1L7AA

Structural genomics, crystal structure of cephalosporin c deacetylase
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
318
structure length
318
Chain Sequence
MQLFDLPLDQLQTYKPEKTAPKDFSEFWKLSLEELAKVQAEPDLQPVDYPADGVKVYRLTYKSFGNARITGWYAVPDKEGPHPAIVKYHGYNASYDGEIHEMVNWALHGYATFGMLVRGQQRSEDTSISPHGHALGWMTKGILDKDTYYYRGVYLDAVRALEVISSFDEVDETRIGVTGGSQGGGLTIAAAALSDIPKAAVADYPYLSNFERAIDVALEQPYLEINSFFRRNGSPETEVQAMKTLSYFDIMNLADRVKVPVLMSIGLIDKVTPPSTVFAAYNHLETKKELKVYRYFGHEYIPAFQTEKLAFFKQILKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cephalosporin C deacetylase
publication title 1.5A crystal structure of the Cephalosporin C deacetylase
rcsb
source organism Bacillus subtilis
total genus 109
structure length 318
sequence length 318
chains with identical sequence B
ec nomenclature ec 3.1.1.41: Cephalosporin-C deacetylase.
pdb deposition date 2002-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1l7aA00
1P0IA 3C8DA 1BE0A 5ALYA 1MAAA 1MN6A 2BUBA 3V1LA 4WDRA 4H18A 4DMCA 4LKOA 1R50A 1AC5A 1EK2A 3OTQA 2FX5A 3EBLA 2GYWA 4KYVA 2WHPB 3ICVA 4AXBA 3N0TA 2Z5GA 1MNAA 2HFKA 1YCDA 3DOIA 5K3FB 4Q3OA 4DIUA 1ZD5A 4IQ4A 5DJ5A 1UFOA 5ALPA 3MVEA 5AM4A 3BL8A 4DYHA 5FLKA 4N8DA 1E8DA 5JANA 4EBBA 4B0OA 3FVRA 1QIDA 2BGRA 4HVTA 2V98A 4A16A 1CV2A 2EEPA 1GKKA 1XKTA 5LP1A 2HFJA 1K8QA 3R3WA 1UOQA 3QMWA 2D5LA 4ETWA 4W1RA 3B12A 5IVIA 1EDBA 2RI6A 5AI4A 1ZICA 2OPHA 1P0PA 3WK4A 4QDTA 1MT3A 2HA0A 4H7HA 2PPLA 3M82A 1DT5A 3I2HA 4CCWA 3IULA 1M33A 1CUGA 4J0KA 1BROA 4G4JA 3I2GA 3WWCA 4FMPA 4GDMA 2C0QA 3EQ9A 1AURA 3FAKA 7YASA 5IVKA 5AOBA 3BF7A 3VDXA 1TRHA 2ONCA 1HPLA 3HSSA 4PQEA 2QKYA 3SX4A 5JZBA 3DL4A 4UBKA 2WU3A 3WWDA 4H7DA 5E4JA 1A8QA 1WOMA 5CURA 5AKXA 4Y2PA 2QZPA 1QJ4A 3PICA 4F21A 3AIMA 3G0GA 3ESCA 3C5WP 4X94A 1DU4A 4HAIA 5JADA 4QZVA 3F98A 2XUPA 5K3BA 4E15A 2RHTA 4G8DA 3OG9A 3I6ZA 3ILSA 2DQYA 4BRZA 4AX4A 3WA6A 5CXXA 4UHCA 5LZ9A 2ZJ7A 3HABA 5DNWA 4BE9A 2XMZA 2I78A 3WWPA 1XQYA 2ZVDA 5YASA 2O7VA 4GLBA 1JKMA 1GPKA 3ZI7A 1GKLA 1LPPA 3PFCA 4GHWA 3STUA 5ALTA 2GBCA 3IDAA 4Y2QA 4V2IA 4X95A 1XZHA 1S8OA 1NU6A 4PNZA 4B81A 3H2IA 1A7UA 4K6HA 1XQWA 3GA7A 1CQWA 1ODCA 5EHZA 4W1QA 2XQGA 3L1JA 2PSJA 3DDUA 4B9AA 4INZA 1ZD3A 2R11A 1WHSA 3A6ZA 4DNQA 3ZV7A 5AM3A 1H22A 4C4YA 1UXOA 3OURA 4OYLA 4LIPD 3H1AA 4B83A 1WCYA 1XLUA 1J07A 1UOOA 4NZZA 4MWTA 2PBLA 2GBFA 4WFKA 1IUNA 1QIEA 1GQRA 3AZQA 1W6RA 4AN0A 3VJMA 1LPMA 3VJKA 1VJ5A 3STYA 4FWBA 3DQZA 2PKYX 1K5PA 4Y2JA 3D2AA 3JW8A 4MXDA 1PJAA 2RGUA 5AKKA 2WUGA 5ALIA 2XUGA 2H7XA 4DNOA 3BE8A 2DHDA 1P0MA 3BDIA 3D2BA 3ESAA 1AMNA 4EY5A 4I19A 4WY5A 1WPXA 4GBGA 1UK9A 1ZI6A 1MNQA 2HA7A 3DD5A 4FLEA 2HDWA 3HRHA 3CCBA 4B84A 5E2IA 4K5QA 2WFLA 3G9TA 4LXGA 1AX9A 3I1IA 1CUCA 3RARA 1YB7A 4A23A 1VA4A 3QVMA 2XE4A 3ANTA 2XMDA 4TGLA 1GZ7A 4MQLA 3IVMA 2G63A 1LNSA 1RYYA 4HS9A 5DNVA 1VKHA 5ALNA 4Y2XA 5K3AA 1LBSA 4WDQA 2XQJA 4Y2YA 3DOHA 3C6YA 1VE7A 2QUBA 1XZKA 5ISMA 1CUVA 2DR0A 5AK5A 1CPYA 3H2HA 3H1BA 2AJLI 4UHHA 5T4BA 5HZGA 1FFCA 1UT6A 1KU6A 1DWOA 5JD4A 2WKWA 4N8SA 2J3QA 5AKIA 2ZYSA 5AKJA 2VTVA 1DQYA 5AHXA 2XLBA 2I3ZA 1P0QA 1QIJA 4J03A 4AMZA 4UBNA 3EQ7A 4LYDA 4J3JA 5EIAA 5CH5A 3G0IA 3KSRA 2ES4A 4J0IA 1T2NA 4MJ3A 2XUDA 4FFVA 1DT3A 5C8ZA 4IH9A 5JATA 1U8EA 2PU7A 1YS1X 2DFPA 4OU5A 2VATA 2XMGA 5A7HA 5T4EA 5H3HA 4BYMA 5CXUA 2CJPA 1BRTA 1X2BA 2HM7A 2FJPA 2DCMA 1THTA 5K3CA 2FUKA 3HJUA 3X3HA 2AJDA 5EIHA 1ODTC 5E4YA 4PSCA 3WL5A 3PF9A 5AKGA 3A2LA 2JGFA 1J2EA 3N2ZB 3GZJA 3QPAA 4EY4A 1CUBA 4AQDA 1R1DA 4I3FA 3WZMA 3IUQA 1Q83A 4H77A 4UPDA 2WIFA 1QO9A 2V9ZA 2JF0A 3PF8A 4ZRDA 1CQZA 4DMKA 3WL6A 1IZ7A 1SOMA 5T4FA 5HQ3B 3QMVA 5CRIA 1OCEA 1Z68A 2GBIA 1QE3A 1XZIA 4CIAA 5LIPA 4UBMA 3BF8A 3LP5A 5AM0A 4Q3LA 3VKFA 3SWWA 4DNFA 1QZ3A 2WHPA 3DKRA 1VZ2A 1DTEA 5K3DA 4K6KA 2IX9A 4BTVA 2ACEA 3A2NA 4EY8A 2VJBA 1YR2A 1H23A 1VZ3A 3FYTA 3WKDA 3T52A 1Q0RA 4RE6A 4FHZA 2C4HA 5CT5A 3BJMA 2JGKA 3BDVA 2VT7A 3HYSA 2VT6A 1XFDA 5D7BA 1T4MA 2WTMA 3OPMA 1L7QA 2OXEA 1H2WA 5LZ2A 1HBJA 1XZEA 3C45A 3LS2A 4NS4A 2WIGA 1R88A 4C4XA 1TCCA 1CUWA 1LPSA 2IITA 3ANSA 3IBTA 1XLVA 3I2KA 1FFAA 5ALEA 2QMQA 4ZXFA 2JBWA 1USWA 5BWCA 5DYWA 4DNPA 4EHBA 2PSFA 3AIOA 3G7NA 3WKCA 4I4CA 3WKEA 4BP9A 1ZD2P 5HFNA 1OXMA 3STXA 5JARA 3H04A 3V1NA 4BCBA 4NVRA 1UKBA 1U2EA 2WILA 4W9RA 2BAGA 5EGNA 1IUOA 1DWQA 3G9XA 2RONA 3FSGD 4JH0A 2HRRA 1ORWA 2PVSA 1QGED 2BCEA 2BUCA 3DJYA 4U2CA 4FNGA 4UHBA 4DM7A 5CBKA 1WB4A 1I6WA 1A8SA 1LPAB 5ALLA 3ESDA 1QTRA 4AO8A 1H2ZA 4H7IA 5A71A 4P93A 4C01A 5CT9A 5LZ7A 2RHWA 3E4DA 4QEKA 2BUAA 4PV7A 3O0DA 1VXOA 2WSLA 4Q1VA 4RNCA 5HF5A 3CN9A 1EDDA 5AM5A 3DYIA 4XVCA 5C8VA 4H7EA 4F60A 1A8UA 1U4NA 2ROQA 4LYEA 1UWCA 3GFFA 3G9UA 1QIGA 1VA5A 1QONA 1W76A 1N5MA 2HA5A 2C5GA 1LBTA 5JD5A 4KACA 3KWJA 1ORVA 1BN6A 2QOEA 4DLNA 3O4GA 4J0GA 3O95A 3VXKA 4OPMA 4FTWA 5LKRA 3T4UA 2VEOA 5BOVA 4Q34A 5AKEA 4X91A 4BATA 1EX9A 3EQ8A 3WK9A 3RLIA 3VVMA 1N5RA 5D3KA 2GYUA 1FFEA 3S2ZA 2CZQA 4PSDA 1IZ8A 3ICWA 1XZAA 3EF3A 2WG1A 1TCAA 4FKBA 4BCDA 3R40A 2PL5A 3R3YA 4KJXA 5D3ZA 5HF8A 1CUYA 1BCRA 1CUIA 3Q0TA 1IUPA 4ITVA 4KRYA 2J3DA 5DYYA 2XUIA 4H7JA 4N5HX 3U1TA 2XUFA 4QDZA 1Q0ZA 5HKBA 2PSDA 1MO2A 2Y2VA 2CEKA 2DSNA 4UBJA 