4YQEA

Crystal structure of e. coli wrba in complex with benzoquinone
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
197
structure length
185
Chain Sequence
AKVLVLYYSYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGKTQTAPVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGTGGGQEQTITSTWTTLAHHGMVIVPIGYAGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD(P)H dehydrogenase (quinone)
publication title Quantum Calculations Indicate Effective Electron Transfer between FMN and Benzoquinone in a New Crystal Structure of Escherichia coli WrbA.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Oxidoreductase
total genus 63
structure length 185
sequence length 197
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4yqeA00
1C7EA 4Y7CA 2QWXA 1FLAA 2KLBA 3ES9A 3TE7A 2ARKA 4BMPB 2R97A 1RTTA 3GAMA 3F6SA 2MWMA 2D5IA 3FVWA 4LTNA 5EAIA 1JA0A 2F1OA 1T5BA 4C14A 2W5UA 1AKRA 3JSXA 3OX1A 3LT5A 4NULA 4GR9A 1YKGA 3NHSA 3HLYA 4LTMA 5A4KA 1QRDA 3OJXA 3D7NA 1YCHA 1XI2A 1ZWLA 1OBOA 1TLLA 3GFRA 2M6RA 1WSBA 3ESXA 3FJOA 1V4BA 1FVXA 2WC1A 3NHFA 4OXXA 3ZHOA 1AHNA 1SQSA 5LVAA 4Y9RA 1H69A 4GI5A 4C0XA 4QOEA 1CZHA 6NULA 3FW1A 3F2VA 1FLVA 2FZ5A 1X77A 1YOBA 4ZVNA 5B3LA 1T0IA 1RLJA 5LJLA 5LMCA 1J9EA 3NLLA 2FX2A 4YQEA 2OHJA 1C7FA 3TZBA 4ESEA 5LLDA 5ULLA 4BMOB 2Z98A 3HR4A 2FZVA 3F90A 4F8YA 3B6MA 2OHHA 3P0RA 4M0CA 3U7RA 5FA6A 3UXEA 4ZVKA 1AMOA 1BU5A 1QHEA 3L9WA 3EDOA 3R6WA 3K20A 3GFSA 1B1CA 4Y9UA 1KBQA 2ZKIA 2AMJA 2B3DA 1AZLA 3B6IA 4DILA 1AKQA 2HNBA 2FLVA 2BZSA 2M6SA 1JA1A 3HA2A 3K1YA 3L9XA 2QX4A 3NHUA 1BVYF 2Q62A 4YALA 1YCGA 3RPEA 3OWXA 4QOJA 3KAQA 1DX9A 4PTZA 2QMZA 3O73A 3U7IA 3UXHA 1CZNA 3NHJA 5NULA 5F12A 1AG9A 3NFRA 5F51A 1D4AA 1TIKA 3OX3A 3NHPA 4HS4A 1D03A 1J8QA 1FUEA 2FAXA 2OYSA 5NLLA 4XDHA 4YAFA 3N39C 2Z9CA 2Q9UA 3KAPA 2QX9A 1RLIA 2Z9BA 2MOKA 2BN4A 1CZLA 3FNIA 4FX2A 2BPOA 4FGKA 1YRHA 2HNAA 4NLLA 2BF4A 2GSWA 4DY4A 2Z9DA 3NHWA 4U7GA 4LAFA 5TGZA 1RCFA 2V5VA 3OX2A 1ZX1A 4CETA 1QR2A 2FDXA 5B3KA 3EYWA 1I1OA 1CZRA 4H2DA 1XYVA 1QBGA 1J9GA 4DIKA 5BUCA 3W79A 3O2NA 4FGLA 2FOXA 2RG1A 4ICIA 2V5UA 5LBTA 2BMVA 2FCRA 4S24A 5FUQA 4HEQA 4CF6A 5FX2A 4XDGA 1FTGA 3NHKA 2MTBA 1AKTA 3N3AC 4ZVMA 4C76A 4N65A 1H66A 1E5DA 2R96A 3ESZA 1SG0A 4ZVLA 5EA2A 4YAWA 1XYYA 1FLNA 3W7AA 1CZOA 1F4PA 1ZWKA 3KEGA 3W77A 1CZUA 3GFQA 2A5LA 4U7FA 2X2PA 1GG5A 4PU0A 1KBOA 1OBVA 4QOIA 3OVMA 4D02A 1AKUA 5LBUA 3QFCA 5LJIA 1WSWA 3S2YA 3TEMA 3OWHA 4FGJA 3NHLA 3B6JA 2XODA 1DXOA 1FX1A 3FX2A 1YCFA 2FVXA 2OHIA 4J8PA 5F4BA 4YAUA 4QOHA 3SVLA 2HPVA 4H6PA 5JROA 4LTDA 4R81A 1D04A 3KLBA 1FLDA 2QMYA 1CZKA 3NHYA 1J9ZA 3QE2A 2QX8A 3NHRA 2QR2A 4QOGA 2XOEA 4PTYA 4N82A 4QOFA 2V9CA 2N1MA 1AKWA 4N9QA 4LA4A 1YDGA 4C0WA 3F6RA 1DXQA 2QX6A 2KQUA 3B6KA 3OJWA 3QFRA 1NNI1 4U7HA 1XT6A 2X2OA 1VMEA 3ESYA 3G5MA 4QODA 2MT9A 1OFVA 4YAOA 3N3BC 3W78A 5EMNA 3LCMA 1AKVA 4GQIA
chains in the Genus database with same CATH superfamily
1CQIB 4F91B 3QLJA 1PWYE 3K6SA 4XUEA 1QHIA 1V3VA 3H2JA 4HDMA 4O2RA 3SXUB 5KREA 4GVLA 2VF2A 2VBCA 3EYAA 1R9GA 5HR5A 4I9GA 3DZGA 4REQB 4AQYB 1DKNA 1R6BX 2D1QA 2JFOA 1RFLA 5L3RA 2AVDA 3S99A 4PG8A 3HCCA 1K75A 4IHJB 1DV2A 4NH4A 1AGNA 3VAYA 4BE9A 3FNRA 2FUCA 2VHVA 1HDCA 3CIOA 3TIGA 1GTJ1 1WXDA 2NZXA 3GBSA 3JAKB 2NXWA 5LMUB 2GAJA 4XUDA 5LCXA 1Z25A 3FVWA 4KUEA 5AT1A 1ZGZA 3CV3A 3ETNA 4C3VA 3PEEA 1WKBA 3D3WB 4HQ6A 3BIJA 2OO3A 1N6OA 3QUCA 3R3UA 4LHEA 5J3JA 1X9HA 2A9VA 1RQGA 4C14A 1JVNA 3C6KA 1XTRA 2X9QA 3B3FA 1XKLA 2R8EA 4F5WA 1ML4A 3R5HA 4RL6A 5EIBC 3U1VA 1ZN2A 2I4MA 2W6ID 1U8UA 3I0ZA 1V43A 4CUKA 2EP8A 2PAFA 3KZXA 4XWGA 3OLCX 3IMFA 4HQOA 1VFNA 2ZVDA 1NRIA 3EC1A 1FSGA 3OMXA 6PFKA 5ICCA 5I01A 3P52A 1FJXA 4LI0A 3VZSA 3JD1A 1MORA 2W2TA 1C8VB 1NJ5A 3NUZA 4U00A 4JJEA 1H0RA 1QTNA 2HCTA 1VCHA 4QEKA 1ML3A 1QHYA 1ZR2A 2BGIA 1C1HA 1KAHA 2JIOA 5EWJA 3K4HA 3O2JA 4Q7LA 3GJ5A 2X9LA 1NUTA 2E5FA 2ZYDA 3RTEA 2X5JO 4PF1A 1D7AA 4ROTA 4E3ZA 5I7FA 1X7WA 1FDVA 1O4VA 1I36A 1IE3A 1E2QA 1NVKA 1N3BA 2VZ9A 4D9HA 4H16A 3EVZA 1V5FA 3GAAA 4HLCA 2VRCA 5A7HA 1HI9A 1WSBA 2IIVA 1V9SA 1V4BA 2W37A 4QXOA 3ZHYA 4AICA 5ITZA 2IQ5A 4YAIA 1SU4A 1W4AA 2PS0A 3NJ8A 2APJA 4G37A 4LCJA 5CX4A 5D5QA 3W2GA 3H6GA 4TVKA 1CS0A 4QU5A 4RS3A 5DTEA 2P5TB 2FQWA 4JSYA 4O25A 3S1SA 2ZRDA 4RCZA 4TKVB 3ZV3A 2JLXA 2V0GA 2PSDA 5LVAA 5KBYA 4TL6A 4OMFG 3RF7A 4CNBA 4ZZIA 3UK6A 2FKNA 4CDRA 3IFSA 3CNNA 5ETJA 4B34A 2NZYA 3G6KA 1XRQA 5CH3A 2IZ7A 4RVNA 2I6TA 2XZDA 3ZS9A 1MC8A 3I3OA 5AHWA 2C8VA 4I66A 4JB3A 3KXKA 4MROA 4QJ5A 1R10A 2OORA 1UZLA 3LC7O 4IDEA 4W8GA 5FA8A 3LG2A 5B1YA 1PZMA 1TAUA 3UFXB 1DCTA 2AG1A 4BJHB 2Q41A 1QHSA 3V4SA 4YCNA 2OQIA 4R1LA 4XCVA 2EKQA 5LLTA 1V11B 3MYRA 3UJ9A 3UAGA 1BMFD 1C8BA 1VOTA 1COWD 4RLSA 5ERXA 1JZQA 2XD4A 3MYYA 2QTBA 1QPGA 5LA6B 2E85A 1AS2A 3I04A 4FUTA 3E7XA 4UFPA 1U7OA 1ISSA 3NJ4A 4DKXA 2B21A 4DBVO 3ZWBA 3AC0A 5KOIA 3E7WA 5KVCA 1XXLA 2ACKA 3G2NA 3BRWA 4H0CA 2XWBF 3UMBA 4OTZA 2BGMA 1Y7PA 5KSWB 1MQ9A 1RI1A 1YB1A 4M9SA 4K81B 1BDJA 3ZY4A 4EPXA 4ESEA 5EMJA 3M4ZA 1UBSB 3TOSA 5LLDA 1E3IA 1OV6A 4Y1EA 4EPWA 2BVNA 1LXCA 3E5RA 3ETGA 4RTLA 3SBOA 2HDOA 3ZBPA 4B4OA 1M34B 1Z12A 1KVUA 1FQKA 4IOLA 