4PCAA

X-ray crystal structure of an o-methyltransferase from anaplasma phagocytophilum bound to sah and manganese
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
221
structure length
221
Chain Sequence
b'HHHMRNVSLSKQDEYLNKLFAVDTEGALKAHKTAPSELRMAQLGTVEGQMLQLLIRMAGIHSIVEVGTCVGFSAICMAHALPSKGHIYTIEKDYENVVTANQNIVNCKLEDKITVLHGEALAQLNTLKEMAPFDMIFIDANKSSYLAYLNWAKMYIRKGGLIVADNTFLFGSVFDEHPTEKVSSNAHASMRAFNDELANKEKYLSTIIPTSEGMMVSIKLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An O-Methyltransferase Is Required for Infection of Tick Cells by Anaplasma phagocytophilum.
pubmed doi rcsb
molecule keywords O-methyltransferase family protein
source organism Anaplasma phagocytophilum str. hge1
molecule tags Transferase
total genus 81
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pcaA00
3NJRA 5FUBA 2BH2A 1UIRA 2QM3A 3HVJA 4RTRA 4C08A 3Q87B 2PSSA 4RTMA 2VZ9A 4E33A 4FR0A 4POOA 1I1NA 4RTSA 1TW2A 2OPBA 2AOUA 1X1AA 2Z6QA 4HG2A 5FULA 4GEKA 5G02A 5ICCA 5EMLA 1SKMA 1WG8A 1VIDA 3G5LA 5KQRA 3C3PA 3P8ZA 3GGDA 1KPIA 1QYRA 4DCGA 3KPUA 4HTFA 3GRZA 3UJAA 2I7CA 5EZSA 3KPYA 4FP9A 5DRTA 4A6DA 3BUSA 3OE4A 2ERCA 1EIZA 1L1EA 5DX0A 5GP1A 1AQJA 3DULA 3RODA 3K0BA 4X61A 9MHTA 3JWJA 2OY0A 3KPWA 3MTIA 4DCMA 2P35A 2P7IA 2PBFA 5DM4A 3CCFA 3R3HA 3V97A 3ERCA 1XJ5A 5F2KA 3KR1A 3FTFA 4PGGA 3HCDA 2YXEA 3V8VA 1O9HA 3EVGA 3P9IA 4FSDA 4AUKA 4EKIA 3E05A 1ZHFA 3E23A 4L7VA 4AX8A 4E30A 4ER0A 4YUVA 1FBNA 2HWKA 3DMGA 3THRA 3HCEA 5DXAA 3R24A 5HZMA 4Y30A 1VLMA 2P1DA 2UYQA 3EEYA 2H00A 4MIKA 4DM3A 3PTAA 2XYRA 1BC5A 1N2XA 3FTCA 2XVMA 3TKYA 3LL7A 1XXLA 5FWDA 4GC9A 1OR8A 4RVFA 4M37A 4F84A 5LQRA 1YUBA 4R6XA 2B2CA 3BKXA 3KKZA 4NECA 3OU6A 3GXOA 1P1CA 4R05A 4FZVA 1SQGA 1JG2A 5E9WA 3GDHA 4RTJA 2GA9A 1EJ6A 1M6YA 3LDUA 3P2KA 3CKKA 2ZBPA 1DCTA 2F8LA 4PIMA 2BZGA 3AJDA 5CVVA 2OXTA 4FGZA 2O07A 1D2CA 4R6WA 2P3QA 1G8SA 3NVMB 4JXJA 4A6EA 4YUWA 1BHJA 1JQEA 2ADMA 2EX4A 1VP9A 1F38A 1NW6A 3QOWA 2ZWVA 5FWAA 1DL5A 4DF3A 2ZIGA 4PYJA 3T7SA 3TM4A 2BR5A 3GCZA 2IPXA 2PV0A 3LDFA 4EQZA 3B5IA 1ZGAA 4FSXA 3KQMA 5E8JA 1JG1A 2PGXA 5DWQA 3CC8A 2BR3A 1Q0TA 3DLCA 3DXXA 8MHTA 3LBFA 1WXXA 1AQIA 3OU2A 5GOZA 2GH1A 3D2LA 3I9FA 5EEGA 1NW3A 3AXSA 2PX5A 4MQ4A 5EIWA 5EKXA 5FCDA 3DR5A 2Y1XA 1JTFA 3TQSA 3A4TA 2EG5A 1EQAA 2AOWA 3M6VA 5EQJB 4KRGA 3SX0A 3QOXA 2QRVA 3NMUF 2NXJA 2CMHA 3NTVA 4BLVA 2NXCA 2YQZA 3ME5A 3TM5A 3GRUA 4M36A 4QDJA 3LKZA 5D1NA 2ZVJA 4ISCA 4C07A 2IGTA 2BM9A 4G56A 3M33A 1TPYA 4QVGA 3LSTA 2LD4A 2ZBRA 3MCTA 3HM2A 1WS6A 3SSNA 4HGYA 4RTPA 2EFJA 3EGEA 5EIFA 3OZTA 4KDRA 2GB4A 2EJUA 4DQ0A 4IWNA 3UJ7A 2AOTA 2AN5A 1NE2A 4OA8A 3BGDA 3AXTA 1X1CA 2YVLA 4KW7A 4M7RA 2ZFUA 4PWYA 5U4XA 4PYOA 4GOND 3UA3A 3TMAA 4OBXA 5CVEA 1X1DA 2UZ4A 2AVNA 2OO3A 3HA7A 4U7TB 4RV9A 5K0EA 3KQQA 1NBIA 3P71T 4KWCA 5EOVA 4XUEA 5DXJA 4AZWA 5C1IA 3EVBA 3TOSA 1FP2A 2AR0A 1G8AA 2GS9A 3P9CA 5GM1A 3HNRA 1WXWA 5KVAA 4ER3A 4PINA 4OA5A 1SUSA 5EEHA 2NP7A 5K05A 4EKGA 1R18A 2VDUE 4GUAA 2PLWA 1NW5A 3DP7A 3JWIA 3EMDA 5EHGA 5EMKA 4UOEA 3G88A 2HR1A 2K4MA 2AN3A 5K0NA 3KQTA 3KQWA 4E70A 2O0LA 5C0OE 1YFJA 2CL5A 4IV0A 5K09A 3FRIA 4X60A 4QDKA 5EC8A 5E9JA 5T67A 3C6KA 5DM1A 3SM3A 1P1BA 3FUWA 1L3BA 4YV0A 1QAQA 3KR9A 3UJCA 3PVCA 2PX2A 3ANXA 3GJYA 1MHTA 4P7GA 1G6Q1 1NV8A 3BWYA 5HFJA 3Q7EA 2JHCA 5E8RA 4C03A 2G72A 2QE6A 4LG1A 4PCAA 5DM0A 4OQEA 2HNKA 5DSTA 3UWPA 5HIKA 4H0NA 3UA4A 5E1MA 2YR0A 2IDJA 3MB5A 4BP1A 3A25A 2AOXA 1RI2A 3SSMA 1XCJA 1KPHA 2ZSUA 3NDJA 2XBMA 4YUZA 1KPGA 3FUVA 4XUCA 1DUSA 2PKWA 1HNNA 4RTKA 1RJDA 2AN4A 2UYCA 3P97A 1D2HA 1U2ZA 3PFGA 3LX6A 2PT9A 5CVDA 4YUXA 2WA2A 4RYLA 4EMSA 5GINE 2BM8A 3PX2A 1KP9A 3LGAA 3FZGA 3OE5A 2V7EA 2KW5A 4E31A 5HILA 5LQNA 5CVJA 3KQPA 3FPHA 3TR6A 3HCFA 1KIAA 3MTEA 2AVDA 5LSAA 1IY9A 4HC4A 3I53A 1VBFA 2ZWAA 3LCCA 4P7FA 1BKYA 10MHA 3BKWA 2IIPA 2NNWB 3CBGA 4X1OA 5DSXA 1JG3A 3E7PA 3ELWA 4C04A 1PJZA 4ER7A 5K01A 3HVKA 2VDVE 3IEIA 1EAMA 5DM2A 2YUIA 1G38A 3LKDA 3P2EA 3KR0A 3R9XB 4HGZA 4Z2YA 3RW9A 5KQSA 2AS0A 1M6EX 5BW4A 3UBTA 2CKDA 2VS1A 4FS8A 4F85A 1JR4A 2ZZNA 1RI3A 3FYCA 4ER5A 5ERGB 1XDZA 1YB2A 2YXLA 2HV9A 3ELDA 5E2BA 5IH3A 2G8NA 3FUTA 3P9KA 3BWMA 3HA3A 2PX8A 4QTTB 4YMHA 4GOOD 5H02A 2YX1A 1ZG3A 2AZTA 1P39A 1Y8CA 3BGIA 3FRHA 3SGLA 3K6RA 3LCVB 3TKAA 5M5BA 3FYDA 2B78A 2IFTA 1KHHA 1JSZA 4PCLA 1VL5A 1RJGA 4KIFA 4FT2A 3LPMA 1QZZA 3P9NA 3SSOA 5IKMA 1YZHA 4QQNA 4AZSA 3G8BA 1RJEA 4IV8A 5E1DA 3KQVA 2IBTA 3EVCA 1M0EA 4CKBA 5EMJA 3EVZA 4B17A 5DTRA 3GRVA 2AOVA 2P8JA 3A26A 1QAOA 1QANA 2R6ZA 3GRRA 3PS9A 5GM2A 4AZVA 4RTOA 1O54A 3G7UA 5E1OA 4EVIA 5K0JA 3B3GA 4K6MA 3KHKA 2C7QA 5E1BA 5EPEA 4GQBA 3G2MA 2GAFA 3FPJA 3S68A 3IYLW 3OZRA 1SVUA 4KIGA 5DT2A 3EEOA 2WK1A 3PB3A 5DRYA 5HIIA 2N47A 5K0FA 3B3JA 2JJQA 4HRAA 3NVKI 3CJQA 2PJDA 1JG4A 3SVZA 1L9KA 3VSEA 2FPOA 1EG2A 4QVKA 2ORED 3OFJA 3SR4A 1KYWA 1YFLA 4MWZA 3X0DA 1X19A 4OBWA 1L3CA 1T43A 2XVAA 3CJRA 3EGVA 2V74B 3R6TA 5FA5A 5K0BA 3I58A 3OU7A 3HCAA 4P7KA 3T7TA 2FYTA 3JWHA 2I9KA 4IKPA 4V0QA 5K0GA 3G5TA 5CIYA 2ZZMA 2NYUA 3E8SA 1XDSA 5T64A 3HP7A 3HVHA 3GIWA 3ID6C 3MQ2A 3ER9A 2B3TA 1JSXA 3LECA 5EG5A 3ORHA 2C7PA 4YV2A 2IH2A 2IH5A 4V0RA 3KQYA 1KXZA 2XYQA 3FPGA 