1G42A 5LYYA 4E46A 2PSEA 1X70A 4HRXA 2V97A 2YYSA 4Z49A 5FUMA 5AP9A 3FLBA 1XZCA 3H0CA 1THGA 4EB0A 2OCKA 5K3EA 4G4IA 4K2AA 3QZUA 1AKNA 5FPQA 4C4ZA 4B82A 4P08A 4OU4A 4P92A 2QXTA 5EHQA 5AJHA 3WKAA 3TEJA 5EHNA 1XRRA 4UHFA 3K6KA 4MYSA 5J3JA 2VJAA 2I3DA 1CEXA 4G4GA 3TJMA 3O4IA 2QS9A 2EDCA 4NMWA 5JD6A 4X97A 1UK8A 1EVEA 5AI5A 5DYTA 1JU3A 3TGLA 4CFSA 4PF1A 5FKJA 1EDEA 3WWOA 4FOLA 1TCBA 5F4ZA 4OUKX 5AIBA 2WIKA 1E5TA 5AI6A 4CCYB 4Y2TA 3AINA 4EUSA 4H7FA 2DHEA 1LZKA 5HK9A 1ZJ5A 1CR6A 4QLAA 4F0JA 5KWJA 3IUMA 4BVLA 3IUNA 3FYUA 3F97A 1XQVA 1YA8A 4UBOA 4N8EA 1QLWA 3D5EA 3VVLA 4TPKA 3WLAA 2B20A 3U0VA 4BZWA 5HCUA 4BTLA 5EIEA 4IH4A 2BFNA 5T4HA 2W22A 4W1PA 4L0CA 2OGTA 5DNUA 2XUAA 3R41A 1EA5A 4X6XA 5C7YA 2WJ4A 4UBLA 3H19A 5CW2A 1KU0A 4AB1A 5FXMA 1WHTA 3M83A 2HU5A 2VSQA 3WIBA 3QMMA 5KREA 2XUOA 2QR5A 4U2FA 1SFRA 2DHCA 2GYVA 3FCYA 5FOQA 1Y7HA 2WTNA 2OQVA 1XQXA 3RM3A 3WKBA 1H2XA 2YASA 3I2JA 2QUAA 3IURA 4UHEA 3MGAA 1JMYA 4ZI5A 2WM2A 4FBMA 4MEBA 3STVA 5CMLA 1W1IA 3WIOA 4ZWNA 3O9MA 4HTAA 5CH8A 1CUUA 4UHDA 3WMRA 2Y1KA 4BB0A 3JYHA 4N5IX 4G9GA 4Q05A 4FDMA 3PFBA 1MTZA 4C6HA 3QITA 4G8BA 1JFRA 3NWOA 4UBIA 4X7BA 4C88A 1HLGA 4RPCA 5AOCA 4K6GA 2GBGA 1XRNA 3HEAA 3WK5A 4KE7A 2QJRA 2V96A 5ALFA 3WZLA 4ARBA 2X5XA 3V1MA 2ZYHA 1Y37A 1WB5A 3CXUA 1JU4A 2CUTA 1GPLA 1LPOA 1Y7IA 1UK6A 4B7ZA 2XQKA 1XZDA 3WJ1A 1XZFA 4BE4A 2AJ8A 2O2IA 1ODSA 2PM8A 3W9BA 2NW6A 3NUZA 1WB6A 3GUUA 3H18A 3WK6A 4J0DA 4AN1A 4PO3X 1R4ZA 3B5EA 3HACA 3C6ZA 2CBGA 5LZ4A 2WUEA 4FBLA 1C7IA 3MUNA 4U2DA 2LIPA 2WFZA 4OB8A 2E3JA 5A7GA 1CRLA 4EZIA 4DMHA 4X71A 3C87A 3PE6A 1FJ2A 4G1FA 5CT4A 4P9NA 1XRQA 4BDTA 5AI8A 3DCNA 4WY8A 4FNMA 4QDXA 1QIMA 5I8PA 4DTCA 4H35A 3WWEA 4FFWA 1B6GA 2WJ6A 3H2KA 2VAXA 4BAGA 3AILA 3NOXA 2XMRA 5LKAA 3H2JA 1IVYA 3UUEA 1YS2X 4IHAA 4WJLA 3QH4A 4HRYA 4QLOA 2ZYRA 5AK4A 4L72A 3I2IA 1XRLA 4L9AA 2PUHA 2ZJ6A 4BAUA 4U2GA 1E89A 1EXWA 4QWWA 3D0KA 4X3CA 1XRPA 3C70A 1MX1A 4QWMA 2XI4A 3ZPXA 1CUZA 4X92A 4EY6A 3FVTA 4IO0A 3I6MA 1SC9A 2XUHA 2Q0XA 1SCKA 4BZZA 1QTIA 3B3QA 1EB9A 5K3FA 2GZSA 3RKSA 3PUIA 4OD0A 3QPCA 4Q3KA 5EHXA 4JEIA 3QBJA 1RP1A 1TK3A 2YH2A 1WM1A 5A62A 2EDAA 4AO7A 4TVKA 1CUFA 5D6OA 1CIJA 3DNMA 5AKLA 1EHYA 3DS8A 1CVLA 3K9BA 5EFZA 2QRUA 1EINA 2JEYA 2PSHA 2VA9A 3E3AA 2B61A 2O2HA 3BIXA 3LIPA 1K63A 1N8SA 1NX9A 5ALSA 4M0FA 5JAHA 1DQZA 1AUOA 3SC2A 1CUXA 2QVBA 1B41A 2HL6A 4UFNA 2QM0A 3C6XA 3V48A 1ACJA 4Y2UA 4OSEA 5AM1A 2C0PA 2JGEA 2Y6VA 1LZLA 5A2GA 3TRDA 3KD2A 3UMJA 3LLCA 4LXIA 3HZOA 3G02A 2DQZA 1EVQA 4RE5A 1HDEA 5HFAA 5ALGA 4ROTA 4HXEB 1UKCA 2WHRA 2QXUA 3FBWA 4H7KA 2XUKA 1G5FA 3W9UA 1QFSA 3K2IA 5AH0A 2HA4A 2XDWA 3CN7A 3IA2A 4J7AA 4YASA 5C81A 1CUEA 5ALHA 5AKHA 3LIIA 3BIWA 2OCIA 5FRDA 4XX1A 1OILA 4X90A 1YAHA 6YASA 1YAJA 4JNCA 3DL7A 3H2GA 3E1GA 5DLPA 4Y9SA 5CH3A 5AI9A 5IVDA 2VQ6A 5SYMA 1JJBA 4CCYA 2OGZA 4F5ZA 4YPVA 3I1YA 2Y6UA 2VF2A 3WQHA 3BWXA 4DGQA 1DX6A 5DWDA 5CTAA 1JMKC 3WK7A 4G8CA 3F67A 2Z8XA 3ZLTA 2BJHA 4KE6A 4CG1A 4S0XA 3R3XA 1GGVA 2W6CX 1ZOIA 1TIBA 3OM8A 2CKMA 1PV1A 4J0HA 2XUQA 1DWPA 2O7RA 2JIDA 2HU8A 2AJCA 4Y2VA 4GW3A 1XZMA 2I03A 5HF6A 3DLTA 3AFIA 3D7RA 4KE8A 2C7BA 1R9NA 1QIFA 3QPDA 3FWHA 2HU7A 4JYPA 3HLKA 1CUSA 4KRXA 2P8SA 3BXPA 3HC7A 1E8MA 3ZLVA 1F0NA 5EI5A 5CT6A 5KWIA 5LZ5A 4OCZA 1JJIA 3WK8A 1GT6A 1X2EA 4GECA 2XMSA 1EI9A 4B9EA 1SCQA 2HHAA 2GZRA 4MEAA 2JGJA 1J06A 1UK7A 2OQIA 2XLCA 1HKHA 1D07A 1HL7A 3O9VA 2ZSIA 4CIBA 5AI0A 5ALRA 3G0DA 1E66A 3FCXA 4H0CA 4X93A 4C87A 1GPNA 2H7CA 1QIKA 1YASA 2HA6A 5C8XA 1BS9A 2ACKA 1VLQA 3WYNA 4UUQA 2XMCA 3STTA 3LCRA 4UFPA 3I28A 2JEZA 2G4LA 3D2CA 3V9AA 2WIJA 2WG2A 4W1SA 2H9YA 3A70A 4BAZA 5ESRA 3P2MA 1MX9A 3G0CA 1ZIXA 3Q8WA 4L3WA 1FFBA 1NU8A 3PUHA 4DMFA 5LLSA 4ZV9A 1BCSA 3F8SA 2CMFA 4A5SA 4CG2A 3OC0A 3GROA 1JT2A 1AGYA 3JWEA 1C4XA 3R0VA 1O6GA 2OG1A 3NGMA 3G0BA 4XIIA 3QYJA 4BC1A 2VJDA 5AICA 2RAUA 1R9MA 3DKKA 5ALZA 4MYDA 2HA3A 1ACLA 3IUJA 4CI9A 1BN7A 1CUAA 1U65A 3PDCA 5JAPA 1A88A 4X00A 3KXPA 4ZGBA 4KR0A 3FLEA 5DTJA 4FLMA 2J4FA 3ZLUA 5ALJA 4RGYA 1ZGBA 4HXGA 2OCLA 2OAGA 4J0JA 3HI4A 5ALWA 4BRSA 3G8YA 3WJ2A 5AKYA 4ZV7A 1EH5A 5FP0A 2J4CA 4G9EA 3YASA 3G9ZA 4B6GA 2WFMA 4DSZA 5A7FA 2BGNA 3FYUC 1SCIA 4JYMA 4LXHA 4HXFB 3PI6A 5LZ8A 4OYYA 1XKLA 1K4YA 1YA4A 4EY7A 1CFJA 2WU4A 1QIIA 3AUKA 4BP8A 1CUHA 3BJRA 1CUDA 1GXSA 4EA6A 4WFIA 1PFQA 4ARAA 2IIVA 3HXKA 4PW0A 4ZREA 4Y2SA 4C89A 2WLSA 4Y2RA 1ZIYA 4QDOA 2JGIA 5ALQA 1QOZA 1MAHA 3W05A 2QT9A 4PSUA 3D59A 3L1IA 1MX5A 5HQ3A 2B4KA 1W52X 4AZ3A 1GQSA 5ALOA 2AXEA 5A6VA 1DINA 5JYCA 2XUJA 3VJLA 4BDSA 4BVKA 3CCCA 3WL7A 2FJ0A 4DSAA 4BVJA 3KWFA 1VOTA 2QTBA 4B85A 4UFOA 2ZYIA 1XZLA 1LLFA 4YK7A 2WJ3A 5AO9A 2PU5A 3M3DA 3IIIA 1G66A 1XROA 5AK3A 4U2BA 2C5FA 4XWGA 3QM1A 3I2FA 2OCGA 4O08A 1QO7A 2WHQA 5KBYA 5JIBA 4BBZA 4YX9A 1N1MA 2X8BA 4AO6A 4X85A 3WI7A 2UZ0A 5JALA 1L7RA 3E0XA 1BU8A 4MWSA 1W75A 3AZPA 1VE6A 2XQIA 3D3NA 5CT8A 2BKLA 4D9JA 2JGLA 4QE3A 3W06A 1XRMA 2K2QB 4OB6A 3R3VA 5ALDA 5K5EA 1UOPA 2C58A 3O4HA 4G5XA 1G4HA 3ESBA 5FV4A 1FFDA 1BEZA 5ALXA 1XZGA 1XLWA 5AOAA 1YSCA 2AJBA 3A2MA 4LHEA 3C8HA 3EIOA 3SK0A 4U2EA 1ZJ4A 5ALKA 3OOSA 1IMJA 2OLEA 4KE9A 4QA9A 2PUJA 4HZGA 3FLAA 2QJWA 3DEAA 3FYUB 4XJVA 3KDAA 3D4LA 4M0EA 