1L7AA

Structural genomics, crystal structure of cephalosporin c deacetylase
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
318
structure length
318
Chain Sequence
b'MQLFDLPLDQLQTYKPEKTAPKDFSEFWKLSLEELAKVQAEPDLQPVDYPADGVKVYRLTYKSFGNARITGWYAVPDKEGPHPAIVKYHGYNASYDGEIHEMVNWALHGYATFGMLVRGQQRSEDTSISPHGHALGWMTKGILDKDTYYYRGVYLDAVRALEVISSFDEVDETRIGVTGGSQGGGLTIAAAALSDIPKAAVADYPYLSNFERAIDVALEQPYLEINSFFRRNGSPETEVQAMKTLSYFDIMNLADRVKVPVLMSIGLIDKVTPPSTVFAAYNHLETKKELKVYRYFGHEYIPAFQTEKLAFFKQILKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cephalosporin C deacetylase
molecule tags Hydrolase
source organism Bacillus subtilis
publication title 1.5A crystal structure of the Cephalosporin C deacetylase
rcsb
total genus 109
structure length 318
sequence length 318
chains with identical sequence B
ec nomenclature ec 3.1.1.41: Cephalosporin-C deacetylase.
pdb deposition date 2002-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1l7aA00
3R0VA 1OCEA 3G0IA 4UPDA 1AGYA 1TCBA 2PKYX 2WG0A 3D59A 3R40A 2GZRA 3QITA 1QLWA 1LPAB 1MX5A 1YS2X 4HVTA 4LYDA 2ZYRA 5ALGA 5ALUA 4EBBA 5AI0A 3WI7A 2XMBA 3KD2A 2QVBA 1JI3A 2AJ8A 2OAEA 3I1YA 4MYDA 1F8UA 4ZREA 2XLBA 3BDVA 4GEGA 3OG9A 2JBWA 2OGSA 3E3AA 3EQ7A 3HEAA 3I2JA 3BDIA 1BROA 1XFDA 2OCIA 1KEZA 2VTVA 1SCQA 1IZ8A 3N0TA 5HFAA 2Y1KA 4FFWA 1OXMA 4F60A 1EHYA 4BZZA 1FFEA 3P2MA 1MU0A 5ALSA 4DM7A 1W1IA 4X00A 2WFMA 4X6UA 5F4ZA 1IUNA 1EB9A 4FTWA 4FLFA 4ZWNA 1EDEA 3QBJA 1XQVA 3WJ2A 1CUAA 4P9NA 4A23A 4H7FA 5FUMA 1JJIA 5AOCA 1E5TA 4CIAA 5LP1A 3DYIA 1DTEA 4B83A 1B41A 4Y2VA 4DNPA 3HI4A 3C87A 3GROA 2HU5A 5BWBA 3E0XA 7YASA 2I3DA 1BS9A 2PUJA 2ZYSA 2HFKA 3STWA 2OCGA 1AX9A 1VE7A 4C6HA 2DHEA 1ZD4A 2GBCA 1EINA 3QPAA 3EBLA 3NOXA 2WIKA 3B5EA 2QT9A 3RARA 4P08A 1JU3A 2FUKA 2JEYA 1CUFA 5AM4A 2W6CX 1QO7A 1K5PA 2QXUA 3HSSA 1XQWA 2B61A 1BRTA 4XWGA 5K3FA 3AFIA 4I4CA 3VVLA 3WL5A 2RIPA 2XMSA 1O6FA 5LZ5A 4NS4A 3UMJA 4Y2UA 5JAOA 1R3DA 1CUBA 3VISA 1CRLA 1XZGA 4DNOA 2CMFA 2JF0A 3I28A 4WJLA 3WMRA 1XZEA 4FNGA 1DX4A 4LXGA 4AO8A 4MEAA 4A16A 2CUTA 3DKRA 1FFBA 4QNNA 4BE4A 5CH3A 3O95A 3C6BA 1UKAA 3QMMA 1VOTA 2H9YA 1VZ2A 5AKGA 1DWQA 2WJ3A 1XZFA 4H7JA 2DFPA 1N1MA 3IURA 5JATA 2CBGA 3GBSA 5JD4A 4HTAA 5JD5A 1N5MA 3DYVA 4KAAA 4PSUA 1ZJ4A 1QONA 2ONCA 2OXEA 2PSFA 3C6YA 2HA4A 5C8VA 2VEOA 5AIBA 2CKMA 2XQIA 4ITVA 3DL4A 1MT3A 1WCYA 2G5TA 2ZYIA 5JAPA 4BRSA 1CUYA 4J0JA 2Z3ZA 5T4FA 2R11A 3H2JA 4L9AA 1EA5A 1Z68A 3WL7A 2VQ6A 2YH2A 1LPSA 4FHZA 5ALJA 3M3DA 1N5RA 1ZICA 5EHQA 1QIGA 3R3UA 4NZZA 2VSQA 2Z8XA 5BV7A 3RLIA 4UBLA 3O0DA 3ESDA 4C4ZA 4JYPA 3STXA 5D6OA 2X5XA 4DMHA 2BFNA 3FYUB 3H0CA 4Y2RA 2Y2UA 2HA3A 5DNUA 5A7FA 2PSJA 4XX1A 4EB0A 1E3QA 4E14A 3KXPA 5SYMA 1XRQA 1ZI8A 3O9MA 1XRLA 4AN0A 5E4YA 1KU6A 3NWOA 3DCNA 1W4LA 2PVSA 2XUGA 1QIJA 4AMZA 4ZV9A 1ACJA 2PSHA 3JWEA 3DJYA 4UFNA 5C8ZA 5AKYA 1UKCA 1SCKA 5JZSA 3PUHA 4UUQA 1QZ3A 4AB1A 4DSAA 4WFKA 3KWFA 2I78A 4Y2SA 3DOHA 2AXEA 4B80A 4X6YA 3CXUA 1F0NA 2J4CA 1EXWA 2HADA 4DNQA 4MYSA 2JEZA 5ALIA 2NW6A 3WKAA 5HKBA 3AIOA 3VDXA 1MN6A 3BIXA 5ISMA 4B0PA 4NVRA 1YS1X 1QIKA 3H04A 4UBMA 2WILA 2PBLA 1HBJA 4X94A 4UBOA 5KWJA 1QTRA 1QIHA 2XUIA 5CXXA 3V1LA 4B9EA 4K6GA 2DQYA 1IUOA 2HDWA 4X95A 3H2HA 1S8OA 5IVHA 1PFQA 2XT0A 1WOMA 4BAGA 2O2GA 4K6KA 1CVLA 3W04A 5YASA 4W1SA 1CUCA 5EIEA 2WIFA 3R3ZA 1DINA 3H1AA 2ZJ7A 3OURA 3WK4A 4BVJA 3AILA 4BRZA 3LIPA 3DLTA 2RONA 1J2EA 1FFCA 1DX6A 1EI9A 3WK8A 1CUWA 2O2IA 4QWMA 1ACLA 2J4FA 1MNAA 3QPCA 1WM1A 4AZ0A 4X92A 3GELA 4K2AA 4BTLA 1AURA 1CUGA 5H3HA 1ORWA 3FYUA 3IDAA 1JFRA 1NU6A 3FCYA 4OB7A 2OAGA 3FWHA 4AN1A 2ZJ6A 4RPCA 1USWA 1QE3A 3SX4A 2ES4A 4FLEA 1XLVA 2OQIA 3BF7A 2XUPA 1ZD3A 1Y37A 4G4GA 4KAJA 1ODTC 3F96A 4GECA 1QIDA 1U2EA 3PF9A 4J3JA 5E4JA 5AI4A 5T4BA 2B9VA 1O6GA 2AJBA 2O7RA 1DQYA 1LZKA 5LZ2A 1CEXA 2ACKA 5CMLA 1C7JA 5IVKA 2YXPX 2XE4A 3AUKA 4BBZA 3I1IA 5JAHA 3WYNA 4G8DA 5HK9A 4V2IA 5A62A 1YAHA 1GPNA 1YA8A 4RE5A 3BXPA 3A70A 4P92A 2PU5A 4FBLA 1X2BA 2HA5A 1LZLA 4KRXA 1HL7A 2H1IA 1GQRA 1NU8A 5AKIA 4OD0A 4J0KA 5AKJA 2XUDA 1AC5A 1LPMA 3V1KA 1P0MA 4X6XA 1MO2A 3WIOA 3WL8A 4WY8A 3STTA 2XMRA 2LIPA 5C8XA 5FV4A 4G1FA 4MQLA 4W1RA 4G4JA 3OOSA 2DHDA 5I7UA 1J1IA 4HXFB 3B12A 3EQ9A 1MX1A 4CCWA 4Q1VA 2OLEA 1UOQA 1LPOA 4KE9A 4UFPA 2XUJA 4BCDA 2V96A 3LLCA 3C8HA 1U8EA 4DMFA 2B20A 3WJ1A 4DLNA 3FCXA 2C4HA 1OILA 1YSCA 1UZAA 3KWJA 3MUOA 4N5HX 3D3NA 5HF6A 4OU5A 3H2IA 2ZSHA 3D2BA 3GA7A 1PJAA 5AH0A 2HRQA 1CR6A 4BYMA 2IITA 1CQZA 2QUAA 4C4YA 1CLEA 2WU3A 4BVKA 5CT9A 4ZI5A 2BCEA 4AX4A 3G7NA 1G42A 1XZJA 3QPDA 4E15A 5ALNA 1TQHA 4PSCA 1TIBA 2ROQA 4DSZA 1X70A 4P93A 3PICA 4I19A 5CRIA 5DYYA 3I6ZA 3H18A 1H2ZA 1R4ZA 1LPNA 4IH1A 3RKSA 1R88A 1MX9A 4UHFA 4BTVA 3WL6A 1VE6A 3K9BA 3KSRA 4XVCA 5HQ3A 1ORVA 4BCBA 3G0BA 2VF2A 1DWOA 3WZMA 4U2FA 4TGLA 5BOVA 2FJ0A 5EIAA 1AMNA 2AJDA 3ESCA 3DEAA 4OCZA 4B7ZA 4FBMA 5D3KA 5BWCA 4LXHA 5ALHA 2QTBA 4DMCA 3I2FA 1ZGBA 2HHAA 4KJXA 3L1HA 2G4LA 4OSEA 4E11A 1CUZA 1AKNA 1PV1A 3G0DA 4KAFA 2WSLA 5D3ZA 1ETHA 2XB6A 4JH0A 2WUEA 3R41A 2XUAA 3GFFA 1U4NA 3PI6A 5AK5A 4X85A 3HZOA 5AM3A 1BCRA 5ALVA 1CUHA 3C6ZA 3CN7A 4AMYA 1GPKA 1EB8A 4BC0A 4EY4A 2JIDA 3F97A 5AJHA 4CI9A 5SYNA 3WK6A 1QOZA 