4X63A 3O4FA 2FHPA 3JWGA 4RX1A 2CMGA 3HVIA 2FCAA 4R8SA 5DX1A 5K8VA 1HMYA 3ELYA 3G2OA 3M70A 4R8RA 5HEKA 1IM8A 3EMBA 3OZSA 3MCZA 1ZKDA 4RTLA 1JQ3A 1RI5A 2OB2A 2PXXA 2PY6A 4LECA 3O31A 1AF7A 2PWPA 1RI4A 1R8XA 1VP3A 2JHPA 2ZTHA 3UZUA 3GWZA 1EJ0A 4C4AA 2JHAA 4E2WA 3HCBA 3PT9A 4PGHA 3NW9A 2YTZA 2H11A 5ICEA 4ATNA 4M38A 3BT7A 4KVZA 4PYQA 4WVLA 2C7RA 3CGGA 3C0KA 3MGGA 4E32A 1SUIA 3I64A 3BWCA 1G60A 2G70A 4RVDA 5FQOA 5KYGA 3DH0A 3NWEA 5HOQA 1ORIA 2EJTA 5LQKA 2ZCJA 5CVUA 3NDIA 3TRKA 3H2BA 1NBHA 2FK8A 3I5UA 4E2YA 1G55A 4PONA 3L8DA 3LHDA 3TLJA 4OX9Y 5JR3A 5ICGA 3EVDA 4HH4A 3LCUA 3C3YA 1SG9A 4XUDA 5C9ZA 3DOUA 3PLAE 2C7OA 4RWZA 5ICFA 2G71A 5D1HA 2Y1WA 5FTWA 3T0IA 4BP3A 3B7PA 3EVEA 5EGSA 3T7RA 4OQDA 2PX4A 3VC1A 4YMGA 1NW8A 3EGIA 4BLWA 3CJTA 1NKVA 2IH4A 3HTXA 1N7IA 2JH9A 4RSRA 2OYRA 4HSGA 3AWIA 2R3SA 4PNEA 5EMMA 1R00A 4YV1A 4YUYA 4MHTA 2ESRA 4E2ZA 4PYKA 5BW5A 3FUUA 2OB1A 1ZQ9A 2FRXA 2ZIEA 3M6XA 5FHRA 4LWPA 2AOUB 3DLIA 3FPFA 1UFKA 2PXCA 3DMHA 2P7HA 1X1BA 3B3FA 3BWBA 1N7JA 3HCCA 4GBED 4X41A 5DTQA 5B1SA 3TPZA 2NXNA 4BLUA 4DA4A 2BR4A 3THSA 1H1DA 1XTPA 3M6WA 4AZTA 5K03A 5CCBA 4HTFB 4P58A 4CKCA 3M6UA 5GIPE 4DMGA 2DULA 3M4XA 5K0CA 3FTEA 4EK9A 4DKJA 2I62A 2QYOA 2Z6UA 2FK7A 1NV9A 1I4WA 1RJFA 2P3OA 4E2XA 5EKUA 2ZW9A 3A7EA 3G8AA 4RVHA 4Y2HA 2HMYB 1YF3A 5DTMA 2PWYA 2IBSA 1XDUA 4CXMA 3KQSA 3G2QA 3KR2A 3LDGA 3TFWA 5HIMA 7MHTA 3UJDA 2A14A 5DLYA 3OFKA 2O06A 3G89A 1KYZA 1B42A 1F3LA 2ZLBA 4QPPA 3MERA 3LBYA 1NW7A 5EVJA 1YZ3A 2VDWA 3GU3A 4RTQA 5K0LA 3BZBA 2B25A 1IXKA 2PT6A 1O9GA 3FTDA 3UJ8A 1D2GA 1FP1D 4PYMA 1Z3CA 3VC2A 3HA5A 3UJBA 5GWXA 3IV6A 5JUWA 2P40A 1RI1A 3GO4A 1NT2A 3DXYA 2XYVA 1ORHA 2IDKA 1JQDA 1JTEA 3GRYA 5GIOE 2WA1A 2ONYA 2G1PA 3EVFA 4F86A 1KR5A 2NP6A 5E9QA 3MAGA 1R6AA 2DPMA 3KPJA 5BP7A 2Z6AA 1V39A 1ZGJA 2JH8A 2UYOA 3KU1A 4GC5A 3SMQA 2GLUA 2P3LA 5EHIA 4CTJA 5P8WA 1Q0SA 3EPPA 4RVGA 4O29A 5CM2Z 3ELUA 3G2PA 3PX3A 3BXOA 3RIEA 3A27A 2O05A 3SXJA 2Q41A 4RTNA 3REOA 3DUWA 2JG3A 2P41A 4WXHA 1L3IA 2HTEA 2VP3A 5KS2A 3CVOA 2OBFA 1MJFA 3KPVA 2E5WA 2ONZA 1XVAA 3EVAA 5BXYA 1SQFA 5LQJA 4QTUB 3DMFA 5DX8A 3DTNA 5CCXA 3OPNA 1QAMA 3ER8A 5LQUA 1XCLA 5DPMA 4ER6A 3NWBA 4XCXA 2ZZKA 2NXEA 4GOMD 1BOOA 2OZVA 1TW3A 3C6MA 5E2AA 2ZULA 4FT4A 4GF5A 2CWWA 3OCJA 4MTLA 2YXDA 4PYIA 5F2OA 4PIPA 4P7JA 3WSTA 4CTKA 4DZRA 3DXZA 1UWVA 2PVCA 2UYHA 2ZIFA 3HEMA 1FJXA 4PYLA 5FHQA 1WY7A 4ZTBA 4QQKA 2QRVB 1I9GA 4GOLD 3FUXA 3O7WA 4PYNA 3R0QA 3VYWA 1P91A 2B9EA 1AV6A 1R74A 3PFHA 3F4KA 4QPNA 3BGVA 3GNLA 3MHTA 5LQCA 5T6BA 5HIJA 4KDCA 3UJ9A 4C05A 5F2NA 5LR6A 3U81A 4BY9E 2PXAA 3FPEA 2QY6A 2O57A 1FPQA 5CD1A 1WZNA 3UJ6A 5EZQA 5LQAA 3A7DA 1PRYA 2IP2A 2ZBQA 2I6GA 3B89A 2GPYA 3IHTA 5FADA 4CWAA 3P2IA 2AOTB 4C06A 1INLA 5FA8A 2H1RA 1VQ1A 4LWOA 3UFBA 5MHTA 1VE3A 3AY0A 4U7PB 5CUQA 1R8YA 2OKCA 3QV2A 4CKEA 3KQOA 5FQNA 1VPTA
chains in the Genus database with same CATH superfamily
3WWZA 3AZOA 1NVTA 5EXTA 1G19A 4D2IA 2Q7OE 3RTEA 3JX9A 1TYCA 1Y1RA 2DCUA 5CLHA 3BJRA 4E4RA 3U3RA 2HBQA 3SCZA 1QRRA 3EASA 2VT3A 2VXYA 2IDMA 5ALYA 4GICA 1DKNA 1VHTA 2VPTA 2GBLC 3D64A 4K6OA 1PF7E 4YECA 4CW7A 3PIRA 4YJ3F 4DCJA 3KWMA 1D8TA 1EFRA 1RRVA 4CM8B 2ZR9A 2SBTA 5LD2B 1XZLA 2H5EA 1FFCA 2HK6A 1CBUA 3TBHA 2RGWA 4RK1A 1L1EA 3FJ1A 5J23A 4DJAA 1JHAA 2WLSA 3RODA 1XX6A 2Z43A 3VU1A 1O8BA 3KSAC 4HFNA 1FYWA 3RABA 1V2HE 3T7JA 1H94A 1DEHA 1Z6TA 2AFRA 1HXHA 2HHAA 1DAPA 5G0VA 3ERCA 5JSYA 3M5DA 4MSUA 1HOTA 5EI5A 3ILYA 3ROQA 3EVGA 3M6MD 1HRDA 3E05A 4F6RB 2XDQB 3F5SA 4FKBA 3PC4A 4I50B 3V4ZA 1C3OB 1KBQA 2WWIA 4EMTA 3B20A 1E0AA 1CJSA 3GEPA 2XWPA 2B3DA 1T5HX 3FNRA 3MIZA 3FPLA 3L77A 4FNGA 4HUJA 4MIKA 5THXA 5KYYB 1Z25A 1SQ5A 4JOCA 2REXB 3BDIA 2CFCA 5KQMA 1M76A 4AQYB 3IV7A 2Q4TA 1HF3A 2NUBA 2RI6A 3FHLA 4QRDA 3EPRA 3KIPA 1L5NA 3Q5DA 3RVMA 5B55A 1MXFA 1R3DA 4R6XA 4J1QA 4MIYA 1EZ1A 4NECA 3DZGA 4Q39A 3VPHA 3ZGZA 1WPXA 1DAGA 2O6LA 1RQPA 3U0BA 5JRJA 1N0UA 1VGRA 3IVRA 1U7HA 4LV5B 5IZCC 1VJGA 2GD2A 4C0HA 1D2CA 1OLOA 3NVMB 4TKUB 4IR7A 4EY3A 4YREA 2P9TA 3RUHA 5JCPA 3W5JA 1T2FA 3WQRA 1XEAA 2HSWA 1E77A 1JLRA 2YJ6A 4MWEA 2QMEA 4B45A 1PWHA 3U16A 1DNPA 2XZLA 4DMRA 3RRMA 3ICVA 5TLSA 4MTCA 1X6VA 3OTOB 2XNDA 3DHNA 3LDFA 4ANFA 1NF9A 3IULA 4KQ1A 4OXYA 4PY2A 1D0IA 1LZKA 4AXXA 5JMOA 1ZN8A 4BKQA 3DXXA 2CFIA 3V1TC 1NYTA 4NULA 1WLYA 1JKMA 2H4YA 1AQIA 1NZJA 3M2TA 3AEQB 3HS3A 1S2IA 3NHPA 1G64A 4JZKA 4RUKA 4O4HB 4ENWA 4QOEA 1NL3A 4C0SA 3GZJA 3A2LA 4V0SA 1R4MA 1O89A 2JFNA 4EVSA 1XQ9A 3WZLA 3MGBA 4R69A 4D56A 5JTTA 2JIPA 1P4RA 1XD2B 4U00A 1E96A 1Z5OA 2HC9A 4QJ3A 4RSMA 1FVXA 1RRGA 2VPZA 2HHJA 1OE0A 1C3LA 2J07A 3C3DA 3ZNNA 4RULA 2O0HA 2FQXA 1NQVA 3VX4A 3E27A 4FMCB 1EJBA 2IXAA 2E4UA 3E1GA 4IFEA 3NUQA 2OKGA 2DLCX 4Y6LA 2C82A 4IS3A 1TKRA 3OZTA 4HY3A 4KDRA 2RC5A 4N54A 1EHIA 5L3QB 2QGFA 2AOTA 3EMVA 1GPWB 4UCWA 3C6ZA 3DAYA 1UBLS 5KWVA 1HG1A 2CMDA 5M7EA 1YZVA 2GERA 5SY6A 2NZXA 4CM9D 1UMCB 1PEKE 2IYFA 3D8SA 1BHO1 2BW0A 1E2KA 2Z3ZA 4IKEA 1VECA 2CNKA 5REQB 5KX5B 2WF7A 1DINA 3CLRC 4DAEA 1MOQA 4UDOA 1X1DA 3VVLA 1HE8B 1Z0KA 3HA7A 1ZVVA 4TRMA 2GJAA 4RV9A 2WTEA 4LNAA 2G83A 5TQ0B 2GZSA 3WOHA 1IVYA 4O4JB 1AKMA 4IIBA 4PC3A 3FFXA 2JKZA 3U7FB 1YJ8A 5KQPA 