2FLWA

Crystal structure of mg2+ and bef3- ound chey in complex with chez 200-214 solved from a f432 crystal grown in hepes (ph 7.5)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELLKTIRADSAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Chemotaxis protein cheY
publication title Crystal Structures of Beryllium Fluoride-free and Beryllium Fluoride-bound CheY in Complex with the Conserved C-terminal Peptide of CheZ Reveal Dual Binding Modes Specific to CheY Conformation.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 45
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2flwA00
4Z4FA 1VRVA 3BILA 4MRMA 1AB5A 4TN5A 3A10A 1JX6A 2QV0A 4PZ0A 2MSKA 2OENG 3JPYA 5CHYA 2MYUA 2NUBA 2P4UA 1M2EA 4LZLA 4N76A 3MM4A 1RPJA 2B4AA 3CTPA 2HQOA 1NXOA 2QSJA 2MSLA 3LUHA 3QEMB 4RDCA 4G86A 4MS4A 1E6LA 4IMIB 4ZPJA 3HM9A 3LUKA 1MAVA 2JK1A 4W5NA 3OO0A 4P1ZA 3C3WA 1A04A 3EODA 5IUNC 3GRCA 3N0WA 3CKMA 3F6PA 2PL1A 4RS3A 1DJMA 2W42A 3H5OA 5KC9A 4OG2A 2FW0A 2I6FA 4H60A 4RXUA 5EWMB 2PUBA 3UKJA 4LRQA 4MR9B 1SXIA 3HUTA 4Z4GA 1VKRA 1JF8A 5D2CA 1AB6A 5C5CA 3NBMA 1NATA 2HSGA 1L5ZA 1TLFA 3QLVA 2E4XA 3QLUC 4D74A 1P8AA 5KQGA 4ML3A 3HSYA 1RZRD 4KQ9A 6ABPA 1YS6A 1ZESA 3KYJB 4MS3B 4NQRA 4XAQA 3QEMA 4MQFB 2H0AA 3BRQA 2R48A 3CG0A 4MLDA 2IKSA 4EYOA 4FE4A 3OM0A 1ABFA 4Z4CA 4KK4A 3H6HA 4UHKA 4KK3A 3JTEA 3Q7TA 3CHYA 4EYKA 1JYEA 5HM6A 3Q15C 4W5QA 5GOTA 4YCSA 4L4UA 2VUIB 1C0EA 4QYMA 3RVKA 4KMRA 5EWMA 3H5IA 4RK4A 4MR9A 5FBKA 1TVMA 2QU7A 4G0ZA 3EQZA 2GKGA 4XARA 2VK2A 2AYZA 4KQCA 5KWSA 4MS3A 1CYEA 2JVJA 3C97A 5I4CA 4CBVA 1NXVA 3OLYA 3FGZA 4MQFA 3QK7A 3OQOA 3HCWA 5DGCA 1YMVA 3CFYA 2FLKA 4Z9BA 3RVMA 4Z4EA 2MYTA 2QZJA 5IUJC 5FBHA 1Z13A 2QVCA 4EYQA 1M5TA 2FQXA 3N8IA 3E61A 3UK0A 2HJ9A 3R0JA 1USKA 4ZYLA 2PUAA 8ABPA 1CHNA 1LK0A 3I45A 3KSMA 2E4VA 4FE7A 1ZITA 1S8NA 3IDOA 3H5VA 4FB4A 1KMIY 3MF4A 2E4UA 2IDMA 5BR1A 3SY8A 4Q6BA 4RK6A 5JNUA 1PEYA 4NV3A 5KI6A 5KC8A 1BDJA 4PYRA 3IPCA 1RNLA 2R25B 1A2OA 3I09A 4MPTA 1P6QA 2VUHB 2PUEA 3TO5A 3IP6A 1J56A 2KYRA 1XHEA 1ZGZA 3K4HA 4WT7A 4EY3A 3FMVA 3EULA 3FFTA 5TPZA 4L85A 5CNMA 4KFCA 2IYNA 3IP7A 4E7PA 2J48A 4KREA 3C6QA 1GLGA 3O1JC 4MQEB 1Z15A 4TLMB 1QO0A 4RWEA 2FEPA 4IILA 2R47A 3HEBA 4JB0A 3BBLA 6CHYA 1ZHHA 3CS3A 1GCGA 3S99A 3QLUA 1K66A 3Q7RA 3RVNA 2IPAB 2PLNA 2X7XA 4XLTA 1JH9A 4MR7B 5B3JC 3EQ2A 3EDCA 3CG4A 5KQMA 5TQ0B 2RGYA 3DBIA 4MAAA 3H6GA 2MSWA 4QYWA 3T38A 1FFWA 2A9QA 1ZVVA 3A3KA 3OLXA 1H9CA 4GNRA 1C4WA 2XDYA 2RDMA 4F3TA 3CU5A 4NICA 7ABPA 3JVIA 4E7OA 1DCFA 3RVOA 3G85A 4MQEA 2M1ZA 3T8YA 1ZH2A 2CHFA 2FN8A 2MYNA 4DN6A 1E6MA 3D8UA 1U8TA 3JVDA 2E4ZA 3H75A 3O2JA 4TMYA 2PKXA 2NZVG 4KVFA 1NY5A 4MR7A 4WZZA 1IIBA 5TQ0A 5IULC 2N9UA 5F64A 1JFSA 2E4WA 1JDNA 1JFVA 3CZ5A 5JS2A 1P6UA 1DBPA 1NXXA 1U04A 3DZDA 1W9HA 4RK0A 3CNBA 5ED4A 1PNTA 3W9SA 1D4ZA 1ZY2A 4YV7A 4ZMSA 3TX6A 1I3CA 3GBPA 3ROFA 1LBIA 4ETMA 4YS6A 1EWKA 5TPZD 4D6XA 3CZCA 3OM1A 1GUBA 3M9WA 4WXEA 5TQ2B 3I5AA 4RY0A 4RY8A 1D2AA 1YS7A 3N0RA 5JNVA 2V0NA 1U2PA 2WRZA 2LUOA 2BGGA 3URMA 1B00A 2WB4A 2FN9A 1EAYA 2HQBA 5HQJA 3T6KA 4KV7A 4JAVC 4Z9AA 5BRJA 5TPWB 2TMYA 2IPMA 4MGEA 3LMKA 2CD7A 1JDPA 2H3HA 1PUXA 2FQWA 4KNYA 5JNSA 3QX8A 4G0PA 4N47A 2GI4A 3LUJA 3LUGA 4ZJPA 3EJWA 3MMNA 4JASB 4OBBA 3FFWA 2FEKA 1EHCA 2FKAA 3EGCA 4PEVA 1QQAA 1QNLA 2ZWMA 4KRFA 5TQ2A 4RY9A 3ILYA 3NNSA 2PUCA 4N0QA 1U2QA 1QQBA 3NHMA 3KKEA 1Z2EA 1YIOA 2NZUG 2PMCA 5TPWA 5E3JA 4N41A 5B3JA 2QXYA 4PICA 3SG0A 4N0PA 1F4VA 1JL3A 1ZH4A 2O20A 1ISSA 3IPAA 5CNIA 5IEJA 2JVKA 3O21A 3HUUA 1SD5A 1VPWA 2LIVA 3G1WA 3HV2A 2P9HA 1FQWA 2HQRA 2PL9A 2YHBA 1Z26A 5FWYB 9ABPA 1NXPA 3ILHA 3KS9A 3DLBA 3T95A 4RXMA 2LBPA 1P2FA 3LUFA 3ROTA 3QX9A 3H1GA 2ZAYA 1ISRA 4HNRA 1USIA 1JBEA 2FLWA 4RKRA 4ETNA 3LUAA 4H3HB 4Z4IA 1QP4A 1TM2A 3JY6A 1APBA 1UDRA 3MIZA 2HPHA 2VYCA 4O1IA 5BQ3A 3KLNA 2B1JA 2QW1A 3GA5A 1QP7A 1GUDA 4DQDA 2PE5A 3HS3A 1DC8A 3O1HB 1OXKB 2JVIA 1ABEA 3KTOA 4RK7A 1MIHA 2FQYA 5DLEA 1TJYA 3SNKA 4EVRA 1DRJA 1NXWA 3TB6A 3C3MA 4HYEA 3H5LA 1EWVA 2FSPA 1DBQA 1RXIA 3A0UA 3KLOA 5EWLB 3RH0A 4KPYA 3HK2A 1MB3A 3LKVA 5JS1A 4GPAA 5ABPA 2L17A 2L19A 5DKFA 5DCLA 2GX6A 2PAFA 3NHZA 4DADA 2WMYA 1A0OA 1KGSA 5CNJA 1MVOA 4MS1B 1JYFA 2E4YA 4XASA 2FMHA 3Q9SA 2FMFA 3OLZA 3O2SB 4W5TA 3CRNA 3EAFA 2F8SA 5IEBA 3N75A 1M2FA 3OO1A 5TQJA 3OLVA 5IUKC 4OTZA 2PUGA 1YTUA 3HO1A 5HKOA 4F8JA 2Q5CA 4MYRA 4B09A 4PE5B 4RKQA 1R8JA 3QEKA 3SM9A 2F8TA 1NXSA 1QMPA 4MR8B 3K9CA 3TMYA 4D6YA 2FTKE 2MYPA 5HSGA 2NT3A 4YGXB 3NNNA 2L18A 5CNKA 3MA0A 5EWLA 4N03A 4RU1A 4Q7EA 1DRKA 1YK1A 2CHEA 1Z16A 3SAJA 1FFSA 1E6KA 4MS1A 3KHTA 3RVLA 2M98A 1D1QA 1JWLA 3H1FA 2JBAB 2JRLA 4JB2A 1QPZA 1ZAYA 4XXHA 3VNBA 3C3KA 1DBWA 2ID7A 4IMJB 2LP4Y 4LX8A 1OXBB 2FEWB 4HNQA 3UUGA 1Z18A 2R4QA 4JA2A 3HVRA 5BRAA 4MR8A 1T34A 2JB9A 3RQIA 3DLHA 3F6CA 4LDZA 5IBQA 3KJXA 1SXHA 4Z99A 5JNRA 3L49A 5T3YA 2WY2D 5C5EA 4IF4A 1JLKA 1QO0D 3RVPA 4P98A 1EWTA 1NTRA 2AYXA 1L5YA 2JBAA 2YHAA 2WWVD 1PEAA 2IPLA 2QVGA 3RVRA 3BRSA 3H1EA 1PHRA 4EUKA 1DCKA 4O1HA 3RVJA 5IC5A 5EWJB 1BA2A 4UHJA 3HZHA 5GQSA 4F12A 5DTEA 1E2BA 4G0MA 4Q6WA 1DC7A 1U0SY 3HJFA 1D5WA 3SQNA 4EGSA 1Z17A 3N6VA 