4BP8A 3IULA 5JADA 5CH8A 4EUSA 1K8QA 1ZIXA 3TJMA 4B84A 4QDTA 3EQ8A 5AM2A 4Y9SA 2BGNA 3F8SA 3STVA 1CIJA 4YASA 1QFSA 3VKFA 1G5FA 4Y2PA 3G8YA 3FNBA 3DL7A 3A2LA 5ESRA 4H35A 4WY5A 4G8BA 1HQDA 5ALKA 2I03A 4MJ3A 4J03A 2C7BA 3PUIA 1FFDA 3G9UA 1DWPA 4AXBA 4WFIA 3E4DA 4Q82A 5AKXA 3QZUA 3WQHA 5KBYA 4X7BA 4FLMA 2AJCA 4INZA 1R9NA 3BJMA 4J0GA 4OB6A 2PM8A 4MQMA 2WLSA 5HK8A 1XLUA 2WHRA 4GW3A 2XLCA 4BDSA 1SCIA 5HCUA 3DNMA 4TVKA 4BVLA 4MXDA 2HA6A 1QIIA 3I6MA 4Y2QA 2O7VA 3EF3A 3RM3A 1VA5A 1KU0A 1XLWA 1IVYA 4HS9A 1QFMA 4W63A 5AI8A 3C43A 4G9GA 3W9UA 4QDOA 3C6XA 4H7KA 1TCCA 1XQYA 1BN6A 2QJRA 5AKHA 4WFJA 3W2TA 4LXIA 2HFJA 3AIMA 3HYSA 1EVQA 3ESAA 1P0QA 1W75A 1CUIA 1UK7A 5AK3A 5E4TA 2OGZA 3A2NA 1Q84A 3WWDA 3FOBA 1UWCA 3W05A 1R1DA 4KYVA 4FMPA 1MAHA 2ACEA 4GBGA 1ZJ5A 5JARA 1AZWA 3FYUC 3FSGA 4F21A 1R50A 5AM5A 1A7UA 2YASA 5HF8A 3O4JA 4W9RA 1HLGA 4G9EA 2Q0XA 3W06A 1UOOA 2QUBA 2UZ0A 5IH7A 2XMZA 1TRHA 1MAAA 2ECFA 2DSNA 1XZHA 2RHTA 5ALZA 2WKWA 1SC9A 3FLAA 1WB5A 1XZDA 2GBGA 3OPMA 4B81A 4UHEA 4LYEA 3ANTA 3HRHA 4IO0A 3PFBA 3HXKA 1XRNA 2PUHA 4Y7DA 5EI5A 1C4XA 3T4UA 5DTIA 1WB4A 2GZSA 3NGMA 1U65A 4KE8A 5IVDA 3TRDA 2WHQA 2WUFA 5ALRA 3FSGD 4Q3OA 4OU4A 3I2GA 3JYHA 4JNCA 4AZ3A 5A71A 3BWXA 1ISPA 1ZD5A 1JT2A 4X71A 3IUMA 4B0OA 5HFNA 3U1TA 5DWDA 4ZV7A 4I3FA 3BE8A 2WHPA 2RI6A 1EK1A 1JMYA 4B9AA 5FRDA 3G9XA 4Q3KA 1WHSA 5CT4A 3TGLA 4QWWA 4PV7A 3F9CA 5CT8A 4BDTA 4RGYA 1ZI9A 5CTAA 4F5ZA 3DOIA 1GZ7A 5CT6A 4G5XA 5D7BA 5DYWA 1A8UA 4G4IA 1CFJA 3WK9A 4FKBA 4ETWA 4OUKX 4PNZA 5FP0A 2JGJA 2DCMA 5AHXA 5HZGA 2EEPA 2D0DA 5CBKA 2CEKA 4KRYA 1Q0RA 1CUSA 1DT3A 2EDCA 2V98A 5LZ7A 3VVMA 2QOEA 2WJ6A 3X3HA 2X76A 4RE6A 3R3WA 5A7GA 3DKKA 2QS9A 4J7AA 2V97A 5AKLA 1W76A 2OCKA 2XUOA 3FVTA 2HA7A 1MNQA 4MWSA 4UFOA 1XZMA 1CUJA 1J07A 4H0CA 4AO6A 5EFZA 3PF8A 1X2EA 3D5EA 4ZGBA 2ZSIA 2OGTA 2PSDA 4ARAA 3DQZA 1XZKA 4QDZA 4BAZA 4FDMA 5AM0A 3I2HA 3G9TA 1NX9A 4OYYA 3D2AA 2VT6A 2OG1A 2Y6VA 4J0IA 2VATA 3GUUA 3O4GA 4CCYB 3IA2A 1LBSA 3FLBA 2C0PA 5JAUA 2VAXA 5ALXA 2ORYA 3CCBA 5JZBA 2WQZA 2RHWA 5JASA 4YK7A 5LKAA 2FJPA 3DD5A 2WUDA 5AKKA 4Y2YA 2VT7A 4AQDA 4FOLA 3H2GA 4LHEA 3IVMA 1J06A 1XRMA 5FLKA 2HM7A 3PDCA 3O9VA 1TKRA 2PX6A 4EY6A 3QMWA 3D4LA 5K3FB 3AJAA 3F67A 3H2KA 4PF1A 3JW8A 4X3CA 4H7IA 1XKTA 2QJWA 3I2IA 3S2ZA 4UHHA 1BCSA 4L3WA 4JUIA 5JIBA 1ZGCA 3B3QA 1FJ2A 1T4MA 3KOOA 5ALLA 1LLFA 2RAUA 2XDWA 5ALMA 5AOAA 4LKOA 1XZAA 2PSEA 1AUOA 1JKMA 3WKCA 1UXOA 1E8DA 2YYSA 2WFLB 2HA0A 2Y2VA 3O4HA 2BUCA 3VXKA 1P0PA 2QR5A 4E46A 4BCCA 2BJHA 2CJPA 1Y7IA 2QM0A 1THGA 3WWPA 1E8NA 4WDRA 3G0GA 3QH4A 4BZWA 4N5IX 3I2KA 1WB6A 1E66A 2G5PA 5CURA 4CG1A 1ZOIA 5ALYA 1GKKA 1YAJA 3HC7A 1HKHA 4J0DA 4IH9A 3ICVA 1VJ5A 3VJLA 4UBJA 2W22A 4Q34A 3OM8A 3E1GA 1Q0ZA 1DT5A 2QXTA 4KACA 5HKAA 4K5QA 4JEIA 4PSDA 1RP1A 1CUXA 4HAIA 2BKLA 1K4YA 4K6HA 5AIAA 2GYVA 3LP5A 2WFZA 4JYMA 1QTIA 1XQXA 1YCDA 2CZQA 3WZLA 2XQFA 6YASA 3WWCA 5DLPA 2AJLI 5AO9A 5EHXA 1K6EA 4OYLA 4X93A 2GYWA 1G4HA 2VJAA 1GT6A 1CUEA 2DQZA 2XUFA 3STYA 1VZ3A 1ODSA 1W52X 2DHCA 5LZ8A 1EVEA 4GXNA 4QZVA 3FAKA 3AIKA 5KREA 3NUZA 2C0QA 3G02A 1CPYA 5FPQA 4N8EA 4QDUA 1T2NA 2JGKA 3BIWA 5JANA 2I3ZA 3WKDA 3WA6A 3L1JA 4DIUA 1SFRA 3ICWA 2GBIA 3U0VA 5IVIA 1K63A 4HXEB 3LCRA 2PL5A 5JZ9A 3ESBA 5T4EA 2BUBA 5J3JA 4EA6A 5K3AA 2XI4A 3A2MA 4Q3LA 5ALQA 1BU8A 2CB9A 3WKEA 3WK7A 1VA4A 1XROA 2JGMA 4U2EA 1GQSA 3AZOA 2P8SA 2BGRA 2V9ZA 1L7AA 1BN7A 3QM1A 4DMKA 2VA9A 3M82A 4MWTA 4CG2A 1ODCA 2XUQA 1E8MA 1YB7A 5FPPA 3ANSA 4KEAA 1N8SA 2WG2A 5E2IA 4H7DA 1ZI6A 5I9IA 3QMVA 3V1MA 4EHBA 1GXSA 1VXOA 1GKLA 2HU7A 5T4HA 5IKXA 4RNCA 2XMDA 5EIHA 4QDXA 1A88A 3D2CA 4A5SA 2QRUA 3V9AA 2QMQA 1EX9A 4B6GA 2C58A 5ALEA 5JYCA 5HQ3B 1H22A 1XZLA 2VAVA 1HPLA 5CXUA 1G66A 3K2IA 3VJKA 1QIFA 5ALWA 2J3QA 3C45A 5DTJA 1MPXA 3AZQA 3IB3A 1LPBB 3EIOA 1F0PA 3AZPA 4OB8A 3C5WP 2WUGA 3RK4A 5FXMA 1D07A 3ZI7A 5KWIA 5DNWA 1IMJA 1IUPA 3Q8WA 1JU4A 2IIVA 3KDAA 2Z5GA 2HIHA 3LIIA 4FNMA 3G9ZA 1GGVA 1A8QA 5AOBA 3HACA 2H7XA 1VXRA 1ZIYA 2HA2A 1XZIA 2VJCA 2X8BA 2XMQA 4GWLA 3HLKA 5AKEA 1UT6A 2C5GA 2FX5A 2VJDA 1VLQA 4GI1A 5ALOA 4N8SA 4MEBA 4M0MA 4GLBA 2ZJFA 4B85A 4G8CA 3R3VA 2HRRA 2WJ4A 4XIIA 5AI6A 2JGIA 4GDMA 5AI5A 2B4KA 1MJ5A 2R8BA 4YPVA 5DJ5A 4H7EA 4PO3X 4O08A 4AO7A 2RGUA 1GPLA 1XZCA 1IZ7A 3A6ZA 5CH5A 1R9MA 4ZXFA 4HXGA 1AQLA 4QEKA 1BEEA 3V48A 3V1NA 4GHWA 3SC2A 1FSSA 3S8YA 1BE0A 4S0XA 2OCLA 2Z8ZA 4U2GA 5C7YA 4ARBA 3UUEA 4Z49A 1CV2A 3WA7A 1YA4A 4H7HA 2WFLA 3C5VA 3WWEA 3T52A 4UBIA 1H2XA 5EHNA 4H77A 1CQWA 4H18A 4OPMA 5LYYA 3PFCA 3R3YA 5HF5A 3ZV7A 1C7IA 2O2HA 4B82A 1H2YA 4Y2XA 3PE6A 2HL6A 4Y2TA 4CCYA 1BEZA 3FBWA 1EK2A 5AP9A 3OC0A 4BP9A 4HRYA 4U2BA 1DQZA 2PPLA 3HJUA 1H23A 5K3EA 2XQGA 2JGEA 2WTNA 3GZJA 2WHPB 2WM2A 3YASA 2XUKA 1QO9A 3ZLTA 4XJVA 1M33A 5AM1A 4EY7A 3AINA 4W1PA 4UBNA 3QVMA 4C88A 3DDUA 2QZPA 5ALFA 3F98A 4QA9A 2Y6UA 2ZVDA 3IUJA 2OQVA 4CG3A 3N2ZB 5A6VA 4CIBA 5FDFA 2D5LA 1UKBA 4BATA 4UHDA 3ILSA 5AKZA 4N8DA 5A2GA 1FFAA 4EY5A 2XMCA 3HABA 4ROTA 3ZLVA 2WTMA 4F0JA 3WWOA 1CUUA 3UUFA 2WU4A 5DYTA 1XRPA 3WLAA 3C70A 3IIIA 1UOPA 1QIEA 4FWBA 5CT5A 1JJBA 5LLSA 4C87A 2HU8A 3D0KA 1RWQA 4BE9A 4DGQA 1I6WA 4Y2JA 4NMWA 2XUHA 3SK0A 1DU4A 2VJBA 3W9BA 3Q0TA 1CUVA 