4PCAA

X-ray crystal structure of an o-methyltransferase from anaplasma phagocytophilum bound to sah and manganese
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
221
structure length
221
Chain Sequence
b'HHHMRNVSLSKQDEYLNKLFAVDTEGALKAHKTAPSELRMAQLGTVEGQMLQLLIRMAGIHSIVEVGTCVGFSAICMAHALPSKGHIYTIEKDYENVVTANQNIVNCKLEDKITVLHGEALAQLNTLKEMAPFDMIFIDANKSSYLAYLNWAKMYIRKGGLIVADNTFLFGSVFDEHPTEKVSSNAHASMRAFNDELANKEKYLSTIIPTSEGMMVSIKLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O-methyltransferase family protein
publication title An O-Methyltransferase Is Required for Infection of Tick Cells by Anaplasma phagocytophilum.
pubmed doi rcsb
source organism Anaplasma phagocytophilum str. hge1
molecule tags Transferase
total genus 81
structure length 221
sequence length 221
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4pcaA00
3HNRA 1NBHA 3GXOA 4XUEA 4RTRA 3SSMA 4BP1A 2OO3A 4OBXA 5LQKA 1FP2A 3DMHA 3ELWA 4NECA 3A7EA 4C4AA 1O9HA 5CVVA 3SVZA 3KR1A 1RI3A 5BP7A 2IDKA 1QZZA 3EMDA 4FSXA 5DX0A 3JWIA 5FWDA 5HIJA 2G72A 3UJ6A 2IGTA 2ZVJA 5ERGB 2BR3A 5EMKA 1G60A 3FTDA 4MQ4A 2ZIEA 3G2PA 3SX0A 3T7SA 1WS6A 3FTFA 2A14A 3P2IA 2Y1XA 3AXTA 4PNEA 3MTEA 3VC1A 1SUIA 4QVKA 1ZQ9A 2P3OA 5ICEA 1O54A 5DXJA 2YR0A 1IXKA 3OFKA 3GRVA 2PV0A 2OBFA 1YUBA 5F2NA 1SUSA 1EJ0A 1KPIA 3BZBA 3LCCA 1VBFA 3E8SA 4KIGA 5H02A 3FPEA 1JG1A 4HTFA 1VL5A 4JXJA 4M7RA 1R8XA 1Q0TA 3HA3A 4AX8A 2Z6QA 1SKMA 3M6UA 3KPWA 3FPHA 3GGDA 1XTPA 1L9KA 3O7WA 3EEOA 2UZ4A 3G2MA 5F2OA 2NP7A 5K0LA 3BWYA 3NVMB 2VDVE 3HA5A 3HCFA 4GOMD 2XBMA 2ESRA 3T7TA 1OR8A 4PIMA 3NWEA 4LWPA 1BC5A 4YV1A 5K0FA 3ANXA 5FULA 1SG9A 4P7FA 4RSRA 5CIYA 2BM8A 3ERCA 4YV2A 2ERCA 3LDFA 1P1CA 2P8JA 2FRXA 3EVEA 5EMMA 3DH0A 2AZTA 1KPGA 2VZ9A 3LDUA 4E30A 4P7JA 4FT2A 1V39A 1D2HA 5D1NA 4HSGA 4RX1A 4RTSA 3AY0A 1JG3A 3K6RA 3UA4A 3B3GA 3G7UA 1BKYA 4QPNA 5K09A 5D1HA 4EVIA 1O9GA 2IDJA 3TM4A 1U2ZA 2GAFA 1EIZA 3HA7A 3GO4A 2E5WA 3UZUA 1D2GA 4GOLD 3KHKA 3OU2A 5FHRA 2YUIA 3CJQA 4RVFA 4CKCA 3TKYA 5DM1A 3UWPA 3OE5A 2PVCA 4YUZA 2ZWVA 2EG5A 3MCTA 3MTIA 3R24A 4KDRA 3TM5A 1TW3A 5CCXA 3MHTA 2IBTA 2CMGA 5G02A 3EMBA 5GM1A 4C04A 2P7IA 1NBIA 5BW4A 2G8NA 5DM2A 3UJDA 2DULA 5K0EA 4X60A 2AVNA 3LX6A 3JWHA 1KIAA 2YQZA 4QTTB 4WXHA 2GA9A 2JJQA 1KXZA 1WXXA 1QYRA 3LCUA 5EMLA 4OA5A 5HIIA 5CVJA 3OFJA 1ZKDA 1JTFA 3PFHA 5K01A 1JR4A 3H2BA 3Q87B 2AOWA 2AOTB 5E8RA 3P71T 5EC8A 2ZSUA 1L1EA 2LD4A 3M4XA 3KQTA 2PX2A 5EVJA 3EVDA 3FTEA 1SVUA 3HCCA 1P91A 2K4MA 1AQJA 4QPPA 5HIKA 4GC9A 4FGZA 2ZW9A 4C07A 4FS8A 3UFBA 2JH9A 4E33A 1JQ3A 4QDKA 4PYNA 4GF5A 4CXMA 4BLUA 2ZIFA 2G71A 4PYLA 5DLYA 4HGYA 3NDIA 5DTMA 1DCTA 5CVUA 2O57A 4U7PB 5EEGA 1UIRA 2HTEA 1RI1A 3B5IA 3X0DA 5DM0A 3NWBA 3TOSA 1P39A 1BHJA 5GOZA 1XDZA 1L3BA 4DCGA 10MHA 4YV0A 2BR4A 4LG1A 2CMHA 1KYZA 4HC4A 2NXEA 5DSTA 2BM9A 2AOUB 4ER0A 3KPUA 1NV8A 3DULA 3GRRA 5DPMA 4ATNA 4C03A 5K05A 4DM3A 4ISCA 1NW6A 2XVMA 4X41A 2H00A 2YTZA 3PTAA 2ZZNA 2DPMA 5LSAA 1I4WA 4OQEA 1HNNA 5E2AA 3O4FA 3NVKI 3G2OA 3P97A 2IP2A 3OU7A 4OA8A 4RTKA 3BWBA 3NDJA 5F2KA 2C7PA 5DX8A 1G38A 2JG3A 3B7PA 4IV0A 5EG5A 3R9XB 2VP3A 2EJTA 3DXZA 3OU6A 3FPGA 3GRYA 3C6KA 3R6TA 5CM2Z 2EX4A 5CVEA 3UJ9A 2QY6A 3HVJA 2IH5A 3DXXA 5HFJA 2C7QA 3K0BA 5FA5A 2BR5A 3G8AA 5C1IA 3A25A 4R8SA 1SQFA 3NTVA 3ID6C 1DUSA 2C7RA 1XDSA 2AN4A 3KPVA 4FSDA 5B1SA 1I1NA 3FUWA 3KQQA 3TKAA 3WSTA 4QDJA 5K0CA 5GIPE 5EQJB 5LQRA 5DTRA 2HV9A 3LKZA 2HNKA 3ORHA 4EKIA 3OZRA 5ICGA 5K8VA 4PYIA 5FCDA 2JHPA 2V74B 4HG2A 4R05A 2BZGA 2P41A 2QM3A 1R74A 3EGIA 2JHCA 3GWZA 2YVLA 3HVHA 3KU1A 4QTUB 5C0OE 1YB2A 3FUVA 3PS9A 5LR6A 3LHDA 5E8JA 1KR5A 2ONYA 3NJRA 5IH3A 3SR4A 3FRHA 3ELDA 3HCBA 1RJEA 3E23A 1VE3A 4P7KA 5EOVA 4ER5A 1RI2A 3CKKA 2B2CA 2H11A 4PYKA 2OKCA 2ZBQA 1KYWA 3I5UA 5GIOE 4E32A 4LECA 3VC2A 2CKDA 2YX1A 3HCAA 4YMGA 2BH2A 1QAOA 1YFJA 2PT6A 3A26A 3KQPA 5CD1A 2QRVB 5GWXA 3EVGA 4RTJA 3CC8A 3B3FA 3M33A 2G1PA 4KW7A 1INLA 1L3CA 2ORED 5E1BA 3EPPA 4EKGA 3THRA 3PT9A 4X63A 5FUBA 2NP6A 1RI4A 2P40A 1M6EX 4DQ0A 5BW5A 3GRUA 1WZNA 2IH4A 2ZCJA 8MHTA 3MAGA 2IH2A 2O07A 1G8SA 3BKWA 3G5LA 3TMAA 3UJAA 3REOA 5JR3A 1RJGA 2JH8A 4PGHA 2V7EA 1P1BA 3GU3A 2B25A 3LPMA 3KQOA 1X1AA 5T67A 1JQDA 3PFGA 2P35A 3EVBA 3KPYA 1F3LA 3BWCA 3HCEA 3SSOA 2PT9A 3TFWA 5EMJA 3FUTA 3HCDA 3ME5A 4YUVA 3CVOA 3B3JA 1YZHA 3HP7A 5E9WA 4E2XA 5E1MA 4C08A 1UFKA 1MHTA 4B17A 5LQUA 2HWKA 4PCLA 3V97A 4GQBA 4F85A 3HM2A 3LDGA 5LQNA 1D2CA 3JWJA 2AOTA 4RVDA 2Z6UA 4PCAA 2IPXA 3F4KA 4PONA 3P9CA 3U81A 5IKMA 3P2EA 2I7CA 4DF3A 5FA8A 1QAQA 2HMYB 4IV8A 2R6ZA 2AN3A 3EGVA 5HZMA 1AF7A 3C6MA 3DMFA 3G5TA 3OPNA 4KDCA 4RYLA 5CVDA 3M6VA 4OBWA 4EK9A 2UYQA 2GPYA 1RJFA 2ZLBA 3I64A 5EKXA 1TPYA 4C06A 2O06A 1IM8A 3FTCA 3MCZA 3P8ZA 1R6AA 4GBED 3KQWA 2B3TA 5E1OA 4E2YA 5EIWA 3P2KA 1VLMA 4GUAA 4AZTA 1B42A 2ADMA 3KPJA 3NW9A 5FHQA 3SXJA 3T7RA 4V0QA 4Y30A 3PLAE 1VIDA 1JSXA 3DLCA 2IIPA 3RODA 2ZFUA 4DMGA 3BGIA 2IBSA 4E70A 2CWWA 1VPTA 3IHTA 2Y1WA 3P9NA 2ZTHA 2AOUA 4PINA 4RTNA 3A4TA 5JUWA 2PX5A 1AQIA 1JQEA 1XCLA 4RV9A 1NE2A 2PJDA 2H1RA 5FQNA 3DUWA 3BXOA 4RTPA 5EZSA 1R18A 3EVZA 