2PUDA 3GWGA 1FSPA 4G0OA 3TD9A 1EFAA 4RV5A 1Y1LA 1M5UA 3MQ4A 5KQPA 1KRWA 1QP0A 2GWRA 3LUCA 3LKBA 1BAPA 4LDAA 4EYGA 4W5OA 2PUFA 3O74A 1DCMA 3B2NA 4G0XA 4YWHA 3P9YA 2OQRA 2ID9A 1TMYA 3M9XA 3JS5A 4LE0A 1XHFA 2GBPA 3H5TA 4EVSA 3F73A 4JOQA 3IP9A 3VNAA 1XWWA 2RJOA 4YRZA 4YO7A 4IGAA 4G0QA 3MYYA 5EWJA 3GYBA 4HNSA 3RVSA 4YR7A 1Z2DA 1GCAA 3Q7SA 4OATA 4YP9A 4OLBA 1LJUA 1HEYA 4M88A 4S04A 3L6UA 4XFKA 4NCAA 2A9RA 1D1PA 3KCNA 3FDFA 4ETIA 2FXIA 1DG9A 2RJNA 1BDHA 4WWHA 1SXGA 4H3KB 3LOPA 3O75A 1ZDMA 4IRXA 4LE2A 1WETA 3HXMA 4Z4HA 1ZN2A 2FVYA 1Z25A 3LTEA 4WUTA 3GV0A 4RZSA 3KG2A 3QELB 4KZKA 1URPA 4EVQA 4RSMA 4F11A 3OMXA 3A0RB 3DGEC 3GT7A 3IP5A 4RK1A 4G0YA 4YLEA 1BVHA 5FWYA 3QLVC 1MB0A 1SRRA 2JCGA 3GBVA 3Q41A 1FFGA 3N0XA 5FWXB 1YK0A 1JHZA 1Z12A 5T7BA 4OLAA 3LUDA 4LE1A 2WJWA 3OQMA 3CLKA 2A9PA 1F51E 2L2QA 5JNWA 1KRXA 1YVUA 4ZMRA 1K68A 4WXMA 3OMWA 3KYIB 3QELA 1LBHA 2QR3A 3JPWA 3N53A 4Z0NA 1CEYA 4QICA 5KQLA 1VLZA 2CWDA 3I42A 3LFTA 3O1IC 3E3MA 1RZRA 1DZ3A 4RK5A 2FMKA 1BDIA 3M6MD 4MRMB 2NT4A 3NNDA 3F7NA 4QPJC 4RXTA 5IX8A 2PJUA 1USGA 1RXEA 5PNTA 5FWXA 1YMUA 1ZGGA 2DRIA 3HDVA 4JP1A 3OQNA 4S05A 2LPMA 5JNTA 4F06A 1PNRA 1W25A 4NCBA 2A9OA 4W5RA 3HDGA 4Y9TA 2FMIA 1JFTA 3BREA 1DP4A 1NXTA 1QKKA 3D02A 3O2QB 3GL9A 3OLWA 3DGFC 4MS4B 4MLCA 2WJAA 4O5AA 5TE9A 1LJLA 4TLLB 3QLTA 3FFXA 4G97A 3H5WA 2IOYA 2IPNA 3RVQA
chains in the Genus database with same CATH superfamily
2PD4A 4HMPA 3I2HA 4D41A 4E1BA 2P6RA 4O2BB 2WJ4A 4WKCA 1IUPA 1DG1G 2M6SA 2YYSA 5TF0A 4PVDA 1GN9A 4H1TA 1GEGA 3A4MA 2ZUUA 3EX7C 5K6TA 1QOPB 1C9KA 3NVDA 2CFOA 2F62A 2JJ1D 3LHIA 3PUZA 5FI3A 2IU0A 1UXIA 1YDHA 3ZGLA 2V3CC 1PGJA 1RWQA 2XECA 5F76A 2SHKA 3D6NB 2GRJA 1TAHA 1J9EA 5GGXA 1OR8A 4N39A 4G1MB 3TMAA 5C80A 4FD3A 3N8NA 4D96A 1P18A 3Q2IA 3NQ41 1XXLA 1E5LA 3FNGA 1QYXA 5AJWA 4B35A 2GN0A 5ERXA 2ZZMA 1KO5A 2A9JA 2AVNA 4TLAA 1QBKC 3GRCA 3PRHA 4LSWA 2G7ZA 2OWDA 5C8YF 4C4YA 5KKAA 4X7RA 5KC9A 5KDLA 4WK0B 4TLCA 1Q50A 3ZHYA 3RF6A 3FR8A 2E4XA 3VI3B 3TKLA 1JU4A 4OQXA 4ERXA 3CNEA 4GL2A 2C03A 3FKJA 4H7EA 4V0QA 4NQRA 5A3SA 2VHWA 2CK3D 2IE0A 4U6QA 5AHWA 2YFKA 1I3KA 4A8JA 1ABFA 3GLFA 3FLAA 4BX3A 4QVIA 4UCXA 5DHTA 4PG8A 1Y4SA 3JQQA 1N0WA 1HDCA 1W2HA 2P2GA 2Y9MB 3DUFB 3EYWA 3PCXA 2GK3A 5DZSA 4AMGA 2YXNA 1F2TB 2AXNA 5EIAA 4FFOA 1ZSVA 3WB9A 3WGMA 2BM8A 1G20A 1Z08A 4RY2A 1OAAA 3FYUC 2XGOA 1OILA 1IK6A 1VI5A 1UDXA 1G4AE 2OEPA 4UMFA 4X66B 2TECE 3P1JA 3OPYA 3KELA 2IH5A 4TV9B 2QRZA 2VQSA 2ZT6A 5ALLA 3EQZA 1C7QA 3JAKA 5IYZA 2JATA 2Z5FA 4ZT2A 5FYQA 1DWUA 3GVHA 2NTJA 1Y5NA 2VNIA 3LQ2A 5A05A 3B8EA 2Y1FA 4B7AA 4CL0A 3QK7A 1IJFA 1WDMA 3D3JA 3LYAA 3KQNA 1K7XB 3NLLA 3IR6A 1ODKA 4RNDB 1F5SA 1MC4A 3EEOA 1DBRA 2W43A 1SEVA 3BCSA 3EBOA 2QWXA 3LX5A 5F3RA 4Y2XA 5K1ZA 4EYQA 5BNZA 4EO4A 3E61A 3OSZA 4KPUB 3HG7A 1QLJA 4JJEA 4PBRA 1NI4A 1M8FA 1EK1A 2Z3VA 2WD9A 3BGOS 3HSSA 5AXCA 3FI9A 3H11A 4DV4B 1CHNA 2WWXA 3PD7A 1N8TA 2E4VA 5LU8A 3UJBA 4FI3C 4G67A 3S8YA 3QE0A 4FB4A 1KMIY 4DXAA 3IL2A 1CB7A 1MO5A 2HO5A 4ED9A 4N3AA 4ENUA 4I2NA 2R7MA 1TT5A 1PT7A 2VPXA 4NMXB 3RC9A 4EMUA 1T4CB 5L40A 1C4KA 4BNHA 3AF1A 3PQ5A 1QYWA 1YRYE 2GNAA 1YZHA 4OSEA 3D3KA 1WE2A 4R9RA 1ZGZA 2HC9A 4GQBA 3FTNA 1COWD 3MGAA 3TQSA 3EULA 2EHJA 2ZIWB 1G21B 1H2FA 1XNHA 5H1YA 2OFFA 4IS3A 5JIBA 2DULA 3AYZB 4NZOA 2IYNA 2P2NA 3T3PB 2EATA 4QJ3A 2FPLA 1CD5A 2O5EA 3IIIA 1ZD9A 2Y0EA 4LF5B 1EFRA 3KXLA 4AQ7A 3I73A 5ILOA 4AIRA 3SQMA 3R1IA 3V6LA 1VQ1A 1K66A 3QVVA 2IPAB 1H6CA 2PLNA 1NVFA 4MUJA 4PX2A 3FPSA 1W76A 4Q39A 3WOVA 2RGYA 1Y6RA 2QY6A 4H0CA 5CG1A 7MDHA 3WDKA 3ITDA 3ETDA 4NYMQ 2NVOA 2HADA 2MSWA 1CRPA 4W6ZA 1EM8A 5CRIA 1ZJZA 3N58A 3MAAC 1E8DA 1MHPA 4AVYA 1NMYA 5K99A 1HL3A 1V47A 4XRGA 2C8LA 2I91A 4ZYTA 1GTVA 3M49A 2NTNA 2G3YA 4F5ZA 1DO8A 2M1ZA 3V1KA 2ZTUA 3LLCA 3O2JA 2HPAA 1USVA 2BHSA 3MQFA 4ZCLA 3KWLA 1LSJA 3MB8A 2ORYA 3LL4A 2JGDA 3KKPA 4B3FX 4UTNA 2WJVA 4CXMA 3SM3A 4D8WA 4QPCA 4YAJA 1K4YA 4EB3A 1NY5A 4MR7A 1CR1A 4PYJA 5EMHA 5AVWA 2ZSJA 3NGMA 3AHDA 3QE2A 2N0SA 4WRRA 5JS2A 1VE6A 3H84A 4W9RA 1J7JA 2PMBA 2HD4A 1ZOSA 2WWRA 3K2IA 3PZRA 3RRXA 1U04A 2ZJ8A 1T5HX 1A77A 4S1NA 3R40A 2OAEA 1PNTA 2NUPB 2PH7A 3W9SA 5C7OO 2A86A 4MCJA 2I1VB 4YCBA 4C4SA 4Q3LA 4JT4A 5EXPA 1NW6A 1KE1A 4KGXA 3RSCA 3KD2A 5TPZD 5J2UA 1ZK0A 3M2PA 1RE1A 1JEYA 5BMOA 3C6MA 3EHDA 5TQ2B 5B12A 2YJZA 4QUAA 4RY8A 3W8FA 2NQ8A 2N75A 3PFKA 4UMDA 4I3HA 4FC6A 1IQUA 1ZHOA 4REMA 1J0XO 2IA5A 3H6KA 4NCNA 1RMQA 2R8EA 3N2EA 2PUTA 2PX3A 3KJGA 4J0JA 3ZIDA 521PA 4AN1A 3N7TA 2MR5A 5EVJA 1QU2A 4I3FA 3K9GA 2P0YA 2WSSA 1JXQA 2WIAA 5K0GA 5KDOA 1Y81A 1PUXA 3BMOA 3CUYA 4I8IA 3QNUA 1N3BA 3OOHA 3L7IA 5BW6B 1II8B 3UB3A 2C00A 4NK4A 1O1YA 4HLNA 3CH4B 2WNHA 1OX4B 4HB4A 4RTSA 1V11B 1XZ8A 3DFFA 4G9EA 4MHOA 4YPOA 3EIUA 2AZTA 5GONB 1BDBA 3NBYC 3BZUA 4FYYA 2WF8A 1QYRA 3E7WA 3G5MA 4ZN6A 3G13A 5C32A 4POOA 2GZAA 3K6SA 2WC1A 4X91A 3L7BA 4PRZA 4FOSA 1ZUHA 3O31A 5JXIA 3K2EA 3SVTA 4R0NA 1FDIA 2I55A 2SNIE 4Y2RA 3LT5A 3IVMA 3RCBA 1T9HA 3KTFA 2ZRBA 1GFIA 1CXZA 2OV2A 3QKSA 3E4DA 2IOFK 4PICA 5E8RA 3D3EA 1TTPB 3U4IA 2HDNB 2FXVA 4XE5A 4RJ2A 2ECQA 4G2TA 3GLRA 2ZJFA 2C94A 2GBFA 1NW9B 1UXHA 2O3UA 2LIVA 4LWQA 2YWEA 