3WIBA 3ZPXA 3WYDA 3ZWQA 3SWWA 3BF8A 1QIMA 5K3BA 3ZLUA 2K2QB 3IUNA 3WK5A 4L0CA 4C01A 1VKHA 4UHBA 4KR0A 4HRXA 3G0CA 4EZIA 1QGED 1HDEA 3CN9A 4X91A 1Q83A 4DYHA 1LPPA 3M81A 1B6GA 3ED1A 3VJMA 1UFOA 5AK4A 2G63A 4IHAA 4DNFA 1EDBA 3QYJA 1A8SA 1UK8A 2H7YA 5CW2A 3K6KA 1TCAA 4UHCA 1P0IA 3C8DA 3IUQA 3TEJA 3STUA 1Y7HA 4M0EA 4FFVA 4C89A 5HF9A 3MUNA 1L7QA 4C4XA 1SOMA 1F6WA 1YR2A 5A7HA 5LIPA 1H2WA 3WKBA 5LZ9A 2H7CA 2WIDA 1XRRA 2BUAA 4UBKA 5ALPA 4IQ4A 4L72A 4KE7A 3FLEA 4QE3A 2Z3WA 4IH4A 5C81A 1XZBA 2WG1A 2GBFA 5AI9A 2WIJA 3I6YA 3FYTA 1YB6A 5FKJA 4BAUA 1QJ4A 2DR0A 4LIPD 2XQJA 1E89A 1MTZA 4PW0A 1UK9A 3M83A 3H1BA 3IBTA 1W6RA 2GYUA 3D7RA 4WDQA 3CCCA 4Q05A 5K3CA 1EH5A 2XQKA 3H17A 4U2CA 1YASA 2EDAA 4TPKA 5JD6A 5AK6A 5LKRA 2WIGA 5ALDA 3BJRA 3FVRA 4YX9A 5K5EA 1RYYA 2JGFA 4EY8A 4J0CA 4DTCA 4QLOA 4WCVA 5I8PA 1WPRA 5DNVA 4D9JA 5ALTA 5JALA 3LS2A 1CUDA 3R3XA 4ZRDA 3MVEA 3H19A 1UK6A 2JGLA 1JMKC 2OPHA 2E3JA 5K3DA 4BC1A 1ZD2P 4PQEA 4X90A 2XMGA 2J3DA 1EDDA 2C5FA 5FOQA 4BB0A 4QLAA 1XKLA 3BL8A 1LNSA 3O4IA 5LZ4A 1WHTA 4J0HA 1JJFA 4KE6A 1LGYA 1TK3A 4HZGA 2ZYHA 1LBTA 3OTQA 3L1IA 5AICA 2QKYA 1WPXA 3DS8A 1TAHA 4U2DA 1THTA 4W1QA 1L7RA 4X97A 3MGAA 5EGNA 5EHZA 2IX9A 2PU7A 2BAGA 4CFSA 4M0FA
chains in the Genus database with same CATH superfamily
1JDBB 4L5CA 4OQFA 3HHPA 1IBRA 3FD8A 3I4LA 2PK3A 3R0VA 3DOOA 1OCEA 3G0IA 2VC2B 2C2MA 4UPDA 3F46A 4DWOA 4LDZA 5E4FA 3VTFA 4AQ7A 1RMQA 1TCBA 4DLLA 5TC4A 3T1OA 5LYJA 3WSTA 4U7WA 4C7KA 4EF4A 1ONPA 2WG0A 4EL5A 1NX6A 2VRNA 4DLVA 2JFBA 3D59A 3NV9A 1RABA 3R40A 4M9SA 4RLSA 3MWYW 2Z1NA 2BTQB 4DZZA 2WMOB 3MBOA 3IE1A 5B53A 4KKXB 3P32A 4HVTA 1IXZA 5HW0A 4LJYA 3AVYA 2QLJA 4S05A 3ZWDA 3KRTA 4YRMA 4X6LA 5BN3B 3TKAA 4DA8A 4W5TA 1K0FA 5FOWA 1ZIOA 3PC4A 1JR3D 5AI0A 1B8PA 4I5FA 5EXPA 4EHFA 2NQ8A 1OXUA 4MTCA 3WI7A 3LBIA 4S1PA 4AKHA 2GPYA 3SJZA 1KMHB 3AVUA 2OAEA 2DUMA 5C4IA 3CNLA 1SM4A 4CKWA 1MRZA 1U6IA 2VQSA 2ZJ3A 3EIHA 3CNOA 3JD1A 4X63A 1VGRA 4TT3A 4ZQHA 3FR8A 3SGLA 3WLTA 3F9IA 4KQXA 4UVEA 3L7DA 2W43A 3EQ7A 1W73A 2I0FA 1KBZA 2Z04A 3O1IC 4DCUA 2HXYA 3QVSA 3TQOA 2XX3A 1FC0A 4HDRB 2I6TA 1N5LA 5I7RA 5I7FA 2FZWA 2QPTA 3H2YA 1SG0A 4V0ME 5EVCA 4MP8A 1R6AA 3BDIA 4FKZA 4WXRA 3WRYC 1E32A 2WM9B 2Q3HA 5C4GB 2OCIA 1ECPA 1EFCA 4OAPA 1XVTA 4ON9A 5DW0A 2BT4A 2POCA 1N7JA 3RTEA 2CL6X 1HORA 3KPWA 4BZQA 4DDHA 2R84A 3HYLA 3OPNA 4DIOA 4RXUA 3N0TA 4TKLA 1PKXA 3L93A 4QL3A 1FQWA 1DO8A 2B92A 5KTKA 4HQ6A 4JR0A 1Q12A 4F60A 4OL0A 4X54A 1DG1G 3CVOA 4FFDA 5E6SB 4CWAA 2HMAA 3ESQA 3FG9A 4YQZA 1Y3IA 5KWVA 1Q0SA 4BZZA 2Z1DA 3Q11A 1UKEA 4DMUB 4FS8A 1XCMA 1G8YA 2IF2A 3BMOB 1J39A 5LDHA 2Y1LA 3WNVA 1FFXA 1IUNA 5F1OA 4Y6LA 2A58A 2QV0A 3O4RA 4FTWA 1UP7A 2NV6A 4ZWNA 1AA9A 3OZVA 1GXSB 3QBJA 3MUFA 2ON6A 5DRYA 3T3DA 2CNDA 4PIPA 1PW7A 2WYVA 1CK4A 3H4TA 1A2BA 3ILHA 4P9NA 3X1JA 4H7FA 4F9EA 4ENVA 4UZSA 5FUMA 4MV8A 5LQJA 3RADC 1N2BA 1SCBA 2HJGA 5J9FA 1D1QA 5AOCA 3U48A 2ZAGA 1E5TA 4JB2A 1W4ZA 3QF4B 4YLYA 1SUEA 3P9PA 1V39A 1EVIA 2A1TR 4L51A 4HY3A 1B41A 2G7MC 1YE8A 2ZXFA 3GDOA 4CTJA 5JYBA 4BFTA 1L1FA 3N2LA 1GPWB 4UUBA 2H11A 2HMUA 2HU5A 2NO9A 2GEDA 2ZRLA 3SLRA 3E0XA 3BWDD 4A9AA 7YASA 3ZDFA 1QRUA 4UU7A 3SM3A 1BS9A 4XUEA 4CKEB 3DKVA 2FWBA 4NMXB 4OQQA 4YRNA 4YUYA 5LU8A 3I1FA 3STWA 5F23A 4LBVA 5IBQA 2TYSB 5CVCA 5JVDF 1ZD4A 1W1WA 5EINA 3L6UA 2NSJA 3Q8MA 3L7IA 1G5QA 5FNZA 2OTCA 1KEUA 4AZVA 3NOXA 4OQEA 2QP9X 4YHBA 2FWRA 4L4UA 1Y3BE 1PSDA 5K8VA 4S04A 1B8UA 4CQMD 1DADA 1KYIA 4AKIA 5I48A 3UPUA 2QLBA 3CPJB 1Y1RA 2FUKA 3AF4A 5AM4A 1IVNA 4RK4A 3SF0A 1AV7A 3O93A 2FFJA 4AMBA 1MOZA 4X64B 4JP5A 2CDCA 2QXUA 2IYNA 3HSSA 3NHRA 4G0OA 3DLPX 4S0ZA 1RACA 1NNEA 2IXDA 3M7IA 2R8RA 4YRGA 1BJTA 2V74B 5TXGA 3ZKWA 1UMDB 3VSCA 1ISSA 1GCUA 3EEBA 3OEEA 3WSWA 2QN1A 3GGSA 5AVTA 3KQWA 2OMKA 1TMOA 2GA8A 4FGWA 4NS4A 1JHUA 1HQKA 2II6A 3KKLA 3UMJA 1R4MA 2YFQA 3EK2A 5J47A 2IGTA 3G7SA 1U80A 2I7TA 3QLVA 1O4VA 2PDAA 2CMGA 3MWLA 2V59A 4O2BF 2OEPA 1P7PA 3WBKA 3VISA 4Q4JA 4ABYA 4EJ6A 4MW0A 1XZGA 3G5LA 4HD8A 5CFMA 1WD7A 3N76A 5IZCC 1XD9A 2CMFA 5JS7A 1EKXA 1VC2A 1N2IA 1L5QA 2IZ0A 4RCYA 3JV7A 1JAXA 5DX1A 4WBNA 3U0BA 1G20B 2CFCA 1D0SA 1PEKE 1NVUQ 2AN4A 1OLOA 3AHDA 2AOTB 1XUOA 2VF7A 1R0KA 2F3SA 3HBNA 1I5RA 2ZJ1A 4M0UA 2FZGA 3WMRA 2NXCA 4XCQA 3W5CA 2BFPA 1E7SA 3J7TA 3MT8A 2LIVA 4LXGA 3T3IA 1Z2NX 4LX0A 4MEAA 3RS0A 2AI1A 2NO6A 4X7RA 4AJKA 3RIXA 4TRNA 2GXSA 1T1SA 2AD5A 3AI3A 3EXHA 2IY8A 3P0JA 4GRIA 3RF6A 3V4VB 1FFBA 1ULAA 2VHWA 5CH3A 3UV3A 1RWMA 3OP1A 5BW8A 8OHMA 2AHOA 4M1QA 3O21A 4EG4A 3QMMA 4EGQA 2X7JA 1LV7A 4GR9A 3IHTA 2YVQA 5IT0A 3NJRA 1VOTA 2UUCB 1PJ8A 2HBRA 2P2LA 1ZVMA 4ZCPA 4FEGA 3UC5A 1VECA 4R3WA 3BEOA 1NQTA 5GV7A 3N6VA 3IOMA 5EQFA 3HU2A 5JECA 1P19A 2XZOA 3K9WA 4C07A 4FMDF 3VU3A 3W5IA 4QGBA 1XCJA 3KVVA 2DFPA 1WZIA 3CJRA 1N1MA 3IURA 3PWKA 4HOYA 2GVZC 1C81A 2Q62A 2R1VB 4F2GA 3DG9A 4DQVA 4PE5B 2JATA 2ADFA 2VQEB 1GU0A 2R8OA 3BTSA 3M6UA 4WBSA 3ZK9A 2NPIA 4ZMBA 4RTQA 4GYJA 1E4EA 2PSFA 1D0IA 3FDFA 2PMCA 3DZFA 1H9AA 1P77A 2W6OA 2A3NA 4I4TA 5FLXA 3PQ7A 5C8VA 1OU4A 2VEOA 2ZUVA 1X1AA 3G1WA 3OOWA 4FHEA 4EPYA 5AIBA 4X8LA 5HS4A 1M0WA 1OY1A 5H4GA 3KQKA 2I8AA 1XWIA 4Y67A 5LD2B 2WPNA 1PZFA 1WCYA 3K0FB 4EK9A 2P3SA 1ZUNB 