1YIDA 2GLUA 1NVUQ 2WC1A 4Z7NB 1SUCA 1L3IA 2C82A 3MFYA 2BKUA 2YTZA 4H08A 4IILA 2G76A 4PTZA 4N82A 3EUAA 1H8EA 3ZOKA 4O2LA 1Z13A 4EX7A 4AF6A 3V8RA 1Z28A 3ZEAA 3R9KA 4GZLA 1RWNA 3G1UA 2PG3A 4YRCA 1HKHA 2Q6LA 2OV1A 3LHIA 4BUJA 5JC1A 4I4TF 3HPQA 4PFJA 4Q24A 3ESZA 2YN4A 4UFOA 3IEUA 3K35A 4B0PA 4WLUA 1XJQA 3OQBA 1SA0A 2CXSA 4E5PA 3IIKA 4EF6A 2W6OA 3DWIA 3OZSA 1PLJA 2LKCA 2PGLA 2P2DA 3KB2A 4YMHA 4HYTA 5IANA 4K6CA 4TS1A 4ZYLA 1JWAB 5HBRA 1LJUA 1BU8A 2AFHE 3R7WB 4WV3A 2QZ9A 4HF7A 2JJ1A 2J7KA 1YJCA 2XZTA 3QKTA 2H1CA 2I62A 1HDEA 4OP3A 5E3IA 4CGYA 3KWMA 2QMOA 5DK4A 2YWEA 1A7JA 3L6BA 1M0TA 3V1NA 1SR8A 3K09C 3PGJA 4QBFA 4HY3A 3IEKA 1BG6A 3IJ5A 1T8WA 1YE5A 4QRIA 3ZGYA 2ONKA 4E2ZA 3BK2A 1FW6A 3HK2A 2VDWA 3GIWA 3OO0A 1JKFA 2GSWA 1QHSA 3IUJA 2BKAA 5U1PA 3S7TA 1RRMA 1U3FA 1MJNA 2A5DA 2JC3A 2ZUCA 4NBNA 4PZPA 3WKDA 4DA9A 3DYBA 3FFTA 4X9XA 5J4VA 3F9IA 1N25A 1QV6A 3OPVA 3W2HA 4HAWA 1L4EA 3FDIA 3KTDA 1NI4B 2W4IA 3HJGA 2O3RA 4HC4A 1ZN8A 5A5DA 4AYXA 3NC4A 4MINA 1PR0A 2RCNA 4NPHA 2LDBA 2C61A 4Z1MD 4PTYA 3EF3A 2PH7A 1L5HA 3NDBB 4B3JA 1OZFA 3VRHA 2FPIA 1T8YA 2XTAA 5IJ0A 3MWLA 5ICEA 4N1AA 2X1HA 1NZJA 3G23A 2Z4RA 3PUIA 4E5SA 5IDWA 4RIFA 4X92A 4MLZA 5TR9A 2H1VA 4R54A 4ZDIA 3GXBA 4R69A 5LMZA 2XKBA 5D84A 1JH9A 3PL5A 2GZ1A 2D5IA 3RI3A 1VLLA 5JHHB 2C57A 3UW1A 1YDMA 4JDPA 3HRHA 3B1YA 2YVUA 3TRDA 2J7PD 5BNWA 2B98A 1KQ3A 4FC7A 5ADWA 4OHCA 4TZ6A 4E5DA 4F2HA 1RZUA 4B09A 5IKEA 2VRBA 1DMSA 1HSOA 3NIGB 1GLGA 3PNSA 5CH3A 2ZRAA 3KL4A 3ET5A 2ATEA 4JA0A 4D0NA 1T5SA 4ZQEA 3SKXA 2CF6A 5CEFA 5KMGB 2IPMA 3N0XA 4J1TC 4LRUA 1AB5A 4WCDA 5F3DA 3RC1A 3HVUA 4B6SA 3L6DA 4DV3B 3AY0A 1KI1A 1AGYA 3KBOA 4P5PA 4WPGA 4B6FA 3OU7A 1M3SA 2FPMA 2O0KA 4MRMA 1KARA 3O8OB 5FQOA 4B3HA 2JI8A 1PZEA 4EYOA 4MXDA 1E2IA 5FAXA 3PFCA 2IPXA 1XTPA 3U1TA 4E7OA 3IKTA 3GWGA 