2FLWA

Crystal structure of mg2+ and bef3- ound chey in complex with chez 200-214 solved from a f432 crystal grown in hepes (ph 7.5)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELLKTIRADSAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Beryllium Fluoride-free and Beryllium Fluoride-bound CheY in Complex with the Conserved C-terminal Peptide of CheZ Reveal Dual Binding Modes Specific to CheY Conformation.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Signaling protein
molecule keywords Chemotaxis protein cheY
total genus 45
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2flwA00
3W9SA 2PJUA 3CHYA 1YMUA 1P2FA 3MQ4A 3HS3A 1LJUA 2X7XA 1NXPA 5KQPA 1E2BA 4OG2A 1ISSA 4MRMB 5IX8A 1CEYA 4ML3A 1NXTA 5GQSA 2WJWA 2PUEA 3R0JA 2MSWA 3OO1A 2FN8A 4LRQA 5JNSA 3IPCA 1EFAA 4W5OA 1TJYA 1TM2A 2JVJA 2PUDA 3T95A 4F06A 3RVSA 1R8JA 4W5NA 1APBA 2E4YA 5T3YA 2QZJA 3CZCA 3ILYA 3FFXA 3RH0A 1JYEA 5KQGA 3TX6A 4N0QA 1QNLA 3H1GA 4GPAA 5CNKA 4E7PA 4EVSA 4EYGA 4TN5A 4O5AA 1NATA 2PUGA 4YP9A 1EAYA 2CD7A 4RY0A 2LPMA 3NNSA 2FEKA 3LUGA 2H0AA 3QEKA 1ZHHA 2HPHA 3DZDA 4HNRA 4YRZA 1YVUA 4FB4A 3QELB 1JDPA 4G86A 4H3KB 4MQEA 1UDRA 4RXMA 5C5EA 5IEJA 2PUFA 5KI6A 3CNBA 4UHKA 1TMYA 1JH9A 4H3HB 5FWXA 1USIA 2V0NA 3C3KA 3HZHA 4HNSA 4IGAA 1PHRA 1DP4A 3KJXA 6CHYA 1GCAA 2QV0A 4QYWA 3LUKA 4QPJC 3O21A 2QR3A 2FQWA 3KSMA 3QLUA 3O2JA 3EJWA 1T34A 1ZESA 4TLLB 4F3TA 5KC9A 2GI4A 4M88A 1E6LA 4XASA 1J56A 2F8TA 3FDFA 3L6UA 1BDJA 3H6GA 4KVFA 4OBBA 3G1WA 2JRLA 2GKGA 2JBAA 4N03A 3RVPA 1DRKA 3CU5A 1ZN2A 3JPWA 4WUTA 3DLHA 5EWLA 4YGXB 3DLBA 3IDOA 4JP1A 3JVDA 3D8UA 2Q5CA 1MB0A 1SXHA 2MSLA 4RZSA 7ABPA 1W9HA 2BGGA 4MS3B 5CNMA 5DKFA 2FMKA 4Z9BA 1JFSA 2NZVG 1GUBA 3KTOA 4RK7A 1QPZA 4RV5A 4D6YA 3ILHA 1L5ZA 2JVKA 4EVRA 1BVHA 2JBAB 4H60A 1FSPA 1Z18A 3EQZA 3H5IA 3IP7A 4KNYA 1M2FA 4ZYLA 2A9RA 4RK5A 3UUGA 5FWYA 4IMIB 1JF8A 2R4QA 1NXSA 3B2NA 2L17A 3T38A 3LTEA 4OTZA 3P9YA 4PEVA 3H6HA 4RY8A 2OENG 3I5AA 3N53A 2IYNA 2J48A 1QP0A 1QO0A 4B09A 2IPNA 1ZAYA 3TO5A 2PUAA 5FWXB 5FBKA 3G85A 3KLOA 3RVKA 4Z4EA 4QICA 3CTPA 2FXIA 3H5LA 1Z16A 3TB6A 4MQEB 3LKBA 3FGZA 3QELA 5GOTA 4NV3A 1JL3A 2NZUG 2W42A 1JWLA 2PAFA 1DG9A 5DTEA 6ABPA 3HV2A 5F64A 5DLEA 1QP4A 3OM1A 4KPYA 3O1JC 1AB5A 3IP6A 3RVJA 4OLAA 1DJMA 2HQOA 2E4XA 3H1EA 4MR9B 2NUBA 1NY5A 2AYZA 2QSJA 4JB0A 4LE2A 5FBHA 4MQFA 2A9OA 3QEMA 2WWVD 2PKXA 3CG0A 3K9CA 4HNQA 4MS1A 5DCLA 1XHEA 2H3HA 4N47A 3SAJA 1VRVA 3F6PA 4Z4IA 1Z13A 3HEBA 3JVIA 4WZZA 4Z0NA 2IDMA 2CWDA 3E3MA 5TQJA 4Z4CA 1P6QA 1QO0D 3Q9SA 3T8YA 3F7NA 2A9PA 4FE7A 2PL1A 4YWHA 4TLMB 1Z25A 4ZMSA 3TMYA 2FW0A 2FMIA 1ZDMA 2R47A 2I6FA 5JNTA 4OATA 3EODA 3LUCA 2R48A 3VNAA 1Z2DA 4OLBA 4MS1B 4YS6A 5HQJA 5B3JC 1FFWA 4MQFB 5EWJA 1BDIA 1U8TA 2FMHA 3KKEA 1DRJA 3HSYA 4MR9A 5BRJA 3CS3A 3LUFA 1Z26A 1ZH2A 1ZH4A 2RJNA 5TPWA 3MF4A 4F11A 1OXBB 4G0YA 3Q7TA 1ABEA 3SM9A 4ETIA 1NXVA 2HQRA 1YS6A 3EDCA 2FVYA 2JK1A 5KC8A 3OLZA 1JFVA 3KHTA 2LP4Y 1KGSA 3I09A 4KREA 2VUHB 1E6KA 4RK6A 1RNLA 3I45A 1LBIA 3KYIB 3NHZA 4RK1A 2N9UA 3MA0A 1YMVA 4RKRA 3KG2A 2MYNA 3L49A 4RSMA 3RVNA 2DRIA 2WRZA 3K4HA 1EWVA 3LOPA 5DGCA 3LUHA 4ZJPA 4PICA 4RU1A 3TD9A 3HM9A 4KK3A 4S04A 1P8AA 3HK2A 3CG4A 3H5TA 2PE5A 1PEAA 2CHFA 1YK0A 1TVMA 1YS7A 3O2QB 4EY3A 5JNUA 3A3KA 2AYXA 2E4UA 1CHNA 5TQ2B 4E7OA 3SY8A 4LZLA 3UK0A 4MS4A 5I4CA 3KS9A 1DZ3A 4MLDA 3RVRA 3BILA 2O20A 3H5OA 2IPMA 4LDAA 4ETMA 2TMYA 5ED4A 3OLVA 3D02A 4G0ZA 2JVIA 4Q6BA 5IEBA 4MAAA 4O1HA 3OMWA 5EWLB 1DCMA 3OQOA 3KLNA 3QX8A 2VYCA 3N75A 3RVOA 1EHCA 2FSPA 4UHJA 2FMFA 3O75A 3C6QA 3KYJB 4FE4A 4N0PA 3LMKA 4DQDA 1Z2EA 1ZGZA 2GWRA 1OXKB 1H9CA 1KRXA 3HDVA 2L19A 3MYYA 1Z17A 2FEWB 1E6MA 4MR7A 5IULC 4RDCA 3Q41A 2MYTA 4G0OA 1JLKA 4LDZA 4EVQA 5HKOA 3F73A 1NXWA 1SD5A 3OLYA 4HYEA 2GX6A 1M5UA 4JASB 3HVRA 3HJFA 1A04A 2HSGA 3OQMA 1SXGA 5T7BA 2XDYA 4LE1A 5IUNC 3LUDA 2P4UA 2B4AA 3GV0A 4YV7A 5IUKC 4NQRA 3GRCA 1USKA 3JPYA 3SG0A 3UKJA 3IP5A 1JDNA 2LIVA 2PMCA 1M5TA 5EWMB 1BDHA 4CBVA 2L18A 3LKVA 1P6UA 3QLVC 3RVMA 4MS4B 3QX9A 5IC5A 5PNTA 4RWEA 3H5WA 1MAVA 5TQ2A 4NCAA 4NCBA 1D2AA 1K66A 4WWHA 1B00A 3N6VA 3HXMA 4Q7EA 2OQRA 3EGCA 3Q7RA 5JNWA 1JYFA 3CFYA 4F8JA 1TLFA 3BBLA 5C5CA 3C3MA 4XXHA 1JX6A 1GCGA 4N41A 2IPLA 4S05A 2FEPA 3OLWA 4GNRA 3NBMA 4KZKA 4XARA 1D1QA 2HQBA 3RVLA 4G0QA 4O1IA 1Y1LA 1ZITA 1FFSA 1D5WA 1LBHA 1NTRA 2HJ9A 2RDMA 1CYEA 3HO1A 2R25B 4LX8A 1DBWA 5B3JA 3GBVA 1A2OA 3QLTA 1QQAA 1L5YA 3N0WA 3EQ2A 4F12A 2IPAB 3S99A 1JFTA 3GT7A 5TE9A 3T6KA 1FQWA 4Z4HA 1DCFA 1SXIA 4EUKA 3E61A 3N8IA 2E4WA 1F51E 2ZAYA 5TPWB 5JNRA 4LE0A 2YHAA 3CRNA 2PL9A 3LUAA 2LUOA 2JCGA 5IUJC 3JTEA 3VNBA 5EWJB 5E3JA 2FN9A 3M6MD 3GA5A 3M9WA 1VLZA 5JS2A 1KMIY 4RKQA 3FMVA 4ZMRA 3OQNA 1PEYA 3QK7A 1U2QA 3ROTA 4YR7A 1VPWA 3Q15C 4G0PA 1C0EA 4W5TA 1DC8A 3LFTA 4MRMA 1NXXA 3N0RA 2KYRA 5BRAA 1QP7A 1ABFA 3A0UA 3BREA 3MM4A 1XWWA 3MMNA 3A10A 4WT7A 4YCSA 3NNNA 3CZ5A 4L85A 4RXTA 1C4WA 2ZWMA 3QEMB 4WXMA 4ETNA 1U2PA 1JBEA 1MB3A 5BQ3A 2QXYA 4N76A 4YO7A 1Z12A 2ID9A 4PZ0A 2L2QA 3OM0A 1FFGA 3DGEC 1URPA 1EWKA 3LUJA 1MVOA 2LBPA 1PUXA 1M2EA 1SRRA 3ROFA 5ABPA 4IILA 4KQ9A 4Y9TA 4Z9AA 5TQ0B 1QMPA 3M9XA 3CKMA 