4YQEA

Crystal structure of e. coli wrba in complex with benzoquinone
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
197
structure length
185
Chain Sequence
b'AKVLVLYYSYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGKTQTAPVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGTGGGQEQTITSTWTTLAHHGMVIVPIGYAGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKLNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD(P)H dehydrogenase (quinone)
publication title Quantum Calculations Indicate Effective Electron Transfer between FMN and Benzoquinone in a New Crystal Structure of Escherichia coli WrbA.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Oxidoreductase
total genus 63
structure length 185
sequence length 197
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4yqeA00
2QMYA 3EYWA 1OBVA 2V5UA 3ESZA 1T0IA 4N65A 3SVLA 1DXOA 1E5DA 3TZBA 1CZOA 2V9CA 2FOXA 4QOIA 1AKRA 1CZLA 2Z98A 4QOJA 1J8QA 2XOEA 1FTGA 3EDOA 2ARKA 5LMCA 4FGJA 3QE2A 1AKUA 4DILA 3OJWA 4QODA 5LBTA 1C7FA 5F51A 5LVAA 3U7RA 4ZVNA 5LLDA 3FX2A 3NHSA 3RPEA 4N82A 3ES9A 4U7FA 3W7AA 3D7NA 1RLJA 3GAMA 2N1MA 1BVYF 2BPOA 5F4BA 4DY4A 3F6SA 3LT5A 3OWXA 3HR4A 4GR9A 4FX2A 4ZVMA 3GFRA 4J8PA 2FZVA 4YAOA 4F8YA 4QOGA 4H6PA 1YOBA 1X77A 3W77A 2GSWA 2W5UA 2FX2A 3NHFA 1BU5A 2Q9UA 3O73A 1SG0A 2FLVA 3HA2A 3TE7A 2MOKA 1H66A 2Z9DA 5LJLA 3B6IA 2R97A 5FX2A 4QOEA 3KEGA 1YDGA 3LCMA 2B3DA 1AKTA 1XT6A 4XDHA 3HLYA 1KBQA 4OXXA 4Y7CA 5TGZA 3FNIA 3NHYA 3NHKA 4C0WA 1I1OA 3G5MA 1D03A 1JA0A 1YCHA 2FAXA 3B6KA 3OX3A 2WC1A 1RLIA 4H2DA 1H69A 1JA1A 4FGKA 1C7EA 3OJXA 4ZVLA 2FZ5A 4C14A 2OHJA 4PTYA 1OFVA 2Z9CA 4PTZA 3ESXA 4BMPB 3N3AC 1FUEA 1WSWA 3NHPA 2MTBA 2F1OA 3N39C 3K20A 2A5LA 1ZWKA 1RTTA 3R6WA 3B6JA 1TLLA 5NLLA 3W79A 2MWMA 4XDGA 1CZRA 2OHIA 3ESYA 2HNBA 1FLNA 1AKWA 3JSXA 3B6MA 1YKGA 3GFQA 5F12A 3FVWA 5A4KA 3KLBA 1AKVA 4C76A 4M0CA 1FVXA 1D04A 4LTDA 4HEQA 3NHLA 1AZLA 5FA6A 2FVXA 3NHUA 5LBUA 1DX9A 4GI5A 4QOHA 2M6SA 3NHWA 4NULA 1CZNA 5ULLA 3L9XA 3ZHOA 2HPVA 4YQEA 2OYSA 1QRDA 1FLAA 3FJOA 1QHEA 1FLVA 2QX9A 2X2OA 1RCFA 4QOFA 3L9WA 3OX2A 3W78A 4NLLA 4U7HA 1ZWLA 3OVMA 2R96A 4ZVKA 5FUQA 1CZKA 2D5IA 1OBOA 4HS4A 5JROA 4GQIA 3NHJA 5B3LA 1CZHA 1XI2A 4LAFA 3OWHA 3KAQA 4YALA 1QBGA 1J9GA 4Y9RA 1DXQA 1TIKA 2XODA 2AMJA 5BUCA 5EMNA 2QX6A 1F4PA 3FW1A 2RG1A 2BN4A 2OHHA 2MT9A 4ESEA 1XYYA 1WSBA 3S2YA 2BMVA 3OX1A 3QFRA 2V5VA 2QMZA 1KBOA 4S24A 3KAPA 1YRHA 3F6RA 1D4AA 1XYVA 1T5BA 1FLDA 4Y9UA 5NULA 2FCRA 2QX4A 1AKQA 1YCFA 3NFRA 5LJIA 1ZX1A 2Q62A 4YAWA 1J9EA 2KLBA 3NHRA 1FX1A 5EAIA 3N3BC 1CZUA 5B3KA 4PU0A 1VMEA 2HNAA 1YCGA 1B1CA 2ZKIA 4LA4A 1NNI1 3F90A 3F2VA 2M6RA 1GG5A 1QR2A 4YAFA 2Z9BA 3GFSA 4BMOB 6NULA 4DIKA 3UXHA 4LTMA 4CF6A 2QWXA 3UXEA 4U7GA 3U7IA 3TEMA 2BF4A 3QFCA 4C0XA 1AMOA 1AG9A 2BZSA 4D02A 4CETA 2QX8A 2X2PA 4R81A 4N9QA 1AHNA 4YAUA 2KQUA 5EA2A 4ICIA 1SQSA 2FDXA 2QR2A 3O2NA 3K1YA 3NLLA 3P0RA 1V4BA 4FGLA 4LTNA 1J9ZA
chains in the Genus database with same CATH superfamily
3BVPA 4FK8A 5TQ0B 3R7BA 1UF9A 4HFJA 3VHXA 4V24A 1RRMA 1XMSA 1C8VB 5C0OE 1P0MA 3PQ4A 4E6EA 4BLSA 2JAXA 1JLRA 1W36B 1OJ7A 4BO8A 3ZHVA 1C0KA 1OV6A 1WNFA 2CJXA 2C2WA 2VTBB 1ESNA 3U7FB 2XF8A 4YRFA 1AGPA 2QF7A 1P9LA 2VK1A 5KC8A 1GSOA 3F7TA 3HXPA 4MV4A 1UBKS 2V9CA 4QATA 4RKWA 3KQSA 4ALIA 3IMFA 3F73A 3SYTA 3VKGA 2VDLB 3K53A 3QH4A 3UMFA 4YXWD 2AD5A 2QNBA 3ONVA 5GONF 2BFNA 2E4XA 5AI6A 3GD5A 1GPAA 1AQYA 3Q9UA 1ODKA 1FTGA 1Y8AA 1DVRA 3BIWA 3AG6A 3VBCA 2Z43A 3SWWA 1B8NA 4QM6A 3E35A 3ZCQA 5DKFA 4QWWA 4YK7A 1RQNA 3HJUA 2PDAA 4C7VA 3OBIA 3CU5A 2W2QA 5FQNA 3E22A 2CNLA 3WB1A 4WVLA 2XE4A 2J67A 3AERB 1WULS 5EXTA 1F6DA 4CLXA 4F6RB 2NSJA 3FTCA 4JVSB 1NMEA 1PR6A 3EXFB 5BSEA 3MA0A 1U3WA 2ZJ3A 4OIFA 2FQQA 5BSMA 1VJCA 4UU0A 2FZWA 3AR8A 1M67A 2BD0A 3AVTA 1SHJA 2R8XA 1JFFB 1MOZA 2O7SA 1QHIA 1MUUA 5JYEA 3HCWA 1UIMA 2O48X 3M9XA 4BVKA 5H8WA 4HDAA 5DIFA 2QQGA 3LBAA 1TKRA 4H18A 5KYXA 3ELUA 1REQA 3UUWA 2QRZA 1E79A 1LLQA 5CB4A 3LUAA 4C88A 3VOBA 3R75A 4R1UA 4XJTA 1P2TA 3F74A 1QS0B 5D1NA 2HRZA 4DA8A 1U8EA 2ZVPX 2ETXA 1O0SA 3N2KA 3NBFA 3A8TA 1WXGA 5JDIA 4CL3A 3T6KA 1RWPA 4YMHA 4L73A 3DHNA 1IZYA 3IAM6 1CUJA 1LQ2A 5AYVA 1UKEA 3TLJA 5EHNA 3OE1A 5AKZA 2YHIA 4ZZ3A 621PA 2ZETA 1T3ZA 3M6WA 2Q7DA 2V0GA 3ZD6A 2IHVA 2HGSA 5FI3A 3LVQE 4MHOA 4HDKA 4BQFA 1HKHA 5KSZA 2B9EA 1ZAYA 1TMOA 5L7TA 5CW2A 4QEDA 4CMIA 3U6BA 3P45A 2C94A 3I30X 1ZN9A 1BKDR 1J2UA 4KLZA 2OYCA 3ESCA 1HG0A 3CF4A 4AKSA 3EPPA 2I4IA 1RIFA 1Q14A 5AVOA 1JEYA 4MUAA 1OCEA 3CO5A 4HH1A 2P41A 2HIHA 3W2HA 3EBOA 4JD5A 1CR6A 3AF1A 3ENNA 4CF3A 4DVGA 2PX0A 1T35A 1PR3A 5ELMA 3SSOA 1OHHD 2C3UA 5HZMA 4RACA 4CMAA 2PT5A 3BFXA 5SY4A 1ZOLA 3ZU4A 2RIPA 3V1MA 1AHIA 4U2GA 3P32A 3V2HA 2JLSA 3LDFA 1DIBA 2J09A 3AOEC 4LYAA 1JI3A 2E0IA 3Q3JB 4TMXA 4C04A 2F62A 1JG7A 2PA0A 4AIIA 2JHFA 5SY6A 2E4AA 1DG9A 1NMQA 4R2WA 5DTIA 1OX5A 1AKTA 2YJZA 4U2BA 5F23A 5IAOA 4EY5A 1Q1GA 4OXXA 5ALIA 1ST3A 2UZ3A 1AUPA 2O2YA 3QMVA 5F33A 3A2KA 2PQMA 3LG2A 3NCTA 3R7AA 2BDEA 1QTNA 3IRUA 3JQ9C 4O8ZA 3Q5EA 4M0PA 4S05A 2XSZA 1A82A 3Q7SA 4UOEA 3K7EA 2WKSA 1D07A 1N5MA 1YR9A 1ND5A 1ZGZA 2FPGB 3Q1KA 1MAVA 1BVRA 2RHDA 3BCHA 