2WKSA 1YA8A 2PT9A 1LLFA 2HQOA 2YCLA 4FWIB 5EJ8A 1HX7A 1GVHA 1JEQA 2EYQA 3AERA 3L0PA 4MCHA 3W8EA 3ZZ1A 4UEWA 5DM60 1AY0A 4D9JA 3VU1A 1EWKA 1US8B 3U7FB 4CMEA 5C46F 3QWAA 5DNVA 3T38A 2WWVD 1Y63A 3ZHQA 3DE1X 4F11A 1QONA 3T94A 1MC5A 1X80A 1U9IC 5FBLB 3HXMA 1A5AB 3PI7A 3URMA 1T4GA 2E3JA 4KQ9A 5IKMA 5CFQA 4EKDA 1F2TB 1S2IA 1AKEA 1SD1A 3AGPA 3MA0A 4DJDC 2ZK7A 1BMFD 3DF7A 3AVVA 1IULA 4P7KA 4XDHA 4YJHB 1SQFA 2KPOA 2FOLA 1U6IA 5EXPA 4ZI7B 4XFDA 3AFHA 3MT7A 1CEQA 1OIXA 2XRZA 1LKZA 2IC5A 2CY0A 4EATA 5JMOA 3FDJA 3L4SO 4MGIR 5CW2A 4NNPA 1TFRA 4JN6B 4WLNA 4RXTA 4QUHA 1ZWKA 3SJBA 3DXXA 2XYPA 4P34A 2Q2OA 5FD8A 4WN3A 4CM9A 3FB4A 1I1NA 1KNXA 5BMOA 2QV0A 4WDQA 4EDHA 5HUQA 5A5EA 2I8CA 5TPZA 4A82A 3H1AA 3QHQA 2D1QA 3OQ6A 1HXHA 1JWBB 3FA2A 3IEIA 5LQMA 2H7XA 4UTPA 2W6MA 3E82A 1WQ3A 1SZPA 4OQLA 3OOYA 1VHLA 4KXMA 4OJNA 3HSYA 2HBYA 1LGYA 4DB2A 3HBLA 1HT3A 2VRWA 3QFRA 4R68A 5H3HA 2FFBA 3RYHA 4EA8A 1WQ4A 1Q84A 1GADO 1F12A 1IG3A 2JIBA 3CZ5A 3WIVA 4LWZA 4K7JA 3V8MA 1I2AA 2OAP1 1YZYA 3WWZA 5CLGA 4BMVA 2C96A 2MINA 4E4RA 3GLIB 5KO2A 3CN7A 2QRNA 3WGHA 1GZUA 1TLLA 4EF5A 4IJVA 1QSGA 2A67A 1N2GA 4W8GA 2LPMA 2O8CB 4UZEA 2GJ4A 4C0WA 1OV6A 1UM9A 3EDRA 4XCXA 4NFHA 4DLYA 2O0HA 1NMEA 4X65B 1QH9A 4X8HA 5FX2A 1KJQA 5MDHA 1JIJA 4OU5A 5DYNA 3OT4A 5IDQA 4YDRA 2IXEA 4XEHA 1AX9A 1QJCA 3WGZA 4BKOA 3MGGA 1P0IA 2O48X 3H1PA 3PL1A 5JXIA 2WDPA 1SGWA 3V3KA 3PA6A 3R0QA 4PBRA 4WY8A 2FE4A 4JASB 4C4RA 3OZGA 4AS1A 5K0NA 1NXOA 5FLKA 1E9DA 5AM5A 1BMDA 1TPYA 5GADl 1PR4A 1P9RA 3WMGA 1DXOA 5BWNA 3OM1A 3QVVA 3PC2A 1JRLA 1MJGA 1W88A 2ZS8A 3NWJA 4BNLA 4I5FA 3RBZA 3ZXUB 1D5CA 2R8OA 1CF9A 5F35A 3C24A 3JV7A 5GMOA 3OE5A 2FNAA 4JROA 3QVWA 1JTFA 2CFIA 1VPVA 3DNMA 2Y93A 4B8WA 1EIWA 3O26A 1GGHA 2BFCA 2QLLA 4BNNA 3DZJA 4JVLA 1OXKB 4UNIA 2FN9A 2WWFA 1VLJA 4R9VA 1ABEA 1ACJA 