5EWMA 4DN6A 1PNRA 4ZPJA 2P9HA 2VUIB 4W5QA 1U0SY 2PLNA 4G0XA 4XFKA 3FFWA 5HM6A 4KRFA 1USGA 5D2CA 2PUBA 3KCNA 2NT4A 1MIHA 1DC7A 2E4VA 3CLKA 4RK0A 2VK2A 1JHZA 2QU7A 9ABPA 4RXUA 3JS5A 3OMXA 4G0MA 4KQCA 3HUUA 5HSGA 3O1HB 1KRWA 3MIZA 1LJLA 4KK4A 2FKAA 3BRQA 3IP9A 4MR7B 3A0RB 3IPAA 3O2SB 2FQXA 1EWTA 5FWYB 1AB6A 3DGFC 5KWSA 3F6CA 3EAFA 3GBPA 1RXEA 2QVGA 4KFCA 1DBQA 3SNKA 5KQLA 4MPTA 3NNDA 5TPZA 3OLXA 4MR8B 3QLVA 3JY6A 4RY9A 1D1PA 3N0XA 1YTUA 1RZRD 1ZVVA 2CHEA 2MYPA 3QLUC 4L4UA 4MS3A 4Z99A 3O74A 2JB9A 1U04A 4QYMA 3SQNA 2QVCA 3GL9A 1D4ZA 4JAVC 1HEYA 1W25A 5TQ0A 4EGSA 1DBPA 4MR8A 1ZY2A 4XAQA 4KMRA 1S8NA 2PUCA 3EULA 3RQIA 4EYQA 2FTKE 4EYKA 4JOQA 4MYRA 2IKSA 2YHBA 1F4VA 1XHFA 4DADA 1NXOA 4Z4GA 4IMJB 4MLCA 5JS1A 1LK0A 4P1ZA 8ABPA 3BRSA 4IF4A 3H5VA 5KQMA 1Z15A 5BR1A 5CHYA 3HCWA 3O1IC 1WETA 1A0OA 2E4ZA 1IIBA 4XLTA 2M1ZA 2WB4A 4EYOA 2WMYA 1VKRA 1YIOA 4WXEA 3H75A 2WY2D 2MSKA 3DBIA 2FLWA 1PNTA 2ID7A 4IRXA 3HDGA 4KV7A 4RK4A 3NHMA 3RVQA 1QKKA 3GWGA 4W5RA 5TPZD 4MGEA 1RPJA 1YK1A 2FLKA 4D74A 3C3WA 4TMYA 1BAPA 3OO0A 1RZRA 3H1FA 1RXIA 4G97A 4JB2A 4Q6WA 4PE5B 2RJOA 5CNJA 2NT3A 5CNIA 4NICA 1DCKA 2GBPA 2WJAA 3HUTA 2B1JA 4RS3A 1ISRA 4D6XA 5IBQA 1QQBA 5JNVA 2M98A 1I3CA 1GUDA 4JA2A 3URMA 3FFTA 2QW1A 3GYBA 4Z4FA 4PYRA 1K68A 4YLEA 2IOYA 4P98A 2MYUA 3C97A 1BA2A 2A9QA 2RGYA 1ZGGA 3Q7SA 2F8SA 2FQYA 3I42A 1GLGA
chains in the Genus database with same CATH superfamily
4G65A 3PHJA 4DSOA 1Q2UA 1AQ6A 3L7YA 3N59A 4OLFA 5AJHA 3T4UA 3IBYA 2R4TA 1ZOPA 5CIQA 2OFFA 3RS4A 2VDUE 2ZJ8A 2VKTA 4PG7A 4X54A 3FLMA 4Y9UA 1E2BA 1Z4KA 4KXNA 1B0AA 3ZHUA 3HDQA 1CZHA 3HABA 2YXLA 4ARBA 4GO1A 1W4RA 2FR8C 1I0ZA 3G2HA 1NLMA 2A3RA 3E5HA 3G8AA 2HMUA 3IPCA 3PYMA 1QG2A 2EFEB 1GTRA 5G1OA 1QE3A 3DJYA 3IIJA 3I73A 4BAZA 4ARZB 2GZAA 1HYEA 1GFWA 3MWJA 3WIBA 3MGGA 1G21E 2H5LA 1QBGA 2ZBVA 2XTZA 2SKCA 4ZI3A 2DWOA 2XCIA 3WGVA 5KTTA 2X1LA 3RH0A 2Q6TA 3IT0A 1LQTA 2JJ2A 4RD6A 5DK4A 1DQPA 5DN9A 3TX6A 5FWNA 1THZA 2B3TA 3EFBA 1AKNA 2OHJA 3ILSA 4JJZA 2ZZKA 4UVHA 2TRSB 4M60A 1G5IA 4ZOLB 4YT2A 1PZFA 5COQA 4DC9A 2IEDA 4MQLA 4WGFA 4TYPA 4Y2VA 3L7KA 4RLFA 1CJSA 4NFHA 2PQMA 4C6HA 3LXMA 2BGRA 3AHJA 5H16A 3E5MA 5C5EA 4MV9A 1HM5A 4PSKA 4B8WA 5IPFA 3U5TA 4PGMA 4MPDA 4YFVA 2DU8A 3C3KA 5J2UA 2VVTA 4WKPA 5HCIA 2FJ0A 2VUUA 2QV0A 2B6HA 1H0SA 1S96A 2O1EA 3FPLA 1BHQ1 3IOEA 2OKCA 1IUKA 2J9RA 3EJWA 4FMCF 1NMSA 1YJBA 1ZESA 2OR3A 4MKRA 5ELMA 5LDHA 4B9EA 2DM6A 5LQSA 4NYMR 5EOVA 2GM3A 3M8KA 1ZVJA 1OV6A 3GRVA 2YXEA 3IMEA 3A1TA 821PA 2D4AA 1BE8A 3K5WA 4DRXB 4OMUA 3PVCA 1ZN2A 3SHWA 4MICA 3I9MA 4YGXB 4UTZA 2WI8A 5DX1A 4KXQA 4XYMA 1NI3A 1NM5C 1E59A 2IEYA 5TR9A 1A8IA 3RUAA 1W9HA 2R6JA 1HDGO 4G9BA 1MABB 2P2GA 1DARA 3IV6A 4EHLA 2AD1A 1Y5NA 5BSMA 2HM7A 5FFNA 4IEEA 3O7WA 1GRVA 4NKRA 3V5NA 4EY8A 2PSDA 2ZUVA 1KSFX 2FH5B 3VNUA 4XR9A 1U3WA 2OV6A 2RI6A 1OFIA 1GSIA 3OC0A 1QAOA 2NZ8A 3GR6A 1WPXA 3AM5A 2WQ6A 4FJ2A 4RZXA 2W9XA 1X7DA 2EBWA 2FSUA 4KXVA 2ONCA 1ISFA 2Q1UA 5D5QA 4Q18A 3W1EA 3TEFA 2Z4SA 2EERA 4PC1A 1XL0A 1NTOA 1QC5B 3G85A 3PWKA 2GT1A 3LC0A 3OZRA 3CCFA 1COWA 1R3DA 1VP3A 2D06A 4E08A 4FB5A 4BGDA 1GSAA 4I2VA 3DHNA 4HEQA 4E32A 3Q12A 5DYTA 4BMVA 4RKYA 5F2EA 1N2EA 5DWVA 4PFKA 3AKZA 2Y9PB 4WH0A 3VDQA 1Y8QA 3CZMA 3UHAA 4BZPA 2GN8A 3NEJA 5F64A 1YS4A 4ZALA 2PQ2A 3CLSD 3OECA 3VNQA 3GLGE 3TUJC 2FK7A 5B3KA 5BN3A 3K1JA 4Q9JA 4AQYB 4TVBA 4C4AA 4A2CA 3PXCX 3VR2D 4N8DA 2ZETA 3NGXA 1NURA 4M8KA 3H1EA 5B1YA 1T4CA 3OIGA 3JQPA 3RK4A 5DXFA 4NESA 4TLAA 1ST3A 3GMSA 2W2VA 4OXIA 4QU0A 3OCWA 2AUTA 5D51S 1OMOA 2YUTA 2WU0A 3P0RA 1LQ2A 5CDHA 3S3TA 2JEOA 2AKAB 2C1XA 2XCOA 4J03A 4Q4AB 4AUMA 5T8KC 5K0SA 3E7WA 1VYTA 4LTNA 3OE1A 1VRVA 3SAJA 4XYLA 5A9SA 3HEBA 3SFZA 2IDMA 2F43B 3OT4A 4MV3A 1VL6A 4L9WA 1Z5GA 2ADOA 2Q8QA 1MX1A 1ID8A 3QFHA 3UGTA 3ZDCA 3AEUA 4YWHA 4IIXA 2VPWA 3RC2A 3TLMA 3PQFA 3E3AA 2WPNA 4YH1A 1O57A 3F9CA 1TYAE 2ZT8A 2ZYTX 1ECCA 2I6FA 4KYVA 5DI3A 1IQRA 3CVXA 2NSDA 2P9QA 4HH0A 2X22A 4OATA 1UQUA 4GMHA 3EAGA 3DVLA 2V6JA 4MS1B 4YJKA 4NI5A 3E18A 3PWSA 4DVGA 5KU7A 5JU6A 5AVXA 1DAKA 4GGOA 1SUFA 3QNMA 4RD3A 3WR5A 5IZCA 3QFFA 4TSRA 4RFSB 1H94A 4UEKA 1NRWA 2OQ2A 3CR3C 3IRUA 1FNDA 1QH0A 3CS3A 3U3DA 4B83A 2A57A 2F9MA 1YR8A 3I76A 5EP3A 2CFTA 4AJHA 1D7AA 2ZUSA 3PUIA 4N6OA 2J0EA 4C21A 2ZR7A 1PJLA 1ABEA 2P7IA 3Q3GE 1KDYA 3TZKA 2COKA 2C8KA 3VSDA 1SBNE 1A4RA 1I4EB 1ZOOA 4ZHQB 5A9RA 4NARA 1FXUA 2Y1KA 2OGZA 1P3JA 1HK7A 1IY0A 1X0VA 1SCNE 3VR5A 3EY9A 3I09A 1ND5A 1T2EA 4LXUA 3K6SA 4CLHA 4ZYWA 1VLJA 4LVUA 1RNLA 4R81A 4RK6A 4HY3A 4UVDA 3TMAA 2C07A 2QM8A 4DR3B 3P32A 2W6MA 1TMOA 1Y8RB 1TEZA 4FFSA 2LKCA 1V8ZA 4GOXA 2ZT5A 2OCPA 4AG3A 4L7VA 1BXKA 2OUKA 1U7WA 4QPPA 4RMJA 4DCVA 1OXXK 2BF4A 3MGCA 3LOPA 2GM9A 2YWJA 3MJEA 3SC6A 1ZXLA 1ULAA 4ZC1A 2QMZA 1D9XA 1O3YA 1PO7A 4TUYA 2VPQA 3VDMA 2PFSA 1U0OC 2WJ6A 3IMCA 4EY3A 5IJ0B 3DEAA 3ZHBA 2W48A 1LPBB 4LF5B 4V0MA 4TN1A 4BRUA 5I8PA 3UK0A 1AGXA 1GTL1 4DL9A 3WNCA 4OKNA 4CHTA 3PE4A 4FN4A 1P45A 4GMXA 3V8VA 1H8HD 2VDWB 4TLBA 2X2OA 3OX3A 1L1EA 2PM8A 1R6DA 1XTIA 2HPAA 2J9FB 4E3WA 5MN6A 1KYZA 1Y34E 2VN8A 2ECPA 3GNTA 4P7BA 4TMFA 4LV6A 2EXXA 2B8NA 2IUTA 3K1ZA 1UPFA 4QATA 4D0LB 5EFOA 