3ITDA 3IVMA 4KIGA 4BNLA 1AJEA 5CIWA 4WK6A 5GJCA 1UJ2A 4FNGA 2BFAA 1V26A 1BRMA 5BWNA 1TVEA 1WABA 4X65B 3DUFB 1A9TA 3L4BA 3MTIA 4REQA 6REQA 3NH6A 3DDOA 3EXIA 4QUEA 4OQFA 3AB3A 4RHFA 4JEMA 1JX6A 4WOBA 3INTA 3C4QA 2M6KA 5KOIA 4MWSA 1WVGA 3PKIA 3B6EA 5E8JA 1MW9X 3KR2A 2OXRA 5DLYA 4BV9A 5HSGA 2H7VA 1P7CA 2G36A 3PC8C 3E9EA 2G83A 4IJUA 2BGWA 4U7PB 5BPFA 3BM5A 1A76A 4LXXA 3UWPA 3ROQA 3D3KA 1CC1S 3QMPA 5AOCA 2X0JA 2B25A 3D6FA 2BBSA 4FJ0A 2AQKA 2AE2A 3TB4A 3UA3A 2PX6A 4NMXB 4OG2A 4CNBA 2RAVA 1K7FB 3T52A 3KL4A 5HJ2A 4DCSA 3L1KA 3IDFA 3QNWA 5MGNA 2B2CA 5DNYB 1CUVA 2P4HX 3HYTA 4HGZA 5CPFA 1B43A 2Q5FA 3A6FA 1OIVA 3P9PA 1QUEA 4CN8A 5DM70 2K2WA 4XDGA 4U8HA 3EW7A 4M1ZA 5FA5A 1NVEA 2ZG6A 3V6LA 1AM4D 3IJPA 4NE9A 2HCRA 4ASUD 1U0RA 2QD2A 3DQPA 3D8BA 1NG9A 2HMAA 3KALA 2W71A 2CB9A 2ZRHA 3BGOS 4IQ4A 3CCBA 4AUEA 2Q21A 1M75A 2NT4A 1E2FA 2R6JA 1YC2A 4JASB 1THGA 821PA 4D8XA 5E9WA 3NWJA 2F8SA 2ZPUA 2H51A 1MQ8B 4RMJA 2GVDC 4EUNA 5B64A 1U0OC 5JV5A 2GM5A 1AKWA 1G6KA 1NQVA 2WBLC 4UXIA 3ASYA 3MLBA 1YI1A 3HUEA 1BXZA 3UFXB 4YROA 4EYSA 1ZHOA 1PKXA 4YR7A 3AUFA 1KEWA 3D4NA 4OHWA 5LZ4A 1T4CA 2ORED 2PVSA 1ZXXA 4AT1A 3OP1A 4PSAA 1O77A 3PWKA 4IILA 4PO8A 1WXWA 3GPBA 5L7WA 4W4TA 1BW9A 1ZBDA 3LDUA 1B0AA 1K2WA 3AKCA 2HU7A 3MHPA 1KJZA 4PCAA 2VDUE 2VT2A 1MP0A 4MNTA 2ZP1A 4N5DA 1S1CA 1Z82A 4S1TA 4F9GA 3T4XA 5IJZA 1OT3A 2QN9A 1W73A 1LJ8A 5ALOA 2NOAA 2LIPA 1KMHB 3TW6A 1Y5NA 1MAHA 3UJNA 5IUNC 2NQ2C 4BJ1A 4C4OA 5FADA 5FI1B 1OI7A 1W88B 1L5YA 1RLOA 4Q9AA 4DPKA 1OVMA 2C7VA 2AK2A 2QU7A 4OHYA 3ZEIA 3TSWA 4X94A 1BQEA 2C2XA 3OZTA 3HI4A 1Q91A 4A8JC 4RLFA 1X6VA 2RH8A 3PITA 1HDIA 3OT1A 4PYQA 4ZPJA 10MHA 4RW0A 1YTLA 4KFCA 2L0XA 5KYVA 3I23A 4FBLA 4L4YA 4OJYA 1T9AA 3OKFA 3VGPA 2IS1A 4KIJA 1CZNA 4GSYA 3ZWCA 2YXBA 2C9YA 3ED1A 2PUWA 1GLNA 4YT2A 2CY0A 1FVHA 4W5NA 5CFOA 4XWWA 1DBSA 1W8IA 2NUPA 5DW0A 3QEAZ 2COUA 4LJKA 3P52A 1RWKA 4G4IA 4V3BA 1K7CA 1ZVJA 2HW8A 3NXKA 4ISBA 3EB9A 3IVXA 2B83A 1RKBA 2ONCA 4M6WA 4MRVA 3UV3A 2SKDA 4V0KA 2XUPA 1AN9A 2HQ1A 4ER6A 2BGRA 1SPXA 3DHWC 3DL0A 4QDKA 1YD7A 2Y1OA 2PRYA 1X9GA 3KVYA 3WG9A 4GI1A 3UB4A 1Z5VA 4ATNA 1RWWA 3FTDA 4OY3A 4FCVA 4F96A 3EGEA 2FUG6 2QTFA 2I91A 4JP3A 4FEGA 4L85A 1FNDA 2P9CA 2RGNC 1GT91 4YV7A 1NXQA 4OKIA 1NXVA 2Q5OA 4LY6A 1IMOA 1IQRA 5ALPA 5L3VA 1VI5A 2ZBPA 1GRQA 1YS9A 2EFJA 2WSBA 3MGGA 3QFHA 4IW3B 5KVSA 4ZQCB 1SOWA 3RUEA 3EXG2 3ER6A 4GWLA 3QV2A 4E11A 2FG6C 4HS4A 1KZ1A 2RHHA 4FVTA 2IBSA 1KYIA 1LH0A 1XLTC 3TOXA 4BDTA 3BMOB 4M7WA 4MQ4A 1FW8A 1ZH6A 2C54A 3IUEA 3EODA 3L1IA 3MD0A 3KB8A 4C29A 5KKAA 4P80A 4E5VA 3EUEA 4ER3A 4L22A 1NQUA 4TWZA 5FF9A 4LMBA 3MPUA 4Q4AB 1EDZA 2BCEA 1C1YA 1YIOA 1L4NA 2CLOB 2FN3A 1MIHA 4W1RA 2OL4A 3UJPA 2CNOA 3A6HA 4AYXA 5JT1A 1X7YA 3IIEA 3NX4A 3MILA 3ZKWB 3B3AA 3OMLA 3P4UA 3R5XA 2RSLA 3JTEA 2HUPA 1POXA 5F77A 1QC5A 1T4MA 4RDCA 3ZE2B 2ZBGA 3DFUA 3EAQA 3I6YA 4ETWA 5JYCA 2QX6A 3EEFA 3TIXB 4K26A 4RXTA 1YL6A 2BZ0A 3PS9A 4JJKA 3AEUB 3NVKI 4ZWNA 1MX1A 2OHHA 2ZBRA 4PSDA 3G9TA 3VDNB 1UXJA 2AJ8A 2B1JA 3D4LA 4DXDA 5DWQA 2J3JA 3ID6C 1Z8FA 1B26A 4IHJF 3CN9A 4OLFA 3R7NA 1K68A 4PRKA 2UUBB 2ZRCA 2ZIGA 1KNQA 1V47A 5HFJA 4YT8A 1DC4A 3U4GA 4DV3B 1FFGA 2Q5QA 1DBVO 2EX1A 3NM4A 5FDFA 4RAOA 3B1WA 5BVGA 3RFXA 3FZGA 5HUJA 4LV5B 4JLAA 3KKQA 1VE9A 5E0KB 5LLSA 3WHKA 4ZAFA 3WWPA 1SCJA 4PFKA 4XWKA 4RSRA 3UVEA 3FI9A 2NSHA 2Q46A 1JUDA 4UU7A 1BG6A 3HKDB 2Z5GA 3ELBA 1WD5A 2JFPA 1NMYA 3MWKA 4QUGA 1MJFA 1PJZA 4D99A 2Z4RA 5KDOA 1AXGA 3QA9A 1X80A 5BYKA 2Y66A 3QY9A 4EHFA 1H6AA 1SHLA 2GTHA 1J24A 3HYNA 3LBFA 3LL7A 2JF0A 4XUCA 5ENDA 3DD5A 4MYSA 5C1IA 1W5AA 4FMDB 3IMEA 1SXGA 4OHRA 2ZS9A 4YPFA 3RS7A 4ALMA 1C30B 1YV9A 4UVHA 3LY9A 1XD8A 3U4AA 3VZDA 2DHCA 4JZKA 4RZUA 2AI3A 5KNCA 1Y8ZA 3ABSB 1YCFA 5EMKA 4DV7B 4ZV9A 2I66A 3IP5A 1FFXA 4X8HA 5IJAA 2OG1A 3ET5A 1YQUA 3FZQA 5B58T 4DWWA 4KQKA 5AP9A 2KLBA 3GLGA 2AUMA 2IEIA 3VH4A 4Q00A 2QRGA 2J7PA 4URWR 3VNQA 1VCNA 4NCAA 4N54A 1HDOA 4IV5A 1CS0A 4EIWA 3DDWA 5JAMA 5JZMA 1XEAA 1RC0A 1UBCA 3N86A 5IYZA 5E4JA 1S89A 2VAPA 3RODA 1JXOA 1EDOA 3DEFA 5CNIA 3RFVA 4HDMB 5BVHB 5CPBA 3HUUA 4YY3B 1DDIA 1AQLA 3I6MA 3KYDA 4HN4B 1NVMB 4IUYA 5E6SA 2HH9A 4KAFA 4DMKA 1LD3A 3AEXA 3ZWVA 2GEUA 3MXOA 4J94A 4CIWA 5MGBA 4YRBA 2QTGA 3D6UA 2VHEA 3CW8X 2HBYA 1V4NA 3K0BA 5ITVA 2XVMA 5E1DA 3VBEA 5DI3B 5ARCA 1KY2A 3LW8A 4WXYB 1S0UA 3P0JA 4R1PA 3IQHX 3WIDA 2VRNA 3UATA 2WSMA 4BBAA 2FW9A 3G0DA 3OEHA 1W85A 4HG2A 5CA1B 2Q3HA 1CD5A 5AT1A 3WGKA 1O2DA 1F4LA 4MP6A 2C7OA 5EMHA 5JVDB 1S9HA 1R9MA 1FK8A 1IVNA 5FNVB 4M9QA 2JFZA 3BXXA 4MPDA 3T3IA 3WX0A 4K9DA 2Z58A 3EWSA 4EKNB 4MV7A 2C04A 5AM4A 4JT2A 1NI3A 4HAZA 2JEYA 3D8HA 4RJLA 4B7CA 1A0OA 4BMOB 1HK7A 2QTHA 3AI7A 3QVLA 4HRVA 1FC0A 1EP1B 1UPTA 1VJDA 1Z0AA 5FXMA 3ZBQA 5FWNA 4DIKA 4DLTA 4Z54A 2GAIA 3HJAA 4NENB 4JJ7A 1ZM2A 4F04A 2DX7A 1D7AA 3VU8A 5B57C 1I3KA 2RI6A 3EVFA 1W87A 1S8FA 3LT2A 4LRXA 4OYLA 3TLCA 1RWXA 3TZEA 1NU6A 3DEJA 2QIPA 3D0OA 1LX7A 4CTJA 4CCAA 1ZN2A 3VR4D 2WIBA 1ENYA 1BXRB 3QUSA 4J2HA 3GT0A 5K7SA 1V3VA 2KJQA 3U7IA 1JG2A 1CBUA 1I2MA 2PWAA 1QZUA 3E7PA 4US0R 5FR2A 5HQ3B 1R0BA 4P2BA 3P19A 3RYTC 4Q01A 3WMWA 1BH6A 4B6SA 2NP6A 1CQPA 1F8YA 4E33A 4C4SA 3CE6A 4WKBA 