5KVAA 3HNRA 1BVUA 4LYJA 4G0YA 4U3JB 4XB1A 2C7VA 1Z5ZA 3W05A 1Z2PX 4FOPA 4QUGA 4F3KA 4PFKA 2RI0A 5AJUA 3S7ZA 3G88A 1XYGA 5AUOB 2CJXA 1JQ5A 1NF2A 2G88A 2I76A 2NIPA 3KQWA 1Z6YA 3KXKA 4FGSA 4UEQA 3ZQKA 1Q15A 4JROA 2PX6A 1DIOB 4Q7JB 4CM8A 1H3EA 1R66A 4B0PA 1JDZA 3ANMA 1P1BA 4GSKA 3VYSB 4K9PA 2VDPB 1QAQA 4US2R 3IIMA 3K71B 2N42A 3UJCA 1E2PA 3KJHA 4LXTA 4MLZA 3B51X 2WWRA 4RHTA 4LXQA 3C4VA 4IZ6A 4MYRA 4ZCPA 2FE1A 1Y7PA 3DCNA 5K3BA 1YDMA 4Q1EA 3GA0A 1GUFA 4Q37A 4DT1B 4EECA 1QPGA 2RFLA 4PZUA 4F6RA 2XDQA 2JAPA 3QUQA 4I50A 1AK9A 1CP3A 1C3OA 3M0EA 4EX6A 4JXZA 5IKXA 3WAKA 1MA3A 4PAMA 4EG3A 3VZCA 5KYYA 4H17A 2R8YA 4JX8A 1U2ZA 1WJGA 3Q4GA 4HUQB 5CVDA 1XUOA 3PU6A 3T12A 5EJEA 1A1VA 4G25A 1QM5A 2B4TO 4KFRA 4JLJA 4GLBA 1U0EA 2XXJA 5DO9A 2EDCA 1L1RA 4BQEA 1KVTA 3GR6A 3PQ4A 2YY5A 5CXXA 3OFSA 4QT0A 3SF8B 4EBBA 2IY8A 4ZO7A 3H04A 1QTNA 2C9BA 2I8CA 3GD5A 5AKLA 3O21A 4ALLA 3UMJA 4AP9A 1P4GA 5FYDA 4YT4A 2W2LD 3P2YA 3KYDA 4TKUA 5EP2A 3BE6A 1L7PA 3AM5A 3WYFA 4Q66C 5A4MS 2GAIA 2HCBA 3DAPA 4BNIA 1KMHB 4BCCA 1WTAA 4W1QA 3UCXA 4DBLC 4EPVA 5MFZA 5JROA 3FOZA 2AS0A 4M9CA 3W5HA 1EBBA 3G9TA 1KKMA 3AR3A 1W88B 2OG2A 4INPA 3WQHA 2ZS8A 5I3ZA 2R65A 3A1VA 1KVRA 1IFXA 1F0KA 1Y81A 1TJNA 2QK4A 3IT1A 5FPTA 1F0PA 1HKUA 1P6UA 1L9XA 1YFZA 1BKSB 2X77A 3NC1C 4TYPA 1ONBA 3O8NA 3TRFA 3R3VA 5I8WA 2ISQA 3CVVA 3STHA 4KJXA 4QEKA 5FBRB 3NGXA 3AEQA 2QIOA 4E88A 4O4HA 3EF1A 3O95A 4LQCA 3AHCA 3V8BA 2Q6KA 3DKRA 1M1YB 3FVVA 5DCUA 1G3UA 2IBTA 3EVCA 2J6BA 3I0NA 5A3QA 5KYVA 5G4LA 1OGIA 1XD2A 4ND1A 2J5RA 4JWTA 1UWCA 1SQSA 2VP4A 3A26A 4D8TA 3D1LA 4JP5A 4LXUA 3QXSA 3B3GA 2BLLA 3HCWA 3KHKA 4ZO4A 1EKXA 3QXCA 4KGZA 4RLQA 5B1DA 5IM4F 3HDTA 3SYRA 4IIJF 3WWPA 2XCIA 1JVSA 1YQWA 2FEOA 4DG9A 4DR2B 1TO6A 3DW3X 3SKVA 4C0LA 2PRKA 5JDCC 1UBEA 1I0ZA 1IEWA 2ZYTX 3DYBA 4EW1A 5IULC 4F1JA 1D4AA 1T5DX 5L3QA 4TROA 4HV4A 1DT5A 2ID8A 1DFGA 1ZJ4A 1H8EA 3A1DA 3TMYA 5BVGB 4Z4EA 4LW8A 3T5GA 2QDKA 2KLBA 3BICA 1KYWA 1GLGA 5REQA 2IY7A 4W8GA 5BRNA 1X3LA 3ZTWA 2HV8A 4EFNA 2DY1A 1DRUA 2R751 2V74B 4NBTA 4EJ6A 4Z1OA 3INNA 4Y2PA 4BIMA 4S2UA 2XGMA 1N6KA 2NACA 5M3BA 4O4JA 1G4AE 4HAXA 2DGDA 3HXTA 4GU5A 5F35A 1TIPA 2AHOA 3Q7TA 4IINA 2W6NA 2WU3A 3E8SA 3QBVA 4WI1A 5G3YA 1MO6A 3MMPA 4KMOA 3DKPA 3PR2B 4K0RA 1UOEA 4I7EA 4PLCA 3WO1A 2B3TA 5F52A 4BO8A 1V8PA 4YV2A 2WINI 1NX6A 4YDHB 4OLBA 2XYQA 3WRXC 2BFOA 2QKYA 3ACBA 3E4CA 4ASUD 1FTGA 4C3OB 1T8SA 4LBWA 4NICA 3ULKA 3TLMA 1C8LA 4IZOA 3QLUC 3Q11A 1PG5A 3O6VA 1N5RA 4EKNB 4GGOA 2O7VA 4EVQA 3OESA 3I04A 2GPJA 5A6VA 1VYUA 3JVDA 5LDHA 4HJXA 1USIA 3UXYA 4LECA 1PTJC 3IBTA 2V1UA 2JCGA 4EF6A 3D2BA 5J40A 1ULUA 3LUCA 2BGRA 2C96A 3WWYA 4W5JA 1WUIS 1G8GA 4Q4CA 3M82A 2P9BA 3IO3A 4CL8A 5G0SA 4WVLA 1RXWA 1PX0A 3EH1A 1G3RA 4CL3A 4B8YA 4GKJB 2AX3A 3R75A 1UODA 9LDBA 4ZU6X 4YQFA 3CISA 1ORTA 3DDUA 4O08A 1GTVA 1CVRA 2FZVA 5JIBA 4ZQHA 1K7EB 5JAIA 1AQNA 4PFJA 3PEWA 4XGKA 3DO5A 1IZYA 2X8BA 4JQYA 4HUQA 3BCSA 1PYDA 4KOAA 4YAJA 1W0JA 1TK2A 1J2TA 5KNCH 2Q9BA 5D1HA 4EWLA 1VSBA 3UVEA 3T0IA 1N2SA 4Y1GA 5KUTA 5AXBA 1I32A 3UC9A 1CDOA 3SF8A 4CPDA 1NW8A 1WHTB 3A9RA 1RE0A 4Z8YA 4YMGA 2ID4A 4JQSA 4RSRA 1E6EA 3ZIAA 3SBXA 3SZOA 4CIAA 4UW9A 1IE3A 1YR3A 2C77A 2D1SA 3KS9A 3CX4A 4RZHA 5EMMA 5KHLB 1TK3A 1Y3BE 1E3MA 2AI3A 4D81A 4DQDA 4PYKA 4H1UA 1QJCA 1BNCA 4IEIA 3LFHA 4E3ZA 2FRXA 4AT1A 4OQXA 5KJ1A 1W88A 1DMSA 1JDSA 3FE2A 4XVHA 5G1OA 3RRNA 2J0VA 1Q1AA 3PBKA 2E4ZA 4M0PA 4U8GA 5BSKA 2DJ5A 1KH1A 3B3FA 3ETNA 4DNQA 1CQWA 2UDPA 5THQA 4O5OA 4MPPA 2IZ7A 2BR4A 2CHQA 4BAUA 2G06A 1GLVA 1DC4A 1WB4A 2Y68A 4TKLA 3OHMA 3MJHA 4CGYA 3T3HA 2RHJA 2GOYA 6PFKA 2JJMA 4RVOA 1N8NA 4P83A 2XCLA 2NVWA 4WBXC 1M1YA 2DQYA 2G7MC 1KAGA 1YC5A 2NVUB 2HMYB 4A0HA 4PZYA 4Z0HO 1VHWA 3KDAA 5KAPA 3ND8A 4ZAGA 1SOVA 4BLTA 4D41A 3G89A 4S1PA 1DQPA 1ORDA 4IDBA 1K08A 3TYXA 4HB0A 4U39A 2ZYAA 2ZLBA 3FNGA 2QOEA 3HBMA 1HTTA 3ONNA 3H2SA 4MUXA 2HN9A 2GXAA 3GFQA 5K0LA 1EVJA 1G2QA 2XQFA 3AQIA 1QB7A 3D6JA 4BEBA 4P92A 2W5UA 5CNKA 5IVDA 1IN7A 4YQZA 4B3HA 2BGMA 4CV0A 1P44A 4ME6A 2I71A 1IHDA 3IRVA 4OJTA 5BVGA 4IEFB 2VK8A 4P32A 1DRWA 5CLIA 2YH2A 3B8EA 4I99A 2IDZA 3DDNA 3FNHA 4Z8XA 3S27A 1L7MA 3KU1A 3ZWAA 5LLDA 1F4PA 5DULA 5I01A 1E1MA 4EW6A 1QZTA 3Q2IA 3ENZA 1Y9DA 5E6SB 1OXBB 2MYUA 1RHMA 1Z4OA 2F9MA 3VJRA 4WFIA 4TVBA 3PICA 4GMKA 5DH9A 4AXBA 3EZ9A 2PQ6A 4TMZA 2XUHA 5EUQB 5AVSA 2QTZA 4O8CA 2ZRGA 2ZAGA 5JAQA 3H3JA 4J7XA 1MCZA 1MJFA 1QF9A 3AONB 3KPVA 2ONZA 3EJWA 1TKAA 3LTEA 3A6LA 3MRSA 3R2JA 5BXYA 3M6AA 4OLHA 1U2DA 1JKJB 5A71A 1RWMA 4G24A 1K75A 5EUBA 2FUNB 3NH6A 2Q29A 5I8ZA 4D9HA 3I9V6 2OBYA 1LZLA 5FI1B 3R76A 4QT4A 1HL7A 5D6OA 4D9KA 3PCRB 1EGHA 2IP4A 1GRRA 4LX0A 1EVKA 1U1DA 1J6UA 2XR1A 1CE8B 2F3QA 4HGQA 2FW8A 3AFGA 1XDBA 2ZRJA 4PHHA 2XCSB 3F3SA 4C4XA 2G09A 4JDUA 2AG8A 4AMVA 4D98A 4QHTA 1LA2A 2ZIVB 1EGVB 4A8JB 621PA 3GDOA 4RIGA 3WK5A 5JCOC 3T3EA 3ZHQA 2PDAA 1CF4A 3PNBA 4X8OA 2QW0X 3OPMA 3S55A 2PKQO 3FIUA 3F4KA 4CLDA 2QNBA 2ZT7A 3KTAB 2IZ1A 3RKUA 3MHTA 3U9TA 4C7OB 2HA0A 3R5KA 1R9GA 5L4SA 4DMFA 4DUPA 2I6UA 2Q99A 2ZXEA 4DWVA 2P6NA 2GUWA 1ADYA 2WKQA 4HAYA 4EA7A 3B6MA 1IN8A 3MT8A 2UUCB 3BJMA 2A1TS 2Q3JA 1OA1A 2P6MA 4JBWA 3OCWA 2D1RA 1C9MA 1CG6A 3I6MA 