1Y8CA 3IYLW 2OZVA 4MTLA 2P3LA 3A7DA 3PVCA 3MB5A 5LQCA 4DCMA 2I6GA 3FYCA 1QAMA 3DMGA 4IWNA 4BLWA 4YUYA 5ICCA 3LL7A 3TR6A 2ZZKA 1BOOA 1F38A 2XYVA 4ER3A 2YXLA 3R3HA 3P9KA 4L7VA 2PXAA 1X1CA 2N47A 4R6XA 4ZTBA 4RTLA 2JHAA 4Y2HA 3E05A 2OY0A 4GOND 5E9QA 3DXYA 3KR0A 1L3IA 3DP7A 2HR1A 1UWVA 3SM3A 2AR0A 1HMYA 3RIEA 5CCBA 3B89A 5T6BA 5HILA 3GIWA 3FPJA 3TRKA 3ER8A 2PBFA 2CL5A 1WY7A 3MQ2A 4C05A 5M5BA 2QE6A 2FHPA 3E7PA 3Q7EA 1AV6A 3CGGA 4V0RA 3TPZA 4A6EA 2YXEA 3KR2A 4IKPA 2VDWA 3PB3A 4MIKA 3KKZA 1DL5A 1JSZA 1MJFA 2FCAA 4PIPA 5E9JA 5T64A 4HH4A 3BKXA 4BP3A 2AS0A 2B9EA 1FP1D 5KQSA 4X61A 1KHHA 3A27A 1N2XA 3DR5A 3G2QA 3P9IA 5FTWA 5K0BA 1NKVA 4CWAA 4AUKA 2I9KA 4CTKA 5HOQA 2QYOA 5FQOA 3IEIA 4MHTA 1YZ3A 1XVAA 5EIFA 4PWYA 3CCFA 5DT2A 5FADA 2VS1A 2OB1A 3AXSA 4CTJA 3G8BA 1G55A 4QVGA 1FJXA 4EMSA 2OPBA 3CBGA 5E1DA 3I53A 2AOVA 5E2BA 5GM2A 4ER6A 2UYCA 3FZGA 3GDHA 3SGLA 2C7OA 1SQGA 2ZULA 4KRGA 1EQAA 9MHTA 3BWMA 3EEYA 4HRAA 2QRVA 1IY9A 1ORHA 2PLWA 5GP1A 3OZTA 1G8AA 4H0NA 4R6WA 5DX1A 1EJ6A 2WA2A 3PX2A 3SMQA 4YUXA 4ER7A 3HEMA 5FWAA 5C9ZA 4KWCA 2VDUE 4YMHA 3BUSA 2P1DA 2R3SA 2KW5A 2ONZA 5DRYA 1NW8A 2O0LA 4PGGA 3NMUF 2OB2A 3CJTA 3G88A 3L8DA 3QOWA 4KIFA 2WA1A 1NW3A 2ZIGA 3JWGA 5ICFA 2NXJA 3LBYA 5K0GA 2OYRA 2XYQA 4YUWA 2UYHA 1PJZA 3D2LA 2B78A 7MHTA 5CUQA 2OXTA 4PYMA 3LKDA 3I58A 5KQRA 4BLVA 4HTFB 5U4XA 1QANA 3MERA 3BGVA 3LGAA 1KP9A 4GEKA 4OQDA 3ER9A 4HGZA 1Q0SA 3LCVB 4DKJA 3UBTA 3GCZA 2EJUA 1RJDA 5EPEA 3LSTA 1R00A 4F86A 3HTXA 4AZSA 4BY9E 3C3YA 4RTMA 2PKWA 2P3QA 1KPHA 4P7GA 5KVAA 3FRIA 4G56A 3VYWA 3OZSA 1ZHFA 2O05A 3ELYA 4K6MA 3BT7A 1JG2A 3FUXA 5GINE 3KQMA 5LQJA 3DLIA 1JTEA 2AN5A 2F8LA 4OX9Y 2YXDA 3BGDA 3KQVA 4O29A 1JG4A 1XJ5A 2WK1A 3FYDA 4M37A 4RWZA 5EKUA 1N7JA 4Z2YA 4LWOA 5EEHA 3UJCA 1NW5A 1R8YA 2PXXA 1NT2A 3EVFA 4RTQA 3VSEA 4P58A 4GOOD 5EZQA 2GH1A 1XCJA 3G89A 1FBNA 4XCXA 3V8VA 4E2WA 2AOXA 1VP9A 5K03A 4QQNA 3GNLA 3DOUA 1M6YA 1WXWA 3FPFA 2NXCA 1RI5A 3S68A 4FZVA 2Z6AA 3UJBA 3EVCA 3RW9A 4U7TB 1ZGAA 3M70A 2XVAA 5HIMA 4UOEA 2PWYA 5BXYA 1I9GA 5KS2A 3C3PA 4EQZA 3EGEA 1XXLA 2NYUA 3FUUA 4RVHA 3TLJA 5LQAA 3R0QA 5DTQA 3QV2A 5DWQA 2IFTA 1FPQA 2G70A 1TW2A 1EAMA 1NW7A 5K0NA 3ELUA 4F84A 4QQKA 2ZBRA 2Q41A 3KQYA 4GC5A 5DXAA 3THSA 4M36A 2PXCA 1NV9A 3O31A 3C0KA 4PYOA 2PSSA 2P7HA 3KQSA 5DM4A 4FP9A 4PYQA 2ZZMA 5MHTA 2FPOA 4AZVA 2PWPA 4FT4A 4WVLA 2FYTA 3LECA 3OCJA 2FK8A 3OE4A 1X1DA 4POOA 2ZBPA 4PYJA 2PX8A 4MWZA 2AVDA 5K0JA 1X1BA 2PY6A 3GRZA 5EHGA 3UA3A 2NNWB 2GB4A 1ZGJA 4M38A 3MGGA 4CKBA 3I9FA 3T0IA 2FK7A 1WG8A 3M6WA 5HEKA 4E31A 5EHIA 4RTOA 4DA4A 1G6Q1 1EG2A 1PRYA 4R8RA 5P8WA 4FR0A 5KYGA 2I62A 3TQSA 3AWIA 4AZWA 2ZWAA 3KR9A 3LBFA 4KVZA 3QOXA 4XUCA 3HVKA 3EVAA 4X1OA 5DRTA 5EGSA 1ORIA 2EFJA 4A6DA 3AJDA 1ZG3A 1YFLA 3HVIA 3CJRA 2UYOA 1X19A 3IV6A 1XDUA 3DTNA 1N7IA 4CKEA 2GS9A 5DSXA 4XUDA 1VP3A 2XYRA 4DZRA 1M0EA 3GJYA 2PX4A 3UJ8A 2PGXA 4E2ZA 2NXNA 4RVGA 1Z3CA 3UJ7A 1VQ1A 1YF3A 3SSNA 1H1DA 1T43A 2GLUA 3PX3A 3M6XA
chains in the Genus database with same CATH superfamily
1L7AA 1U8CB 4BP1A 3ZHRA 1T6BY 1Y3CE 3NDBB 1PJAA 5A5EA 4JLOA 5EN4A 4IG4A 1W19A 5FPHA 2WHEA 4H7FA 4XWTA 1VMDA 3PA6A 1OT5A 4MWTA 2NVWA 5JCJA 5AXAA 5BP7A 5DGXA 1KJQA 1PDOA 1TL7C 4WCFB 4YBZA 4PXSA 1PJCA 2XUHA 2JI6A 3NBQA 1G7CA 4F9FA 5MFPA 1RZRD 2OBMA 2Y1CA 3IR5A 2WJJA 1A8PA 2FB9A 2H63A 1TCBA 2Q99A 1EPUA 1DJLA 4JUFA 3BFPA 4ZDWA 2W2KB 3TE6A 3ICWA 1X38A 2VDNB 4FNAA 4URUR 4MRMB 3K1AB 1QIHA 2ZJ5A 3OE1A 4L6AA 1SUIA 4XD7A 4L5JA 1GXSA 4HDMA 1PV2A 3PEWA 1FJ2A 1D8AA 3QYAA 1E9RA 1Z3IX 4QUBA 1PR5A 2XB9A 1X1EA 2R6GA 4URHA 1T2AA 3BICA 4OFXA 5IM5A 4AECA 5ICSA 5MF6A 1H5NA 5BQFA 4WADA 1WKVA 4GI3A 5DHTA 4BKMA 5IDXA 1XAIA 1Z5PA 4M9ZA 1GZHB 4G0WA 2R6R1 3DCYA 3HA3A 5EIAA 2EATA 4JOCA 5ELLA 4MVJG 3T5AA 4Z4QA 2P9TA 1CUWA 2ZJ1A 4J3JA 1J70A 4P33A 4H1WA 4YMVA 1Y0BA 1C1DB 1UJ5A 2Q2VA 1G20E 1LK0A 1RHQA 3HA5A 2VAWA 1JYFA 3QE2A 4GOMD 4QYMA 3IMGA 4S35A 3T9FA 3TN7A 4XWWA 1R50A 1XU4A 1EXNA 4UD6A 2JJ2A 4FS3A 2BM8A 4FGLA 2ZBFA 4KQ6A 5FORA 1WU8A 1FP4B 2N42A 3WGQA 2X6RA 1KDZA 4YJ3F 3GRPA 3MFQA 4AD8A 4E30A 3ZI4A 2I34A 4KFSA 4RX1A 3K6RA 3B3GA 2CL6X 1CUYA 1VL6A 2WU3A 3FBTA 4II3A 2BKXA 1O9GA 1CB7A 4YRQA 4EA6A 2GAFA 1JXMA 2UZAA 3UZUA 3T5PA 2IUSA 4O6VA 3TAXA 1E3JA 2FQWA 5LP6C 1ZBDA 1J1ZA 2VRBA 2PZJA 3TGWA 4AULA 4YPVA 1Q15A 3A36A 1EQ2A 3S28A 3PL1A 3T4UA 2DHEA 3WL4A 1U4SA 4CZ2A 1R0KA 1L5LA 3E58A 3X2EA 4JLJA 4UXIA 1G98A 4OQZA 2ONJA 4GGMX 3UATA 5A5VA 1J4AA 1C7IA 5CA0F 4IMJB 1YBFA 1NL3A 1DC8A 2KM1A 5F9MA 2MJLA 2V7TA 3HP4A 2A8YA 3P9SA 1WCIB 2ZTMA 4PS1A 3ROTA 1T9GS 4DLZA 4KE6A 1OI4A 2QLMA 1KK2A 2ID4A 2P5YA 5IJZA 5L3QA 3K6SA 4D92A 2VZ0A 1N2CE 2FFAA 4JYBA 4TKLA 1FNSA 1X9GA 3IOCA 1R4MA 3UUEA 4V0KA 3E9YA 3EGXA 1XZAA 3V2GA 3E3LA 4ENWA 1GUYA 3HE3A 1II8A 4A26A 3EIXA 1U9CA 3DAPA 5IK2D 1KEKA 3BWVA 3OOSA 4GC9A 5HIKA 2G7MC 4J0CA 3ICCA 2CNLA 2JVJA 2XQFA 1R9NA 4HKTA 1BU8A 3R5JA 4KI0A 2W2QA 4TMXA 2VYNA 4UVEA 2GVNA 5BN3A 5CYGA 5A2QA 1L9XA 2BN4A 2WWTA 3OQ6A 4XX0A 4RFLA 3U7FB 1J2RA 2YNMD 1PR0A 3EDMA 3ST7A 4EP1A 1IG0A 1D7AA 2GRAA 4FNMA 3OZXA 2B4YA 4G37A 1JJFA 