2JFBA 1KK1A 3KLNA 2BZSA 1AY0A 3VHRA 4BVKA 5LVAA 1Q77A 1TZJA 2GF9A 5LLDA 3VNRA 1GDHA 2FW7A 5I5GA 5BT8A 2D1RA 4ZOBA 2G5TA 1R6UA 4ZU3A 3BA1A 3KYJB 2PG3A 3JD1A 2QS9A 1PSWA 2QUJA 1KORA 1N5JA 2GWRA 2AOUA 3O4JA 4TRRA 5B1DA 4NZ9A 2AOUB 4EKIA 2F7SA 3SX2A 1E6MA 4O4JA 1GQ2A 1BYIA 1X1SA 2REQA 3E9DA 4HX2A 4W5JA 2GVDC 4WZBA 4LFAB 4DLXA 4LNUB 4CIWA 2OV3A 5L3QA 1M5UA 3RSQA 1G0OA 1CBUA 5DYNA 3R9XB 2BMDA 2O3RA 5K3EA 2ILVA 2OVBA 1I0IA 2IF2A 2PJZA 1GPNA 2AC7A 2B5WA 2P4UA 4JEIA 4D3FA 5JPIA 4QTYA 4YIHA 1AZLA 2XSZD 3LPNA 2FPIB 4B79A 1NVVQ 1X1EA 3HADA 3ITNA 2VHXA 3LI2A 4FNGA 4TV8B 5EG5A 4PCAA 1BMFA 1YL7A 2IW1A 1XROA 2VDWA 5B37A 3D8RA 2WU3A 1KIFA 4QNNA 4JT9A 5F1PA 4YP6A 4CJXA 1P1BA 2C5SA 3DVAA 5PNTA 5TMBA 5BN1A 1BTOA 4NCBA 2FR1A 2J45A 2GKSA 3P26A 4QD3A 2BLNA 3D8NA 4GECA 4U6QA 1GFZA 3GFPA 4OIMA 1LZKA 4N54A 4CR6A 4D43A 2XUDA 3H9CA 3NTVA 3GJSA 4N3CA 1H69A 4YRTA 2A84A 1Y98A 5TY0A 3TRDA 3C4VA 1QZXA 4OK6A 1A77A 3S55A 5KJCA 4EP1A 3PX7A 5EJ9A 1JPUA 5DMXA 4W7IA 1EXDA 2ODBA 1BVRA 3KQOA 3INYA 5E9QA 3QE4A 3ZEIA 1KJJA 3MJ4A 5KHAA 4O2RA 4TV9A 4XJTA 3GPDG 2CL7X 2H5JA 3UIEA 3V33A 1GARA 1NNLA 2HA0A 2R5WA 1NTRA 1T91A 3FJOA 3DC7A 5JJLA 2Y1WA 5IAOA 5KVVA 2VHYA 2ZYDA 3UMFA 2ZSHA 3MXOA 1B16A 2MT9A 2W2KB 3SEQA 2M9MA 2HYIC 3Q8KA 1X2EA 1AKMA 2H85A 1YNOA 3NVKI 1EAMA 3M4ZA 4O4HA 1VTKA 2CYBA 2H8GA 1Z6YA 5UKDA 1OW3B 4DLAA 4Y6LA 2GFQA 1JFTA 3T6KA 4X1IB 4KBYA 1DXHA 1JEJA 2F6RA 4E5VA 3EEBA 2HLHA 3N8IA 2I3BA 1MJFA 1R2QA 2E4WA 2XQFA 5AK3A 4BMOB 4OGKA 2BFEB 3D7RA 3MD9A 4JYCA 4LE0A 4RZHA 1P2UA 4IGIA 1UC4B 1NL3A 5JXJA 2PL9A 1DGQA 2C9MA 2XDWA 2JCGA 5IUJC 1E9AA 4Y2YA 2QRNA 5G1NA 3VQTA 3KUUA 3FCUB 3VJKA 3MHTA 1A9YA 3SBOA 4I4CA 2FZKA 3EXHB 1VMIA 3D8BA 2IY7A 4YEDA 4KLNA 3L0ZA 4XGNA 4DEYA 5EZYB 2YMMA 3PQ3A 4WY8A 4GXQA 5TEVA 2WF5A 3ROZA 2C4NA 1K7EB 1IBLB 1XD2A 4MRMA 2WJPA 3UF0A 1IZ0A 2K2QB 3Q2IA 2VHUA 3ETCA 3EXHC 2E89A 3C1AA 1GZDA 3FLAA 2QN9A 4W9MC 4BMXA 1NHGA 4JDUA 3SJAA 3AIOA 1WP4A 1AUPA 2PX0A 3L46A 2CXRA 1I2BA 3HM2A 5KX5B 3IHLA 3MMNA 1W93A 4B2LA 4LF6B 1OFTA 3ELBA 3HSSA 1VL2A 4GZLA 2HLDA 2BTQB 4RXTA 1TM5E 1PE0A 2WKSA 5KAMA 4I4LA 1Z22A 2RHHA 4PPQA 3SE0A 4QWWA 3P5BA 3TTYA 2GTHA 3TLJA 1XQ6A 2Q4RA 4KR9A 3FWNA 1P77A 4BO6A 3AFHA 4QXPA 3IPLA 1TFRA 1URPA 1RAGA 3BMCB 3LUJA 2WFZA 4U6NA 2FF5A 4KN8A 4NMHA 5BWLA 4NBVA 2XCQA 3SXUA 3QX7A 4ND6A 3WDSA 4DNOA 3ACBA 2ZRLA 3N05A 3MD0A 1Y6QA 2C04A 1JHUA 4M6WA 2XDQA 3PJFA 2OCLA 4UOQA 1JIUA 2WOJA 1U0SY 4B7XA 3RNLA 1YULA 5CBKA 1X39A 1FB5A 3FZEA 3J7TA 1P0PA 2BUAA 2HV8A 1NC3A 1YGPA 2ZVQX 3EUEA 4GOND 4GYYA 4J8PA 5K0BA 2EL7A 4MULA 4ZQEA 4MEBA 9ABPA 4RIGA 1BG6A 4KBGA 5CH8A 2ZSFA 3GJ3A 2JL1A 1OX4B 2DTDA 3K0KA 4OI2A 2I4NA 3REQA 2OHOA 4EECA 5BORA 5EE1A 5H81A 2I1LA 1Y89A 3IOCA 1ZI8A 1JV2B 1RM4A 3B6MA 3EW7A 3GQBB 4B81A 3VYUB 4X1KA 1SUWA 5LYJB 2HLNA 1SU4A 3F6CA 3EAFA 4WCFB 2EKBA 2BGTA 3WICA 3GBPA 1KTVA 2BAGA 3QPAA 1ITZA 2G70A 5CM9C 3ZCSA 3WDMA 1T3GA 1EM6A 2I7DA 1JKMA 1ODSA 2ZSIA 3MJTA 5A7FA 3Q1KA 3N0XA 5CX4A 4LECA 1NG1A 4M22A 3QLUC 4RENA 3WAJA 4QUAA 4ZVNA 5FEUA 3ONNA 1N8NA 1T2DA 2QVCA 2D3WA 3O3CA 4ND2A 5ALXA 3LHSA 4KO2S 1HEYA 4P4LA 3NXKA 1R64A 3MTAA 4Y6PA 1ZLYA 2GXSA 4KE7A 4HNAA 1PRYA 1SU6A 4OA8A 1ECFA 1KWKA 2PXXA 2POQX 4EHNA 5ER6A 3NHRA 4LYFA 3EVTA 1J70A 1PZMA 4JQOA 2FV8A 5L4SA 3C3XA 4L8LA 1E0AA 3E82A 4R0MA 2D7DA 2F3TA 4J7XA 4NVRA 4Y9SA 3YASA 2O8DA 3UFXA 1U1IA 3G1UA 1CU1A 4F2HA 1O7JA 4RADA 1VL1A 2P3LA 2QD4A 1VKRA 3WRYC 1XOIA 4AP5A 5I7VA 4KQMA 1WJGA 2R8XA 3DKRA 2FLWA 3RU3A 4CMIB 4K9RA 2CCKA 2QMHA 1E98A 3EVCA 3P71T 1BU8A 2I03A 4RQUA 3HJRA 5HYVA 4MGEA 3VTKA 4ABTA 1EFTA 2IPXA 4ILEA 3CY6A 3EZLA 4TRJA 2QRZA 5LNK6 2QB5A 1U1GA 3EXHA 1XTBA 3AUXA 4LJAA 1Z0SA 4MKXA 5AHOA 4ZCLA 1BD3A 2XHEA 4A2WA 1NVAA 1Q7RA 1SIBE 3DS8A 3IIKA 3RTCA 1LK7A 3EMDA 3ZIUA 2B1JA 3L1JA 2V6BA 3RB8A 1EXMA 4YREA 3CVYA 2AF4C 3LS2A 4QE3A 5H7XA 2PT5A 4TLCA 2LIPA 1AM4D 1U7TA 2QRQA 1RU3A 2PZGA 2GSWA 3Q0EA 5JLAA 4CMBA 1X7XB 2IVZA 4UAJA 4MAMA 2I34A 3AFMA 3MS2A 3WK9A 2FSVA 1GLGA 4JASB 3RM3A 1CDDA 3LZDA 3U4QA 1AQNA 2QVXX 4NCKA 4NY1A 3UB3A 1MAWA 1NXPA 3BMOA 1QFZA 4F8YA 1C7QA 1GZSA 1LS1A 3D4IA 3T3HA 1NXTA 4P2BA 2G71A 3FMIA 3EBPA 3E05A 1RXUA 1LXCA 3E4CA 3OO1A 1P1FA 4WUVA 3MVEA 2NP6A 4BDSA 3ESRA 4GOMD 2JVJA 1N1EA 1CQJA 2FPPB 4LQLA 1RWNA 3VAYA 1N2CA 1K08A 1U65A 1TRKA 2QLBA 2QYHA 1IEVA 4AK9A 2JJ1A 2WIAA 3RFCA 3U3ZA 2ENWA 1YR3A 4DT1B 1QNLA 2ZI7A 1D0VA 4CG3A 5DPMA 2HLPA 2F1OA 3DTVB 3DKIA 3H04A 3PEVA 2OG1A 4G1FA 1K6XA 4WRRA 3RK1A 4D9JA 4QREA 1NRXA 1A5ZA 1JJFA 2FEKA 4HGZA 3UQYS 4JS0A 3IJRA 4HUQA 4KUGA 5K4AA 1EVEA 3IAUA 1YVUA 3PRJA 4TV8A 5FTKA 4JMLA 1MB2A 3KB6A 5HCNA 5KINB 1U2SA 1RRFA 2KI5A 2J87A 3RFTA 4DV4B 2V96A 1AF7A 4IHKA 4IUBS 4AP9A 1UBRS 2GILA 1UOOA 1USIA 2XIQA 2E1PA 2BFDB 3ISTA 2RHDA 2ZATA 3ECSA 2XGOA 1T0UA 5L3QB 1HV8A 1R5BA 4LNUA 2PKYX 4LFCB 2ZJ0A 2CEAA 4LOHA 5JALA 2E3JA 1JDSA 3N0TA 3IRVA 1PFVA 1T34A 3IT1A 4ALJA 4ISCA 1Q1BA 4BBJA 4FFMA 2BEWB 3VYTB 2XAAA 1KO1A 4F96A 1T5OA 5A6SA 2BM9A 3FGNA 3UICA 1BDJA 1GZUA 5K6AC 4MQ4A 3KPYA 1DE0A 2QZSA 3GUYA 4WCFC 1NUHA 1MOSA 2IOQA 2QDXA 3IUSA 4GOOD 4R8RA 4C7OA 1M2GA 4WCDA 1DO8A 2HL6A 4IHJF 1Y6ZA 3AG6A 