3O8CA 3JWEA 3DAHA 4GPBA 3I2YX 3QI2A 2J9RA 3MQ4A 5FAXA 4BVFA 2AXNA 1YDFA 1Z8NA 3NI2A 5SZJA 5ARBA 3PQFA 5BYAA 1W6UA 3WGIA 4XB6B 1A9PA 3JV7A 2Z56A 4IFEA 3IA7A 3IPRA 3LQQA 2GFIA 3LWNA 1V5WA 3QMVA 3QW4B 2G40A 3A6DA 1GGMA 3F97A 2WJIA 2OAQ1 2ZTSA 4G8DA 1JKFA 4Z54A 4XR9A 2A58A 2QN1A 3D81A 2QD4A 3U3OA 3OJLA 1QHEA 3L9WA 2D2EA 4GP7A 2H16A 4AG5A 3DFUA 3L18A 3Q3CA 5C1OA 4ZCQA 3DLHA 2YWCA 4LY9A 2BV3A 2GZ2A 4WJZA 5L7YA 4W5JA 4TYWA 4LF6B 3HTXA 2AVNA 3O7MA 3D43A 4MRPA 2BONA 3NEJA 4ZZ1A 2GBGA 2G6BA 2W6OA 2WAOA 3KEOA 1DQSA 1WQ3A 4DCVA 5IXJA 1ONSA 2RHCA 4WD3A 1BH2A 4NMHA 2X5KO 4KIUA 1V25A 2AQKA 2FFJA 3IUQA 2HQ1A 3HB7A 3L6OO 4EI9A 2HNBA 3P9KA 2J3JA 2M6SA 3O82A 4GNRA 4IGEA 4R2HA 4RWEA 4GRDA 1Z0SA 2A30A 3L9XA 4OIMA 4D0SA 1K8XB 2RGDA 5KX5B 1CJCA 2HGZA 3H4VA 3M34A 3RIGA 5MN5A 2V7TA 3LO5A 4DQKA 4PSAA 2GT1A 1YS9A 3WLAA 2VYND 3DKKA 1SZDA 4H7KA 2J5QA 3R3YA 5FLKA 1GLVA 3PXXA 1N6KA 2ZZNA 1DAKA 2ZYUX 3PXUA 2P1DA 3JPWA 4OB6A 3NAMA 4RE5A 3RD5A 1JE0A 1VB5A 3SQOA 3T9DA 4B3IA 2KM1A 2NV2B 2ONZA 3BIFA 1FVFA 4OHCA 3C8DA 4FDVA 221PA 1HBJA 4MCJA 3RHSA 5C5IA 1QIMA 6Q21A 4P7KA 4MEAA 3GF4A 3RADC 2R8BA 2JH3A 3MUFA 1ZMRA 2ZRIA 5A3VA 4GD3Q 1HQDA 3AIIA 4CG1A 4V02A 1MVNA 4J1TA 1T3TA 4EL5A 1NXVA 2HA2A 1HZZC 5DNDA 4CM7A 4WLOA 1A4RA 3O73A 1BXKA 1SQ6A 5C81A 3S81A 1FUYB 4Q1CA 2QY6A 2WKQA 4DMUB 1R4MB 2KW5A 2PVSA 4HGRA 2ID4A 4IUYA 5LBIA 2GNOA 3VX4A 4E22A 1EBFA 3VYTB 1KIMA 1L4YA 1VGRA 1NRWA 3CX7A 1M5RA 1R16A 1K1EA 1OH8A 3UMFA 2B7CA 3QXXA 2F55A 3ESCA 3RBXA 1LWOA 4P38A 4Y1RA 3CLSC 4LZAA 4D0NA 4EITA 2EX0A 4TLCA 1DBRA 2QW0X 2O1WA 1KYTA 1XCPA 1GA6A 3BJZA 4CEJA 2YINC 2ZXFA 2AZDA 2FEAA 4KNVA 3QLTA 1ZI6A 4KITB 3UWPA 1LDGA 1SELA 1O6CA 3H9JA 5FTMA 5B2ZA 2C2MA 3KUKA 4B4DA 5CCDA 5CVEA 1X1RA 2NTVA 2VPIA 4IF4A 4KXMA 4DY6A 4EY6A 2CSXA 3SVZA 2HHCA 3VSEA 5JASA 1DBQA 3LVQE 1YR7A 1YR3A 3OKAA 1GJRA 4CM4A 5AVYA 5FNVF 3QV2A 4U6SA 1TIPA 4DAOA 1T9CA 3KVYA 4L8GA 1KJIA 2N46A 4P08A 1KVSA 4U7TB 3PPWA 1GZ5A 4I4LA 4G23A 4QBIA 5AO9A 3TRJA 1IZ9A 1I10A 1AX9A 1SA0B 1W34A 1ZOLA 2RMKA 3QP9A 1SFRA 2D2IA 1NVGA 1NT2A 1S2MA 3MWLA 4M1TA 3UUEA 2NYVA 3LA8A 3B48A 2Q45A 2X77A 3GX1A 1WLSA 3FVVA 3NIFB 1MOPA 3GH3A 4I8XA 4IO0A 4LOAA 5FLYA 1OZ0A 1WMFA 3H1BA 1XNQB 1OVMA 3I01M 2PXCA 3BL5A 3BZWA 4N54A 4WXEA 1U9IA 2XUIA 2QRUA 4ZO4A 3DDZX 4CI0B 4CMGA 4KRFA 1CZLA 2JBHA 1I7QB 1T36A 1H23A 3AZOA 4FX2A 4JQCA 4M89A 2ZT8A 1L7XA 1VPEA 1XSEA 1TI7A 3HLKA 2O05A 7YASA 1LLQA 3WLNA 3SQXA 4FHFA 1JDZA 4QDXA 3VR3D 4EUNA 5A5DA 3HUTA 1IWPB 3OI7A 1H4QA 1J2JA 3LPAA 4JVOA 4QYMA 4KR9A 3GLRA 4J7AA 1F12A 3GMIA 3NHBA 1X7YB 3R5XA 1U2PA 4JLWA 4LVNA 3GRFA 4TXLA 5REQB 2POQX 4BMNA 4JLNA 2ZS7A 4MYSA 4RNCA 4C87A 4DCOA 4ZV4A 3IKTA 2JJYA 1KSGA 3WMXA 3V8NA 5KNDA 2CHGA 1HSZA 2ZJYA 3EXHA 3H2HA 5EUBA 1CETA 3OIWA 2GCGA 2R4UA 3QMMA 3BE4A 1JBEA 4ZAWA 1XVTA 4XGNA 5FPSA 3D2BA 3G0CA 4RLHA 2YV5A 1ZX1A 1EM8A 2I62A 2ODPA 5A2QA 5AIBA 2HK9A 1NAIA 1YJXA 2OYCA 2CJYA 1OFUA 3CPEA 3CSSA 3FYTA 4DANA 1F8UA 2EL9A 4IS3A 1X7ZB 2JH8A 4H2DA 5ICEA 3KKPA 3TLJA 1A2BA 1R6TA 3LUHA 4AMBA 4QJ4A 4ZMBA 1QS0A 4A5OA 4D4LA 1GL7A 4F3RA 4KNYA 4XTCS 1CUAA 3AEXA 1L8OA 1P1JA 1FRZA 1QTIA 2NU7B 3V80A 1ZK4A 3RC7A 1FDUA 1VKOA 4INJA 3ZZTA 3MQFA 5DKFA 1JKIA 4B4KA 1VE5A 4QFBA 3A4TA 5HWSA 3I64A 3K2IA 2PNJA 4TXMA 5KNBH 3NEPX 3RSOA 4HG2A 3UAWA 4MZXA 2VL7A 5F2OA 3K6JA 2NVUB 5B2EA 2X8LA 1P74A 4OIFA 4JQYA 2W70A 3DAYA 2VXYA 5AJHA 5IF9A 5C7OO 3VX3A 1KMQA 3QPAA 1K89A 2P2SA 5F52A 1RQXA 1XAGA 4MUXA 4DIMA 2KSQA 1C0IA 2EKBA 4G8JA 2O8VA 3I9LA 1SG6A 1U2SA 5ESXA 5LDGA 3VM6A 3HUDA 4QU9A 3QWAA 4J9VA 2BH2A 2ACWA 4NQZA 2ZM6B 1CBUA 1SHKA 1W19A 2ILTA 4XRRA 1W5BA 2VP3A 4HSGA 4DQVA 3AVOA 4IEFB 1NSYA 2P5YA 4MQ4A 3SOZA 5HQTA 2O2IA 1VHQA 1LI7A 2EWWA 2KBEA 3O8LA 3JTEA 3K2QA 1S9DA 5C2JB 4G0YA 3TNYA 1VJ0A 4BRSA 4KSYA 3HKEB 2HU2A 10MHA 2QZ9A 3STUA 1DP4A 2FSPA 3H9EO 3W77A 4DA8A 2TMYA 1N34B 4GBJA 4YP9A 1VA5A 2HWYA 2RGEA 3RIMA 5EL0A 3WO1A 1B41A 1PZGA 3GFQA 3IYLW 5CURA 5LZ9A 3IEIA 3LK6A 1WR8A 1NA5A 1XEFA 2G82A 2OBBA 1SU6A 5G3ZA 2PMFA 3O4JA 4YBZA 1KGSA 2YC4C 1E0DA 3C45A 1PWEA 4FLFA 3HY4A 2AB0A 1QMPA 5DNEA 3U7QA 3FWHA 3KHSA 3I5XA 1OBVA 1YUMA 1T8RA 1ZHFA 3BB3A 3ZNQA 2PX3A 3AUTA 2JFBA 3OVMA 4PX2A 4EF4A 3PD7A 4YV7A 4BU0A 3RAEC 2C2GA 4ZO9A 3GVHA 3O8OB 1UMDB 4UBIA 4BCDA 4CM3A 5KINB 3A1NA 4UHFA 2QPTA 4BLWA 1KI3A 5A0TA 3MW8A 2WEKA 4JASB 2WHPA 2QRLA 3CO5A 4YJKA 5K0JA 1UDRA 1DIAA 1I2MA 2VWPA 2WLTA 1J20A 1I01A 1QGYA 1PD0A 1PWZA 4RJIA 4PLWA 3IPAA 2Y68A 1CEEA 1ES9A 2QXTA 3P2OA 4Q3EA 4GF5A 4DIBA 3L1UA 4NOKA 3IP8A 1NLUA 2CVOA 1E3LA 3I0NA 1FNNA 5AOAA 2JATA 2AZMA 4YRSA 1KSJA 5F4BA 3AI3A 2K2QB 2NTYC 2XNDD 4IEIA 5BSWA 3HXMA 1OYOA 2QVYX 4HGYA 2HPVA 1AO3A 1JDBC 1XWWA 5E38A 3BMNB 4NU5A 3NOOA 3DLBA 4XVCA 3AB7A 5GONB 1MR3F 2V7PA 1L5VA 3RVLA 3CUSA 2I4TA 4L16A 4GBMA 3R9WA 1G21A 2XDAA 4MQUA 2P78A 2QYOA 1E4VA 5AHKA 1D6NA 4CW7A 1TMGE 3BHIA 4CPDA 4J7UA 2IYRA 3GD5A 4MP6A 3TG2A 5CB4B 1SKAA 2W58A 4FLMA 3O5AA 4KQ9A 1XZKA 2C5FA 1J8YF 4INAA 4O2BF 4D8UA 2E7ZA 3AP1A 2OENG 2AEEA 3FFWA 3P9QA 2OGWA 1CNFA 1WIWA 4KQJA 2OV8A 2IDZA 3UMJA 1Z2OX 4OL0A 4DCGA 1Y9AA 2P9BA 4D9IA 4DN6A 4Z7QB 1RU3A 1SOVA 3OLQA 5EKSA 1GEEA 2QAGB 