4DMFA 1RC8A 1OBVA 5BRNA 2AG5A 3H5AA 4W9RA 3GPCA 3EN0A 3ENZA 4DCGA 1E3WB 1UMBA 1TZJA 2ZK7A 3ZKAA 1EQUA 1FNBA 3ZXIA 3A6LA 3AKEA 4B79A 5DPMA 2PFSA 1NZDA 2Q3EA 3RGGA 1D1SA 2ZTVA 1ZP6A 4B48A 4X41A 3IVRA 3BFVA 2FPSA 3WWPA 3ISVA 1QVZA 1T9KA 2YTZA 2ZZNA 1N2ZA 1GHTA 5BNZA 3VZCA 1RWWA 4ONEA 1VZ3A 2OD2A 3ZJ5A 5LUAA 1M2OA 1LLUA 1CJBA 3VYRB 3WK4A 1U0RA 1FQOA 2FDCA 3E7FA 1MAWA 5G1NA 2DERA 2ZI5A 2ISSD 3BJMA 1ZONA 3FNIA 4KQWA 4GZMA 4A2QA 1DX9A 5AOBA 3RT9A 5CVEA 3WWYA 4CMEC 2Y3IA 4MYSA 3AHFA 2GKGA 4KR7A 3K0BA 4BVHA 4JT9A 4E46A 3VV2A 1T1RA 5AI4A 3NTVA 3T3MB 2ECPA 4O4LB 4NULA 1EUDB 3TMYA 1RPZA 3PEUA 4ZO8A 2IOQA 3QK7A 5I5GA 4FE3A 4FPXA 5I9IA 1UJ6A 1F2TA 1R6TA 2VRNA 1N5IA 3FUWA 3H75A 1L4UA 1U5CA 3JCZA 3M4NA 1NASA 5SZHB 3TKAA 4M55A 1BH6A 4FBMA 4D42A 1H2RS 1O6BA 1UFQA 1BQ4A 2Z3WA 3D1LA 3ZH9B 4BWYA 4F72A 3SVTA 2NT3A 1QZ3A 1BROA 3VX3A 4WOCA 1JB1A 1DXOA 1MF7A 4BIIA 2NM0A 3KJGA 1H3EA 3OY2A 2NAPA 2Q4TA 1PNTA 4GSLA 4S1VA 1F2UB 1FUYB 1U8TA 2G9VA 3OSZA 3HL0A 4CF7A 1S8FA 1PFGA 5CP8A 3CKYA 4U7JA 3L7OA 3TR5A 5TT0A 3HCPA 3JD2A 3S2FA 2VK8A 1LRKA 2UZ1A 2BKEA 3DL2A 1CUAA 4WPGA 1KZ6A 1VM6A 1BW9B 1Q50A 4LECA 3V32A 2X86A 1UODA 4HGPA 2RGGA 3DM9B 4FE4A 4IXDA 3PGVA 3KQPA 4ZCIA 1NM5C 1YZLA 1CR0A 5JLJA 1VI6A 1H1TA 4QQ8A 4G4IA 4BS9A 3EPPA 4EKGA 2PQ2A 4ZI7B 3UNXA 3WQBA 2IYOA 4N0DA 1L4NA 1S9DA 3GUZA 1P7PA 3HLTA 4PSAA 4X63A 2WJ3A 1V3QE 1XB2A 2FUG6 3D0RA 5FUBA 3WWOA 3L8HA 2Y71A 2AJTA 2JFYA 3DG9A 2FMIA 3I9V6 2IH4A 4IXNA 1FMLA 3ZJUA 2QAJA 3OLCX 3R7DA 4OHZA 3EZ6A 3Q9NA 1N4AA 2ANBA 4HS4A 3I42A 2E89A 2QTVA 3S2YA 3C85A 1ORTA 1AZLA 2PKRA 3G1WA 3IPCA 2QJFA 3PFGA 3IIKA 4B2PA 3T3OA 4OU4A 4FLFA 2DFPA 4F2PA 5FF9A 2CFCA 3FUTA 1DIHA 2HIMA 2JLBA 2FSUA 1Y6QA 2XRFA 4W6ZA 4F4DA 4YT2A 1HFKA 3B1WA 5DULA 2H4XA 3V97A 5CDTA 4D43A 5LQUA 2FAXA 3Q8XB 2WM2A 3NBUA 1D2CA 1IUNA 2X0JA 1S8AA 2ATIA 4IMIB 1XVIA 2HK7A 3PSHA 3MT0A 4HVTA 5IKMA 3BXGA 3NEJA 1H2YA 3VI3B 1YR2A 1T0PA 3AF2A 1KZ1A 3KXLA 4MV1A 4AY3A 4MLZA 4JFAA 5JSZA 3EGVA 4XLLA 2BEUB 4HJRA 2C98A 3WGVA 4HAOA 4V0SA 4JKIA 2P6OA 2KQUA 3KU4A 4BNYA 1J22A 2KLBA 3GR6A 3IAUA 1CE8A 4EBFA 1R6AA 1ZN2A 2X0NA 4HWRA 4ASUA 3F9RA 4XR4A 3GEDA 1XMOB 4WBSA 1EFPA 1IU9A 1KY5A 2QENA 3KZMA 3MUFA 2QU8A 3CEMA 3QVTA 4OM7A 3F3KA 1UJ4A 1XRRA 2WLSA 3BFKA 1GKYA 4FJ0A 4MUNA 4Q93A 3ZOZA 4XXHA 2XMDA 2E1RA 2RARA 1UBLS 3OKPA 4IH4A 3QTBA 1FTWA 3PPIA 5L4NA 2GPSA 1QC5A 1JB9A 2Q2NA 3GN1A 5A4DA 5BN5A 2DR0A 4CT0A 1H66A 3FF1A 3GPLA 1NRWA 1X7YB 2QN7A 5BORA 1T0JB 2LUOA 1J7JA 4L9AA 4L22A 3SLKA 2J3EA 3V7WA 5IM4F 3U3KA 4E51A 2Q3BA 4AVYA 2XH8A 4HYQA 4IJQA 1Z6QA 5CFQA 2F1JA 2IHBA 2ACWA 1OLUA 2WWIA 3D31A 3IQEA 4KWTA 2I6GA 2O2HA 3HB9A 2ZDQA 3K92A 4ZVNA 5JMTA 1XWFA 4ITVA 2A1TR 2BBSA 4LHYA 1IVNA 3F98A 2YS6A 4WUTA 1N3YA 3II6X 2ICAA 1YRHA 1XZHA 1SPXA 2WJAA 1GQ2A 3FMPB 3QLVA 4YCJA 3CINA 5KJCA 2C3YA 2ZGVA 4Y2HA 1S2GA 2PM8A 3QXJA 2PCLA 3AEZA 4NRDA 3CT6A 3C16C 1QQ6A 1E0DA 3DP7A 4KWIA 4I8XA 3PI7A 2AKYA 2R86A 3TJRA 4BFWA 4Q3NA 5IC4A 1ZMOA 3T9BA 3ZDAA 7YASA 1MQ9A 2FHPA 1AV6A 1RKXA 2GKSA 5EHNA 1SXJB 2ZUVA 4NS1A 4GX5A 1FVXA 5HBGA 3VFDA 4ZGGA 5CB4A 3PQCA 4LF8B 1NSFA 4N7RA 3VOBA 4RY0A 1YI0A 3WGZA 1CRWG 2I03A 5FPPA 1EP3B 1PYDA 4G5FA 4M21A 2PZAA 3CHYA 5DGDA 1Z26A 2MU1A 1HEIA 3WNVA 2A0KA 3IJ5A 4QXQA 3H8SA 2JGEA 4TZTA 2J5QA 5IT5A 3O8RA 3DMRA 5B12A 3BFJA 3IUPA 3KZCA 2QLLA 5EMHA 3TX2A 1DT5A 2ZR8A 3ET5A 3KOWA 4CUKA 5JAUA 3FZGA 2H4ZA 2XCSB 4W4TA 4KRGA 4ETMA 1OF1A 2GN0A 3KJXA 2IS4A 1OWOA 3PFNA 5JH7B 4OBBA 4RPHA 4BZQA 1XZCA 3ITNA 4Q3DA 4A0SA 5BV0A 4JBGA 5J3JA 3AY6A 4L95C 3JD0A 1FVHA 3EE6A 4Z6KA 1TFUA 4WZBB 3BORA 1QIGA 3PQ3A 5DRYA 5JZBA 2PN1A 3J7TA 3UGQA 3OJ0A 4XI9A 5C5CA 1P5FA 1QHHB 1YZFA 4Y2PA 1T3GA 2B30A 3E0XA 1K7EB 1NIJA 1T36A 1MC1A 3OOHA 4IIEA 1M2VB 3P94A 3DF7A 1ZM7A 3SMVA 3W6UA 2XXAA 4UD2A 3M7IA 3SBXA 4D41A 1L5GB 4KMSA 2BLLA 1S3FA 3INTA 4Q9DA 2DAPA 3W5HA 1Z6TA 2IVZA 2X40A 1GU7A 1FFXB 3WLMA 3NPAA 4FOTA 1PWXA 3S1AA 3HTXA 2XSZD 3OOJA 4ODIA 3EHDA 2DQ4A 1FQWA 1KPHA 3E48A 2J6BA 1K5GA 4TM8A 3S2EA 1LS1A 5E6RA 1GDTA 3LT4A 5G2OA 4AS3A 2XR1A 3GFFA 2SKDA 4NESA 2BTEA 1JTEA 1HT2E 3K0AB 1CIVA 4F12A 1OPRA 2ZQ5A 4A92A 1JQKA 1RJWA 3UN1A 1NOJA 3LO5A 3MWFA 3IT1A 4DJTA 1NW5A 2FPGA 1STOA 2PUJA 4BVBA 1GQSA 1QG2A 4WOPA 2W8BB 3KBOA 1GCUA 2B83A 4RKWA 1V7ZA 3VSEA 1ZL2A 1ZM9A 4XCXA 4RZUA 3FBGA 2WKSA 2FLWA 2OQRA 4PO1A 4O59O 2YWGA 3ITKA 2W42A 3IPLA 3PXUA 3RUPA 2XIJA 2X1HA 2VPWA 2EQAA 5FWYB 3RW9A 3WBFA 3GLFB 5J4VA 2CY0A 2OQIA 2D1QA 2Q4DA 3TTYA 3CSDA 4EPXA 3AHCA 5L9AA 4AK9A 5SY4A 1Q1GA 5HMMA 4IL5A 1OBCA 4IFIA 4RVHA 3CM0A 1EUQA 4Q4LA 5MN6A 3PUKA 5DWQA 4F06A 3AEKA 4ZCRA 3I8XA 2O8BB 1EAMA 2QLTA 4ALKA 1X70A 1EK5A 5FX2A 1QCDA 1XCMA 3A14A 3L7DA 4LXUA 5K0SA 1XQVA 1RT9A 4BN0A 3L4SO 5DEIA 3DB1A 4EO7A 3HU2A 4HUQB 4RKRA 3KHSA 3SZRA 5L6LB 2WBLC 1X7ZA 1RYEA 4MW7A 1R0YA 1Z15A 5AUQA 4X8MA 2LKCA 3O7MA 2FPOA 2BHRA 4OUDB 1NNLA 4BX2A 3G79A 4OHUA 2DBYA 2FPLA 2PX0A 4WLEA 1TXGA 4UE3S 3GGOA 1XJQA 3OX4A 4UE2A 3STYA 1S2IA 3EIEA 3K72B 4KQKA 5TSDA 4FBGA 2FK7A 4A3SA 4PHHA 3W8NA 2AWNA 2PMEA 5IKPA 4UTNA 1PRYA 4WEOA 4BNUA 4ZXPA 2OQVA 3KVRA 2BRUA 