3KOUA 3WLEA 4DJFC 4P5PA 4CLRA 3D2CA 4KNVA 1AQUA 4MPRA 2WT4A 3MTGA 3ETLA 2HWUA 4YC7A 3UWSA 1VHTA 3JQ9A 3GT3A 2Y0PA 3WGQA 1GILA 1GUBA 2COUA 2RBKA 2XRFA 3CURA 3K9NA 4DM3A 5LIRA 3RTAA 4P32A 4NOMA 1YZHA 4LCJA 5JXHA 4B45A 4F9TA 4NDAA 1TW3A 5JRJA 2ZTMA 3CO5A 3S8YA 4CQLB 4REMA 3G5TA 5BN4A 4OSEA 3H6HA 5CFPA 3DO8A 3QVVA 2OENG 5I4BA 4YRKA 1QP0A 3IAM6 4FYMA 1TC2A 4NH0A 4IMRA 1Z2PX 1SHUX 2EJUA 2RMKA 5JRDS 5FTWA 2OG2A 3INGA 4BUCA 2PKQO 4KR3A 1EP9A 2G06A 2IXDA 1ZOLA 3A4VA 3I37X 3IAFA 4MQEB 3LKBA 2ZBPA 5CU7A 3OICA 5AWFC 3PA6A 2PSSA 3ROPA 3WBKA 5EZ6B 4HNTA 3UT5A 3CWQA 4NK5A 4YACA 4NBRA 3KHSA 2IIVA 1JE1A 4I1OA 3JVVA 2XOXA 4GDFA 1LVUA 3Q40A 4M38A 3MCAA 1SQGA 2H51A 4HG2A 3KOWA 4DLYA 4FYPA 2RBEA 2YJZA 4P6VF 4QDKA 1RM3A 1T4BA 5ARBA 2H1HA 1GUYA 1C3EA 1DT3A 2CUTA 3DH0A 4JJIA 5JQGF 5HF6A 4Z3KA 2YXBA 4DCOA 3OHSX 4XR4A 3JQEA 1LH0A 4B84A 4DHWA 3HBNA 4AECA 2AYZA 3AIMA 5TIIA 1EA5A 2IH4A 3PT9A 3D3WB 3AEKB 3OPQA 2VT2A 1E2KA 2JIDA 4RFLA 1G66A 4MS1A 1TVKA 3AI2A 4MA5A 5ICCA 2VJNA 2QTHA 1NKSA 4WDRA 4M46A 2HA5A 4BZXA 4GXNA 4BZQA 4F4FA 2V98A 5A04A 2EX0A 4AJPA 1F8YA 3FR7A 2WHPA 3GD7A 4P93A 1N2JA 2WHPB 3GFRA 3KZXA 1T9KA 4PAGA 2CDBA 1J5EB 3H0CA 4Q1FA 5LDGA 1Q0SA 3WQSB 4ECEA 1E5LA 3HCFA 2VWGA 3F2VA 2R47A 5JMWA 1UJCA 3B6ZA 5FKJA 4AFNA 5JNTA 4CQMB 1YR9A 3VSEA 4DDKA 4ZEVA 1XUOA 2R48A 5JATA 3COPA 2GVZC 3AETB 3NT2A 3WL8A 4LJSA 3OOEA 3RRJA 3HZZA 3LPMA 1NU8A 1E1MA 3ZGVA 1HNZB 2ANBA 2C7QA 3QKRB 4DQKA 1T4CB 2HKIA 2ZCUA 5DHTA 1J9EA 5F5NA 2G4CA 5J4KA 4V3CA 2OBYA 1FNSA 4Y98A 2HDHA 2IT1A 3LU1A 1RBQA 3AO0B 2GHRA 2WSLA 4ZCSA 3N8KA 5EXPA 1VG9B 1NXVA 5GJCA 1L4NA 1C4XA 1WUTA 3G0DA 4MGKR 1XKQA 2W6CX 4JXKA 4MO2A 2FVYA 3ND9A 3HU3A 1JTFA 4PS0A 3WBBA 4A03A 4GVXA 2BT4A 4RHUA 5SYAA 3U4AA 3V55A 2I2AA 3IESA 5AYVA 1S9DA 1N0UA 3MNFA 3PEYA 3L6OO 5KYUB 1F0YA 3FCXA 3W6UA 3PXBA 5C1PA 2C2ZA 3M5CA 4KODA 3T5BA 3WWYA 1BDMA 3JYPA 5H3CA 4U7WA 5HG0A 3MTIA 1XVLA 2B99A 3A2MA 3EGVA 4FJ1A 2Q6IA 2LWIA 4XFDA 4KXXA 4KLRA 2GHQA 2WJHA 2ZIVB 4U6SA 3RT9A 2DVMA 4ZJPA 3K2IA 3LLUA 3LIIA 2C42A 4C0HA 5DHUA 5H5JA 2HWKA 4KR6A 2Z5GA 2VO1A 5JV5A 1YI0A 3OFVA 4URFA 4Q4HA 1NPDA 2OP0A 2W58A 4W1RA 3TLKA 3E53A 4N7MA 4URZR 3QBJA 4MS4A 2EJWA 2GYUA 3R4CA 3D8SA 1R8YA 4LEIA 4ETMA 2HU7A 1UM8A 5G40A 3T9AA 1LI5A 1MF7A 3U19A 4KAFA 1O87A 2B20A 3ZE7A 1A98A 4G0ZA 4CM9D 4MW6A 4I9HA 1LI4A 4WKBA 5EJAA 1ZGCA 1ZRSA 2QTMA 4ARSA 5CBPB 3IC5A 1H8EA 3WB1A 1WDTA 2XZDA 3OZEA 1YR6A 1JIQA 2HF2A 3LQ2A 3G0OA 3Q10A 5DLDA 4IV0A 5K51A 4AULA 4NONA 4N0PA 3U7QA 1SK8A 1KJ8A 1T2VA 3DE7X 3PUJA 5EVCA 4PC7A 1AE1A 1OXKB 2B8TA 1G0NA 4O4LA 4Y1RB 1XNRB 1F2TA 2FEWB 2BFNA 2FFHA 5TEWA 1RMTA 1JDUA 4FDVA 4Z51A 1RYFA 2UVQA 2BMJA 2Q62A 2G4VA 1Z8NA 4DMMA 2IHNA 2DBQA 1OFVA 1TA4A 3IGFA 4MV6A 3LLVA 3ADBA 4NMLA 2I91A 3ZJVA 1ZICA 2I71A 3MSXA 4GBJA 2QTLA 3LUDA 4JI8B 2B4AA 3EHEA 1D8AA 4BKMA 1NVWQ 3C5EA 4CF7A 4B6EA 4KDRA 3SNHA 4F4CA 2B35A 5CFRA 3IP5A 4HUQB 4WBNF 1C1YA 1AA9A 4H1UA 5ALYA 4DM7A 4RL4A 3D5EA 2WKQA 3QLVC 1QG0A 3KEOA 1H23A 4Q66C 4RELA 4AN1A 2XY4A 4GPD1 4RWEA 1S4QA 3UQZA 5L40A 3SQLA 1G8FA 1K66A 4HRAA 3SVLA 1UXIA 2OYCA 3RO7A 4F56A 2WT9A 4FHGA 2OXTA 1EHIA 1NULA 1N2CB 5CITA 1CUIA 1JE0A 3FG9A 4L0CA 2Y8EA 2H31A 4NXMB 2X9VA 2BE7A 2GM5A 3M4NA 1T5SA 5JSZA 1WAMA 1I6LA 4NL4H 2X5KO 4GNRA 1RKUA 1EBBA 2H2HA 2ZE8A 2ZVJA 3COZA 3R0VA 1KI2A 4Q47A 1VCOA 1Y1LA 1QXSA 1TQ4A 3AEYA 3SHTA 2MINA 2VDPB 3LPLA 4M76B 4QG7A 2VJLA 1TVEA 2ZUUA 3AHHA 3BMOB 1UFKA 1US8A 2BJWA 3D4LA 3WO1A 4DJEC 1XVUA 2AZMA 3QE2A 2HXGA 2QW0X 1EVLA 1GFIA 1Z0FA 1CRWG 1P5FA 2R7NA 2CLMB 1TLTA 2YYSA 5NULA 2GEJA 2VJCA 4IIHA 3KQUA 1M34B 2KMLA 3EZFA 1EJ2A 2ETXA 1CF2O 3HJBA 1FVOA 1FUUA 3LXXA 1KKUA 4ENRA 5FI0B 1EUYA 1U2TA 2ROQA 3OHPA 4NEGA 1QBKC 2ZYUX 3BFPA 2WSSA 2FPXA 5TSDA 2CXOA 4ASUD 1KYTA 1RQRA 3ZI7A 4K0KB 3HYNA 2D62A 4PM4A 1Z0KA 3F4BA 3KHKA 2BC9A 2QT9A 2F1JA 3U7JA 4O63O 2O8EA 3M1AA 4TGLA 2W6IA 2FPMA 5ALPA 2MDTA 1MJ5A 3PNBA 5IVIA 4JQZA 3PVSA 4EO7A 3OA0A 3E8XA 1P7CA 5I7AA 3ZHOA 4BFYA 1QYWA 1VECA 3CRQA 1C3OB 2WD9A 1KC1A 3HR7A 1DC8A 3LFTA 4MJXA 2NU6B 1XD8A 4QOSA 4M37A 4OQPA 4CN8A 5IXSA 4CR7A 4K1XA 1Z6GA 2CLLB 2BW0A 3A1CA 2ZZNA 2D5CA 1LV8A 2H1SA 2Z6UA 2NSYA 1L2TA 4IBOA 4GX0A 4UFPA 1SVIA 1J1UA 2X58A 2Y4NA 1A7AA 5ALTA 4CL3A 4N0DA 3L9XA 3SF0A 2FAXA 4RMHA 3DE4X 3GRKA 5JCZA 2BKLA 4II2A 5JO9A 4ENQA 3AR5A 1MRSA 2VQFB 5I48A 2WINI 1AXEA 3PUZA 3VR4A 3DV2A 1R16A 4KPGA 2APJA 3CX6A 3BFXA 1AU9A 3DFZA 2WJZB 3GI1A 4Z1OA 1V16A 1YA4A 3RW9A 2WG1A 1EWKA 4KXFB 1NNI1 1M54A 2LBPA 4PCUA 2NXEA 4HNAB 4D44A 2OC4A 4P84A 1W5FA 1Z35A 1PS0A 3BERA 3H1TA 4NMMA 4HQOA 4DRZA 1CZUA 1X13A 2PO5A 3BD6A 3EOBI 4JN6B 3GJ6A 4FPXA 4URWR 4DN6A 1TXGA 3DWIA 3KSUA 4BE4A 3DBVO 4JJKA 5IVHA 4YIKA 2BP7B 5CEFA 3V2HA 1RTKA 1K3FA 1U9ZA 2SKDA 1IXZA 1U99A 1WXQA 4QYIB 4R9VA 3AUFA 4WMLA 1YE3A 2K2WA 2H65A 1B8UA 3QI7A 3D7LA 4J0KA 1P19A 1K86A 4R8SA 2PNJA 1P1RA 4KQEA 1R9MA 3C8DA 4LCBA 1RWPA 2L42A 2EP5A 1YQDA 2X6TA 1OA0A 4IDHA 1N6PA 2GEUA 4EABA 4ZA2A 3PL1A 2AMFA 1Z38A 5LL6P 2VJPA 1HKUA 3RT1A 5KWJA 1QE0A 1QVZA 1V8FA 1P2DA 1KI4A 3A37A 2FE1A 2GJKA 1UJNA 1WCYA 3N8HA 1TUBB 1J90A 1U7ZA 4C3UA 4OX9Y 2WC1A 3R5FA 3G68A 2EZ4A 4V0NA 