3H11B 1C0IA 1XRLA 2CHGA 4G67A 4G84A 4PGFA 4EHNA 1MHPA 1BO6A 1W29A 3IAXA 3JARA 3ZLTA 3O2SB 2ZWPA 1SVWA 5CEEA 4XM1A 3ENQA 4DM7A 4AP9A 2L82A 1IY0A 4BXOB 4H2DA 1OWOA 1ISFA 2FUCA 4QOFA 3F3YA 3DEKA 3J81k 1IZ9A 4PZLA 3W9UA 1XYGA 1JHYA 3RARA 2W6ZA 4LVOA 1XB2A 5ALHA 5LA6B 1B7GO 1YVPA 5B7QA 5L7YA 3PWZA 2ZIWB 2QSZA 5A3SA 2IZ0A 1KE2A 2VF8A 2JGRA 5AJTA 3CVYA 2OZVA 3R5SA 1L7EA 1VJCA 3HB1A 2J5XA 3O3NB 4CL3A 5JRDS 4JP3A 1L7DA 4KAXA 3R7WA 1GPWB 1CWUA 4XDYA 4GPAA 1P0MA 1ZVQA 3J81A 2YVQA 2AOTA 3QPBA 2OD9A 1W35A 1N6IA 3SVZA 3SPXA 4AJ2A 4PG8A 1S3IA 3OETA 3SG0A 2AC2A 5K2OA 2QD2A 2YWRA 3A3NA 3MB5A 2XQGA 2ZSHA 4MTLA 4YRGA 3C74A 2ZRQA 5T7BA 3AR7A 2XMSA 2OB1A 3F6CA 3TSZA 4CLRB 2QJFA 2MYPA 2H4HA 3WKAA 5ISMA 1LJ8A 4H6XA 1U2SA 4TRRA 1XC7A 5IF3A 5E95A 3WC4A 3VO1A 1NI4A 3RVRA 1XTVA 1ZL0A 3BGSA 3QOWA 3STHA 2REOA 3EWIA 1NBMD 3TR5A 4YS6A 1U65A 3PK0A 4JA2A 3A6HA 4B9EA 3DPUA 3U9LA 3E3AA 3KZ1E 4OQMA 1FMTA 4P3XA 4W63A 5A06A 4GP7A 3R7NA 3OCVA 3VPXA 3WLHA 1U7OA 5T67A 3HP4A 4GGPA 4P0QB 3W5JA 2DQKA 3DDWA 3LT4A 1TT7A 4XGNA 1GZVA 3IHKA 1NRWA 3MTJA 3PJFA 3P9CA 4JBHA 4FWBA 2BFFB 2IW3A 3WGLA 4OMUA 3JWPA 2QX6A 2AN1A 4Y0VA 4PQFA 3ZZNA 4N5DA 5LUAA 3W5IA 1OIVA 1J8YF 1IB0A 1SBIA 2FRDA 1YMVA 3VDMA 1KNQA 3OZXA 5AUPB 1T3SA 4HN4B 3STWA 1L5LA 1PR9A 4UCWA 4I66A 4WLEA 5D7BA 3P0IA 3EGEA 5EXSA 3MAAC 3CZ4A 3CB4A 3PNYA 3AVWA 4LX8A 5KMGA 2XQKA 3ZCTA 3QKSB 1J6UA 4OOFA 1DC5A 4KWCA 4DUGA 3T4XA 2QU8A 3QYFA 1GQFA 4YP9A 2ZSAA 1CJVC 1ODJA 1IJEA 3NTUA 1N3YA 3O8OA 2P9YA 4RX1A 3FLBA 1U31A 4RABA 3ZOZA 3A6FA 4DY4A 2XUDA 3ZDAA 4Z3KA 2WF6A 4EYSA 2GASA 1ZZEA 2UXBB 1ZD8A 2A9RA 3GJ0A 1U4NA 4QPCA 2PQ6A 2VNKA 3H3FA 3HA7A 3QG5A 2IY8A 4KR9A 4LZPA 3A6DA 5AI4A 4RPGA 5FI3A 3USCS 1US8A 3SKVA 4CBVA 1DQPA 3NJ8A 4G0ZA 4UAVA 2C88A 2GK7A 3VYVA 3R3ZA 1JUDA 3DE5X 1U3GA 1Z5VA 2BSXA 