3W2GA 4Y6GB 1SEPA 2E6UX 2PRZA 2W6ZA 3KSRA 5JI3E 2D13A 3RHZA 1XCJA 1CUSA 2PSSA 3U56A 2RGUA 4B31A 5D84A 4X0EA 3CH7A 1YAJA 5BWBA 2BTEA 1JWBB 1C2TA 5FORA 5EMJA 4YRKA 4HGNA 3WTCA 4QLAA 4YRRA 2EEPA 4ZALA 1MC1A 1Q21A 2DMRA 3OH8A 1K6XA 4MYTA 1IEQA 2B92A 3AX6A 4I6JA 3UMBA 4N76A 4F4UA 3A1CA 2W6NA 3K1YA 1H0RA 1HE8B 1RRCA 1QYRA 5C5EA 2CE7A 1TU0A 1KMCA 3MFYA 5JE8A 2BDTA 3HCOA 1HI9A 4X90A 3JALB 3VHRA 2R7LA 4BJ6A 1W96A 4XUGB 5JJ5A 1OAOC 1JR3E 4HWRA 2AFIE 4RK6A 2QM8A 3RS3A 1Y48E 1PNOA 5C52B 3OAAA 3MRVA 5D00A 5DI9A 1RZVA 1FMFA 2H9IA 3LWZA 2AVDA 3W6ZA 5CDGA 1XPOA 4CIBA 3SVLA 2XIQA 5TQ2A 3RYIB 3WBJA 4YYEA 3ZHZA 1D5WA 3S8YA 4V3CA 3GBSA 4MGYR 2JVJA 4MH0R 1UAYA 3SYKA 1WZEA 4OU4A 3HXQA 4RHUA 1JF8A 2G5PA 1J25A 3ZXIA 1BFDA 2QTVB 4E21A 2AYYA 4E13A 1GGKA 2Y4NA 1CNFA 2H18A 3L4SO 2QTLA 5BV1A 1GKYA 1PEDA 5F73A 1TPZA 3C8ZA 4U1RA 3FIJA 1X7HA 5LMCA 5H3CA 1SCDA 1KEVA 4YQYA 1IHPA 1OC2A 1UM9A 3L79A 4EB6A 1E9DA 4XM1A 4ZVVA 5JEDA 1E6EA 2OLEA 2QR5A 3ANNA 3FAZA 5K0SA 1M66A 3W5BA 1QNFA 1E4EB 1KKMA 3PUZA 4I50F 5J63A 4NYJR 3K0FB 2NNLD 3JWEA 1KK2A 2FPOA 1NDHA 3L05A 3ZWWA 4ZRDA 2OHVA 3LGXA 1XSEA 4RKYA 1LRLA 4R2HA 1J21A 1QYDA 3TMYA 1ENZA 1Q7RA 1GCOA 3ISTA 2ERCA 4RULA 2EFEB 2ZUCA 3U7RA 4CKEB 3RSZA 2K6GA 1EZ4A 2C88A 2J0EA 1O6ZA 3W6PA 3AR9A 4C6TB 4JELA 1ZJZA 1OI4A 3U7QB 4Z7OB 2M9MA 2BONA 3ZXSA 3LK6A 2GWRA 3HU2A 4EG1A 4NJEA 5JFGA 1T5HX 4R6XA 2X8BA 4BKPA 3GAMA 1N5LA 1EFKA 2F1JA 3DDCA 3EVZA 1XPRA 2YXNA 1E2EA 4RD2A 1DHTA 1YJBA 1PT8A 5TQ0A 2BPOA 4OV6B 4IJWA 2Y1WA 5F4BA 4CKYA 1E3EA 3DFIA 2WV9A 1U1DA 5JZOA 2AG5A 1FYVA 1TCVA 1V5GA 3GT7A 2V6FA 5ALYA 5FBRB 1DX4A 2VTBA 4G4JA 1G7CA 1L7EA 3OWXA 4KLRA 3ZNNA 3MBIA 2XMRA 4RCYA 3NWEA 4ZU3A 1T0PA 2OOSA 5JCPA 2H54A 1KO1A 1W0KD 1N7JA 4ZVMA 4EMSA 2J3LA 2FUKA 5D3KA 5K0BA 4M54A 4Z3KA 3WSTA 4QQ8A 3RIHA 3L4KA 1Q57A 2HJGA 1T9ZA 3LIPA 3OEED 1HSZA 2V58A 4RPIA 5G4LA 4INAA 4EAQA 5IJWA 5K0FA 5KEIA 1KR2A 2PRKA 2SECE 1DO2A 3K3PA 3B3QA 1JQEA 1TIPA 2I6GA 1X8XA 2EZUA 4JS0A 4Q1AA 3EVDA 1ZZEA 1L7XA 2W5UA 3AERA 3K0KA 4F6RA 3ICEA 3TXXA 4DB2A 2WILA 1ZHHA 3CLSC 5KNBA 1JIJA 2GM3A 2IEYA 5A0TA 1XNHA 1DO0A 2D1RA 2XZDA 3H9QA 3OC6A 2RKWA 1I6MA 1A77A 2VI5A 2J0SA 4G37A 1ZN8A 2ASEA 3IE1A 1JFFA 4AMZA 1MH9A 4TZ6A 4CBVA 3OIVA 1V9LA 2DP4E 3Q72A 4ZQIA 5J5VA 2AN3A 3CVOA 5ECDA 3PX3A 4LBVA 4XE5A 2VYNA 4GECA 1K8QA 1SXJB 5ISMA 4ID3A 1DI0A 4C7XA 4B73A 1T3SA 3EY9A 3VPGA 1TYAE 1HY3A 4H1WA 5ALXA 2OFXA 2W2LA 5F9HA 1CF4A 4RIHA 4IIUA 4C0WA 4NR0A 3ZZUA 4BBPA 4DC0A 2DR3A 4Q9LA 5B30A 3JSAA 4XCXA 4K9MA 5FULA 2P2DA 5I7AA 4QAQA 2ZJZA 5GGXA 1UL1X 2ZB2A 1J7JA 4HLUA 3IPLA 1AMUA 5L40A 1JQKA 5IUJC 4TYYA 3RUIA 2PX5A 1MBZA 4MEJA 3IEIA 4H0FA 4NYMR 2PD3A 3HGTA 4KP7A 3WGIA 2P9QA 3OG9A 1Y8QB 4KKVA 4AU1A 4BNHA 1R8JA 3L1JA 1H69A 1L4BA 1U2SA 2WJIA 3V1TC 2Z6QA 4ZVLA 3NATA 1I3OA 5IKPA 2ZUVA 4CMCA 3PEVA 1QO9A 3HN7A 4F4CA 1MAUA 1HETA 4JI7B 3MWYW 2ZRAA 3N07A 3UGQA 5JAUA 3E4DA 5D51S 3AR6A 1IM2A 3B48A 3P2MA 3REFA 3RHSA 2F8LA 1ECLA 4JP8A 3QX8A 3INNA 5HCIA 4FB4A 1KMQA 4DA7A 5LQRA 1J5EB 1L8AA 2DWQA 4C3UA 4B3MB 1IATA 3AG5A 1YZ3A 2N42A 2VP9A 3FVQA 3L7NA 4LYFA 2J6HA 1UFQA 1YRAA 3O26A 3OZ7A 4KLNA 5HILA 4JI1B 4BXOB 3F49S 5JS1A 5KVCA 1K97A 2HPAA 2X1VA 3D4BA 1THZA 1OLUB 2GD2A 2JDIA 3OP4A 4ZAVA 3LBHA 1G9XA 3ND5A 3TJMA 3C5EA 2PSDA 1UZLA 5AXDA 5LMUB 3ZWKA 1K9SA 1H4SA 5M29A 1I13A 1TXGA 2IQIA 2PBRA 2HXYA 4HKTA 5ALUA 2FPXA 1SCQA 3C14C 3EVNA 3PI6A 4ARVA 1V8BA 3D7RA 2VF8A 4F46A 2P79A 4WJKB 4O29A 3CNEA 4M9CA 5DHUA 5L6MB 5DASA 1Z6GA 1QFJA 1F6BA 3PQ2A 2AEJA 3F1LA 3U5TA 2CBGA 3PD7A 3U3ZA 5HMLA 1HBJA 1J5XA 2CNWA 2TECE 1LZLA 2OG2A 4WEQA 2GS9A 3TL3A 5B7QA 2HWYA 3AFNA 1ISFA 3ICCA 4HNAB 16PKA 5GMOA 3RVMA 4CM3A 2QT9A 3KOWA 2FPGA 4IFIA 2HL6A 1FA9A 1L9XA 3R20A 5I7HA 4NZNA 1JILA 3HUTA 4TRRA 1YS4A 1J97A 4OHFA 5BXYA 1B2LA 2DTDA 2N1BA 3CKLA 3GJ8A 3DUFA 4OQPA 3RQIA 3A04A 4C76A 3SVTA 1N33B 2QMOA 2PHZA 4ABYA 1LPAB 3IOCA 4EM6A 1YA8A 5HG0A 3B1JA 2Q27A 4DQXA 1Z4MA 3EVTA 1AQIA 2E89A 2Y0CA 2GEVA 4UBLA 4COOA 4B6QA 2FEOA 4DJDC 1CV2A 3LP8A 2LUOA 4B3SB 2ZW9A 3WGNA 4YRCA 1VHTA 2Y9MB 3QW2A 3AP1A 2I2WA 2NZVG 2R44A 4OEHA 5IBPA 1ZRSA 3LFUA 3N8GA 4RGVA 3WAKA 1E7QA 1N2ZA 3BB3A 2JFQA 2MIIA 1TUIA 3B13B 3NNSA 4QDJA 5P8WA 3UF0A 1O0CA 1TK9A 1ZK3A 3FIUA 3WLJA 1FJ2A 4QQFA 3V8MA 3H99A 1FNMA 1IY0A 4O2LA 1EWTA 4N12A 1G5HA 1YRYE 2DSTA 4QKQA 5LL6P 3WKBA 3LF1A 1KAQA 1YNSA 2FE4A 4MV9A 4Q9JA 4GMKA 4R6WA 3F6CA 5L3ZA 2ZWPA 5DMHA 4AN1A 2YW9A 3IYLW 2WU1A 1OBCA 2FK8A 4XUEA 4QC2A 5ULLA 1W9HA 4ZN6A 3PF9A 3Q9NA 1M1YB 3R40A 1V0JA 1RXYA 3FZNA 4UAGA 4WXRA 1PZFA 1Y0BA 1TADA 1IBKB 1EJ2A 3LRPA 1JMKC 1NJ6A 2RGEA 1FLVA 1PT9A 4HLQB 2BHRA 1P44A 4EVQA 3STYA 3AJ9A 1RCFA 2O57A 3H75A 1ZVVA 3UFXA 1JT2A 3GROA 4YP6A 3RAFC 5I7EA 2C5SA 4GUDA 4LDJA 2Q1WA 4GEGA 3KQVA 1NYTA 4KCGA 1V5EA 1ZLXA 4MKRA 2IW1A 1QJCA 4KPEC 5CVVA 1NBHA 1ZO8A 1SELA 3VR5D 3LLMA 3ZIAA 1QM5A 2P77A 1T1SA 4J0QA 3ZY5A 3TKLA 3UW3A 2WFZA 2R96A 5JD3A 2P6RA 5JAIA 3IX7A 2HA7A 1JIXA 1P74A 3FR7A 1QB7A 2I2DA 4GPD1 4QRDA 3TMKA 3ZWBA 1MXHA 1OBOA 4JQSA 1RJGA 2F4VB 3H2JA 1T9BA 2EGUA 3PGA1 3Q9SA 1Y6GA 5AM2A 4XB6B 1KMHA 1G8GA 3RWMB 3KZMA 4D0RA 1F8XA 1FVOA 1GTMA 1E64A 1PK8A 1B0PA 1TAHA 1VIDA 