1PX0A 2AJ8A 5CM2Z 4JNCA 3VDRA 3AVXA 5LMNB 3ZCSA 5KZMB 1GZUA 1IEQA 1NX9A 1YKFA 4YS6A 4C0WA 5CAEB 5I3CA 3W5AA 4X1IB 1E9BA 1A9QA 2WF8A 3VMFA 3G8DA 1TM4E 3L1HA 4XEUA 5JAOA 4BBJA 3KQLA 3CONA 5EXXA 2JJ2A 5AJYA 4P35A 2QDKA 4EQ6A 1PG5A 2D74A 1E2DA 2H1VA 4GS5A 5G4LA 2X2OA 4RELA 3TXYA 2PVPA 4XGKA 3G5MA 4PYRA 4RVHA 4BNGA 4LJSA 5D6OA 1KFJB 3EZ7A 4KPGA 5FADA 3SJCA 3T0GA 5H4GA 4ZI3A 2V9ZA 3E9CA 4YRBA 5KOHB 4A8HA 3KXPA 2GB4A 3CGWA 3A4VA 2GR9A 4YONB 3QTTA 5AI0A 3ZGLA 4AULA 1ZKDA 2R60A 5CA0A 1QZ3A 4AMVA 2HA6A 2XHEA 3LMKA 4WOBA 4Y2RA 3GOQA 3MIZA 3DZJA 2HUNA 4LC0A 5AP9A 3L01A 3TTUA 3ICPA 1DADA 3BAFA 2ZRGA 3V8EA 1U04A 3MGAA 2KLBA 1E6MA 3W2EA 5L9AA 5AHXA 3QY9A 3TE7A 1JIJA 5ER6A 4HGPA 1EI9A 3GEHA 4ZMSA 1P2DA 3OQMA 4EL0A 1S0UA 1VKHA 1Z0KA 2CD7A 4Q4JA 3SM9A 5D7BA 1QORA 2I2XB 2QTVB 3H65A 7REQA 1ZMTA 1F60A 3H3XA 3R3SA 1RHKA 1WU8A 3AJDA 1W8IA 2BJVA 2Q3HA 2YJGA 1ZL0A 3AL2A 3GZNB 3PDIA 4ZOQI 4X1YB 3CG4A 3H1AA 1T2DA 1ZZGA 2YVQA 1NN5A 4R7TA 1ZGCA 5IS2A 1W2GA 2G83A 4C0KA 1I6LA 2SKDA 2QN2A 1GSAA 5BNTA 5JYDA 2D6FA 1HDZA 1CP2A 4XFDA 3TZ6A 1H05A 3LT4A 1EFRA 2JC3A 2B69A 2VDJA 1HMPA 2IL1A 1YFZA 5ICGA 5FWDA 3AVUA 4O08A 3P0JA 4P83A 1P6QA 4AF8A 3WGVA 3UJBA 2D5LA 3C16C 3RRMA 3GY0A 3L1VA 3VH1A 1W73A 3A6FA 4ZJZA 5JYBA 3TUZC 2Z09A 5ALEA 4XVUA 2I9PA 2AR0A 3IALA 2O3SA 4JOBA 1GRVA 2C5HA 2P6OA 2YJNA 2PX5A 2OBMA 3Q0EA 1OBOA 2GBCA 4CR7A 1ZJWA 4P31A 3RYIB 4UU1A 3GAFA 3GJ7A 3FVRA 4RPIA 4RHXA 2DB3A 1FSZA 1BTOA 4EHJA 1AK2A 1X42A 4CMIA 4OHRA 2CJPA 4OH1A 4ZJYA 3QVOA 2R85A 4AP5A 3PDJA 4MB6A 1G5TA 3G0GA 1OGJA 1ZUHA 1XZPA 1LVUA 2HHAA 2ZJ7A 5AXBA 3RRBA 3SX0A 4F4IA 3S7ZA 5CFOA 4PCAA 3C7AA 1T0JB 2JJMA 2OGSA 2WWGA 2DKOA 1I4OA 2NTEA 1MRNA 3NVDA 1QF6A 5DBEX 2IZ0A 2IH5A 4LOHA 3W7VA 1PG2A 4CMBA 1V16A 4RTSA 4D4MA 1F9EA 1T2AA 4FHCA 4XYEA 2DUMA 3WBBA 3EPLA 1BQEA 2OFFA 3TW8B 2CNLA 5HGXA 5KMGA 5AW6A 5L3QB 4IOKA 4N6GA 2NSLA 5A5EA 4Y2PA 4P4NA 3U1TA 3GXOA 3IAEA 3ZKWB 3HGMA 2FZ5A 5AUPB 4LN1A 2EZ4A 2HU7A 3M49A 4ZVNA 4Q9HA 4P3PA 1EFDN 3GJ6A 4BNMA 3LT2A 1J21A 2FEOA 2QRKA 1E89A 5AOCA 1BC5A 4UAVA 1R4NA 3O47A 1MB0A 1QK3A 3O92A 2AI2A 1BVHA 1ULAA 3DMFA 3ZY2A 1MAWA 1S1CA 3HN6A 4CCYB 2EZ8A 3QOWA 4RVUA 1NFFA 1C7RA 4DDUA 5A05A 3IUNA 3I28A 3JR3A 3QEKA 1ZESA 2LGJA 2Q2WA 2WIFA 3L82B 4ME6A 4MS3A 4JJ4A 4KX3A 1W581 3ZDYB 1J9EA 4U63A 4RF4A 4WFKA 1E9SA 1PLKA 3BXEA 2PKCA 4FS3A 3N8NA 3P2KA 3A9UA 1C30A 4LE1A 3TM5A 4EF6A 1R88A 1KKMA 2CDBA 4K9MA 4N5DA 4BVAA 4RTQA 4PN3A 2KJQA 1E63A 3A32A 5KWSA 3SHTA 1RKXA 2J0EA 3G49A 5YASA 1F51E 1W93A 3M6AA 1WY7A 2FZVA 3VTZA 2ZTMA 3ABQB 4OV6B 2CNNA 5C5CA 4WJLA 1XZGA 2GNPA 3T5AA 1AQNA 2QENA 4CV3A 1KJ9A 3HA7A 4YCMA 2W6CX 4MW9A 3GFBA 3QYJA 4K87A 3G1UA 4U6NA 4LI3X 5AKZA 2AJDA 4YJHB 2FP4A 1EINA 1T8TA 1Z33A 1GPMA 2O7RA 5D87A 2OBYA 1UF9A 1W52X 2YZNA 3W2IA 4DWWA 1XZMA 2XE6A 3FH0A 3TVDA 4GGMX 2NU6A 2VJMB 2GN9A 1BHJA 4NK5A 1H3NA 3TQSA 4ARIA 1QANA 1DC4A 2VHJA 1UWLA 3BF7A 3P1JA 3FYCA 2ILVA 2QVLA 4ZXFA 4ETWA 4OP1A 1E96A 2H48A 4XSHA 3R6WA 2VHEA 2J6BA 3JARA 3C3MA 2EJWA 2CBXA 1BW9B 1HYBA 2NQTA 4TKUB 3MELA 2HF2A 4CDGA 2QUIA 2JCSA 4R2XA 5K51A 1JKMA 2JPDA 1XQXA 3EWIA 2AMJA 3MMNA 2IRWA 5FD8A 1C3OB 3T1QA 4TS9A 4GMFA 4AN1A 1ISFA 1IJFA 4UEJA 1QOQB 5IK2D 1RXWA 2IXAA 3L7BA 1BEZA 3OM8A 3ZJ5A 4WKOA 4YLYA 3FRJA 3DMHA 3GLGB 2YWHA 2AX4A 4NONA 2MYTA 1HURA 3FOCA 4RDCA 4YJ2B 3ZIDA 2R84A 4ZAYA 2HA4A 4YRAA 1GKKA 3ZWWA 5HKKD 3QHPA 2HIAA 2QVGA 1U3FA 2FU5C 2YHIB 1AHIA 2ZYHA 4PC3A 2NUAA 3GLQA 4UFNA 1UBLS 2PKXA 2QX4A 4KACA 4C30A 4KPFC 3ZOZA 4X60A 1G7CA 1PGOA 2QUJA 3AERB 3GYBA 1NUSA 3RFTA 1V8BA 3I5MA 2FUEA 3R77A 1V45E 3D6VA 3GRYA 4LOIA 3D6HA 3QJGA 3TR5A 4EEKA 4QLAA 2FMXA 3LLVA 2FRXA 4A6DA 1R0YA 3TBKA 1MT0A 3QLVA 2GJ9A 4MV1A 4FU0A 1PT9A 1FP7A 1K9VF 1P5RA 3BH6A 1TPYA 4FFSA 3OWXA 4X6UA 5KAMA 5CBKA 3DBLA 2WB2A 2Z2IA 3DEJA 2OPHA 1VXRA 1EFTA 1FFWA 2CLKB 3P5SA 4OBXA 3STWA 3AP2A 1L5HB 1RCTE 2J7PD 4WZ6A 4E5KA 1J42A 4HUTA 2RHWA 5F2NA 2R6R1 5EIWA 5DI3B 4HDKA 3CT4A 3CW9A 5JD5A 3UNXA 4BFUA 4BO5A 2P6MA 2FRDA 4NHOA 1X15A 1Z82A 2H0RA 1NBWB 2IEYA 4BQNA 2GD0A 4W9RA 4KN9S 5CK4A 3MMZA 1F2UB 3N2GB 4EFLA 2CT8A 1WP4A 2AG8A 3KKKA 4UNQA 2PUGA 1ZCAA 3V1MA 1V6SA 3CKYA 2J48A 3AIMA 3T94A 3ESBA 5EJ4A 2NXJA 5C31A 1K63A 2WYUA 3AY7A 2WA2A 1LCIA 3RAJA 1YA8A 4ZGBA 3OOYA 5THKA 2NU8A 2DWUA 3G85A 1IHUA 3S5JA 2I0FA 4D45A 4H31A 3OCJA 5CB4F 3EY4A 3X1YA 5IF3A 5GZ6A 1EFKA 2W0SA 1UKYA 3F4BA 3KELA 4BFXA 1J8QA 4L3OA 5FUBA 1MRZA 5ADVA 3LGXA 1Q2UA 1NM5A 4YT8A 1LBIA 1AN9A 3K5PA 4FHDA 1N2GA 5EIBD 3SXUA 2DHEA 1QWOA 3QLUA 3IVGA 4OJKA 5JNUA 4L02A 4WZBB 5K01A 4Z1MD 4IMPA 3VRHA 4IHJA 1RAIA 1ZUWA 2VWQA 3BSFA 2CFRA 3EE6A 4BGDA 1ULSA 3DDUA 3U9SA 4KBFA 2XY4A 2X8JB 1RQ2A 1SC3A 4EB6B 5J5CA 3AHHA 2MOKA 3T7DA 4US2R 4X92A 2IU3A 1SVIA 2CNBA 3EQ7A 3HZOA 4YRTA 1B4DA 1O5IA 1ORWA 2H4JA 2BPOA 5HCIA 5DWDA 3F6CA 1JPJA 1ECBA 2CFCA 3BXXA 1GZVA 5AK5A 3DBVO 1TEHA 2XBLA 2D1TA 2ATIA 3KEFA 4OYRA 1GAEO 2IF0A 3UB2A 4TYNA 2GJ8A 2PT9A 3ZWCA 3G8YA 1QE3A 3UMSA 1CUZA 1D2MA 4Q9JA 4M1YA 4DV5B 1R0KA 2RC5A 5B7QA 2JAWA 1P3JA 2C78A 4DQDA 4TSFA 4L4YA 5IBCA 3Q8MA 1Z7YA 1G3QA 1G20B 2ZUDA 5EZYF 8OHMA 4PG6A 2CLLB 2GPJA 2BCEA 4B3BA 1JG2A 2JJ1A 1ND5A 5E9WA 