3PNKA 4FHZA 2AHOA 4WOBA 4F96A 1W94A 2E4UA 3DO5A 2CXRA 1WUHS 1HT0A 1PZXA 4QLOA 4QOGA 3FVWA 4J91A 1ZG3A 4R0MA 2CXUA 2VF2A 4ZEMA 1Y8RB 4PLYA 3SICE 1RQLA 5EYPB 3B3AA 2SNIE 3DTNA 1ZH0A 2ECOA 4L9WA 4HDOB 5DIFA 3BRCA 2F90A 1K08A 4A82A 5I9BA 1LCIA 2L17A 3IIIA 4REQB 4YCNA 2IXEA 1QP8A 1NF8A 1O57A 1RWVA 1WX1A 3A1SA 4OIMA 3C8UA 2FZ4A 4FW9A 1C30B 4RL6A 4RVGA 5D8DA 3TPFA 3VNRA 1G42A 1T43A 3TZBA 3WIEA 4BU1A 1GTVA 1UBJS 4JL5A 2EF1A 4QD3A 1YDHA 5E9AA 2J59A 2HQ1A 5FV7A 1VKJA 3U7HB 1H5QA 2JFVA 1MVNA 1N4DA 4K3UA 2ZB8A 1N25A 1YAHA 1J24A 5AOAA 5I9MA 2IZ0A 4KK4A 4J4HA 4JJ6A 1G3RA 1KGDA 2ZB7A 2EWWA 1QZZA 1FL9A 1QHIA 4FB4A 5IVIA 1EX6A 1Z5ZA 1ZXXA 2D13A 4NICA 1JEDA 1UBGA 4MLCA 1DNPA 4R16A 2IGTA 2ZVJA 3PNSA 1ZEJA 2IYNA 4G9GA 2NZXA 5CXUA 1N92A 3AB3A 3Q10A 4D3ZA 2CLFB 5IBCA 1CZKA 1H6AA 2QR3A 1TCAA 2PX3A 2Q50A 3CX3A 4HLUC 4KXYA 3VR5D 4AF7A 4TVOA 4QSHA 3VR6D 3R3XA 4A9AA 4OXQA 1RWMA 2FLKA 3U7GA 4GDMA 4CLDA 4DS3A 5T7BA 1C3OB 3C1OA 1ODSA 2IW3A 2YXBA 3IOYA 4H9GA 4IRMA 4QRIA 2DQZA 2XDQA 5DHQA 1E6CA 2RCNA 3AHGA 1J0XO 3LFTA 1Q0TA 1PG0A 3UMBA 5HPYB 5BUSA 1LLQA 4JOBA 4F0JA 2YS7A 1RRPA 1NSTA 1TUBA 1EHCA 3DV0A 3QFTA 4UMEA 3IQIX 2XKKA 4CU5A 1U0HC 1PK7A 4J0KA 5D84A 4IKEA 4BJ1A 3HWWA 4KJXA 4PC3A 1NZFA 2RHWA 1JV2B 4L4SA 1XALA 1AGPA 3HU1A 3KTFA 4Q0MA 1A9RA 4WDRA 3R7FA 2H0QA 5IZ4A 5EZYB 4BXOB 5GVSA 3DZCA 2EBUA 2P8JA 4ZC1A 2EL9A 4YAIA 4RD3A 4U7DA 1WDKA 5H3HA 2J5RA 3ZVMA 2DZDA 4K5QA 2ROQA 3JQCA 3QZUA 5TF4A 3A10A 3K9NA 1UPBA 2M1ZA 2WAYA 1Z88A 3NC4A 4ZEWA 5MGBA 1IWOA 4PZDA 4US2R 3S7TA 1L1FA 4TMFA 1N0VC 1T4DA 4IDEA 1J8YF 4LHWA 1VPEA 5DM1A 4WX2B 4IVPA 3W8EA 1PR2A 3ETJA 2QRPA 4GKBA 2ZYIA 3RC2A 3RSHA 3SYNA 5KTOA 2Z09A 3L46A 3HBNA 4RM2A 5ALGA 3IVMA 1SM4A 4EL0A 1UZUA 1P1JA 1UP7A 4I1SA 5JS1A 2G8NA 5KHLB 3P4UA 1EHIA 1Q2XA 4DYHA 1YT5A 1T1GA 1C8LA 2FW0A 2P5SA 1SCAA 3JASB 1XHFA 4QEDA 2KSQA 2O5EA 5JQGB 4CU2A 1ZR2A 1OH6A 2RGXA 2WHXA 1F9AA 1Z6AA 3ZQKA 3H3JA 5E8RA 4WT7A 4YJHB 5BN4A 4YJGA 1HE3A 1T2DA 2AJDA 2JCXA 3PG5A 2OOKA 4RKYA 5L3ZA 4DLAA 3H13A 4F3YA 5KSWB 1TJPB 1CULC 3BDIA 2XCUA 3BK7A 2X58A 4HUJA 4D3YA 2IUYA 3S3TA 3OOWA 2CXHA 5KTMA 3HB1A 4TWIA 5LOVF 1UDXA 3BXHA 3RSLA 2WWHA 4BC0A 1X0XA 4QDKA 3LX5A 3K2QA 3RIHA 4DM7A 1AKUA 4YAOA 5REQA 3RSSA 1LBSA 1RXYA 2AF3C 2WMOB 5ALPA 2VJOA 1AE1A 1GFIA 2VYQA 3RAJA 4ZAGA 4J7UA 1UDBA 3SHWA 1P80A 3ORSA 1UC8A 1PLKA 2AR9A 3KJIA 5ALHA 1F0KA 1L3BA 4W5NA 4U6NA 5ELXA 3HYNA 3A4IA 3N59A 1N9ZA 2VCYA 1C4XA 3BXEA 5H70A 2C84A 2AC4A 1JEJA 4N5LA 4MGEA 2PYDA 3GOQA 4I9GA 1V5IA 3ZZTA 3RNOA 1JJAA 2XVMA 1KDVA 4MA0A 1N8NA 5DE3A 1XPJA 5EXSA 3KM0A 3GBPA 3TDKA 3DM5A 1E3TA 3RSGA 1I4WA 1J21A 1UT6A 2GJ8A 4HGOA 3RIYA 3VBEA 3P97A 5B55A 1EVLA 3PIRA 4MEJA 3U13A 4EKYA 1M6VA 3JRNA 1DBSA 1E6LA 1YRYE 5I48A 3KZNA 5E6SB 3I2YX 3RG2A 4BLTA 4LRTB 1QQAA 5CX4A 2AW5A 1Y4UA 4RKQA 1L5RA 1BJRE 2I1WA 2AE1A 2Q2QA 4EQ6B 4DGSA 1CLEA 3CLSC 3K9GA 2OBNA 3L7LA 5FYQA 2VI5A 1NATA 3U31A 3V1TC 4EKEA 5KQLA 2V59A 3FOEC 3LRTA 2WYWA 5EIHA 3LW8A 4F91B 4O2RA 1MOPA 4FMCB 3FYTA 3MM4A 4Q7LA 5FOWA 4K9LA 2OAGA 3NB0A 5B1SA 1NU8A 2G1JA 3DKPA 1MNQA 1OPXA 3ZBTA 3AVPA 2C5AA 5EZYF 3BN3A 5IARA 3JQAD 3G6WA 2VDWB 2G06A 3F1LA 3R74A 3STWA 5FCDA 5AKYA 2J9ZB 3PICA 5DLPA 2YRFA 2H0AA 1XX6A 2Q5OA 2BZGA 1GQQA 2L69A 1JHDA 3GWZA 3S7ZA 1TZKA 2FFBA 4B4WA 2IU6A 5TVKA 4YRNA 1SKQA 3NJRA 2AFRA 2PWZA 4PLZA 5AKXA 5TC4A 4N8EA 3RSFA 2OE2A 4DJJA 5IZCA 2QG6A 1UC4B 5KNLA 3ZI0A 4B3MB 1JKXA 4YXWA 4NDZA 3DOJA 2Y4OA 4QICA 1E1CB 2O14A 3L8GA 4C7OB 2QRJA 2YVQA 2PD6A 3CUVA 1GYPA 2BF7A 3QG1A 5JDIA 1WBJB 2XUIA 1PHRA 4DPLA 3RANA 4OYRA 2SHKA 1SKAA 3UF0A 2AJLI 4CIWA 1FW6A 1GNPA 1MX5A 5I7OA 5EJGA 2QRVB 1L7NA 2BVNA 2JAPA 3DEAA 4TSFA 3TF5A 2B34A 5A0FA 4KB5A 4YBRA 2XW6A 1YJAA 2L18A 5AJUA 4DSOA 1SUBA 1U2TA 1TCCA 1QBGA 4CVNA 5JQGF 4P80A 5F1YA 3BG5A 3TLKA 4DQ0A 3AL3A 4BCDA 4C2AA 3WWCA 1Z74A 1VXRA 1JKIA 5F9HA 2HA7A 2H2IA 1NONA 2BBWA 3GCWA 1NC3A 4KV7A 1V8BA 4NF2A 5EJMA 3U9LA 4I9NA 4ZOLA 4CHTA 2CC2A 5T67A 3UMGA 3VSCA 1GTSA 4NL4H 4G5SA 3PGA1 2AG8A 2I4NA 4QHTA 5KQPA 1Z0KA 3V4VB 1T5SA 4UHEA 3QUBA 2AK2A 1QGOA 4JR0A 1BWRA 1CUUA 1GZSA 4OHXA 3BE4A 4LJAA 5CPFA 3JQEA 3PFWO 1UJ2A 1MABB 4KR2A 4NBWA 2VQ3A 1RTTA 1H0HA 3MIIA 4DQLA 2PJZA 4ZV9A 1EKXA 3G68A 3JWJA 4DDWA 1AKQA 1U2DC 4EJMA 4AMGA 4AO7A 3K3PA 4LHXA 4KBGA 4I5DA 1JPVA 3ZY2A 2PBRA 4DLLA 2XSZA 1ACMA 1OJLA 2JLRA 3HR7A 1I3NA 2X9QA 1J9EA 1N36B 5D87A 2DLDA 4GLBA 6CHYA 2A1UB 1K63A 4P8RA 1DSSG 5JBIA 4LOJA 4OBWA 3ED5A 3ORRA 1J7KA 5IFLA 4QUEA 5K4HA 3UYKA 2FSFA 2OGZA 2TS1A 1LVUA 1LXCA 2AW3A 3P2KA 1C3VA 1K5PA 3ZU3A 4AZTA 1B42A 1E4OA 2C5SA 1QONA 5FHQA 4BTEA 4YIKA 1LEHA 3N28A 3I8SA 4TS1A 3V4OA 1AJEA 1K6JA 1TUIA 2BH9A 2FH5B 1IYZA 3MRSA 2IIPA 4C6TB 2ZFUA 1NLYA 2F3SA 4CM1A 2Q1UA 1YJCA 3FH0A 2XGJA 2CJXA 2AOUA 3INNA 4PC6A 3A4TA 3C74A 3V1NA 3KS9A 1GZUA 1R15A 1YRWA 4LJ9A 2WKPA 1T5IA 2IX9A 4DILA 3OPVA 4UCXA 3IMCA 1U5BB 2OZVA 1P31A 3QVJA 3RABA 5CBPA 1Z2DA 2BYTA 2WB2A 3W5AA 4XM0A 1NQVA 1X7XB 2GDZA 4I0WB 3WAKA 1KQOA 1KZ4A 1OFUX 1I1OA 4G9EA 3T5GA 3D8RA 2AFHA 2SBTA 1DHTA 1JS1X 3TUJC 4IGEA 1OILA 1PWHA 1J0CA 1YTLA 3M4YA 3AW8A 