3E6AA 3GRZA 4ER3A 4HZIA 1JQDA 1CUYA 2YWXA 4JELA 2OO3A 4C4SA 4HLUA 4DIFA 2Z3ZA 2Y9MB 2BKUA 3IUSA 3TQFA 3R44A 1M2NA 2R11A 3T7SA 1COWA 1MGOA 5FPSA 3EODA 4D6PA 1ADJA 4YRRA 1TK9A 4L9AA 1EA5A 1N2GA 2FWMX 2Z0MA 4YPFA 1UZLA 4BMCA 3HP7A 4RTNA 4B3GA 3ZVMA 3UJ3X 1GCAA 2Q3LA 3IE0A 3ZE0B 3JCZA 1EZ4A 1YFLA 5AQEA 1OXSC 2YMQA 1GGHA 3EC7A 1BNCA 1DAGA 1W0KA 2BFBA 1KO1A 1SVOA 2C8LA 1JKXA 4MQ6A 3NW9A 3M3DA 2QTWB 3BFJA 1MBZA 1K8ZB 1SUWA 3R0JA 1DKMA 2HF2A 3QEMA 2Y0DA 4FDUA 1MQ9A 2QTTA 2Z8XA 2WU8A 4ALIA 5K0FA 3DF9A 1YE3A 4Z1OA 1M1NA 4RBNA 2R97A 1XTQA 4QXAA 4OQPA 3WSVA 1VQ1A 1IJBA 4C4ZA 4K0KB 3GCDA 4XDGA 1OFIA 2WZBA 2DUWA 4AIIA 3OIDA 4OSPA 4CGZA 5KYVA 4C4RA 2I22A 1N57A 3CZ5A 1E18A 4LRXA 5EKDA 2RB5A 4B4KA 2BFNA 5E1BA 3TTSA 4B3HA 2P0AA 2WUVA 1EFKA 4INOA 3ADCA 1PTJA 1NFRA 1JDSA 4P8RA 4I8DA 1L8XA 2PSJA 5A3VA 2FDXA 4EX6A 5K8JB 2FPGB 1KR5A 2BFCA 3HCNA 4XX1A 4BU1A 4EB0A 1S6YA 1YRBA 2HNKA 5JISA 5K0ZA 1IBMB 2JI9A 3KXPA 3QVUA 5F3RA 1ILEA 4DUGD 1XRLA 1AS3A 2OESA 2V45A 3VNUA 3PVSA 4JUFA 4XYMA 3SHQA 4IIUA 3FDJA 4AN0A 1BD4A 1GHTA 5E4YA 4BNVA 1KU6A 1UANA 1VRWA 1XDZA 5JDIA 4K9PA 2O57A 3Q12A 2GMWA 1FPQA 2PVSA 4RFSB 2V4UA 4WBNB 3SSOA 3SIPA 1LF5A 2FJUA 3HP4A 3HO6A 4QU5A 3CNHA 1B3BA 5C3MA 3ZCXA 2ZRFA 3QELB 3PNVA 1O97D 2ISSD 2P68A 2QPAA 1ZMTA 3EEOA 3UMBA 4KR2A 4M0DA 4BV8A 3CW8X 4FHDA 1WKVA 1T4BA 4RSGA 3HCRA 4ZVNA 4YN3A 1OXKB 2V5VA 3IAAA 4CN8A 1G8JA 1RHMA 1UKCA 1CZRA 1SCKA 5C1BA 4FHFA 2JASA 1YZTA 4ZAZA 3OX4A 4CBVA 4YP7A 3A6FA 4IRMA 4TVOA 4QUDA 4BO5A 4JB3A 1QZ3A 5KTYA 1QHIA 5DASA 1REQB 3IQZA 4G5HA 3O8OA 3CHYA 1YDFA 3N6RA 4G0PA 2JLYA 1O6CA 3VUEA 5CIYA 2EJUA 4G56A 2VSFA 1ORRA 1YR6A 2FPOA 3SX2A 3K30A 1KOFA 5DMXA 4ZDKA 2AXEA 3OECA 2QTFA 4V39A 3OCJA 4IFBA 5IF3A 1ZNZA 1E59A 2FZKA 4X6YA 1F0NA 1HO3A 2YDYA 2J4CA 2XZTA 2ZTUA 1HSOA 1H4SA 2EIXA 1LBQA 3CEHA 4XIGS 2WIBA 3Q7TA 3WV4A 5KYXB 5ALIA 1DTWA 2W0SA 1PQ4A 2NW6A 2C97A 2X1HA 3C0KA 2BI4A 2PMDA 1Y81A 3AU8A 3BE6A 5B7NA 3VBEA 5HKKD 2PKQO 1BVHA 3F7TA 1YKFA 3AMVA 5TQVA 1J42A 2FPIB 3NRBA 3RVRA 3FI0A 3DDWA 1UMCA 1E3WA 1GR1A 2B8TA 1OPRA 1BDIA 4NNOA 1QIKA 3H04A 1RD4A 5HBGA 4YXWA 1ITZA 4UNIA 5HHTA 4E5SA 4ODIA 4TL9A 4YUXA 1M8JA 1VMAA 3T5TA 3LYLA 5K8UA 4G8JA 2PBLA 2Q6TA 4N48A 4X94A 4TSKA 2WHEA 3CRW1 4UBOA 5CW1A 3TZQA 2OLKA 5D5QA 3NYRA 3NTXA 1QIHA 3MWEB 5CNKA 5H82A 4IJKA 2A0UA 2IUYA 4L2IB 5EERA 1FXWA 1Q7TA 5LP6B 3P2KA 3UH0A 4M1MA 3V1LA 2O5VA 2YWRA 5ILOA 4TT3D 4F3TA 1IG0A 2NUBA 1DIGA 3ELBA 3IPLA 4UVDA 3UKJA 5CEJA 1MB3A 4R1TA 1NR5A 2HBQA 3QTTA 4IXNA 4B2PA 3AEKA 3I72A 2HDWA 3O84A 1VLLA 4X95A 3SQDA 1PQWA 1E1LA 1DXOA 2ECKA 3FCAA 4E4YA 2XT0A 1GUAA 2X0JA 1H0RA 2YFYA 4Q4DA 3ZK8A 4E6EA 2IA5A 2X86A 1FP2A 4HDCA 4G1VA 2QB5A 5CXSA 4ZC1A 2D4HA 4GOLD 4MDHA 3C74A 1EFRA 4ERXA 1B8NA 5DLYA 5K1ZA 1CVLA 1Y1PA 3H99A 5IDYA 3VGJA 5I7VA 3PHCA 4H1TA 5DNAA 2PQ2A 1KMQA 1W93A 3ZS8A 1N2HA 2PO7A 3TBHA 4UOEA 1PS0A 4R1UA 3IR6A 2XCSB 2QD4A 2C4VA 3RV4A 2JBHA 3TXAA 4OK3A 4CTOA 4XA8A 3OU6A 3MRXA 3EYWA 3KCNA 3RROA 5DHTA 5IG2A 3KLBA 4BN5A 1W7AA 3NOOA 3UK7A 2WIFA 4XX0A 6ADHA 1ZINA 3HCAA 3TSYA 3OTHA 4LECA 4EFKA 5JSYA 2IU6A 4JKIA 5H8WA 4ZCSA 3E5RA 4LC1A 2JFXA 1NJ8A 3L1VA 5JCJD 2HNAA 1MORA 1X74A 1ZXXA 3ANMA 3DFKA 5B4UA 8ABPA 3NYIA 2E4UA 3PX7A 3K53A 3VZBA 3LIPA 3DLTA 4HAOA 3M1YA 1ZM2A 1BW9A 2P78A 2OG2A 1IOZA 4JR2A 2VWQA 3ZUPA 3EB9A 1VHQA 2COUA 4Q01A 1WP4A 3DWEX 1BQ4A 4MV5A 2OWDA 1TI7A 2HPAA 3EXFB 4NCNA 2R6GA 1M8KA 1XK6A 4G4SP 3QP9A 1TM1E 3KDPA 4L76A 2DERA 3ROKA 1QP8A 2J0QA 1UAAA 3KL2A 4LY3A 3ENNA 1ACLA 5C7IO 2PJRA 4HGZA 2CNNA 2OHXA 4OJTA 5D7NA 2HJRA 2H1HA 1ADBA 3QPCA 4PX3A 2LBPA 1MXFA 2EFDB 2IOYA 3O2NA 4PG4A 1F14A 2YN0A 3GELA 2FZLA 4OQLA 5CK5A 1P74A 4K2AA 1TQ6A 5BV8A 1Q16A 2JLWA 3MB5A 4BNDB 2E55A 1U28A 4CL8A 5A3RA 3HDJA 4B4OA 1XPUA 4M87A 5H3HA 3UTCA 4CDGA 5BQ3A 3M4YA 4I8XA 1JPNA 1JFRA 3K15A 4DLXA 3ZW7A 3HKBB 3GUZA 1TKBA 2CVHA 2H2HA 5JZVA 3G2NA 1WA5A 3O8NA 3NHUA 5KVQA 2ZJ6A 4LOAA 3HB7A 4OHCA 4BNGA 2GN6A 1G1MA 1I4EB 3L8MA 5L3ZA 5I7SA 1X9IA 1XTKA 4ZXPA 3QKWA 3SX4A 4E5YA 1FMJA 3FB4A 2ES4A 4JP3A 3HP1A 3R5JA 5AVWA 3K9FC 2X8LA 3FHOA 4JLUA 2Z30A 2Q45A 3VR6H 2V9PA 1DCTA 2OQ2A 3I12A 5F76A 3H0EA 3SC3A 5EJ2A 4L8WB 4BWGA 3MERA 1GA4A 2GDJA 1ODTC 2PV7A 1U2EA 3PF9A 2E5WA 1YS6A 4K8OA 4J3JA 5AI4A 1E1YA 2J3HA 4IIBA 3IA7A 2B9VA 3TSOA 2GZ3A 4Q6BA 2P9FA 1IWBB 2AJBA 2O7RA 4AJHA 3A1DA 3MD9A 2ZE6A 3LT4A 3FN4A 4OAQA 3Q3IA 3ILXA 1UC9A 3HJHA 5G3YA 1FF9A 5ITZB 4IDAA 1GWNA 2I4OA 2AI3A 1PT5A 3U7HB 1LRKA 1Z56C 1YTLA 1HY3A 2FZVA 5JAHA 3JPYA 4G8DA 1GDDA 2JIRA 4IL5A 5EIWA 2ZT7A 3VO9A 5L3QB 4YECA 3VOAA 1YAHA 1RPNA 5A62A 3CV3A 2BZGA 3MT7A 4M88A 4K6OA 1F38A 1BD3A 3B8HA 1IULA 4PYNA 1VYTA 3ACCA 4B76A 1JIQA 3O1JC 3BXPA 4R9RA 5AXCA 5CVVA 4NU5A 2D8AA 3AR4A 2ENWA 4P92A 3MXTA 3I5UA 5REQB 3AWDA 1T8TA 4EJ0A 5B1DA 1ZS9A 2EERA 5JH7A 4DG5A 1FVHA 2LXNA 3B1ZA 3E9EA 4N3GA 1QRTA 3A7EA 2B6NA 3ZBTA 4B4WA 1F4VA 1GQRA 1NJ5A 1XMXA 3SLKA 3KT8A 5FI1B 1RKBA 4ER5A 5AKIA 2D1YA 5FH9A 1P75A 3Q5EA 4XPZA 1U3VA 4KTVE 5AKJA 1VJGA 2XUDA 1JHDA 1AC5A 4Y6PA 1O95C 4PC7A 3V1KA 1JXQA 1SHKA 2KI5A 4LXYA 4X6XA 3A27A 3PNKA 2IE0A 1EGAA 3WIOA 2NO0A 3PVCA 3WL8A 1D2NA 4CM9A 4MA4A 4F4UA 3V2IA 4ZAWA 8ATCA 3UHPA 2VJKA 1VM6A 3L7AA 