1VP3A 2HIAA 3G23A 1NUQA 4LSZA 5CLLA 3T7KA 2ODTX 1ZNXA 2I2BA 2IOFK 2WKQA 2WUEA 1Z4LA 2HWXA 5CLIA 3QPAA 2A9RA 1QCZA 4XZ3A 2X7JA 3NOQA 2KBEA 1F0NA 2XTZA 1NQTA 4RYLA 1F8FA 3NAZA 2J46A 2PRSA 3WK7A 1KWKA 3LQFA 2OBBA 1I6WA 2YXEA 1E3SA 3V42A 4DLPA 3U7GA 4NV1A 2IC5A 2VCYA 4MVJE 1IY9A 4DA0A 2PU7A 1CUZA 3HXKA 4HWPA 4BE4A 2IYAA 1ZCBA 2D6FA 3ZV5A 3SZ3A 2Y1KA 2O52A 1JHXA 5E7JA 5EIAA 1JPNA 1Z2AA 1ZSYA 3MERA 5JTTA 4Z8XA 1K0UA 4ZDJA 3E53A 3OHSX 1XZGA 3WGJA 3A4YA 2Q6KA 3VM6A 2BMWA 1ZUIA 1RJEA 4GKBA 3JWHA 2JFWA 3VC2A 1XEWX 4GXQA 5TJHA 3R74A 3MRTA 2IDKA 4CM5A 1ADFA 3LWDA 5B2ZA 3ZHCA 2P69A 2XQVA 2CMFA 1ZCFA 5KTMA 1FFEA 2Q3MA 4JHXA 5JHHB 5LIRA 2WYIA 1E59A 3PPXA 4GKJB 2GESA 1NBIA 3CRMA 1WF3A 4LJ4A 1U5AA 2I87A 2FDCA 2CNKA 2ZROA 1IL0A 3WWYA 2QGFA 4O4LA 4E5MA 2ST1A 3RS2A 3ZGVA 4DG5A 2A88A 5FOQA 2FPMA 2NACA 3KQKA 1DIOB 3WAJA 5J2UF 3I9OA 2F7SA 3LBIA 4UMDA 3MRSA 5DCYA 2QSUA 1DEXA 1UKAA 2XRMA 3QLVA 4B3JA 1N7GA 1Z34A 3CW9A 3MCAA 2GT1A 3ZV6A 3ZE6A 3NWOA 4RKRA 1USGA 5A02A 3BMOA 2GDJA 3O9ZA 1Y80A 3N0RA 4JJGA 5A4IS 2HA4A 2C5GA 5H4HA 4OOEA 4H9GA 1AY0A 4HDRB 4KRGA 4GPAA 1QIFA 4FYJA 1N2CE 1SUDA 2WVAA 3ANTA 3KFXA 4QULA 4Q15A 3GJXC 4RVSA 4D92A 1WQ1R 4FE4A 4XGRA 3ZDYB 3BWBA 1MAAA 3H5WA 4Q4AA 3PFCA 4BO4A 3QVGB 1OGYA 1F2UB 3FWNA 1DPFA 4GQAA 1U8TA 4ENQA 5DXAA 3TINA 1NWCA 3MT9A 1P3JA 5EIFA 1GPYA 4NICA 1ISJA 1TEHA 3AF4A 4B82A 1OB5A 5FCDA 2O19A 1FRFS 1OLXB 3EULA 4EYGA 1A4IA 2I2FA 5GVRA 3TYXA 1OH6A 4LRUA 1IE3A 1TGVA 5LNK1 2ESRA 5DEIA 1T8UA 3GNSA 4MI1A 2VJOA 3MD9A 4X44A 2BY4A 4ZK6A 5C1DA 3FLMA 1HLGA 3AXTA 1AA6A 2PIAA 3A36A 3AEUA 3P2YA 3QEOA 4QUBA 5J5CA 3GLFE 4PU0A 2ZE8A 5IP5A 3IV9A 3PWSA 3P0IA 3TTWA 1VC2A 2VIIA 1I4WA 2B34A 3W4KA 4CI9A 3TEMA 2WDZA 1VHQA 4LA4A 4CR8A 3K6SB 3QPWA 1AMNA 2ECPA 4Q1BA 4OO3A 2NVWA 2X4GA 4YAKA 2LCFA 3TOSA 2DFLA 1IZ7A 1EWKA 1I2AA 4KU4A 5FB3A 3SE7A 3FKSD 3EGCA 2QV0A 4AJPA 2H5IA 4I4TB 1DC8A 4B4KA 4JAVC 3I9V6 3F7MA 4HEJA 4PO1A 5J4LA 2NGRA 3OJCA 4NYJQ 2QTAA 2EL7A 1EGQA 2VRCD 1VLJA 2DQSA 4H7JA 4ZANA 1RAIA 2OO5A 2ZI3A 1XN1A 4KGVA 2WF8A 2X6TA 3HKDA 3O91A 1MO2A 2Q4RA 4HT3B 3UPUA 3OCVA 4JP1A 2Z2JA 4WQMA 3VVCA 4BDSA 2XUJA 4RTPA 2ECOA 3GDGA 3ZS9A 4ZP1A 5KX5F 1WXHA 1HMYA 3C3EA 4N0DA 4MW0A 4Z7JA 3A27A 3LPMA 3T4UA 2PKXA 4PCVA 5AJZA 2IGBA 4YCAA 3VI4B 5THQA 5B3JC 4CM4B 4DQKA 5KTOA 4EJSC 3B3FA 4AY5A 2YZNA 3RTEA 1U0EA 4ZZ1A 5LM3A 2XUDA 3L0IB 1H4QA 1X3LA 4IL5A 3JX9A 2IUUA 2OCXA 2WAMA 2BFCB 2XB4A 4G63A 5BY2A 3GJ0A 1USIA 3C3KA 1U8FO 3ZQ4A 2IS4A 2LIVA 3AHGA 1VXRA 2QM7A 2YJTD 1TJ3A 4IWXA 2OGSA 4PLFA 4RFLA 2ZIUB 4UUBA 5C8DA 2ODWA 3KR1A 3H2ZA 3UIEA 5KU7A 4JJIA 4HDMA 1SVKA 4PPYA 4BNYA 5BVHA 3QUBA 5J2TB 3M4ZA 1KH1A 3ZU6A 1FFSA 4LGMA 4BX0A 1UBSB 4FGSA 4P5DA 4OGKA 1KARA 5EHGA 1JI0A 2Q1YA 3PXXA 3FYSA 3JQDA 4LJSA 4NU5A 4QM7A 4WXHA 2VH1A 4WFIA 1GA1A 2V65A 2BCJQ 1YS6A 2VRBA 1IUOA 4IJMA 2GCOA 3ZU3A 2ZXFA 2WTXA 3ZHTA 5DYWA 5BWCA 2R8YA 5CA1A 3C43A 3L8DA 4FGLA 4G5HA 4HNSA 4HMQA 3DOEA 3BD7A 3W5IA 3GDFA 3PGKA 4IS3A 5ARDA 5JVDA 3II6X 4UFOA 1PDVA 3S6JA 3VISA 2QMYA 2Z2KA 3EYWA 3X1ZA 3KKNA 5E8RA 1WZIA 5I9NA 1Q0UA 3GUZA 4KUHA 4MHSA 1QH1B 4HLCA 4V2IA 4CQNA 2ZTLA 2G9UA 1SCUB 1PL8A 5DN9A 5C34B 4W9NC 3L7AA 4NENA 4HFRA 5KS2A 5IT9A 1KJNA 2AG8A 4YONB 1S2IA 2W93A 4QOIA 1S2OA 1FTYA 2O2ZA 2YN0A 2GAFA 1SVMA 2ALJA 3PDIB 1JEEA 3EF3A 5B1SA 4N8DA 1OPRA 3H1BA 4OB6A 4ZDIA 4RTQA 4B32A 3DR3A 1FX0B 3CF6R 3D3WB 4OQNA 4YRJA 3GCDA 3DH0A 2HDOA 4ZHQF 3TTSA 5HQ3A 1H0KA 4O3MA 2WSSD 2C59A 1CQJA 3B85A 2CC2A 4YCCA 1KRWA 2JIBA 2ERYA 2QSYA 2V4ZA 3D6VA 4BU1A 2IE8A 2XMCA 3LXMA 3TFOA 5IRCD 2HO4A 1Z26A 3VOSA 2WTAA 4M1QA 2GCEA 3OT5A 4NYMQ 3VU0A 4DB4A 1IHDA 1A8UA 2N46A 2XGMA 2GAAA 5CFMA 4Z6KA 1UKBA 3VNRA 2BKEA 1ULBA 3PJEA 4RZ2A 5FBHA 3C1AA 1M74A 1G5TA 3HFJA 1C0IA 2ZSUA 3D7MA 2P4EA 2XKAA 2O8DB 3KQTA 2O8EB 1OGJA 3HA5A 1TLFA 5EE1A 3QLJA 3IJ5A 1AGRA 2WJWA 2ZRGA 1UR5A 1X39A 1G20B 3CX6A 3HCRA 4G85A 3TI9A 4TYQA 3HO6A 3JALA 2ZB3A 3UMCA 2C3OA 1A98A 3SS8A 2X2FA 4TYMA 3R7WB 4IVNA 3KWJA 1XU9A 2YUIA 1NLYA 4DY4A 4NE2A 1RQXA 1S3SA 3JQ6A 3W1VA 4Q4JA 3M3HA 3RYIA 4TTAA 3W2TA 4BRZA 3WYNA 2ZJYA 3WDSA 2I4MA 1R74A 2R5FA 4M86A 3SJBA 1CG6A 5AVXA 4AWXA 2O2CA 2VPWA 4JLOA 4GMDA 4JLUA 4OFZA 1OI2A 4GXTA 4KNWA 1SXIA 1NRXA 2R8EA 2YC4C 4DA6A 2X9VA 1Y4UA 3QQPA 4GR9A 2B7LA 5F2KA 3VX3A 3SM9A 5C8VA 3IVGA 5ICSA 1J0EA 5FQOA 5IDVA 1KC3A 2RGBA 4XD2A 3RU7A 4F71A 3WLEA 3QP9A 3SXJA 2H0QA 2WIJA 3OTOB 1O58A 2H5LA 1IJFA 2JJQA 4JLWA 3AFGA 5AKKA 1W35A 2HHLA 3WADA 1TMGE 2PBZA 2PZ8A 3UW1A 1T3LA 3WA6A 2XDQB 2ZU0C 3IUQA 4MK4A 1PJRA 4FNOA 5EG5A 3WNVA 1E4EA 4DCPA 4YXWA 2G0NA 3FTPA 3K0FA 4PAOA 5JPCA 4BBJA 1N4AA 1NMZA 4FTWA 1NNLA 1W5EA 1X1CA 1YVEI 2Q9UA 2QLMA 1NOKA 5C32A 1USUA 2Z83A 5DX1A 2XITA 5IW8A 4ZGGA 4C6SA 5TVKA 1VJ1A 4CKEA 2HKIA 5LJLA 2VHVA 4U0JA 4TWIA 2FZKA 2FMFA 1WW2A 2ZRKA 4JLVA 4UCFA 4C6TA 3D3NA 2QG6A 1V8PA 4AN0A 3V9AA 3DC2A 4CCWA 5LLTA 1SVUA 2RDMA 2QPAA 2AJDA 2XRFA 3HA3A 4EHAA 1T1EA 3O5AA 4GWKA 4GPTA 1M2JA 2G7ZA 3AHIA 4NNJA 3F4KA 1XKTA 3OD5A 4TV8B 5SICE 2VHCA 3R3YA 1XIVA 3ICPA 3T0GA 4F92B 2NXEA 4ACAA 1UBJS 1RI5A 3D2BA 5F7ZA 3TH5A 2YZGA 3OQMA 3FPAA 1RVV1 4M46A 1XZQA 2P5TB 3SK0A 1G2OA 2J45A 3Q11A 4XX1A 3EA5A 