4NP6A 5LBIA 3T4EA 2W8BB 4YCCA 1BE6A 4CODB 1P7ZA 2ZUEA 4LOLA 1EVJA 4IEIA 4IXTA 1AUQA 2G0NA 5FT9A 2UKDA 3D4NA 3QX9A 4OPMA 2C88A 1E2QA 2W98A 4IJ6A 2X8BA 4JYPA 3WIBA 1FFXA 3GVCA 4GMFA 4BEJA 1YA6A 4KU4A 4CI0B 3PICA 3PHLA 3PQ2A 2VRCD 5HOQA 1NVWQ 3QLJA 3STWA 1TKRA 2AZ4A 3WIUA 3RYCB 2IYZA 4PYIA 1Z4MA 4HN2A 1ZMXA 3HDJA 3GLHB 4MWBA 2IY8A 2NSJA 5DH9A 3G5LA 5U4QA 3IJEB 3OP1A 2UUCB 2Z04A 1N5MA 3DOIA 3RT9A 3F7OA 5D3MB 4US0R 5CW2A 3PV0A 2QEQA 1PCXA 2IV2X 1CV2A 2GN9A 4NRDA 1QHSA 3KLOA 3PUJA 4RTMA 5ALNA 4Z49A 3MD0A 5P8WA 2ZEJA 1AZTA 4KQIA 2H1SA 3KALA 1P3Y1 1EX6A 3Q9SA 4J0CA 4UARA 4BDSA 4TRJA 4DDKA 1RPZA 4G9BA 2ODPA 4HN9A 1Z29A 1RRKA 1N34B 1Y6JA 3S8EA 1NNLA 3UOGA 3HO1A 3DPUA 4KR0A 1T8WA 4MW4A 4Z1OA 5HKOA 1WP4A 4HGRA 2FPXA 3QH4A 1IDN1 4JX8A 2ZYAA 4BLUA 2OOSA 3QEKA 1AN9A 1TCBA 3DMHA 1K8QA 4FN4A 4MUBA 3NC4A 3AFHA 3TMYA 3TTTA 2MYPA 4QYIA 1F60A 5AR1A 5HCUA 5EI5A 1AKVA 4KLAA 1QTIA 3EDQA 4LYAA 3L8EA 5T6MA 1DXYA 3RSFA 2QV7A 4XWYA 1Y3AA 3BXHA 3ESBA 1L5VA 4GLLA 4AZ3A 2EKDA 3I3SR 3AF2A 4X8HA 4BIIA 2Q62A 1E2JA 1T24A 3CRRA 1GUZA 1SVUA 1PGPA 4S1WA 5BYKA 4WJKB 3UJNA 1JDTA 2WTXA 3AVXA 5HF8A 3UUGA 2GJAA 4F2GA 4YAOA 3TZCA 2FEWB 3T5MA 1DQYA 1YJAA 1XMSA 3ZXXA 2C7PA 4LF9B 2AX4A 1Y82A 4YAGA 1J0CA 1UAGA 2WKPA 2GLXA 1U7XA 4R8SA 5JARA 2BI8A 4N7RA 1BKDR 3G2MA 3DZFA 2XTAA 5JMWA 1FTYA 1Z9BA 1GAWA 2CB0A 3CXRA 1Q1GA 1T10A 2UV8A 4RPHA 3ZIAA 3JQ9A 1W35A 2BMVA 3OLCX 3S2GA 3A31A 6REQB 2D8AA 4QLBA 1E6UA 1AK2A 2KWIA 3NB0A 1EWTA 1K2VN 4OQPA 1Y33E 3CZRA 3PQ6A 3RC8A 3BA1A 1HLGA 3CPHA 3H2GA 4JROA 2WWVD 4B3SB 3UF0A 2GRUA 1CJTC 3JZAA 3ET4A 3AQIA 1FU7A 1ULUA 1RAGA 1SKBA 1BA2A 1NJFA 2YX1A 2PS3A 3NHWA 5B7PA 3AUJB 2GEKA 3UMCA 4CNBA 5MGNA 4HH3C 1U0SY 2IYSA 3PUXA 3I5XA 1PFUA 1TC1A 1FSPA 3HL0A 1E20A 1TQDA 3GNLA 3U3RA 4A5SA 5ALSA 1Q0PA 4RNCA 5HFJA 1KBZA 2WG2A 3T9DA 4RD0A 5T67A 4BZXA 1ISJA 3FNBA 2W6JD 1J0EA 4LDAA 5ESDA 2H5EA 5GY7A 4W5OA 2XRZA 1OXXK 3L93A 3AF0A 3PXXA 3NJ4A 1L7RA 1MHTA 2ATVA 2B4RO 3AVYA 4F0JA 3VDQA 2RJOA 4HDCA 1R16A 1XZCA 3HCRA 4GX0A 3U7QA 4UQLA 3FMIA 3ROXA 4BKMA 1XEXA 1KWKA 4W9NC 1U1FA 5A9SA 2O7RA 1JG3A 3UEOA 5BSKA 3WGJA 4RPCA 4OATA 4YP9A 4M88A 4KQXA 1T13A 4PAMA 5C8YB 2VDQB 1RQLA 3O93A 3IVCA 5JECA 2HGZA 2NYRA 3ZU2A 3GUHA 4E08A 4CG0A 5JDIA 2EJVA 1RW4A 1OTXA 2F2TA 2WUVA 1SXGA 2ZG6A 4AJEA 5SYMA 4ZEWA 2PVPA 4ZDJA 3MBKA 4I36A 5IANA 1KI6B 4ZI7F 2BTOA 1PJRA 1XN1A 2HMYB 2FU5C 2NPOA 3L7MA 2X5KO 3PHJA 4E70A 5ITZA 4EPRA 3SD7A 5KYKA 3SIPA 3F5SA 1LSSA 1VIYA 1Y63A 3MGBA 3IE2A 4FEAA 1UPFA 1QXSA 5DDIP 3TIIA 3UJPA 3ZHOA 3FTEA 3WE7A 3OMXA 3JAWB 2QDXA 4FGZA 2PYDA 4KAJA 1H2ZA 1DTSA 1UZLA 3IBFA 3QUCA 4AJ2A 5FWYA 5DN6D 2KPOA 1ZD8A 4FMDF 1ENZA 3ZY2A 1DT3A 5JY1A 5IMBA 1GKYA 5FTMA 4CLDA 1WUKS 4ZU3A 5ALTA 1XKXA 1XTTA 4URHA 4MQUA 2J31A 3ZDQA 4GWLA 4EM6A 1WVMA 4P93A 2V8OA 3D0OA 4YRLA 1W0KA 1DXQA 2O06A 5HFAA 2EFHB 2CL0X 4KYUA 4ETWA 1R8QA 4P2BA 5D00A 2F9MA 1B0ZA 4M38A 1BCRB 1RLOA 4RFVA 1W5EA 3JPWA 2FW9A 3AOEA 4OYLA 1EDEA 2CWDA 2ILTA 3FCXA 2H1WA 4NZPA 2GZ1A 5BT8A 4MUXA 1QTRA 3E3MA 1J8YF 1FMCA 4QQ8A 4IHKA 4D57A 4JUBA 1HPLA 1K08A 2OECA 3S4YA 3U7IA 5I5EA 1XDZA 3AOGA 2XZLA 3MGCA 1SVMA 5M29A 1RXEA 3KYDB 1JA1A 1PNOA 4RPIA 5FOSA 1Z83A 1CQJB 4QHYA 1HQYE 2FFQA 2BHRA 4D5GA 1LVGA 3Q12A 2BONA 4ZT3A 3TNFA 5CCEA 1G3UA 3BORA 4GR5A 1ECGA 1UKVY 3TZQA 3BJEA 1L7BA 3FDZA 4B31A 1ZOLA 4UUQA 2ZYUX 4EKIA 9LDTA 3S1SA 1W0JA 4MS4B 4Z3DA 1U2DC 2VJYA 1KDVA 3ZHXA 2FR0A 1FP1D 2ZJYA 3SYMA 1Q7RA 5LPNA 4OQDA 4OXQA 2EQAA 1X86B 5CYOA 4DBLE 3F47A 3DEZA 4QSMA 3FYTA 3KRTA 4G97A 1A27A 5DMXA 4EHAA 1SK9A 4FEGA 5DM70 3VSAA 2VSNA 4HATA 1C5KA 1OIVA 3TWOA 4PNEA 4CEIB 4HVTA 1BXZA 3DKVA 8GPBA 1EE2A 4RVOA 2QIPA 3D8SA 4F3RA 3C8MA 1WTCA 3IVRA 1VRVA 2R8PA 4MGIR 4S2UA 4X8LA 3N7AA 2FSHA 3H1BA 5TVKA 4RFLA 1ZCZA 4URFA 4JGGA 1T4DA 1NSTA 2BL4A 4H27A 2OCIA 3OEED 2F1JA 4GR9A 3FKSA 3H2BA 5AM2A 3ZVNA 2FPPB 2EJTA 3MM4A 3U56A 3CTPA 1LX6A 3IPXA 4QU0A 4XLZA 4R2KA 1Z2NX 1W581 5AXAA 3DP7A 3B5IA 3P9SA 4I6GA 3C74A 3I9KA 5SICE 1PQYA 4B6RA 4U7HA 5AUOB 5TB5A 4DCNA 5I9IA 3M34A 2H1OA 4BO6A 3FAKA 2IL1A 5DBFA 1JQ5A 2XCQA 5K03A 5FL7D 2VJMA 2HK6A 3UAGA 5C4MA 5CJJA 2Y1LA 1T25A 2EF0A 3PC3A 2G04A 3FVTA 1GNSA 1UEXC 2F4NA 4P7FA 3VAYA 5EIXA 2Z57A 2GUGA 2OHJA 3SGLA 3IPLA 5AP9A 2P5SA 2W42A 3ZBUA 3P9PA 5EJ2A 2X2PA 4C6SA 1EDOA 4OQEA 4EZIA 5BN1A 3BFXA 3G9TA 4E4TA 2VTDA 3FBWA 4JCCA 3BWBA 1NBHA 3PNPA 3GJZA 4IDQA 1NGSA 4R05A 4U3JA 2O2CA 2PL3A 4MS3B 5DX0A 9MHTA 4L07A 3TLBA 2WTNA 3T3IA 1YCDA 2PQ2A 4PO3X 4UOEA 1JA0A 2GKSA 1ESMA 1PO7A 3FGNA 1PJZA 5ELMA 5F1YA 2H4HA 1HK7A 1QX3A 3DBOB 3HB0A 3DO5A 5B2ZA 2VL7A 3AZPA 1XWFA 1GZUA 3MUOA 3Q7TA 4GXNA 3HJRA 1KR5A 4LKRA 4Q1AA 4BNTA 2B8NA 5B6JA 3VDNB 4Z0HO 5HEKA 5L53A 3I9LA 5JTUA 3NXKA 4XZ3A 1H2BA 2HZ7A 2I7TA 3RW9A 2XYQA 4BN5A 2J45A 4L8LA 3H5IA 1DQNA 1NE7A 2UZ1A 3OZBA 1IN8A 1QKJA 2V7EA 2XMZA 3B6IA 4WBXC 4IV5A 4Q9KA 1NW5A 5GPBA 3WKEA 2ATXA 3SC2A 5GZ1A 2GKGA 2ZTHA 4C3VA 4Z3OA 2FZ4A 3OT5A 2FN3A 4IMRA 4OJKA 3W77A 3H8SA 3ND5A 4B8WA 4CBVA 3PSHA 3FGZA 3ZLBA 5J1SB 1CR2A 3G9XA 4RV4A 2DQSA 2JZOA 4P4LA 1Y1TA 1PR9A 1XZQA 3T9FA 2N3ZA 4UASA 3U9TA 2J9FB 1XV5A 4LVCA 2QM0A 4BVKA 3EGXB 1JQKA 1RMYA 