2XQFA 2XB6A 2O2GA 1MJ5A 3RK4A 1RWQA 1LPBB 1K6EA 2JGMA 2D0DA 5SYNA 4Y7DA 3W2TA 1QFMA 4M0MA 1CLEA 5FDFA 3W04A 2G5PA 4X6UA 5ALMA 2WUDA 2Z3WA 3WA7A 1J1IA 4CG3A 2ORYA 3AIKA 2HIHA 4E14A 1WPRA 5FPPA 4JUIA 2XMBA 1HQDA 1W4LA 5JAOA 1UZAA 4KAAA 1UKAA 1XZBA 5JASA 1MU0A 2HA2A 2VJCA 5BV7A 3S8YA 2B9VA 2WG0A 3ED1A 4E11A 4QNNA 1CUJA 2HRQA 2Y2UA 2PX6A 3V1KA 1LGYA 2OGSA 3DYVA 4KAJA 1E3QA 1XZJA 5E4TA 3L1HA 2HADA 1ZGCA 2WUFA 1ISPA 4B80A 4AMYA 2H7YA 1AQLA 2WFLB 4KEAA 5AIAA 2ZSHA 3O4JA 3C6BA 2RIPA 4GWLA 3VISA 1ZI8A 3F96A 4WCVA 5JAUA 2XT0A 1R3DA 2WIDA 2CB9A 4X6YA 3KOOA 1FSSA 3F9CA 4FLFA 3R3UA 3MUOA 4GI1A 5AM2A 5HK8A 4AZ0A 1F6WA 5BWBA 1C7JA 3FNBA 5I7UA 3AJAA 4GXNA 4IH1A 3STWA 3FSGA 2YXPX 1Q84A 3C43A 3C5VA 1H2YA 1F8UA 4W63A 2Z8ZA 1ZI9A 3ZWQA 1TAHA 3FOBA 4QDUA 4BC0A 2G5TA 1ETHA 1F0PA 5JZ9A 3GBSA 5HKAA 1EK1A 1QIHA 2R8BA 3WYDA 3I6YA 1BEEA 4J0CA 1L7AA 5ALUA 4B0PA 1LPNA 2ZJFA 3GELA 1MPXA 2Z3ZA 2OAEA 1VXRA 3UUFA 5I9IA 2WQZA 4OB7A 5IVHA 4Q82A 5DTIA 1TKRA 5HF9A 4KAFA 3AZOA 1DX4A 1AZWA 4WFJA 1ZD4A 4GEGA 3R3ZA 3H17A 1EB8A 2VAVA 5AKZA 1JJFA 5IKXA 3WL8A 2X76A 3IB3A 3M81A 2ECFA 5JZSA 1YB6A 1JI3A 2H1IA 1E8NA 1O6FA 5ALVA 5IH7A 4BCCA 2XMQA 1KEZA 1TQHA 4MQMA 5AK6A
chains in the Genus database with same CATH superfamily
1NW8A 1DAPA 1SKQA 3NEPX 1C9JA 4IL5A 3SS8A 1CCWA 3O3CA 3GRAA 5FLYA 3JQBC 3O82A 1MN6A 3ST7A 3CF0A 2BUBA 4FOSA 4GPZA 1QRAA 1LF0A 4BWGA 3PPYA 4C4TA 4DIBA 1KHHA 3H1EA 3PFHA 4RDCA 3HGQA 1B0ZA 4LKOA 1W5TA 2FQQA 1AC5A 1XP8A 3SC6A 3B2NA 2WJGA 3AJ8A 4YC7A 3F8TA 2WU8A 4M1QA 4EJFA 3QTLA 2R8PA 1XVIA 4HAWA 1J9GA 1M54A 2VDJA 2I2DA 1LVHA 2WHPB 2ID9A 4IOJA 1Z83A 1CQJB 3G6WA 4OQXA 4YCNA 1NW7A 4BNVA 5E7JA 2HFKA 1Z0UA 4EUKA 2FWAA 5EVCA 3AEKB 3EJWA 4MI3A 4RZQA 4DIUA 1IG3A 2FUNB 3Q40A 3TDNA 1ILWA 1X9GA 4KQ1A 2H5JA 4JWKA 3MVEA 4LXXA 5AM4A 1ZUD1 1NIPA 2G67A 4RHFA 5FLKA 3PEYA 5IT4A 1H5UA 5EUCA 4B0OA 3QEMB 3V2HA 3L8CA 4FW8A 5TQ0B 1H3NA 4LF5B 3NTRA 3K9NA 5EVJA 3CWQA 1YR7A 3GUCA 1KMIY 1VPEA 1XKTA 3FGPA 3R3SA 5LP1A 1K8QA 3KQVA 3R3WA 3RUFA 3UF0A 4B3JA 2FUG6 1NW3A 5A5VA 5CEEA 1GRVA 3CUKA 2H4YA 5ES4B 1AKQA 4QUDA 4BQOA 3KSDO 9LDTA 3B12A 4QBTA 4DPLA 2RI6A 2G76A 2XF8A 3Q8KA 1G21B 1Y3CE 2N47A 2OHOA 3IPXA 3NJ4A 4ND2A 4R8KA 3FNRA 4LJ8A 2O8CB 1X15A 4F5YA 3HCEA 3NKFA 1OXXK 1PD0A 4MQ6A 4P34A 2GHQA 1P33A 3L7DA 2PPLA 4Y6GB 1WMBA 4YQZA 4KNWA 4I4TA 3WLKX 1E6UA 4RKRA 2BDTA 5C7IO 3CLVA 3I2HA 1WABA 1HE2A 3A9TA 5GOTA 2EP8A 2LKDA 4IIGA 3TM5A 1UPTA 4FOOA 3U16A 2W2XA 1CUGA 5ECGC 2DFLA 4GE0A 5EZYB 4K81B 3E9ZA 3I2GA 3GLTA 1MTOA 4V0MA 5JXJA 5BMVA 2LV8A 4GDMA 2X2PA 4H15A 4C3OB 4QIHA 1IK6A 4WLUA 4GFDA 3EQ9A 3RIMA 3SZMA 3VR4H 1NUHA 5A4FS 3HTXA 4OJMX 5EFOA 4ETMA 2Q28A 3E03A 4LG1A 4L28A 5T67A 1FS4A 4URUR 2JZOA 2FUG1 1N5IA 3CF6R 4FR0A 1P2VA 3W6NA 1VSBA 3OIUA 5LOVB 3CLTD 1DTWB 2I54A 2QD4A 4XM1A 4OMDA 4RF3A 3HKBA 3SZLA 3DL4A 3O0TA 4C30A 5AW1A 3IT0A 2WU3A 3WWDA 5E4JA 2Q3LA 4HG2A 4CF4A 4Z1OA 1YIAA 4FC7A 1WOMA 5F3DA 1L7MA 1WZEA 4C21A 3R3HA 1IN5A 1L7XA 2B37A 4ND7A 3UJCA 4LSGA 4WE3A 1GNTA 1KK3A 3DMTA 4KUHA 4UVDA 2BKVA 5B30A 4ZDIA 4F21A 1OGYA 2A6PA 2WLTA 4C14A 2VDLB 4CKWA 1BHJA 2RH9B 4IIUA 5K20A 2QGNA 1UP6A 2B36A 4ER5A 2Q50A 5KU1A 1EDOA 4QEDA 4XD2A 4NOMA 5ES3A 1V5WA 4JROA 4QU5A 3TLBA 1DU4A 3F5QA 4UQPA 1Q77A 2R62A 3PCRB 4ZQBA 1Z8NA 5C0OE 3QX3A 5C52B 1KFEB 1VL0A 1TK9A 2GAIA 4GX1A 2XKKA 1Z3CA 1HM5A 2Q4EA 1PWEA 4L51A 4F6CA 2IVZA 4E15A 5JMWA 2GT1A 1EFPB 1SBIA 1CQPA 3D7KA 1OYVA 4CLOB 2RHTA 4G8DA 1P9LA 4RK7A 1A4RA 4I36A 3PX3A 4MVJE 3UJ8A 2GJ8A 2JVJA 3LKZA 1ENYA 3HR8A 4I5FA 3EC2A 3NUQA 3HB1A 3JQAB 4U7PB 4WZAB 2CNDA 2DQYA 2YOHA 3AUAA 2Y1CA 3KFXA 4BJHB 3C0KA 4BRZA 5EJ5A 3GPLA 2BPOA 2UZ1A 3F6YA 3SYMA 1W7AA 3IQGX 2JI4A 1QOPB 2ECOA 4XCXA 4BNKA 2FN7A 3A9CA 2WVGA 3DVRX 3KVOA 5LZ9A 4R2HA 2F48A 2PJZA 3I04A 1K8ZB 5EYPA 5A9SA 1QV9A 1ZITA 3L8ZA 1V48A 2IPLA 1LB1B 4OLFA 4PWZA 1O0SA 2ZVDA 4WSOA 1PFGA 3LW7A 3I6BA 2CXTA 1QR6A 2OB1A 3B82A 2O7VA 5YASA 1YR1A 1AKEA 3BEDA 3OZRA 3ELWA 3NR2A 4NMMA 4NFHA 3IESA 1YZNA 4MS3B 1MOSA 2BFCB 1XDWA 3QMPA 1IUKA 1P4JA 1GPKA 1MDFA 1ML3A 2QYTA 3CX8A 3ZI7A 1QGYA 3AHIA 4HO1X 4AUKA 1FUKA 3E9EA 1V95A 2D1QA 2WSYB 1V41E 1KK1A 3GFVA 3QVGB 2LCIA 4KQCA 3U7EB 3PDUA 3WGIA 2O3UA 1E7RA 3DLAA 5ALTA 4YP6A 4RETA 2FEPA 4J3NA 4B47A 3OPQA 1JEQB 4TV9F 2RB5A 4M1TA 1PF7E 4JBYA 1R8QA 2FFJA 1S2GA 2VTEA 4Q0MA 3THWB 3O84A 1SELA 1PS9A 2ZPTX 1CNMA 6REQA 1LFAA 4X95A 1Q22A 1AQNA 1JQDA 5LYJF 5LMCA 1OR8A 2E82A 2AC7A 4C22A 2R1ZA 4WMLA 4KXVA 1XE3A 1I14A 3LSTA 5C31A 1NU6A 2GK6A 2JVKA 4YHBA 5HE8A 1SZJG 1UXGA 3I0NA 3FZYA 4B81A 1DLIA 1P72A 4M36A 4BGDA 1DP4A 4JENA 1ZJJA 1ZOOA 1UKEA 3ZBPA 1LLQA 2V6FA 1JSLA 3DZJA 3FPFA 5HDBB 2R8YA 4RKEA 3ROFA 2YVLA 2PKRA 2EFCB 2H0AA 4W1QA 5EHZA 1KKMA 1OV6A 1P2DA 2Z9BA 3LT5A 4XDHA 2DETA 3OZEA 4BBAA 5IJ0A 1ZD3A 3MWFA 4ZT6A 1WHSA 1B43A 3T34A 4U9HS 2ZM6B 1LBEA 1WTAA 5DI9A 4DNQA 3HJFA 1H22A 1IN1A 2AOWA 3GT4A 4RDIA 1SUBA 1UXOA 1W4RA 3IQHX 1H5NA 3PFFA 4LIPD 1GPDG 1WCYA 3CUWA 5BYJA 3X1XA 1T5HX 1Z8DA 5CAEA 1ZIOA 1FNMA 3OMXA 4L3VA 1OX4B 4MWTA 1ZZGA 3AM5A 3GJ4A 3NHKA 3O83A 1IPEA 2PBLA 3N28A 4REMA 3WGZA 1RZRD 5HUQA 1DXQA 1HDOA 1OHHA 3E2PA 1QIEA 4WJKB 2TYSB 4IUCS 5D5QA 2VUSA 3E15A 