4KRXA 1Z6PA 1ZGCA 2Q0HA 3WQSB 4MUNA 1SK9A 1O94C 1GARA 2BVNA 1PL7A 4B2YA 4IIFA 4G36A 4FGKA 3RQSA 1C7EA 1YR1A 2WSIA 1NPYA 1H2ZA 3BHMA 3S5JA 2IPMA 3ISJA 3F0TA 3ZBUA 4E2YA 2BEJA 2QYHA 1C7JA 3DEHA 3FSRA 4MLPA 4PTYA 1IB6A 5IF3A 1P4JA 3WSVA 3GVHA 2GFIA 4MQEA 2OHXA 4WFKA 3EZ2A 3PVZA 3FTQA 4GX2A 4YDSA 1LF5A 4AMUA 2INGX 1IOVA 2PL3A 5ALJA 1O03A 1EX6A 2WWXA 2OXTA 5C1PA 5FWYA 3RUAA 5K3BA 4EQ6B 2WOJA 4II3A 4LE2A 1PQYA 3K96A 1YMUA 4JLBA 3MMXA 3RF6A 1PS8A 3C6XA 1P3Y1 1T5LA 3E9CA 1I2DA 3Q6IA 4UATA 2VNSA 5LQNA 1ZWKA 5BN5B 5TT0A 1R27A 4ZAXA 1BC5A 2ZR7A 4BP9A 1P0FA 4ZYLA 1ICEA 3H65A 3ILYA 1GUBA 3HWX1 4B3IA 4WLFA 1QPGA 4ZT6A 3N2YA 1JEDA 4W99A 3W7BA 4BCCA 3H1AA 2O1SA 2B5VA 2BHSA 3EUWA 3H16A 1X7ZB 1WCWA 5F5XA 1SXJA 1MA0A 1OHHA 3CLKA 5LZ5A 2O0MA 2FSPA 3LFTA 3MC1A 1Y3FE 4ZVPA 2H59A 3T5GA 4HNUA 1AB5A 1KO8A 1CR4A 4K9LA 1TECE 3VU9B 5CA0B 2FWAA 5SYAA 1PUJA 2EARA 2V7PA 5AMXA 3ZDFA 2OMKA 3LOUA 1TTPB 4J0GA 3RTCA 1P7YA 3ZXYA 4ALJA 4BWVA 4D97A 5T7BA 4Y6LA 2WYWA 3DONA 3B6MA 3IQXA 4ETNA 1HFJA 2EKZA 5G1OA 1F0YA 1TKBA 3W6NA 1IUNA 5A4KA 3N0VA 4WKNA 1UBFA 1W52X 2GN0A 3AINA 3B38A 3KCQA 4QFDA 1Y8QA 3PCTA 3QI7A 4BO9A 3G88A 3ZWPA 4EG8A 4EUKA 5B5SA 1MD9A 1ARZA 2B36A 2YJ5A 5EKXA 1PZEA 2YR0A 3CT4A 3FNRA 3NGMA 1OA1A 2IL1A 3T5PA 1AKYA 1COWD 4MX8A 2O7QA 2CMKA 4EFKA 4ZC8A 2ODQA 4MUMA 3FMIA 2FXVA 1UAGA 5BV0A 1WV1A 1FUYB 2I4OA 3FZEA 4UUMA 3T7RA 4PEVA 2E1RA 2VDJA 4X1KB 5AKJA 4IVQA 4PNZA 2XGJA 1B16A 2OTCA 1WWKA 1O1YA 4K5QA 1F0PA 4QOSA 2BFBA 5FA6A 4TYPA 5TMPA 3ABOB 3R0VA 2Y0PA 2VF4X 2ZITA 1OLUA 2P9GA 2IH2A 4ZARA 1TJYA 1TD9A 2M6SA 1P80A 3IERA 3OQHA 5EI5A 1LFDB 2GGSA 3KYBA 5T57A 1N77A 2ES4A 1XTRA 4G24A 4Q3CA 4HD8A 3EARA 3KFVA 1AO3A 2K87A 4NZPA 1QCYA 4Q3KA 1U3GA 1FFBA 1RFGE 2QJWA 3FBWA 3JRWA 2XPCA 3IKVA 3IODA 1LA2A 2XCIA 1EGAA 1VB5A 4QOFA 3KQYA 4HNAA 3W5JA 1UBUS 5IK2D 4HAYA 3AJEA 5DNCA 2H2WA 3TW8B 3QFSA 3HLTA 5IMBA 5EEHA 3JU3A 4Z7QB 3O0TA 5JSFA 4CT5A 3J7TA 1M6WA 3VSCA 4EI9A 4LHZA 2P0EA 5EE3A 4ZCTA 1J2RA 2JJ1D 1TUGA 2D2VA 2ZYRA 2DF8A 5A62A 2PS3A 1IEVA 2BKAA 2PLNA 1GLVA 3Q7QA 3BFPA 1JIKA 1GP2A 1YVPA 4WNIA 3HNPA 2WNHA 2Z4TA 3PSAA 4EFNA 1KI9A 2WMOB 1UH5A 2FYTA 1Q2UA 2RAFA 1RPJA 1X38A 2AOWA 5DNEA 5UKDA 3IP7A 4F9FA 3TRIA 3LX8A 4LNUB 3N8IA 2PSJA 2Z1MA 5K2OA 4D9FA 3LC7O 4C2UA 1G55A 4TT8A 1D3AA 3MCZA 1P0QA 3T9AA 1DT3A 4RTMA 4K05A 1GRCA 5HHTA 3SQXA 3S2EA 3FGZA 1JDUA 1PZXA 4ONEA 3DE2X 3BGSA 1TGYA 2JLAA 1SQFA 2WG0A 4UHJA 4Z9AA 1KIAA 4Q16A 2NPFA 4GOOD 3WC4A 2PMEA 1OX4B 1L5LA 5C7IO 4QVIA 3VC7A 3MK31 1RR6A 1M1YA 2ATXA 2NO9A 4A91A 3WYCA 5FH9A 3QWIA 4OL9A 1CU1A 3IULA 4DMFA 5JJCA 4EJ2A 3O8DA 4YP1A 1AC5A 1ZH4A 1DG1G 4DYVA 1I3LA 3BX1A 3A6DA 4OQDA 2Q2QA 3PE4A 3KP1A 3CUUA 3PDHA 3A9WA 4DCMA 1QQAA 2BFMA 2I99A 3JWJA 1QV9A 4NATA 2ZYVX 3OKAA 3T0IA 3TFQA 4Z0NA 4RMIA 4BGEA 5I9SA 4YTEA 1BJRE 3COWA 3EGDB 5A9TA 2DUJA 3BFKA 3EG9B 4EB3A 5DGDA 1TZCA 4MWGA 2WTNA 2AC2A 3JVDA 5IAEA 2FSUA 1F2TA 4MV5A 4N9WA 1JWLA 2P65A 5K2MA 3R3ZA 3I9FA 4RJ2A 4UEKA 4H15A 3WGYA 1CDZA 5IJ9B 3AM1A 4HWGA 3ETDA 3N2NA 4Y2YA 1Y3IA 3C1TA 4BNDA 2Q8NA 2VDMB 3V1NA 1KNXA 3BCSA 3L6CA 2AUTA 2EL9A 4RTLA 3IUYA 2RH4A 4OIMA 4UUQA 1OASA 1L5SA 1UFRA 3Q9LA 3Q3HA 3C7DB 4IF4A 1C0PA 1E5LA 1UFVA 5DBEX 1FRNA 2GD6A 1L4GA 1RXIA 3V34A 1U28C 3E3LA 3IKJA 1DKRA 2HF2A 4BX8A 4DBZA 2WU3A 1T4DA 2VTDA 3LE8A 3GI1A 3WZ2A 3OO1A 4ZZIA 2XXBA 4OU5A 1Y9EA 1TT7A 1UP4A 5IJ0A 2NN3C 2YC2C 2V6GA 3ETGA 4G5FA 1B3RA 1HE3A 3UCEA 3GXBA 3OM8A 1OH5A 3OIFA 5EWLA 3MUFA 2G63A 1RLMA 1YQXA 2FRDC 2VLIA 1BROA 4FXOA 1Z8DA 4OJTA 3QZUA 4C43A 2HIGA 2O8FB 1YRLA 2AN5A 4KXFB 3LGSA 5IC6A 2Q4TA 3DHYA 5LZ2A 2XMSA 1CRZA 3QU5A 4G0NA 2GEFA 3LCRA 3MTAA 2CVOA 1AQUA 2XTMA 5ELLA 4ZJZA 2CUKA 4GSLA 1FQJA 2DT8A 2ZJ2A 1ECJA 2AFRA 1BE1A 4KYTA 3D4OA 3I58A 2P2CA 3AFIA 1I5OA 4NBKA 1VMEA 4B6JA 1D0VA 4L28A 2P6OA 1ZZGA 2JI6A 3RBAA 5KHOC 2ZIVB 1Z0JA 4MB0A 1RC1A 2NNWB 5E4YA 2I1LA 1K98A 3HRKA 5JARA 5HKAA 1TOAA 2W22A 3FZYA 4K2HA 5DO9A 4QXOA 5LWHA 2VTVA 2V0NA 4ON9A 2HLPA 1U2TA 3BJEA 4I9HA 5DNVA 1GPLA 3R5HA 1GAWA 2I80A 3WLKX 1RXEA 1AO0A 1PX2A 1NVXQ 9MHTA 4L9AA 3AM5A 3I9KA 3SM3A 1DAEA 5CT8A 3ZWYA 2K5UA 3EAFA 3W34A 5A3RA 2G40A 1A1SA 1EVQA 5A7GA 4D9NA 4F5ZA 5IABA 4HNHA 4N5IX 4QU9A 1W1UA 1A97A 3O0DA 4OK3A 4JOQA 4PYMA 1U0BB 3TM5A 3AIKA 4HC4A 4DCUA 1EX7A 2QNIA 1ZI9A 2BFDB 3I64A 1EPUA 5E4FA 2JZOA 1SKYB 2VUTA 2WICA 4KVAA 3G68A 5JS8A 5EXDA 1FFYA 1TM1E 5H5JA 1F2UA 4JJ8A 3AH8A 4R7ZA 1JJAA 1KAMA 5JLJA 2VUHB 2PY6A 4P58A 1I10A 1R10A 2QWXA 1NW8A 4P54A 1V11B 1DKPA 2P9JA 2Q6LA 2P9ZA 4P7KA 4Q05A 1O5TA 1OLXA 3AKYA 1GPNA 3BGDA 2H2HA 4QPPA 3SZUA 1P9NA 3WLHA 4MRSA 4Z2AA 4J3FA 4ZXFA 3VUEA 4UKDA 1OFGA 1VPVA 4KXXA 1KWGA 3OPQA 5FUWA 3DLBA 4QGBA 4EA9A 1PWHA 5AVYA 2I3DA 3M34A 3RG8A 2D2XA 1CWUA 4ZOAA 4C0BA 2PXAA 1VM6A 1O8CA 2OXIA 2X1HA 3CQ9A 4DL9A 1KHHA 4E2XA 4IDHA 4ZCIA 3GARA 3IVCA 2VYVD 3EWIA 3I0NA 4D4IA 2YMMA 2XNCA 3PNSA 3W9SA 3K6SA 4Y2GA 4DA4A 1A95A 1RMYA 3FHTA 4Q9IA 1WJGA 3OBBA 5BSGA 2CXQA 1N1EA 2Y71A 1EG7A 2OKGA 2QVYX 2PYDA 2W6CX 1ZK0A 3HQ4O 2D1YA 3IV6A 4JBLA 2P2ZA 3K9QO 4I4TA 1EEXB 4UCXA 2QUBA 3GCXA 3L0PA 5CDSA 1LNSA 5ADHA 5IM4F 4CEHB 2ZYGA 3RNOA 1X92A 1X3SA 3IEMA 2WF9A 3PRJA 1D4FA 4UEJA 4TS9A 