5AI6A 3T3GA 2O8DB 4MAFA 2BAGA 4IEEA 3UAZA 1Z08A 3GUYA 3R6WA 4H1HA 3EXG1 2I6XA 3Q7RA 1G7RA 2HJRA 2OESA 1I7LA 2OSVA 2PH1A 4G0QA 4ARAA 5HILA 3H97A 4EW2A 5K6TA 4TV9B 1MXHA 1XA3A 1G4UR 1P1HA 3MWGA 4AKIA 4R5MA 2PSDA 4ALNA 4H08A 3IEPA 4V0RA 4BB6A 2WJIA 4ZVRA 2WPDD 4AROA 3KR2A 4DMMA 1H9CA 4AICA 4MIKA 1XEFA 2QP3A 4GOKA 4J0FA 4FC6A 4HH4A 4BVAA 4CKEB 3ADPA 4BP3A 2GCOB 1HDXA 1BXZA 3RRYA 3PDUA 1AUQA 5K0BA 2X9GA 3H5NA 5SV2A 2JVIA 2ZRIA 2WD7B 4BMDA 4DUGD 1CC1S 4AJPA 3G13A 2D1YA 2HXGA 1ULHA 3M2PA 3LUCA 3EXHB 1KI6A 3C39A 1XV5A 4RMGA 1VKNA 4UUMA 4RD2A 2F9MA 3AFNA 1YHNA 3AP1A 3GDHA 5H9WA 1G20A 4XWYA 5DISB 1ZR4A 5EY5B 3PC7A 1W7AA 3SEFA 1G8AA 2R9VA 3EA4A 2CXTA 3V8MA 2NSLA 1JIXA 1WULS 2QAGC 4ER7A 4UPEA 4OI0A 1VI5A 1T3HA 4KWCA 1U8FO 1T26A 2P1DA 3NFYA 4PHTA 3GLGB 1B14A 2ORVA 3D0KA 2X0KA 2W6MA 4NABA 4WFJA 1BSVA 4ZOEA 3QG5A 3RBXA 1X1TA 1NF9A 3Q6IA 5HJEA 3CA8A 3RC1A 1K0UA 2ZIZA 2ZIGA 3DEFA 2H2HA 3OFVA 4EGSA 4JVOA 3I3SR 3IAS6 3D2LA 1V3TA 2W9XA 3MSCA 4PYMA 1P3DA 4IH9A 3SNHA 3U4QB 3IOBA 4RBNA 1LX7A 4NFSA 3VR6A 2V58A 2IOFK 1KH1A 1QANA 2HEGA 2R1TB 3NONA 1JYEA 5LMZA 4OQDA 3GK3A 2HL6A 4JMPA 1FSZA 3GAAA 2ZM6B 3COYA 4ACBA 1XT6A 3OFSA 4XDYA 4DL9A 4ZJYA 5C7OO 2OZKA 2CVHA 4HMQA 3VYWA 4DA7A 3GHYA 3ELYA 2WG1A 3SFTA 1KL7A 1JG2A 1Z06A 4O0LA 3H1GA 1EXMA 5J2TB 3P4YA 1N2CA 3G6KA 2F8LA 2GPNA 1C2TA 3NBXX 4A8HA 5ENDA 3KQVA 3MQFA 3UJPA 4M37A 2JIPA 2V0CA 4EPTA 1U9ZA 2R87A 5KCZA 4OKIA 2W8ZA 3Q41A 4B4OA 4XYMA 4EUEA 4JITA 4XTCS 1D5WA 1E99A 1TYCA 3MS2A 2BEWB 4R0NA 4ARIA 3C14C 2KS6A 1C4WA 1VP9A 2IW1A 2LCFA 4LZAA 4LYFA 5CA1B 5K8CA 4GKJB 1V96A 3QQ5A 1VTKA 3S68A 4JC8A 4P4TA 1I2AA 3SDBA 1HRDA 5I7SA 3EWAA 3WL8A 2O5CA 4RVOA 5KJEA 1VKZA 4MDYA 1F48A 4MR9B 1Z33A 4L4UA 1ZIPA 1TC1A 5F5XA 2NYUA 3QVLA 5BW6B 3NPMA 1A96A 2MINB 1W9MA 1T2FA 3FB4A 3IKLA 2ZANA 4DLUA 5TVGA 5LD2C 1SHLA 4CQNA 5EFZA 3RO7A 1TW2A 5JNRA 2QDXA 1RRFA 2DTDA 3HABA 3WIBA 4E12A 5L3SB 3FWZA 1Z4NA 1CFZA 2YYYA 1DKOA 3GV0A 2QX4A 5D00A 4B31A 2BF4A 4IRUB 1RJ9A 1BH2A 3ETEA 4BTVA 2OXEA 3HY4A 3JYHA 3FYUC 4AZVA 2Z2KA 1ZJ4A 3WTCA 3O8QA 1XTBA 3SC2A 3KT0A 4KN8A 4POOA 1UT8A 1NP6A 3F6PA 1FQKA 1THMA 3KLNA 1I5RA 4LSWA 5HZKA 3H19A 2HSZA 2XVXA 3KO8A 4M53A 2JZOA 3H11A 4Z9FA 5HJ7A 4CKBA 4OHKA 3MJVA 1FYDA 3DJFA 5T3UA 1YBHA 1T9GR 3D8TA 1Z2AA 3AERB 1Y9JA 2Q9CA 3DUFB 3OZWA 4GPZA 4MJLA 3TEJA 3KR9A 2OHXA 1JJIA 2R2GA 1EM8A 2VPPA 2A0YA 3P9RA 1CTQA 4KVZA 4L8FA 4CLEA 2APJA 4FD2A 3ND8A 1FDSA 3RFXA 3G0BA 4OAOA 4A10A 4GKVA 1YQDA 3ON5A 2FN4A 3JVEA 4RM3A 1FX0B 3RBZA 3KB6A 2QRUA 5K1ZA 1NPDA 2V9ZA 2VJMB 3T3EA 1YRAA 2JKYA 2PRIA 3JVIA 4GX0A 4BKOA 2VJKA 1Z5NA 1OVGA 1JA0A 1KI2A 1VQ1A 2QZSA 4KEAA 5DFAA 3CLTC 2WDPA 2QSZA 4RTRA 1GPJA 4WJZA 4OBXA 1PT5A 2NUBA 2OZLB 1RFGE 3SG0A 4JXKA 1PV4A 1SC1A 3NALA 4YAGA 3WGYA 3S29A 2B37A 4XQ9A 3K20A 4OSOA 4QBIA 2JZCA 3HU3A 3ZWCA 4FSXA 1IQ0A 1XPUA 1X7WB 3IOMA 5J2UB 1I1HA 5FI5A 1ZYUA 1TC2A 1J1UA 3TW8A 3VPCA 2BR3A 3WLPA 3D6UA 5EMKA 3ZTYA 1G16A 3K94A 3DF9A 4TTVA 2JF0A 3GYBA 3IEUA 4WI1A 3SFZA 4X8OA 2YXPX 3NXSA 4G09A 3H7AA 3HO8A 3L7YA 3VC1A 5I8WA 1W0KD 3HY6A 5ICEA 1SQ0A 1XVTA 1U0EA 3W7BA 3U19A 4DA0A 3TTVA 2WTEA 3ENNA 1E9CA 2POCA 3ORQA 2LP4Y 2QF7A 4LTMA 5B64A 2X2FA 3V4LA 5LXTA 3VU8A 2O8FB 5AOVA 2VO1A 3LCCA 2JFNA 3EXEB 3OZEA 1TT7A 1KY4A 2FWAA 1JG1A 1E7WA 1NLFA 2OCYC 3IP5A 4ZJPA 1ZNXA 3VR6H 3IVAA 4YJ2A 4BLPA 3ZCPA 3JQAA 1I14A 2WF9A 4YMWA 4LDZA 5F2OA 3VAYA 3RVRA 3IPYA 5K0LA 4IHQA 5CA1F 3OLZA 3J81k 3OMWA 5K3BA 3TNJA 4LJ5A 1ODKA 3WHPA 1P7YA 4Q00A 2O8EA 2D4AA 4GP9A 5GTDA 3D0QA 3LCJA 1AT1A 4XW2A 3UXHA 3PHJA 1P2GA 3JQ6A 1WUYA 3I0ZA 5ESRA 1LJLA 4M7OA 4QBHA 3ROMA 3CNBA 1RBMA 1R9JA 3D4NA 4JXXA 1XTKA 1JVBA 5EMMA 4A8JA 4PXYA 5ECDA 5KYVA 4DLYA 2D6FA 4GE3A 1QIMA 3QLUA 4KBFA 5BQ5A 3LYAA 2DOKA 4UMFA 2GN4A 2GN8A 3O2QB 4I99A 4M9RA 2QPTA 3TQOA 3FGPA 3OEHD 4KUHA 2ZJZA 3QW2A 4G97A 4TLMB 1HDRA 4Y1RB 4GOLD 1F2VA 3N8HA 4WK2B 1GSHA 3G8CA 4LRWA 2IEYA 4BUCA 1A5SB 1SQSA 1V1RB 2H7XA 3D2BA 4A8JC 5AWFC 2JIZA 4C0KA 1PGPA 3O93A 5JNSA 4ZARA 1J00A 3Q7TA 4NS4A 3C7AA 3MCTA 3VNUA 3WOVA 3MHTA 1A9ZA 2W6OA 3FCAA 2Z2XA 4FYYA 4WXPA 4Y2UA 5BW4A 2P7IA 1R3UA 4JQZA 3E9ZA 1PZGA 1W85B 4YNBA 3SZUA 1SRRA 1VLJA 2I2FA 2VK4A 5JEEA 3ZCUA 2IOFA 3HYCA 1N1EA 4U2BA 5BYBA 1YS9A 1QWOA 3KHUA 3QNUA 4EKDA 4FFRA 3IE0A 1QV9A 2OBXA 3LUDA 3UMYA 4JJGA 5EESA 4YRBA 5KYWA 1S2DA 2PX2A 4DCOA 4GXNA 4EB8A 4BGVA 3UKDA 1A4XA 1GG2A 3VOAA 2JH9A 2ZYRA 1FCJA 4GF5A 1NRJB 3AHEA 4CDMA 2QRNA 1ZJJA 3BJRA 2KBFA 1EK6A 4P0PB 3NDIA 2XGSA 1DCTA 5BSRA 2I1QA 2Z8YM 4HN4B 4ZDIA 3DHVA 5CW1A 4NJMA 3SXPA 2QJOA 2C8LA 4J94A 4OXYA 2DT8A 5DW3A 3ZU4A 3I9JA 3FCCA 1MH1A 1BHJA 3U44B 1V7CA 2P2YA 5BUZA 3IMFA 1NJGA 1UEJA 2VNHA 3I73A 3K1JA 5F5NA 1PEDA 3CXRA 3DULA 1A9SA 1AZWA 5FOQA 1OSNA 4KLAA 1A72A 2B3DA 3K96A 2IU3A 2Y9PB 4FEAA 3IODA 4XOIA 5D01A 5JG7A 3JALB 1J8DA 3DVLA 1JVSA 2X4GA 2JLYA 2DF8A 1U9JA 2JHGA 4IEFB 1U7XA 1SOMA 3BERA 4I9UA 4JODA 2QUIA 3HKBA 3HRKA 2WT4A 5EZ6B 2I6TA 4FFSA 1WP4A 5THXA 4BJHB 3VYVA 3CR7A 1OC2A 3WB2A 5IVKA 5BSMA 4YRSA 4EB6B 2PT5A 2OFWA 1O0BA 4NZZA 2XTNA 2FFRA 3THXA 3W9BA 1SG0A 2GHRA 4KHPB 1XMJA 