4GLOA 5B1IA 1FLVA 1KIFA 3JXEA 2FSVC 3OZAA 1T0BA 1WMEA 2BTEA 1AKWA 1GGEA 2HWXA 1WR8A 4Q93A 4YP1A 5FBVB 1F2TA 2ZRMA 1WUIS 1SHKA 3DV2A 5IMSA 4H18A 1O5IA 3KYDB 2J08A 2O07A 3IC5A 4RMJA 1VE3A 3CSUA 3QUCA 4UCQA 3M1LA 4YJHA 4L1KA 3TEJA 3K5HA 1M54A 1YS7A 2HGZA 5D2CA 4CR8A 3RS0A 3OTOB 1JDBC 1S8FA 1NLFA 3KX2A 2ZZMA 2WLTA 1B14A 2RHDA 2YVKA 3HVKA 3L8ZA 2IITA 3WYFA 2XVAA 3DCIA 3IQZA 1NJ6A 4PZZA 4TMTA 4TTIA 3CISA 4PONA 1YL6A 3F1LA 4B76A 3ET4A 1WO8A 1H23A 2P3SA 1O1YA 3B1XA 1RWKA 2AOWA 1DXQA 3T1QA 5EZ5A 3T5BA 4AZWA 3DCYA 1CZUA 5C81A 2RH9B 4CEHB 2O8DA 4PAOA 4CTNA 1PSZA 2I1WA 2J5RA 3MW8A 2HXSA 3GLUA 3PXEA 4BN4A 4BOYA 1NMYA 3K9FC 3G2QA 3NHWA 3OG9A 3R8FA 2NVWA 4GQBA 1OE0A 1U7TA 4M9UA 1HYHA 4PX2A 3EHDA 1IQPA 3AVOA 2X8AA 2GKOA 2FE1A 5JJIA 3JYNA 4URZR 1EG7A 4X7BA 2E89A 4KQIA 1N2JA 1KMMA 4DR4B 1PN3A 3AFGA 1OZGA 1Z18A 1T4BA 3KTAA 3GLIA 3L40A 4KQCA 4TQ9A 3F49S 5BSUA 2J9RA 3QENA 4BNGA 4L5YA 3W5VA 1QNFA 2C2BA 1ABFA 1VE9A 3PG5A 3CWCA 3WFIA 1PR5A 2O8CA 3PFKA 2ZIFA 4ZK2A 3L77A 4MVYA 5I9LA 3ZHUA 5GJVC 1RU3A 1HFEL 5H4GA 3T7KA 2V7EA 2IHJA 1GGMA 3NFRA 4JXJA 3KQPA 4TSFA 2O0JA 1S89A 3BD6A 3H3JA 3GD7A 3KQVA 4HH0A 4BYMA 1DUIA 1KJ8A 4Q4LA 3PPXA 3E03A 4L5JA 1PT7A 1QPGA 4BCCA 4CQMB 4ZV9A 3SDBA 1DBWA 3V2UA 1H1LB 1SVIA 1I36A 4TSKA 1UQUA 4CNQA 1DO8A 4L6AA 1EP9A 1SXJB 2V96A 1FDRA 1YB7A 1NAHA 4NABA 1CETA 5HX7A 3C5EA 4RWEA 1EWQA 2GHTA 2BBTA 2X6RA 4QELA 4DIEA 3MMXA 1XALA 1FK8A 5HEKA 1FP4B 4FI3F 3AR4A 4LGCA 1BWPA 2QI9C 1RJGA 2G4LA 2XNKA 3VSEA 1QP7A 1M34B 5FOUA 1KKMA 2JGKA 1PYDA 3WMRA 1DO0A 4V1CI 4XJXA 4B2YA 1DKRA 1E3DA 2D8MA 3P9ZA 4GI2A 2YJ3A 1FRQA 2WE7A 4DRXB 1CK4A 3L0YA 3ZC3A 1KO5A 3P0HA 1IJKA 4QQFA 3H11A 1Z0FA 4HAYA 1GV1A 2FXVA 3JQBA 2GTHA 1JVNA 2EDCA 5KWJA 1IHPA 2ZR8A 3EHEA 1J70A 3ZX4A 4EI8A 1QOPB 3AG6A 3ELWA 4OXYA 3UCFA 1HMPA 4IOJA 4OGWA 