1C4WA 3DS8A 2H3HA 2XWQA 1T9KA 4IDAA 2QUIA 4KGDA 4DDTA 1EDEA 1T0HB 1VL6A 3IIMA 1QVWA 3BWMA 4YCNA 3P2KA 5EVJA 4AN4A 3ZLJA 4NAHA 1O95D 2D1FA 3IUJA 1SVNA 2I34A 3SC4A 1CJCA 1RYHA 3FPBA 2IHTA 3HYLA 3QXCA 4JGIA 1AKRA 4BZPA 4GX5A 3H11B 3PICA 2Z98A 4FT4A 4CM4A 2IHZA 4BMSA 1DRJA 4JB8A 4M7OA 4LHYA 1TYEB 4CMGA 3C15C 3C97A 1OVGA 1AGXA 4RY2A 1DG3A 3FWZA 3GHYA 2FP3A 3EXEB 5I9LA 1QCDA 4MKZA 2IZZA 3KM0A 1DGQA 4JB3A 4LC1A 4KFSA 2Q1UA 3GMTA 2CNDA 2C0PA 3DKKA 4KXQA 3F71A 5EINA 2OBYA 2C1XA 2JHGA 3O1HB 1HZJA 3F8TA 5J2TA 4RZIA 2C4NA 1CY8A 2Y0BA 4QODA 3HB1A 3TBHA 1QVZA 3VV3A 5FAKA 2OLJA 3ZDAA 1P4HA 1QMGA 2R84A 2EFHB 2YCLA 3H6HA 5KNLA 1HL3A 2I03A 1KO4A 3OPVA 4DAOA 3V1YA 3V4RA 2A84A 1W2GA 5EERA 5J5AA 1V48A 1L4MA 4H35A 2ICAA 5HCUA 3T5TA 3OETA 4DSAA 4F2PA 5DYNA 4GP7A 4KV7A 3UANA 4D3XA 1SC6A 1X1SA 3PLRA 3RPEA 5L6LB 3C3MA 2WD8A 3TTVA 1W2HA 3KSMA 4XTCS 4F3TA 5F7OA 3NPAA 1R00A 4YDHB 3TNLA 3C3CA 4HOYA 1H2HA 4ZU6X 5ABPA 1GZVA 5KINB 1JAHA 2PEYA 2OILA 4ENTA 3B1XA 4LY3A 4NSNA 4BV8A 1ID8A 2RBKA 2OHFA 1DAHA 2D59A 5I4BA 2PJUA 1YS2X 5FIUA 3UC5A 5KCZA 4CG2A 1QH1A 5IZCA 2XOXA 4RF5A 1WP9A 2CJWB 1SCUA 3GJRA 4EABA 5JECA 1HDCA 4A7PA 5LQMA 2VBFA 2HZBA 3EVAA 3CF0A 1GVHA 4Q3DA 3ICVA 3MCWA 1WUYA 4HHEA 4CDMA 2BGNA 4M0EA 1I7QB 2RFLA 4D46A 1KP9A 4DLAA 3PDIA 2J4CA 2FOIA 3HXOA 3PPIA 5CB0A 2E4YA 1DPGA 5JZVA 3D3WA 2Q9CA 1YFZA 3A1NA 1ISSA 3C98A 2I76A 1DIRA 1SEVA 3R7FA 4MQBA 4AJOA 4KUGA 4YCMA 5ITSA 3VDMA 3VR1A 3UGTA 1CXZA 2MU1A 3CIOA 2XNKA 1Q2XA 5LOVF 4Q18A 1BYUA 4MW6A 1VGVA 3MUOA 2VKTA 2ID4A 1ESEA 3LHSA 1NZJA 1WEHA 3L7BA 1KYWA 2DH6A 3X1XA 1E9VA 2FGJA 5L3SB 1F2DA 3CF4G 1HE1C 4N18A 2BH2A 4OXNA 3KS9A 2QGNA 4ALNA 3S1SA 1S4MA 4KGXA 2IH4A 3ZDDA 4JJAA 1XE3A 3SDSA 4BY9E 3S28A 3NIWA 1A8PA 3C85A 4V02A 4L16A 4CLEA 2O8DA 1RJDA 4F93B 2O8EA 1MOSA 3WBBA 2J9ZB 4NBWA 5FLXA 1K7YA 2GJ8A 2P2YA 4UM5A 3TQCA 4E03A 1SCKA 1G20A 3B8EA 2WVGA 2Y2VA 4P7JA 1KP3A 4QFCA 4F4HA 4Y7CA 3F4BA 3LVFO 4KQ2A 1SB9A 1ZPDA 1L5QA 2FPLA 2GBLA 3HMQA 4C3ZA 2RK6A 4EB8A 1R6XA 3KCNA 3LUPA 3R7WA 4N1AA 4KR6A 1UC9A 3DMPA 4L95C 3OF5A 1Q74A 2JGLA 1MHPA 3A3PA 4IIJB 4PYRA 2OAGA 3GNQA 3WRYC 4CJXA 1QGYA 1Y42X 3D1VA 2JL1A 3LX4A 3PCRB 5ALGA 1EP2B 1QONA 3HADA 3WHPA 5F21A 4OHUA 1IXYA 3WGQA 1XRPA 3L5OA 1SKUA 3CBQA 3MAJA 1JPJA 1Q16A 1VP9A 4Y9TA 1NX6A 3VKWA 2I6SA 1P6UA 2P11A 7MDHA 1QDLB 3H3XA 2HU8A 3NT2A 3AKDA 1Y82A 3FM9A 4G6ZA 1FXWF 4RELA 1TVKB 5DT9A 4CODB 1G5RA 3UQZA 4O33A 3TQFA 2WP0A 4EUFA 1CERA 1M2GA 3MF4A 2ZUFA 1E69A 3QG1A 3HEAA 3GJZA 3MMPA 3ZHBA 2GF2A 3PEYA 4GF5A 1QHHB 3WV5A 2QJTA 5EZYF 2PO7A 4II2A 4N39A 4PHGA 1PL6A 2Z95A 1AX9A 2FFJA 4M1TA 1E9SA 4UAJA 4WHMA 1ISRA 2XDQA 3DAPA 1AIPA 1FUEA 2WABA 1B00A 3CG4A 5EJFA 3Q40A 4RXMA 5JAQA 1V8DA 1Z4QA 1W0KA 3QGMA 3RROA 3UJ6A 4NBLA 5TIIA 5AW2A 1VIYA 1ZJJA 2MYPA 1IZ0A 2PXHA 1GR1A 4WN3A 2A1UB 3UQYS 2NV0A 3OKCA 5DP1A 1YBAA 5I6DA 1R0KA 2GCGA 1DNPA 5LWQA 1YUMA 3OEEA 4G65A 1Q5PA 2DUMA 2ZRDA 4IGEA 3E3NA 3S3TA 4LKRA 3AVXA 4RIGA 1DCTA 5EJ6A 2WAXA 1XVUA 4IWNA 3C8HA 3ZZ1A 1PFWA 3OZEA 3VAYA 4ZDKA 3TZQA 4JUAA 4AMBA 1XVLA 5BR8B 3UAVA 3WLIA 1UJ4A 1U98A 1LW6E 1LS6A 4DXHA 4FC7A 3SU8A 3CR3C 3N7AA 2GN9A 1W4RA 3I53A 4PX5A 1RPZA 4UQOA 2KBFA 1YHNA 4KXNA 4XLTA 4QE3A 4XYMA 2YQ4A 5ELXA 2WFAA 2AZXA 3KZOA 1FMLA 4RKEA 1V45E 1NTOA 2DPLA 4BUZA 7YASA 3NV9A 5PGMA 4FYHA 2H6EA 4OF4A 2NUTA 1UWKA 2QLBA 5HFNA 4EL0A 5JANA 3I52A 1ZDMA 1SBZA 2FPRA 4N3CA 2PMKA 1UMKA 2QQ0A 4L4ZA 2WIGA 4OP3A 1HNXB 3YASA 2CFCA 3P9RA 4K03A 2FSHA 4AMGA 1Z6ZA 1NP7A 2VYQA 4JKOA 4LQLA 3SHFA 3C87A 2GERA 1ZK2A 2YIMA 3ENZA 4G23A 3PD1A 4BFXA 2FU5C 2X3YA 4E0BA 1GYQA 4OQQA 3SICE 2A6PA 5C7YA 2VTKA 5LB2A 4ED9A 1XNQB 5HOQA 2DJ5A 4EQ6A 1UZAA 4GWGA 3H0EA 1WR8A 2XNSA 3EOZA 1FNBA 4WPGA 1LSJA 1P17A 2W2MA 5B12A 1G3IA 1GEEA 4D7AA 2XB8A 3M3PA 1LBEA 3PFFA 3OFSA 4AKEA 1W19A 3K4PA 1RBMA 3OCCA 5GADl 1J4AA 1JH8A 3KZVA 4W5JA 1JIQA 4ECAA 2ZAGA 4KO8A 1SQ5A 2WU4A 3REQB 3VYVA 2D62A 2B4TO 1IUKA 2GA8A 3NWPA 2GCPA 4HQLA 2B8JA 1OMOA 2QE7A 2V55B 4I4LA 3ZVLA 1X7ZA 4OUKX 4WY5A 5F78A 4YUZA 4LXIA 4YQEA 1CVIA 2EDAA 4YA6A 5F5NA 1ORTA 1QRDA 4LJ5A 1WPGA 1NQOA 2DXIA 1VPWA 4BV3A 2Q6VA 5CA0A 4BLWA 4J0CA 2BI7A 1Z6AA 3ZJUA 1N8NA 1LBTA 5DWDA 4QAJA 2KLHA 1YVUA 4IGIA 3USZA 1ZW6A 3WWEA 2QLTA 1XLUA 1ZIPA 3V4FA 1YRQA 1H94A 4ADSG 2X41A 2C77A 4BKRA 1EA5A 3FRJA 1ZYUA 2J6IA 3CRVA 3VAAA 3TDNA 4YMIA 3BCRA 2Z2ZA 2W4QA 4JEIA 3QE4A 2QGZA 3STHA 3I72A 4FPXA 3A3OA 3HB9A 5LZ9A 3EIFA 3OA0A 4E31A 4CHTA 5IKXA 3A32A 1XAHA 5JCOC 4QHSA 1RS0A 3FYUB 5JFOA 4TVOA 1K8RA 3WWOA 3TCNA 4QJ3A 2UZ0A 5EP3A 2Q49A 2DQ4A 3PUVA 4N6GA 4EW3A 3NHJA 3ORYA 4UM8B 2H1WA 3EXAA 3SC2B 2R60A 2FEWB 1GL6A 4X1KA 4V0QA 4PC2A 5A2QA 1BDHA 5ER9A 1V2GA 4R41A 2XEXA 4A0QA 5E3IA 1ABFA 2P6UA 1ZJ6A 4IRXA 1CR1A 3HGQA 4JYCA 2NXJA 1KORA 1NLFA 3AP2A 3PC4A 4KFRA 4P35A 1NY5A 1Z17A 4MVJF 1HE5A 5B55A 1OUMA 2F3PA 1VPDA 1R16A 2PT9A 3HV2A 4OHCA 3KU4A 5BR7A 2F55A 5K4HA 3GDWA 3PDCA 2F9LA 1U31A 2PL5A 5TGDA 4BX3A 3W3AD 2G1KA 1KY3A 1ZUNB 3LDAA 4FYKA 4KXWA 1RHRA 4LY9A 4OHBA 2R62A 3TWOA 1OSNA 3EE6A 3GFFA 3HN6A 2P2GA 4K3UA 3IAHA 3AVYA 5JWHA 1XMOB 3DZ8A 1G8HA 3RBVA 4CT0A 1OFUX 4DT1B 3WIOA 3P96A 1HYQA 1ZD1A 5HJEA 2NWQA 4A26A 5KVVA 