4X24A 3AVPA 3UXEA 3EYAA 4P80A 5HYVA 1I6WA 1L0BA 1XUOA 2P90A 3GDGA 2QK4A 4GC5A 3THOA 1JJ7A 2AIRA 1AN0A 2VTVA 3VGPA 5ICEA 2IEZA 2YC4C 3LCVB 5HBRA 3FH0A 4HQLA 3S5UA 1U2TA 4MPRA 4PGFA 5DSZA 5FB3A 3CV3A 1MB4A 3ZKWB 1Q21A 1RVDA 3DVQX 1Z35A 4M46A 5EHGA 1QIDA 3IQZA 1P2TA 3CXUA 4MK4A 1QG4A 3FWYA 3EFHA 4DR6B 4B85A 1K75A 1DJOA 1NQTA 1QKIA 3BA6A 4RGQA 1F3OA 3PS9A 3IPCA 3ZEAA 4I5IA 4EI2A 3U44B 3FGOA 2HKIA 4BCBA 5BPHA 2EVWX 4I50F 3DCJA 3KVRA 3NVMB 2G1JA 3K4HA 4EY3A 4UBMA 3SYLA 1RFLA 1WMSA 1WQ4A 3WSTA 3GGDA 5CNMA 5TMPA 1SBYA 4N9WA 1R37A 4PBSA 2VDPB 4PNPA 5BT9A 4BNIA 5KIAA 1C7EA 2GJ8A 2QT0A 2DC1A 1PTJA 3LQFA 1C0PA 4MQEB 1A69A 3ONVA 4JBXA 1ICEA 2QTVB 3ODPA 1GZ7A 2R47A 3UN1A 1JHPA 4DV2B 3HEBA 4JSRA 4URUR 4FFLA 4FMBB 3R7SA 2HDWA 3IUYA 2D54A 4OO3A 2JKZA 3BKWA 3HY6A 3NFYA 4D9IA 1TJPB 1YUMA 3F46A 3U4GA 5FTLA 2ACWA 2QD4A 4C7OB 1RI2A 5CVUA 2JBHA 3JR7A 4G3XA 2AV6A 3EDCA 1XZMA 4GECA 1YHNA 1JTVA 2H29A 4G0WA 3DBIA 3L7DA 5DWQA 2ZOSA 2H7VA 3VKVA 2PR2A 2G06A 1JYSA 3EGWA 4C0WA 1CJUC 5JNLA 3MELA 1XTVA 5E38A 4ASUD 5K09A 2QVBA 3CUWA 3B12A 1RBZA 2ZM5A 2SICE 2FH5B 3BWDD 3BGVA 3I2JA 4YUYA 3SIRA 1WS6A 2WD8A 4BNGA 5BWNA 2XMPA 5AW1A 1LGYA 2WMNB 4FZJA 3L6RA 4XFDA 5CK4A 2JLCA 5JCPA 2IEYA 1TADA 3DFMA 3E2PA 2G8LA 4MO2A 4NMHA 5FEMA 3ISTA 5IAKA 3R7LA 1JHYA 4JB8A 4EVIA 1CZHA 1P1CA 3UJ7A 2RC5A 4AO8A 1G8JA 4U8GA 5DNUA 3BBPA 3ZR4B 1ANKA 4DUGD 3TJMA 5J4VA 4WZZA 1L5KA 5CU7A 3R9XB 2C54A 3RPEA 3OTQA 1AMOA 3WC4A 4D56A 3DHYA 3TTUA 1SQFA 1SUCA 1WQ3A 2X19A 2Q6IA 3E7DA 3H16A 3N0TA 3OCXA 1E98A 4PLYA 4MA5A 1RLUA 2ZJ6A 3OCYA 4M1WA 1YUBA 3VJMA 1BGXT 2OD9A 1MJGM 4BNVA 2D1FA 5IWAB 3ZDEA 3RABA 1QCCA 3FA2A 3FPJA 4HNAB 2AQKA 4UD2A 4ZMSA 5KX5A 2O7SA 3RBZA 5DIFA 1FVXA 1TD1A 4LTNA 1NUHA 3TLGA 2RHLA 5EC8A 1GIAA 4TS1A 4QGBA 3S55A 2BBOA 3GFRA 1BNCA 2IXFA 3V32A 4DUZB 2PKRA 4K46A 3HO8A 4EKEA 2NU8A 2JFXA 3ZGNA 3L1KA 3TFOA 4DM3A 1HLDA 5IDYA 2BFAA 2H16A 1NHWA 2RKOA 1P0PA 4XJTA 3NIDB 4IXDA 3LOQA 3UMBA 4YRAA 1GTMA 3ED1A 3NBUA 4F6RA 1UBSB 5EZQA 3KTAB 1V8OA 1JIIA 2PV7A 2FOLA 3NH6A 3KQPA 3WKAA 1XHLA 2VBFA 3D6MA 5JCOC 1O6FA 1WP9A 4L02A 4J2TA 2WDPA 3VH1A 1CE8A 1UC4B 4G0PA 4OU4A 3JD1A 4Y2JA 3G0HA 4CM4B 2PZJA 1KTIA 1J8FA 1WSAA 4YFYA 1J1ZA 3K7EA 1GSIA 3ILSA 1OBCA 4JJIA 3D54D 4YONB 1G6KA 4BVHA 4DIOA 5HWSA 2FKAA 1WUYA 2NU6B 2BD0A 3RK1A 5BVGB 2H31A 4BP9A 1MGOA 2ZBDA 4G63A 2B5VA 1I8TA 2HIHA 4QFCA 2ILVA 4MULA 1TF7A 5LCXA 3T06B 5JTTA 3HYRA 2ONKA 3KKEA 3H4IA 4IDOA 3QITA 4BZPA 5L3SB 1QK3A 1ZM4A 2JAQA 3WJ7A 4Q02A 5KJCA 2R6CA 1S01A 2WIKA 3S7TA 1AQIA 1G3IA 2NU9B 1YL5A 2KQUA 3HYCA 5H81A 2EOAA 3IR5A 4J1TC 5B3JA 4BFZA 2RHHA 1NW8A 2WFMA 1MV8A 1P7VA 2YQ5A 4IHJF 2WICA 4YFVA 2XJ4A 4C21A 3GC6A 5IBCA 4JUCA 3OY7A 2P91A 2YXBA 5EA2A 3C6YA 3ZQ6A 5EKUA 4CG2A 3O21A 2GZMA 3FX2A 3H0CA 3HLTA 2PNJA 4ZTZB 2XCLA 4A2PA 1RWWA 3MWEA 1OX5A 1CDEA 2WVJA 5BVHB 1WLYA 2M6LA 4BTLA 2EG5A 2OCYC 2ZJ2A 3FOAA 3LSYA 1RLIA 3LUFA 3SDSA 4KITB 1SUBA 3QTBA 1ISRA 1SOVA 3FVWA 5EJ6A 1JBEA 1G21E 3ABSB 3NHYA 2Y1XA 1OAOA 4H3HB 4S1OA 4I08A 4P32A 4V1CA 1WBBA 4QM6A 1PFQA 2VYCA 3QKRB 4YEDA 3G2JA 2XZTA 4QRIA 4LXTA 4D9EA 3DOOA 4DUPA 1RYHA 4AKGA 3P9XA 1RM5A 1KVQA 5EJ4A 5AVUA 3AFIA 3BB1A 1NF9A 1SKUA 1TJYA 3GEIA 3ETGA 4KMMA 4X6YA 3TS1A 2HJSA 2PXCA 1H93A 2P75A 4HDMB 3M4XA 3T4UA 1E2GA 2VTEA 1J2RA 1TEVA 1RYMA 2AUTA 2B7BA 4YMSA 3RHFA 2PZBA 3O7WA 1N2OA 2CLEB 3ROQA 5E7IA 4D0SA 2GVNA 4E5MA 3PIDA 1LRLA 2ZQYA 3TLZA 3VKFA 4F4HA 2V97A 3IT2A 2IOQA 2NAPA 2XW6A 3ZHTA 3A1TA 1Y4DE 3F5FA 4DMLA 3NDRA 1A0OA 2VQFB 1DCTA 1ZGAA 1PVDA 3W0LB 4ZTUB 1L5HB 2P5YA 4CI9A 1CSEE 5MFPA 3OLZA 1I7QB 4CETA 1LBQA 5HDBB 1G5PA 3VNUA 2Z08A 4MARA 4ZI7B 2PLWA 2QN1A 3SSNA 1U94A 4IGEA 3U7EB 5TS3A 4AY3A 5KYGA 3FZYA 4YHHB 1RWBA 4BO1A 1L3IA 4C7OA 4IKEA 1R8YA 1YS4A 1D07A 3LPDA 2ZYIA 1QIKA 2X2FA 3B3QA 4K5QA 4L57A 4A2WA 2N46A 2G07A 2P11A 2Q6VA 1L4UA 3IMFA 3MA0A 3NDJA 1E3LA 1ZUNA 3UATA 1K63A 3F6EX 1N3IA 3M4NA 1AUVA 4FMDB 2VNAA 2KS6A 4KE9A 4BX9A 4CM8B 1B1AA 4EG5A 4RTOA 2W2LD 4AJLA 3IAM1 4BQRA 3NORA 4AIIA 3A7EA 1LTQA 3FJOA 2C99A 4GPD1 1FDTA 3PSAA 4JP5A 1EB8A 4XB2A 2H11A 5FNVF 3CX6A 3VC1A 5KWEA 4WKBA 2FG7C 1KZYC 3K73O 1GXSA 3TZHA 3B36A 1MP0A 1RKVA 1OZ0A 3AB7A 3UWSA 3X1DA 4F1JA 4C5BA 1DIAA 1J09A 1GAEO 2R4QA 5BV8A 2GXUA 3H83A 3QE4A 3KNZA 3TQQA 4ER5A 5BRAA 5GIPE 3FSEA 4J6EA 5EQTA 1JG1A 2XA9A 3PWKA 5DOZA 5IG2A 4TYYA 1XCGB 4HRAA 1O89A 2W2KA 3Q5DA 3IKTA 4P4UA 1GNTA 4PFSA 4RABA 2VSOA 3BULA 1M33A 2YL2A 2HCJB 4Q1VA 1PZMA 2VEOA 2AFIA 3MN1A 2FPGB 5T4EA 4MWTA 3ZJ4A 2ZUWA 5F51A 3MSXA 3HHPA 3HXKA 1CVRA 1Y9ZA 3E9MA 4MPDA 2AYXA 1MX9A 2SCUB 4X00A 2R6AA 4B74A 3MWKA 4B4KA 3IHKA 1I2CA 2IPLA 2O7NA 3K6JA 1FUIA 2OHHA 2ZE6A 4ND3A 3ICQB 1WHSB 1YZVA 4AZ0B 3NYIA 2HPVA 4N5IX 4M55A 3BRWD 3EPRA 4F7DA 5IZCC 5FUVA 5FUMA 2J3MA 3CLRD 2VDUE 5JSKA 1K06A 1R0SA 4IEEA 3NYWA 2CXSA 3UFXB 5KNLA 3P2OA 1FTNA 1Z17A 1OBOA 2FGKA 3P97A 1V71A 3KBBA 1ML4A 5E7MA 4G23A 5YASA 5GP1A 5A5GA 1FE8A 4KQ2A 4PRYA 1N7IA 1U3WA 2P6MA 5JFTA 2F1KA 2BR4A 4J0EA 3A05A 4F3NA 1KK0A 3PC8A 3V1UA 3B5JA 4G81A 4NEQA 3P9YA 1CHDA 1NYQA 1JZQA 2OUIA 3IUJA 4RYLA 1G291 5EE5B 5EJMA 3R75A 3W6OA 4UTVA 1U8UA 2GVDC 3GEHA 1K3TA 