3BL5A 4GYKA 3Q7QA 1G59A 1Z7EA 1U3TA 3M49A 1J90A 1CK4A 1HDIA 1R37A 1P9NA 3AU8A 3DDHA 1YVRA 3DPSA 3E1KA 4MWSA 2EFYA 5KWIA 2RK4A 4JAVC 1DUSA 3KZVA 4ZZ0A 4LXQA 2C7RA 1XDSA 2AQ8A 3ZZMA 3ASVA 5EAIA 1EWRA 3U62A 5KMGA 2HX1A 1LU9A 2GK7A 3PKJA 1ATZA 1PFKA 1VOTA 2HIAA 5K4GA 1JKJB 3UAXA 1A7UA 5TMPA 4OM8A 4MQMA 3NHLA 3LKZA 3OT1A 1KU6A 2HPAA 4N5NA 4OQPA 4GI1A 3U48A 2RBGA 1JHZA 1PW7A 1Z8HA 4F97A 3HVHA 3ETNA 3FKQA 4O4JB 2D2IA 2NZUG 2PD3A 2WPDA 5DNEA 1KY2A 4Q7QA 2CW5A 4BJ6A 2UVPB 2PSFA 4YYZA 3BHIA 4DDKA 4YVFA 4JP1A 1NVKA 1AKWA 3ZWDA 4RIGA 4K9RA 3GJXC 4YCDA 3KETA 4UFOA 5JSQA 1UJCA 2JGDA 4EGCB 4AT1A 2C9MA 4Y6PA 3VAAA 2UAGA 3N2NA 2FP4A 2BH2A 3HCAA 1YS6A 2H52A 3AIIA 2RHBA 4RMHA 4U3JB 4BVJA 4QLBA 2GK4A 4ZALA 2PT6A 3TH5A 3OIUA 1MNAA 1SEPA 2Z4RA 1WTAA 1Y5RA 5CT8A 4EHNA 1M2JA 1Y1RA 5K4AA 1INLA 4QHYA 4BZWA 5E1BA 2GAJA 3EHEA 4R1UA 3E6AA 3PT9A 5JS2A 2PKQO 3BRQA 4MKXA 3ZZNA 2D62A 3A6DA 3QFCA 4HAWA 4N0QA 5C4IA 4ZVVA 2ETVA 4C0XA 4BP8A 2QZPA 3AMVA 1T8WA 1YVEI 2R8ZA 2O07A 3GH1A 4PS0A 3UJAA 3BIOA 3EC2A 1KRXA 1FPMA 5JR3A 1TOAA 2IEZA 2V7QD 1X7GA 1KJJA 1L4KA 2VHTA 1XL0A 4ZICA 5BSGA 4HAYA 2RI1A 4HB3A 4WA7A 2BTOA 4RETA 2PSJA 4Z51A 9ATCA 3TRFA 5EMJA 3EXIB 2DFKB 4CDGA 1U11A 1Y7LA 2P2LA 2XMSA 4HNGA 5IWCA 1ODIA 4PG7A 2QKYA 1GEEA 1QMPA 1RZ3A 4IJVA 5ITZB 1MHTA 3CE9A 1OVMA 2V7XA 2R5WA 3D6HA 4B3XA 4F6CA 1K89A 1TDJA 3FNEA 1N2SA 3UXEA 1ZJZA 2ZT5A 2IYPA 3QKSB 3STHA 4W9MC 2RIRA 1OX6A 4XZ3A 4V3BA 3P9CA 3U81A 2BSXA 2BT4A 5EJ4A 1MORA 4ZU3A 3D1JA 3RAFC 2NN3C 2D4HA 5H3LA 1J0AA 1E2FA 1T8RA 1ZWKA 1DKLA 2AN3A 4BO6A 3ZC3A 4H6VA 5HZMA 1VB5A 2A5JA 1DG1G 4R8LA 3MW8A 4EFKA 2IPNA 4JB8A 4KIUA 1H05A 4S2UA 1QLWA 4EX7A 1HORA 2JFFA 4YP9A 4EA8A 1WB6A 2PUCA 1JLLB 4TXMA 2GNAA 2XWSA 3AJ9A 2X2OA 4G65A 1CJSA 2F7SA 1FX1A 3I9LA 4B82A 4ACAA 1ZN9A 5LUBA 1QGED 5JPIA 2JFXA 2IY7A 1YZQA 1KYXA 3AHJA 4DBVO 1VIDA 3HUTA 1FP6A 3B2NA 4Q47A 5FRDA 3RODA 1UPCA 2C4HA 1TVKB 1YE8A 2CUNA 1C3EA 2LDXA 4DMGA 3WP1B 1IPEA 1ECLA 3IDFA 3FAKA 1XEXA 3O8OA 4PINA 4TS3A 3L49A 2VEOA 1JSLA 1NI5A 4UEJA 4BE7B 4DV5B 4B45A 3T1VA 3KDAA 5TQ2A 3N8IA 3PSAA 3K0SA 4ARZA 1X7HA 4TVSA 2NTJA 4KP7A 4OEHA 4FOLA 4KVAA 1NN3A 2QUAA 3EEQA 3WBKA 3ZKWA 5EJ7A 1YVDA 2GJ4A 4BP9A 3A9UA 3DZJA 1YNSA 3OFND 1QHSA 1YB4A 4MULA 2ZJ8A 3DONA 1Q20A 1NPTO 4B84A 3FWNA 3T15A 3ICEA 4NHOA 4M1WA 3PDIA 4TTQA 2AV6A 2XNJA 2ZR7A 4K9NA 5BSUA 3Q4GA 3EH1A 5DO9A 2GYYA 1U1CA 2O2EA 4ZAWA 2A92A 1F12A 1KJ8A 4V3CA 4DLVA 1QIFA 2HR1A 4RLFA 2AQKA 5AI8A 2XMZA 3ER6A 1GGHA 4YHBA 3L7AA 2FUEA 4AY5A 1T5TA 2XJ4A 1XNGA 4BASA 2GPJA 2Q3FA 3ER8A 4NG5A 2BP7B 4GLOA 4Q05A 4G0OA 4MWDA 3N8KA 4C05A 2CJWA 1ZVJA 1KGSA 5IMSA 4WN3A 3TLEA 3ONVA 2B36A 2E82A 3MCVA 2VNIA 4CETA 3G0GA 4GPTA 4IKPA 4YRZA 2MCFA 1TZBA 4YQFA 1WAMA 4PIPA 3R76A 3A2MA 4CIYA 1IDOA 3QITA 4CG0A 5KWSA 1TX4B 4S05A 3L5KA 3P26A 4ZQIA 1E62A 4Q4AB 4DXAA 4WKBA 4Z1MD 5H59A 1ZRNA 2V54A 3DR5A 4H4EA 4URFA 4RNDB 1C4KA 2GQ0A 3F4BA 4M9XA 1Z4IA 2I9KA 1O4VA 3CNQS 3ZYZA 4CCWA 1B0UA 3WGHA 1YZ3A 2C0QA 4B6PA 4LJRA 3L7IA 4MHTA 4PWYA 3EPLA 2YW9A 4UQLA 2J33A 1ZJ5A 2ZVPX 3F6RA 2DSNA 1F8UA 2LIVA 5ALUA 3ZHSA 4BMYA 2PZFA 1SH7A 5H9VA 3BZWA 4YRFA 4MNTA 2DQKA 2JJ1D 3OCUA 3VPSA 5JAMA 1AH2A 4J9VA 5K3CA 1U0LA 1NRXA 2UZ0A 1Q1ZA 1PEYA 3G9UA 3PE3A 4FYPA 2WA2A 1QB8A 2QUZA 1P0FA 2ZXUA 4LV6A 3DL4A 3ANMA 2O5VA 1QYXA 3JYQA 3LDHA 1X13A 4ZK2A 2WAXA 2VDUE 4D8WA 1SCDA 3HCOA 2J32A 3NANA 2GF2A 3RCBA 5JYEA 2GSDA 1JHAA 1TM4E 4RA6A 2C5HA 1N2IA 3N6XA 3KSAC 3GVIA 3RRZA 1REQB 1Q7RA 2OXCA 3IUQA 3RYIA 2OYRA 1S2NA 4YUWA 4V38A 3RVBA 1J5PA 2OXTA 1JDVA 2KLHA 1GN9A 4HTFB 3ZV5A 1WBDA 2WJWA 3NZEA 2OAEA 3MERA 1A5BB 4B0OA 5HNKA 3T7CA 3ER9A 4NMXB 4RIFA 3QE4A 1RJDA 1NDHA 3B9QA 3KFXA 4E21A 4JI1B 1DAEA 1PJ2A 1V43A 5F4ZA 3KAJA 4KAJA 1QFZA 2QLBA 4YC7A 3Q88A 5C8ZA 1WTCA 1OZFA 1KI3A 1ZI8A 1NBAA 1KAGA 4Y67A 2H54A 1KJZA 1P1IA 3CKLA 1W36D 4C0WA 1FA9A 1Z4PX 2YXDA 3ZBUA 4W9NA 4Z9XA 1K8RA 1O96B 2H1FA 3HKCB 2ZE5A 2F3UA 4Z2YA 4HDKA 4C43A 3VKUA 4AJEA 4OX9B 4I5GA 1RHJA 4UAJA 3GQBB 4AL4A 4GOOD 5EZQA 2LBPA 1DIBA 3V1YA 2FA9A 2V6IA 3G02A 4EG7A 4XDZA 3ZVNA 4RV5A 4YGYA 4MEAA 121PA 1Z5UA 4CM5A 1M6YA 2YJTD 4I4TA 4JSYA 1YWGO 3VC7A 5JHHB 2PWAA 4FZVA 4H6PA 5TNXA 5MN4A 4ZT6A 1QYIA 3I37X 3OEHA 4IEIA 3RR2A 3AVUA 1FMCA 3VTFA 1LNZA 5KDDA 4M54A 4FLEA 5A3VA 1GPYA 2VT7A 4LVOA 1XXLA 5A5GA 4Z4GA 3CH5A 2WAOA 2JAWA 2PPVA 4P3YA 4I3GA 4DMCA 1P44A 3R0QA 1WMAA 4B73A 3MJTA 5DTQA 4IDPA 1DDIA 2F1OA 2NV6A 1Y9AA 2R7NA 4ZODA 5K3FB 2WVGA 1YK0A 3AFGA 3QMVA 3LMKA 4MS1B 3RS9A 3SR0A 1KZYC 1LDNA 3JATA 4INJA 2HSWA 4OF4A 4K6OA 4JWKA 2CYBA 5BVHB 2ZAIA 4P98A 5KWVA 2YJ4A 1NVBA 3CEJA 2G08A 3TG2A 1M73E 3O4IA 2FPMA 4I6EA 2QS9A 3T1YB 3C4QA 1AG9A 3OCJA 1Z22A 4ALLA 5KNDA 3A1UA 2PMWB 5ER9A 1R1DA 5B3KA 1BOFA 1TVMA 1UBSB 3OBIA 2CN1A 1GGJA 1Q6ZA 3BGWA 3K8QA 3PQ6A 4KXFB 1TAUA 1ZGJA 4HF7A 3I9FA 2F9FA 5JYCA 5KNBD 1RIIA 1WXFA 4UEOA 1IN6A 2X8BA 2X8JB 1UBKS 2B5OA 1WABA 2WM3A 1US8A 2WUVA 3AWIA 3ONDA 4I7EA 3JX9A 3NATA 4FHEA 4U2GA 1NC1A 1VMIA 2YJZA 1WSAA 4JGIA 5EE5B 1IEVA 4KLNA 2R85A 4GPAA 5FTNA 2WV7A 3L8CA 4NMLA 4PSKA 3FYHA 1N7IA 4B7CA 4WE3A 