4BXOA 1Q1ZA 1UEJA 4JJAA 4D0SA 2HFJA 1DIBA 2JBWA 2WHXA 4JQSA 1ZFNA 5FDFA 1PFGA 4N8DA 2XBUA 4ZRMA 4ARVA 2W5UA 3UB2A 4ZI5A 4QU0A 2GMWA 2CNOA 5TGTA 4N5HX 4F3TA 2CL0X 2IYFA 4LYYA 5LA6A 4MKZA 1EJ0A 1ONPA 3WLKX 4LHWA 4M54A 2C77A 1A8UA 1KI8A 1XTKA 2BELA 2HRDA 1D1TA 5CITA 1E1YA 5AKXA 4U2EA 4KOEC 3SYMA 1THZA 4KLCA 2FRXA 5CVUA 5AVOA 2N46A 2IYOA 1GZDA 1DELA 2DOKA 2P9CA 5P21A 1YQQA 4CF4A 2V6BA 2ZJZA 2XOEA 1XZDA 4MDEA 3LOQA 1GPAA 3AIIA 4L4YA 5TE9A 3SR3A 1X8XA 1WPGA 2OZLB 5JNWA 2CXUA 4KVZA 1ZN7A 5AW0A 3DE2X 4CLRA 5I01A 1D6SA 1M2HA 1QFSA 1V35A 4RTKA 3P20A 3CVVA 2ZLBA 2IYQA 3R74A 1M7HA 4FDAA 4YA6A 1N6KA 4GGMX 1R0XA 2XNDA 3F6PA 3HS3A 2QA5A 3OE7A 3Q0EA 4RY2A 5K03A 5A04A 1LNQA 2J6BA 4EJ6A 2QN9A 5T6MA 5JBQA 2B7BA 1SHLA 2RGRA 1L7BA 2WVHA 3PQ8A 5I4KA 3EPHA 4PQEA 1VYUA 2X6QA 4CKYA 1TVKB 3CGGA 4PAMA 3X1MA 3ZZUA 3C7TA 1GQRA 3FX2A 5JCOC 4K05A 1UBGA 2RHBA 2Y0CA 1IH8A 1LLUA 1RAIA 4RPJA 3UJBA 2BR5A 1IN1A 4IX1A 2XJ9A 2FRVA 3VVMA 2WYUA 2OM6A 2Z57A 3TSYA 1B8NA 2D8AA 4EQ6B 3WK4A 5EQTA 2AF4C 5IVPA 2BFFA 1OLXB 5A0VA 1W2GA 3LY7A 2GCGA 5CNMA 3ES9A 5HDBB 2XB4A 5CNIA 4TVSA 2C5GA 1IFXA 1Y3FE 1EXNA 3BM5A 1D2GA 1KMQA 4RIHA 4MQFB 1YQDA 3CFYA 1R4MB 3B2NA 1S3GA 2V4MA 2CEKA 5SZJA 3E05A 5ERYA 3V1UA 8ABPA 1NOJA 3L6RA 3BMOB 3QKIA 3VYSB 2FP4B 2JBHA 3D8HA 2V65A 1OX4B 3OKAA 2MSCB 5TEWA 3WWPA 3QKSA 1OA0A 3ZEIA 3TRJA 1SVOA 3HYCA 2SICE 1T9CA 1XD9A 2Y1OA 1R0YA 2YUTA 4TMKA 5IDYA 5EP3A 2AZMA 3SSNA 3TQOA 2QUZA 5KPDA 6CHYA 1GCAA 4H31A 4S12A 2HIMA 1X9HA 2LBPA 1JMVA 3O2NA 4ASUD 4AY4A 3L0ZA 3VR4A 1WZCA 2Z83A 4HPJB 3U4CA 2XUZA 3CE9A 1JR6A 2B3TA 4XWKA 2J4FA 1SH7A 4XFJA 3SQLA 1NIPA 2H18A 3RTBA 1R3DA 3KJNA 2BJVA 4EYGA 2EFYA 4BTLA 4D9IA 1QVVA 2QN6A 1JALA 3GH1A 1UJCA 4JR0A 1RBMA 4G2NA 5AJXA 1W85B 1FMJA 2DUUA 3JZIA 1GTSA 4Q12A 2VJQA 5JCJA 3KYDA 3SXUB 5G0SA 