5GV7A 2UZAA 1YZKA 3IP9A 3HCNA 3O4HA 3VPAA 1XWWA 1GPKA 3OZCA 1AMNA 3IURA 2O8BB 1D9ZA 1Z73A 3VR5H 4FFVA 4JLMA 2YNMD 5BRNA 1E9SA 3AWDA 3VZSA 1GG2A 3L8MA 2GYUA 4NV1A 4BQPA 4F1KA 1UC8A 4R7TA 4F4DA 4DV3B 4LHSA 3K0KA 3TNYA 3W3AH 1L1EA 5FPHA 1NFRA 3GRPA 3AR8A 2RI6A 3DWIA 3QMMA 3K0EA 3KUDA 4C76A 3OFSA 1UPUA 3GLHE 4GC9A 1VLHA 2F55A 4D0LB 5FI1B 1CJVC 1KS9A 2H07A 2BGJA 3RTDA 1P5FA 4LY6A 3WNBA 1N2XA 3HNOA 5AHKA 2IUYA 5L51A 2AC7A 2X0JA 1ZLXA 1ZKDA 1Z25A 2JI6A 3LTEA 3H86A 4P35A 1IHDA 3GV0A 2CWWA 4KBYA 2OLEA 1CIVA 3KG2A 4OOEA 3UJ6A 5IN5A 4GNKA 1GSHA 3HL4A 5BV1A 3UW3A 2JK0A 1MJHA 3DCNA 2LDBA 2XH8A 3DTVB 4X1IB 4XWKA 5FRDA 3IP5A 3T5DA 3EZLA 2NNWB 3C15C 4G0YA 4JGIA 1IXKA 3EQ9A 3LX6A 1OU4A 1EDZA 4MV4A 3CRW1 4YJDA 3ROMA 3Q85A 3GXOA 1F4LA 4QOFA 1HQDA 1GPLA 5T7BA 1YB7A 2Q41A 1R3DA 1HWYA 2IODA 4U39A 3AKEA 1J00A 4OEHA 5TARA 3ADKA 1XAGA 3PI6A 4AFNA 4JQCA 5E4YA 2GN4A 3IPYA 2RAPA 4PSUA 2WU1A 1HDOA 3V4SA 3KYCB 3FPEA 4AJJA 5IDWA 1X7YB 2H0QA 3DFIA 5B64A 1KH1A 3RUDA 3EDMA 4Z0NA 2C1EA 3CISA 4QICA 4B3TB 2DSTA 2PPLA 4C0AC 3PGMA 4DA7A 3LF1A 4C4ZA 4QYSA 2WTUA 4HF7A 4X95A 2VWGA 1P2VA 3QSYA 1UAYA 3Q8MA 3WYNA 1S9DA 1GA6A 3ESAA 4V24A 2P1DA 4LXGA 1FP4A 1C80A 1USGA 3L6DA 1UT5A 2WHPB 3NWBA 3VHQA 4RD4A 2QOEA 4WNIA 3GUCA 3I6QA 3LT4A 2C7VA 2PSSA 1FYWA 2X6QA 4O2RA 4AYWA 5C31A 4TQUS 1LWNA 3HUDA 2PA0A 4D5EA 1E1QA 5LD2B 1G6HA 2D5AA 3I4FA 1DBVO 2AE1A 2Y2UA 2EC5A 4ID9A 4D4HA 1Z3IX 2HEIA 4I50B 4HDKA 1SVOA 3H5WA 3ZWCA 5IJ9A 3K70D 2IPNA 4Q5IA 3PFHA 4DY4A 3G5AA 4PAOA 5THXA 5JHGB 2QAIA 4MQBA 3DMPA 4PANA 2PK3A 2BKAA 3TLJA 1KFBB 4JFAA 3C5WP 3H8JA 4RD2A 4YRPA 5CXXA 3N86A 4CF7A 5EVCA 5K0EA 2OENG 2I3GA 1FX0A 3JPYA 3P19A 4RC9A 4URXR 3IAEA 4Y0NA 2AWNA 1I3OA 4M49A 4MA4A 5IT4A 3O4VA 1RPJA 2CDRA 2WHEA 2GTPA 3NOQA 1XJWA 3R9IA 4ZICA 4Q21A 4ZCSA 3BXZA 4I6EA 3WAKA 5I7VA 1LPOA 1MG5A 3AP2A 3RYTC 4WOPA 3MINB 1CR4A 1D7AA 4LUCA 3L1HA 4L4SA 2B61A 3PC7A 1DVRA 1E63A 3I9JA 3LP8A 3KZOA 3VR2A 2RJ3A 5CLJA 2Y76A 4JI1B 1KC3A 2PTGA 4TS4A 4KLRA 3JQAB 1QHNA 3GG9A 2VIIA 2G40A 2QRHA 2VTBB 3E81A 4BFSA 1NATA 3F78A 2D74A 4EGCB 4PG4A 1RWOA 2Y27A 3BMXA 3AL0C 4EJSB 1U28A 2KM1A 2YICA 3OC6A 6ABPA 4ND4A 3IAS6 3N2IA 1IIRA 1MQSA 2WIDA 4IGKA 3RFVA 2E0IA 3OI7A 2IKSA 4EG4A 1E62A 2PX0A 4YROA 4Z4CA 5CM9C 3NC0C 4C78A 5CM2Z 5ALRA 4P7BA 4WXRA 1XZPA 3HBNA 3FPBA 5LYYA 4MYTA 5IC4A 2RB5A 1JYEA 1PE0A 1UANA 2GGSA 2JJ2A 2B1RA 2VHJA 2XT0A 3NAQA 3SF8A 5B3KA 3BXFA 4EB8A 3KQQA 4R8KA 1UJ2A 4FHDA 2VJCA 4GU5A 1K7EB 4E2ZA 3L7LA 3ZD9A 2DBVO 2D1RA 4ENSA 4RK4A 1GV1A 3KQWA 1WHTA 3QJ5A 3OU2A 3GLTA 1L7VC 5FJJA 4PZ9A 1WXIA 2I4MA 4WFKA 1QYVA 2H92A 4G01B 4EKNB 3W90A 4R69A 2YXPX 3T5TA 1NBWB 2YVLA 4O2AA 3NCHA 1F3LA 2WIFA 4DWWA 1JG7A 4GGOA 4Z9BA 3X1KA 2VHXA 3PGJA 1C4OA 3ABQB 2XGSA 3RJZA 3WYDA 1AKQA 3VNRA 3ORHA 3K53A 4KWHA 3K09A 1SXJD 3L82B 4Q48A 4QBTA 4DCPA 4KTVE 2GD6A 2GDZA 2ZCUA 3RLIA 1BHO1 4ZRMA 1LRKA 3GH3A 3R0JA 2J9YB 2DECA 1L4GA 1E7YA 1M2VA 1YUNA 5BQOA 1ZPDA 3CGWA 2OBNA 4JUDX 2EW1A 3GGPA 4XLLA 1R6TA 4ZOEA 3HKEA 3SQOA 1Z38A 1EVYA 2IYRA 3EFOA 2BMDA 2FN7A 5DYWA 2V7BA 4HEQA 1O2DA 5LQDA 1W5FA 3P45A 5KJFA 1PWHA 2ZKLA 5D8DA 2W2TA 3HB4X 2BF7A 3IRUA 2YZKA 5AOVA 1XD8A 4U7DA 2LGJA 4Y98A 4IH4A 4A5OA 1VYVA 4J0HA 2PUEA 3G23A 1Y80A 2C9CA 2ZB3A 2G6TA 3MB5A 3ZV4A 2OA0A 4F4CA 2W2VA 5JO9A 1YASA 3DE3X 4LJAA 1EWYA 4IHJB 3BG5A 4LQLA 3CLSD 4X97A 3EFBA 3P9KA 1V3UA 2Q49A 1ZJJA 3AI3A 4RKWA 5EY5B 4J8PA 2P9JA 3K8YA 4GI1A 4Q1CA 4F4IA 4YXWD 3EIXA 4U1RA 1WDWB 1NLZA 1CUAA 3Q10A 1ADFA 1H66A 1JN0A 2A5GA 4EYSA 3U1BA 1JFFB 4A0GA 3K16A 3GNQA 1IBKB 4LZOA 3S2UA 2QHXA 2X40A 3NHPA 6CHYA 3BT7A 4YRCA 3UC9A 1RC8A 3RVNA 2DKFA 3J81k 4LHWA 3S40A 1U8AA 2R65A 3HVUA 5A6SA 4LI0A 3H9CA 5FPPA 3LBHA 4TKLA 4B33A 5COAA 1E94E 4QYWA 2GAOA 4XOIA 3LECA 1ZVVA 1H9CA 2BKLA 2A1TR 1HOXA 5TVGA 2NYUA 3BD7A 4CUJA 3VSEA 2JIPA 1M6NA 1R0XA 3ICCA 4LBZA 4U9UA 3ZTWA 3RROA 1AK1A 4EI9A 2FN8A 3AEKA 2OBBA 3D8BA 1DEHA 4YCMA 4I8DA 1CR0A 5ES3A 1E1MA 2J0VA 3N3AC 1T2UA 4WADA 1PT6A 3D43A 3WIEA 1K0FA 4O4IF 1F6BA 4F71A 4HB2A 1NF8A 2GQ0A 4M76B 4R68A 4D46A 4GRAA 1ESDA 3TQIA 3D6HA 1Z4IA 3T94A 1VL2A 4RZUA 2FY8A 2PNFA 2IYAA 4NEGA 4TL7A 1W9MA 1E18A 2MU1A 5ER6A 1SU6A 3TRIA 3TW0A 5CT8A 5A7GA 2BGRA 1Q17A 1DBPA 3N2NA 1E7WA 1VXRA 3MUEA 1OREA 4N0EA 3EF0A 2H52A 4NYIQ 5A5FA 2CLLB 4KXNA 1KDYA 2W70A 4E1VA 4KPGA 3HFJA 3TTYA 4R2WA 4JIGA 2VT2A 4KZPA 4ETMA 4JBHA 4G0NA 1QLHA 4UM5A 1P31A 3UM9A 1Y1RA 4CUZA 5A1JA 3DDOA 7REQA 3I5AA 1KY2A 2HF9A 2HJVA 4REQB 2BM1A 1VPVA 2PAAA 3FTCA 4DSNA 1DQSA 4YAUA 2AG5A 4WAUA 3URMA 2FUG1 3V33A 1GVNB 1W19A 5HOEA 2BGUA 1MKYA 3HY3A 2QT1A 1SD2A 5DP1A 3ROGA 5FTNA 1T36A 1A95A 3ZWXA 2F43B 2NACA 2NVWA 3JATB 1B4DA 2CD7A 3AILA 3JQ7B 3O2NA 3OESA 4FGJA 1ZD4A 2PRJA 2G4VA 1DO0A 4YP5A 3KFXA 4NVRA 3U4DA 4OXYA 1V9LA 4AYXA 3RK4A 2CCKA 2W93A 3WGHA 5ADUS 1QVRA 1TM7E 1A7AA 2GN2A 1EFVA 3NXSA 1OKKD 4FR2A 1UQRA 1YRHA 3H1PA 4M4SA 3VSCA 5EXSA 4G09A 4E6PA 1H1DA 1ZK4A 3HU1A 2XSZD 1OVGA 3U60B 2PUCA 1ZRNA 3ZVLA 1HZZA 2DU8A 2P9BA 5CA0B 4Y9DA 3ETHA 4PSCA 1YGPA 4G24A 3T1HB 4F5EA 4TTTS 3BFVA 5CTJA 3W6ZA 4CLOA 3HA2A 4DILA 1QFJA 4EMBA 5KTMA 1MFPA 1KC1A 3CEAA 2A1UB 4KL8S 4L0MA 1JL3A 