2C9CA 4OU4A 1KK0A 1WHTA 2FCRA 2J7PD 1KS9A 5LPNA 3V4FA 1IUNA 1PIWA 2UZ3A 4LRSB 3TJZA 1JRLA 1Z33A 3ICEA 1TQHA 4NENB 3L6UA 3RC2A 3REQB 1M54A 4F6CA 3SLRA 3FGNA 4YA6A 5F1OA 5FEUA 4DLAA 3BVPA 2AFVA 2V0CA 4YMWA 4D9NA 4MA5A 3ZCXA 3R3WA 1P2GA 1HSOA 3DLPX 4E33A 3DA8A 1MEJA 2PBRA 3NT2A 4PFSA 1JAXA 4MV4A 3LUBA 4DJJA 1FP4B 3NTLA 3W4JA 3A4NA 1JVBA 4IUCS 4ZIRB 5ICCA 2CFSA 3KKPA 1ST2A 1XXHB 2XE8A 3PI6A 4QBTA 1BRMA 5ECGC 4ZJUA 2GETA 5EKTA 4ZO8A 5IS2A 5FTLA 3GRZA 3KQUA 3QVWA 4F96A 3WL6A 1AXEA 2ZJ0A 4LMRA 4MVJM 4MNTA 4YRTA 3T0GA 4L16A 4MGKR 3WP1B 3K0SA 3GJQA 3HLKA 5DN6A 4B5LA 3C7AA 1NR1A 2ZBFA 4X61A 2AR9A 4IMPA 2DLNA 3PYMA 3ZDEA 2NVUA 3QG1A 2CC2A 3PHGA 3WR5A 3FGPA 4IJMA 2A30A 1ZH4A 3EUWA 4Q1VA 2RJ3A 5J3JA 4KQEA 3U7JA 3UJPA 5IANA 4CF7A 1ZW6A 4G0MA 3P9IA 2Z8XA 2W98A 4JXXA 4L7VA 4AX8A 4ER0A 2WOJA 2LV8A 4DV3B 2Z57A 1N2IA 1SRRA 2X6TA 3UPTA 5IMBA 2HLNA 3A6PC 4I8DA 4U6QA 3PZBA 4ID3A 1M2KA 3IEKA 3DZFA 3IV9A 1WXHA 1GTZA 4BLRA 1AKWA 1BMFD 4C6RA 1T35A 4DTCA 2CHEA 4IHJB 3H0CA 4OQYA 4KI0A 3VOAA 4RBNA 3OHSX 4DRZA 1PWEA 1N9GB 2ZSJA 3DL4A 3W2TA 1SH7A 3WQBA 2TMGA 1M2HA 5AKXA 1Z4MA 2Z9BA 3QELB 1DI0A 4GLLA 3CT6A 1RW4A 3L8YA 5E6SA 1PFWA 4F3CA 3M2PA 5HKKD 3SK0A 4GVLA 1FLDA 4EOGA 1KI1A 1QHYA 2JGNA 1M6VB 1G0NA 3T3DA 4LNUB 3UCFA 2G77B 4UNRA 2E4XA 3LZDA 4WQMA 4DMHA 4D4IA 3N7UA 2XQKA 3HUFA 5CLQA 4PYJA 2IT1A 1JKJA 1T8TA 1EUCA 3I42A 1H2RS 1T4DA 5A1JA 1YRHA 3I01A 3QVVA 4JJKA 3CRVA 1JG1A 4HQ0A 2BF7A 4K9QA 4NYIR 1EESA 2XE4A 5AR1A 3N0WA 2BR3A 1E0KA 4TT8A 1J20A 1XZMA 4YJGB 2XKBA 3N9IA 4EG0A 3CKMA 5E4YA 3LQYA 3ONVA 4L9RA 3KEQA 5DI3B 1MOSA 2PYDA 5CJ2A 1U2QA 4LY9A 4ZVRA 3RUFA 3U7EB 1KYTA 1MQ8B 1G3QA 2HJHA 3B6EA 4KE8A 4NVRA 1D09A 5JG7A 1ZC3A 3TQSA 2OV1A 1XNRB 4A8JA 4X9XA 4ZHQB 3B2EA 3B6JA 1L7OA 1P60A 2I2CA 3RF6A 5C4GB 2FPPB 4BLVA 2PMDA 3HZOA 1A8QA 1ZGZA 1TYDE 3WMWA 3OOYA 4BNXA 3KTAA 1P29A 1U7OA 3RIMA 1HGXA 4UDXX 4C7OA 3GP3A 1X0VA 2OGWA 2H57A 4UNPA 1TPYA 2DTXA 4Q4AB 4TQUS 3ZU6A 2ODEA 2ZBRA 2QTHA 4MA4A 1H9AA 4EGQA 2BMDA 1IY0A 4RAQA 4ZVTA 5DF1A 3VKFA 4NBNA 1OROA 2GB4A 2LKCA 4F8YA 3NIGB 3AYZB 4HXYA 2NLOA 2VQFB 4OA8A 2V6IA 3BGDA 2J85A 3ITDA 3L18A 3HDVA 2EJWA 4PWYA 5DHSA 5K5EA 3V33A 3OZWA 1M67A 1SBNE 1XSEA 1Z37A 1NQUA 1NQTA 3HLTA 3L41A 1NR7A 1YNSA 1YQ9A 3QA3E 4NENA 1M5UA 4OVKA 1DBSA 4PPYA 4JYCA 4LUCA 3REQA 1T26A 2OFFA 1XQWA 4IQ4A 3J81A 4BBPA 4P2GA 1KGDA 2ADOA 4UUNA 5C1IA 1JHPA 4C7MA 4ZYUA 1LV8A 4CCWA 1WXWA 2NZJA 4I1RA 5P21A 3ZHZA 4OA5A 2VRCA 3QI7A 3EUAA 1FP4A 3ZJYA 1CEXA 2DG2A 3H1EA 1DO8A 1G5QA 2PLWA 4C20A 4DVJA 4ZIRA 2BRUA 1ZCFA 2RGCA 4J0IA 3IMFA 4OBEA 1XXHA 1XA4A 4YXWA 4INJA 3RLIA 4NJMB 1XMOB 2P4EA 3R6DA 3NBKA 1KJWA 4QU8A 3L7OA 2R8OA 5HM8A 1HY3A 3N2YA 4FE7A 5DM1A 1JJIA 4L8YA 2PT5A 1U8EA 1L3BA 2AZ4A 3LUPA 4YBZA 4HPXB 3C87A 2V6FA 1QYVA 5G4KB 2NTVA 5B4VA 1DIAA 3OLQA 1OTHA 3EWNA 1W96A 4TVOA 5ERYA 1YR8A 4LOIA 4OHVA 2ZJ1A 3RUDA 3K09A 1ILEA 1NYQA 3T5AA 4X65B 5JH7F 2O8EB 3B9BA 1ECLA 3C39A 4X1YB 1TM5E 4GBMA 4TLAA 4HS9A 2OQRA 4F56A 4POAA 2FX5A 2RAFA 2HLDD 4BP1A 1JLLB 2VNKA 1YJ5A 3T99A 2REQB 2ISSD 1UDCA 2AK2A 1UOPA 1W34A 3WYNA 1TIBA 4B84A 4DQUA 3BYZA 4H77A 5FOXA 3TTXA 2CLOB 2Z5VA 4IHAA 3OJ0A 1FFHA 3NQ41 1P3Y1 3C5CA 4BMOB 4YUXA 4IHJA 4Z3KA 4Q1CA 4V1CI 2X5JO 1BQEA 4Y7DA 16PKA 1RYDA 3CZQA 5HILA 1N9GA 2I9PA 2PAFA 1H8HA 4XDHA 5CVJA 3ZYCA 3SQWA 1BW9B 1OZFA 1QWSA 1W4BA 2OAGA 1T1GA 1IY9A 6AT1A 5J59A 1QBGA 1GFWA 3QELA 1TRKA 2LZ0A 3JATB 2YVKA 4NK5A 2C0PA 1D9ZA 4W99A 1QO7A 2WU4A 4MZXA 3KEFA 3S1LA 5JBNA 2PGOA 3Q3CA 3IEIA 5DM2A 4BLPA 1M6VA 1DKMA 2C03A 4XFKA 4LNUA 5IX8A 4TTRA 1OYOA 2IHTA 3GRKA 3AL3A 1PL0A 3G0DA 4QX6A 1WUHS 1XZDA 4CDNA 2P8SA 3GNTA 1SC1A 2A3RA 4JLAA 2HFJA 2HMAA 4YO7A 2AR7A 5ERGB 5JC8A 4M1OA 5AKYA 5IH3A 1OWMA 3FUTA 3HZZA 3GW8A 5KVCA 5HDQA 4ZJYA 3T52A 3W8FA 5CDTA 3DM5A 3W77A 1VL6A 3UHPA 1NDQA 1P9LA 2IU4A 1M8FA 1EGAA 3FRHA 1RYBA 3O8LA 3TKAA 1XRJA 4YJGA 2WQ7A 4F38A 5IYZB 1VL5A 3AGQA 3BRWA 1EJ2A 1JLHA 5DI3A 4X5OA 3RV3A 5JXJA 2I87A 2HF9A 5AI9A 4TLLB 2GN1A 4Z53A 4HX9A 1EP9A 1XVLA 2FVYA 2O4UX 3FSGA 4B3IA 4DCOA 1FQWA 1V16B 2G0AA 3KZOA 4ZHQA 5CLFA 2J3KA 1ECGA 1FQOA 2O20A 3MMXA 4QDUA 2FPPA 5ALWA 3K05A 4AZVA 3IQXA 2AV6A 3LRPA 2V6GA 3PENA 2WYOA 1UXHA 2TSYB 1GEGA 2Y66A 1GARA 4IM7A 5KNCD 1V7PC 5E9AA 4C4PA 2FSGA 5GPBA 4D3YA 1EUZA 2Y67A 5ADVA 4Q4AA 2C8LA 2RHLA 2C4WA 4IZHA 2G4VA 3VDXA 4F0JA 9ABPA 3W3ZB 4WK0B 1F8GA 4AN0A 1LK7A 3F9RA 2DH5A 2WM9B 1HM5A 4HZUB 1K7XB 3B3JA 1NBMA 4O4IF 4UAGA 3VH3A 2QP9X 2ATXA 3QRWA 4YQEA 1RXYA 1KQGA 2YVQA 4L6AA 3VSEA 3GP8A 1GAEO 3ECSA 4RY8A 3I4LA 3RFTA 2E89A 1R4ZA 3B82A 2JCYA 3Q7PA 3MYRA 2CEAA 4Q1FA 1JJBA 1AC5A 1V3VA 2V6MA 1O08A 2HK9A 3HCOA 1Z45A 1HDZA 1QVRA 3NATA 4IDNA 4UDYX 2AC4A 4IQFA 3RKRA 4ZYXA 1IXYA 4KQ2A 4BJ1A 1Z2DA 3B3QA 1RKQA 5ALNA 4DR7B 4MQEB 4IIYA 3FLMA 3GIWA 3L7JA 1U0BB 5IF9A 2BEVB 2V4ZA 1W2HA 2HB6A 4G85A 5H3CA 4QU0A 5JO9A 4YRNA 1DV1A 3QLVC 2HK8A 1GVNB 4PQEA 1EA7A 4JENA 1CULC 5TRTA 1Y3AA 5D3QA 1I7LA 1N2OA 5ALZA 4PPGA 3P27A 5JD6A 1L7XA 4Q12A 4UM7A 1HQKA 1J8QA 2QJRA 1E7SA 3DS8A 3G2OA 2QDXA 3CW9A 4GW3A 5G4KA 3WHKA 2ZOSA 4IILA 3O31A 3UZUA 1AA9A 3DF9A 4JA2A 1EK1A 2D8MA 1WZUA 3ZTYA 2QSYA 4ZDKA 2F4NA 3OCZA 4QARA 5D01A 