3HL0A 3W2TA 3NV7A 4C0SA 4DLYA 1I2BA 5TNXA 1PQUA 2QSJA 1LY1A 2I3AA 4X44A 1C14A 3QFHA 4D8TA 5CFQA 1BDBA 1JZTA 3DTVD 3BE5A 1PR1A 1Y4ZA 4RVDA 3R5KA 5JD3A 1X9GA 5I6DA 5J2UA 3I30X 2CMKA 3G2HA 1AK9A 2MR5A 3DLIA 4NZYA 4E7PA 4H35A 4FT4A 3T5MA 1YU9A 3FOFC 4CV1A 4BY9E 4IDHA 4UE3S 1WNFA 5EWLB 1WDMA 4EMBA 5A02A 2HIMA 1VGQA 3HKDB 1EK5A 1IG0A 4KKXB 3VYVA 4GIBA 1F3OA 1SVSA 4Z51A 4FCTA 1WHTB 1UC9A 3J7TA 3PUXA 4IXTA 4BVLA 1N2HA 3HCWA 5DXAA 3NBQA 4LIPD 5FO1A 1O87A 2C4HA 3B9QA 1NULA 2ZBGA 3LC0A 3NZEA 4UDYX 2NNLD 4GRIA 5JNLA 4PYLA 2HK8A 4I55B 3GUCA 3L06A 2OUIA 3LHSA 1E4YA 3MERA 3UXMA 1ZBQA 3NB0A 3AUXA 2XUZA 3SHQA 4UNRA 2C58A 4EJMA 3G13A 1PS0A 1ZD8A 2GPTA 4GOXA 4LRUA 2G5PA 3UENA 1QRUA 1GU1A 1I33A 1YA4A 3UFXA 4CMAA 3QUSA 1O77A 2YJ6A 1O6GA 4EJSB 3VKHA 4F2PA 3W2FA 1V11A 1B93A 2AR7A 4A8JC 1B2LA 4ZVMA 4IQ0A 1CDOA 4LW8A 3K09A 1SXGA 1ZOSA 2MSKA 5LA6A 4AJHA 1QLWA 3L3BA 2IZ6A 3LYHA 4ZO8A 3WGLA 2Y1EA 3ABIA 5H68A 4TSRA 5JXJA 4CQNA 4J0DA 2ZS9A 4LYYA 4XD7A 5AM4A 3RRZA 4FYWA 3TQRA 1R1DA 2GETA 4YN3A 3P9ZA 4BLRA 2WV9A 2VS1A 5IT4A 3PKJA 3L8HA 4G8BA 3C15C 1X80B 1IRXA 2HYIC 3ZH9B 3GGOA 4BGUA 3BDIA 2KS6A 4B4VA 1AUOA 4NYIR 1I3MA 4E09A 1U3CA 4B73A 2R2AA 1X1CA 1ZWKA 2FK8A 5BN3B 2UXDB 1GSOA 3MUEA 4NNOA 1CTQA 3P2MA 4R1QA 5EQDA 3EEBA 3TMYA 1H8HA 4AG6A 3WAGA 1WV0A 4BNLA 3IKJA 4OOEA 5G02A 1FS6A 4G1MB 1NDQA 2GM5A 2I2CA 2P0EA 1PR4A 2CYAA 2A9OA 2RJNA 3DYVA 3RC9A 4F6LA 3FM9A 2WWWA 5C51B 2YV2A 4O5AA 5LKRA 1K3FA 1WCIB 3OF5A 4IRUB 5LLSA 3IHKA 2ID8A 4WL0A 4Z9FA 4C7VA 1DC6A 1RJGA 5KYWB 3BD8A 2VQFB 4RJ2A 1U0SY 5JAIA 3LT0A 4FCCA 1AKUA 4I50B 4NMLA 2RHMA 3PFCA 2OCIA 5LJIA 1QHGA 1XXHE 3FCSB 4GI2A 2GQ0A 1GTVA 5KVVA 3ITEA 4FGJA 2JGJA 1RYYA 4D2IA 1XZNA 2XNSA 2W00A 2FN4A 2H4ZA 4HN9A 4WXYB 5J5AA 3TBFA 1LSSA 4N7RA 4ZA2A 3OQNA 1YXMA 3ANYB 3ZU4A 1M54A 3OZBA 4FOOA 3W04A 3Q85A 2Q1WA 4ALJA 1UJ4A 4PV7A 3UMMA 2Z83A 1LJLA 1SVUA 2H1WA 2BC9A 2PWYA 1V37A 3O4IA 4S1OA 4LHVA 2IYSA 3A14A 4S1WA 3CRQA 4N8SA 4C7OB 3F2IA 4BMVA 3KJEA 4IQGA 2SICE 4ENSA 4JI7B 1INLA 4FFPA 4LTDA 2IHNA 1P2TA 1U9CA 2ETVA 4XLLA 3I83A 4MUKA 1R9JA 2A4MA 3H19A 2PNFA 4F4DA 5KX5A 4Q34A 2RH9B 1ULTA 3PKZA 4G07A 4KL8S 3KLBA 3PUKA 1H6DA 2IUYA 3U4AA 2VP6A 4B3FX 1OB5A 1IY8A 1NIPA 1BWPA 2OFXA 4P2BA 4YDSA 1LWNA 3TJMA 3TX2A 1Q2XA 2DM6A 4DRXB 2WR8A 4GPTA 2B7BA 1ZINA 4WEOA 2JAXA 4JLKA 9ABPA 4QRIA 3JQFC 1RBYA 4M21A 4ARZB 4QU0A 4ERXA 5G1PA 3VGPA 3GGSA 2ZYVX 3NTUA 4ZXPA 1PJ2A 5KO2A 3RVMA 3GZ4A 4C7BA 5CYOA 3ESQA 1IL0A 4UBKA 3CLSD 2ETXA 4BEJA 3D2AA 4LE0A 3RSGA 1X1QA 4BB6A 4EP1A 5AIAA 4IJ6A 2ZJ3A 3QXCA 4LGMA 3M2TA 5BWCA 4YJ2F 1O2DA 3IQXA 1F8XA 4CLHA 3DCIA 4IWYA 1YS4A 2Y92A 2OXFA 3U61B 2V3VA 2YWRA 2HSEA 1PK8A 2Q4BA 3F6RA 1T8WA 3H2ZA 4O4JB 4OXRA 1R4MA 4MAAA 5A4DA 3GLIA 3TI7A 1Y98A 1E7SA 4R9NA 4TLMB 2FMFA 1E99A 3DOOA 4QELA 1CDEA 3NBUA 3U13A 3INNA 2ORVA 1SXIA 3PT5A 2XOXA 2FQQA 1PFKA 3P7MA 1ZCBA 4U8HA 5JYEA 2JKVA 2QU7A 2GHQA 3C3JA 2MINB 1Z6YA 2H9AA 2JANA 3VR6D 1HEIA 1Z3IX 2X3FA 3Q3JB 3W78A 3FHTA 5ALQA 3A1SA 4PM4A 1CRQA 3H16A 4AXBA 5B1DA 4HJRA 3M33A 5DM60 2HA0A 3NEAA 4PG7A 4LZNA 2O14A 4F3CA 1GQSA 2ADFA 3E22B 1M2JA 4B47A 4JU8A 3TGLA 4UEKA 1K7CA 4MKFA 3ABSB 1EIZA 4PSVA 1W0CA 1N4DA 2GX6A 3LQ1A 4EPRA 1S8OA 3LP8A 4M46A 4PS0A 3LIIA 1ZN8A 5CFRA 5E95A 4H08A 2B36A 1SA0A 1WB6A 3JD4A 1E32A 2KI5A 3C3BA 2HBZA 3OJCA 1E9FA 4FR5A 4GPEA 4MIEA 3RSHA 4QX6A 3NETA 2IV7A 1LVHA 1GTZA 1JYSA 1Y1LA 4JFRA 4NJMB 4I5IA 1Y7LA 3CA8A 1QC5B 1HFEL 3ITNA 3I9OA 1IULA 4LV8B 2I1VB 1D8AA 2F43B 3C5WP 2ANCA 1T4DA 2FF7A 2ZE8A 3JYQA 3PHLA 3CUWA 5F9MA 4BQSA 4D9BA 1AKRA 2VP5A 3HSYA 5AVUA 4RXMA 2WAMA 5M04A 4LWPA 3FOBA 4MYRA 2XUGA 4DNQA 2LD4A 1U5BB 5K6AA 2H6EA 3CNQS 3LY5A 3T3GA 3FHLA 3CSUA 3E0XA 3QVLA 4YGYA 2FZLA 3C7KA 5BNFA 3VO2A 1QONA 3WQRA 3NTLA 3BQNB 4QZVA 1X7YA 1TU4A 5REQA 5LC1A 4IJ5A 3OOJA 1RWOA 3VHRA 1H94A 1YQUA 3IR6A 4IVPA 2VQ3A 1R8SA 3ISTA 4QJBA 1O8BA 4GDMA 5HQJA 3UT0A 3GROA 5HRAA 3DULA 1QRSA 3F9RA 2OE2A 4LXIA 3SJZA 4KGDA 4DW8A 4A73A 3D7MA 4YUYA 1I0IA 3PYMA 3CMMA 3LPNA 2PKQP 3NM6B 3SLKA 1SCIA 2XGJA 1B3BA 3FJOA 3ROQA 4BBZA 4DMLA 4YT2A 3KV1A 1SUAA 1WDTA 3UY4A 3M6UA 3PE3A 4MKXA 3M1AA 3C0KA 3K8YA 1MHPA 3QQPA 1IVNA 1AUXA 2BYTA 1PV1A 3N2YA 4BZZA 1CCWA 1O4WA 1VTKA 1X7ZA 2VP0A 3A04A 4JVMA 4KWHA 5KTYA 5KCMA 3IDAA 1W5EA 3ZDBA 3FCOA 2DUNA 3OQBA 2XLBA 1M2VA 4U8GA 1NQ5A 3DD5A 4HBZA 5DOZA 4BC1A 1O6ZA 2NU7A 4C1BA 1GUDA 5IZ4A 3T9EA 3SVTA 4OVKA 5H80A 4FNAA 1GM5A 4DCJA 4QOEA 1II0A 1IBMB 4QDZA 5LXTF 3TAUA 1B8UA 4DCNA 3FMFA 1P7ZA 3OEED 3SE0A 4MDEA 1Z7WA 3LC2O 2Q2OA 3AQIA 1KETA 1W9MA 3WQSB 1A71A 1JR2A 3GLHB 4OO3A 3CEAA 5BW6B 2HSDA 3UCXA 3WO0A 3ZCUA 1MU0A 4D82A 3U4DA 4JC5A 2NVUA 1JDUA 5G53C 2QTCA 3LBFA 3N2EA 4MWOA 4WASA 3OU6A 5TSDA 5CTJA 3G2OA 1KP3A 1U3WA 3ZWPA 3C3XA 3BK7A 4HDQB 4YCDA 3A25A 2CCKA 2VJAA 4ZC1A 2IUUA 4AJPA 1QF9A 4DQUA 3AJRA 4OKNA 1UJ6A 3OU7A 5A5VA 1Q50A 2FW6A 2PEZA 3QX7A 2ID9A 4QD3A 1TC1A 2ZSIA 4JLVA 3KYDB 5LJLA 3UZUA 4BZXA 4B7XA 3MWDB 4S2EA 4NZPA 4YXWD 5A06A 1GPJA 4YCLA 1WEKA 4R8SA 1XVIA 3PUIA 4B83A 4NH0A 2FX2A 2RIPA 4KHPB 3LNTA 1AF4A 2O7NA 3TZBA 5A7GA 1T10A 1NP7A 3WNBA 4CIBA 5J2TB 1KA9H 3KDSE 2O59A 2AN5A 5ULLA 1D9XA 2OFPA 4KRYA 1SXHA 