4TXHA 1PR3A 2HFKA 3IQGX 1EFUA 4PTYA 4DWVA 4D26A 1U8YA 1K5HA 1VPWA 1ZGJA 4AQYB 1AU9A 1LLUA 3SC4A 1A5BB 3UJCA 5A5EA 3QJGA 1HFEL 4KKXB 3Q8KA 1NXPA 4JBNA 4QVKA 3QVWA 3HADA 2EJCA 2VPYA 4XKJA 2DFDA 3V97A 4C04A 3K92A 1VMKA 3BXXA 1TM3E 2LCIA 1AZWA 2AEMA 4E15A 5HUHA 1CJCA 1X0XA 3WDMA 4CM9A 1WABA 2QN3A 1GNRA 4YJ3A 4DCTA 4KR6A 2B9VA 1DAMA 1FF9A 5T8KC 1RWKA 1UDRA 3BQNB 1WW8A 1E5TA 3MXOA 4K05A 1ATIA 1P80A 3SJ7A 2NZJA 3T9EA 3SZRA 1CQIA 2VN8A 2IHVA 3BTOA 2PE5A 3BAFA 3PNOA 2A9VA 3EQ8A 5EIFA 2CCGA 1ULTA 5B2EA 1C1XB 4M9QA 2C3PA 1H4VB 1IHXA 3H9JA 3UFBA 4HPWA 5I45A 5KYYA 1RWMA 4Q34A 4ZOAA 2XT6A 1ZW6A 1IN7A 1EGAA 4U2FA 5I9SA 4XWAA 1V1MB 4P08A 1VLLA 1B76A 1PR6A 2RBGA 3FPGA 2G9UA 1TVKB 4NYJR 2ZPTX 4XIFA 2ZBRA 3R44A 2FGJA 5DCLA 4ZAZA 3K0CA 4U6NA 4BPRA 3NHZA 1VCIA 1CUWA 1F2VA 3WBJA 4XASA 2SECE 2JDID 2I2CA 3CB4A 1MH1A 1T43A 1UAAA 3H1AA 1UR5A 3L0PA 3I5MA 4PFJA 4LFAB 3OO1A 2ZRIA 3V3TA 3WLHA 4EZBA 3CO0S 4LCJA 5BNIA 5AW0A 2O5CA 3K9WA 2NSDA 1PR5A 4F8JA 3W8DA 4A73A 3GFTA 5AVXA 4C0LA 2ZIAA 5SY6A 3HBJA 3H2IA 5HIIA 3VTAA 1VZ3A 3U3ZA 2C57A 2O2XA 5TRTA 2Q1SA 3PXGA 3TAHA 1XMXA 3PEVA 4KRYA 3PQCA 4RDXA 2ANBA 4I4TF 5KNDH 3O92A 4S24A 5BMVB 1PVOA 5DW3A 3ADBA 1T5TA 1QCYA 3IIMA 1QO7A 1QE0A 3KHTA 1D03A 2WLTA 2YZNA 3VO2A 1Z0UA 2JBAB 1LV8A 3THXA 1RJ9A 3SCZA 4LX8A 2AN1A 2YRXA 2JAHA 4NJMA 5JSZB 1O94A 3E6AA 3D5EA 1M7BA 1YZFA 1X8KA 2VZLA 4I9GA 4D82A 3ZJ5A 5MN4A 1U9YA 4QLAA 5KHOC 5CBKA 1M3SA 4QNNA 1NJ6A 4FHCA 2G17A 2F1HA 3SP1A 2FOIA 4HZIA 4XQ9A 3DLHA 4MGZR 3FTFA 2GPBA 4TKVB 1MOQA 3P9QA 5E6UA 2XR1A 4FN5A 4CM7A 1E9BA 2GM9A 1EVZA 1TZJA 3LV8A 1SUAA 3KE9A 3L49A 4TLEA 2EZ9A 1PSDA 4I1UA 1QO0D 2JEZA 5C5EA 3ECAA 5TY0A 1J0AA 2FEMA 1NJ1A 2XUGA 4PV7A 2XXJA 4QWMA 1AT1A 2PVCA 3OBBA 4FJ2A 1GL9B 1YD7A 1YZUA 2X4IA 3MWLA 3ZV3A 5LOVA 2NUTB 2ZJ5A 3IESA 1ESZA 4IKPA 5DRTA 1VJDA 2IX3A 3A4NA 2D2XA 1J8QA 5FV7A 3GUYA 4AJ4A 3T7RA 4B83A 4R71A 4ZCIA 1V7PC 3K9QO 3FUTA 2QORA 1B6SA 5DXAA 5MDHA 4II7A 2A9KA 5KSWB 1DC7A 2V45A 1N9GB 4LJSA 1XPJA 3DZ8A 4WK2B 3KQLA 2NXWA 3NTUA 3SQNA 1N0UA 3IP1A 4M0FA 4B3JA 4UVGA 1R18A 3RVBA 3GBSA 4J0IA 3RFTA 5AQEA 3T15A 5KREA 3N6XA 1C50A 3LUCA 3DXXA 1GRRA 2J67A 4KXWA 3K71B 4P5EA 4AZVA 4YCJA 5DO9A 3DS8A 1RQ7A 4URYR 1GTL1 1IXRC 1HG0A 1ODJA 1ID1A 2JKYA 3LC7O 3UWOA 4PHCA 2GBPA 4LAFA 3PQDA 3PNSA 1N0VC 4MUGA 4UFNA 3ZV6A 5IMSA 1GV0A 1JG6A 3MCWA 2V3VA 3VVLA 4Q3CA 5L3RA 2AD1A 3BGIA 1LNQA 1X80B 2GCOA 2PMKA 3WLSA 3ZU6A 3GEPA 4QUHA 2A0FA 4RD6A 1QR2A 5I3ZA 5JHHB 5JWOA 3U4QB 3C3JA 3LBFA 1LJUA 2XEDA 3KZ1E 1V1JA 3L6UA 4H1WA 1RDFA 2QX6A 3F9IA 4R0MA 4DC1A 3A4YA 3UPDA 3ICPA 2QMHA 2RGCA 2QTCA 1D1PA 2O5RA 4K9MA 2FKNA 1PFKA 3IAAA 4KKVA 1LD3A 1Q7CA 1DG9A 4TRNA 4I5FA 1CJSA 3DEKA 4FWBA 4KPFC 2YVAA 3RFXA 4DLPA 1U8ZA 3AVWA 4DOMA 1YBMA 4KO8A 1C4XA 3B13B 3D2LA 3MLEA 3KKNA 4ABTA 4RTJA 4HMQA 4G5XA 2DQZA 1IEVA 4KCGA 4V0KA 2PZAA 5CM8B 1LSUA 1JXMA 2LKDA 2WJJA 1URPA 4CMEC 3IOEA 4JDPA 4DLAA 2RG7A 4DTIA 5A5VA 4JI4B 1LZLA 3QI2A 2QUAA 5K3DA 1XOIA 1N9ZA 3MUFA 2LTAA 3H9QA 5F2EA 1KNQA 1X1TA 3HBFA 3U3MA 3ZXYA 4DBLC 4RTRA 2VFAA 4RIHA 4B6QA 3SHFA 1Z7GA 2BFEA 5D84A 2X9GA 5IT5A 4BGEA 5LWQA 5IM4A 2QRGA 5FWXB 1YK0A 2IU3A 3BJIC 4HJRA 1JKJB 1UKAA 4LMBA 3ZVRA 4G25A 1TUBB 3VKUA 3MC1A 3VX4A 2GNPA 3KDPA 4DR4B 4WCFB 5LM3A 5JNWA 1T9GR 4TMVA 2GK4A 1K68A 4GPIB 4L74A 3H2HA 1FDUA 1PDOA 4X7BA 2XIQA 1Y37A 3DBRB 4Y2HA 3TEJA 3UMFA 3ANNA 3IJRA 1H4SA 5JXJA 1XZEA 1CEYA 3PHIA 4F4FA 3K1AB 3W04A 4MJ3A 4DIBA 2E85A 2HWUA 4YO8A 1RZRA 1OWPA 1T3ZA 1F5NA 1F0PA 1ZP6A 4HXEB 2EP8A 5BN5B 3LT0A 4BRZA 2NTEA 1H8HA 4ON9A 3JYPA 1MABB 1MDBA 1KO1A 1GTG1 1YR6A 3U4AA 4W1PA 4BASA 1GPWB 3WKDA 4JP1A 1E60A 1KORA 1ZIPA 2LPMA 3GCGA 3TG2A 2R0QC 3SOPA 3TDMA 4D3XA 5ICCA 3C5EA 4W5RA 2J0EA 5JCXA 3HQ4O 3RSGA 1U3CA 1NXTA 1GCIA 2EKPA 4KQ6A 2NUAA 3WNQA 3MTDA 2EX1A 3EVAA 4E03A 2F7SA 2VS1A 1DPGA 3FFXA 4MW5A 1DARA 3R5FA 5DBOA 5IJWA 1W36D 2IOYA 2VG8A 4G4GA 1A9ZA 1E3IA 3AB3A 3ZEIA 5KNBH 4US2R 3QOXA 2V7PA 3VVCA 1VHLA 2C8JA 4R01A 1M34E 1EZ1A 1IHYA 5EZ5A 3DMNA 4BFLA 3IBCA 1AB5A 2Q8PA 2CZCA 3FWHA 3HSKA 1YQGA 2ORED 4GWKA 1UBTS 4OUDB 3TJZA 4A2CA 3HXTA 4EI8A 1ECPA 3PPXA 1TD9A 2W83A 3HYLA 4OFWA 5L9AA 3T7KA 5JXWA 4JT8A 2QSJA 1NL3A 2C2GA 4JEIA 3DL2A 1SFRA 3TSOA 1TRKA 1WRBA 3GJRA 3ZY4A 1BROA 3AY0A 3CT6A 3HM9A 1YC2A 4M1EA 4ZV4A 3GEEA 5JAZA 1XTIA 3RODA 2EBHX 1DEXA 4XPZA 1T9DA 2R8BA 4UU0A 4P86A 3GPLA 4G84A 4RXUA 3VU3A 1NKSA 2BJWA 2V4MA 4Z4GA 2JCSA 1BMFD 3P4UA 1CDDA 4UMVA 1IY9A 3PX7A 5DTMA 1RMTA 4BNXA 2ZS9A 2P77A 1MW8X 3CF6R 5L3ZA 3E1SA 4MKZA 1XJ0A 4O4IB 4CT4B 1DV2A 2POQX 2QF7A 2H1FA 2P40A 2O3JA 2Y1WA 1OI3A 2B8TA 3LGSA 2L42A 3L46A 5JC8A 2W2MA 3RS3A 1OMOA 3LWDA 3B8HA 3O73A 1R9GA 1QJCA 5CH3A 1OI7A 1JHRA 3U1VA 3O03A 2FI1A 2WQZA 4UE2A 5GOTA 4Z0PA 5KCZA 4ZV7A 5LR6A 1R9MA 2PS1A 4L4UA 4NZ9A 1X2EA 4ND2A 4XDHA 1MB2A 3DWGA 5CT6A 5A02A 5BUQA 2VAMA 4H16A 5JZVA 3GLQA 5ALKA 1LSOA 3AJ9A 1PS0A 4B4VA 3A2KA 3F1LA 1Z75A 4DLYA 3KZMA 3NDIA 4U6SA 1ND6A 1UWVA 1HUQA 1R9NA 3D31A 1L7MA 1NXVA 3OLYA 4GH5A 1Z6QA 5BSUA 1S2LA 1OH6A 3OQOA 1V35A 2FMXA 5J3JA 1MTOA 3IV7A 2VRNA 4JVNA 1OFHA 1EG7A 3KLPX 3DUWA 1BOFA 4BE4A 2Q6LA 1LDNA 3U0VA 3PCRB 3HP1A 