1I1QB 1F2DA 3SJUA 4XX1A 1WNTA 2RGEA 5LB4A 4D3DA 4P0QB 4MJXA 4D96A 2I4TA 1BWRA 2O8EA 4LE1A 4AZ0B 4X1YA 5MN5A 1E4YA 3L6CA 4YYEA 1VKJA 1XL1A 2G07A 4KBFA 1FS4A 4B6QA 2PMBA 1NNEA 3JWPA 5BO5A 4NV3A 1MO5A 3TLAA 1XFDA 2REQA 5IDQA 4ZZ0A 2QZ4A 3WGVA 1MF7A 1NBHA 1QDLB 1WR8A 3I52A 3O94A 3D8TA 3GROA 4YRJA 3H16A 4Q00A 1XLTC 4M88A 5A7FA 5IKEA 4N7RA 1WRBA 1HDOA 1R5OA 2JBHA 1I4DD 2YINC 3L93A 1YI1A 3PFIA 3GLUA 4P3KA 3F7OA 1QGOA 3FTPA 5FTWA 2H1VA 5IFLA 1TCUA 2DUMA 2VT6A 5B36A 1BW9A 2PU5A 4MQBA 2R4UA 3CPJB 5CT9A 4C2UA 1USGA 4YAFA 3ADPA 1PJ2A 4C4ZA 1D7OA 3JATA 3W9SA 4QQFA 2OOKA 3HJTA 1ZVQA 4GMFA 1CZOA 5KO2A 4OL0A 4AZ3B 2HSZA 4Q9DA 4CMEC 3S1SA 3QPUA 3WNBA 5F7ZA 3OD5A 2Y92A 4GXTA 3JZDA 2G04A 3QUCA 3JSAA 5CB4A 3U60B 3IMKA 4FJ2A 1GCIA 3KTOA 1MX1A 2J0QA 1VL1A 1XN1A 3DWIA 1NJ8A 4NJOA 3RAPR 5BSMA 2EP5A 4RM2A 4LE2A 4URWR 4OI1A 1L7BA 3RUCA 1QHEA 1UBNA 1LI7A 2I80A 3V3TA 2JKVA 4AURA 1P5RA 1TZCA 3PD1A 3HK2A 3UK1A 3I76A 1T9DA 2P2YA 8GPBA 4Z4FA 4EG7A 2QYTA 3ZVRA 2Q6LA 5IYZA 5C81A 2HCRA 5AM5A 1U9ZA 5EMHA 1B7GO 4DKJA 1SHJA 1TGVA 4E21A 1G5IA 2RH5A 3CCBA 3ORYA 2JFWA 2JRLA 2B5WA 2QRMA 3OP4A 3TH5A 2VTBB 4H3VA 1Y8QB 2Q2OA 4Y2HA 4Y2TA 1EQ2A 1V16A 4NZOA 4S12A 4CXMA 4ML3A 4V0ME 5LCXA 5C18A 1KO8A 4GOKA 3AF5A 4MMZB 5DBFA 5DM70 1P6QA 1OV6A 2ZI5A 4RETA 2QRJA 1U1CA 3GC6A 1ISHA 1GSIA 3W8RA 5KC8A 4WY8A 1VJDA 3PNSA 2O2EA 2O50A 1GZSA 3LH5A 3TW6A 5I7FA 1ABBA 2I91A 1YZTA 3F6EX 1FUKA 2GI4A 3LLUA 2B1JA 4IJ5A 1ACLA 3PVSA 4JBGA 5H68A 3L0IB 3S99A 5A0TA 1Z3CA 1EP3B 3WFZA 2EZ9A 4HZUA 1MO2A 2PNJA 5KREA 2GSDA 2V7VA 4BAZA 1JIJA 2B7LA 2I1VB 2FEKA 2DMRA 4O2AB 5F4ZA 4F5WA 1ZH8A 2G1PA 2OHOA 1SXGA 1I3CA 2WTNA 4MWGA 3LQKA 4MYDA 5LMUB 2VKQA 3ESZA 4MINA 4EYQA 3GN2A 4JVSB 5CEJA 5CHEA 4RORA 2PL9A 4FX2A 2NAFA 3AW8A 4XTRA 5FNVB 2TS1A 1X1RA 4RVGA 3ELUA 3KKKA 4MULA 2A4MA 4MP6A 1QVAA 4Y2SA 5JMPA 3EXAA 3VR4H 2OAQ1 2C59A 4S0ZA 1FP6A 1U63A 3OI7A 4HDSB 4RDCA 3IR6A 3CF0A 2A78A 2CYBA 3CU5A 1SU4A 4OJNA 4X64B 2CL6X 1L3IA 1OUMA 1PR2A 3NCHA 1O8CA 3QI2A 4MQEA 4TLMB 2BEVA 5ALKA 1MU0A 4KNYA 5KB3A 1W4ZA 1UK7A 3OUZA 3R9KA 5CCXA 2JIDA 2B4AA 2XTZA 4JR2A 2C58A 1WXIA 3FR8A 3OQ1A 4GSLA 5EIBC 3UNXA 4B48A 3ETJA 3I2HA 1PFKA 5H7XA 1C5KA 2E48A 4PN3A 4BRUA 4LF6B 3K0CA 3C6MA 3AM1A 4B4KA 3C4QA 4B7XA 1LRLA 1T4BA 2ZXUA 2ZQZA 2QPAA 1KIFA 3RG8A 5T7BA 1KIMA 4H7FA 1Z39A 4G9EA 1GRVA 4YN3A 1CB7A 3WSTA 4BEWA 5T4EA 3GX1A 3FCOA 2ZIFA 3I3OA 2ZU0C 1OKKD 3UAWA 3HHEA 4HADA 3ZDDA 4TOIA 4F91B 1V5FA 2EG9A 2ZVDA 3P5SA 4I2NA 4DOMA 4C2TA 1ECPA 5ETJA 1GQRA 4IFBA 5DYYA 1DUIA 1RQLA 5FFFA 3I5YA 1G2PA 2VUUA 3ZBPA 3K3PA 3FMOB 5AI8A 4ENUA 3O82A 4JC4A 4JVOA 5K20A 1N36B 4KXLA 4B87A 2F8MA 4FILA 2B21A 3K2EA 1EXMA 4L4YA 4V3CA 1PW5A 4TVKA 5DNDA 2FJ0A 1INLA 1I36A 4LWOA 5CCDA 3VR3D 3W4KA 5HQTA 1VE3A 3GGOA 4YRCA 2F8SA 4FS3A 3SJCA 1QFZA 4DDUA 3IQZA 1PL8A 2JLRA 4MV9A 1ZU4A 3EIWA 1QIMA 2C97A 1KFEB 1VPTA 3MG9A 3NHBA 1SXIA 3IOBA 4AZ3A 3S3TA 2HJGA 4GVXA 3Q87B 2IX9A 3R3YA 5A3SA 1ULHA 2NAPA 1TW2A 2IEIA 3AOGA 3KOWA 4KXQA 1YVPA 1CUAA 2XT0A 3C8ZA 4DV7B 5FULA 3H0KA 5ANRB 3UK6A 3S81A 3NIBA 3DEZA 4ZICA 3GUYA 3RK1A 4OQLA 5AKHA 1QYRA 4G5HA 3IE0A 5I7OA 5AW7A 4AY4A 2C3OA 1MIHA 3G5UA 1G2IA 3OZCA 3PWZA 5J43A 1UJNA 1AB6A 2QUJA 1T1SA 1WKBA 3CH6A 5DKFA 2BJHA 1SBTA 4LE0A 5KTTA 2J3QA 1EVQA 3OM8A 2A9OA 4RK0A 3U4AA 1F2TB 3L8EA 2VTBA 2FMTA 4CDGA 1Y8QA 4BJ5A 1VZ2A 4BVJA 4EAQA 2PGDA 2ZPUA 5B58C 3ETHA 4W5HA 2YW2A 3OT1B 3OZFA 4Y0VA 2WB4A 4YRQA 2A7QA 4I81A 2BBTA 1HWYA 3ZGOA 1TT7A 2CZGA 3JAWB 1LVGA 1E9AA 4YPFA 3WFIA 2C98A 4OSEA 3HB7A 1Z7BA 1A5TA 1K0UA 3UB4A 4FCVA 4EHBA 5DNYB 4CR8A 5B57C 1ZMOA 3C3WA 5U4QA 1N2XA 1RTKA 1NSYA 3M9WA 1VE5A 2CJYA 3IAS6 5FWDA 4AD8A 2CSXA 4L07A 2ZYRA 4LVUA 5FI5A 4O2AA 1KZ4A 1R8QA 2PWBA 5FV7A 3LUKA 3SZ3A 3E2IA 4TTQA 3DYVA 3P94A 5A9RA 3IAAA 4IOKA 3WV4A 1M74A 5FWYB 5B37A 4KXVA 4N5NA 2VKTA 3LDUA 3LVFO 4NQZA 3R7WB 3CTMA 1Y0BA 1UC9A 4G1VA 1ISJA 1Z8NA 2G76A 3CKKA 3KEOA 3LHIA 3O8DA 4M49A 3OCXA 5FNVA 2OXTA 2GNAA 1WUYA 1QIHA 3ZC3A 1G8JA 3DP9A 4YUWA 1IY8A 5EMNA 1OC2A 4LPKA 1U6IA 4HDSA 5JY6A 1U4NA 4ZT4A 1JQEA 3H75A 1FDWA 4IYRA 1L5LA 2VH2A 4OMFG 1QIIA 3H1TA 1UM9B 4IHQA 4DL9A 4KR3A 2X14A 1RPTA 3IAHA 1L1FA 4DF3A 2PUEA 3ESXA 4JDPA 2XYPA 5F7OA 2EC5A 3THXA 1YS1X 1MNAA 3V7FA 3SYTA 3EEQA 3H5NA 2PG3A 2WJIA 3DMRA 2JI8A 5DWQA 4BGEA 1F20A 2A59A 1B16A 2ZR0A 3RLFA 2C04A 2WAYA 3LC2O 5GOZA 2K2WA 1KY4A 4NY1A 2JIZA 2KBFA 3H9QA 1O87A 5HRAA 2M1ZA 4N0DA 5LIRA 3S7TA 5IXYA 2FEPA 2QPLA 2JJYA 5B7GA 3A4TA 3M6VA 5EQJB 4UBKA 4PO8A 2O7QA 1UDWA 5B2EA 1XV5A 1VFPA 2NYVA 3GGSA 3NVAA 4DY6A 1KFKB 5H70A 1L5GB 4S04A 5KQGA 2DBZA 3G13A 1GG8A 3ZXYA 3O2JA 3LYAA 3QKRB 4GBJA 2QLJA 2HUPA 2LUOA 2PZLA 4HDOB 2GSWA 4WZAE 2ZRMA 1K27A 2ZSDA 3ZTTA 4ZCIA 3MCTA 3ETCA 1IAQA 1DBVO 3K16A 2EFJA 2FOXA 2ZIAA 3JTEA 3OQJA 4NDZA 2WWFA 1TTTA 3LC1O 1E99A 1NJ1A 1U31A 1KYXA 4IWNA 4MKHA 1TMOA 4ZXFA 5CVCA 4G4SP 4CMJA 5KSWB 1O0CA 2GUGA 2BF4A 4UTPA 3K30A 4HEHA 1Z7YA 1KGSA 4F7DA 3ETGA 1YOVB 5EZYF 3CV3A 1N8KA 1TD1A 1LTHR 3UAVA 1UFQA 4OBXA 2OO3A 2XITA 4U7TB 2QLLA 3PUYA 3NVDA 1SGWA 3LWZA 3MOSA 3PF8A 5JAMA 1R0XA 4MPDA 4D26A 1G8AA 3H6KA 4O02B 4ZOLF 5AJZA 4EY6A 2ONKA 1VYTA 1ONPA 2UVDA 2JZNA 2WJ6A 