4TWBA 4I14A 3ITEA 3IUBA 1OTXA 3KJFA 4P7BA 3VV3A 2SHKA 3PNSA 3IKLA 3DPIA 4G1FA 2O2DA 4MQLA 1IWPB 5B3AA 2WW8A 4MQ4A 3JQBC 2QRKA 1SD1A 2BH9A 3W5UA 3C3BA 3CBQA 4Z53A 1J1IA 5IWCA 3L9XA 3B12A 2UZ4A 1X6VA 1GTVA 3PD1A 1L7EA 3QVWA 2AOUB 4G67A 1WL8A 5B6PA 1E98A 4WINA 1NN0A 3BMCA 1RZ3A 3L7CA 1GZ5A 2GEUA 4XJXA 3TQCA 3ZTTA 4MVJG 3QJYA 1DG9A 2OLEA 3KTFA 4JVLA 4JXKA 1M7BA 4YJ2B 5TT1A 1QVRA 1SXJD 2Q4DA 5G0UA 4UFPA 4N6OA 4TXLA 2MIIA 3F4KA 1YZFA 3LLCA 1DAMA 4D3DA 2ZWOA 1U8EA 3C8HA 3MHTA 4HYQA 4PG7A 3DR3A 5DHQA 3DOUA 2WD8A 4BKPA 1BGVA 2WF9A 4NZOA 4QVGA 1A1VA 4I9HA 1J2RA 1NUHA 1RC1A 4RC9A 1CR4A 1TEXA 3EDOA 3CBGA 1O7JA 5C32A 1GR0A 1PT6A 3ZWKA 2QX8A 2HWUA 4GI7A 3UNXA 3KS9A 3I45A 3UUWA 1W85B 1ODJA 2L19A 2GILA 2QMOA 3MUOA 4E5DA 3WHLA 1KVTA 2QN6A 3OJFA 1TJ4A 3R0QA 1N9GB 2H4FA 2ZSHA 4OU5A 4PZ9A 3QNUA 4OXXA 3RU2A 3WHPA 5B30A 5D1HA 2ZUCA 3GA7A 1PJAA 4J0FA 1AK9A 4YRQA 2WWWA 3UXEA 4CMKA 1GRVA 3K9GA 3KPUA 4BYGA 5CDUA 1PNOA 2FXIA 2NTEA 4YJ3F 5TPWB 2QYTA 4BYMA 2IITA 1CQZA 1CLEA 2WJVA 4O4LA 4BVKA 2I6GA 3OZFA 2GO7A 4ZI5A 4D02A 4FE7A 4AX4A 2ZWAA 3R0IA 2Q5OA 5FEMA 1G42A 1G20E 3MMNA 2Z8YM 5MGBA 5ALNA 1YVEI 4BLOA 5AQ1A 1DBWA 1KI3A 4TN5A 1P72A 3JY6A 4NH0A 1DJLA 1R0BA 4ZP1A 5EL0A 4IOLA 1Q7GA 4OGGA 4TS9A 4WMLA 5DE3A 5D51S 1TNDA 1EAMA 1L4LA 2JHCA 3RUFA 2Z4RA 3VR4H 2R1ZA 5EPUA 1QE5A 1AF4A 2QL9A 1C14A 1Y1SA 4P93A 2OM6A 1I4DD 2IPOA 2P9JA 3PICA 4I19A 4PINA 5CRIA 2D3TA 3H18A 4A91A 3M5CA 3JQAA 2RJ3A 4JLNA 3U3RA 3R9XB 3RKSA 4F2WA 3T61A 5KAMA 3KYDA 3G8CA 2Z2JA 1U7XA 4KOEC 4F6LA 1RAAA 1ZK1A 2DM6A 3ANLA 1T1EA 3EWSA 1NW9B 1S2GA 2ZYUX 5HQ3A 4IXWA 2WICA 3N87A 3S2IA 5H7XA 2YXEA 1DCKA 1TMGE 3WIVA 1U8UA 2R6AA 3FLMA 1RHKA 5AJUA 4B3FX 4B48A 2F48A 2NQTA 4BB6A 1RYZA 2VHTA 4WRRA 1JLKA 3WZMA 1OWPA 1MZPA 2C3UA 4N4AA 1RADA 1G6KA 1UJ5A 2FP3A 3USZA 4TTTS 3SJUA 4EJSB 3LX5A 2GD2A 4KWHA 1SU6A 3DEAA 2ZITA 1DXYA 4UM9D 1SG6A 4XUDA 5FIUA 3I6IA 3FPSA 3GLFE 1FJGB 3I64A 4LXHA 3RE1A 3PNPA 2ZTVA 3RYCA 2P4HX 1WMFA 3USES 4LXQA 3FHCB 3AC0A 4C0LA 3AT1A 4Y6GB 3SDBA 1V8DA 3CLVA 3HJRA 3UJ9A 5C31A 1CY8A 1EJ2A 3R5XA 2FEMA 2B98A 1QH0A 5F5LA 5HUJA 3X44A 3L1HA 3CUSA 5AVVA 4BFXA 2HBYA 3ZXUB 4ZEXA 5JCJA 1P39A 5TS3A 1BX0A 1QRDA 1NE2A 3S27A 4W9MC 1CUZA 3BXZA 1Z3CA 4O4HB 3TLGA 1KIFA 1OAKA 4J9UE 1CJCA 1GYPA 4LK2A 5BSEA 2OFXA 4EVIA 4EFLA 1AKRA 4MW5A 2IUTA 5BYBA 5KOJA 1M6WA 2XAUA 3NFRA 4NULA 2QTRA 2QY9A 2WZQA 2XUAA 3G5UA 4MR9A 2CT8A 2FF7A 3DT8A 5ARCA 1E96A 1DRVA 1DAPA 1XD2A 2N1BA 1PR9A 3HZOA 1BCRA 2H51A 2AD1A 2FETA 2HD4A 3I8OA 5AM3A 1HH4A 3CLRD 3OIYA 4P6VF 1IEQA 4Q18A 5LWQA 1CTQA 4JBGA 4OLFA 2W4IA 4XGKA 3SXUB 4D4MA 2JIDA 3FRHA 3GUCA 1OZ0A 3OWOA 2ZI7A 3PNQA 3QHAA 2LR0A 4TWRA 3LVBA 3EG5A 5SYNA 3EA0A 2C3PA 5JQGF 1CJVC 3F3MA 1QG6A 3N8HA 1YU9A 3BWBA 5ICCA 3EXG1 4R83A 4JA0A 2VK8A 421PA 4DIMA 3NHKA 1KEEB 2A92A 5JJCA 1Y8ZA 2EHDA 4XRRA 1CQXA 1B14A 4QM6A 1KYZA 4NENA 1QV6A 1G4AE 2LKDA 2ILVA 3MRVA 3INRA 1G6Q1 1ZIXA 3Q2OA 4HWRA 5CFRA 1TQ8A 3KFLA 4FYWA 3QG1A 1U81A 4Q7MB 4QDTA 3TTUA 3EQ8A 3NP7A 1VL6A 4Y9SA 2GN2A 2ZBPA 2BGNA 1FB5A 1K8YB 1QC5A 2FFQA 3O38A 1V16A 3AB8A 4JVMA 3TBKA 3STVA 4OOEA 5ERYA 1CIVA 1JEQA 1J0DA 3KV1A 4EG7A 1U7UA 3DBRB 1UC8A 5FX2A 3GEBA 1L4GA 1SQSA 5B55A 4HWOA 1RBYA 2AMLA 4M83A 4OLHA 1US8A 5JCPA 1Q22A 3G2LA 4E03A 2FYTA 2XEXA 1T3GA 3ROXA 1OXBB 3AKDA 1COZA 1X3LA 1PFUA 4IDQA 4IV5A 3A9CA 4HUQA 4E5VA 4E7PA 4QXRA 1WKBA 4AVYA 4V02A 1HQDA 2G4CA 2QQGA 4L5JA 2FN4A 3ONVA 5TIIA 2GXQA 3QEKA 4EYEA 2IZOA 1W48A 3P0IA 2YOHA 1C1DB 3PUIA 1EUCB 1OVMA 2F1OA 4ZOLA 3C4JA 4IYRA 4BMZA 3PZBA 2VQFB 2GAAA 1IAVA 3HQ4O 3RSFA 3SEFA 3A6LA 3JD0A 2C4UA 3E8SA 3FTPA 4MVJH 5GJCA 2IYPA 5AKXA 4F91B 5DPMA 1YZGA 2A1UB 3H86A 3LKZA 5DI3B 5EESA 1F06A 1PL6A 4IBOA 8AT1A 2RCYA 2XTAA 1Y7PA 3NT2A 5DM70 3WQHA 1KH2A 2BE7A 5KBYA 4MW2A 4BNMA 1ULBA 5HFJA 1NC3A 1BG6A 4GFDA 4OATA 4QHYA 5CD1A 1IRIA 1JVSA 4EPWA 1TIKA 1I3OA 1KMIY 2D06A 2IU3A 3KCQA 3IT2A 3CTPA 1SXHA 1QX4A 2PM8A 5KVVA 1TU3A 2GEVA 3GCZA 3O8QB 4FNOA 4CL2A 3K70D 4JI7B 4P5EA 2WHRA 3IRVA 3NASA 3W8RA 4HWKA 2EJTA 4PWYA 4BDSA 3AH8A 2PLNA 4WUTA 1I7QB 2BKXA 1WSAA 2BM9A 2H1RA 3HNRA 3PC2A 1CE8B 3SU8A 4ROSA 4YQFA 4BVLA 3KQUA 5WRFA 3RAPR 1T36A 3TYXA 1N2EA 3PG5A 4OAOA 2GTIA 5FFNA 2HQSA 4Y2QA 4O5AA 5CVDA 5FPHA 2WD9A 3RM3A 2FUCA 2GF0A 2OZLA 1DC7A 4DN6A 3IALA 1M6HA 3TNFA 4JJIA 1A9XA 2GPWA 2EG9A 1KS9A 1C29B 1X13A 3IGFA 4NPCA 4D82A 5COQA 4GKJB 4M1EA 1IVYA 4MRMA 4ZAYA 1SB8A 3CF4G 3QLVC 4W63A 4PSVA 1PJBA 2W48A 5IAOA 1SQ0A 3TCKA 2OBMA 2OENG 4PNEA 3LVFO 1H05A 3T3GA 4EQZA 1D5CA 1DKUA 1L8OA 2R6CA 4LY0A 5LIRA 3PNLA 4KPEC 2IHTA 4QDOA 3ZU3A 2F9MA 4H7KA 3RSCA 3Q7PA 2HWKA 5BXYA 1GNTA 5EWJA 1BN6A 5HRCA 4EUFA 3GG9A 3P9RA 1WG8A 4MRAA 2HFJA 3OPYA 3WXBA 3W1EA 2V6GA 4JT8A 4WH0A 1JG3A 1MABB 1ZLXA 1BW9B 3B3JA 2XAAA 3N3BC 3PHBE 3M89A 3SDZA 4EKDA 3FCOA 4FKMA 4GMGA 4LJLA 1NTRA 3DEYX 4TMKA 1HNZB 4JX8A 1ZN2A 4BNNA 5JMOA 1YONA 2GSDA 5E4TA 4M6WB 1BFDA 4GWKA 4BO3A 1GQOA 4L75A 2P5YA 2ORIA 3DBHA 3GX1A 4ND8A 4J3NA 5A0VA 2E5FA 4AJ2A 1GNRA 1TF5A 2OV4A 4K3VA 3DEJA 1Y5RA 2H0QA 5TLSA 1ENOA 1E6MA 3AFHA 1G7CA 1UWCA 1HYEA 3K0AA 4AWXA 3PE4A 1P1CA 3THSA 2ACEA 1YS9A 2G28A 1V2GA 3UHAA 1IUKA 1H3NA 2CK3D 1A0OA 2NTYC 2X1MA 2Z9CA 