2AJCA 4MTLA 2DE0X 2IH4A 4R9SA 3B3AA 2DYKA 2FX5A 1GU7A 3HKEA 2QL9A 3OP1A 4N01A 4OPMA 5LU9A 2E37A 4Z86A 1ZAYA 1JW9B 3G2PA 4BVEA 3TLEA 2AEMA 1REQB 1VQ1A 2X4GA 3OT5A 2D5AA 3UAYA 2WTXA 1XPUA 4DCMA 3GBPA 4UHEA 1KK2A 1N6RA 1PEAA 2OCPA 1RI5A 3BMXA 3L4BA 4KLNA 4BFSA 1JFTA 5HF8A 4G5HA 1IQRA 1KRXA 1I3KA 5DGXA 5TQ0B 4CV2A 4D9NA 5EJAA 1DELA 2R11A 3EIXA 3BGVA 3FB1A 1VPVA 1PX2A 1M6YA 2QP3A 1U8EA 3NWPA 4HXFB 4U39A 3Q7QA 5DX1A 2BFDA 3FJYA 3PF9A 3RVKA 4M8NE 4L4UA 5I9NA 3IUPA 1E7QA 2JFUA 1ISPA 1DBPA 2QV0A 2Y1DA 3DW1X 4UM9D 1YVDA 4B3XA 4EFKA 1P9OA 4J29A 3WY9A 3IDOA 4WBNF 1R7RA 3K2BA 1DQZA 2QJOA 1XZBA 1AZLA 3EZYA 4O3FA 1YRBA 4ZPJA 4MUIA 4BFVA 3CU5A 2Z95A 4YT5A 2ZLBA 4MVJE 2ZPTX 2Q1XA 4QSHA 4HI0E 2AI1A 2WU1A 2BI7A 3F7MA 3F5MA 1ADJA 2QVCA 3H1PA 3TL6A 2H4XA 5CNIA 5FA5A 4AECA 3F46A 2Z4TA 5AM1A 3GP5A 3EB9A 4HO1X 3SSMA 3ZZNA 3RNLA 4C2BA 3IHTA 2HHJA 1X0VA 4WV3A 3BGOS 3D59A 4YHBA 1E98A 1OKKD 2A86A 2H9YA 4FOLA 4J6FA 5H3HA 4P4SB 3BMNA 3HM2A 1BVYF 4NYIQ 3T3PB 4BFCA 3CRNA 5DNUA 1KQFA 3EQ2A 4GKVA 5GONA 3HYRA 4BC0A 3FNEA 4GQAA 3R8FA 5HIJA 5HZHA 2YOFA 3MT9A 4ESHA 3MBIA 2B98A 3VYRB 1U80A 1Y8AA 1YS6A 1Z13A 1HF3A 1F3LA 1EBUA 4JKIA 2J9GA 4FLEA 4N4AA 1NZDA 5GGXA 4HNVA 3PJRA 4ZVOA 1RXEA 1T3SA 1CUJA 2VAWA 3WZMA 4IO1A 4UD2A 2ALJA 3TUIC 1T3LA 4X20B 1JYEA 1KDRA 4QDKA 4CCWA 1XP8A 3JPYA 3U9LA 1FUKA 1G7RA 1VI5A 1KJQA 4M7OA 4FXOA 2VQ6A 2QL7A 3BH7A 4B7CA 4BNUA 1Z6PA 1P4JA 2CXHA 2CYBA 3WL7A 1A8SA 3CF0A 3MCAA 1M6NA 2QAGA 3BMCB 3VR6H 1V9CA 3SS7X 3L7MA 5JS7A 1HDIA 3C39A 1WBBA 1SD1A 4X1IA 1L7PA 2F3PA 2FEKA 2IUEA 4JT2A 5IHXA 1PG0A 3Q11A 4PPGA 3RJZA 4F9GA 5DK4A 5FX2A 4JEIA 1Z0ZA 4YIHA 1S2NA 4A6EA 5KJ6A 1NW4A 2ZRQA 2EV9A 5AKLA 1R12A 5JAHA 1ZQ1A 1NDUA 2G88A 2GUWA 3A3KA 2FLKA 3PQ4A 1FPMA 3LLMA 3RSLA 5DX0A 2QYTA 2VDUE 3JQAB 3HH8A 1NL3A 4CCSA 1PR3A 1Z47A 2EF1A 2EW1A 2PPLA 4FIDA 4MWGA 1JSRA 4TWJA 1KGDA 4OY3A 5FUXA 2DTDA 2B25A 3AF1A 3URMA 2JFWA 4HQKA 3E5NA 2QYHA 1T9GR 2KMLA 4TV9A 1ZNWA 4Y67A 2H1IA 1KEWA 1PW5A 1VCOA 4UATA 3ENNA 4HGZA 3N39C 4X54A 4QAJA 4UTRA 1VM6A 2MSLA 4FYVA 4GH5A 1X92A 2WYIA 4RV4A 1PDVA 5JS2A 2OXRA 2Q46A 4FP9A 5T8KC 3PQ7A 1K92A 3U7EB 1EUZA 2YXNA 1Q0ZA 3AR3A 2HFJA 1MXFA 2QX9A 2QTVA 3CH5A 4O4JF 3UPUA 3FBGA 2CVZA 1E1QA 5ALGA 4LXQA 1RBZA 4UQOA 4V0RA 4ZO6A 3VOSA 4BP1A 2G5TA 2QLBA 3EEYA 3GZNA 5KDDA 2C0PA 1O3YA 3IBGA 2JIDA 3SSAA 2UYYA 2JFVA 3IT0A 4RVFA 3B1FA 4X1YA 4XJXA 1QGDA 1KFBB 3HWWA 5C46F 1NJ8A 3I4CA 5EJ2A 2BJHA 2D62A 3OURA 3QLEA 2BY4A 3DJYA 4H9GA 2N1BA 4U9HS 4DR4B 3MVEA 4X71A 1A2QA 1Z4QA 4HWPA 4RH0A 1F9AA 3EXAA 4II2A 4PVDA 3ZHSA 3GC6A 2XMBA 3HXKA 3EIFA 2YJZA 1WM1A 3AEKB 2HJGA 1XP5A 3KOZA 1GNLA 2ADMA 4JEHA 2QTFA 3GD7A 1DEAA 5K0CA 4U7GA 4BUJA 5CEFA 3O2SB 2VHTA 3A7EA 1WBJB 1RYHA 1VXOA 1H2RS 3G0DA 1IEWA 3PXEA 4QTXA 1QRRA 4R7GA 5C8DA 4I99A 3AZPA 1ZHHA 3EDMA 1HQKA 2CCJA 2OLJA 3DAOA 4BEBA 3WBJA 1B76A 4CODB 2IU6A 3MMPA 3WR5A 2YOGA 1PN3A 4UJ3A 4BV3A 5IJZA 1QQBA 4GP9A 2DECA 1JRLA 1R0WA 3UGQA 1NW3A 3SNHA 4EBFA 2JK0A 2EKPA 1SAYA 4PZEA 5AJUA 1GA4A 3V4OA 1Z8DA 1C1DB 1DKMA 1J7KA 3NBAA 3OZRA 3TKYA 3FG9A 5KTMA 4A5SA 2CV1A 2ZUEA 4DIKA 3I2FA 1ZD1A 4Q4DA 5JDCC 3IKLA 1Z2AA 3C7CB 3ESDA 4MUGA 2JLCA 3OBIA 4S1PA 2ZRKA 1HQYE 4BFYA 5CIYA 1GSHA 4NE2A 4ZU1X 1I51A 3M3DA 2QT0A 4WK2B 3RUIA 2B8JA 1E6EA 2RKOA 1G9XA 2G4VA 2PZGA 3PQCA 3HDGA 4ZT6A 1OFTA 2O4UX 3L0SA 2ERCA 4YX9A 5JCZA 3R2JA 4Z4HA 2LCQA 5HKAA 1V47A 2Q4OA 2Q9BA 4HS9A 4P3OA 1FNSA 1QOPB 2HJWA 3MFQA 4WBSA 3C3WA 5C0OE 3QVJA 3ZDQA 2UXCB 2HTEA 3HADA 5L3QA 5IYZB 1G38A 4QM7A 5DGDA 4WW0A 3JX9A 2Q1UA 4R68A 4ENWA 3G2QA 1FFDA 2FPXA 4PE5B 1OLXB 4PZAA 4ED9A 3AHCA 3EH1A 1WV1A 1SEPA 1QV9A 3D4IA 3HACA 4WLNA 4C0BA 4L08A 2YWXA 3BD7A 4PQRA 3HA3A 3ZYZA 1DJPA 2IXGA 3C70A 1DTEA 4CCYA 3STHA 1PK7A 1M72A 4C3OB 3KKEA 4MNTA 5TPZA 4A1OA 1CRLA 4CM1A 5L7WA 1G59A 1V3TA 4KKVA 1QU3A 4BN4A 2QMUA 4AJKA 2GTIA 3STVA 3CLKA 3LHKA 1R8QA 2EZ9A 1WPRA 2QTGA 2DPGA 2X4LA 2R44A 4G24A 4LOLA 2PZKA 3I12A 3PHIA 5FO0A 2XCTB 1WS6A 1UFOA 2VNAA 1F4PA 3I5UA 4LZWA 4U2EA 3ANLA 4R71A 1P4AA 2NVOA 3WHIA 2IGTA 5K6RA 3EGCA 2AZTA 2OHOA 5JI3E 3U5TA 5BV1A 4ATNA 4R2IA 2G1AA 2A5LA 1N2XA 3UMGA 2SKEA 4FMCF 4P4UA 1Y6GA 4FSXA 1U11A 4LHXA 4FOTA 2G08A 4B35A 4Q18A 4YJHA 1VPLA 3LPMA 2O0JA 5AKXA 5C8YB 3RFFA 3RTBA 3ICQB 2PV7A 3B9PA 6REQA 4AN4A 3QX8A 5F3DA 4PHTA 3PIIA 4UPDA 5J4HA 4JI2B 2VJMA 3A4YA 5DYWA 2E4ZA 2P11A 4LSZA 1U8YA 4NFYA 1W1WA 6ABPA 1XDDA 1YOVB 3KZMA 5DO9A 3B5IA 4LBYA 3TMAA 4FB5A 4B46A 1QH1B 2QRGA 4RE6A 3DO6A 1AHPA 1H3FA 2YY5A 2WZDA 2DQYA 5DGHA 4AKGA 1NSTA 3ENZA 5KDLA 4RV9A 3ZE8A 1JH8A 3LPCA 3DL7A 4Y6LA 2VJOA 2O2SA 4JP8A 3JQ9C 1UBCA 5D85A 1C3OA 3I0MA 3PC6A 2EARA 2FSVA 3OECA 2WT9A 4B9AA 3BFJA 4UU8A 3TQHA 3GLGA 1WBDA 3EXG1 1YDEA 1P91A 1RPTA 1YZQA 2ZPUA 1U0FA 4TL9A 5C3UA 3ZCTA 4PX5A 4BVJA 3GG9A 1ZD3A 3GEPA 3LBIA 1R9NA 3CM0A 3OD1A 4GE3A 1E5TA 3KLMX 1SOMA 4YRQA 5ALRA 2YHIA 3MTDA 2IUFA 4BLPA 4EEXA 3K71B 4ZV7A 2WBLC 5KKNB 4FKMA 1JG4A 1KZ9A 3PC8C 3QWBA 4RA6B 3AERA 4LJKA 1XTKA 1QIDA 2OQ2A 5JVDA 3O03A 3EF1A 1F1JA 5FBRB 3T61A 4XX1A 1RPZA 3BKWA 3PDCA 4S12A 3V2IA 4M1QA 3PSHA 2DERA 2CJXA 3K96A 3PA8A 4WVFA 2M1XA 3FKQA 3IJEB 1MABB 1Q0SA 4OREX 3CUEF 3DHYA 