3PQ6A 3R4CA 4PAWA 5DSZA 3AVXA 3FFBA 4PZCA 3BZWA 3JWIA 5EHGA 1E9VA 3DTYA 2WT8A 2X1LA 3QWFA 5EMKA 3A0RB 3R5XA 2DT5A 5DBOA 5C0OE 4I08A 3KCNA 3ROZA 3NAQA 3H9CA 1BE6A 3WNDA 4XSGA 1ZM7A 4YV0A 2WABA 3C8DA 4LYHA 1HLGA 4BPBA 5KVQA 4NBVA 2OAEA 1WQ3A 4AJHA 4A23A 3GJYA 4GNKA 4E5NA 3K9CA 5BVHB 3BWYA 2YWEA 5BR4A 5EJ7A 3P2OA 1TTQB 3G8DA 2ZT8A 4BGUA 4CMIB 1DQNA 4C03A 5HIKA 4WLFA 1MW8X 1FOEB 2CV2A 4ZEXA 1PDOA 5BUZA 1E9CA 5HS6A 2H16A 2ETXA 1LDYA 4U7DA 2DWOA 2VOJA 4JJEA 2DU8A 3JAWA 4CFSA 4CF5A 5LDDC 5I4BA 1RLTA 3KX2A 2EVWX 1HH4A 1I0LA 1Z6XA 2MSWA 4EENA 1HEIA 3KXLA 4LFCB 2VA9A 4UEKA 4KQFA 4M8IA 1FXUA 3FHCB 1P0CA 4MGZR 2E21A 4RD0A 4LZJA 2ZYVX 3IUSA 1TU0A 5BWBA 5C7IO 3L84A 1SUWA 2WYVA 2KW5A 4Z7JA 5DBIA 4TSFD 3V34A 4C0KA 3KQPA 1Y1QA 4ZYWA 5FWYA 1UK6A 2AQHA 1WW8A 4EGFA 3R7WA 2BDUA 4WLEA 10MHA 2YWJA 3GFSA 1OX5A 4DM7A 2W6OA 1UM8A 3E9CA 2IVZA 3LXRA 1CY7A 4AY2A 3ZE7A 3QVMA 4DUZB 3B70A 2BFFB 3Q5GA 2LCFA 4NFYA 4MW2A 1ZK3A 2JAOA 2LCIA 5AI0A 4MW6A 1TJ5A 2C5EA 5FWXB 3MTJA 4HGZA 1NMSA 1UM9A 4X7PA 1IOZA 2CHGA 2FJUA 5IU6A 3VNAA 2H51A 2PEYA 4HP8A 1TCAA 3GN1A 3P9KA 2ZRDA 4EW3A 4N7JA 4JBXA 2C5GA 4GSYA 4C4TA 2XA9A 1FS5A 2YWXA 3PA6A 4GOOD 5EXSA 1QNLA 3NIFB 3CTPA 1CERA 3WE7A 4RMHA 4B31A 3K6RA 4JP2A 5AW8A 3ZJUA 2P9QA 4E14A 4WFKA 2GLXA 4NH0A 1GVHA 1ZOOA 4NK4A 4R2LA 3ZJ4A 1KJNA 4FQ8A 1S02A 1CD5A 1EE1A 1C3JA 3G8BA 4B6PA 1T3LA 1TQ8A 4KXUA 5AP9A 3H4IA 2V3CC 1FFEA 4NEQA 1UL1X 3DZKA 2ZJ2A 2V7PA 3G0OA 2Q3CA 3P1JA 5C3MA 2EWVA 1XNGA 3ZU5A 1JEQB 2JANA 4DV5B 2QTMA 2C4NA 3DVQX 4RHEA 5AVJA 5E7IA 2FMUA 4LKOA 4NZMA 4A8HA 3NBMA 2X0KA 3QKRA 1DCKA 4OYRA 3ZWNA 3KC2A 5HR5A 3S68A 4DG5A 1W4RA 5DT2A 3SX4A 4G9GA 4EDFA 4NX2A 3P0EA 4TMYA 2AQKA 4MKGA 3TDKA 1DTWB 1RAIA 5CNJA 3H8VA 3T35A 5KNDA 2IOFK 4Y1FA 1C9JA 3EZNA 1PS0A 2AEFA 1JB1A 2C2KA 2GDJA 3CR3C 3OFJA 4JQZA 1YOVA 4HQFA 4MWZA 3KAPA 4NAUA 3AHEA 5AI4A 2IYEA 5LU9A 3AEZA 5JAZA 1QP0A 1GTL1 1IXSB 2Q4OA 4J2TA 4ZWNA 4LGVA 3OU7A 2O8BB 1LU9A 2F43B 3KEGA 4EAAA 1O58A 1CUBA 1Z8HA 3GT7A 4Y6SA 2QSZA 1E9EA 2A9PA 4I1SA 2YWFA 2PR7A 1MDFA 1J2RA 4A3SA 5ELXA 4MKFA 3ZWVA 3U9SA 1V96A 2FPUA 4MR8B 4X95A 1FMLA 4GI3A 3K8ZA 3LECA 4DLSA 4MQFB 4LHSA 3GFPA 5ECYA 3THOA 2CT8A 3MF4A 1FZTA 5FEMA 3Q7QA 4BFYA 3GLHE 2IXBA 2PWZA 2XTJA 3GDGA 1A9YA 2DFPA 3ELYA 3ZWWA 3P5BA 1FE8A 4R68A 4UHFA 3SC3A 4ERXA 2J8ZA 2AKAB 3QSGA 3TRIA 4HFMA 5D6NA 2AGVA 5CYOA 2P69A 2O5RA 3VZSA 4E2WA 3BCHA 2GK6A 1V41E 5ICEA 4CMIA 1JDTA 2XRYA 4PRLA 1UEIA 1NOIA 2VDJA 1UANA 1ZM4A 4XWGA 3T4PA 3TQFA 3CGGA 1U3VA 3H18A 4HDMB 3KKQA 4GE3A 4XYLA 1NMEA 1Z2CA 4MLDA 2QD4A 2YHAA 4GX5A 4FDLA 2W6JA 1U0LA 3NDBB 4UQLA 4EEZA 1IVNA 2FWIA 1ADBA 3STUA 2YC4C 1YAHA 1Y8RA 3IO5A 4TL8A 4CT4B 2VQDA 4L5YA 1ZM3A 2GHQA 4ZZ3A 1Q6ZA 4CN8A 4BVLA 3KXDA 2PYIA 1I01A 4HH4A 1PW7A 4FTWA 4OFZA 4MGYR 4DV6B 4UNQA 2G71A 2WJHA 3QTLA 2VP5A 4XB2A 3THYB 4YMVA 1EWTA 1CUDA 5ECDA 3VR4D 3BRSA 3RVNA 2F59A 1EFCA 5C35A 2WDZA 5AW3A 4LY0A 4BLWA 4LJSA 1N7IA 3CRRA 4CKEB 5AUNB 2PBZA 2WFLB 1W2GA 5JZSA 4PNEA 4GPTA 2YXBA 1G5TA 3NHMA 5FT9A 2BFFA 4RMNA 2DUWA 4EUNA 1UPAA 1QHHA 4FZ3A 4MZDA 4YAKA 4XH9B 1KDZA 3K2BA 3N0RA 4MQMA 5FTJA 5FWXA 1STOA 1XGKA 4ARBA 4C76A 2ZIEA 1HYGA 3VZQA 3KDPA 1FNSA 2I34A 3G49A 1EDZA 2VYND 5BYBA 1VB3A 1XA3A 3A6ZA 4RHFA 2XWSA 4DA4A 3OEHD 2L18A 1R37A 4AZTA 5DNCA 1IBSA 1Z35A 4PQYA 2BGIA 2L42A 3T1YB 3LG2A 3M6UA 2VJQA 5KTOA 3ZV7A 3ORFA 3U3JA 3AEYA 4KAAA 2GHIA 3B7GA 4UU1A 2FK7A 1I4WA 3TIGA 1UP7A 1HZZC 2ILTA 3KK0A 4DIEA 3B1WA 5C4MA 1IM5A 2P62A 3EIHA 3HJHA 4ZRDA 2X9QA 1HE1C 1NMXA 4DWWA 1QK4A 3ZVNA 1JEQA 2DHRA 1GL3A 4H08A 3QEMB 3LLVA 3ROMA 1ZONA 1F3LA 1DP4A 1N6PA 1SCIA 3BMOB 4FYKA 3NEAA 1NDHA 4G4IA 2CSUA 1P4AA 4LN1A 1QCDA 3VR5H 3D31A 3AUJB 1NW7A 5TIIA 1AXRA 5ALFA 2GN9A 4EHKA 3TFQA 4MVYA 5A4KA 3CO5A 1M75A 1U7DA 4LDPA 3G23A 3K0FB 3SEZA 3E5HA 4IDGA 1DTWA 3IV6A 4LOKA 3T5TA 4BZPA 2YOGA 2QN1A 1K6MA 3UBMA 2ZVQX 2BWJA 1NNUA 1NT2A 2ZE8A 4KMMA 4RK7A 1JQDA 1JTEA 4UFOA 1IQRA 4LJ7A 2JIRA 2HCTA 3L9XA 1SHUX 4EHIA 2YVAA 3KPJA 1OASA 2WWVD 2YJ3A 2J33A 1TMKA 2X40A 3HGQA 4X84A 1K5DA 3L02A 3MWFA 1R6BX 2AYXA 2P30A 3D1JA 1GNRA 3ENWA 2O8BA 2F43A 1BCSB 4ZQEA 4L5AA 3TLKA 4C22A 2QAGC 1V3QE 1GR1A 4V0MA 1XEXB 2JG3A 1GUYA 2PUBA 4NCJA 2VP3A 3I28A 1YGPA 3GGPA 4MR8A 3WLHA 2XB9A 1RAHA 1MBZA 2FQ1A 4MQFA 5CVTA 1VKHA 2DOKA 2GCPA 2P5UA 4LQ4A 2MSKA 3UGTA 1K86A 1TTHA 1U2DC 1XMJA 4U1RA 1VHDA 2VHUA 2RCYA 3JQ9A 1JN0A 1DV2A 3LPNA 1SUCA 1T0UA 2E6KA 1PJ3A 4YK7A 4Z2AA 3SIXA 2PGJA 3FWYA 4LYDA 3PD0A 2VNIA 4R1NA 2WRZA 2IEYA 3I2GA 4HDKA 4LXYA 2O8FB 4X91A 4A15A 1NN1A 3A9UA 4UUQA 1D9XA 1SVLA 3GEDA 5EFZA 5KJEA 3WX0A 5A0FA 5IZ4A 1YCGA 4TWIA 1EX1A 3JZMA 1RACA 3R3XA 4BO2A 3B1YA 2VYVA 4HDMA 3TL6A 4ZYTA 3ZVLA 3K1JA 4DGQA 4KPEC 1CUEA 4RPCA 4BV9A 1FB5A 1BXKA 1K8XB 2IL1A 3LYHA 1T15A 3VYWA 2VQEB 3G02A 3WKDA 5CT6A 2CVHA 3IC5A 1XZPA 3FPSA 4KHPB 3NKFA 3DZJA 1LK5A 4TLDA 5T6BA 3IP6A 2AI2A 1H1TA 2A9FA 2B20A 2GTPA 2IKQA 1YV9A 3U61B 4IGFA 2O57A 3TD6A 1FPQA 1R0CA 4DV0B 4DCPA 1BGVA 5NULA 3WIOA 4BNWA 4QAQA 3THYA 4K6FA 1CZNA 1E94E 1UQTA 2CNOA 2RHWA 1YS7A 1VQ1A 4G0NA 4Z9BA 1MRZA 3LX4A 2B4QA 2WWXA 4JL8A 2HA6A 3K5IA 5EP4A 4CKEA 2G17A 4J9VA 2WFLA 1SVOA 3DFFA 2QUKA 1MR3F 3LC7O 