4MRNA 1Y5RA 4I08A 1LD3A 2GCGA 2RC5A 5HRUA 3C4QA 3G85A 1NJFA 1EG2A 1UJ4A 2WDPA 2HBQA 2V45A 3ANXA 4IHJB 2NO6A 2ZQZA 3FIUA 2QD2A 5EJIA 3TW6A 3NRJA 1K89A 3VR4A 3WZ2A 5CX4A 3STYA 1QH0A 2HNBA 2PO5A 3M6XA 3HUEA 4KLAA 2Q45A 5CB4A 1E3WA 4RTJA 2CFRA 2AYZA 1PKEA 2NYRA 1TC1A 2V7TA 1FX1A 2HPVA 3OZTA 3QBVA 1LU9A 1V8DA 5IUJC 2IHNA 1L5WA 4PQYA 1N7IA 1X0VA 2PUEA 3D2AA 1QUEA 2ODNA 3JW8A 2FW9A 3AQIA 3GDGA 5AKKA 3UFXA 1XD2A 2DKNA 5DF1A 3B7PA 1P31A 4RTNA 2J09A 3FFBA 4FJ1A 1G2PA 2DHDA 5K03A 1P61B 2Z30A 3EAFA 4WCFC 3I5MA 4BKUA 4YJ3A 4DQ0A 2WVJA 3IT1A 2X0NA 2VT2A 2ZRQA 3BDIA 5DHPA 3ESAA 3C5CA 3FFAA 5LP6A 3DLIA 2Q5FA 1Z75A 4YUWA 1AMNA 4I19A 3CFYA 5L3ZA 4A1FA 2XCRB 1LH0A 4FXPA 3TQHA 5JNRA 1SM4A 4NEGA 1QAOA 4RV5A 2DXIA 1P1RA 2ZE8A 3OWXA 3DGFC 3FPLA 1Y1TA 3N2KA 4RD0A 4W9NA 4XWKA 1Z37A 1YOVB 2O2ZA 4INOA 3H6GA 3L5OA 4A9AA 2VG8A 1M0TA 1UEXC 2B0CA 3C6KA 3ZW7A 2Q6TA 2VYVD 1NXSA 2HA7A 3L6UA 5DPMA 2LCQA 3EOAI 2YVQA 3U4IA 4NZMA 4RVCA 2NVUA 4BO2A 3KDPA 4CWAA 1SXJC 3Q3IA 1I94B 3NEAA 1FSGA 4NZPA 2PFSA 4K5QA 3JVVA 1VJTA 2WFLA 3NH6A 1M9NA 1NUUA 1PFWA 2W93A 3PNMA 4LN1A 4HDQB 1HL3A 1D2EA 2BSXA 1WP4A 2JGAA 2WT9A 4HQ6A 4PYOA 4QC2A 5K0LA 1AV7A 3NBAA 2ODWA 2FOIA 1W6UA 4ZT2A 2OQRA 1E2NA 4YJHA 2MYNA 3SIXA 1SOUA 3EFBA 2G63A 1RYYA 4J9VA 4B3HA 4LK2A 4NPAA 2EARA 2VJQA 4WDQA 3DAFA 4YRZA 2XQJA 3NEYA 3PBKA 1GAQA 2HO4A 1CNEA 3KQKA 1XXHB 2QTFA 1RTKA 1E20A 1FXSA 1NJ6A 1GNVA 3FNGA 3IQFA 1C9NA 5LPNA 3DBIA 1BD4A 3CH7A 1WAMA 3I23A 1PEAA 1TCUA 3IVRA 1Z9BA 4Q5IA 1R9JA 2HDHA 5KYWA 1XZKA 3TZEA 2ZVQX 2R6JA 4P32A 1MQSA 1B0UA 3VPHA 5K8LA 2E1PA 4CW7A 3BJZA 3T3MB 1CPYA 3UATA 2GSDA 1GGEA 1FDWA 3H2HA 3ZXSA 1JTVA 3Q9LA 3I9NA 4F46A 2REXB 4RK5A 3PYMA 2I1QA 1FFCA 3TW0A 4S12A 3AEQB 1UT6A 3A7EA 2DPHA 4LECA 5JXIA 5J23A 1IOLA 2CJYA 4RMGA 1GSHA 1HOXA 3QKSB 4BQIA 5J4HA 1EFCA 2WKWA 3IE1A 1SVWA 2CE7A 2PT9A 3ZZNA 4J0FA 1EBFA 1MJHA 5AKIA 1JRLA 3V34A 5HX7A 3SQMA 2JL1A 1LJUA 4ZHQA 1F9AA 1W88B 1UM9A 4NS1A 4BU1A 2VSFA 5JOQA 2OHGA 3ZK7A 1P4RA 1QIJA 3IJRA 1DIRA 4J1TA 4Q3AA 5ARDA 1BVYF 5H80A 1QQ6A 3DC7A 5C1PA 5HIAA 1NWCA 3DL2A 4DLKA 3T1HB 5EIAA 3B5JA 2XKBA 3V7NA 2YWGA 3G0IA 3KSRA 4Q1DA 4RF2A 3W4KA 4TV8A 2OEPA 4GP7A 3QU4A 4MWDA 1NYRA 1MG5A 1KC3A 2WYHA 4IRXA 4MUYA 1TM4E 1VG8A 2IT1A 3UHPA 3A6LA 2RHMA 5C4GB 4BP3A 4MJ3A 2Z58A 5F9HA 5B3LA 3O5AA 2BELA 3NH9A 1EGMB 5C8ZA 5JATA 4Q7JB 2B7BA 4ENWA 1QV6A 2ZI4A 1W36D 4QYWA 3ZY6A 3DEJA 1U8EA 2IHYA 4Q21A 2PU7A 4KJZA 4E09A 1JDSA 1CS0B 1YS1X 2DFPA 4X1IB 4D57A 3R0IA 2HO5A 1WLSA 3ZD8A 1C5KA 2VATA 9ABPA 2XMGA 5I4CA 4L8FA 5C5CA 4LFAB 3BRCA 5A7HA 5T4EA 3AF3A 3RNOA 5A4JA 5CXUA 3AVXA 4CN9A 4WOBA 3WGTA 2BZGA 3HNOA 1ZISA 2IEAA 3KG2A 1ISMA 1UBHS 4OTZA 3GLFE 2HM7A 2FJPA 1YR9A 3SY8A 1AMOA 3OWOA 1QE5A 3IV9A 1OXUA 1JHVA 1ZK4A 3EUFA 1MGOA 1TOAA 5KSOA 1E1CB 4C20A 2EQBA 3GU3A 3HCNA 2H2HA 2CF5A 1V6SA 2AJDA 1W49A 4RESA 4XKJA 5EMHA 7GPBA 1EXVA 2AFHB 4YWHA 3M5CA 3SQNA 3ID6C 2OBBA 2WWIA 3M7IA 4CKZA 5E4YA 5DX8A 5JWOA 1KPHA 1PJLA 7MHTA 1Y4AE 3HRIA 3WL5A 9LDBA 2JHGA 2ZWVA 1X74A 4ND3A 1QRTA 3KQYA 4EPVA 4HV4A 3IALA 1HNNA 3A4NA 1SD2A 2Q99A 1O94A 4UNQA 1Q74A 4E5KA 4DL9A 2AQ8A 4BNIA 4IXMA 2EYUA 2J3KA 3BMXA 4D0GA 2C59A 2FOXA 1CUBA 1ECLA 1G3IA 3W3AA 5C4MA 4L5BA 1WQ4A 4EF5A 2MSLA 3PEWA 1U7PA 5KTNA 2NO5A 1NV8A 1NTOA 5ER9A 3W2FA 1TCVA 1P8JA 1X94A 3U0BA 3KPWA 2C9OA 4AVYA 3BRWD 2IQIA 2XIJA 4O4HA 3GLHA 4WGGA 3ZHYA 1T9CA 3WZMA 2HRBA 3ZU3A 2DQSA 3KBOA 2VZLA 3IUQA 4D7AA 2XWPA 4X64B 1GDTA 1A2KC 5JSKA 4MX8A 3U5TA 3PTLA 3UANA 1SKYB 2E55A 2WIFA 4OKIA 2GN2A 2JF0A 2RMKA 121PA 3AJEA 4TUYB 2A78A 5DYNA 2VQSA 4TZTA 4CMBA 1RU3A 4G2TA 3WL6A 3IPLA 3WSTA 4CM9A 5EAIA 1G7SA 3ETGA 5CRIA 1Z68A 4DRXB 4ARCA 2DBQA 1QE3A 2NXCA 3BXHA 3IMKA 1QHIA 3PYXA 4MKXA 1DIBA 4YUXA 3RKRA 1GPYA 3AGPA 2BHTA 1LK7A 2O3QA 3CUUA 1NQXA 1DQNA 1FX0B 5TXGA 1VJ1A 2GETA 4KQKA 4JVNA 3AP2A 4F2HA 3VKFA 2QE7D 1QZ3A 2Y93A 5L4SA 2I4MA 3OP1A 3TXYA 1RPJA 1DTEA 2EHJA 1I1HA 4X6LA 1M67A 3NDJA 1XQ6A 1VI5A 1I2BA 2XE8A 4RVGA 3GT3A 2L18A 1H23A 1TMYA 5BVHA 3GLIA 1EFRD 4XSVA 3FYTA 3WYFA 3GAFA 3HY6A 1Q0RA 2PS1A 2BDEA 3EN0A 4G1EB 4YAGA 5IJWA 3AIIA 1X7ZB 4CL8A 1YB2A 3BB1A 4Z7NB 3K3PA 3O1JC 4RJLA 5CT5A 5KYUB 2AKYA 1P2TA 2PMBA 4DCVA 4UHJA 1RABA 1KDOA 3HQ4O 2VT6A 2Q6LA 1HT0A 1XFDA 2VPXA 2Q8PA 3HYSA 5JD3A 2VHQA 3MCUA 3NHMA 4ZGGA 1YZLA 4QQ8A 3SDSA 3L93A 13PKA 3B6ZA 3LWBA 4GPTA 3LWZA 5HMMA 3JAKA 2EFEB 2QN9A 1H2WA 4H4CA 1AOXA 1B8PA 1IXZA 1HBJA 1K97A 2BR5A 3D81A 4K2HA 2EKQA 4NBNA 4NMLA 3TL6A 3L6RA 2C3YA 3AR8A 4N5LA 1FDUA 4CLEA 2WIGA 1R88A 2VOJA 5A4MS 5JCOA 4C4XA 1TCCA 5KYXB 4MPTA 2ECPA 3JD0A 1CP2A 1O03A 3KTAB 4LZLA 1LXCA 4EW6A 4XR9A 3ZGZA 4K9NA 4Q39A 3N58A 3GT0A 4YVFA 4ZXFA 4RY2A 4ZOBA 1YJ5A 2UUCB 1HZZA 3CW9A 4HBZA 2WF8A 4Z6KA 1GZHB 2GJAA 2ZW9A 3SJBA 1Y5MA 3EXG1 4A8TA 4FFNA 1E4YA 1LY1A 1Z08A 2G6TA 3CJQA 3CZMA 2PSFA 2BGGA 4DMLA 5MFZA 3AIOA 2ODBA 2V3VA 4JQZA 4I4CA 1TJYA 1X7WA 2PYDA 3F74A 3S2UA 1EM6A 1ZD2P 4BP9A 4OXXA 5C35A 4Y1FA 2MDTA 2G7ZA 5FR2A 3JX9A 3CW8X 3B9QA 1JAZA 1I5OA 1I2DA 4MO2A 1TZBA 2IDZA 5DXAA 2DC1A 1D8AA 4G63A 4KYIB 4BCBA 1TFUA 1FUYB 1X19A 2WF9A 2GB4A 1Z07A 4L9SA 3REQB 4E1BA 4YPOA 4EWLA 2R00A 4UZSA 4ML3A 4CR8A 2H92A 4RFVA 1FEZA 1IY8A 2BN4A 