3I2JA 1Y89A 3D0KA 3NS7A 4FZRA 4KZPA 4X63A 5DM0A 3TW8A 4Z3OA 1E66A 1ORRA 2R1UA 4DR3B 2Y1XA 1XVTA 3AHCA 5FBLB 4WOJA 3EMKA 2ZIXA 5H02A 1LBQA 4S24A 1X9IA 4OATA 4BFTA 2O0LA 4R8SA 4HUTA 4B46A 2YKGA 2KI5A 2BIFA 4RHTA 3U4HA 3H3JA 5E9QA 1XA3A 5J1SB 1XMJA 3IRVA 2C2KA 2P3OA 3DP7A 3H0KA 4K9RA 3QV1A 4GKKB 1DFIA 4TSKA 3ZZMA 4OMFG 3RHTA 3S2ZA 3FHJA 4M8KA 3RWBA 2RHTA 3F5SA 2Z57A 4LNUA 5A7HA 3UJAA 3ZEAA 2FCRA 3UOGA 4MVJD 4MW2A 3C7TA 3QHQA 4IDQA 4YV1A 1U0LA 5DU2A 4GX1A 3OIUA 4XGNA 1SG6A 3E4CA 1MX3A 2O2GA 4MMXB 1H65A 2L69A 1SUBA 3MJTA 2FKNA 1Y37A 2OK7A 4R8MA 2GZAA 3M6UA 4BJ3A 1WPQA 3M6IA 2ZAOA 4JSRA 4ZV7A 3S1LA 2C3MA 4UE6A 3ZI4A 3EN0A 1TCBA 2ROQA 1OX4A 1R0CA 3ZBPA 3EAGA 5G0WA 2PD6A 1JKJB 1P2DA 2O5RA 4IDBA 1KGDA 3NEYA 3QLUA 4TTIA 5BQOA 1L5GB 5KB3A 5KJ6A 3PFGA 4JC4A 2H52A 4EGFA 1QOZA 2FN8A 4BNVA 5B3KA 4ZT5A 2C5AA 1TKAA 1CIVA 1GZHB 1WB4A 2JASA 1CPYA 1BEZA 2PJDA 3FFWA 3KQUA 3VU3A 4Z9YA 4B3TB 2XYGA 2HNAA 1M2OB 4EYKA 1GD1O 4MRMB 5BUSA 3F5MA 3IMGA 4R3NA 4KN5A 4MWTA 4TMTA 2I1VB 3WY9A 3EGDA 1EBBA 4QTXA 2ZE7A 3EG9A 3G0IA 4AO6A 3QYJA 2DULA 3I6BA 4C0KA 5KMGB 1NF9A 2GUGA 2OM2A 4LI3X 2XHZA 4MAFA 4MROA 2XTJA 3CN7A 1XTTA 3FKJA 1DADA 1PG0A 3BB4A 2WZQA 5IJ9A 1ESMA 1HZZC 3NKVA 3U31A 2GJ9A 2PUTA 2JCGA 1ZITA 2JZCA 1SVWA 2DHEA 3PGJA 3UG6A 1YI8A 3OZAA 1VE7A 2QZ9A 2ZYWX 3EXHC 2ZI9A 4NCJA 3SYLA 1MENA 3VR0A 4DSNA 2CHFA 2KS6A 5DFAA 4HXFB 5JRJA 4YBZA 4IQFA 1F7VA 4C21A 1QAMA 2QN2A 3KZ1E 3PPWA 2ZXEA 1MJGM 4R2JA 1BMFD 4OHKA 4XQCA 2FZCA 3FCXA 2IWRA 2VT3A 4D4JA 2ADMA 1ZLYA 1AZWA 2SCUB 5FUXA 2ZVDA 3A37A 1KVQA 4QO8A 1Z4IA 4E1AA 1IQPA 4WINA 3TX2A 2RHCA 3GN1A 4Q02A 2O8FA 2XZLA 5ES4B 4UNNA 3SXUB 3TQTA 4YX9A 4EVRA 5E7QA 5EQJB 3KVRA 1AG9A 2GNOA 3FCSB 4MVWA 2XZOA 3SEFA 2B1QA 4YEDA 1B6SA 2B78A 4QBKA 4XLLA 4XM2A 3DBLB 3IDZA 2FMXA 1L7PA 5KU1A 1YHYA 4BQEA 4FQ7A 3TBFA 4MITA 2RGYA 3KTDA 4ILKA 1RYBA 1GSAA 5INTA 2I6TA 1YZYA 1YAHA 2WLSA 1D2AA 2FB9A 4PC3A 4DY6A 2HTFA 2CSXA 1QE5A 5K0NA 1E6MA 1A3CA 1KFBB 4RKQA 1N6RA 1MTZA 4WCFA 4HVCA 4TN5A 4YRZA 4MQMA 3D7LA 4D6XA 4IG9A 1RZ3A 3H1PA 1MEOA 4LTNA 2HSEA 2O0HA 4U00A 4URXR 1KZ7B 4O4HF 3IHLA 3VR5H 4MWZA 2BL4A 3E81A 4BUJA 5EIXA 3C6MA 3FRHA 1FP4A 3KT3A 1KJ8A 1JKIA 4P34A 5I4IA 2C07A 4NZMA 5EXXA 4NDAA 3AWDA 2QRMA 3SD7A 4ARZB 1V9CA 4QTYA 1WLYA 3BE8A 3OY2A 3W5SA 2LBPA 5K6AC 3GJQA 5ICFA 1XDSA 2G1PA 2IK8A 2C7GA 4DCNA 3KSDO 1XCOA 2BHLA 2BFDA 4AJLA 3PYXA 2P7HA 2HA2A 2VRCA 1L1EA 3EOAI 1SRQA 4XGKA 3L4JA 1Z2PX 3V8QA 4UHDA 4B7XA 4Q19A 3AZOA 5BXQC 2VH5R 2P5UA 1V11A 3EBPA 3FTNA 3FSGA 5IZ4A 3PDJA 3BD9A 4JR2A 3EDOA 3FNBA 2GRAA 2UXDB 4IIXA 3F5DA 1XZJA 3GEPA 1CJBA 4GVPA 4JT9A 4X8MA 5CXQA 2VH2A 3DWIA 1I5RA 3VPHA 1HNWB 4KN6A 4X9XA 3GLVA 4M1EA 4WLOA 4YRPA 3LOQA 3RUDA 4DR2B 4F21A 3EWAA 1G8YA 3PENA 5EP4A 3HVKA 4TM7A 3NHZA 5I7RA 4HUQB 2QIOA 1QX3A 2HJSA 2HV9A 3EEIA 1W4CA 2CUZA 4IFTA 1KI2A 2PG3A 4KOAA 4W5RA 5LD2C 1LRJA 1EQUA 1I2ZA 1OW3B 4QXPA 1PKEA 3GJYA 3CJTA 3PGMA 3GB9A 2AMLA 1FW6A 3EVCA 1EJ6A 3JS5A 2WFLB 2PMBA 2FEAA 1J00A 3O2QB 4HYQA 2XMPA 3ES9A 3JQ7B 3NONA 5A2GA 1ONBA 4DTCA 1A9ZA 4PZAA 4V0LA 3CH4B 4G4SP 1LNZA 3WK6A 4E09A 5SYNA 1GWNA 4CEHA 4UU1A 1DKQA 1RMTA 2WPDD 2NU9B 2QAGC 3U80A 1ZCAA 5TY0A 1ZMOA 1QE0A 3IKMB 3LV8A 3O4GA 3RWOA 5CH3A 2YMLA 3T9EA 1XPUA 2VPZA 4NF2A 2FVYA 1BVUA 1BXGB 2H1SA 4J75A 4UREA 3RSHA 1YZHA 2X9GA 4KMRA 4W63A 3MGBA 1RYZA 4GGMX 1L1RA 4F84A 1RXCA 2IV3A 1PHPA 1N5IA 1E1YA 4R16A 4BO6A 2QJFA 4QVGA 4R0MA 2Y6VA 1AGYA 4DQVA 3SQWA 5AW6A 1IOWA 1UM8A 1I30A 2ANCA 4OAQA 5C4IA 4X62B 3H11A 3KB2A 5J4YA 4QPCA 3ZIDA 2WUDA 3A2MA 3VGJA 3S7TA 1FEZA 1IK4A 4URZR 1NHWA 3EGVA 1UMCB 3KHUA 3NG1A 4I1YA 3VSAA 1PFKA 4F8YA 5K3SA 4DYHA 3EXEA 1GSHA 3EIUA 4IP0A 1OU4A 1HYBA 2D00A 1N8KA 1QZXA 3OICA 1I2BA 5DGXA 4DN6A 2OK8A 4TWRA 4BNJA 1X77A 1PR5A 3MWDB 3Q0EA 4NNOA 4BGIA 1G7TA 3C1UA 2B4KA 3KT6A 3I1YA 1DJLA 4PHFA 1T9GS 2R00C 4Y9SA 3NHFA 3EIXA 4KKXB 4IOKA 2QTZA 5FWXB 2VRWA 3LLCA 4K87A 1N2OA 4PXYA 1L7RA 2D8AA 2O3JA 3FOBA 1HOTA 1OTXA 3N2GB 2IBTA 2QPTA 1ULUA 1Z5PA 1ZOIA 3IC5A 4B0PA 4V0ME 5HBRA 4C2TA 1EXVA 1G3RA 2DLNA 3MGAA 4PQGA 3BEDA 3GRPA 4R8RA 9LDBA 4IKOA 2IKQA 3BSWA 3I62A 4U02A 2QAIA 2OFOA 1TYDE 3N8DA 2QROA 1MA3A 1G1AA 4NBSA 2IPLA 1U5CA 2CD7A 4FN5A 4URUR 3ROMA 2QLNA 4XDHA 5J23A 1PJSA 3P9SA 1LDMA 3T1OA 2A78A 2V3CC 2BWJA 1I4DD 4X64B 1EFAA 4L0MA 2YRFA 3HVIA 1NN1A 3Q7EA 1BOFA 1J0DA 3TD9A 3K0CA 4AJEA 4BBZA 3BHJA 4JOSA 5E3JA 4PLGA 3NHKA 4M1WA 3S81A 2H2AA 4HLDA 4CLOB 3GF4A 3DMYA 2GZ3A 1Z88A 4ZGBA 3WWZA 2CJWA 2E3JA 2ZFUA 1G7SA 2PO5A 3GGDA 3B53X 1KDVA 3RNLA 3NTXA 3SCZA 3TLXA 5ADVA 5I7WA 1U0TA 3RS0A 1P5HA 3R76A 4DGSA 3OE7A 4J16C 1S2LA 1JJ7A 1VA4A 3DFMA 3OSUA 2WZCA 2DQKA 4OAPA 1QE3A 2EKPA 2LW7A 4IZOA 5HM8A 1ONOA 2UYCA 4H2DA 2GPYA 2VLBA 4P4UA 4TXNA 3G6WA 1DELA 2IOQA 4TXJA 1Z83A 2GN8A 3BFJA 3UG7A 3OIGA 2NU6B 4MUYA 2PUEA 3MS2A 2J9RA 3VR4H 1KYQA 4OGFA 4ISCA 3R1IA 4TL6A 1JFVA 4UTPA 4EG3A 2VP4A 2QL9A 2GSDA 3WQQA 3NEPX 4BFVA 1EFLA 4CKCB 4Q1EA 1L7NA 1VDZA 4LWQA 1SHTX 2ZDQA 4M99A 4YRDA 4NPAA 4DAEA 4EB0A 2YY6A 1T13A 3QKUA 1EE1A 4PC1A 2V6MA 4X6YA 3KQHA 5L3SA 3EXG1 1D6JA 3GY0A 3RRJA 4LE1A 3ZCSA 1EDDA 3F7NA 2RK4A 1TA0A 3TSYA 5BSFA 2O8BB 4EKDA 4B2LA 4C03A 