3Q9LA 5EQDA 1E5VA 1UIRA 5K0SA 5JJIA 4NATA 2QQ5A 5AW0A 4CI0B 5HKOA 1Z0DA 2OFXA 3H13A 4IXTA 1QIFA 3Q6NA 4K5QA 1VXRA 1JHZA 4N7MA 4PSKA 4U63A 1C4XA 3VZPA 4EHDA 4RTSA 5A5EA 4PSDA 1XZKA 2D59A 2WHQA 4F2WA 1HO3A 2XUDA 5IDWA 3DZHA 1QV9A 3CNEA 1C7FA 1NRIA 4JEUA 5TQ2B 2RGUA 4BTLA 5BY2A 3K1TA 1YHNA 3NRBA 4C01A 1MXHA 1KPIA 4L5JA 3IP7A 3RPEA 3TLZA 4WZAB 1HV8A 1TZMA 1J5XA 1PL7A 3LHFA 3O2SB 4Y8VA 3WKEA 4BV8A 2FUG1 1GNVA 4DLUA 3LA8A 2X5NA 4AY6A 4B3BA 3ICPA 2QRHA 2LTAA 2R8BA 3E3OA 3WGTA 1IQPA 2FW9A 3OWHA 2XA2A 5AYVA 3GRPA 1W93A 2P7IA 1PL6A 4YVFA 1O1YA 2DPYA 2ZBGA 4J1NA 3A3NA 3FTFA 1CP2A 4MYSA 3DBHB 3QX9A 1K3UB 1ONSA 3QEMA 4H18A 4IG4A 3DQPA 4WW0A 1U2RA 3N8KA 3S2EA 2CJPA 4UTXA 4A1FA 4EKIA 4BMPB 4E30A 3QY0A 5K2OA 1HDEA 2VZ8A 4F5DA 1S2MA 4IMIB 3KUCA 2I55A 2ZI3A 3WGNA 3KUKA 3F6BX 4GFDA 3RGWS 4DQVA 2H00A 4WJKB 4DYVA 4AKIA 4AJEA 1N2CE 4MVCA 1WSWA 3K0FA 1YR7A 3LL7A 2PUWA 4XQGA 4WBNF 1H2XA 1BQ4A 4F84A 1LV7A 1YUBA 2JW5A 4DIOA 4PLVA 5ESXA 3WLQA 1XL0A 3T7CA 2WSYB 1LPOA 4PG5A 2GA9A 2OR3A 3EZXA 3P2KA 3BSYA 3U3ZA 1U8ZA 3C5HA 1NF3A 3CVWA 1ZNQO 4AFNA 3WB2A 3VQTA 4E5MA 3O3CA 5JFGA 1BCSA 4P6VF 4MKXA 4K9KA 2XT9A 2J0SA 1XEXA 2FF5A 2DWUA 3CRQA 3NNSA 4MV7A 3ZDRA 3U4MA 2PUAA 1HQDA 3U31A 5JANA 4D3XA 1SQ6A 3GRFA 4H15A 5JXIA 5CYPA 1RAGA 2ZI7A 1MO3A 1DXOA 2L17A 3GCZA 5HS4A 2PUGA 3O8QB 1BMQA 1YI0A 3CONA 4FSXA 4Z3OA 4CM7A 3GGJA 1Y7HA 2J6HA 4RK5A 2GWRA 2M98A 1WABA 4RANA 1JIIA 1I6WA 4NP6A 3S2SA 3WFJA 1ACMA 1L8AA 4WXMA 2VPWA 4MJLA 4TMKA 1WXXA 2B8TA 2GO1A 3D0OA 5FA5A 5IBQA 1AO0A 3R0IA 4BX2A 3ETLA 2VBFA 1AMOA 2IELA 4Y9SA 3PIIA 4H7DA 4G01B 3NHYA 2PX5A 5AOVA 4JBHA 3Q72A 1E8MA 1UFRA 3O92A 4P93A 5CP8A 4P53A 5G0UA 2AOWA 3AUFA 3IUBA 3O0TA 5EJMA 4A8JC 4YV7A 3S29A 2CDRA 2DHDA 1ABEA 3GRUA 3SDBA 3TQRA 1BQ3A 3QVGB 4PRYA 1SHKA 3KJGA 2BUBA 2AC7A 3VHRA 2DFNA 1AUQA 3UAGA 3L8CA 4BMZA 2EFDB 2QUBA 4Q5IA 1AQ6A 4FE3A 2BEKA 4LSZA 1W1WA 2EU8A 5DMHA 1I2BA 3RS4A 1Y33E 1TAUA 2XCOA 1RRMA 5FB3A 2F67A 3SAJA 3WXBA 2WE7A 5HHTA 1OBVA 4JITA 1G3IA 5DI9A 3UHOA 1ISMA 2Y3IA 2QJOA 1LTKA 2EBWA 4US0R 4UCFA 3ADCA 2R6CA 4LYGA 1N6HA 4MVJF 1F48A 5AJHA 2Y1OA 2HU8A 2ZUDA 1RTTA 3KJIA 3TSWA 3H5WA 3JZIA 3HC7A 2UZ4A 3VGJA 3F9IA 3LK6A 1SHLA 1I2DA 4QYXA 4ZI3A 3F0TA 3LKVA 1RYFA 2QTGA 3JRNA 5EY5B 4A36A 5GJBA 4INZA 3VTZA 3N2ZB 3EVBA 3J7AC 1FP2A 1YVRA 5GM1A 3L05A 1TM4E 3JD4A 1C29B 1WM1A 1VRCA 2H31A 3D6FA 3X1JA 2IRWA 2FHSA 1KOJA 1JG7A 3L0SA 4JJ4A 4LZPA 4MMXB 4PLGA 4PSCA 1XRPA 4YJDA 5TQ2A 1IBLB 1XRSB 3AIIA 2HQOA 4YR7A 2XUAA 1SCAA 2W6CX 4WZAA 4XRGA 1WCYA 1V8BA 2Q5FA 2WUFA 1GT91 2WVGA 3ZV5A 1OMOA 1WB5A 3ZXUB 1HNZB 3AV3A 3KTDA 5G2OA 2OV3A 2XWJI 3T54A 1R0ZA 2BZ1A 2XMSA 3WIDA 4FXOA 3RVLA 1WY5A 4YWHA 1A3CA 2Y76A 2OZKA 2XQIA 3WLAA 3JAMA 1ML3A 3V8QA 1KDPA 1UQUA 4Q3LA 3DBHA 1PFYA 2VAVA 2YQ5A 2CCKA 3R20A 4OQEA 4RK4A 3RHFA 4NMXB 2FPIB 2WHPA 3CFYA 4RA6B 2VHTA 1B43A 1GILA 1GL6A 2VXOA 4OXKA 3KT3A 4WOBA 1RXUA 2GJ8A 2XTAA 3SSMA 3PKIA 1E7MA 1Y9EA 2PFGA 1YNOA 1JJAA 1HYHA 4O4LF 1E3EA 1JPJA 5H3LA 1YWGO 3PITA 4ITRC 1G7SA 4Y1RB 1HLPA 4ILKA 4NBWA 1NN0A 1QK3A 4EMSA 3K6SB 2BM8A 4GKVA 5JWOA 3KV1A 2ET6A 3GLSA 3GLHB 3KJFA 4ENVA 1SBCA 4UATA 3U3MA 1ENPA 2AEJA 3ECAA 3D6HA 5FPYA 7ADHA 4O1MA 1ZCAA 4M3NA 1BKYA 1F2UB 1CB0A 2R4QA 3CW2A 1CY0A 4QICA 1QCCA 4EUFA 3CBGA 3VMFA 5TMBA 2PKEA 4OK3A 5K01A 3U4GA 4B9AA 3A2NA 4QL3A 3COVA 5KYXB 2B8JA 1T6NA 1IN4A 3OM1A 5HUJA 1G38A 3NJ8A 3D2AA 3M4NA 2XUJA 4ZVOA 1KBZA 1ABFA 3PZRA 4XUGB 3HDHA 4BN5A 3ESRA 1K6EA 4HNGA 1VPDA 3R5JA 3KV3O 3O8QA 4Y2GA 5E2BA 1ID8A 4Y2YA 4ODIA 4Y6GB 1Z38A 2MU1A 4Z4QA 3NNNA 2ZDHA 4XJXA 4KV9A 3ZLTA 1G18A 1ZG3A 1JJVA 1VJ0A 2AZTA 2D3TA 3TX2A 1O5IA 1CZKA 1JVNA 2H7VA 4ND6A 4KODA 2Y0CA 3EBLA 1Y63A 2JFFA 4R71A 4FNMA 5AMXA 5GV8A 5LIPA 4H35A 4Q3CA 5AK4A 4IV8A 1RJEA 3V4PB 5EIAA 1J0DA 2OILA 4NS4A 3SHTA 1YMVA 4ZVPA 3IDQA 2D5BA 1PEAA 2FZEA 3V32A 4QO7A 2OHFA 2XUKA 3OQPA 4ND7A 4PTLA 5HUQA 3GRRA 2C42A 2J9XB 5JD3A 3VZDA 1KSFX 3A06A 4C4RA 1E2GA 5K0JA 3DNMA 4K6MA 1N3BA 3IAFA 3LWBA 3IBFA 3QVGA 4HB4A 4OJYA 2C07A 3CQ9A 1LDNA 1JALA 4KSCA 1PJQA 4ZAWA 2ZU6A 2GF0A 1ZUIA 4O3MA 2EEZA 5K8JB 3RU3A 2OCIA 1Q12A 4MV1A 5DNEA 5TR9A 3PHHA 2XF2A 3N8IA 4Y2UA 3A37A 4F9FA 4F92B 4Q6WA 1JH8A 1SR8A 2LPMA 1VJRA 1NVFA 3X0DA 1SY7A 4FI3C 4G4SO 1L3CA 4FNAA 3ASUA 4I5EA 4KTVE 5I7AA 5ULLA 2IV3A 5J47A 1OB2A 3JR7A 3ORQA 2VJCA 5JQGA 2I1LA 2WUGA 5TJHA 2H92A 1VKOA 5IJXA 1W0CA 1Z5NA 3MZ0A 2AJ8A 1UBUS 3MLAA 3H65A 5J63A 3VR1A 4FMDF 1SG6A 4JT9A 5EHNA 3DOEA 3ID6C 3QU5A 1J1ZA 1QZXA 2CNNA 2BM1A 2Y0EA 3ORHA 4IUYA 4JKYA 4PS1A 4RACA 5EJ2A 4F5EA 1C3VA 3ZVKA 2IH5A 2XHEA 1NATA 1SU8A 2QJFA 4IIFA 4ZVUA 4R8SA 5HCUA 3SBEA 1IZ7A 5E0KB 4D0LB 4RXUA 3W5UA 4PXSA 5C37A 1V8OA 4UEWA 1KEZA 1RKXA 4WZBE 1KQNA 1WOYA 3CUTA 2R6DA 3PPXA 3PHIA 3EDOA 4RKRA 1Q57A 4R0MA 5I7EA 1FJGB 5JXHA 1KAMA 1QGED 1U1EA 1GZHB 2V9ZA 2YHIB 3DV9A 3MWGA 2J4FA 3GP5A 4H16A 4J0QA 4LMAA 5DE3A 4L8VA 1TM3E 3R7BA 3I0ZA 3RS3A 3UWKA 2ZRIA 3VR5D 1UKZA 2FPIA 1ZEJA 3Q0IA 1F51E 4RVDA 2Y1GA 4RA6A 1EFUA 1YH3A 5FKJA 2R96A 3V2GA 5C5CA 2Z83A 4LTMA 6GPBA 4KQ9A 4L4UA 2DUUA 3E03A 5LQKA 2YFKA 3HB1A 2QZJA 5DTJA 3ZBQA 1BJKA 2GYYA 2WMYA 5BYAA 1Z0IA 4C21A 5EGNA 2XOXA 4AYTA 2VJBA 4Y1RA 