5CBPA 1BOFA 4BRWA 1RRVA 2FW6A 2G40A 4F2PA 2CHEA 3L06A 1AKEA 2H4YA 4DQXA 3HXOA 2JB9A 1QIIA 1QIJA 4I99A 1QFYA 1FMTA 1ZH0A 4MHSA 1YJAA 4JAVC 1Z7EA 1DRWA 3IE1A 4PYKA 4AAYA 4D9CA 4PO3X 4G1MB 4DY4A 4B6OA 1L8OA 1MQSA 1K97A 1S8NA 4FHDA 4FIDA 4UXJA 1ETHA 5CGZA 1QPGA 3JQ8B 3FPFA 4IDGA 4X1YB 5KNLA 1N8KA 2JC3A 4QLOA 1BGVA 1F4VA 1NMYA 1LX7A 1HQCA 1V35A 4YCCA 1PQ4A 1E7RA 1NSFA 2VRCD 4OM7A 3LCUA 3BRSA 4HRYA 1BMDA 1GAEO 1OYOA 2GN4A 2QG6A 4YAWA 4Q03A 2PVSA 1NF2A 1Z7GA 1QG6A 3AX6A 3BGOS 3C7CB 3ENVA 2L69A 3K9WA 5CHYA 5DTJA 3MLEA 4M8NE 1T0HB 2P1DA 4Y2RA 3TQTA 4EB3A 5ITZB 2HR1A 4C4RA 4GKVA 1FTNA 1VPLA 2M1ZA 2WB4A 2G67A 1OLUB 3DC2A 3BVPA 4WXEA 2PZAA 3H75A 1I7DA 3L6CA 1PNTA 3HDGA 2KQUA 2JGDB 4PBTA 2XXJA 2R8OA 4J3FA 3ZGLA 5K0ZA 3ZLUA 3GWGA 1SH7A 3PXXA 3EIWA 5BPHA 3NANA 1ZLXA 3L7LA 4AJ1A 1XBTA 1VLHA 1G21B 2CB9A 3BGDA 1QVRA 1NE2A 2ZXUA 3DPSA 4UQLA 1INLA 2HJRA 1EFPA 2HNKA 4JB2A 2A1UB 4U7PB 13PKA 1E0JA 1VL5A 2Q5JA 5CNIA 1W581 2H4HA 3QITA 1RI4A 3JQDA 4AXBA 2G0TA 1Z5NA 4Z49A 4EHHA 5AI0A 1YZGA 3VJMA 3KKMA 4KLAA 2YMQA 4ZO9A 4V0KA 4IDPA 3PRHA 4CLDA 1WUHS 2HHJA 1ZPDA 4FLMA 1ZD9A 4WBNB 5ECYA 2V7QA 3ER9A 4AS1A 4M55A 1H5UA 5G41A 3V4FA 5H9WA 1QHFA 1RIFA 2Q3BA 5AI6A 3DSRA 5EPOA 1BA2A 1XJCA 1CDEA 1USKA 2WNIA 4FLEA 1KPGA 3P2YA 4KX5A 5EIOA 1O89A 2D0PB 1BSVA 1BXZA 1OVGA 3CJQA 4GWGA 4P5DA 3W6NA 3I0MA 2WU8A 1Z4NA 3K16A 5B6JA 3S2SA 3KZCA 1UDAA 4DDHA 4QBKA 1DEOA 3ZXUB 3SMVA 5AUNB 1GPMA 5ICFA 4KXWA 3EUFA 1YA8A 3H3FA 4K6CA 5GQSA 4WACA 1ZD4A 4Q3CA 2G09A 5EFZA 5BWCA 1U8CB 4ND5A 2R6CA 4WZBE 3QJYA 4DMRA 3VMFA 4UATA 3K8ZA 3QFRA 5EHGA 1OGJA 1U0RA 3M33A 2HK9A 1NONA 3QG5A 4XOIA 1JXOA 2P4HX 2XQJA 3DZFA 3S0JA 1CZKA 2QX8A 4AMGA 4GU5A 1ZYUA 4DSNA 5KOJA 1UBKS 4AN0A 2BRUA 2VDLB 1K63A 4ZVTA 5B12A 4L7QA 5MGNA 2PWYA 1NATA 1TLLA 4AJLA 2PR2A 4HX9A 2CD7A 5BYBA 5JSZB 4TMXA 2NTNA 1M8KA 2IA5A 3NNSA 3RTEA 5BURA 2BH2A 2O3QA 5KSWB 1DJNA 2IXBA 3A6PC 3L0YA 3SBDA 3KT8A 1R0YA 1DV1A 1J8DA 4WW0A 2IXFA 2A8YA 1FP7A 3HCRA 2GA9A 1UDXA 2M6RA 4MEAA 4WXHA 3QVSA 5FFFA 1NX9A 2ZBDA 4AJEA 5ESDA 3SKXA 4EA8A 4N82A 2PIDA 2XTMA 3NHWA 3R9XA 2B6NA 1HT1E 1F0NA 1AKTA 4IJVA 4QPJC 1TQHA 2XRMA 3QKSB 2VNSA 6ADHA 1DEXA 2HPZA 3T0GA 1G6HA 3AHGA 4F3TA 2PZFA 1FTWA 2JCVA 1OWPA 3IQEA 4EHBA 5I45A 2WYWA 3WFJA 3BF7A 3HYTA 2ZSKA 3SJBA 5DWDA 3AP3A 4ON9A 2GM4A 4QPNA 3CU5A 1SBYA 4CV2A 1RE1A 1SOAA 3HE3A 3PUXA 4PPYA 5LBUA 3DLBA 3WSTA 3EH2A 1PDOA 1RKVA 2O2ZA 2RKOA 4JP1A 4L15A 4N7BA 4YBRA 4TMTA 3WXMA 4F5EA 4LF7B 4WK2B 1RAEA 2XQIA 2FGKA 4CPDA 2AN4A 4MS3B 1X0XA 2I3ZA 2IJGX 4PLHA 5CNMA 1U8ZA 3VR4H 2Y68A 4KUEA 4EG8A 2Q3JA 3NJ4A 1XR3A 4IKOA 2QYTA 1NWHA 4JBXA 1CRPA 1H3NA 2ID4A 5A6SB 5L8VA 1QH1B 1D04A 3O73A 4JVSB 3ZIAD 1JXAA 4RK5A 4HDKA 1IN7A 1HLDA 3QI2A 1NW3A 4EHJA 4IVPA 5C9ZA 3BE4A 1GJRA 2CNDA 1YS1X 2DBVO 3I4FA 3PR2B 1RYEA 3ZCQA 2IYNA 5CD9A 1CK4A 2QX6A 3ORSA 3PQ4A 5FBKA 4S1NA 3STWA 1IY8A 3NX4A 4OY3A 3VVMA 4C3ZA 5I3ZA 4DHEA 4QGSA 3IUEA 1Z16A 3TGLA 5E7QA 2DKNA 2IY9A 3SFVA 3K6SB 4AWBA 1YSCA 3KU1A 5K6AA 4MUBA 3HEMA 2H6EA 4X91A 3K4PA 2XI4A 1F0PA 4MP6A 2VF4X 2C1ZA 3IB6A 1ATZA 5AW8A 3NFYA 2B37A 1IJBA 3AHFA 2WTNA 3OM1A 4GGPA 2OVFA 2VNJA 1CR0A 3CLVA 2FG5A 3EIXA 1F2DA 1DJMA 4AI6A 3S1AB 1K1EA 1MBZA 3STYA 5IK2D 2OCXA 4UZFA 3OE7A 1GPH1 3Q98A 4BNKA 3RYHB 4ETWA 4B6SA 1KU0A 3C16C 1SHLA 3KR0A 3ZU5A 4BMYA 3EDYA 2Y9MB 4L0MA 3GJ4A 3LT0A 2CK3D 4FM9A 1C80A 5DI9A 5TS2A 3JAKA 4XPIB 1QJ4A 5EJGA 4E2WA 3DZ8A 1FQKA 2NZXA 2XYHA 5FPPA 5C3UA 1RAAA 3P0EA 2QRHA 3TJRA 1L5NA 4ZIRA 1JAHA 3F7NA 4WVLA 3U09A 4QX6A 4AY3A 2X41A 5G4KB 2EATA 1G17A 1PJCA 1Q0ZA 5FTJA 1SZDA 3TMYA 1KI6A 2W6JD 4DEXA 2H9AA 1ABBA 1M6EX 2QX9A 3MFYA 5THXA 2XJ4A 4X7PA 2E4AA 1TT7A 5K01A 1V3UA 3ZDQA 3T5DA 1U7HA 2JGFA 5LDDC 1E9BA 3HUDA 4YJ2F 1ONOA 1QOPB 2PWZA 1E9RA 3R6LA 3WLIA 2BFCA 1LEHA 3AUYA 3PHGA 1YQUA 2B0CA 1C1XA 1LUAA 2J6BA 2UVPA 1YRWA 2WABA 4BLRA 5EZYF 4NHOA 3CIOA 3I5MA 3LUFA 1P60A 4RD0A 2OFXA 3E22A 3VR2A 4NJEA 1VP9A 5BN3B 5SYNA 4EELA 4G0YA 4QG3A 4XQGA 4CEJA 3LG2A 3CLUD 4A23A 1N36B 3I4LA 2GDJA 3NLLA 2BJVA 4GI2A 1UZUA 2WJIA 3T9DA 3ADKA 3UHPA 4EFDA 1GZHB 2G9NA 2YV2A 1T6XA 1HMYA 3T9BA 3T9CA 3UO8B 4EPRA 4QM7A 4F5ZA 1JTEA 4CXMA 3MT7A 3KYIB 2Z9DA 3S2GA 4A9AA 1J33A 2F1KA 2R00C 1EP3B 3A4YA 3TNDA 1AH2A 2HO4A 3S68A 1L7EA 4PPGA 2R8BA 2V9PA 1V7PC 1EK1A 1RRPA 5D3MA 5DGCA 3CE6A 3WLPA 1ORIA 3IP3A 1Y6FA 3SYRA 3KJIA 1CP3A 4JR2A 1IONA 1JWAB 2PWBA 2MJLA 4P4NA 3RRNA 2CHFA 4B4KA 1DWUA 2C4UA 3D0RA 3BTUA 4OU4A 4UDYX 3U4MA 1V1RA 3DOUA 2SICE 4G8CA 1IMJA 4GVLA 4ME6A 2IE8A 4S3MA 5IXJA 4Q9HA 1DTEA 1Q5PA 3K7EA 5C2JB 1U0BB 4M0KA 3TL6A 2IPMA 1S8FA 2LDBA 2OHXA 4LRTB 2X0FA 4GC5A 1QOQB 3IVMA 4Q6BA 1HTWA 4HEJA 1MPTA 4QT0A 1ZD1A 2QRPA 3O4IA 3L0PA 3B3QA 5F33A 4YMHA 1CJKC 3ICOA 2ZRGA 2R8EA 3E7FA 3L8YA 4NULA 4F4UA 2UUPA 1J09A 1WQ3A 1PG5A 1RI2A 1DBSA 1T9GS 2NTJA 4FE4A 4Y30A 1VCHA 1JLHA 4GE0A 4IOLA 2UZ3A 4H7KA 3OZSA 3V7UA 1HNNA 3KXIA 3U37A 2VLIA 4DIOA 3NKVA 4LXHA 1ZRMA 2JFZA 5EGSA 4BTLA 3ZXXA 1UKBA 3L07A 3LKZA 3ADCA 2V9ZA 3ZE6A 2XNKA 3WKCA 1N6LA 5FDFA 5J2TA 3E3NA 5CIWA 3IDSA 3EC7A 4DIKA 4B33A 1J0CA 2JI7A 3ANMA 4F4DA 4KACA 4ZYUA 5IUNC 4PG6A 5HJEA 1UBGA 3DULA 3FUXA 1NW4A 