3E2MA 2XV1A 2DJ5A 2P5UA 4QQRA 2ZSAA 1CW2B 1ORWA 5KAPA 4C3VA 1QGED 4TWZA 1KY5A 3ROEA 4P0TA 5D5HA 1C1XA 1TW2A 3DJYA 5KX5F 1NATA 2UZ4A 3ZZTA 3SXUB 1WTCA 4IFBA 4LNUA 5CJ2A 2CL6X 4KWEA 1E61A 1YI8A 2JJ1A 3V8MA 5BY2A 1PUXA 1OFHA 3FWPA 3TOVA 4Q19A 1ES9A 1B6SA 2NZJA 2NYAA 1S3FA 2VHZA 3WADA 2BONA 3EXIB 1MBZA 2JBAA 4Z99A 5CCDA 1RWXA 3UKJA 4PBTA 4GC5A 4KIFA 3AWDA 3BQ9A 1GVHA 4MUFA 3FHCB 5AVYA 4XUEA 5CT9A 2JIZA 2ENUA 2R48A 4NV0A 4URFA 1XAHA 2JHPA 3DT8A 3KYDA 5DTRA 1QRRA 4E7PA 1NF3A 4LHVA 1T8UA 221PA 2GK4A 3NOQA 4QGSA 2V0CA 5CA0B 4R9NA 2RHWA 4FUQA 5JUWA 3HK2A 2NV6A 1RMTA 3PJGA 2KI5A 3RBZA 1VXOA 2QU8A 2VJKA 4Q1VA 4ZN6A 1DQRA 1X8KA 1AKMA 3CN9A 4FYYA 5F4BA 1N8TA 1PK8A 4B43A 4BUJA 2GUWA 3SQLA 3TSYA 3HKCB 2RSLA 3IPYA 3JWIA 5K0JA 1TXGA 2RHLA 1FB5A 4KODA 3E3NA 3QF4A 1GUAA 3Q0IA 4KXLA 1MGPA 1T24A 2D0OB 2X9QA 4B3SB 1ONOA 2YJ5A 3WMWA 2QBYB 3CZCA 3OCJA 2EGGA 3Q5DA 1XC7A 1FVHA 4U9UA 1U4NA 3E84A 3T1OA 3BMCB 4B6SA 2IOYA 3AHFA 1J0CA 4P3OA 3FYSA 1B76A 2ZCJA 1E5VA 3M6WA 4ZOLF 2AW5A 4HDSB 1FQWA 4L7VA 5AVOA 3LZDA 4RY9A 4C2UA 4AJKA 4HFMA 4TKVB 3P9ZA 2PUGA 2BFAA 3NI2A 3KWJA 4YRBA 4DLXA 2Q7OE 1ZO8A 4KAXA 4OSPA 4I9NA 5ITWA 3LK7A 3PC6A 2QOEA 1QDUA 3ZWBA 1SBHA 3O4GA 4E5SA 4EG0A 1KS2A 2D8MA 4PCVA 1G7RA 3QELB 4JKOA 3T5BA 2ZYUX 3VXKA 4F2PA 2ATCA 4X1YA 1CR2A 2BFOA 2DFVA 3H84A 5HILA 3W4JA 3SHTA 1GDHA 3A4TA 2DTDA 4AURA 4PE5B 1IN7A 2CYAA 3C74A 4IG9A 1L9XA 4OJTA 3SFTA 3THOA 4AZWA 2UVPB 1NURA 4BLTA 5GAJA 1FNSA 1XVAA 2VEOA 2C0CA 4M0CA 2HEGA 2HOQA 2PMFA 4OHUA 2DH6A 3N2GB 4N65A 1RXCA 4RK0A 1ND5A 1RHMA 4TXLA 3TD9A 4AF8A 3UMSA 5BOVA 1E9DA 2Q5JA 4INJA 4ZZ0A 1SC1A 1XYYA 3I53A 3WSVA 1TVKA 3A1CA 2WMYA 4DMUB 1EFHA 1SUFA 4HNQA 1I9GA 5HCIA 4AWAA 3L0BA 4KR2A 1EX9A 3WK9A 1MXFA 4JI7B 3OUZA 4Y1RB 3UJ9A 1IY2A 2ZIXB 1N5RA 1JLKA 3GVXA 1VIMA 2HNAA 3O4FA 1ZC4A 2GYUA 2Y1DA 1FFEA 4YUZA 3RIEA 1L3BA 5L6LB 2IQ5A 5CPFA 3B3AA 3FTNA 1ZH2A 3Q7SA 5GVSA 1PBNA 3OFND 1SULA 2W0SA 1Z82A 3KO8A 1IZ8A 3O2QB 4YCJA 4H31A 3E8XA 3HVRA 1ZSNA 4G65A 5HZHA 2QVZX 3V00A 5KNBH 2YIVX 3L3BA 1O96B 3QHPA 5I5GA 4OLAA 3R40A 1OB5A 1CJSA 5T3YA 3SYLA 4GSYA 3LBAA 4H27A 5GVRA 4JELA 1JHRA 1S89A 1RJ9B 3ACBA 5D3ZA 1C7ZA 1UFVA 3AOGA 3OZCA 2JJMA 4L57A 4Z5XA 3RGWS 3OLWA 4MUIA 4R51A 4JODA 2WB4A 3EDYA 2ZJ1A 4UJ5A 1Q0HA 1XCOA 1R4MA 3CRW1 5LR6A 3NXKA 4E32A 3V8QA 1IUPA 1WQ3A 3QVSA 2FZVA 4HF7A 1KZ6A 1Z0JA 2H5LA 1HEYA 2EC5A 1Q7RA 1ZZEA 4N5HX 5DYYA 4AJLA 4MR9A 4WECA 4FYMA 2XUFA 3LQFA 3H9GA 5K2MA 4IVQA 2NGRA 2ZJ0A 1V5EA 3TSWA 4F12A 3A9UA 1E1RA 2ASEA 1U0SY 3P0IA 4ZVOA 5LDGA 4UASA 3AI3A 3C8UA 1UMCA 4JLBA 4MRMB 3HPQA 4MW4A 1H6AA 4P3NA 2Y2VA 4L74A 1S4QA 3O8QB 3ZOKA 2C99A 3CSDA 2WWFA 5LYYA 4BKOA 2IYRA 5BNWA 2UDPA 2HCBA 5KS2A 2I4TA 4CLRA 3A1TA 5PGMA 2EKDA 2WP0A 4M88A 2NYVA 4QXPA 1KRXA 3DTVA 4X62B 5AP9A 2VF4X 3A1FA 5GINE 4DLAA 3MWKA 3PGMA 3A9VA 3ETDA 4EB0A 3RRJA 3U5ZB 2XEDA 5K3EA 4QXRA 3UJHA 1XP5A 4CMEA 3QZUA 2FK7A 4JJ7A 3TRHA 4MI6A 3E9CA 4I55B 1H3EA 2XZDA 4KIJA 2GA8A 4OK6A 4C7VA 1OLSB 5JBIA 1WW3A 3R6DA 2XOKD 3WMEA 2E1RA 2JJYA 2PCLA 3QGMA 4Z3DA 2QGZA 4YP9A 2BZ1A 2HWYA 1NPTO 4ER0A 2QXTA 2APJA 2WD8A 4MLCA 2R2GA 4B4WA 4GMGA 4LGCA 1SUPA 4DSNA 2IOFK 3LL4A 4S1PA 2ZXEA 1SR8A 4UUAA 5TGDA 4LWOA 2B8NA 1QZXA 2VJAA 3ZHCA 1AUPA 3A6GA 1NMSA 4RCVA 3G23A 4W5WA 1PK7A 4JR1A 2VNHA 3N2NA 3VH3A 4WXRA 3A4YA 4NMWA 4D0NA 5JD6A 1SQFA 1AKRA 2DT5A 1OMOA 3IRUA 4X97A 2EBWA 1CZNA 1NUTA 1UJNA 1UK8A 3KKOA 4K6FA 3RFTA 3H5IA 1UP7A 3FCUB 5AI5A 1MABB 3KCNA 3OT5A 3EZXA 1KXZA 1UZUA 4IIJA 5DYTA 3QPUA 1JU3A 2C2OA 2UUPA 2FHPA 3KJIA 3T3OA 3DBHB 4IXWA 3MLEA 1SVIA 1DAEA 4F6RB 2GHIA 3P45A 4P31A 5C5EA 4DG9A 3TX6A 1PR1A 1G8FA 4FOLA 2YCBA 4UU7A 4A10A 2QJOA 1XNHA 3K0CA 3II6X 2PEZA 2GCPA 2NTVA 4LHYA 4MHSA 2WYUA 3FIJA 3HU5A 1AT1A 2OCDA 1YJQA 1YOBA 4HAXA 4BNJA 1RPTA 3EEBA 1NN1A 3L7KA 2BL4A 2CCKA 1KMQA 2KHZA 3OO1A 3KAPA 4MWGA 1PZGA 1T8SA 3UICA 1TYZA 1P7VA 3PNLA 3T0IA 3C7CB 3PJRA 2V3CC 1V4VA 4WK2B 1L7DA 1BHQ1 3ULKA 4HMOA 2DR2A 1QYVA 3OF3A 2XHZA 3L8YA 4TV9A 3DMRA 3TFWA 4TYWA 2D1YA 1NQAO 1EHCA 1ZKMA 4FN4A 1D2MA 5HK9A 1T25A 3SX0A 1AUXA 4TX1A 4DMMA 5F12A 4PYRA 4I6EA 4LMBA 1XEWY 3BDAA 4QXMA 3VU9B 1CR6A 1Z17A 4I50F 4F0JA 5LYJA 1UAGA 3ENVA 4S24A 3NONA 3WDMA 3K6SA 2XXAB 3IUMA 1EJ6A 5F2KA 1A7AA 5CCXA 2AXNA 2JFXA 4G23A 1M2OA 5CNMA 3IUNA 3RJ9A 2DBZA 1LTKA 5DBIA 4FOPA 2X86A 4D0LB 4FSXA 3LHKA 4JYBA 4UTZA 4BS9A 2A0WA 4MVJF 4D0RA 1QX3A 2HLNA 3PWSA 4LEIA 2QLTA 4DDTA 3D5EA 3DB1A 1YZKA 3M5WA 2H7VA 5CGZA 4KR7A 1C7EA 3W5CA 2XTZA 3QBEA 4ZOEA 4B46A 1JR2A 3QEKA 4FT4A 3AL2A 2B20A 4S1OA 5KNDD 3O6VA 2O7NA 3GEGA 3JATA 3IODA 4NOLA 5D7NA 1S3IA 1RLMA 5JROA 1ZCFA 5KNBD 5L7YA 2RGNC 3KSMA 4P81A 3JQFC 4BN5A 3BIJA 2ZAIA 1T3SA 1PUJA 4TSRA 5AESA 3CLRC 1Q3HA 2ZZKA 3TRFA 1I3OA 4ZHSA 1NMXA 3W5HA 1NXPA 2GPJA 2D7DA 3LL7A 2PFKA 1JR4A 2H9IA 4HP8A 2W58A 2QORA 3HA7A 4ABYA 4MYUA 3R41A 3C8ZA 5DOVA 5IVPA 3KFLA 3PLAE 5DB4A 4AKEA 5FI1B 3RU3A 3CKKA 1XPUA 1QC5A 1M6EX 3ZHXA 2KLHA 5HUHA 5C7YA 4N41A 4XYGA 1JLMA 2D1TA 1J0XO 3TS1A 2Z8YM 5I7AA 4UBLA 1NVDA 4RXTA 5H59A 5CW2A 2H11A 5DHRA 2MWMA 5AXBA 4C1BA 2RKBA 5A62A 3CZPA 5KIAA 2FF7A 1RCFA 3I4FA 2YIMA 4MKGA 4AB1A 4M7RA 3HDYA 5FXMA 3UW3A 4M8SA 3AM3A 2QTLA 1WHTA 1DFIA 