3GRVA 4L8FA 4DT1B 1J0CA 4M1YA 1RXWA 1JSZA 2HU2A 5UKDA 2F4VB 5BVGA 1AZWA 3LW8A 3UV6A 3N7UA 3RVLA 2WYUA 3AUXA 1KXJA 3FI9A 4IFEA 3N2GA 3NRJA 5K99A 3FSGA 4NNPA 1ORDA 4QUAA 1THZA 4G65A 5H02A 5JCXA 2GJKA 4KB5A 3FUXA 1A7UA 2A9VA 4JC5A 4JEHA 3B52X 1ID1A 2HN9A 4IYJA 4FGJA 2RARA 4MR7A 2Q1TA 3K9LA 3T1VA 4G9EA 3CWZA 4RZ2A 1JR3E 4BGUA 4MJXA 3SP1A 1KQPA 5IABA 1LNZA 2Q0XA 2LKCA 2X9QA 4PYMA 4YR9A 4GICA 3IO5A 4U5QA 4UREA 4DG9A 4KBFA 2HGSA 3L40A 2VOJA 2UZAA 2QUBA 2P7IA 2XMZA 1NE7A 2O5CA 9MHTA 1P61B 3HFJA 4W8OA 4XAQA 1W8DA 3KOMA 1Z7EA 3NNSA 1F8FA 3ONFA 1N0VC 1YIDA 4QEDA 3L0CA 3VR5A 3LHKA 3V4SA 4DCJA 2QG6A 4IJWA 2WKWA 1C2YA 1I51A 3MTJA 4YMTA 1MO5A 3DL0A 2AOXA 4KGZA 5GJVC 2CLMB 2ISCA 4B4UA 4BLRA 5JU6A 1IVSA 2PUDA 2FP4B 1FOEB 1NNSA 4FFNA 2GBGA 2QN9A 4JJ7A 1JEOA 2XD4A 1PZNA 1FTYA 1VKJA 2QRQA 3H11A 4PGHA 4U2DA 3OWXA 4LYEA 4RF2A 4B81A 3LUKA 4IXTA 2O0KA 3KT6A 3KQNA 1BFKA 1RQ2A 2B7BA 2J6BA 3IP1A 3UT0A 3VO8A 4GEKA 1C41A 2XADA 1BAPA 5BW6B 3VNQA 3RRMA 4Y7DA 1ZP6A 4Q1BA 1L4KA 2VYVD 5EI5A 2F6RA 3DLIA 3L7KA 4POOA 1Z7WA 2ZJBA 3RK0A 4DPMA 2PFKA 1IU9A 2VHEA 4MP3A 3MPOA 5DTIA 2HO5A 2P67A 1WB4A 3ZIAA 4BWFB 3ZJTA 3WGQA 2GZSA 1QG4A 3GVCA 2XHEA 3NGMA 5FBWB 5EUCA 5F7JA 3U7FB 1C1HA 2B83A 3ZW8A 2DSTA 1SKBA 2JHFA 1XJCA 1P2TA 3R5SA 5B7QA 4LF7B 2VBGA 2OY0A 3FWKA 2IOQA 3BAFA 5SV2A 2YJ4A 2VUTA 3GMDA 2EEZA 4A03A 2ZSEA 5D87A 1HE8B 4KJZA 4LXUA 2OC4A 3AHFA 3FSGD 3T12A 4ZRNA 4E1AA 4OHYA 4DR2B 1TUEA 2PGIA 2G25A 2G67A 1FLDA 1VSBA 3JYHA 1HDZA 3MW8A 3Q5DA 4IMJB 4NC9A 2C2OA 2PZJA 1R5OA 4JGBA 1ISPA 5E3JA 4MS1A 3PB3A 3SNHA 4CM6A 2GPJA 3HBLA 2H5IA 3JZFA 1RLMA 4RMGA 4MVJI 2R5FA 1LXCA 2J48A 1WZ2A 1U8TA 4O8ZA 4HQOA 5I5EA 4NG5A 4MW1A 4XWYA 3RT1A 3BMQB 3RHFA 4EDFA 4MDYA 4YLGA 4AJ1A 3LQFA 4ZV7A 5JDCA 5LPNA 1JFVA 1EVLA 2PAFA 1OT3A 3FNEA 4I3FA 4DIBA 3OU2A 4MCIA 1RFLA 5F9FA 2Q1SA 3HVKA 2OBNA 3RW9A 2BCGY 1EK1A 4M89A 1ZN7A 5CTJA 1PUXA 4Q3KA 5EKXA 2B8EA 3CRZA 5JD3A 1IK4A 1YCHA 4MUFA 2HXSA 1W59A 2ZBUA 3ISJA 2P3LA 1U4SA 2E82A 3ON5A 2DRIA 1GAWA 2VLIA 5EYPB 2COKA 3EGDB 3QENA 1GGEA 1ZI9A 4MKIA 3UWPA 3V8BA 2YWDA 3E81A 2IBMA 4LMRA 1PLJA 2K7ZA 4RZ3A 4LJSA 4D4JA 821PA 1IN6A 2QW8A 3DAHA 4HDRA 3UICA 4IUBS 3DOIA 4HX2A 3GFQA 2OYCA 4C1NA 1OBCA 3TTTA 1Y3DE 4WSOA 2IYSA 3ZNPA 3AEQB 1GZ7A 5CT6A 2QY6A 3EEIA 3USCS 2AZTA 2ZVPX 3JARB 3P94A 4FJ1A 2C4KA 1FNBA 2COEA 1QKKA 1FDIA 1NBOA 1E2MA 1WRBA 1JFFA 4Q15A 3VC2A 1ZQ1A 3WGTA 4LF6B 4B6QA 4JOSA 3TQSA 1NF3A 1TL7C 3OFVA 4FKBA 2GJAA 1JHZA 3EXIA 4ZU3A 3GGPA 1UEXC 2I33A 3P5SA 2QDXA 4Q6WA 1NUSA 3ME5A 3OUZA 3RWOA 1ZU4A 3HB1A 4ISBA 1DO0A 1L4BA 1FUEA 2J9XB 3EQ6A 2DCMA 4N18A 4M0KA 4YACA 4YUVA 3SDSA 5HZGA 4YV2A 3SYMA 4BFZA 5C4MA 2RGEA 1T36B 3R9WA 1PKEA 1XJ0A 3NP9A 3AUTA 5FWNA 1R66A 2O6HA 1RQLA 4LSGA 1Q3TA 1HNWB 1Q0RA 1F0YA 5DP1A 4CQJA 4PO9A 5B58T 3O26A 1J9GA 3VVMA 2CLIB 3B36A 3HVUA 3NNNA 3VAZA 2WJ6A 4MYRA 4ZHSA 5K0JA 5C5IA 4DLRA 2P11A 4ZFNA 1GARA 2JAOA 4E12A 5CLFA 3Q72A 4XWKA 3EXAA 3OETA 3HM9A 2V97A 3PKJA 1CB7A 3TCNA 1W76A 4B74A 2OCKA 4C4TA 2HLDD 3LRTA 1OWMA 3FVTA 1Y5NA 3BIFA 3I9MA 3C3WA 4G3XA 2CWDA 3KKQA 4ZO9A 4JI3B 1MAUA 2O3QA 3RFFA 1J07A 1T2VA 4JP1A 4QAQA 1OAOC 1X2EA 3PF8A 2NU7A 1PR2A 2H18A 1SKAA 3L0BA 2HO4A 1Z6TA 3DA8A 4IUYA 2Q5EA 4ARAA 5KWEA 4HQKA 1XZKA 4BAZA 3FHTA 4H0NA 4ESVA 4OP2A 1M34E 2A94A 5AVYA 2PZAA 5AM0A 4JI5B 1ZY2A 1C3LA 1C8KA 2QMUA 3EXG2 2B8JA 3G9TA 2RKOA 3I2HA 3INGA 4GU5A 1NVFA 2VDQB 3F5FA 3W8NA 5CXQA 1N6OA 2DLNA 2QWXA 4DPLA 2X77A 2BEWB 2PZBA 2UYYA 3TX6A 4F1JA 4BMXA 2DAPA 2OG1A 3PI6A 2YYAA 4ND8B 2Y6VA 4NSNA 4UU8A 4Q9IA 1D1TA 4AJ9A 1QVWA 5FHRA 3U3ZA 3GUUA 3O4GA 1FXUA 3N3AC 3AYXB 4YP5A 5LQUA 1LF0A 3FUTA 2FUEA 1OV4A 4BNFA 5A5VA 1GZDA 3B2QA 3L46A 1LBSA 2IXBA 3R5KA 5AUQA 3E9CA 4ZCLA 4L5BA 4EW3A 2JIOA 1Q11A 3TUIC 1Q1QA 3U7EB 1XXHA 3HVHA 2VAXA 3ABZA 4M21A 4N82A 5M5BA 6ABPA 1OWOA 1WPGA 1CRQA 1JHAA 3TLEA 5HM6A 5F33A 1V5IA 3T7AA 1W49A 4L9WA 5EE1A 3D3EA 1W6UA 1R18A 4R7GA 2C57A 1V47A 5E95A 4ZOAA 4UHJA 1ZIDA 1FP6A 1EP9A 2PT9A 3QLUC 4XR9A 5DVZA 4ZA2A 3RWBA 4UTOA 2F7SA 2AB0A 3CRQA 1RE0A 3L06A 4U0JA 4WQMA 3DL2A 4AQDA 3SYNA 2HK9A 4Q3DA 3U7QA 3U16A 1NVDA 7MHTA 4HN9A 5EXXA 4KFCA 3IVMA 5IM5A 2DZDA 1J06A 4A27A 4JBYA 4TYMA 2Q2QA 1XRMA 5MFZA 2ZIXB 1GPJA 2HJHA 2GA9A 3LLVA 1GG5A 1TA0A 1P1JA 4KQ1A 2BR3A 1AMOA 1FRNA 1TLTA 3MGKA 2Q5CA 3PDCA 5KKNB 2Z57A 3GT3A 3BA1A 1BZYA 4BN0A 4ZYVA 2PX6A 4HDKB 1KTVA 2DQ4A 3L0DA 2CFRA 1PEAA 3QMWA 1IN4A 3B89A 1UMDA 4IIEA 4PC2A 2XODA 4MKGA 3NBMA 5JVDB 4EA9A 4OH1A 4OQNA 2FG6C 4J7UA 4RD6A 5EUMA 1KORA 3KUCA 5CCXA 2NP6A 3JW8A 5FA5A 3G6KA 2J32A 1VI2A 4PSAA 3FYDA 2CYCA 4R1SA 5E1MA 4C4OA 1MVLA 1DFIA 1FW8A 1R0XA 2B5VA 2QJWA 3EVCA 3I2IA 1QQ7A 4FYJA 2GKSA 1LKZA 3H42B 4JUIA 4NENB 4BBPA 3IQWA 3QOFA 2E1RA 4UCFA 4WXPA 3ZE7A 3KAPA 2NXWA 2BKAA 3B3QA 3MEQA 2FMFA 1SU4A 3N8GA 4M60A 4NBWA 1HEYA 2O1WA 2I2DA 1XMPA 4RHCA 3ZV6A 2EXXA 3A37A 2O4UX 2RAUA 3MSXA 2CFTA 2I2AA 4HNTA 3RTGA 2PMBA 4Q1AA 5BQOA 3K5WA 2EQAA 5KNDH 1XZAA 2GBLA 3BTUA 4HH1A 4XTRA 2XQVA 1ZGGA 5T6BA 3LTNC 3AOEC 2CHUA 4H60A 3PQCA 3IX7A 4P31A 4FI3F 4MMXB 4PRZA 2C2HA 2NM0A 1IY0A 1Z88A 2VF5X 4MIYA 3RSQA 3GNQA 1QSGA 1N5DA 5HE8A 3KE8A 2FMTA 5J58A 2X6RA 2C2GA 4O6VA 3IEXA 3QXXA 5AHRA 