5E9WA 1WVMA 3LK7A 3MT0A 3PDCA 3LA8A 3ZH2A 5AD1A 4B47A 5JH7B 4ZQIA 1G291 4ZAFA 3F1KA 4NK4A 3UKJA 2XR1A 3GYGA 1FSSA 2BGIA 1Y4ZA 4UAUA 3CEAA 1ML3A 1O8CA 2JI6A 1JU9A 1EDBA 4RVGA 5DH9A 1T8UA 1H6AA 3ZVLA 2IYVA 1D2AA 3W2TA 3FTCA 1DIOB 1XZEA 2C99A 4WWHA 3ZZTA 4NENB 3R7LA 1IVYA 2AIRA 3FYUA 5KKCA 3SHVA 3C8HA 1JAIA 2NVBA 2EAUA 4D9KA 3FUVA 3CUKA 3GLGB 3W4IA 4EMUA 4TROA 4XVCA 1K8YB 1IK6A 2YIMA 4WIAA 1W36C 4RS4A 4NRDA 4DKJA 5SYMA 3DW3X 5FL7A 3RANA 4EPXA 1FUKA 1Z28A 2VDQB 3ND8A 1SC3A 4G0QA 3B82A 4U8HA 1L8QA 4IICA 3E3OA 2EL9A 2YNMD 1R0LA 4L8YA 1SAYA 1YXMA 3JQFC 2DLNA 3QMMA 3T12A 5B3JA 1SXQA 4MK4A 1FDVA 1FXWF 1VIDA 4GPBA 2OZKA 4FOLA 1I13A 4M9CA 4RVHA 2QTTA 5DO9A 5G0TA 3JYNA 4LSWA 2NPFA 1FEZA 3GT7A 4RSHA 1XMXA 1XTKA 2HXYA 4E1BA 1USVA 1GRQA 5BSHA 3DMHA 2HDWA 4JODA 2IX3A 3TBFA 1XJ5A 2VWQA 4IX9A 2GBLA 3QVGA 4X8HA 4JBGA 4X00A 2DT5A 1YQWA 3H9BA 3RRZA 3MAJA 2XIJA 5E2BA 3ROKA 2XA9A 3VRHA 4IQ8A 1JEQB 3AUAA 5IC4A 3ET5A 4LJ9A 3AHDA 3LFUA 1MC8A 1Q0RA 1W73A 3CW8X 3JQQA 4S1WA 2II6A 4CODB 4P22A 1OFUX 4L73A 4YR7A 5ICEA 1DLJA 3CVOA 3QXXA 2FR8A 2O48X 4C4PA 5F2OA 4E70A 1FCJA 1COZA 3ZY3A 1Y8CA 5F9HA 4L5BA 3PJRA 2J4CA 1JQBA 1ADJA 4KHZA 4X6UA 1KY5A 5K20A 4EA9A 4GRDA 1GL9B 2R87A 3ENZA 1F9EA 4HTAA 1QPBA 4UARA 5K0TA 1OFHA 1Z6QA 3QKIA 4D98A 3RREA 2YHUA 3V8EA 4U9IS 3I5XA 2H1VA 4RF5A 4RBNA 4UVGA 4BX9A 4YCBA 2QNIA 1Z6TA 4O4HF 4EJ2A 5LLTA 1ZU4A 4Y2PA 2CHGA 2ERYA 4JVOA 1R6AA 3LWBA 3U17A 5BQ5A 1KK3A 1CF4A 1AHIA 1U0NA 4FBMA 1DKLA 2ASVA 4H08A 3EWAA 1QX3A 4UPVA 4K8OA 5ALUA 2X8JA 5G3ZA 1PUXA 4HDQB 4L2IA 4BYMA 1M2EA 4LY0A 4S1VA 1UBOS 3VKUA 5LD2B 4MPPA 4EUSA 2OM6A 1QHHA 4XWKA 4I55F 4NCHA 3W3AD 2ADFA 2ODEA 4GF5A 4R68A 2P6MA 2H3EA 1UUFA 3RWOA 2B83A 2D2XA 1PZHA 2FN7A 3PFBA 6REQB 1CG6A 1H2RS 1UMKA 3OAAA 2Y1FA 3NHFA 2AG1A 1E1LA 1UFOA 2PLWA 3HI6A 3HRIA 4W5QA 3KU4A 1TTTA 1LZLA 2NT4A 2VBCA 2E4VA 4TRMA 1VKHA 3BDVA 2E5FA 2LE0A 4UDNA 1F9AA 5KNDH 4D8YA 4BV2A 3W6PA 4TVSA 1QVVA 4CTKA 1KRWA 2C4HA 3PPVA 3JZAA 1L5RA 2C4TA 4RY2A 1EDDA 3VYWA 1ZN8A 4LY9A 4EX7A 1VDZA 1XA0A 3IP9A 3A4IA 4Z9YA 4K6KA 2QRUA 3WK7A 2C00A 3U4CA 5KWSA 3C45A 5DTRA 3T3NA 2BM8A 2RAFA 4NSNA 3BAZA 5AVZA 5AKXA 2HC9A 1ZRNA 2F3PA 1H9BA 2KS6A 4CMGA 1DEAA 2XKJE 1PNVA 1OXTA 2V58A 1L3BA 4X7BA 3TIXB 1WW2A 3TXYA 1G20B 1MO4A 1DINA 1E69A 1GGJA 3F46A 3KPWA 1JSRA 2JGNA 1D2RA 1CDZA 2DR0A 4MVJH 4ZVRA 5EIXA 4O3MA 1JBKA 1HE2A 2I7XA 4CI9A 2LV8A 2QNBA 1EU1A 3O74A 4P4UA 1OI4A 1QGYA 2ZJOA 3QOYA 2XXAB 3EBLA 5BNIA 4JLAA 4FVTA 1RSZA 2HIAA 1N3BA 2HH9A 5FOQA 4B87A 1OWLA 4PV7A 1ZGJA 4WZAE 2F1HA 3HL0A 4C07A 3FBWA 1PJSA 3L7BA 4R2JA 2FTKE 2VQ6A 2EDCA 2Y99A 4W7SA 3UH0A 2F17A 4CE6A 5CDUA 4C2TA 5FWAA 2YV3A 4QXMA 3IQDB 3GJZA 1LK0A 2HRDA 2PHZA 1SCDA 4IF4A 3HYLA 2N75A 5FLYA 5HKKA 3BSYA 4BIMA 3X3HA 5HF9A 4AC9A 1UKVY 3U81A 1E1DA 2Q3LA 3P0FA 5DHSA 1MC5A 1FYFA 1QAQA 5FAXA 1HKHA 1QRUA 2DMRA 2FEMA 3TNFA 4QVIA 2V7TA 4K1LA 1Y8RA 1SEVA 1JSZA 2DQYA 3NRJA 1JMKC 4YUZA 4QUBA 1YFJA 4M7RA 2FSSA 5F51A 3W3AH 4DW8A 1YJCA 4UUPA 4O1MA 4DYVA 3PQEA 1MIOB 4DV2B 5CLLA 1TI7A 3MB5A 3H1FA 4JMPA 4MKHA 2YNMC 4NAHA 4O2BA 2YZKA 1U9YA 5J47A 4TTVA 2GFIA 2H7VA 2CNOA 1A9TA 2RJOA 1N5KA 5CNJA 1T9BA 3ZDFA 1WMAA 3KOXA 1FZTA 1JFLA 1I51A 4MUFA 1P5JA 1JHPA 1DBRA 3AZQA 1TO1E 2Q3DA 3PLRA 4JIMA 5FI3A 4YRPA 3DMPA 3SJZA 4E46A 5FEMA 2XE6A 4K9OA 4RVFA 3I01A 1FUEA 3KJZA 3EDRA 5CFNA 2MYUA 1F8FA 3L0SA 1Y3CE 2NUPB 2ZRPA 1E3MA 2PCLA 3ZWMA 3SBEA 2R9VA 4LYYA 1H5NA 2H52A 1T6BY 2NTYC 2VJYA 1YMUA 3FVQA 3HS3A 4LKOA 4IJWA 4L16A 1LD3A 1I2DA 5FHQA 3ZVMA 1ISSA 3V8RA 1M2HA 2ODQA 1D5CA 3DTNA 1CEYA 1OCEA 4PO8A 3UNXA 8ATCA 2AN9A 5JXGA 1EB9A 1JB9A 2XT0A 5HJ2A 1WXWA 1V0JA 3DDNA 4G26A 1IPHA 4JLKA 1U81A 2Q5LA 2DETA 4RC9A 2R6HA 2VHJA 1WCV1 4WSOA 5LB2A 3RS9A 5ALRA 3T95A 5E38A 3RS8A 3IQHX 1GNRA 1KBOA 3IVXA 2X76A 4Q12A 3EGDA 2P2NA 1Q0HA 2CLFB 3K09C 1Z5UA 3ROEA 3S7TA 4UVEA 2D00A 4PZLA 3ZK7A 1NQWA 3VPHA 4N0QA 4A1FA 1VQ1A 4EFMA 4GR5A 4MVJG 3LOUA 2AW5A 3M6AA 5CFLA 1ONSA 5TJHA 2LPMA 1U6KA 3O8NA 1Q1NA 2Z2KA 2NYAA 1MQAA 3I9JA 3QF4B 1RRKA 4W5WA 1GYPA 3E7DA 2G9VA 3FETA 1F06A 3ZE9A 1Y1QA 1YB4A 4TV9F 3WK5A 4TVKA 2ACKA 3CNBA 3RHFA 4D0NA 1PDWA 1XCJA 3MUNA 3C41J 4PXYA 4TLEA 5T4HA 3Q5EA 5JJKA 4R4JA 1J97A 2P6PA 4F2WA 3RIYA 2QNRA 1W2WB 1CUWA 2IEAA 3HY6A 4EB8A 1L5FA 4CV3A 2XF8A 3CZPA 4LI3X 5B7GA 4D9FA 2A58A 2IE0A 5ALFA 5M29A 2C54A 1M2OB 2AOVA 4JUBA 4KPUB 4L27A 4Y67A 3CE9A 4L22A 1FNCA 4GSLA 1IHXA 2JFHA 3BBPA 1AF4A 1VG8A 4XM1A 1KEZA 3WNVA 2WIKA 3R3SA 3PQ8A 4PXAA 3BEDA 1XP8A 2BSXA 1KMCA 3O03A 3AZOA 1K8XB 2PMDA 1RS0A 3UGQA 1DRKA 2G28A 4WKNA 1SBIA 5B58C 5JI3E 5J43A 5K09A 3EGWA 4LRSB 4JCOA 2EFHB 3T54A 4RULA 5EKTA 1ZUHA 3RIXA 1AUOA 5JMTA 1WHSA 3IO5A 1IUOA 2BGGA 3VZBA 2YICA 2IXTA 3PVZA 4F7WA 2FUKA 1VB5A 2ZBUA 5C1OA 4MMYB 2BPOA 3T15A 4LZNA 4FU0A 1ORHA 4HDNA 4KRGA 4ONEA 4AUKA 3RUFA 4P7JA 5A3SA 1AKRA 2A9KA 2HCJB 1BVHA 3GH3A 2WZCA 4L5JA 4F3CA 3DE3X 5AOCA 1PVDA 3L5KA 4BPRA 4NZYA 1CXZA 4ZTBA 5L9AA 3L18A 4YJGA 3U1VA 3ZG6A 4RY8A 3NIBA 1BW9B 1QFJA 3GROA 3HA5A 3L0OA 3HNPA 5EIWA 3DT9A 1NR1A 4NBSA 2OD9A 1E99A 1L7XA 2XZPA 3QXJA 2ZPUA 2J46A 3CRRA 1HLFA 1M72A 2Q5OA 3FTNA 3H5LA 5AP9A 1JGTA 