3GMDA 1NT2A 4YS6A 3RRMA 1MO4A 3R6WA 1SUCA 3PD0A 1U7OA 1PR0A 4Z99A 1BHQ1 1Y81A 3HY4A 4NY1A 5NLLA 4E70A 3IEVA 5FTLA 3HCBA 3ILHA 5DH9A 2HBRA 1IHYA 2PZJA 3W5CA 2XB2A 4XWTA 3CE9A 4Q0MA 1WRBA 8AT1A 1DJPA 3ESYA 1QGAA 2JA2A 3IP3A 1AS3A 1KEZA 4XTRA 5E95A 4QXAA 1PFYA 2Q99A 3A6JA 4L6AA 2VSXA 4QYSA 4RM3A 3G2PA 3VQTA 4HTAA 1OXMA 4IIJA 4JB0A 3SC6A 1XRLA 1CEYA 2L2QA 4FILA 1O57A 4Y1FA 5ALRA 5BQ3A 3OKPA 3THXA 4QICA 1VRCA 4BN0A 1QVRA 2B9VA 1H2XA 2QW0X 4UW9A 3RFCA 4WADA 2FW0A 1NVWQ 5I9IA 4DR7B 4QBGB 4JX9A 2ZU6A 1RYDA 4P9NA 1TVKA 1TVMA 4JIGA 4TXLA 1RT9A 2GDZA 1PSZA 3WGVA 3LLVA 1PD0A 2UUPA 2O50A 4B79A 4LYDA 1DCMA 1AQ6A 3CZMA 4KSBA 4PNPA 1QHHA 4PHCA 2NAFA 3DE7X 3Q4GA 1H2AS 3CMMA 1L4LA 2NSLA 3IIIA 1L5MA 3CISA 5AKYA 5D5QA 1JAZA 1XZNA 3RU9A 1Y1KE 4YJ2F 5M5BA 2R6R1 2BTQB 2GPAA 4YJ3A 2BI8A 1WBDA 3BD6A 1UP7A 3OF2A 5LYJB 4K6CA 1J8FA 2A1UA 5AW5A 2JI7A 3MJEA 2IIVA 3KZNA 2YY5A 3TNYA 2X8JB 4EP1A 5LP6F 1QVVA 3CZRA 4WLVA 4ZVSA 1Y3CE 3OQBA 4J2OA 5BR4A 4TLEA 1HE4A 3I73A 2CYAA 2JI4A 3F97A 3UMMA 1DTWB 3ZU5A 4N0QA 3QKRB 4J7AA 1YQ9A 1VKHA 1LPMA 1DE0A 4YMSA 4J0IA 5IARA 1ZISA 2H3EA 2AYXA 2AMVA 4HX9A 4IHAA 4ZFNA 2VJLA 3WMGA 4BFWA 3P2IA 4C4RA 5I51A 1H22A 3KLPX 1TCAA 2CJPA 3DGEC 4KWHA 4GR5A 4RV9A 4E5KA 2J5BA 4AUKA 4BNNA 2JLRA 1NI5A 1O3YA 1U9IC 6GPBA 2EHJA 2IYQA 1QIIA 3FNQA 1D2EA 2JGIA 2FMTA 3GLHE 4CRWB 1ZIYA 2O2SA 1IZ9A 3GPCA 2PIDA 4LX8A 3UKOA 5K4GA 4CQLB 4GOMD 1R88A 4FKZA 2Y0EA 4CI0B 3O4HA 2B69A 3NCHA 2Q7XA 2OQRA 2QRPA 2OP0A 2QXTA 3QXXA 4RC9A 1Y6FA 2ZT5A 3QUCA 3E5MA 1CY6A 2Q1XA 1JDSA 1IXSB 1PV2A 2BM0A 2W2OA 2XVXA 4Z9BA 5G1NA 3PYLA 4M8NE 1ZNYA 3OIWA 4OA8A 3NTVA 5DM60 1WQ4A 3PHLA 5MFPA 2JIZD 1RM4A 4LF6B 4PZZA 4PIVA 2C7BA 5I9MA 3ZWOA 3BGVA 3RTDA 1IWOA 2G9NA 3CT6A 1ZD4A 1VIVA 4B35A 5DBFA 2I1QA 4LJ6A 4S0ZA 4GQIA 1KEEB 4UUPA 2AIRA 3KPWA 4AX4A 1L4KA 5J43A 5CTAA 3KPYA 4TUYA 1AKMA 1PEYA 1T1JA 3E27A 5TSDA 3SJZA 5ANRB 4GL2A 1JLLB 3ITNA 1SURA 2IX3A 3K35A 3F6YA 4O0LA 5CK5A 4H7EA 1A8HA 4XVHA 3TS1A 1A9XB 4L4XA 4FZVA 5IDQA 2UZIR 1V35A 4B83A 1LVGA 4UNQA 4BTVA 3URMA 4HZIA 1KZYC 4FHFA 2X9LA 4JSTA 4QD3A 5ESXA 2Y3IA 4N3BA 2KHZA 1MF7A 2W2TA 3D0QA 1U2GA 4PONA 1TU4A 4CMKA 1P1KA 3KAKA 1CTQA 3I1FA 5T3YA 4Q7QA 2WHEA 3H5RA 4FDVA 4M2LA 4CV3A 8MHTA 1IOZA 1N92A 1WPRA 3R0ZA 4AS1A 3RLIA 4COKA 1M0EA 2PUCA 2P2LA 3V2IA 1W48A 2FQWA 4G8BA 4L5BA 3K0SA 1VSQA 1J1ZA 3V00A 4OX9Y 5DZSA 1Y3AA 4Y2PA 2RHMA 4HMPA 3LC2O 1YUBA 4E4RA 4YAGA 1A2KC 4LDNA 1GNQA 3IQEA 4KJXA 3ORRA 2BEVA 2X5XA 1Q22A 3F2IA 3UJ8A 1V1RB 3BQMB 3RBXA 1QU2A 3H9EO 1IIRA 1KBOA 2WA1A 3VPFA 5J1TB 2J5QA 4JI2B 2XV1A 3KAPA 3F1KA 1VSVA 3F6RA 1L4EA 2YXDA 5K0CA 1OWOA 5DW3A 3FYUA 4NS1A 1D1PA 4K6FA 3VO9A 5AIAA 4WCDA 3JZAA 1NYLA 2QT1A 4LJYA 4NXNB 3FFBA 1DEAA 4CTMA 3AB8A 3PTLA 2QD3A 3SC2A 3R4VA 2CUNA 2OB1A 2JJ1A 4KPGA 4AKIA 4EFDA 3CRNA 5HZHA 2J33A 3IQGX 1QORA 4UUNA 3INYA 2ADOA 1CF9A 3K0EA 3QVVA 4MEAA 3PQDA 4QZVA 1IY2A 3CPHA 3GUHA 4LHEA 1GKKA 1FYDA 1I9GA 1VE5A 2VF7A 3NNDA 3LHDA 4FGZA 2BGGA 3NHBA 1GXSA 4BIMA 2ZXUA 5CUQA 1NYRA 3O47A 5FL7D 3WMXA 4UHKA 4IO1A 1N6PA 1PJAA 2UXCB 2Q62A 4J1TA 4BFZA 3CLRD 1LDNA 2AVNA 4HJRA 2D4HA 4OQMA 1U02A 3ONNA 1ZUNA 4L5AA 4F3NA 1NJ1A 4P4SA 2GETA 3LX6A 3IEXA 3IMCA 3N3BC 4NOMA 1YMVA 2RHLA 2EP8A 1OFHA 1DAGA 1CNMA 3O83A 1OKKA 4TT3D 1K66A 3HL4A 1GFWA 3HKCB 4E5UA 3HVJA 3U40A 1EP3B 2D2FA 4I8XA 2OZVA 4FSHA 4J7CA 2FR8C 4UE2A 1GFIA 4KACA 4PX9A 4XGQA 4YECA 4CNQA 3CSSA 3DUWA 3R23A 1K4KA 2I3BA 3DB2A 4BMNA 4CIAA 2ZKIA 3AHEA 3HY6A 2HYIC 3PCXA 1SXHA 2NYVA 4HNGA 1RI1A 4LHXA 4RLHA 3PQ3A 5GZ1A 3I4CA 2XGGA 2D1TA 3R0JA 2HJRA 5BPHA 3ABZA 721PA 1DX6A 4KEAA 1U63A 4NCIA 3LT0A 1KYYA 3UOWA 3LQKA 2JH3A 1KYXA 3LQ4A 3K8ZA 5DF1A 4I5EA 4EATA 3G9ZA 3EJWA 5ICGA 1I7SB 4UE3S 4TKVB 5CJ2A 4DV5B 4PX2A 2HEGA 3E8MA 3HB7A 1H4TA 1D6NA 1NVDA 3KXPA 4IIBA 4P8RA 4AUMA 4L07A 2VWHA 3WSWA 3DHEA 2GQ0A 3KVNA 2B8TA 4CLDA 1IEXA 2I4NA 2CLFB 4I55F 4XH9B 2OM6A 1IONA 4JEUA 4E3WA 2JAUA 4MAMA 4CV0A 1C81A 3FCCA 5JEEA 2AKEA 2ZJ5A 1XQ1A 4LECA 2PR2A 3HJBA 2WTUA 1N2CB 2YS7A 4ENVA 4FMBB 4WBXC 3GIWA 1ZC4A 5GINE 5CD1A 2EOAA 4LTMA 2Y1LA 1VPEA 3QOFA 4QUKA 4RPCA 1VPLA 4WECA 5A5GA 4UHFA 1NSFA 3K6RA 5BSUA 4U9UA 5BSWA 2WTMA 4LMAA 4Y6RA 1TF7A 4IJ6A 5A71A 5C7LO 3OFNA 4U7GA 1Q1QA 4CKZA 5J4VA 1WMEA 2H0RA 2RJOA 3WYEA 3SGLA 1JHPA 3U9LA 1W4ZA 1JKJA 1DKMA 3MG9A 1HC7A 3F3YA 3L7DA 4MVXA 2VWGA 3RRYA 5M34A 1AU9A 2B7BA 3MZ0A 1OD6A 2VP6A 3TZHA 1S2MA 1Z18A 4B45A 1ZRMA 3U4QB 1T8WA 1HKUA 4I19A 4POOA 1WCIB 3GLFB 2OZLB 2CEKA 1E1QD 2ZAIA 3K5IA 3I4LA 4JJEA 1M2OA 5GM1A 5CAEB 3AWIA 2VL7A 4OM8A 4AP5A 4UTRA 1YS1X 4IRMA 2MSLA 4HN2A 4IVPA 4RENA 4ND8B 1JEQB 4AM8A 3K9GA 4X1OA 1P4RA 1XRRA 1RHQA 3A3YA 1ZVQA 3KBOA 1MN6A 4KDFA 5G0TA 1JDTA 4HO1X 1YH3A 1OLOA 4DV6B 4AJ9A 5EZQA 2C5HA 3JAWA 1EKXA 4PR0A 4WGGA 5KMGA 1HNZB 4OM7A 3HB5X 1PG5A 3U9SA 1OY1A 4ZZ2A 4B87A 4EDHA 2BSQA 1J9ZA 1IBCA 1KH3A 1I6KA 2EFDB 2WYHA 3H8VA 4IJVA 5CU7A 5KDDA 1CB7A 1A5SB 5EHQA 1HH4A 2FZ4A 4QDXA 1NKTA 4JT4A 2HF9A 3VR6A 2B98A 2F3QA 4I4IA 3HY3A 4A6EA 3PQ6A 3OJLA 3TUZC 3WGGA 1R66A 1YA4A 3U39A 2VZ9A 2JLQA 1VJ5A 4UCWA 1WB9A 3FB1A 3L92A 4LOIA 1CZOA 4N3GA 4FJ1A 4I4NA 1AK2A 2RG7A 3U3KA 1BFUA 1FRVA 1SD1A 1CSEE 2QZJA