5FNVA 3WRXC 4YDSA 2WFLB 3SQLA 2HA0A 4Q7KA 3ZNNA 2C78A 2Q07A 2QZZA 3O8LA 4GLLA 1KAGA 4A6XA 4V1CI 5FWXB 2IT1A 1G9TA 1XT6A 3CLSC 3D9QX 3OT1A 2R4TA 1J4AA 4M54A 2O2JA 1SQ5A 2VNHA 4PR0A 5CDYA 5MDHA 4G07A 3VI4B 1UPFA 1W25A 2XB9A 3CSUA 2QUKA 3M6LA 1QTQA 5IAJA 2FPUA 1Y7IA 2QNBA 3PL1A 3U4CA 3IFSA 3WWPA 2BBSA 1KSGA 5KNDA 1FLAA 1G3UA 4OGFA 1E8NA 3NXKA 2DUUA 2R6HA 4U9IS 4BB9A 2VP2A 4EMBA 3Q7QA 1Y3FE 1Y80A 3IT0A 1VLMA 1WUKS 4Z7NB 4J76A 4YAUA 2ID8A 4KO3S 5DOVA 3BMOA 3FKSD 1L2TA 3V6LA 3ZHRA 2YHBA 1L5MA 4FZJA 2D8MA 1BX1A 4YUZA 4I50A 3COYA 2PGJA 3L7LA 2FDRA 3BYZA 4U02A 3SY8A 3HBAA 2AWNA 4IKEA 4CG1A 1M66A 1TZJA 1RM4A 3KYIB 3LT5A 1QHYA 1I2CA 4R2IA 2C2YA 1GKKA 4J0DA 5EE3A 5C18A 1AKQA 2JLCA 4IH9A 5LL6P 1X0XA 2BGGA 3T7JA 2VUIB 2F8LA 2PD4A 3WJAA 3WLRA 4DMLA 3SXPA 1R74A 3G6WA 5B12A 1WMBA 3LM8A 4LSZA 4F84A 4LF9B 3L07A 2PNFA 3OM8A 2B35A 4IJQA 5KX5F 3E1GA 3HN7A 3IP5A 3HRKA 1O4WA 1KEPA 1RLOA 2ORWA 3FTQA 2B4TO 3GY0A 3KQQA 3FBTA 3R2JA 4KO1S 4DQ0A 5HKAA 3EQZA 3PUZA 4K5QA 3W5VA 1X15A 3BBPA 4HZUB 3RRBA 3TVTA 1NLMA 4R16A 1QX3A 1KQNA 5FTLA 2BKLA 5I45A 4K6HA 3LDHA 3FA2A 4MUBA 3W8EA 3D8NA 4OMCA 1L1RA 2W58A 4OFBA 3W7AA 1G8FA 2P1ZA 3LP5A 2DE0X 3HJGA 1Z2CA 1HZZC 1QTIA 1ZCAA 4JYMA 5EXDA 3OE1A 5I4CA 2CZQA 2W2VA 4FBGA 4JDPA 2XWBF 2Y77A 3V8QA 3ZE6A 1RBQA 4MS4A 4DCTA 4BQPA 4E5MA 4DDVA 1KYQA 3V5NA 1ZMXA 2RG1A 5CLGA 1REQA 3H1FA 5CDTA 2H65A 5JRZA 1GN9A 3WWCA 3PCXA 2VCHA 4HUQB 4JBWA 1P2UA 2JRLA 5EY5B 5IKMA 5KTOA 1VB3A 3VR3D 3EPRA 3RJ5A 3T3EA 1CRZA 1YNSA 5AO9A 4ZD6A 5EHXA 5ER9A 3F8WA 4HSGA 4X93A 4QTYA 1VRCA 4YRKA 2VJAA 3M1IA 3W1WA 3KP1A 4OGKA 3PCTA 4X44A 3KR2A 4LQ4A 3OICA 3STYA 2DQZA 2R1TA 3KKPA 3CVYA 2YJ6A 3KLNA 2LRHA 1WCXA 4YLEA 2AW5A 4P4NA 2QR2A 1C8LA 3JAKA 3KWMA 5AW4A 2VOEA 2HK6A 2HI0A 3U5ZB 1EVEA 1N0HA 1VP3A 2HV9A 3NVMB 1M1UA 4LXTA 2XITA 5E1OA 2J30A 4C6TA 3HO1A 5KREA 3Q3GE 3EVAA 2C0QA 3G02A 1QV9A 1BS2A 4KXMA 1R27A 4N8EA 4QDUA 3PEYA 2HHCA 2HPHA 1P44A 2PS9A 4LZZA 4NY1A 3EZLA 2Y05A 1JHOA 1TZKA 5I7AA 1P91A 3T5CA 2FZEA 1HQCA 4ND3A 3M70A 1SELA 3E48A 3Q0IA 4P7FA 5I6DA 3ZE9A 2R7KA 3G0OA 2E6KA 1L5HA 3IEVA 5F3DA 4O0LA 3ICWA 3U0VA 1YQ9A 1N6LA 2CVOA 4M1TA 3ZOKA 4HXEB 2NP7A 4AZ3B 3LCRA 1X1QA 4MYCA 4DLSA 1AMUA 3SKVA 3ZKAA 3QNMA 4S12A 3ESBA 3R5TA 4RVSA 4LYAA 4Y1EA 1NUTA 2V7QA 3OCYA 2FZ5A 3WVNA 4V0NA 4Y0NA 5A3JA 3HFSA 2YJ3A 4GRAA 3OCUA 2B4YA 4PXYA 2FOXA 1SY7A 2XI4A 3DW1X 4RHUA 5K3AA 4MW6A 1OA0A 1JKJA 1P7CA 2CB9A 3REGA 3RIMA 2VNSA 3INNA 3VPFA 3HGQA 3TLGB 5GZ6A 2XYVA 2JGMA 2APJA 5EQDA 3EHDA 3AKCA 1XAHA 1DX9A 2ZAIA 1GQSA 1W96A 2J59A 2Q7OE 5CB0A 2J33A 2J0UA 13PKA 2JZCA 4I6GA 4H17A 2ONJA 1FMFA 3P20A 1DUIA 3FOFC 4DY6A 2HQOA 1G8KA 5BT9A 1I80A 2OUIA 3B60A 3HYNA 2BGRA 4XYLA 5ELMA 2ECPA 5FUXA 3ZI4A 2V9ZA 4RTOA 1L7AA 4GGPA 1SBZA 3DP7A 4JGIA 3RRFA 2DCUA 2O0LA 2G1AA 3QNWA 5ENVA 4XXHA 3RQIA 3OVMA 3D4NA 1SXJC 3M82A 3P19A 1EZ1A 4GE0A 3P5BA 1C7FA 3AIIA 3Q88A 2OVBA 1ELOA 4HAVA 2Z8YA 2WNSA 3AF6A 1RE1A 1ADCA 2QTNA 5JUWA 5SZJA 4E3ZA 4F97A 2XSZA 5IM4A 4LOKA 5JNSA 4NDZA 2GF9A 1JA9A 4P3NA 2JZOA 5C8YB 1VHLA 2IK8A 2CL0X 3QUCA 4LJKA 5CIWA 3VU1A 4BFSA 4QD3A 1BMFD 4CR8A 1SK9A 4ZOCA 4MS1B 5ANRB 1ZI6A 2HKIA 1ZD8A 4Q9HA 2AA3A 3UVEA 2DHQA 3OFNA 4G5SA 1G59A 4Z4IA 2YZ7A 1G8GA 1NMXA 1OBHA 5CCDA 2Q3MA 1XDGA 3BGVA 2XXJA 1MENA 5CLHA 3V1MA 5KWSA 3J81A 2ZJZA 1GCIA 4GSYA 4J29A 2PSSA 3KUUA 1ATIA 3FB1A 5FOTA 1PR3A 1U98A 3CZQA 2W6ID 5ETJA 3GPBA 1KJQA 3UK0A 1RYEA 3G9QA 4WLNA 2ZS9A 1WZEA 1A88A 3TNDA 3LO5A 3QBVA 4AIRA 8MHTA 3QKRB 1U9ZA 2CXRA 1DC3A 2IZ1A 3RT9A 2OD7A 4OEHA 4D97A 2JLZA 4ZI3A 1P17A 3TWOA 2GRAA 5CGZA 1GNVA 2X3UA 3A1NA 3FOAA 2QUZA 1YJQA 2JIBA 1UM8A 1XF9A 5JYDA 2CXSA 1QNFA 2DKOA 3KU1A 4GQAA 3JS5A 5D1NA 2YXBA 3DXXA 4W6QA 4XWAA 4GVPA 3OIGA 1M5TA 1UDCA 3L01A 1Q44A 2IV3A 4M9XA 3NAGA 1LX7A 3O2JA 2P8JA 2VAVA 3BAZA 3GLIA 1E2GA 2W70A 1YK1A 1KSFX 1G66A 2YWCA 1H2HA 3DLAA 2DQSA 3K2IA 2V0GA 1Z6YA 1JHQA 2IOHA 5ALWA 2EV9A 3VV2A 2J3QA 2ZUTA 5KDOA 3MZ0A 1MPXA 1YQDA 4YREA 2C59A 1G98A 1GNLA 2R48A 1E1RA 5EC8A 4F3RA 1T8WA 3AF1A 3OQHA 1E1CB 4X3OA 5BWLA 4ZVPA 2XXAB 4EI2A 4B34A 4PBRA 5JPIA 1F0PA 2CMKA 3AZPA 3EZFA 4IG4A 2GFHA 3PNYA 4MUAA 5TJHA 3R7NA 2IS6A 3FSEA 3SX0A 3U3MA 3WFZA 3MLBA 3FTNA 1C5KA 1X7WA 1X1BA 1TIPA 5A5EA 4NYMR 1NVVQ 1AZTA 3RSZA 2G1JA 4FT2A 1MDBA 3A4IA 3T1NA 1JAYA 1IUPA 2OXTA 5CPFA 5LLDA 3Q8WA 2G80A 1RAGA 4L4SA 1W4BA 1ZL2A 3CIFA 4FI3C 5HX7A 3MD0A 2OC9A 1RHUA 2Z5GA 4FNAA 1M10A 2AF3C 2HIHA 2YX1A 2YQZA 4ZAXA 4BO2A 1QPZA 4CKCB 3VR5H 3QU5A 2UUAB 1XPJA 4EG3A 3GJYA 3OZCA 4A5OA 4RESA 2Q49A 3GAAA 1VG9B 4K88A 1B26A 2ATCA 2J9YB 4BFWA 1VXRA 1ZIYA 2HA2A 4EO9A 1V8BA 4U63A 2H4WA 4W8HA 3V7FA 5KQLA 4C7OA 5EAIA 1KI9A 1GEGA 3L79A 4S1TA 3IKVA 3OSUA 2ZLBA 2OQRA 3ES9A 4GT1A 3UK6A 4EZBA 3GFGA 4M9QA 2BFWA 1L5SA 3EULA 3HA5A 3IBYA 1MCZA 5HSGA 3B1WA 1E0DA 3OQPA 4P98A 2Z4TA 3I83A 5CP8A 3WNCA 4KPFC 2JVJA 4YT2A 3G8DA 2Y1WA 4KXUA 4OQMA 3A6JA 2SBTA 2ZEJA 4NCIA 2NUPB 1GSAA 1KRWA 2ATEA 1RRKA 4M0MA 2HMWA 2QQ5A 1BEUB 4U7JA 621PA 4YP6A 4CQLA 1A7AA 5AVQA 2DFTA 2WB2A 3BWYA 1XELA 4LV6A 5GGXA 1JAIA 3E35A 4HEHA 4UKDA 3R3VA 3M6WA 1QHHA 2BM1A 2HSJA 3I3OA 4YROA 3LE8A 1BDJA 1JMVA 2W2NA 4F8EA 5DWVA 3ZNQA 4MO9A 2Z98A 1A2KC 2I71A 3RVKA 