1H8EA 2VDRB 3PS9A 2VSQA 5K8VA 3WIBA 4RO0A 4J2HA 3V4RA 1WL8A 2I9PA 4M46A 3H9EO 3TH5A 1Y7TA 5I3ZA 1RFLA 1SFRA 1G1AA 3L79A 3VYRB 3W7VA 3CKYA 1XQXA 1TTQB 2ZIGA 3I05A 1Z4OA 1BJKA 1KR2A 1KYYA 5INTA 2H29A 1B8VA 3WKBA 2WNSA 5IBPA 2FRDA 3NORA 1GQFA 2O1EA 3A0RB 4JI1B 1JIVA 5KU7A 1M1UA 4N0MA 1Z34A 4RQUA 1DFHA 3GJ5A 1WE2A 2QVXX 4Y0NA 4XRGA 4DA6A 1JR3E 3Q9NA 3U9TA 4ZJYA 5IWAB 4QEZA 3CR3C 3AR2A 2P2NA 4E31A 4A2PA 4PG8A 3KLBA 2KMLA 4ZI5A 3ZDFA 3GRKA 2FG6C 4MEBA 4WERA 3TWOA 3STVA 3VSCA 1W1IA 1WEHA 3SPXA 1KYTA 3SBDA 1AHPA 5HTOA 3U13A 4ZWNA 2JDIA 3UMBA 3IQWA 4PHTA 1IBLB 2OMKA 3M8KA 3F3YA 3PGJA 3DBLB 3MMZA 3VOAA 4RXUA 3WMRA 2KJQA 1NM5A 3UHJA 1II9A 2RCNA 1TYCA 4GI3A 2ZQYA 4N5IX 3W9YA 3ESXA 4XD7D 4EI7A 1XV5A 1E59A 2C04A 2A14A 3I01A 1IIRA 2XDQB 2IUSA 3R44A 4G9GA 1J7KA 1C3OB 4I5IA 3HKBB 4ITUA 4ZCMA 5D1NA 5E1BA 3WNVA 1PL6A 4P6VF 4KREA 2N9UA 3IEKA 2FSSA 1U7UA 4HX2A 2IXEA 3QLVC 4KV7A 5F5NA 5JXGA 4NXMB 3OU6A 4TL8A 2UYCA 2QRVA 1W0KA 1W5FA 4UBIA 4IVRA 4C0AC 5I01A 4EEKA 4QUKA 4LDRA 2QTGA 4OM7A 1BCSB 2QPLA 2EJCA 2VJPA 4K6GA 5DGCA 3GNTA 1HGXA 1D4AA 2JFUA 1C81A 1IWPB 1GZVA 2G25A 3OF2A 1GADO 1DV2A 2I99A 4JX8A 4KE7A 2GPSA 1POXA 3WZLA 2PD6A 2OECA 2X5XA 2YYAA 3V1MA 3VDQA 3GD7A 1E9BA 4WOKA 2L69A 1ZIPA 4V1CI 1JU4A 2CUTA 1GPLA 2HWKA 3A3OA 4IG4A 4MKHA 4GIBA 4WN9B 3N0XA 1P1FA 4NJOA 4B7ZA 5FUQA 4MINA 1U2SA 3C41J 4X3PA 1P3DA 1QNFA 2WBLC 3CG4A 1XELA 1Z8FA 4LUCA 2PM8A 3W9BA 1J24A 4D92A 5HKKA 3FR8A 2E6UX 1B3RA 3P4YA 3S44A 3NBYC 1MO3A 1Q0LA 3B1YA 4DVGA 3NUZA 2KM1A 1GPJA 3SIWA 3LO5A 4J0DA 2F3PA 3WIVA 3Q11A 5C8YB 3CHYA 1RXIA 4YAJA 1E2JA 4KTTE 4PZ9A 5JH7A 1R4ZA 2GN4A 3B5EA 1Z26A 1Z0SA 3AKYA 4JEUA 1Y7PA 2FPUA 4FBLA 1UWVA 4TLEA 2QRZA 1C7IA 2YWXA 1XVVA 3GJ8A 3RTDA 3AUJB 3V8BA 3KQNA 1JLHA 2LIPA 3LK6A 1X1DA 1CRPA 1N2CA 1T3LA 2DT8A 2V7BA 2NTJA 1PR4A 5JPIA 1L5OA 1GFSA 1Y4SA 3TPZA 4H1TA 1M6NA 1O54A 2C4UA 2ZGVA 3KXDA 4NJEA 1SUAA 4RTRA 1H2BA 4I1OA 2YN2A 2PX3A 4X71A 4Z9XA 1II8B 4IXDA 1LTHR 2GKGA 1WD7A 3HL0A 1K5DA 1KVUA 1UXKA 2X15A 2BTQA 2FRXA 4G1FA 4L4UA 2F7SA 2HQBA 3FWKA 3KJQA 4DKXA 1XNJA 1I51A 4AAYA 3DKVA 4OXQA 1XRQA 3RS2A 5JY6A 1FVFA 1VLZA 2EOAA 1HE8B 1K92A 1M66A 2R2AA 1QMPA 2O5VA 1PX0A 3PD7A 5B37A 4TWJA 1LDGA 4OLJA 4FNMA 5FTKA 4QXQA 4I0WB 3NASA 1R7RA 5EJ7A 3F8WA 1JSRA 4ESHA 4CEIB 3TTTA 3PQ5A 2JGNA 1G291 4CDRA 3V6LA 3SZRA 1FE8A 2Z9DA 1RBMA 2QLJA 5DGIA 4P22A 4WIAA 4D4KA 4MH0R 3HDJA 3LA6A 4XQEA 4B4DA 4EYSA 1HORA 4JI0B 2JFNA 2OD2A 1MC5A 2WJ6A 4HC4A 4N7RA 5HKOA 3NHZA 2PGOA 2HRZA 3MMPA 2YWFA 1G8JA 2IU3A 2Z4RA 1N6PA 4DLYA 2Z6UA 3BZUA 3BJIC 3EYAA 1KHTA 1IVYA 1KOFA 2C9MA 2QQ0A 2UYQA 2ZIAA 3MHPA 4ND5A 4D4GA 1WHSB 4D9GA 4BMOB 4HYQA 1Z6QA 1KO1A 1TL7C 3VDNB 3TE7A 3T8YA 4WJLA 2H1WA 3QH4A 1H2HA 1DXYA 1FRQA 1NJSA 4EJ0A 4UULA 5EQTA 3SZ3A 4RQTA 2ZYRA 4R69A 3UK6A 5AK4A 2YIDA 4MGYR 4TXJA 2PUHA 1R4AA 2OBYA 5HCNA 3L6BA 4UD2A 3TZHA 4ZZ1A 4ZCIA 4L7QA 4MS1A 4MROA 4ANFA 3A6DA 3G5UA 3IBFA 2OFXA 4YBRA 4E12A 5BN1A 3ETLA 5C51B 1Z73A 4P86A 4R5HA 4II7A 4GSLA 4ZXPA 4MQ4A 2GVZC 5DX1A 3TMAA 5C3MA 1WPQA 3IBSA 2VP0A 2R6AA 4JLWA 3RS8A 4WCFB 4QWWA 1GUZA 2PCJA 3U6BA 2FR0A 1FMJA 1KH2A 1OVGA 4Y9UA 4FEAA 2HIGA 3ZDRA 3UTDA 3KB8A 5CYPA 3ZJVA 2FEWB 4O59O 1DAKA 5KC8A 5DXJA 4BVEA 2GILA 2WWXA 3G0OA 3Q8XB 1E2GA 4WLNA 4QWMA 4B3CA 3VNVA 2XI4A 2ZRKA 4TMZA 3ZPXA 3DFIA 2AFRA 2Q9BA 1U7XA 2ERXA 2VP5A 4LHXA 3DHEA 1VECA 2L82A 1O5IA 1Q44A 2OBNA 3C7TA 3HJTA 3NV9A 2I7CA 2F8MA 4OQNA 5TQ2A 5BYKA 2BE9A 4NG4A 1W8DA 3I6MA 1R5JA 1K8YB 1SC9A 4ZYYA 3EH1A 3IPRA 1RLTA 2ZJBA 4Q93A 3TTYA 3JWHA 4DABA 2C2YA 2AMVA 3ORYA 1I2AA 3P9XA 4BZZA 4YRQA 5K3FA 2GZSA 1TIPA 4M6WA 4GUDA 4AXXA 4GL2A 3PFKA 5LP6B 4IX1A 1B16A 1A1SA 3HV0A 3KTFA 1EXMA 3D1LA 1LBHA 4OD0A 3COSA 1DLJA 2QHXA 3GH3A 1RM4A 3OFSA 4BJ6A 2PUBA 4RVSA 3ISJA 3QE3A 1Z18A 4KNVA 3N2KB 1P60A 4EPRA 3DTYA 2WKPA 3AF6A 1V25A 1G8GA 2F1RA 1Y3FE 4TWBA 2YV4A 4UW9A 1WNFA 1NQWA 2ZRCA 3RAPR 2O8FB 1PBTA 5B4UA 3CZ9A 4MW9A 1JA9A 1S02A 2NVUB 5AXCA 1CUFA 2Z57A 4W6ZA 4CM8A 4DDKA 4QULA 1EP9A 2E4UA 3U7RA 3PL1A 2FW6A 1GGMA 3OQMA 5E0KB 4AI6A 4JDUA 4OP2A 3ICOA 1N9GA 5BSUA 3AR9A 4ZTUB 1O9GA 1VHWA 4GMKA 2SKDA 4TZKA 5KQMA 3K15A 3K9BA 1PWHA 2VCEA 3L84A 5AJTA 4M89A 4UU8A 2Q3JA 5EFZA 1HYBA 3R8XA 1OIVA 3TSCA 3AEXA 1P4HA 2AG8A 1LBQA 2YWDA 2GJSA 1T6YA 2JEYA 1D2NA 2PSHA 1YQTA 4HNHA 3VR3A 3WDLA 4BWVA 2G9NA 4BE7B 3FYHA 3CRQA 1KE2A 4C7KA 3DVLA 1D1TA 4YV2A 1JXAA 4WNAA 5DP1A 4HEA1 3E05A 3KQTA 3C85A 3QYPA 1N8SA 3D8NA 1N3IA 3F4KA 1ID1A 3KL2A 4M0FA 5AHRA 1N2EA 1AQJA 4XGIA 1UJ2A 3SC2A 1V7PC 4DQUA 4PTYA 1CUXA 1HG0A 1O9BA 1A69A 1WWKA 4TTPA 3S99A 1V45E 1HI9A 2HL6A 2I2WA 2QM0A 3L7IA 1OIWA 3LPLA 1RT9A 1T8RA 2AMJA 3ENWA 5AYVA 2Y6VA 5THXA 5IMSA 5CA1F 1LZLA 2EU8A 2E4ZA 3CKMA 3KOZA 2PZBA 1KEEB 4RZUA 5TT0A 3B78A 5T6MA 3NOVA 2V5VA 1KL7A 3TRDA 3UMJA 1IN6A 1HY3A 2V6BA 1BMDA 2YVUA 4W9MC 2EBHX 2YX1A 3D6TB 4F3KA 4PAWA 4WZAE 4YH1A 1V2GA 3MSXA 4JASB 4PPFA 4D43A 4DR5B 4K3VA 1SRQA 5KX5A 5K4GA 4P53A 2YHIA 4H59A 2XDAA 4AW9A 1PVVA 1UKYA 4OHMA 2I6XA 4R8RA 4ROTA 4DDWA 3CUSA 4N0PA 5IT9A 2CXSA 3I8OA 2HRDA 1NZFA 2O8NA 3MEQA 3QFTA 5GQSA 2EL9A 4F72A 1HNXB 1IL0A 2XUKA 4JOBA 4IXTA 3AHHA 4WNYA 1K9VF 3SJUA 5IF3A 4XIJA 3RRYA 5KOIA 