3DDWA 5NULA 2QD4A 2NQ8A 2Z98A 3AILA 1M0EA 1UK7A 2VJQA 4RH3A 2VRWA 4FN5A 3O1IC 3DCIA 1QO0D 4KI7A 5DHRA 3WGKA 5B57C 1Q95A 3NO4A 1PZFA 4BVEA 1K5HA 3O3NB 3HNOA 4JU9A 4D9CA 4LRYA 4DA8A 4BUJA 2G3YA 2OOSA 1LLCA 4HRYA 5C3UA 5M29A 3I0MA 3ONNA 4C4SA 4HYEA 4REOA 3FVRA 2BFNA 2EFDB 3CF2A 4ALMA 1GR0A 1EG7A 4Y6SA 1RMYA 3KLPX 3LT5A 4DJFC 4QXMA 4IINA 4N9WA 4RHTA 3I61A 2O2GA 3EXFA 4TTAA 1EDZA 3BD7A 1LV8A 3NTXA 4OJMX 5GONB 3K2IA 3RTDA 3TBFA 3ZV6A 2QT9A 2Z8ZA 4DLWA 1U2GA 1PKEA 4ND3A 1GQYA 4O4IA 5SYMA 3W3AD 3H86A 1QK5A 2PZBA 2PKXA 2UUAB 1TD1A 4D0GA 4YQZA 1SVKA 1E7RA 4URVR 4DIUA 5FBHA 4IHJA 3MS4A 4GH5A 3IT0A 2IODA 1RACA 3P2IA 5AK6A 4C14A 3VQTA 1LSJA 1CFJA 4CQMD 2I3DA 3MILA 4KUGA 1DRUA 3RYHA 3PXXA 2JLUA 4EH1A 4WINA 5DXJA 3S99A 4KO1S 1IXKA 1C9NA 2PU7A 3AEQB 3GRVA 1PJ3A 4CIBA 1U2GC 4FFLA 1YUBA 2PL1A 4FC7A 4EUNA 5AVRA 1P9LA 2DKNA 2W37A 3UW3A 2RE8A 4N03A 1M7BA 4EHJA 3AUSA 3HHPA 1YUNA 3NC0C 3USZA 4LHVA 1M5UA 2ZRCA 4MUYA 3WADA 3A4YA 3HR8A 1HMPA 4BFXA 4IDAA 2ZEJA 1GZ3A 1ZK2A 1KMHA 2YWEA 4MPPA 4DY6A 4RS4A 1ZD4A 4Q3BA 1JQ5A 3P45A 2UUBB 1ZCFA 3EFOB 5IDYA 2CLEB 4ND6A 1TK3A 1Y6JA 3AUXA 3HCFA 4UCFA 1OR8A 3QBDA 3EGOA 3H8JA 1H94A 1RWOA 3Q3JB 4FWBA 4EEKA 5G3ZA 5BY2A 1E2PA 1TM7E 1ADCA 2HCBA 2YHUA 3UICA 4NXNB 3U3XA 3VBCA 2HDNB 3W3ZB 1ZGZA 4B5LA 3DH0A 2AMVA 3IQZA 3TEFA 2YRXA 2WUFA 4ND2A 1H9AA 4HSGA 2DPLA 2QYTA 4RLQA 4XTRA 4HAVA 1U9IC 3EEIA 3R6DA 3MUEA 4YIHA 1ISPA 3R7SA 4GQIA 2D7CA 3QFSA 4UUNA 4DUYB 2B7CA 4P4SA 3EUWA 2C3UA 3ORYA 4FOPA 3MD9A 2D5LA 1I4DD 2H5LA 2IBMA 1Y9ZA 3IRVA 1WF3A 3PP8A 1YDWA 3ZE1B 2NTNA 4OH7A 1DO0A 3DD5A 4YASA 3TM5A 2WF6A 2CK3D 4LVCA 3RTEA 1TAGA 3SHVA 4BJ5A 4OSPA 2QVLA 3RDPA 4P4GA 2H1OA 2IY9A 2ZAYA 2I65A 3FBWA 5K6RA 4LY6A 4LYEA 4J0EA 2JJQA 4XSGA 5CX1B 3OPYI 1B0AA 2YV1A 1TVCA 3X1YA 1GPAA 1EZ4A 3H2BA 1F6BA 2AOWA 3VTAA 1SQ5A 4MJ3A 2ZIXB 1WEHA 2IS2A 3RD5A 1E5VA 5AKZA 3IPRA 2GLTA 1KVQA 4OLHA 2PNFA 3NASA 2CZGA 1JFRA 2ZJ4A 1YDFA 2UYYA 5D85A 5JAPA 1P91A 5KNDH 3CONA 2GD1O 3IP8A 4HR7A 5CNIA 4Q9JA 5KYUA 3G2NA 3TSZA 1ILEA 1G1MA 5K2MA 3PITA 4IOMA 2QM0A 1DHRA 3LYUA 1XLTA 5I51A 2JLWA 2EKPA 1RQ7A 1X74A 3JZFA 4HGYA 1KP3A 1ZRHA 2B7BA 3DZ8A 4D7AA 4ECAA 5L4SA 2OMKA 3L77A 1CEXA 1XXHE 1SBTA 2O7RA 1R0RE 3KVOA 1BFKA 3PV0A 2XWPA 4UJ5A 5L3VA 4Z3OA 1IDN1 3C97A 4DCCA 3R09A 4C6HA 4FR5A 2PL5A 2YMMA 2JAUA 2HPVA 4RIEA 4BKUA 4BNDA 1KYZA 3WK6A 4XIIA 3WRXA 4NONA 2P9EA 1ZIDA 3NT2A 3W04A 3NBMA 5H0IA 3PQ8A 2FUCA 3EJWA 1GARA 2NTYC 3QMWA 4IJ6A 1VPWA 3LC7O 2K6GA 4M8IA 4N7BA 4C78A 1L5SA 3NEPX 3PJGA 4G36A 3RB8A 5HE8A 2POQX 3T95A 2A35A 4AQ7A 2QQ5A 4CLOB 1A9QA 2ILTA 4PGFA 2PZKA 4D9GA 1KAMA 3TTWA 5BXQC 3CSSA 1P61B 2JFOA 2O7SA 3QVUA 1E2UA 4LVUA 5H81A 1V3VA 5JO0A 1C1HA 1V7QA 2HSJA 3D9QX 2CL0X 4K46A 5JSYA 2CXPA 3OFNA 4Z3KA 3HVJA 3CNHA 1Q3TA 2OD9A 2VUSA 5EUCA 1T1SA 1Z82A 2EG9A 5DGTA 2DR2A 2D2XA 2Q46A 5C1IA 3OPXA 4G4GA 1SQFA 1CY8A 4B35A 4H4DA 1DDOA 4RKEA 4B71A 4KIJA 2X1LA 4YR9A 4KQIA 4Z9BA 3GJSA 1VIYA 3R3WA 4ZVLA 3KQQA 3WNZA 3ABOB 5THKA 5K0CA 4QDJA 1M1NA 5DTRA 5DZSA 4CL0A 1NTOA 1RYFA 4BC1A 4XPIA 1GZDA 2FEXA 1XZLA 2GHQA 2DFTA 4EKIA 5KVCA 1BS9A 2VAVA 3SHOA 1BE0A 1DC4A 1BGVA 2JARA 3O2SB 4ZDKA 2DETA 4B33A 1R5OA 4INOA 4MJ7A 4Q82A 4PSDA 2M32A 4H0CA 4AO8A 4XRGA 4OSEA 2RHHA 3A1TA 3C6ZA 5TGDA 1NE7A 2YASA 4JELA 5K3OA 2AKAB 1UOOA 2OKCA 5FBLB 4TL6A 1FP7A 1S3SA 3IESA 4RGYA 2F48A 2YX1A 2MMGA 2Y1KA 3C5CA 4M22A 1YFJA 3HSYA 3I45A 4JLAA 5GWXA 2PEZA 2G7ZA 3JXEA 3PZBA 1YACA 1CB0A 2G6BA 3MOGA 1APBA 2B21A 4JP2A 1NNSA 1BFUA 2HGSA 2JJ1A 4XGRA 3T3PB 1VYVA 1U7TA 3A4LA 1MKYA 2DUWA 2YDYA 2WUGA 4JT4A 4L0DA 1SVIA 3CLUD 5DK6A 5HG0A 3VR2A 8MHTA 1SC9A 2ZCJA 4TV8B 2IH2A 2GPWA 4MQ5A 4AN1A 2ISCA 1G8SA 2ZREA 4CR6A 2Q7DA 2OBLA 1EZZA 4JJ4A 2PT7A 4NI5A 4UCWA 4Z7OB 1M0WA 3WXBA 6Q21A 4V1CA 5J63A 2B61A 2CDRA 4D6PA 2Z3VA 1L7BA 5SICE 5CYOA 2PZ8A 5LLSA 5ADWA 4LXTA 3QEAZ 3GD7A 3IQGX 4PFJA 1QGYA 5LMCA 1O9BA 4FX5A 4V02A 4JI6B 4ZIRB 1KEWA 4WTOA 1P77A 2NU9B 1NNEA 4X1YA 3N0TA 5E9WA 1U0SY 4WLVA 4EYOA 1XDDA 3QOYA 3RRJA 1I8TA 4MRRA 2EZ8A 7MDHA 3OIWA 2FMHA 1EFTA 2GM5A 4C0BA 2ZJ2A 1UL1X 4QFMA 4UEKA 5J23A 1USVA 4PN7A 1P0PA 1BYUA 1U8ZA 2AOTA 1JHYA 2FW9A 3QENA 1L5HB 4J3FA 5HKLA 4ZEXA 5JW6A 2G5CA 4Y98A 4ESVA 3BMCB 1WIWA 3FMOB 5FR2A 2C99A 4P84A 5IRCD 4KSYA 4IUCS 4IV8A 9LDBA 2P0EA 2GSWA 3ML1A 3DOFA 3TEMA 2OCDA 5JCPA 2MSCB 4MUFA 5B7QA 5HSGA 2X3UA 3ZU5A 5AW3A 5D6OA 3I2IA 1IHXA 3W5SA 2Y0EA 2AG1A 3NKVA 1RABA 4Q1BA 3ZHBA 3SWWA 2IEGA 4GBED 3T5CA 4E4TA 1H1LA 4HX9A 1ZMRA 5GPBA 8OHMA 4C4ZA 4JK3A 5D86A 1UPXA 1SUFA 5AW0A 5TB5A 3N2IA 3GAMA 2X5NA 1XSEA 4RPKA 1WMSA 5DHPA 2EBHX 1MU0A 4WIAA 1OD6A 2UU9B 3LRPA 1O5OA 4RK6A 2R79A 1DO2A 5CB0A 3ZWYA 1JWLA 1FJHA 4LOHA 4CMBA 1M34A 3WYEA 4WDQA 3CF4G 3UQYS 4HVCA 3QMMA 4E5NA 3T3DA 1EWVA 1DC5A 3QLEA 4DM3A 1O89A 3UB4A 2JLZA 1E4EA 3WQHA 3AVVA 2JCBA 1TIBA 4WCVA 4RTPA 3KEQA 1B8PA 3IYLW 1Z6PA 3GLTA 4MUIA 2IQIA 2HJHA 3CSUA 1Z7GA 2I6UA 4IWNA 2WWXA 4S1OA 5D7BA 3AQIA 3EZXA 2I5PO 3H9BA 4MUKA 3HB0A 3TB6A 3FX2A 1BOOA 1KXJA 1V5WA 2IF0A 1T8UA 3K5HA 3R0IA 3AESB 1J42A 3H8VA 3B7WA 3GA0A 5TPWB 1ZX1A 2JS7A 3A6KA 4Q9HA 