1QCZA 4MDHA 5KYTA 1GV1A 3SK0A 3VHLB 4LIPD 3GLFA 3O6VA 1FVFA 3PDHA 5DTEA 3R9KA 3ABSB 1EUCA 2EYUA 4R31A 4OP1A 4DCJA 3SHOA 3QPCA 2RHGB 2FK8A 1XK7A 1XJQA 4M7WA 4OD0A 1PK7A 2XVYA 4RCVA 3GEBA 3F4KA 4R41A 3VHXB 1AN9A 3Q3VA 2ANCA 3DUWA 3H0KA 1CQIA 2HQOA 2I8LA 3IEPA 1K89A 2E4XA 2ZRFA 4NZMA 4BGVA 5REQA 3BJIC 1DX4A 1PL0A 4LWPA 2M6KA 2ZDGA 2IYRA 2VA9A 2BE9A 3CMMA 4WQMA 5DNVA 5DNEA 2ZRIA 4HI0E 2K6GA 4ZCPA 1PEDA 2SCUA 3AWDA 3IAS1 3OEHD 4LRWA 5LYJF 4BXOB 4R2XA 4CT5A 4XWTA 2NVUB 2WMDA 2AS0A 4Z0NA 2KWIA 2PH1A 4HXFB 1WLSA 3FWHA 4G07A 5F1KA 2IV2X 3WXBA 5JDCC 5FB3A 3UHJA 1KP9A 4TXJA 5HR5A 2I1WA 3G8DA 4QBTA 1G60A 2DSTA 1W0KA 5KYYB 1IFXA 1EE2A 5EJMA 1TUEA 3ABIA 1JW9B 3DOHA 1YAJA 4L8GA 1FRVA 4RH3A 4LZAA 2IHJA 4R71A 3MT9A 1CC1S 1A27A 2ZW9A 2X40A 3WE7A 3SR0A 2Q9UA 5K8UA 1BDIA 2Y2UA 3K31A 4EHAA 3QUSA 1QX4A 4MR9A 2MR6A 4P4SB 1V4NA 3IELA 3EFOB 1U1EA 4AY5A 2Z56A 1LSOA 1H4QA 5TPWA 1DHRA 1HA3A 3LX5A 3Q1LA 4I4NA 1ULTA 1XWIA 4ESEA 1T2CA 2VPZA 5JECA 4IV8A 2CVZA 2CLOB 1GN9A 4BASA 5KC8A 2QMEA 1XD9A 5EJ2A 4DLVA 2VTBA 4P4TA 4E07A 1D9ZA 3ME5A 1B6RA 2PQ0A 2NSJA 4UAVA 2TMGA 2IYPA 4X84A 3IAS6 1KDVA 1G2OA 1SKUA 4HSGA 1MXHA 4NBWA 4C2BA 4OU5A 3DE0X 3ONDA 4RK1A 1YU6A 5DT2A 1YMVA 3L7NA 2QAJA 4C14A 3TAXA 4JUDX 3HDHA 1CY2A 1ZM9A 2ECOA 1P9NA 1K6JA 1T1SA 1RXCA 1XN1A 2JPDA 2QMUA 2BIFA 1BRTA 5F1OA 1YHNA 1KFJB 5EL0A 2ZB4A 2CXSA 1AZWA 1O96A 1XZCA 4DNXA 2C2KA 1KBZA 3BWBA 3TD9A 3CR7A 3K73O 3O94A 4M9QA 3V7FA 4JI0B 1PJAA 4K9KA 5B1IA 3PKZA 2H4JA 5F7JA 4OA5A 5BSVA 2D7CA 4NJMA 3EGXB 1F8XA 3BG5A 1C14A 3LX6A 5B64A 3DLCA 1XCBA 1II8B 2XWBF 5IAAA 4LZLA 2JAUA 4MW1A 1WB9A 3T3DA 3LOQA 4ZJZA 4J2OA 4AZ0B 1ZD5A 2QWXA 2FZ5A 2GN0A 5DB4A 1XRRA 2JFPA 3IMGA 1E9DA 3PE3A 2FPRA 2VNAA 3Q87B 2V0CA 4IIEA 4YY3B 4YN3A 4A8JB 5I4KA 4HH3C 2C7VA 3OESA 4BLUA 4MAAA 4YMTA 3EYAA 1X1CA 4Y2SA 1U4SA 1ZK1A 1E20A 3ZHXA 3ED5A 5CYOA 4D4KA 2FWJA 3RVOA 2NSLA 2Q1XA 4ALMA 3KQLA 2Z3WA 1FJHA 1S3IA 3KWFA 3CZ9A 2NXNA 2X2EA 2JGRA 2BJHA 3CUYA 3WLOA 4ESVA 1Z17A 4CR8A 5M7EA 2KHZA 3RKRA 1FDOA 1NVTA 3ORFA 3QV2A 2MYTA 3PNMA 4PAWA 3H2YA 5GINE 2AKEA 2Y66A 1A1SA 1IM8A 2JHAA 1GXSA 3Q72A 2E2WA 4L9AA 2PKEA 3PHCA 3HJFA 1T4GA 3FGPA 2LCIA 3TPFA 4BP8A 3RRBA 3OQMA 1CERA 3HLTA 4DDUA 2RH5A 1QTNA 5HILA 3ZKWA 3H97A 3W6OA 3H9JA 1YHYA 3I2IA 5AR1A 3V7NA 4BVEA 3GV0A 4O29A 4BRSA 2Q4OA 2XE7A 2GYYA 3AI1A 3TD2A 4AYWA 1PQWA 2QSYA 2VR1A 2O8NA 3JPYA 1UM9A 2X5OA 2VNKA 4OYHA 1NW5A 3CWCA 2GUWA 4HDSB 1UZMA 4YJFA 4IYJA 5TRTA 5C5IA 3LKVA 4L07A 3SQOA 4MI6A 1TT5A 3C4JA 4K2HA 2FRXA 3FX2A 1P0IA 1FYWA 1WZUA 2J4FA 4I66A 4U7TB 2GAAA 2OYRA 1Z2NX 3V4RA 3H2HA 3N6VA 3EGCA 3INRA 3O92A 3NT5A 4ZT2A 3GRRA 1IYZA 4LW8A 1PGOA 1WTAA 3QXGA 4HMQA 3T7JA 2JHPA 3GJ5A 3H5AA 4XXHA 2W93A 5AM0A 1A9QA 1ZH6A 2WG2A 4GOLD 3WNBA 3R0IA 3T7EA 3I6ZA 3WTCA 4EW3A 3W8NA 3BCRA 3VOTA 4X60A 1WKBA 3PITA 1N7IA 1MX9A 2VP5A 3N9IA 2BHSA 4TS3A 2UZ0A 3O1LA 1JSCA 5ISMA 3OWOA 5EAIA 2PGLA 5BOSB 4NPHA 3ZLTA 5LP6F 5F3DA 3VTZA 1EUQA 4MGHA 3MINA 2YWCA 4DARA 5EKDA 2BFFB 4GS5A 5BV1A 3QLTA 3ND5A 3FRIA 2IYQA 4I3FA 4HX5A 1TMKA 2AXNA 4WEOA 1PF7E 3SSOA 1EH5A 4QLBA 3V4OA 5FPYA 2DUNA 1QIDA 2XCLA 2Y3IA 3B78A 2FW9A 3FNEA 1MTZA 4XTCS 4ZEMA 2YYAA 3R6GA 5H02A 1X1BA 2GD2A 3LUAA 5ES4B 4L8WB 4XI9A 5AKHA 2G1KA 2CJWB 2IIQA 1T26A 4UBOA 2F3UA 5E4YA 1Q22A 1BH6A 4W1PA 3DWFA 3ZOKA 3IJ5A 3ANLA 4I1PA 3OTHA 1J49A 5JS2A 3KT6A 2I7TA 4Y7DA 1PI3A 3OQNA 1PEYA 2OCGA 2WHEA 3L0BA 5BQXA 3T3IA 2WU1A 3B8EA 4KQ1A 5CT5A 2I3DA 3RFXA 1NXXA 1SKMA 5LSAA 2H5EA 2VHQA 1L7NA 4R5MA 4HLUA 2ORYA 3B6IA 3G7SA 2W00A 4GI7A 4ES6A 3UT0A 2CZQA 4W9NC 4QTUB 1XWWA 3ULKA 4F60A 3IQGX 3AB7A 4Q00A 1CB7A 4U3JB 1GA4A 4L95C 5TGTA 2Z8XA 5JT1A 1AV6A 3WIEA 3AHCA 4L85A 4HPJB 4MB6A 3I8OA 3QFTA 2R85A 3VA7A 1TPZA 2R1ZA 4J0GA 2IXEA 4G3XA 3PPXA 1Z12A 2ACVA 3P7MA 3FIUA 5IBRA 3OM0A 2AFVA 2BHLA 2CVPA 4X1YA 4H7FA 2WSSD 5JCOA 1RQNA 3VAZA 4ADSG 3ZQJA 4BJ1A 2WFMA 2QSZA 5U9CA 3CCBA 3DT6A 4DIMA 3RARA 3TDKA 1ZZGA 1VA4A 5I6DA 1T8RA 3DZIA 3LGAA 2H48A 4X1OA 2UUBB 4WFJA 1ISIA 4DJJA 1N9ZA 1QG4A 2NN3C 1W46A 2OWEA 3KUKA 4TMVA 4XIYA 5IT5A 3WMWA 3I04A 1H2FA 1P4SA 3KCNA 1R5JA 4NC9A 4WBXC 3R74A 3EBOA 1TUBA 4AB1A 1IBMB 1FFYA 1XDZA 3PD0A 16PKA 1DLIA 3I1IA 5CA1F 1GGMA 3K1TA 4BKQA 3DAFA 1YZQA 3ELDA 4D82A 4KK4A 3O93A 3IUNA 4OFBA 5K9ZA 1D6MA 1OSNA 1S1MA 3HR4A 3OCZA 3SIXA 3VJLA 2XJ9A 2ZKIA 5LR6A 1G7TA 2ONZA 4Q9KA 4IJ5A 1KTIA 2W37A 2BEVA 2VJKA 1QB8A 4ZI2A 1LKZA 6GPBA 3FHTA 2QVGA 3NUQA 3VR4D 5JC8A 5CB4A 1OU4A 1RWQA 2W2QA 1R6XA 3GCWA 3K9QO 2ZRDA 2VK8A 4L4SA 4F38A 4AD8A 1WL8A 1JB1A 1MO3A 1UH5A 1J4AA 2PTGA 2XODA 1ACLA 2DH5A 4KTTE 2RAVA 3QXSA 2AMYA 3EHDA 5ENDA 2QTVB 4K0RA 3DE5X 4JVNA 5DGXA 4URXR 3AERA 1J23A 3RASA 2D0IA 3MHPA 3EGOA 4M49A 4MRAA 1OGIA 2EIHA 4XCVA 1MFPA 4DLUA 3WYGA 1I30A 5B3AA 5K3FB 5E9AA 7AT1A 5AVRA 1E1QD 1JQ5A 1RQ7A 2HDNB 3QYPA 3DDCA 4WD3A 3PC8C 3FYHA 4MJLA 2GN1A 3EA5A 4PSVA 2W71A 4QOIA 5GP1A 1XHFA 4B9AA 1WZIA 3B3GA 1WMSA 4V1CI 2X19A 1O08A 2EBHX 4JR0A 1EJBA 2P9FA 5BNFA 3QRWA 3LF1A 4DIBA 4DTIA 1XRMA 1MHTA 2PYIA 4XX0B 4C05A 3MOSA 4D5GA 1DV2A 3ON5A 3ZBUA 1NVVR 1U8XX 1Z74A 1VL8A 2PZ8A 3M83A 4HDMB 1SD2A 2FGJA 1XV5A 3JWJA 4IH1A 4AUEA 2ZWIA 