5AXBA 4BKPA 1AGNA 3L8HA 4HZUB 4X44A 1KFJB 3ZGOA 4D4LA 1F2TA 4XGQA 2FQXA 4NG4A 1G8SA 4P53A 3GQBB 3WDLA 5DHUA 2B83A 1ACLA 3NZEA 4HMOA 5FNVB 2HRCA 5JD6A 2XNJA 2A3RA 1AO3A 4JI8B 5JC1A 3I2YX 2O0MA 1QHYA 3KQKA 4J1NA 2B3TA 1WOYA 4H6XA 1C9EA 1JKFA 4QATA 3IQIX 1QTQA 1W87A 3GF4A 2O2YA 3NBXX 4LYHA 3WLNA 4BAGA 5AKZA 2R4TA 2Q7DA 2OTCA 3MMXA 1FYFA 1E1RD 4I1SA 4POAA 5KC8A 5LKAA 2ZSHA 3GZ4A 3U6KA 2P30A 4RTNA 3CH5A 1WMFA 3PFCA 4O4LF 1Q19A 1Y5RA 2QJRA 1K89A 2XEXA 2ACVA 2AGVA 3VSDA 4IIEA 2DF8A 3ZDAA 3FMVA 1H1TA 3ZZ0A 2Q21A 3HFSA 4KXMA 3T61A 3CE9A 3ICVA 4KPUA 1XTUA 3KSDO 1TF5A 3IP7A 3BHNA 3OHMA 1CY1A 3AQ4A 4KYIB 5CLGA 5JCZA 1ZEJA 1X1EA 5LQJA 4ARAA 4Z53A 5EJEA 3UYKA 2XKAA 3KOZA 1G63A 2KBEA 1O57A 1S1MA 4X84A 1FRNA 2W6NA 1E1LA 1KYQA 1DAPA 5EZSA 3WV5A 2DHDA 4B0OA 4B4WA 4B48A 1H05A 1QP8A 1A9XB 2P8JA 1T4CA 1TIPA 3HDTA 4KIWA 3EF1A 1JH9A 5K0TA 1U0LA 3EQ2A 4DTCA 4ZKDA 1JXAA 1JDBC 1DJPA 2YASA 3IOYA 4ZCPA 5TQVA 4B8ZA 2QUJA 1GTRA 4FIZA 1Z8DA 2VXOA 1M5RA 3W6UA 1G21A 4ZCTA 3OLXA 2ZXEA 3A28A 3REFA 2YCLA 1G0OA 3T0FA 3DVAB 3ED5A 4AP6A 4BBAA 5K8TA 1HLPA 5IK2D 5F3WB 3SC3A 1WVIA 1CUEA 3W2EA 4H08A 2R62A 4QUKA 1E5DA 1LZKA 1XZDA 1S7CA 2CNLA 1A5AB 1JAHA 4FX5A 2QRVB 3OX4A 5E1MA 4MUNA 3W7AA 4LDJA 2C4UA 3IXLA 3EC2A 4LVOA 5E0KB 4Y8VA 2HTEA 3LIPA 5IWCA 4M98A 3INRA 1WXQA 5BSVA 2O59A 3DAOA 2R96A 5BYBA 4QUGA 4BFCA 3WYEA 1SCUA 1SY7A 4PSAA 2J4FA 1DUSA 4IFBA 4F85A 4M60A 1Z0FA 4J7CA 2E1PA 3E84A 2R6HA 2OGSA 4K9LA 3WKCA 3DG9A 3V2UA 2PFSA 3FD8A 3LFHA 2EW2A 1WNTA 4YV7A 4JENA 1CLEA 2WAOA 1FDVA 1Z2AA 1LBIA 3B6JA 3WIVA 3VR6A 4GYKA 3TKAA 4WH0A 2W90A 4KSYA 3GPBA 5FQNA 2PGJA 2IEBA 4BNMA 4INAA 4GVXA 4NE2A 4JP8A 5IBRA 2JLWA 3O5AA 4I4TB 3V7UA 2HQBA 5HQJA 4YN3A 5C8VA 3RIYA 3ZN2A 4EECA 4KV7A 4ICIA 3S28A 2WF9A 4JAVC 5CLQA 5KHLB 4PZUA 5JYDA 5IS2A 2ZRHA 4UUAA 1L5MA 4EABA 2AOTB 2V03A 2ZI5A 1J2EA 2IUFA 5FD8A 2GETA 3VNVA 5DNVA 3VV3A 4P84A 2DPMA 1NVAA 2G71A 4KR2A 1JR3D 2NUPA 1XFDA 5LVAA 4AMZA 3BD9A 3IUNA 3KOMA 1F06A 2XLCA 4YC7A 5D3ZA 3MMNA 2YDXA 1KYVA 3K96A 4UHEA 3ZHBA 2FEKA 3JARB 1TMGE 2XIJA 4IWNA 2PMEA 2R8XA 3LGAA 3Q2KA 5TQ2A 1ZNYA 3FI0A 3OCJA 2BFFA 4GEKA 2IEDA 2C4KA 1GKLA 4HWPA 5LQNA 1WL8A 2EARA 5KWIA 1V4VA 1GGNA 2IBSA 4UUOA 3UAZA 3C4QA 5K5EA 2DAPA 4I55B 3CNQS 4MROA 4IYJA 4DKXA 4RGYA 1DLJA 3ZXIA 1N33B 3K5PA 1JT9A 1U3FA 3FWZA 4CR8A 2ZIFA 3WJAA 2QLBA 2CXTA 4Q7JB 4UTXA 5KU1A 3KFVA 2WWHA 4MYSA 1II8A 3DAGA 4ZCMA 3MBIA 3STVA 5CD1A 4HH0A 4MV0A 1SXPA 3CR8A 3EVDA 1V11A 3A6EA 3COSA 2H9AA 2OWEA 3E1GA 3C45A 1SBHA 1SZDA 2IHJA 2VNHA 1Z26A 2J07A 2ZE7A 3D7SA 2PBRA 4JHLA 4L6IA 3EWAA 4Q0MA 1Q2XA 5GONA 4DCUA 1P2FA 3NM4A 2Y68A 4NBRA 1AKMA 1HT2E 1GGFA 1CIJA 4BYGA 3LUAA 1CYDA 4AUKA 2J7KA 4JSTA 5M3BA 1MEOA 2JLRA 2YWDA 1VHJA 1VKNA 1SKMA 5CFPA 3BCRA 5DE3A 1YF3A 1H4QA 1E4OA 2CBGA 4TMTA 1XRNA 3R3ZA 1K92A 3ZWNA 1GUDA 3AETB 4JLSA 2X8JB 3A6JA 1E2EA 1DC8A 3KQTA 2A1IA 3CZ4A 1NW7A 3O1HB 3LXXA 5ISMA 4IP0A 2VI5A 3W2HA 3O8RA 4UTZA 4V0LA 1CF4A 4XEHA 3P20A 1A9QA 3D0QA 4CWAA 4K6GA 3ETCA 2GEDA 3BJMA 3LBAA 2AX3A 4LV6A 2OG1A 4EGJA 1SOUA 3T1NA 1RJEA 1VI6A 5GVSA 3SR4A 2GBLC 2R44A 2B8EA 2C97A 4OQMA 1GFWA 2E6UX 1X42A 3LY9A 2FJ0A 4RJKA 2L17A 3U0BA 1Q0RA 1L7NA 1BXRA 1RZUA 5AVJA 1RI1A 1Q3TA 4INZA 1SBTA 4LZZA 1ISHA 3C7KA 5BSFA 1PT9A 4C08A 3HEMA 3CRNA 4EUEA 1YFLA 4GYWA 1Y7HA 4ZYWA 5BSWA 1B8OA 3NJ8A 4IG9A 1YTUA 5FH9A 1P4HA 13PKA 5AWFC 1IZZA 1QDLB 3IEIA 4O5OA 4XFJA 4J49A 1XTZA 4CRWB 1E3QA 1MTZA 5L95A 5D3MA 1WVGA 3A4TA 2BOVA 3NUQA 2NSYA 3HMQA 1G66A 2XUHA 3I6ZA 1QFZA 5HSGA 4BFUA 1GWNA 2HO4A 1GNVA 2IZZA 2CHGA 2O1SA 3LQ4A 4OQZA 4PGMA 3VX3A 1AHNA 4OXKA 5CEEA 3DVSX 1O8BA 5DHAA 3ZK7A 5KTOA 3QX7A 3DQQA 1VJ0A 3BHMA 1CDOA 1ZN8A 2CHEA 4YUVA 3ZUPA 3PLAE 4ZXFA 1EFTA 2OCBA 3MSCA 2QAGC 4RX1A 2VJDA 1E0SA 1E5QA 1AKNA 3BXGA 3H1FA 3W5DA 1EA5A 4FINA 5DCYA 4XXHA 2VQ6A 2R5FA 3C3KA 2OZPA 3KDSE 3HKDB 4YDRA 2JZNA 4QECA 5AUNB 5DK4A 5ALUA 3D59A 3S44A 3WL8A 3KYBA 1USUA 3FSJX 4DC0A 2PZ8A 4ZIRB 3C8DA 3GUVA 4QU8A 2JCVA 1GU7A 3KXDA 3ZNPA 4YUAA 2JFBA 4ZQGA 1KJ9A 1RXWA 2H2IA 2E3JA 1O0SA 3HJHA 2AK3A 2H2GA 2Q4BA 4F92B 5GAJA 4XIYA 1AV7A 4WLOA 3P2EA 1Q44A 3QXXA 4A8JB 1U11A 3RRJA 2XADA 3GLFB 5DLQC 4CKWB 2B1QA 4JYAB 5LLSA 1KY4A 1XD9A 2ZIVB 4FS3A 1OB2A 3WYBA 1RXVA 4GDFA 4MKRA 3KEMA 1HZJA 3DWFA 3EA5A 3KQMA 4OJYA 5IFLA 2IXBA 5IC5A 10MHA 5TJHA 3AG5A 4K9SA 1CF2O 5J2TF 3RE1A 4GSLA 1ZINA 3V4VB 1AO0A 3OPYB 4D43A 2H7YA 2QX7A 2CDAA 2ZI7A 4WY2A 4A16A 3T5AA 1AQ6A 1Y6QA 1ZQ1A 1B0AA 2QKYA 3BXEA 3CLHA 4XIJA 2PSDA 3A11A 2V7QD 3TAXA 2RHOA 3DAFA 2X2OA 1Y1LA 1IWOA 2ANCA 2C0PA 2O50A 3UXHA 4RF5A 1ZZGA 3ND6A 3QU9A 4KXFB 5BSGA 6REQA 1EUCB 1GT6A 4K9RA 4FYMA 3P0FA 3LJKA 1LK7A 4YWHA 3SWWA 2X7HA 1WIWA 4HAUA 3IT3A 5G1NA 4DDTA 1E3SA 1S9HA 1SOAA 3CJRA 3PHCA 4YR9A 2HIMA 3F73A 4FYHA 3VNAA 1A5TA 4NMLA 5GJVC 4D97A 3NKLA 4YO7A 1N6NA 1R3UA 3AI7A 1N8NA 5CX1B 4DCOA 1JNXX 2B37A 4HNSA 4K9OA 3NASA 4W5JA 1Y42X 1F17A 1TUGA 3H11B 3Q7SA 3UGJA 1F4PA 1ULAA 3IDSA 3RWMB 1UMCB 1SIOA 4JP3A 1M2HA 5DTQA 3D4LA 2JH8A 4XI9A 2C3OA 3FOCA 4IV0A 1OJLA 1XF1A 1TUEA 1X74A 3MS2A 5KVQA 2ZZNA 2CSUA 5EGSA 2Q45A 4DLSA 1VJTA 2FZCA 3D6FA 2YMLA 3DW1X 2YFHA 3GJQA 1VKJA 