3WLQA 1QHFA 4LK3A 3FYUC 2QV7A 2HJSA 3COVA 2Z8XA 3FSRA 3PFIA 4N82A 1BS1A 1N8SA 2CXUA 2JGMA 3QUQA 4TL8A 2BRUC 3FMGA 4IIJB 4DJTA 5IANA 1TJYA 1JFFB 2WMNB 2DFKB 2CBGA 3NT4A 3I6YA 4URZR 3X2EA 4UNIA 3R5TA 2QGZA 3HWX1 1L5HA 2W6IA 4JZKA 2VK8A 4G1UC 1PJCA 2ATCA 4JJ7A 3HKBB 1JF8A 5ICMA 2NW6A 5DI3A 4OGFA 1R0SA 3T4EA 1UXOA 4UNSA 4Z6KA 4NMWA 1FNCA 4X7MA 3LPLA 1P2SA 3BDAA 3EVNA 1GZ3A 3HCFA 1DJLA 4L3WA 1E5LA 3IT3A 2VJBA 2NADA 4A1FA 3KT3A 5L53A 5LMZA 1WXWA 2XQIA 1WXGA 3COPA 3SFVA 3N2NA 3SEAA 1LRKA 2PLWA 3DTVB 4E6EA 2FWPA 2A6PA 2HCJB 4FT2A 1XZEA 4H3KB 3RRFA 4AG3A 4ER3A 1E2PA 5LNK1 2PU5A 1WZ2A 3FWNA 5B4UA 5EYPB 1VJGA 1JKXA 4JOQA 4X84A 1Z63A 3EUFA 4GOND 2GEDA 3KB1A 3P4YA 4CIVA 1WX1A 1YCDA 1TF7A 5JQGB 8ADHA 3NASA 4FX5A 1J4AA 4GNKA 5K0FA 3RYHB 4EHNA 1RTTA 3GAMA 4G5GA 4R5MA 1IBKB 2PL9A 3FLBA 4BQPA 2H2DA 4RVGA 4V0SA 1N36B 4YFYA 2CF5A 3EUAA 3G9XA 2Q2VA 2MWMA 3OT1A 3FRIA 3O9MA 3FPKA 2IIBA 2VI5A 1Y8QA 2BGWA 2F1OA 2X8JA 3P4UA 4S1NA 3HI4A 1EE1A 5DRYA 4EB6A 1SIOA 2YWBA 4P58A 3OPVA 3U3RA 5I7WA 1EQAA 2NZ2A 5SZHB 3H5TA 3DR3A 2O8NA 4DLWA 3P26A 4PC1A 4F7DA 3DXXA 2QT9A 2QF7A 3SZOA 3U49A 3O3MB 3U81A 4WLUA 1RD4A 1XQVA 1N0HA 4MGYR 1CY0A 4ENQA 3WLRA 1TGYA 1M75A 1ISJA 2WTMA 3MJHA 4LTMA 1EXVA 1IK4A 4LWQA 2VTBB 3T3EA 4DEYA 3ANSA 5KTPA 1RZUA 3E35A 3VJKA 3WK6A 3ECSA 4JI0B 1FYXA 5ALMA 4ZVPA 2XWQA 3HCNA 3LVFO 4J4HA 3R74A 2CY0A 1EWRA 1VECA 4JIGA 5BQPA 5CD1A 2FOIA 3MS4A 5F33A 2C95A 3GFRA 1P8JA 1E1NA 3B1VA 3R5JA 4TPKA 5D8DA 4RF3A 2JGFA 4NYJR 4C5BA 2PX6A 2I2WA 2VHZA 3HBLA 3C6QA 4B31A 2PX0A 3WBKA 1NXPA 3GGGA 4PNZA 1NMZA 2CFTA 2QS9A 1VKJA 1U0RA 2QM0A 3AL3A 3M8KA 4Q15A 3WK9A 4KO4S 1SUCA 4PLZA 1K88A 2PQ0A 4TM8A 4UULA 5EWLA 4W5WA 3HKDA 4Y9RA 2HZ7A 1VHJA 2D2FA 1CUCA 1K06A 3L0IB 5CGQB 2X9GA 2PCJA 3ENWA 2XAUA 3IBSA 2DFDA 3KSMA 4C0XA 1NJ6A 4CM6A 3BZBA 3K5HA 4FDUA 5KSZA 1QPZA 1I1QB 4P2GA 1SU7A 2QRVB 3JD3A 5EIAA 2Q27A 3AYXB 3DFZA 5FWAA 4D3YA 3G7NA 3A2LA 1FLVA 3KYJB 4I55A 3ANTA 4ZRDA 3A2NA 4FBLA 1QV7A 3UWMA 5BVHB 3M5DA 4M6WB 1T0UA 1Q0LA 3CKLA 2H0AA 1U28A 3DHVA 4DLTA 2JJ8A 2IX3A 2DHRA 3JQEA 3FF1A 5T3YA 2D13A 4DSZA 1THMA 2ZRJA 3AVWA 4EJSA 821PA 8ATCA 1XWIA 2WM2A 5ABPA 3OG9A 2GBLA 3PFFA 4JR0A 4RK5A 4X64B 2YIJA 4YMTA 1SUFA 3CZPA 3HO6A 3WLLA 4IIYA 4C6TB 3SN6A 5KVAA 5MGNA 1NVEA 2OR3A 2OYRA 1SBCA 3ZXYA 1K2WA 5SYAA 1ZISA 1IHDA 4KTVE 5GZ3A 4DMMA 5F7XA 3LQFA 4GRAA 3OP4A 1EVIA 3HJCA 1XXHB 1XC7A 4FKBA 4QUGA 3ZCQA 3TRIA 5ADWA 1X80A 5KQRA 1KOGA 3PUYA 1XDZA 4E70A 3DOIA 1PSWA 3OY2A 4J1QA 4XVHA 2BGNA 2QUZA 4RPKA 5JCPA 5BN3A 4GKBA 3PPIA 1N2EA 4Z4GA 3CBGA 2JF0A 4XGIA 4A03A 5IN5A 3DPUA 2NO7A 8LDHA 1THGA 3QU7A 3EXIB 4JLBA 1NVFA 1YMQA 2AF3C 2PU7A 2R6GA 4QPCA 2MJLA 5ARDA 3RWOA 3PDWA 1E2EA 3KZVA 3HU3A 3ZE2B 1BA2A 3AINA 3JW8A 3OUTA 2NUPB 1WCIA 2PX4A 4WGFA 3TUJC 1OBCA 4DNXA 1WF3A 2EVWX 3EXFB 3RYTC 1VSQA 1Z38A 3BGWA 5KYWA 1TM1E 3W5DA 4GXQA 4Y2GA 3RJ9A 2XMCA 1GR0A 1K97A 2DFPA 3PNYA 4I50A 4OMDA 4X63A 3VV2A 2A7XA 2O3JA 3K0AB 4TV8B 4LDNA 2LKDA 4AL4A 4BE7B 4E5UA 1SQFA 2W6ZA 1Q0UA 1QVWA 2EFCB 1MB2A 3QSYA 1B8OA 2Q0HA 3HYLA 1HY3A 1X7HA 3AJEA 3FVTA 5AUNB 2ZBPA 2GBFA 5F78A 3WLTA 1QIKA 1OJLA 1L9XA 1K27A 1W1IA 2C61A 3ICOA 5LQRA 2AKEA 2YDYA 1PGPA 1ZM3A 1BOFA 1X3SA 2WRZA 1WZCA 2NMVA 1QFZA 3AHJA 3KSDO 2RGGA 4PN7A 1UQRA 2GZSA 4CYMA 3RSCA 4W7IA 1JA1A 3KK0A 1JKJB 4FW8A 5ESWA 3Q12A 5LQUA 1VL2A 1GA1A 3AUFA 3BSSA 3NHUA 4C7OA 2EJVA 5L51A 3T5BA 1JJFA 2PDAA 4ZI2A 3EZXA 1HO3A 4YP5A 1YBHA 5COBA 2VSFA 1KO5A 2PA0A 3PEUA 4NCXA 4I1OA 1JNYA 1GG9A 1P9WA 4X8OA 5C8YF 4QYWA 2AUTA 3EF3A 4ACBA 4CTJA 5BWMA 4CEIA 1QO9A 3ED5A 3DH0A 4D97A 2WABA 3K53A 3CNBA 2BR4A 4IIBA 1E20A 1UQUA 5CNJA 3ZZ1A 4ZYVA 4DE5A 3NWBA 4LSWA 4DSOA 3SG0A 3UQYS 1YC2A 1M66A 4UVGA 1B0AA 4CQLB 1E0AA 3TPZA 1Y4DE 1UJCA 1SBTA 1ZQ9A 2IK8A 3K05A 2IKQA 4LQ4A 3PVSA 2GN1A 2Z5GA 3AF5A 4U2CA 5JC8A 4LY3A 4EY4A 4F9FA 2UUCB 3M3PA 1CB7A 3S2EA 3UH1A 1PT8A 2WM9B 3NKFA 1IXRC 3D1LA 4F2WA 2B78A 1T1JA 3VR3A 2PFGA 3VNAA 2YS6A 2ZI7A 4G5FA 2H00A 1FS4A 1JFRA 1G4AE 4HAWA 4IL5A 3C98A 3DMDA 2A0YA 3RV3A 1CC1S 2GCIA 1TD1A 1GKIA 4G2TA 3UANA 3U7GA 1AB5A 2VNIA 2WUGA 4YRZA 1JXQA 1KQNA 3W06A 5CLQA 2XOKD 1TE2A 4CTKA 5BNIA 5A3RA 4FS8A 1H4TA 2FZGA 2EZTA 1E7YA 3OX3A 1GCAA 3GA0A 2PBFA 3ASVA 3C87A 4K6GA 1ZCZA 5DEOA 3WWCA 2IS1A 3QBDA 2I6GA 3MTQA 5HP4A 3IQFA 1NG1A 1SWWA 2D8AA 4HZUB 3OOWA 1ISIA 1US8B 3DKIA 5FPHA 4Z53A 5KWIA 2MINA 4AX8A 1UBUS 2VH5R 4P92A 2GI4A 1FUEA 1R0LA 3N0XA 1UZAA 4M99A 5EP1A 4K6HA 4WNCA 4D0LB 3PKIA 4YAFA 5BMVA 4R2KA 3A9VA 1LPAB 3E22A 4KQWA 1I5EA 1NLMA 2FNAA 4U2GA 4RIEA 1Y5RA 1YE3A 1B0UA 3NHMA 3DW3X 4MIKA 4C4PA 3DS8A 3DZBA 5ITWA 4UVHA 1RWBA 2FDRA 5CTAA 5IAOA 1JE1A 5KS2A 3WIBA 4CLEA 3KAPA 3RVSA 2RGRA 3ETCA 4MRRA 3U3XA 1HV8A 4CKCB 3F1KA 2DHQA 1EJBA 2OK8A 5AMXA 1M0EA 1EUYA 3DE6X 4MDFA 4RZSA 2IYPA 1TXGA 3CZQA 4YWJA 4NJMA 2X5OA 4HNAB 4OQZA 5CH8A 1QC5A 3IP6A 4FGKA 1GCGA 2CBZA 4TWZA 2F43A 4OUDB 3GRRA 1IC6A 1YRHA 2XB4A 1E9CA 2IP2A 4K8RB 4M8LA 2PZEA 3EBLA 4OU4A 1M1ZA 1FMCA 3WHLA 4GL2A 1N6LA 3HVIA 4N5IX 4FEYA 2GSWA 3RBZA 2FUNB 4DC0A 2FSUA 4YCCA 1T0BA 3IUMA 5JXWA 3BE8A 1GNPA 1GOTA 1TKCA 2AEJA 2D3TA 2WJ6A 1Z0FA 4UZEA 1U5BA 2LNDA 3ZEAA 1QJCA 2XITA 