4DMFA 4C0KA 2WMYA 4YRBA 1PN3A 1QNFA 5CG1A 2NZ2A 1MA3A 3X43A 1KJNA 3KT3A 2OHFA 3AFIA 3KETA 1XNQB 1QTIA 2PSFA 4M9SA 5IMBA 2WZDA 3NHMA 4MGIR 5TT1A 3KTAA 5FOTA 5E4TA 3GGCA 2ATVA 2QM7A 1SMKA 2P1ZA 2YYZA 4V3BA 4BO5A 2GPBA 3AJEA 4AURA 1IG0A 1PIWA 3NVDA 1WZ2A 3EPHA 1E62A 1X74A 3UK7A 4A0QA 1E1CA 1ODCA 1RRGA 2CL6X 3OKCA 2DJ5A 3AHIA 3HZRA 3WY9A 1SB8A 1GNTA 2Z58A 2BGJA 2O7SA 2B0JA 3OY2A 3GJ0A 4XH9B 4ZU6X 1DC4A 5TGDA 1CIPA 3MJRA 2X0RA 4GEGA 3JASB 1S7GA 4PONA 4RTKA 2VF2A 3VTFA 1I6MA 4UTRA 4RQAA 1KVRA 1IHUA 2ORVA 4KAAA 4W1SA 1U7PA 4YTEA 1VBMA 4B2IA 4FFPA 3WLNA 1DZIA 2OK7A 2W4QA 4M9ZA 2XUOA 3IOBA 4BB0A 3WGIA 4FZJA 3AUJB 2G77B 3I6QA 3ESBA 1XA3A 2HNAA 4RJ2A 1Y4DE 3D31A 2OBBA 2YFKA 1M0TA 3OT5A 3PHHA 1A5SB 4ISBA 4K9MA 1H42A 1PEKE 1YFKA 3RGGA 5I01A 3RFFA 4PWYA 4BO2A 4E1AA 2GPYA 2IDZA 1WV1A 1J0BA 2WZQA 3CH4B 4GBGA 2X9LA 3UJCA 2JEZA 5HS6A 4D5EA 5C46F 5IH7A 4LRQA 2VNIA 4FDMA 4ZV9A 1T9CA 3ET4A 2PUDA 3MB8A 1SUDA 1DMSA 1XRNA 4GH5A 1KJIA 4RV9A 2AV6A 4ARVA 4BP3A 1GPDG 3UKDA 5HZGA 4J0QA 1OJ7A 4R8MA 3EZXA 3R8XA 2O14A 2JLQA 3S2FA 3A3NA 4RKFA 4UUQA 1N2CE 1XPOA 5CNKA 3D4PA 3AUUA 3OQIA 2OZLB 1UZNA 3CF0A 4RJKA 4YI3A 4MJ3A 2W22A 4DF3A 3H4VA 2B94A 1UDWA 3K0FB 1CZRA 3HVIA 5FP0A 3WWPA 2IHVA 2GCPA 1JDPA 1OZHA 4RPKA 1EGHA 3ACDA 2FUCA 3MOIA 5BOSA 1CS0A 3C6BA 4MW4A 3GMTA 2X9QA 1N5DA 1DQRA 4ZVPA 4IGAA 1VCIA 3RYCB 2J6IA 5EIBD 4E4TA 3A3YA 5DMHA 1FYDA 1P91A 1GCAA 1Y63A 2RCYA 1HLGA 4QYWA 2Y0BA 5DVZA 5F78A 3T0FA 4A3SA 2WWRA 2WYIA 2CGEA 3O2JA 3QKWA 4I7EA 4PZCA 1RTTA 1AZTA 5LUBA 4A8HA 4PZUA 1PS9A 4BDTA 1C5KA 3L7IA 3OIWA 5L7YA 2IS1A 1GPWB 4IS2A 2AJCA 2Q7DA 3ETDA 3ZCRA 3F7OA 4TQGA 3BGIA 2GKGA 3BL8A 1JQAA 3PJEA 1NRJB 4JFAA 5LYYA 4ER0A 2F3SA 3ZCVA 5BSGA 2EJTA 2JHFA 2J41A 2JGLA 2UV8A 3U2QA 4DCUA 2JJ2D 3OOSA 4FHZA 1NF8A 2WNSA 4D9HA 3D8UA 2B25A 1MB0A 1MVNA 3RSGA 7ABPA 1LWNA 1W85B 4A8PA 1EWRA 1D0SA 3ESYA 3UJPA 2O2JA 4URYR 2C3PA 3QX3A 2YJ5A 3OBIA 5TJ9A 2C96A 1XCPA 2NZVG 2YBDA 1GY8A 2Z83A 3ILHA 3ITKA 1Z56C 4IJQA 2IUSA 2VXCA 2ZE5A 2R7KA 3ZE8A 4OHZA 4OEHA 4EI8A 4GKKB 1E5TA 2G7ZA 3IQIX 4OCZA 5EJFA 1AC5A 1EE9A 5FO1A 4GX2A 4B2PA 4ZYLA 1CQWA 2C31A 1L1RA 4IMIB 5K3AA 2O3SA 4QC2A 4A5SA 3V4VB 3W77A 3IAAA 3A05A 2GZDA 4IFBA 3IAM1 3UPTA 5G0WA 1I7LA 3TZEA 5K45A 2ZITA 3I5AA 4PR0A 2AEEA 1QO0A 1PJ8A 2FWPA 3P9SA 1QQ6A 1PJQA 1VSBA 2P2ZA 3EIEA 3PPYA 3O8OA 4Y0VA 2NUTA 3KLOA 2AQKA 4DWVA 3DHWC 3WWEA 2VS1A 3B70A 1ZEMA 2Z8YM 2XF2A 3NHLA 5TMDA 1WO8A 3BSWA 3CSUA 4HBGA 2WY2D 3DNPA 3TM4A 5B1SA 1PFYA 1L4GA 3C6ZA 5GOTA 2JIZA 4RABA 5F4ZA 2NZUG 3K0AB 1VJRA 2QPAA 3GAFA 4IDCA 1AUQA 1K9SA 1LDMA 2GJ9A 5GONF 4E5DA 2YWDA 3JARB 1TU3A 2P5TB 1YRBA 1SVWA 3JQCA 4H16A 1DI0A 4IIGA 1I5OA 3ZNNA 3ZV4A 1IZ9A 3A2NA 3VPCA 5E8RA 3KIPA 3DBLA 2WHXA 3QZUA 3ZS8A 4HFJA 3A11A 3T3EA 4FLFA 2QRMA 1NN0A 1FW8A 2QQFA 2WUDA 4N4AA 4PFJA 4R40A 5IDWA 1SA0B 4OREX 4L02A 3WMEA 4CKBB 1ZBDA 2EBUA 3GVPA 4OHXA 1ZGBA 3NKFA 4RLSA 5FYDA 2HAEA 3TOXA 3GY0A 4ZOAA 4R5HA 5CA0A 3VR5D 1TJ4A 3NB0A 2P30A 4BFCA 3MCUA 4N8SA 4P80A 5DF1A 1CUDA 2VATA 4L6IA 1A82A 3WZ2A 4G4GA 2F1RA 4KQKA 3SLKA 2ZKLA 2GXUA 3SEAA 5AKYA 4E3ZA 1RJ9A 4UUMA 4PFSA 2FN3A 3VH2A 1Q92A 1B7GO 4OH7A 3THYB 3M6IA 4WESA 5FR1A 1ZBQA 1Y9ZA 1CE8B 2G08A 3ADOA 4AM8A 4Q4JA 1BU5A 1CUFA 2QGFA 1CR6A 1V5WA 3V46A 3EFOA 1NJSA 3KBOA 4LF9B 3IUYA 1RHMA 3S2YA 5LP6C 2DFLA 4KWIA 4JY7A 1WOMA 3M49A 2XCSB 1ZH2A 1GCUA 2OHVA 2QMOA 3N5CA 2GCOB 1SD1A 3Q7TA 4R54A 4YQZA 2CYCA 1N9GB 5ILQA 5IK2A 5A7HA 7REQA 4Q24A 3OE7D 4DXHA 5HOQA 4DR6B 2V55B 5LP6B 5LKAA 4ZQGA 2I22A 3DMYA 1LTKA 2OLJA 3Q9UA 4O0MA 1A7KA 1ODKA 5HMMA 1YJ5A 2ZP1A 4KREA 1UT6A 3RV3A 4EEXA 3W8FA 2VUHB 5JAPA 2H17A 4EL0A 1OILA 2GETA 2UYGA 3KYDB 5HK8A 1JECA 1UJ4A 3LSTA 4Z8XA 2GBFA 1R4NB 1GGVA 4RLHA 5KNBD 1GGHA 2XYQA 3HWSA 3DL0A 2MHCA 2NM0A 3D6TB 2WRZA 2KSQA 4ZRMA 2RARA 1TO6A 2RCNA 3PDJA 4ITRC 4M1KA 4KYTA 3TPCA 3LUHA 6NULA 4X5OA 3A6HA 1AGPA 1UAYA 1QGAA 3P9RA 1ZNWA 4M1YA 3I05A 1MAHA 3SF8B 5D5HA 1CQIB 4LXXA 1EE1A 4YRRA 2DOKA 2CXPA 1O95C 5BW8A 1CHNA 3NGMA 5E0OA 3TAUA 3NTQA 3RS2A 3VH1A 4BE9A 1BMFD 1REQA 4ZFNA 3WB9A 3UY4A 4A0RA 4AMBA 2XITA 1WCIB 5KPDA 2TMYA 1TPYA 1I9GA 5CK4A 3OJCA 1I1OA 3A26A 1PSZA 3HP4A 3PFGA 5CPBA 4CYMA 4BNYA 1U8UA 1UJ6A 1LGYA 1JEYB 2QTWB 4UPEA 1MV8A 3QBDA 1HF3A 3ESCA 1E9EA 4F8EA 3UJNA 1O95D 1SVUA 4IL5A 3WLTA 4LVOA 5J4HA 3IKTA 1EEHA 4EY5A 1Q0UA 3T5AA 3HN2A 1VMDA 3JQ7B 3SP1A 2P0YA 2F64A 1Z2EA 2NMVA 2VXYA 1FU8A 3DZGA 2OCIA 2OOKA 3HH8A 2UZ1B 3LUPA 3D3NA 3TKLA 1JKJB 4M21A 3W9UA 4BNWA 3AW8A 1I36A 3C4QA 3L8GA 5HWSA 2PX2A 4DIDA 1YJ8A 1YFLA 4YMWA 5KSZA 1PQPA 4UM7A 4LV8B 2IZ6A 4I1RA 4ZKDA 4UQOA 3FWKA 1KF0A 2ZRHA 3MJSA 5G0VA 3S1LA 1U8YA 1RRCA 4LJRA 4EK9A 1XZFA 1ZJ5A 1PR0A 1VB3A 1ENYA 2WTBA 2X1MA 4JYZA 3FCCA 4QYTA 4QBHA 4C6SA 3EG9B 3K53A 4R7ZA 1D2MA 5SY9A 1EGMB 1GZ6A 1LY1A 1P6UA 3RVMA 1UL1X 3LE8A 5LA6F 5IC5A 1RAIA 3F8TA 1KEVA 1NBEA 1UEIA 2B30A 5K03A 4NS4A 4OI1A 4IVRA 3UCEA 1BJKA 2GD6A 4CKZA 3Q7PA 4WNYA 5D1NA 1IQUA 2ZIGA 5JWRA 4HADA 3BBLA 4COKA 1DG1G 4GQIA 3WYNA 2F8MA 2QJRA 1E3SA 3VDRA 5A2GA 1VJ0A 4OXKA 2DPYA 4S05A 4QTXA 2IUYA 2O52A 4AQ7A 1YTLA 3U7HB 4O4LF 2O0KA 5F35A 4ZI7F 4D8WA 2AQ8A 1WZCA 4D0GA