4JKOA 2ZS7A 4E21A 2ZRJA 2DJIA 2I87A 4KHZA 5M04A 3IERA 1WETA 1G8PA 2XHZA 4WLUA 2VSQA 3ZLJA 1OUMA 4PX5A 5CFZA 1XG5A 3HJBA 4E5KA 4X90A 1H5UA 1KAOA 3H2JA 4OKIA 4BZZA 1D09A 2UVQA 4IHAA 4W7HA 3BL6A 2PT9A 3UHAA 2F3PA 4DPKA 5BR7A 5C8DA 3NIFB 1RJDA 3I8OA 2Q7OE 3PC4A 1O96B 3OOEA 3DGEC 4AZTA 2IYTA 5ELLA 2IYUA 4INOA 1CCWA 1Y4ZA 4JR1A 5C8YA 3ZE2B 1RPNA 3OTHA 4UMEA 4QEKA 4RMJA 2WKWA 3ENZA 2WABA 4ER6A 3RHZA 4EL0A 4LE1A 3VC3A 1YBHA 1K7FB 1R1DA 2XOKD 4CV1A 2HW8A 1UKYA 3DPSA 3DHWC 3M8KA 1KI6A 1TYDE 1OGYA 5IH3A 1WMAA 1X1AA 2OD2A 1PG2A 1ZOPA 3QF7A 1FFAA 1NLMA 4NDNE 4PGGA 4FZRA 5FPYA 1T2CA 1PFVA 2OAP1 4Q1FA 4HADA 1GKKA 1OYYA 3ZNQA 2Q1UA 5KS2A 1PZXA 1M6HA 1DKOA 2GHIA 3PL1A 4YNBA 4MWOA 4JX9A 2RSLA 3JAWA 4EQZA 1GY8A 3OAAD 3TVTA 3CVVA 1BDIA 1I01A 5IBPA 1L7DA 3I61A 1UK9A 1WUIS 2ID4A 2MCFA 3KEFA 4WECA 2AKEA 1IH8A 3KSBC 1YMUA 2XZDA 5KTRA 1E0JA 1BIFA 2BFDB 2A84A 4Q93A 4RETA 1W25A 1REQA 2QN2A 3CZAA 3I01M 1P2BA 1XLTA 4OB8A 3UT0A 1DADA 1I36A 3DVLA 3BREA 3FMGA 5FPSA 2GK7A 3GA7A 1JQJC 4GKBA 5KTTA 5K0FA 4FILA 4O0LA 4OMFG 3ZCXA 1IVSA 4YCDA 1LJLA 3B2QA 3TIGA 4O4LB 1TU4A 2WUEA 1YAHA 1BCRA 2G7MC 3C98A 5CVEA 1QHEA 4KWCA 4RZIA 721PA 4TT3D 3P96A 1CY2A 2J41A 1JVBA 4P7GA 2WTEA 4RVCA 4ZZ2A 2H48A 3R6WA 4BMNA 3Q3CA 3AKZA 3FNEA 1RQRA 2WU0A 3A10A 2Q1WA 2DFLA 4CR7A 2CF5A 4MVJF 1T8YA 4IO0A 4QGGA 1VHTA 4OFXA 3TH5A 3KYDA 2E21A 2PJDA 5CVJA 1V26A 1CQJA 4JCOA 4MMYB 5GM2A 1MVNA 1QAMA 1M2EA 2BZ0A 2H59A 3GJSA 4YRIA 1Q0LA 8LDHA 3CBGA 3LYLA 5BOVA 3BOSA 3LUHA 4FUQA 3WVNA 3ZV7A 4EFLA 2CFRA 1QGOA 1G4UR 3MS4A 4MS4A 5SZHB 4TSKA 4TN1A 3WMWA 5EEHA 5LQRA 1KE2A 5HE8A 3A7DA 2JBWA 2IXGA 3BMOB 1P1HA 5JWRA 2DERA 2GRAA 5I4IA 1V39A 1ZKMA 2IEGA 4GOXA 4CEIA 3W1EA 4OI2A 3UPUA 1P6XA 2R85A 1DKQA 4WKGA 1ZIXA 1QB8A 1I3NA 3QFCA 4NARA 5FO0A 1WSBA 3ORFA 1Q1BA 5EWMB 1SOMA 5TF4A 3HV0A 1WDKA 1JF8A 1U9IC 4HZGA 4XVQA 3CGGA 1P8AA 3K6SB 3AEZA 2FPPA 4DLRA 5BSMA 4OQYA 2GYYA 2ZUBA 1YVRA 4BZWA 1BQ4A 4V38A 1D9XA 3BRQA 5ES4B 1EH5A 3CG0A 1N5OX 5FUXA 5KSZA 4ZDKA 3CVOA 3IDZA 3QHQA 1JSZA 3W34A 1HYHA 2H5IA 4FFPA 3TW8B 2II6A 4FBMA 3AUAA 3CHYA 3W1WA 4W1SA 3C24A 1NVMB 2BJHA 2P3OA 3L9XA 3M1AA 4FC7A 2AG8A 4YCSA 2D62A 3LRPA 4M0CA 2FOXA 3ZJUA 2VUIB 3ZE7A 4UVEA 3IQEA 3HVJA 1PGNA 2A5LA 5L4NA 1IRIA 2V8BA 3GPCA 1J1UA 5EMKA 5F7ZA 3Q3HA 4G85A 2A59A 1H65A 2NVBA 1XVLA 3IKVA 2AFHE 3KK0A 2GN6A 4OHCA 2JFQA 2ZSFA 1FFXB 4G5RA 5C1OA 1COZA 2RHRA 2HNAA 3BIWA 2JVJA 4MS3A 4MKGA 3RM3A 1N78A 1JE0A 4PNZA 3AF6A 2H4YA 2F67A 1A4IA 2VUTA 3BVPA 1TF2A 5JLJA 4RZ2A 1LEHA 2KHZA 1YB1A 5ALYA 5BQFA 4YP6A 4C7XA 3PENA 4X1OA 2G67A 1FX1A 3A9WA 1Z13A 1SPXA 4EX6A 2ZQZA 2CMGA 2Y99A 4PC2A 3RKRA 2I1QA 2X0RA 4P3OA 1I0LA 3KUUA 1A4RA 3D3QA 1U8XX 3T3MB 1T0HB 3KZCA 3VR5A 4N40A 5IKMA 1YE8A 4JYBA 4PR3A 4QQNA 5DP2A 4BHTA 3WRXC 1BDMA 4UHFA 4IX1A 4DMMA 1S8NA 2RH9B 2CVOA 3MRVA 4HLQB 4KIFA 6AT1A 5JSQA 3HNRA 1MRNA 3W7VA 2G70A 1SC9A 3W3AA 5ALVA 4HP8A 4OL9A 2HBYA 3BZWA 4RJJA 5AESA 3R5XA 3H5NA 4DR7B 3OFNA 4ZALA 3LPCA 1P6QA 3A6ZA 3G2KA 4I1OA 2J9FA 3IMKA 4PAWA 3K6KA 3NIWA 1AS2A 1RT9A 5KX5F 3N07A 4R31A 4BBZA 1DJNA 3X1ZA 3IMGA 2CDCA 3C85A 3HCDA 2I6QA 3Q5GA 4B9EA 5KKNB 5HILA 4Y6PA 2XPCA 3BHJA 1Y3CE 1WSWA 2XTMA 2XWJI 2GFIA 3O1JC 4Z9XA 4EYEA 4BBJA 2YBEA 2DBRA 4RWEA 1UKEA 1J8MF 5I9BA 3ZKWA 2OSBA 1PN3A 2JIBA 2PWPA 5KYWB 2BSQA 1SCBA 5BWCA 1QIJA 3KUKA 5DM60 1SVLA 3O0DA 5BNTA 1NPDA 5A4DA 1QHGA 4AZ3B 5CB4F 4MRSA 1YWGO 5A5DA 5AW8A 1H2EA 3NWPA 4G2NA 4Q3NA 4AN0A 3RUPA 3VPGA 4OMUA 4LRSB 3GNTA 1M1XB 2VAXA 3QBTA 4GP9A 4RHUA 3KB6A 2I7XA 4LWZA 1QM5A 3F96A 5BXYA 1BWPA 3LVRE 4NENA 5FA8A 4PLFA 4D8UA 3R74A 4MSUA 2WWTA 3QPAA 4LOKA 5BSRA 3S27A 4YYEA 5AI9A 5C9ZA 1CF9A 4MQEA 4A9AA 1VIVA 1PWXA 3K9FC 2OE2A 1E6MA 2QTVA 5G1OA 3HR4A 3NCTA 2QB5A 3ME5A 1H94A 3CURA 3NC1C 3B85A 4FQ5A 4II3A 1JG2A 4PSDA 2WSMA 1KKMA 1Q0UA 1U8FO 1YCHA 2B82A 5GTDA 5DRYA 2H6EA 3F3MA 3R3JA 4M1TA 1BX1A 1SKAA 1YZYA 2H18A 4KQMA 4PZPA 1J9ZA 2G25A 4ZQBA 3TL2A 4ATNA 5A9RA 4PPQA 3COVA 1E32A 3WHPA 3PJRA 1NR5A 3G8YA 1V8BA 4L16A 2Q5HA 4YIKA 4BP1A 1ORVA 3A9VA 4N7MA 3I9V6 1T5OA 2WFZA 5IW8A 1D4ZA 4EA6A 1KMCA 2OHOA 2BDUA 3A1WA 3K0HA 3TBFA 1LTHR 4AXBA 4CG1A 1XCJA 3OFJA 1E2FA 4LZAA 3WK7A 1RBMA 3CZCA 3X2SA 1UK8A 2JS7A 4YPVA 3ND8A 3T54A 3FUCA 3EHEA 2I33A 3K1YA 2GDJA 4O4JF 2MINB 2Z5GA 3QU4A 3WLIA 2WRZA 4DQ0A 5JZMA 1N3LA 3OZEA 3UQZA 1LBTA 4FHEA 3A27A 3OEWA 1GLVA 1OE0A 1EFRD 2HJWA 4FIDA 3KWMA 4NBLA 3N8DA 3LU1A 3RC7A 3SFZA 3R9XA 1N2JA 4U7PB 4IVPA 1MCZA 3A4VA 3WJ2A 1LNSA 2ASVA 1SUIA 2I8CA 1QX4A 4N4AA 3QFSA 1F14A 1ZHFA 4TLBA 4H6VA 2P9CA 4D9MA 2PU5A 1XZHA 2F90A 3H9UA 1KZ1A 5JRZA 1XQ1A 1XO1A 3GEDA 2QS9A 4XM2A 3LZCA 3ACDA 3R3YA 1YIAA 1IQ0A 4K0RA 1LDBA 1QGAA 5JBQA 5JYEA 1ZMRA 1ZCFA 3Q8WA 3ZDYB 1EFLA 4G1BA 1IAVA 3V7YA 4DMCA 4BO9A 3V5NA 2ZXUA 2NXNA 2YNMC 2NZUG 3PJGA 4ZCQA 2K87A 3KTAA 1KA9H 4WTOA 4I1PA 1BJTA 2PWZA 2R5NA 3G7UA 4BC0A 5ITZB 4P82A 1RKXA 4B7ZA 5FTJA 4ENTA 2G08A 4UU1A 5FFFA 3DMTA 2Q5QA 2QL6A 4J2HA 1OGJA 2YWXA 5E4TA 2NP7A 1I13A 4LZPA 2ZAGA 2YXEA 4CM4A 2RARA 2GCNA 5I9NA 4MOWA 1Z8FA 1HE1C 2W4MA 3CWZA 3EW9A 3H2ZA 4RS4A 4IO1A 5FOUA 4XD2A 3MTIA 4RHCA 5FWYB 2NU6A 3RDPA 4D6PA 5BVGA 2OOKA 5J2TB