1APBA 4F3NA 2LUOA 2DE0X 3HV2A 4RD3A 3UUGA 2NUAA 1HE1C 4TV8B 3CMMA 4EX7A 1VLJA 4Y6SA 1NBMA 4XTCS 1KQFA 1OFUX 1WNTA 4EFDA 3HCAA 3K2BA 3U3ZA 4QUIA 1S9DA 5D51S 5FNVF 1I3CA 2OAP1 5FTNA 1C30B 3N1UA 3SEAA 1T15A 2XYGA 2PBZA 3C1OA 5J59A 1JNYA 2ORED 3FVVA 4S1NA 5TS2A 3RQIA 4AS1A 2HZ7A 1YR6A 3U3OA 1COWD 4KO4S 2VDWA 3KS9A 1YTLA 4GM0A 1OILA 3U3RA 1G5RA 1WDWB 2OPBA 2QU7A 1S2NA 3DHNA 3TOXA 3Q88A 4UNRA 6NULA 1T9HA 1EZ1A 2E4WA 1YAHA 2ZU6A 4ZD6A 3ZHTA 4EAAA 2IH2A 2W6JD 1P4SA 1YAJA 3CVJA 4JNCA 3DL7A 5FNZA 2Q3EA 1C4WA 4EZBA 3H65A 3MCTA 3WGVA 4GDFA 2WJZB 2PNJA 4HKTA 5FQNA 3W6UA 2E4AA 5ICMA 2FEAA 5IVDA 4GPD1 4MICA 4FMCF 5SYMA 4XSHA 1E4EB 2R6CA 1ZA2A 2ZSKA 2OGZA 4L78A 4X54A 1AQUA 1KMHA 2H0QA 4NQZA 3ZH2A 4PZAA 2H85A 2FWJA 3HBLA 5CJJA 1ZPDA 3VU1A 3K9WA 4D3XA 2Y6UA 3P0RA 3BWXA 3WG9A 1N75A 4NQRA 3WK7A 5ELMA 1FJXA 2JFVA 2YN4A 2HXSA 5K0CA 2Z8XA 3VR2D 2GEVA 1MJFA 2BJHA 1KYZA 4GZ5A 2Y1LA 3BXXA 4JNKA 3GHHA 4LWZA 4O4IB 1RI4A 2B5WA 1PHRA 2XCTB 1TEZA 2ISCA 4AKIA 1FP1D 1QP7A 4D8TA 1N1DA 2HTFA 3O7WA 2BRUC 4J76A 4DJJA 2WHEA 2XWSA 2IZ6A 4TMFA 1P7CA 2UUAB 2ZB4A 1N6HA 2IHTA 4ZIRA 1ZOIA 1TIBA 2YBDA 1KDVA 3G8AA 1PYDA 1ZNQO 1YIDA 4BEJA 1YC2A 3CF4A 2QJFA 1ECFA 2GERA 4DHWA 1PV1A 4X8OA 4J0HA 2XUQA 3AY0A 2LBPA 1PSWA 2AE2A 4Y2VA 2ZS8A 4O2AA 2CL5A 5SY4A 2PN1A 1YUBA 1UKZA 1Y8QB 1REQB 2GARA 1BXGB 4RENA 3T6KA 5B55A 1LQTA 2I1WA 1XZMA 4C4PA 3MC1A 4RANA 2I03A 4QRIA 2GPBA 2FR1A 2O5EA 2IUFA 5AVXA 1XTKA 5E7QA 1FUEA 1Z5UA 4BVHA 2AMFA 4D9CA 3EHDA 4NARA 2WTUA 3BCUA 1LDMA 3HBAA 4MVJH 3OIDA 3FWHA 3B6KA 3PNBA 4TLAA 3ZLBA 2FPRA 1U3FA 1M5TA 2HQRA 2Z6VA 4OK3A 4AK9A 4P4UA 2C2BA 3FUTA 2B34A 1X7DA 2J30A 1VMAA 4RJJA 1PS0A 3EG9B 2P8SA 3AJ9A 3M6MD 4JXZA 4MCHA 4D8XA 3W5DA 5ICSA 3AOEC 4MYCA 1F0NA 1JIKA 2V54A 4O5AA 2C00A 4DVJA 3GLIB 2EWVA 5EZQA 2C2HA 2ZIFA 1Q1AA 2BCJQ 3GD5A 3GZ4A 4WOCA 3RVMA 1RTTA 5KDLA 1OXKB 1U2RA 2BEUA 2LPMA 1MIOA 1G3UA 2C94A 2GN9A 4DZRA 4RVFA 4A8HA 3TW4A 3IGFA 3EGOA 3LTNC 1BE6A 2O23A 2X4IA 4KTVE 2HHAA 2R4TA 2ZI7A 3D3JA 1U8FO 1O8BA 1SU7A 1WCWA 3TG2A 2ZUVA 1Q5PA 1IONA 2P6OA 2GF2A 3ECSA 2IIQA 4LW8A 2GZHA 1RWKA 1J06A 3MWLA 4COOA 2BI4A 3JAKB 3TFQA 3CNLA 4WW0A 3U81A 1L5SA 2CFOA 2IEDA 2ZM5A 2AQHA 2OK7A 1TYDE 1CZUA 4FK8A 4LJ5A 1YCFA 4U1RA 1AMUA 3U4MA 1F1BA 3M6AA 3VNUA 6GPBA 2WJPA 3B36A 4F5EA 1FP6A 4C43A 1JECA 2Q4DA 2VP6A 5ALRA 2A1UB 2HV8A 4PZCA 4ZQEA 5ITZA 3EVGA 4K1LA 2OT3B 1GTVA 4H0CA 1GYQA 3L4BA 4TMKA 4YI3A 4DEXA 2NAFA 4LXQA 3UWMA 3U09A 3X1YA 4LNHA 1XXHE 5K4HA 1TEHA 2H7CA 2O8BB 2HA6A 5BXQC 5C8XA 3DCJA 1IJFA 1WCIA 2V6GA 2QPOA 2VWPA 1VIYA 4XSGA 5DFAA 5JVDF 4A0FA 1JYEA 1MB0A 1U6IA 3DPIA 3AF4A 4IF6A 3GW8A 2ACKA 1JBKA 3N86A 5AXAA 4Z1MA 2JCSA 4RPKA 3Q8LA 1PQYA 5DU2A 3VZQA 1Z6PA 5H81A 4UUQA 4WINA 1TPZA 2AXPA 4XGRA 3NIFB 4GX2A 1Z2EA 3P19A 5JEEA 1Z39A 3CRNA 4AKTA 1RJWA 1EE2A 2E7ZA 1P17A 2JEZA 1HDYA 2ZVJA 3D2CA 4G5RA 2QSUA 4GI5A 2WIJA 4K40A 4URHA 5FUYA 3ROMA 5K0GA 4W1SA 3NETA 4EHDA 1RWOA 1W581 2P79A 3KVVA 4F9TA 2OZPA 1D4FA 4KK4A 3P2MA 1MX9A 4JP2A 4AJNA 4F4FA 3RFCA 1RAEA 1RCUA 2Z4TA 1YFJA 5JO9A 2HK8A 4LNAA 3E9YA 3DTTA 4M0LA 3UT0A 2W2VA 3HLYA 2FWBA 3I04M 3WLJA 1WPGA 3EF1A 5MN5A 1WIWA 4G1UC 3OIFA 3ZDQA 5FTLA 3PUHA 4QICA 2VSNA 2J3EA 4DMFA 4RH3A 4EA7A 2NXEA 2AK3A 1Q2XA 1WULS 2CMFA 4O0LA 3RIXA 2ODAA 4RBNA 1YR3A 3LUKA 3FRHA 3QX9A 4A5SA 1CSEE 2CL7X 2Z08A 3OC0A 4AROA 2XOEA 5IANA 1V6AA 1JT2A 1DJLA 1ZHFA 4YJ2B 2PBRA 5HQJA 3JWPA 2FFBA 4KH0A 4UEKA 1D2HA 1IHOA 2TS1A 1FUUA 6Q21A 4NV1A 4QBHA 1ORTA 4LI0A 3BILA 3D43A 4D96A 1U3DA 2WKSA 1E7SA 4FS3A 3WNZA 3KYDB 4NICA 2MINA 3WLOA 2HHLA 2VJDA 3FTQA 4MNTA 1LUAA 4TLBA 5HDQA 2X0EA 3V8NA 3KHUA 4YCSA 4MUMA 2F1OA 2H2WA 3E9MA 1I7PA 4X7PA 3PUWA 4JJ4A 4HTFB 1V2HE 3WAJA 4PAOA 1GNSA 3ZCXA 3DKKA 1Q17A 4V02A 1WZCA 4ENTA 5EG5A 3KTDA 2IPOA 4PZLA 5L3QA 3DDSA 1FMCA 1RC0A 1ACLA 3BZBA 1N2XA 2F3UA 3I92A 3A3PA 3ICQB 2LKCA 4WK0B 2O0LA 4R9SA 1Z4MA 3W5BA 1CUAA 1GTG1 5DASA 1A88A 1PZHA 3AEZA 2BCGY 4I50A 2CV1A 3PHGA 1EAMA 1NJ2A 3QQPA 4JGGA 1IH8A 2YWBA 1TVCA 1V16B 4X00A 2AFHE 3LRTA 4UAVA 4HGNA 3RV3A 3FLEA 1ZM4A 3GEIA 3KYCA 4YR9A 1W85A 3KD3A 3KTOA 1V96A 1TUBB 3AR3A 2C5LA 3Q0EA 5EZ5A 4B6JA 1XL1A 3A0UA 3LLSA 4UEQA 3PJFA 4OHZA 2IHUA 3RDPA 1J1ZA 3ZLUA 4E70A 3K92A 5K0BA 3A3YA 4HGRA 3T9EA 5JSZA 4HXGA 3ADCA 2EJWA 4D4HA 3K9QO 2DTXA 1NJ1A 3WYAA 4BLRA 4KO8A 2OSVA 3ONDA 4PICA 3TLCA 1MD9A 4PTZA 5D6NA 5ALWA 2NV2B 4D98A 3G8YA 4KQ6A 3OCWA 3PNVA 4GL4A 5EJ8A 1BHSA 1GKIA 4LQDA 5FBKA 1SQ5A 2B78A 5DTQA 2FZLA 5CBPA 4DIEA 5M7EA 3YASA 3C6MA 3FD8A 5BSVA 2XJ4A 1Y9AA 1DRWA 2X1MA 1T6NA 2R8XA 3TNJA 1UFRA 4HGOA 4OBXA 5IYZF 1GA6A 2BGNA 2ASVA 3A14A 4UM9B 5K6TA 3OLVA 3C3CA 1G4AE 3INNA 1YK0A 4XEHA 3UPDA 4OQDA 2AC4A 2AGVA 2TMYA 3OBIA 2XUZA 4UE3S 2RBEA 3PI6A 3TW8B 2ZB8A 2HMAA 3PFWO 4EATA 5LIPA 1U28A 2IZ1A 2JCBA 5E8RA 4IZ6A 5AW2A 4MWOA 1X92A 5EXXA 2FDXA 5ICFA 1OT5A 1ZMTA 5K8JB 1CFJA 4BFTA 1QPBA 1OYOA 2GPTA 2LXNA 1KR5A 1QIIA 2P3QA 2ZBDA 3DNFA 3AUKA 3SGLA 5C46F 2J46A 1GXSA 3EWSA 3R6WA 1B23P 3ABZA 1RP7A 1TYBE 2JIBA 1GSOA 4JFAA 6ABPA 2PQ2A 3FDFA 5F21A 1ECJA 2QMZA 3HXKA 4PW0A 4ZREA 4WNIA 1B0AA 2ZSFA 4Y2SA 2O07A 3PC3A 4JR0A 2IP4A 2JAOA 3E9QA 5FD8A 2WLSA 2GFHA 5JZVA 2P1ZA 4ZAXA 1Y48E 4G2NA 