2GNOA 3PNQA 1YRAA 3K6SA 3LBAA 3EQ7A 4J3JA 2ZS9A 4H7JA 4X6UA 1Z75A 1JE0A 1Y4AE 1QOQB 3GLHA 4NDNE 1SXHA 1CSEE 2CVZA 4AJJA 1SOUA 5FOSA 2WF5A 4C88A 1MC4A 4TT3D 5EWJB 3A4VA 3EGIA 5TGTA 1AN0A 1P4SA 2KMLA 3MUEA 2OORA 1F2UA 4BX3A 1WDLA 4DNXA 3M5PA 4HSGA 4HLCA 2BGKA 1M9NA 2VDRB 2ZJ6A 4PXAA 1RLOA 2F3TA 4X8MA 4DE5A 2J9GA 2HA7A 3V2UA 5KYXA 3DGFC 1XHLA 1XHEA 3IUJA 4J0GA 1EK0A 1FRVA 1LSOA 1WQ4A 5B64A 1OGYA 3QPCA 4GVPA 3UT6A 1I5EA 2W90A 2PD3A 3CMCO 4YCSA 1J5EB 2D2FA 5DU2A 5I7VA 1GKKA 1UEJA 2JCVA 4QUDA 2ZRCA 1MZPA 3E2PA 4UD6A 3MN1A 4YQYA 2BT4A 4IDDA 4WY2A 3FYHA 2PRJA 5HMLA 1ZH2A 4I55F 1S96A 1W52X 2V8OA 2ZSAA 3NDRA 4I8IA 4EI7A 3T41A 5CFQA 3ZNQA 3ZU2A 3AKCA 3PGJA 4AQ7A 3M3DA 2CF5A 5TX7A 1CXZA 4BZXA 3D8NA 2PJUA 1FC0A 1X92A 4H7EA 1GY8A 2BDTA 2GVZC 3TI9A 4QU5A 4W5OA 5DTMA 4B3CA 5FL7D 1J22A 4Q82A 3LQRA 2C5BA 1QH1A 4NQRA 4U5XA 3L0YA 3DB2A 3OFKA 1RC0A 2CNLA 3STYA 3G68A 1A98A 2V9CA 2DP4E 1BDHA 2JFYA 3GA7A 5B5SA 3FMVA 3PK0A 5EN4A 3L7MA 1CQXA 4PZ9A 3PL5A 4K26A 5A06A 1O9GA 5DLPA 3A70A 1DKOA 1FP1D 3STWA 1ATIA 3EZFA 4HDRB 4QPDA 4AMBA 1D6NA 4RHUA 2QS9A 4CRWB 4ABTA 1OH7A 3EVFA 1EGQA 4U2BA 4NFLA 2A6PA 1XZNA 1XZFA 1DG3A 2ZJYA 4CNBA 1TECE 2G80A 2W70A 3PX3A 5IC5A 4CFYA 7REQA 2XWBF 2I6SA 2AZDA 3IRUA 3HXKA 4NOKA 4PAOA 1J7KA 4UUBA 3DAGA 5DM60 4KQXA 5CIWA 3CMMA 5B2FA 1MAVA 4Z7OB 2NTJA 3SEFA 1IZ0A 4CEHB 2KB0A 4QUAA 1YDFA 3KOMA 1TVMA 3QX7A 2P5SA 4Q18A 2R6HA 2VUTA 4N1AA 3L7BA 721PA 4YCBA 4LA4A 3W2FA 4EFMA 4URVR 4AUMA 4EI9A 1QPBA 1N2CB 4WGGA 3QMPA 2JH3A 5IC4A 3KQHA 1RP1A 3Q7RA 1BXRA 1N75A 4XQ9A 4H60A 4IQGA 1TM2A 3TI7A 2CWWA 2CXPA 3D7MA 2YHIA 4AUEA 1GNLA 3R5TA 4KLAA 5DDIP 1ATZA 1UKYA 4J94A 3DXZA 5AT1A 4CIVA 3U44A 4MV8A 4ZVSA 3E61A 3M6FA 4YO8A 3E58A 3OQVA 2PIDA 1F4VA 2QRVB 1PZXA 3HADA 3OEYA 4J76A 5DCLA 1QMGA 4GPD1 5KKCA 3F71A 3AV0B 1MOPA 3A6JA 2CDAA 3IAS1 1GNTA 3R0XA 4Y6QA 2H52A 5GMOA 1NE7A 5DYNA 5BNWA 1NRJB 3E0QA 3KKEA 4ICIA 4KU4A 2WPNA 2QXTA 4U2EA 4W6QA 4KQJA 2ZYWX 3G6KA 2IHKA 4WAUA 4WFQA 1U4OA 1V3UA 1W75A 2R79A 3AOEC 3E15A 3A7DA 1K8ZB 2VSNA 3B89A 1A9ZA 2GZMA 2NU7B 3EFOB 3W34A 1Z63A 3RQSA 2HPVA 3HYTA 4JXKA 5H1YA 3COWA 1QIGA 2RI1A 1WP4A 3IPCA 5EWJA 5JECA 5IAGA 3QYPA 1RWBA 3WGIA 1J9ZA 3VOSA 3K1ZA 3JVEA 4JLUA 4L76A 1T1JA 1SPXA 4WFJA 2QGZA 1PZMA 4JVLA 4Z4GA 5CR9A 2JBWA 5K8TA 4NYJR 3HYLA 4QOHA 2FAXA 2VUHB 3FOBA 3NFYA 3OIFA 3KUDA 3EBPA 4TKZA 3TLEA 3AVVA 1UZLA 1EVZA 3WK6A 3OIUA 1DSSG 1LVUA 1II9A 1PV2A 3KSRA 2RG7A 3KUUA 4C7JA 3JW8A 3HJGA 1JR6A 3UMFA 2ILVA 3VDNB 1M5RA 2XIJA 3IUEA 1WG8A 3ZUGA 5I6DA 1NTRA 3C3PA 4R4JA 1PGNA 3L1HA 3ZHSA 3GG2A 1MHPA 2FVXA 1X7DA 3VDMA 4A6DA 2JI4A 2B69A 4UU7A 3FMGA 1XD8A 4TXJA 4LJKA 4OI4A 3CZ5A 2PNFA 3E82A 3VVMA 1U99A 1Z83A 4J1TC 4WDQA 3T4UA 4R8MA 1H2BA 2AG1A 3G85A 4K8RB 5LMCA 9MHTA 4M4SA 4BCDA 1T5OA 5BYKA 3UGJA 4Q0MA 2AWOA 3JQ6A 4DJDC 4R1OA 2RGNA 1XJ5A 5JWRA 2QJTA 4MOWA 4YJ2F 2YXNA 4RESA 4LFBB 3OIGA 1CU1A 2FPRA 1SOMA 3A1CA 2CVOA 4RJIA 3LVBA 5F7JA 5TEWA 4AUKA 4ZGWA 3OAAD 2PLRA 3FZNA 2HWKA 1T8YA 2QL7A 4UBLA 3SYNA 5D5HA 3I37X 3NBXX 1FYXA 3CSSA 5DHRA 3WYGA 4AF7A 1V5EA 2JAUA 3PPIA 3FTCA 4LRQA 4FHZA 1TC2A 2B4RO 4P36A 2HIAA 4HDRA 2J5XA 3LT5A 3BWEA 1JHUA 4Q3KA 3NEPX 4RVFA 4EUEA 1OIXA 3Q12A 3OX1A 2A9QA 4LF5B 4FZVA 3OF2A 1IEXA 1QH0A 5FBZA 2QXYA 4Q7MB 4UU0A 4NCHA 2OL4A 4TM8A 3H42B 4GDFA 4U7WA 1LRKA 4B74A 4BL5A 4O3FA 5I7WA 3KXIA 4L3WA 4FGZA 3ENQA 2AX4A 1CWUA 3GYBA 1G8SA 4JXJA 4L7QA 5FPQA 1KYYA 3I6ZA 2X5XA 1ZINA 4ZOAA 2C8KA 1VDZA 2EX4A 1ZCBA 3WAGA 1YS6A 2YYSA 1EXNA 4ZK2A 1JDNA 4I46A 1CRLA 4R98A 1YMQA 4CEHA 1QK5A 4BFCA 3OQ6A 3PF9A 1TFRA 3DBRB 2VSQA 2OENG 2DETA 3B5IA 5KYTA 1DAFA 1GTG1 1G8FA 1JIQA 3IJRA 4G0WA 3C5EA 1EDDA 4ARZB 1PUIA 1N2CA 3CY6A 1JDPA 3LBFA 2AYYA 3H3XA 2QRLA 4CM6A 2GH1A 3JRXA 3O47A 2RD2A 2QBYB 3MAJA 2O2JA 1X7HA 4ZVKA 1OF1A 4C30A 2EZ4A 2QRKA 4JCCA 4B34A 2CNWA 4M9SA 1LI4A 1JTFA 2V5UA 4CL0A 1MP0A 2VZLA 4CKBB 2HSEA 2C9YA 2QRVA 3QOXA 4GI5A 1Z5WA 4ZVNA 5CFLA 5BSUA 2H4JA 2TECE 3MD0A 2NXCA 4JSYA 4LBZA 4R2HA 3ROTA 2QZZA 5BSTA 1OU0A 1PEDA 4JB0A 2Q5JA 3VBEA 4OB8A 3N87A 2HTFA 1HFEL 1JZSA 3PQ3A 4X20B 4OI0A 3F5DA 2XGJA 1I6MA 4GX1A 3EARA 3R3ZA 4L2IB 5DIZA 1KBOA 1XAHA 2VL7A 5HKAA 2J59A 3I92A 4RTPA 1Z5VA 4H3HB 5EXDA 3H1FA 2EZ8A 2NU7A 4C7KA 2NW6A 1AGNA 3WWDA 1S3FA 1XKXA 4L85A 4QGFA 5G0TA 1IXZA 3X3HA 3DV2A 1NE2A 5LL6P 4ZU3A 4ND8B 3ENNA 3QJGA 1Z73A 1R6XA 4R0NA 4EPYA 2QWXA 5FAXA 5HKKA 2Q0QA 3TSYA 2HT6A 2N1MA 3ESAA 1FSZA 1VHQA 5D3ZA 2D2IA 2ZTLA 4RVSA 1D04A 4U9UA 3U5ZB 1OREA 1SCDA 2IEBA 4XEUA 4EFLA 5ABPA 4OM8A 3DNFA 1MQAA 3Q7SA 1FBTA 3TOSA 1QSGA 1EA5A 2YV5A 1YTLA 5JAPA 3HUDA 3PJDA 4B32A 2BJWA 3R3JA 1NVWQ 3A9SA 5D51S 3EGOA 2HR1A 9ATCA 1RM4A 2AN3A 2GZAA 2WPDD 2JS7A 1ETUA 1TQ2A 1Z29A 1R27A 1ZEMA 4WN9A 3T34A 4E70A 1GSHA 3IA2A 1OVMA 4QDKA 2X9VA 3O4RA 2LE0A 1FUIA 3BE8A 3BQ9A 4YB8A 1IOVA 1YZNA 3DKIA 2NYRA 3Q9UA 1AO3A 2ZGVA 3R9WA 1HYEA 3E48A 4Y9RA 5JT1A 3LZ6A 1XMQB 2PKRA 2XMCA 5TPZD 1MHTA 3G9UA 1VRWA 2HJVA 2NT3A 2B2XA 2HQ1A 2OWEA 5I7HA 3CH7A 5TGDA 3G2LA 2G72A 4PBRA 1N0IA 2HH9A 3OJXA 4TX1A 1E9RA 3ROKA 1X94A 3UUWA 2WIJA 4M9RA 1L8QA 2P3SA 4RZ2A 1Q14A 4WOCA 4DNPA 5JDIA 5L40A 5LKAA 1XCJA 2XRFA 2H7XA 1QF7A 3FUVA 4TXMA 1VLZA