2VG8A 3HM2A 2IEBA 2R68A 2R751 2VH5R 4FYWA 1Q0ZA 1WHTB 2XNSA 1QRTA 2VJNA 5CJJA 3V1LA 1VSQA 4HL6A 4IJMA 3NX4A 5ALTA 3AMVA 3Q3GE 5BSRA 2IPAB 1OAOA 2Q46A 2FZ5A 5EHQA 2FCRA 3C1OA 1QHXA 4YRQA 2Q62A 2G6TA 4P83A 5I9TA 5C80A 5JPCA 2PWZA 2VHUA 1VCHA 3LQFA 1IN8A 3OJOA 3S55A 2H5LA 1Y3CE 2OP1A 4NYIQ 3OH8A 2PUFA 1PFQA 1H5UA 3PBKA 2PUTA 1WW8A 2GHRA 4CEHA 4ZU6X 3REQB 4B7XA 2FMHA 2EF0A 4F0JA 2CXHA 3DTVB 5LB2A 4J9UE 2XB6A 4CDMA 5LDHA 1QIKA 2ZZNA 1YGPA 3UMMA 4H3SA 3ZXSA 3AL2A 3WV4A 1D8AA 2B20A 2YHIB 1B3BA 3EZFA 2A9KA 5AJYA 5HIAA 1FA9A 1SHTX 2OBYA 3ANSA 2BUBA 2A88A 4MVJH 2KX7A 1NXTA 2X7HA 4FW9A 3OM0A 1MCZA 3CLRC 2J3JA 3GVHA 2I91A 2R62A 4DMLA 3EQ8A 3MUNA 4QXOA 4WRRA 2BFDA 2XQIA 1EK0A 1JG6A 2VWGA 4JFAA 1QHNA 2E18A 4KQEA 2CHUA 4BLRA 5C37A 4XYBA 4QDXA 2PL9A 1GGNA 4HMQA 4ALMA 5KX5F 5LP1A 3NGXA 2R7LA 4W5WA 3RUCA 1II0A 3GLTA 3VAAA 2JI9A 1UEIA 1W46A 5HE9A 4AK9A 3JQPA 1GPJA 3S44A 5EXXA 1G18A 4CQMA 3AL0C 1KBOA 1M1ZA 2AUTA 4LOIA 4V03A 4GUDA 2OPHA 1VCIA 1H1LA 3MMPA 4JB3A 1BMQA 2I3ZA 1DIAA 3OKCA 3KDSE 2GK4A 1KEVA 1SXJA 1AXGA 1AV7A 1VGRA 3RR2A 1SCKA 4RSHA 3TRHA 1U0SY 1E3JA 1YZLA 1JXQA 1TO2E 2N75A 3DNPA 4Q48A 4S24A 4BIMA 2XMGA 3LT0A 1H2FA 1V1JA 2ORIA 2ST1A 2FVXA 3WIDA 1YFKA 4NOJA 1FP4A 5CX1A 1J39A 1ZW1A 3LYAA 1BYIA 1K5GA 1QZ3A 1Q22A 1C50A 4BKPA 2XRFA 3ZGOA 2KLHA 5LA6F 3NETA 2R8XA 4DRXA 3KK0A 2LTAA 4PGAA 5LBIA 5FTLA 5TLSA 1NSFA 2IXTA 4Q15A 3FGPA 4D41A 2R48A 3L0DA 3NDRA 4G89A 1O58A 1KMHB 2JCGA 3R3XA 1LX6A 3UFXB 1DARA 1N6NA 1NVXQ 3TI7A 3ZZMA 2N42A 3PNBA 1B74A 2ZVJA 4H1TA 1U0JA 1K6JA 1ZN2A 2V5UA 1Z7GA 3MPUA 1BA2A 1FQKA 1ZKMA 1NBME 2FSSA 4QA9A 3USZA 3ZE1B 4S05A 4MS1B 5EHZA 3CLTC 2XDYA 1LFAA 4Z1MA 2PMEA 3F4BA 3RJ5A 4C07A 2PKYX 4DG9A 3EDCA 4Y1GA 1KDVA 4ZANA 3WLOA 1NP7A 4IJ5A 1T0IA 2CL7X 3ICQB 1H9AA 5AW4A 5L6MB 4E14A 2EQ5A 1RAEA 2FAXA