4O1MA 1ZIYA 1H4SA 2JW5A 1Z2CA 3HJRA 3E4CA 2FMTA 4GYWA 3VA7A 3NTVA 4E6EA 3R5JA 4YRRA 2PT6A 2ZXFA 4PSUA 4PXYA 2HF7A 4ND6A 1ZHHA 3AP1A 3B1XA 4BO8A 4CQMD 4D9EA 2C7RA 1FC0A 1MX5A 2P4SA 2PT5A 2WAXA 3I9JA 3N2YA 2PZEA 1V7CA 1HYHA 1EWVA 1CC1S 2VDPB 3DT6A 3F7OA 3OHPA 1DDGA 1YKGA 2IK8A 3R6LA 4RVDA 5DBEX 2XT9A 3PXCX 5HM8A 3ZCSA 1R4MB 3WBKA 4B87A 2I6GA 2QLBA 3ADPA 1Y1PA 1YRLA 4PFQA 1RNLA 5BN5B 4AZ3A 2CXNA 1G64A 1PLJA 3IIKA 2PDAA 3RQSA 2AXEA 4DC9A 4HNTA 4UMFA 1NVWQ 1N7GA 3LQQA 3OP4A 4M9UA 4MR9B 4DQKA 5HIKA 5KTKA 1PDVA 4TMWA 2NUTA 5A6VA 1UAAA 5J9FA 2PUAA 3Q7PA 3QEBZ 4MUKA 2GNAA 4B4OA 3ZD7A 3OX4A 1UMCB 2RK6A 5B58T 1LQUA 2X0JA 2BMEA 1DIHA 3LKBA 2JLAA 2CLEB 3TUIC 1VTKA 2R25B 4IFEA 4FKMA 5ENVA 3ZWYA 2GH1A 4MW5A 5DCYA 1YQGA 3HSYA 3A7DA 1VOTA 2OM6A 3ROTA 3P32A 4CLRB 2IOFA 4BMDA 2W2OA 3KYIB 3C48A 2BBTA 3DTVB 1V4BA 4UZFA 2Q5IA 3JAWA 4KR3A 1MPTA 1O97C 2KPOA 5CHEA 5AO9A 4EHJA 5A3VA 3KKNA 1C14A 1VDMA 4JVLA 1Q91A 3CX7A 3J80A 3Q2KA 1NC3A 5IT5A 4O02B 4HLNA 2EKPA 4S2EA 4LRUA 2C5FA 4XWGA 4Y2GA 4BV8A 3RGGA 1A9PA 2CFCA 2E0IA 5AQ1A 5HRCA 2HGZA 4BKQA 2ARKA 3H1TA 3O2JA 3P7MA 1J5PA 1HWYA 1YHZA 2VNIA 4ZVUA 3MJRA 1O4VA 3IVGA 1D9ZA 1KEKA 2KQUA 1E9SA 3D9QX 2YMMA 1CJCA 2X8BA 2ZREA 3FB4A 3ITKA 2YY5A 3KOUA 2ZSBA 4L8GA 4TS3A 1I1OA 4UCXA 5DMHA 3VHXA 1XALA 4AICA 5J58A 2IUUA 1ZRMA 1L7RA 1XPJA 2O2DA 5B7NA 2ZQ5A 3EVAA 4IOKA 5U4QA 3TIGA 3FLMA 3CO0S 2XAAA 4A2WA 2DB3A 4OXKA 2AKAB 2O19A 2CN1A 4EEXA 2W6OA 4EHIA 1L4KA 4D6YA 2JGLA 5KPDA 2BFDB 4G56A 4JGIA 2FWIA 5F2OA 4BRUA 3QUBA 4IIJB 4IBOA 2PMCA 2D1SA 4EHHA 1N6IA 2HTEA 4KFTA 3W5IA 3U19A 3R3VA 5IJXA 5ALDA 1J8YF 2CNOA 3T5MA 1PT6A 2G36A 3O4HA 4HADA 4G5XA 1SIOA 1Y9JA 1XA3A 3AF2A 1ISFA 1H1LB 2X8JA 1XZGA 4WKOA 5AOAA 4QM7A 1YSCA 1GRQA 2JFWA 3EVFA 3U44B 2JKYA 2C9ZA 5UKDA 2AJBA 3T1NA 4P38A 4CYMA 2I8AA 2YV1A 1MG0A 1G3MA 3A2MA 1VJ0A 1Z2NX 2H4JA 1GZSA 1JP7A 2PWYA 3Q2IA 4TTRA 3KIPA 4C6SA 3ROGA 1IATA 3WL3A 1JL3A 2BEVA 3EIOA 3ZWVA 2IXTA 3SK0A 1ZK2A 3C7DB 1JYFA 1CP3A 1KJQA 1BOOA 3H8JA 4ID9A 4ZMSA 1X7YA 3ZJ4A 1XTZA 4CIXA 1VFPA 5CITA 3AJDA 3WBFA 2H65A 2W71A 1YACA 3KP1A 3K6SB 4LHWA 4LVNA 4YN3A 4UVHA 4CQLA 3PYLA 4PNPA 2PUJA 3FLAA 1Z3IX 4PBRA 5J47A 3QI2A 1BXRB 3HNPA 2QYSA 2YFYA 3K35A 3O1LA 3V4OA 1IBSA 4QUGA 3GEPA 4HGQA 5I7HA 1VMIA 3NPMA 3OLQA 16PKA 3OIWA 4G25A 2IZ7A 2JASA 3D4LA 2OG2A 1FP4A 1DKLA 5K8TA 4MEJA 4NIMA 3EDQA 3HHPA 1CDDA 1ZP6A 2ZBUA 4NCJA 3HR4A 4ATNA 2O2GA 2VJMA 3K8YA 3V8VA 1WSWA 2BFFA 2GTIA 3EQ6A 4F84A 3EPLA 3G7SA 5IM4F 2FKNA 3JATB 4R3UC 4BNDA 2HF9A 2Y3IA 2LE0A 1GR0A 4MO9A 1SZCA 1K6EA 2JGMA 3DUFA 3QLEA 4KQMA 3DV0B 2I91A 2RG7A 3BRWA 4UVGA 5I7WA 3T1VA 2VP3A 5C8YA 4M0MA 4ZRNA 2ZBQA 4EDHA 2R6FA 2HCRA 3L7AA 3SHOA 3HKDB 1XWWA 1AGNA 1XTTA 3HA3A 1H1TA 4AYXA 4RMNA 2Z3WA 1VLMA 2VYFA 3KV1A 4RVUA 2P4HX 1D1QA 1NSFA 4ZZ2A 1G2IA 4UTPA 1YA6A 1TJ5A 1DPGA 3PXBA 5ERGB 3RUAA 5HIMA 3U3XA 1JLLB 2E9SA 3MWEB 3DAYA 5DO9A 3UXYA 4KB5A 2ORYA 4CG3A 4XVUA 1YHYA 2A5LA 1O87A 2HSZA 4CDNA 1QGZA 3GYBA 4E14A 4TT3D 1N25A 2B5OA 1W0JD 1RYDA 3OIGA 3R77A 4FFLA 4UNPA 2YKGA 3TRKA 2CXOA 4GPIB 3UB2A 4G4SP 4AS2A 1T26A 3BTUA 2VK1A 3QTTA 4HNAB 1NUQA 1MLDA 4KN8A 4KDFA 4ZCSA 3JQ6A 4FYJA 3ZWPA 3PRHA 2OD7A 2F6RA 1KJ8A 2Z3VA 4PLYA 4FXOA 1TTPB 2IV3A 2DRIA 1SU4A 2QE7A 2VTDA 4OQYA 4R1NA 1YQWA 2XTJA 3EMBA 4QUHA 2O8BA 2HA2A 4U8HA 1VSVA 3GVHA 5B6PA 1AUVA 5CVDA 3W1WA 1A5BB 1MA0A 2PK3A 2REQA 3PLRA 5A6SA 1HFKA 4EBFA 1M7BA 5FH9A 4R81A 2VNJA 4TYNA 3OE5A 1KORA 1T0UA 1UDCA 2OOSA 3FGZA 1L1EA 3GDOA 3LVRE 2QM7A 5DW0A 3TGPA 2A86A 4EPYA 3IT2A 4FGKA 4RDXA 4JB8A 1OBHA 4OOFA 3DG9A 2VF7A 3OQPA 1PV2A 4FI3F 4MTLA 2G9VA 1FDOA 2XXJA 1QVWA 3EE6A 2FWPA 2OGSA 1V1RA 3W78A 3MOGA 1JPUA 1OC4A 2AI3A 4UDYX 4ZRMA 2CFTA 5I45A 1E3QA 4M9QA 4AU1A 2ID4A 3G8DA 4B31A 2FW7A 3OTHA 1Z88A 3QV1A 5COBA 1RAFA 4WBSA 1U31A 3NG1A 2VF5X 1FJGB 1JG6A 1SKAA 1HE3A 4JYZA 3BWBA 4G0XA 2QTCA 5DNCA 1PGNA 2H31A 1XJ5A 2TSYB 2ZSHA 3O4JA 5E9AA 2W70A 3TEMA 1Z0KA 3DE3X 2JI9A 3TRIA 3SVLA 4S1TA 2HSEA 4WCVA 4R0NA 3RS9A 5JAUA 1A04A 1R0CA 4NATA 2G9ZA 4OA8A 3F3KA 4PNHA 4TTJA 4X6YA 3KOOA 4MMYB 1AGPA 3SSOA 1NN3A 1OH6A 1K4MA 3I9V1 1J8QA 4RPIA 3MUOA 4GI1A 2HJWA 1ZMBA 4A0QA 1W73A 1YS7A 4AUEA 5BORA 2PRZA 5KWVA 2J9XB 3WBBA 1C1DB 5F33A 1C3XA 3H2ZA 1A8HA 5EQFA 2QUHA 3DR5A 1T43A 3DE4X 4B45A 2YZ7A 2HJHA 2QVLA 3OZUA 4OHCA 5DSTA 3FFWA 3WGJA 3WRYC 4AJOA 1KJNA 2JRLA 3KDSE 5EKXA 3EEFA 4ZAVA 4DCOA 4DYVA 3FNBA 2CDAA 3AUUA 4JLSA 4TYQA 1YTUA 3R5XA 4IJQA 2QSJA 3KPJA 1GCIA 1CJBA 2RGBA 5BQXA 1FLAA 5EZ6B 4X66B 2X4GA 3JU3A 4DQDA 4O0MA 1MQ9A 2QVCA 1GTMA 2NMVA 2O2XA 4EF4A 3C43A 4GOLD 3ZE9A 1N2HA 3ZGOA 2QTRA 2QRHA 4LE0A 5HFJA 1E2UA 3K0AA 1F8UA 4KUEA 4P2GA 5P21A 4Q9JA 5EZYF 3K8ZA 4JMPA 4UREA 3VQTA 2CK3D 1Y6ZA 1ZEMA 4IOLA 2M6KA 5LQKA 3REFA 1F0PA 1TUGA 1RCTE 3N76A 5JH7B 4PVCA 5DBFA 3ET4A 3PENA 1EK1A 5LOVF 1T9BA 4LZJA 3TINA 3KSBC 3WB2A 1HNWB 4N6NA 3KEFA 2IFTA 3IE0A 3D7LA 3PQDA 4WFQA 3PD1A 5GMOA 1HDXA 1I1NA 3I6YA 3DF9A 1J2TA 1Y1SA 1Z2AA 1L7AA 3PKJA 2R1TA 1N32B 3Q98A 4B0PA 3CPJB 4NJEB 3H4VA 5CEFA 3H5WA 1W35A 2FPLA 3RVPA 2ZJ2A 1LPNA 4IQFA 3CX6A 3OE7D 3GELA 3D8RA 3IXQA 3RHFA 5DK6A 1I32A 1Z38A 4Z9BA 4U7DA 4XYMA 1MPXA 2Z3ZA 3QX8A 3H0KA 2HDOA 1HMYA 1XWIA