5BOVA 2VF5X 3K9GA 4XIJA 3MLAA 4LNHA 1HDRA 2RAUA 2A2ZA 2LDBA 4R8LA 1JXOA 3DFMA 3ETEA 1JAZA 5EFZA 1FDWA 1JLHA 1YB2A 5TT1A 3KT0A 4QEDA 5HFJA 3ZNPA 4PIPA 2O2YA 5EZ5A 1YRAA 4IH4A 5JQGF 4G9BA 1PLLA 3T5PA 2R0QC 3AEQB 2DBQA 3JR7A 4C07A 3KOXA 1ACJA 2B30A 2IHTA 3G7SA 4JT8A 2Q9AA 4MUJA 2OY0A 2Q6VA 2XECA 3TSZA 1LTQA 1L5ZA 2ZWVA 1MBZA 3BOSA 3N0WA 3IE2A 4HBGA 4KRXA 3PQ2A 1S4QA 5HE8A 3ZD6A 2EFYA 4NNJA 3GGCA 4BGEA 3WP1B 4CHTA 3BL8A 3DKVA 4HDCA 2CLFB 1J9GA 4RQUA 4RMJA 3LK7A 1WMBA 1YIAA 3OMWA 1MOZA 2WVAA 1N1GA 2BM0A 2HX1A 4MUMA 4Z8YA 5BUCA 1PE0A 1BOOA 3HJRA 5EJGA 3W79A 3WIDA 4CF7A 3B2NA 3LI2A 3IMGA 3O2NA 2Q1SA 2EBHX 1F2VA 4R1MA 2IF2A 4KMMA 1RHMA 1W5SA 4R8MA 3CUKA 1PCXA 3PEYA 3EOBI 1ZNXA 5E0OA 7AT1A 4ZOAA 3WMEA 5L4LA 4DIUA 4JNKA 1QHNA 1XTJA 4RIFA 4JWKA 2AG0A 3LXUX 1P7PA 1ZEMA 1WUTA 2YCLA 3NPAA 4GOLD 4LRQA 1TIBA 1OFUX 3QV1A 1NGSA 2AQHA 3SHFA 4IG4A 1IBSA 3BCHA 4XDGA 3NHKA 2WIJA 3HNOA 2E55A 3WYEA 3LTNC 4JIMA 4IEEA 2QLNA 4NOJA 5CNKA 3O8QB 2M6KA 3UWKA 2EWVA 1VCMA 1Q12A 2CLDX 4LX0A 4XM1A 3I8OA 1DBIA 4N65A 2ZIGA 4C76A 2JFQA 3FJ1A 4JI6B 1TVCA 3OZTA 4Z9YA 2BBOA 1W8DA 1E5DA 2R96A 3S1AB 1XZIA 5JDIC 4M0MA 4EECA 3M5PA 4Q4AB 2V7GA 3P9YA 1I7LA 3ADCA 4Q9IA 5IJ0B 2O2XA 3H1FA 3K73O 3MWDA 1EBBA 1G8JA 3V2HA 3H7AA 5IT5A 3T3IA 2IEZA 4IWXA 1Q0RA 1E3DA 2ZFUA 2ZI4A 4HRVA 1C5KA 1KSFX 5J2TA 1UZMA 1NV8A 3DE7X 3EW9A 2XKAA 4NYJQ 1H2BA 1I1HA 1EGQA 2QRZA 2JA2A 3D7LA 2ZUSA 2AI3A 4UMVA 2PVCA 4CTNA 3I9KA 3B82A 4J16A 4BN0A 2GYYA 1Y5LA 1REQA 3LX8A 3ZWDA 4K6MA 3CINA 5ALOA 3FCAA 1U7ZA 3AETB 1Y89A 2GAIA 2IE0A 1L5OA 3ID6C 4FR0A 3DE3X 4QOIA 3A3PA 4WHMA 3A6LA 1BXZA 2ZSAA 4GG1A 2F17A 4CR6A 2A9KA 2ZRNA 2FZKA 1EESA 3Q2IA 1CSEE 4OB8A 4D02A 3VKFA 5FI3A 2QTLA 2ZTHA 3BQMB 5D6NA 4Z0TA 3R7BA 2Q50A 1WSWA 2KBFA 4B4UA 4I1IA 1BKSB 4Z2AA 2BR3A 2R62A 4WK4B 2Q6LA 1QZXA 4MJ3A 2O2CA 1N4AA 1EXMA 1N5RA 4KNWA 3V1TC 4QUJA 2WU8A 2PX2A 1IPHA 3KKZA 3S55A 3U4HA 1ACMA 1I32A 1P6UA 3VNRA 5KVSA 2PKEA 4C6HA 1N3IA 2FVXA 1NONA 3G0BA 3ABRB 3SS9X 1SO8A 3AKCA 1GPDG 1P0IA 3E53A 4MGHA 5EZQA 1WPXA 5T6BA 5FNZA 1JHOA 1NXXA 3COWA 4DLUA 3S8EA 5AFSA 1U8TA 4D8WA 3UAZA 3M6WA 1CUEA 2HEGA 4G5XA 3DMPA 4BTLA 4YMWA 3A9SA 1SUSA 1C1XA 1NLFA 1Y80A 2J9YB 1GN8A 2WOJA 2ZAGA 4JC0A 1YH3A 3F49S 3H3JA 2O3RA 3C3YA 3DF9A 4P4SA 3BILA 3YASA 1OHHD 3AVTA 2DFNA 4RSGA 2O5EA 1KXZA 2XHZA 2C2HA 4MO2A 1Q3TA 1IXYA 2PXHA 1JVBA 2EJCA 1RYMA 4RS4A 1ODKA 2JAPA 3K0CC 4DEXA 1BH6A 3D0QA 2DUUA 1QBKC 4GLLA 1B3RA 3EHDA 4K7JA 3OFSA 4TV8F 3NP7A 1T3ZA 5IJ9B 5DBFA 5C9ZA 1E62A 2C84A 1NURA 1VBNA 5DYTA 4W1SA 1CRWG 1SKQA 4RX1A 4OYYA 1GUFA 3IULA 1DQYA 2QD2A 4Q9DA 4X20A 1XPRA 3PYXA 1ULUA 5FQNA 3QJ5A 4OI4A 4PLHA 4FJ2A 5AJXA 1NPTO 2WUFA 1K4KA 2REQA 4ERNA 3NVAA 5HUHA 2G9QA 3TD2A 1GG2A 2EBUA 3AV0B 2BEJA 3CR7A 3GH1A 3H87A 4LA4A 5FYDA 1J7JA 2FW7A 4XYBA 1JTEA 5HBGA 4UTPA 3VOAA 2R2GA 4LJ8A 2EGUA 1H5UA 4LVUA 4NESA 3HBNA 4IIVA 4IMRA 2VDLB 2BEUB 3BMCA 4EMTA 1PFGA 2ODAA 4YJGB 1LPPA 1U6IA 1GU0A 1V6AA 3QFRA 3QKWA 4TVSA 8ABPA 5IAJA 1I5RA 1LUAA 4RKWA 3MT0A 1Y3DE 1PQ4A 3IX7A 2NTJA 1VMEA 3ESYA 4ID9A 1CUHA 2G25A 2Q7OE 4OHMA 3BWMA 4F71A 2ZBFA 2W42A 1JJVA 5FBWB 1PS8A 1V5GA 1XFAA 1U7WA 1J25A 5U9CA 3AWDA 3F3SA 1XCGB 2HMYB 3EOAI 3QFTA 4G9EA 1H5QA 1I80A 2XIQA 2W43A 3P0HA 2JFXA 4PLCA 5HJ2A 4C1NA 3W4IA 1YS2X 1C7EA 1KK0A 1XHEA 3FAZA 4H1UA 3JQAA 4MS1B 1T2NA 3CJRA 4NAHA 3WIVA 3NU1A 3GEDA 2PWPA 4HDOB 4X41A 4Q66C 4DQXA 4PYMA 5KYXA 1JWLA 3CN7A 3GEIA 3OJOA 4XCQA 3WK4A 4JBNA 3VU1A 4UPVA 1K3TA 2EFHB 3CUTA 4M86A 2O1SA 4R6WA 3DE5X 1XX6A 5LQSA 4B2LA 1WUYA 4FD3A 4EIWA 1IUNA 2A1TR 4LMPA 3NFYA 4EZIA 4PW0A 5JATA 2GYUA 2V0NA 3AFMA 4M1WA 3ILVA 4EVRA 1L5LA 4Y6QA 5DCUA 3EIWA 5DCYA 2HM7A 1OW3B 2V96A 2Y05A 5A0VA 1T9ZA 1DG1G 1EHYA 4Q3AA 4WZAB 2HMVA 3SLGA 4DR5B 2P2LA 1SKUA 2DWPA 2H9IA 3GJYA 1MG0A 3G2JA 1DJMA 1RRKA 1VKZA 4TSKA 3PHGA 4JBGA 1D4ZA 2ZANA 2PRIA 3BXFA 4UHDA 1GZ6A 4NEQA 3DB1A 3ZVNA 1OB2A 4YIKA 3DM9B 1RAEA 1A27A 2WJPA 3LUCA 2FETA 1QO7A 1ZPDA 1FOEB 2CYCA 2QG9A 3AEKA 2O20A 3G5UA 3K35A 4RHFA 5JZSA 1T1GA 4M4SA 2G4CA 5JALA 1DAHA 2WF9A 2CHEA 1ZU5A 1XI2A 5T64A 3HB5X 1TVKA 4BV9A 2I71A 1U5AA 2E4XA 1QNFA 1KI1A 5FPQA 1UOPA 3NBKA 1B6RA 1CR2A 5DNVA 4EY8A 2M6RA 1HG0A 3PU6A 1B26A 1FVXA 2NTNA 2Z2ZA 2GFHA 3U3DA 4C0QC 5AW7A 2O0KA 4IDFA 5JWOA 5JZMA 4RY9A 5CBPA 3F47A 3VISA 2IHZA 3B7PA 3F6YA 3OKCA 1NJGA 1TO1E 3HN7A 5CJ2A 3Q1KA 2CHFA 5FUMA 4TVBA 3TFWA 1Z62A 2QVBA 2F2TA 1FSSA 1GP2A 3GWGA 3HU2A 1EK2A 3LY7A 3V7UA 4YMVA 4MH0R 1QF7A 2OZLA 2I3BA 1F5SA 3LRTA 4ZOLB 3JY6A 5KQGA 4C04A 4OI0A 4HUQB 5I8ZA 4BFLA 3W5VA 3QF4B 2DT8A 3N58A 3WRXC 3A3YA 5KDOA 1YDHA 2FE4A 3A6HA 5ALWA 2Z6AA 3SZLA 4GI1A 2FR0A 3DFFA 3F0TA 3LWZA 3MJRA 4LBZA 4QGAA 3RIEA 4ZK6A 4G0NA 3HGQA 1KS9A 2ZROA 4JH0A 3ZJYA 4EG5A 5AVRA 3CG0A 1OX6A 2C94A 5ED0A 5IYZA 2PH1A 4ITRC 3L0YA 1QTRA 1PFUA 2ZSUA 1JAIA 1UOQA 4HK4A 3HPRA 1OLXA 4AO6A 3B89A 5DNCA 2BGUA 2CB0A 1U6KA 4LYJA 1E8NA 5B3LA 1BDHA 1Y1KE 4M8KA 5JAPA 1N7IA 3IEMA 4LRYA 3L1IA 4QPJC 4NCHA 3CEJA 4MR7B 1RWWA 3QE3A 5EHNA 1AQLA 3TDKA 3ANMA 1MA3A 2G4LA 3ZQKA 5F76A 1E3TA 4RK7A 4AC9A 1E2HA 2HA3A 4QDOA 4Z49A 4Z4FA 2WSBA 3S6JA 3FUXA 1YB6A 7MDHA 1M6EX 1SVOA 4O2AB 1P9LA 3U60B 3EQ8A 