1F51E 3UMCA 3D3WA 5AI6A 4EUEA 1HTBA 1U0TA 1CZNA 3RC3A 3KQTA 3UMYA 2B0CA 4R7TA 1UKYA 2FRDC 1XCPA 4GBED 1AN9A 3SJ7A 1WWKA 3OF2A 5AFSA 1MJ5A 1ULSA 2BIFA 1PGJA 2BFAA 1G21B 3AONB 1XLTC 4B8YA 1X7ZB 1KE2A 1ZCZA 1NG1A 4AO7A 2RGUA 3A6PC 1R8XA 1V3QE 2RGRA 4QUJA 3EY9A 1LVGA 4IDCA 1HK7A 1GPLA 2JDID 4TTVA 1ODFA 3BS4A 3JWJA 3Q98A 2BBTA 1HZJA 2EF0A 1XZCA 1ZJ6A 1VTKA 2MR6A 3A6ZA 3IAHA 3T38A 5A4AA 1MV8A 2PQMA 1NFQA 4AJIA 4UW9A 4YGXB 4G5FA 3CVJA 1GZ4A 6Q21A 2YR0A 3L18A 1BEEA 3V48A 5I7OA 3HJTA 4DARA 1Q14A 2H92A 5B58C 1I3MA 3S8YA 2XB4A 2NNWB 1BE0A 1B7GO 4CM5A 2ZDQA 3FDZA 5J43A 1BOOA 2PR7A 1S3SA 3H16A 4GG1A 2OCLA 4IMRA 4IDPA 5E6RA 3CVWA 1E62A 3VPXA 2I2WA 4U2GA 4C76A 1I7NA 4KL8S 3H5IA 1U7DA 1W4RA 3FPLA 1PK9A 2SKDA 4ARBA 3UUEA 2QD3A 1A7JA 1NP6A 2CHVA 3FGPA 4LHWA 4LISA 4LRUA 4Q7LA 1YA4A 4BLUA 2X3FA 4EUKA 5DN6D 3T52A 2AEFA 3WB2A 3THOA 3I39X 2VG8A 2ABWA 2QNIA 4IEFB 2IVFA 3KBBA 1AQIA 1RLJA 1RJ9B 2MINB 2I65A 1MH9A 4QOGA 4S1NA 4BV2A 5LYYA 3FPFA 3PFCA 3V4OA 1I8TA 3R3YA 3O3NB 3V2HA 4C0JA 4F4FA 1FDWA 4L78A 1TW2A 2O2HA 2YYYA 4B82A 2ZAMA 4EABA 3FF4A 3QFRA 1YZQA 4ZOQI 2QE6A 4MIEA 4KDEA 5TY0A 4BUCA 1G8PA 2FMHA 3C1UA 3D6AA 3PE6A 3DH0A 2HX1A 2O52A 2QTVA 1C7RA 1ZA2A 3UT5B 2NU8B 1Z06A 1T35A 2JL1A 4HFRA 3F2VA 3AETB 1H3EA 3ZGOA 1XTPA 1G3RA 3GCXA 1WS6A 4Z4GA 3QFCA 1D2MA 2C9MA 5EZQA 3VH1A 1DQZA 2CXPA 2PPLA 3LF2A 3WOHA 5C52B 3SQXA 2WOOA 2WVJA 4NV3A 1C1XA 4ZZ1A 1X8KA 2QTCA 3IDFA 5KCZA 3QX7A 2WM2A 3R7DA 1YDMA 4A26A 2BKVA 4JLPA 2HYDA 2HSZA 2XUKA 5FL7D 3ZDXB 2CVFA 4RVHA 1KO5A 1J24A 3VZRA 1DIRA 2EU8A 1L5VA 1F1BA 1Q15A 2L18A 3CT6A 3I9NA 1J33A 1Q50A 1C30A 1VIYA 3AINA 4FYHA 5D3QA 3MJCA 3CNQS 1OYWA 5A02A 4CKEA 2BTEA 3NWEA 2B4QA 4CIYA 5AK0A 5JRDS 1RJFA 2O54A 1XEWX 4UBNA 1PJCA 3AR7A 5FUWA 1ZM7A 4NAVA 3KYJB 3S29A 1WDKA 3E4CA 3LL4A 2IXTA 3I4FA 3D7MA 3PLRA 4FOPA 4XQCA 1LQ2A 4IEIA 5F5NA 4C88A 3DDUA 4DLPA 5KYNA 4RANA 5KZMB 1Q1NA 3FJOA 5ALFA 1NAIA 3CLKA 5B36A 4J75A 1NWHA 1Y0BA 4Q7QA 4CG3A 1T5HX 2OQVA 1HZZA 4AP9A 1O1YA 1E2UA 2XYPA 2JKYA 3EMDA 4OBXA 4XR4A 1NIJA 1Z4KA 4S35A 1NSYA 3ILSA 4FDAA 1JR6A 3JYQA 2I99A 2FX3A 2AVDA 4GPIB 4GO1A 4HWTA 5A2GA 2Q3EA 2Q5FA 4EY5A 3NBUA 4Q5IA 2VDPB 2BFDB 2WU4A 1XRPA 2QTHA 4RIIA 4DABA 4GPEA 2W2QA 2NZJA 4U9UA 2WM3A 3JQDA 3LUPA 1E0SA 3C70A 4N0DA 3OX2A 3EZ2A 5B1HA 5BN4B 5KC9A 2ZP1A 2BZSA 1NYLA 3PIIA 1WHTB 1UOPA 3KJQA 2DKFA 4ALJA 1UWVA 2FLWA 3NEAA 3AR5A 1VJCA 1G2OA 1U7TA 1KZ6A 2QGZA 4MI1A 1ID8A 3IVCA 4DGQA 1EGVB 2DULA 3VYUB 2PD3A 5IUNC 1R00A 3O7MA 3JQ8A 4NMWA 1P3Y1 4BL5A 3SK0A 2K87A 4IG9A 3VR1A 1DU4A 2ZI5A 3K9NA 3VVCA 1LDYA 4A8JA 5JJLA 1ISIA 4G5OA 2XOKA 1TD1A 3BDAA 4IIGA 2QQEA 1FL9A 2R00C 2H59A 4PSKA 4F2PA 5E6UB 5J4KA 2DY1A 3BF8A 4GPBA 3ZCRA 1KAHA 3OOHA 3V1YA 3U9TA 1M73E 4E1VA 4PBTA 1UAGA 2IXGA 4NBRA 3ISVA 3NPAA 2FAXA 3SEZA 1Q74A 1W5AA 2DTDA 1SCUB 3VC3A 3ZLUA 5CG1A 3FW1A 3GUHA 3NYWA 2H31A 3IUNA 2PXHA 1Z35A 4QRHA 3NBAA 3WK5A 4EUNA 4JL5A 4F4DA 3HKEA 2P6NA 4C01A 1FSPA 2C1XA 1VKHA 2QMYA 4EGAA 1ST2A 3WRXA 1U0SY 4BQEA 4KG7A 3A1TA 1SEPA 1L5HB 1USIA 3GEPA 3MTGA 3IOEA 3DQQA 3VU9A 4DDTA 1SC6A 4QBFA 3LQRA 3I6BA 1B1AA 3PD0A 2XKAA 2PHZA 1NQOA 3ZGZA 1J25A 4WADA 1PYOA 2QPOA 2Y4NA 3IIEA 4LBWA 2GX6A 3CNNA 4Y9TA 4J0EA 1H2EA 2JGAA 2QXYA 3F49S 2A86A 2A35A 3VJMA 2C1EA 2PZEA 1N77A 3QYJA 4B45A 4JYZA 1KJWA 3Q40A 4AS2A 4EAQA 5MN5A 5KNBD 3OC6A 4BX0A 5IJ9B 4RVCA 3DHEA 1CSEE 3K6KA 4XGNA 1Z29A 3LYHA 3SYRA 3HDGA 2ZBEA 1XHEA 1AK2A 3OT5A 4XD2A 5P21A 3LPDA 1C0PA 4XIJA 5LQKA 3UB2A 5A6SA 4L74A 3E3LA 1EP3B 3ZGNA 1F7UA 3HJBA 2QM3A 4C89A 3SSAA 5J4YA 5HCNA 2RJOA 3MUNA 1L5KA 4GVLA 1L7QA 3NYQA 1D6JA 3CZ9A 1FZQA 1T3ZA 3RBAA 4LEIA 3U4HA 4C08A 4HCJA 3UENA 3W6ZA 2X14A 2H7CA 2WIDA 4CTNA 4TN1A 1VHDA 2BUAA 4JJGA 2QIPA 1VMIA 2QRHA 2W6JD 3BH7A 4NARA 3G8AA 2DJIA 3RJTA 5L6MB 4HEA6 5A4KA 1R5JA 4JC8A 4QE3A 3B2EA 2ZSFA 3ZWNA 3U09A 1G21E 1ND6A 3KQPA 5CDHA 4P58A 5JMTA 2J5QA 4R8RA 5CAEB 2GK6A 3GRRA 2WG1A 3ADPA 3HXQA 5AI9A 5KYWB 1SKYB 1LBEA 3DMTA 4ZAVA 1H69A 1ZDMA 2E0IA 2WIJA 4ZMRA 2QUHA 2O59A 4BV9A 1O58A 3L1UA 5CFQA 4AF6A 1TVMA 3UMFA 3ENZA 4LOIA 3TFOA 4LWPA 2PXAA 1HDXA 4GPAA 1Q17A 3PXBA 4Y6OA 3ZG6A 2ZBFA 1TEHA 3ICOA 2CVQA 2BR5A 5FKJA 5JNLA 1MDFA 2AZMA 1W0CA 2PUGA 3M9XA 4BAUA 5I9BA 1GAJA 3PC6A 2BHLA 3HLYA 4HBZA 5BSHA 1ICEA 2O20A 1W47A 3IR5A 4CKBA 5GIPE 2Q1XA 3M2PA 5EJAA 2AYYA 1NZJA 4L0DA 3ROEA 3L49A 3ND5A 1E89A 4E2XA 4PW0A 4MI6A 1SNYA 3F1KA 3AFMA 5EP3A 1M1YB 1V0JA 3KD3A 1W6RA 3GFBA 4IDBA 4TS1A 5AJWA 4UMFA 4WDQA 5H3CA 2GN1A 3LDUA 3QE2A 3EAGA 4WLUA 4XI9A 1A9YA 1VSTA 1PYGA 2AXPA 2X6QA 4HAXA 4DV7B 1SA0A 1OROA 5I7WA 4GX5A 4B40A 1NRXA 4H3SA 2AEMA 3PWTA 5AK6A 3K70C 4I50B 1USGA 4TMFA 2WIGA 4DREA 3H4MA 3LH5A 1SB9A 2Z2YA 3LX4A 4CV0A 4NTZA 1J0AA 2R25B 3BJRA 3FVRA 3IHWA 3OQ6A 3N7TA 4WXHA 4KV9A 1DBVO 3EF1A 1ZVKA 2E4YA 4JBXA 5A0FA 4D25A 1H2RS 4GL4A 2JGFA 3WLJA 1DRUA 221PA 3PXGA 5CBPB 2IXFA 2FEAA 2XTZA 1P0CA 3NALA 4DCNA 3E05A 2GYYA 4NHOA 4YP0A 4BKOA 1F48A 3G68A 3UFXA 4M2LA 3OJXA 4TV8A 4Y6SA 2D00A 4IILA 1VL8A 3BWEA 3PEVA 1YS7A 4R5MA 3O92A 1RAIA 2EBFX 2ORED 1WOYA 2IQ5A 2Q28A 5HYVA 4S2EA 4ZT4A 3AI1A 5CCEA 2AQHA 3SVLA 1RRGA 4O4JA 1KI4A 3UWOA 4I46A 1P1RA 3IHKA 3TXXA 1JE1A 3H2SA 3MVEA 2HW8A