1MF7A 3FI0A 1NBHA 3JZMA 5FWNA 2J5RA 3TLMA 4BNWA 4BASA 1S2DA 3FWYA 3BQ9A 5JAZA 1L8AA 2R00A 4AB1A 1N2SA 4I8DA 4WFJA 1JR6A 3PWSA 3N28A 5K99A 3BORA 3CYFA 1NRJB 4Q00A 4YUAA 1XNRB 3O4VA 1A9TA 3OFJA 5ECDA 1CFJA 4GPZA 1JP7A 2IKSA 3FZEA 3G02A 4LVOA 4X3PA 1NQXA 3DE4X 5EXTA 3R7FA 4ZDKA 2DUJA 1XRSB 1XNJA 3FLEA 5HVNA 2J7PA 3U6BA 2ZZMA 1QX4A 3NAZA 2GA9A 2QTWB 1AV6A 4B84A 3UA3A 1SN7A 5THQA 5C8YA 3SKXA 3INGA 5DM1A 2EG5A 1CW2B 1YZVA 2JLUA 2PG3A 3B7GA 5IKEA 2AN4A 3IVRA 3UHOA 1ZVJA 3MGGA 2A84A 1QH1A 2Z4SA 1IXZA 5KAPA 4HY3A 3ZHQA 4DILA 3C5CA 4H60A 4AKIA 3TJRA 1CLUA 1T43A 4XI9A 2JCBA 3BREA 5K0ZA 2X1LA 2GTPA 3PVCA 3DB2A 1PSDA 3PENA 4RAQA 4RMGA 4NC9A 2JH9A 3HA2A 2H7VA 4Z9BA 4US1R 4P36A 3WYCA 1FFGA 4Z4IA 1EX6A 4JHXA 4DRXA 2VJQA 4DLNA 5BV0A 4D0GA 1QP4A 1Z5ZA 4KQGA 3VKVA 2P3OA 3OE4A 3UGJA 2PUJA 4IOJA 4EKYA 5T4EA 1Z0JA 3BCSA 3Q6NA 4RA6A 3UIEA 3UJNA 1LLCA 2G77B 5FBHA 5FF9A 5HE9A 2VA8A 4H1TA 5AI4A 5B58T 5A9SB 4X8HA 1U1GA 1RXSA 2OSVA 3JQBC 5JPDA 1BJRE 2HMTA 3RPEA 2LKCA 4EPYA 3PX3A 1KRHA 3DVSX 2COKA 3R3XA 4H7IA 4HWGA 4O0MA 3Q40A 2A7QA 1IY9A 2CUKA 1KYIA 5DP1A 4F7WA 4KPEC 1UR5A 1MABA 2J0VA 2R8YA 3WG9A 1UXKA 1E66A 3HSSA 3OIVA 3P5BA 3W9SA 4JJFA 2BD0A 4HXEB 4X1KA 2JJQA 2B8EA 1LW6E 1D4OA 1NBIA 4WXRA 1IDOA 1GL3A 4IIJA 1JFFA 1XMXA 1P0PA 3EQ9A 4NABA 4U7JA 2WM3A 5EMHA 1UBEA 1V26A 1PVVA 2SNIE 3OQVA 4CQMD 4MINA 4P5PA 4FQ5A 2A5JA 4QXAA 3HKBA 5C7YA 3BGSA 2PGIA 5HIAA 5JTUA 1TEZA 2YQ5A 2RGWA 5M3BA 5NULA 1VHDA 4K5QA 4P81A 4H18A 3KR1A 1L4BA 4MWEA 2ZYIA 1DJQA 1Z5VA 1JSCA 1UPTA 3F98A 5DZSA 1E3WB 1N2CE 2Y1XA 5F51A 1L1FA 3U39A 3V8MA 3PFGA 4C6SA 1APBA 1W46A 1KJWA 5ESDA 3WRYA 5DHSA 5B3JC 1W25A 5H81A 1R6AA 1CJBA 2OLEA 3OC6A 3SEZA 3T9FA 1DCFA 4JZYA 2P4QA 2HTFA 1MW9X 5DN6D 3AM1A 5AK0A 2XGSA 2BIFA 3PR3A 5J43A 1USIA 2I9KA 4V24A 4D4GA 2C07A 4F1WA 2HWWA 3H86A 1L4GA 4KR6A 5DHPA 3KD2A 2OL4A 1GGFA 4LJLA 2C7VA 3LSYA 4MYDA 3LDUA 3IGFA 1CVLA 5EYPA 2ZUVA 1AZWA 3TKAA 4ENUA 1Y7HA 3O1IC 1JHDA 1JV2B 3TLYA 1SUPA 1PVDA 3AFOA 4RM3A 2R6HA 4JK3A 4L3VA 4Z5XA 1KU0A 1Y4SA 4MW7A 3TQCA 4XJTA 3GPLA 4O4IB 4EJ6A 5ECWA 2PR2A 5JECA 3RYHA 4A9AA 1M1UA 2FZCA 2OAGA 3UYLA 2H1OA 1VI2A 5K5EA 2AZ4A 1BGXT 5FKJA 1BQ4A 3RFVA 3BBLA 2ZSBA 5EN4A 3AFGA 3Q15C 4J3NA 4UHBA 4CV0A 2VT6A 2NO5A 2C5GA 3QPWA 5KUTA 1EA5A 2EWMA 1RRPA 1CRZA 4LWOA 5E4FA 2A5GA 5K3FB 4HAXA 4RPHA 3C5HA 4JLMA 3O91A 4NLLA 3T8YA 1SVLA 1TJ5A 1IPEA 2GNAA 3TMKA 3ZWVA 4DBLE 1TADA 3GUYA 3GLFB 4HATA 1H1DA 5E1MA 1DXHA 1GIAA 3ASYA 4LNAA 5JJIA 3WTBA 4LCEA 3UUGA 3WGMA 2BM8A 2VTBA 1J90A 2XT9A 1A50B 4RL4A 4TKZA 3KR0A 3PI7A 3O8BA 3KUDA 3GFPA 4GU5A 4I4TB 4NMMA 4A2PA 2OQRA 3CX4A 5F23A 1SHJA 3ZV7A 1QRAA 1YKSA 4UARA 5FWYB 1UFKA 4P98A 3ICWA 1IHOA 1EH5A 4FYHA 4BO4A 5I7HA 5HCNA 5K8TA 1EFAA 1QSGA 3NV9A 3FE2A 2IEBA 1XJQA 1YS1X 3V4RA 1X3LA 2VSYA 4LJ5A 3Q6IA 5HEKA 5MDHA 2LIVA 2YN0A 1XLVA 3JTMA 4YJFB 3OZFA 2PTGA 4MPTA 4PAMA 1RRMA 3IV6A 1H6CA 4A4DA 5KQSA 2DWCA 5JNTA 3MFYA 4GFDA 1VIDA 3AKEA 1TMKA 2VDKB 3PRJA 3RVBA 3L4KA 3FMIA 4OX9B 1GYQA 4MPRA 1X8LA 4RXUA 3UTDA 5B1EA 2GK7A 3G1WA 4F4HA 5C4IA 4V1CB 2XUFA 4MB0A 1W48A 4MVJI 2G9NA 3KTOA 3Q3GE 4PX9A 1KI6B 1XJ5A 1AM4D 3OLVA 1XK7A 1UJ2A 1HT2E 4M38A 2O8CB 3HMQA 5G0UA 1S02A 4J4BA 4AKEA 4F4FA 1JHAA 5JLAA 3H2SA 1YZLA 2QRVA 3D8SA 4CUJA 4UNPA 5IFLA 1DFIA 1T3HA 3CN9A 1UMBB 4DDWA 4L50A 5HXAA 3DWIA 4Z9AA 3V1UA 5JG7A 5L6LB 3DWFA 4M6WA 2PYIA 2Y4NA 3KAKA 5HS6A 4B87A 4EVQA 4PRYA 4A8PA 4NEHB 4QGGA 3AR8A 2AOXA 2IEIA 3DZHA 3PRKE 4IMJB 3EZFA 2NGRA 3QELB 4NZMA 3KPUA 1SBIA 3FDXA 3L0OA 4TKMA 5EA2A 1ADGA 1JNXX 2W9XA 1KZHA 1UKEA 5F1PA 4BWYA 2ZVPX 4JYBA 4ZICA 1UIRA 2GZMA 2XTJA 1U99A 4XLZA 2G9VA 4WOCA 2UXBB 2XXBA 3D4PA 4GUDA 4JJGA 1HZZA 1N2JA 3B5EA 5HMLA 4PSKA 3B8HA 4RWZA 1V1JA 1RJ9B 2F3SA 4CBVA 1XXHA 5JCXA 3KEGA 1P33A 2I6FA 5DM2A 3KTDA 2XUAA 3V4ZA 3LF2A 4LV5B 3ZY3A 2J3DA 1GADO 4I3HA 5FLEX 3PC3A 3IOBA 3U40A 4U02A 1T5HX 2UKDA 1XDGA 2XCUA 2FN7A 1I7NA 5KQPA 1C9JA 1IUOA 5MN4A 5CCXA 4H4EA 2N9UA 1C41A 4HFNA 4LDZA 4GE0A 1A8UA 3EXIA 5EKUA 2VCYA 2W2KB 4RESA 3VZRA 2P35A 2IYEA 1SY7A 1UEIA 2AOVA 2XE7A 2ZAIA 1IG3A 3LHFA 3QVTA 1K08A 5I7AA 2D4HA 4DLLA 2CWDA 4EZBA 1BDIA 1LLDA 1VE6A 3PLRA 3OO0A 3MEQA 3MMXA 1AXEA 2LCFA 2NUPA 1JA9A 4ALLA 5ICSA 1I7SB 4PQEA 3EXFA 1GAQA 3F74A 2PLRA 1S2IA 4HJXA 3SYMA 3V9AA 3JYLA 2HCFA 1U7UA 4BN5A 5IZCC 3HM9A 4EHAA 4YCJA 2WHRA 2DBYA 3A28A 2YV1A 1DDGA 3K0AA 1WCWA 3SIPA 3TZKA 3E58A 3H42B 4UBMA 1G1MA 1V1RB 4O2AF 4BS9A 4EHLA 4TROA 1BFKA 2WQ6A 4UW9A 3RDPA 3TSCA 4NDZA 4IV5A 1JJAA 3VR6A 4JKOA 4DTIA 2JS7A 4KO1S 5JROA 3LYLA 3RLIA 1M7GA 1M6WA 1Z36A 4ZU6X 1JKJA 1KHHA 1QYRA 2V6BA 2W2MA 1EEHA 2FJPA 3EIHA 5DLYA 4D4IA 1UBHS 2QLMA 5C5EA 5CXUA 4K03A 2Q3MA 3Q8KA 1WMEA 2PANA 3AJ8A 4E33A 1NY6A 1MVOA 1E0JA 4WK6A 1J9ZA 4FGUA 2HK7A 1EP9A 2B61A 1OPXA 3EBPA 2OBFA 1QGED 4QOGA 4X0EA 3GRKA 4OLJA 3WQHA 5LYJB 1GUAA 2QQ0A 1OWNA 3GFTA 2FPPA 1XL0A 2QTHA 2VPZA 3GEBA 4ND7A 4OEHA 4UCXA 4HDNB 2A9QA 3MT7A 3UHPA 2G7MC 3IIEA 4CQLA 3T1HB 1QAQA 1RQ7A 4O4LF 3PYLA 5IDVA 1YBVA 1AN0A 5FPPA 3ICVA 5FP0A 4LFCB 4RUKA 4ZAVA 1HX7A 3HUFA 2VAXA 5EKTA 3GP8A 4LBWA 5LP6B 1FRFS 2FA9A 2YJ3A 4RD6A 1YDGA 2NO6A 5H83A 2V3CC 3K0KA 4PHFA 4YI5A 2DBRA