2XUPA 3FVVA 1IZ7A 4YACA 3LP5A 2OY0A 2HPZA 3KALA 3L8ZA 1R4NA 2V6BA 4G81A 3R0XA 4GYYA 4WVFA 5DYYA 3H4VA 4M60A 1Z37A 3SQWA 3NHSA 3RIEA 1KQFA 2X13A 3KKPA 5EL0A 4G8BA 3FTPA 3GIWA 4XARA 2A88A 1FUKA 2EU8A 2EW8A 3CH4B 3F8WA 1DQRA 3IILA 4JCCA 5DKFA 5ESWA 3MUNA 4OLAA 1Q7GA 2JATA 2NVBA 4EAQA 5T4BA 2M2IA 3IA7A 4ZU1X 5KNBA 2VTBB 4FWIB 4KN6A 2COUA 3P0RA 3AB8A 5DBHX 3KT8A 5FBWB 2OO5C 4W7IA 5BWNA 1RWQA 1VJ5A 2TMKA 5HZGA 1DL5A 1N6HA 3K1ZA 3WLAA 1CUEA 3BKXA 4JOSA 4U7GA 2WQZA 3HXMA 4PHCA 1VLHA 4UC0A 4GOXA 3FOZA 4X61A 1WZCA 1YS7A 3P9IA 4D0RA 3MWDA 2EOAA 2IP4A 2XCIA 3LXXA 1Z6XA 3QU7A 4U02A 5AXDA 4B9EA 4DRZA 1K7XB 4COOA 3G8BA 4HWKA 4MAMA 5K20A 1RP7A 1QO0A 1NQXA 1GG5A 2OPBA 3U7QA 1KNXA 1SUPA 3GJZA 3KLMX 3RKSA 4AJHA 3OD5A 4YI5A 5G4KA 4C3UA 3D8SA 3SGLA 1X2BA 2ZBVA 2QTLA 1LQ2A 2O8CB 3T9EA 1DI0A 4FONA 5E95A 2QZ9A 3EC1A 5K3SA 2IHJA 4B83A 4V24A 4JZKA 2G9RA 1O4WA 3GHHA 3A3PA 4FLMA 3KUCA 2BFCB 1KEEA 4Q3OA 2YL2A 3T4PA 1V71A 3P0IA 4I4NA 4L3OA 3VPXA 5EJ8A 4AKHA 1SY7A 3LQ2A 1PIWA 5BURA 2QRGA 2FEOA 1A04A 1KP2A 1CEEA 1YCDA 3ZGOA 4P4NA 2QNBA 2OUIA 4NSNA 1Z0UA 3EY9A 1GUBA 1S96A 1OREA 3BD9A 3BULA 1OY1A 1NJ8A 1QK4A 4IS2A 2IXFA 3N5CA 2WINI 4X97A 2DYKA 3WLIA 1HEYA 3AJAA 4K28A 2FX3A 5KQRA 3DNFA 4JI2B 5ERYA 1E3IA 4JZYA 4IXTA 4WY8A 1GTRA 2ZRJA 4TRRA 1HDEA 1ZPDA 2CHGA 4B3BA 4ZCMA 1GJRA 5CBKA 5CFNA 1QB7A 3C3YA 2QMEA 4G1UC 2JI4A 2RBKA 2MSWA 2C9ZA 4JA2A 1GAJA 2OXFA 4DV3B 3AG6A 2LPMA 3MINB 1UEIA 4MP8A 5DYWA 2HQBA 2RHGB 2XUZA 3DKRA 3RS7A 1X86B 2H3HA 3C6XA 1WB4A 1BCSB 4OHPA 3K0CA 3MQ4A 3UIEA 5FJIA 3FKSD 1XJ5A 5DCUA 3H2HA 1Z2EA 3H87A 1Z7WA 3OC6A 4RFSB 1U3VA 2ZYGA 3HWSA 3IPXA 4LRUA 4DDMA 4FBLA 5IAAA 1WB5A 3EX7C 3T34A 4X8HA 4M1KA 2JLXA 3OJOA 1D2MA 1ULBA 4OB6A 4LGCA 1JLMA 3L9WA 3MWEA 5T8KA 3WAJA 3FPFA 1C7RA 3IP3A 4H59A 2ID9A 2DKOA 3DDSA 2OVFA 4FZJA 3ZWVA 1P74A 4OIFA 3EGEA 3GDFA 1DBWA 1U5AA 4WKPA 4B6SA 5LQAA 4CEIB 2OWDA 2VT3A 2IHYA 4BEBA 2Z1MA 3L0BA 4UNSA 3FCOA 1AKVA 3KSBC 2FPIA 3QV2A 5EQTA 2VZLA 4I36A 1TKCA 3ZV3A 3VAZA 3RTAA 3PNBA 2PXCA 2V6FA 4DG5A 3T9CA 3C5HA 3TLXA 4X0EA 1GL6A 2DPGA 2P7HA 1H8HD 4ARCA 3VC3A 3AWDA 4LOKA 2BW0A 4WVLA 3G9ZA 1VKHA 2GPBA 1U7DA 3UAYA 4TTJA 2Q0HA 3BHMA 5JJKA 3G59A 2RGWA 3OX1A 3VM6A 4CQLA 4YCAA 2JCSA 5JWOA 3BIJA 2J4DA 4F4FA 1JFVA 4CR7A 4EBBA 1QE5A 1OXMA 4FUQA 4MGHA 4JDPA 2ZRLA 1XVLA 5F51A 4RVCA 1N7GA 3TW0A 4JT2A 3VPBA 3HVRA 2NZWA 4NNJA 4P5PA 3O8NA 3K9QO 3H04A 3QOXA 3WA6A 1ORIA 1RADA 5KNBH 1ARZA 1AF4A 3OJXA 4JFRA 4O4HB 3ESQA 4MITA 1CU1A 2BFPA 2FU5C 3EOBI 3HB7A 2GILA 4CMJA 1N2EA 2QUBA 3C1AA 1RYBA 2VWPA 3ZBPA 3IR7A 4C2BA 1KKLA 3HSSA 5IWAB 1ZUNB 5FOSA 2QSYA 4PQGA 1USKA 4TUYA 1I24A 4RE6A 5ADHA 2FRDC 5DCYA 2XUFA 1K1EA 4WBNA 5LZ5A 3U56A 2CVZA 2W22A 1FP2A 1RKVA 3EQ9A 5JHGB 4NECA 1E79D 1IONA 3BSSA 3FZEA 1P75A 1YFZA 3ZE6A 2WJHA 1C5KA 1K8ZB 3NT5A 4NFHA 1B6RA 2ZSAA 3OZGA 1XD8A 1L4LA 4C0LA 1OOEA 3TNFA 5CTJA 1X7DA 4M0PA 5FWDA 4JBNA 4AIIA 3T7DA 5CITA 5ALKA 2JBHA 4LK2A 4IMRA 2NIPA 1KS9A 2IYVA 2XITA 5IJAA 4LX0A 3THWB 4OAQA 2C78A 1HUQA 1RNLA 3LY9A 3TOVA 4AKSA 1QS0B 2OCPA 1B8UA 1P1RA 3K4PA 2O3RA 3MTEA 3DPIA 4G5GA 4N5MA 1A50B 1I0ZA 1UBUS 1NMQA 3P19A 1A82A 1X1RA 3CMCO 4N12A 1A5AB 2R6HA 4NYMR 1R6VA 4KIGA 3E8SA 1FNCA 1CEYA 2ZS9A 5ISMA 1R8XA 3EIOA 3ESBA 4ZN6A 2JGIA 4S1NA 4C4PA 1LDEA 3NWJA 2KBEA 3FPHA 3GAZA 4C88A 4E15A 2JAQA 2X0RA 1T0HB 3RVOA 1L5YA 1CVIA 5DI3A 3DBRB 5D3MA 1UUFA 2J9YB 3T7TA 4H27A 1ZMXA 2NU7A 5AOCA 3K1YA 1TM2A 2XUQA 5ALJA 4DNPA 1KEVA 1XQ1A 1PCXA 1NN5A 4IDQA 4D2IA 5K0FA 3JQFC 4P7FA 1U7HA 3ERCA 3ZVKA 3EVEA 2PUBA 2ZIWB 3G2JA 4URWR 5LP6B 4WACA 3ITEA 3M0EA 4XDGA 4MOWA 3O3OB 2JJ8A 4UZSA 3I76A 1JFFA 4HWOA 4OQXA 3E9EA 3V7FA 4EJ6A 4DEYA 3E9DA 3KSRA 4EABA 5ESXA 4COKA 5JANA 3ABRB 1Y37A 2HC9A 3KJEA 4BO3A 5KJFA 4KN9S 3SJCA 4QPDA 5DCLA 1QRTA 2PK3A 1DBVO 2C2HA 4ZRMA 1F0NA 4CM8B 3OE5A 3EG5A 4IP0A 3GZJA 2BFEA 2C7GA 4B6FA 2GXAA 2RKBA 1Z25A 5EQDA 2EC5A 1EVKA 1XEAA 3QPDA 2YZMA 4KR6A 1N3IA 1CYDA 1NUSA 3HPQA 3NVAA 4HX5A 5ERXA 1E1KA 4AKEA 2D0DA 3N76A 5B7NA 1L7XA 3G5AA 4ZT2A 1G21B 3BSFA 3L0SA 4MB2A 5AW5A 3QJ5A 3OPYA 2B5WA 2XNHA 3UHJA 3AU9A 3V48A 4BKRA 4HWPA 3U7EB 2C9OA 2BOVA 5AYVA 2IU4A 3PC4A 1DBPA 3GDOA 1LNSA 3HZOA 3H16A 1IH8A 1JX6A 4R2LA 4UUBA 2TYSB 1JTFA 2NUPA 3RVKA 4AQDA 1IBSA 2GUWA 4D9MA 3FPCA 3M81A 3EG9A 4ND4A 3SC3A 3VX4A 3K6SB 3KFLA 1X80A 1CS0B 3FTEA 3PDJA 3DVAB 4EJSA 2GN9A 3DOOA 1CQJA 5FPTA 4ZVQA 4OMCA 3ZCXA 2FP3A 4ZDJA 1NVWQ 1RW4A 1KAEA 1PTJA 4OCZA 4GRAA 4N65A 3AEXA 3ICOA 3H0KA 4C07A 4EJFA 1DU4A 2ZIFA 3MXOA 4KNYA 2BFFA 3C1UA 1O58A 1UXHA 2Q6LA 3ZJ4A 3TRHA 4ZZ3A 3IUEA 2I2AA 2YIDA 4LGVA 3AUTA 4U7PB 3ZHVA 1FDWA 4CCYA 5HKKD 4DMKA 1XJCA 4GXRA 5LQDA 2HRZA 1KIMA 4IDOA 4PHGA 4EJSC 4HZUB 1N2HA 5FI0B 4BNLA 5AUPB 1TF7A 4QO8A 1AKEA 5AJXA 4LSZA 1I32A 2ZYVX 3GT3A 3HYSA 3OIVA 3QP9A 5FFNA 2ATVA 2OV4A 3GUCA 4JNCA 1QZXA 5L3RA 1FRQA 4HADA 2I66A 4AJ4A 4BNFA 4M1MA 1P6QA 3HXTA 1MN6A 4N49A 3FGNA 1NBME 1XOIA 2GNOA 2UUOA 1UMBB 2N1BA 2CLIB 3HL4A 1E1QD 5CHYA 3VJMA 1GDDA 1U9YA 1UBMS 2WI8A 2CV2A 1V11B 5IJXA 2FTKE 4XASA 2QR2A 5ILGA 1ND5A 4OA8A 3H1EA 4BO8A 1BMFA 2VA9A 1M7GA 3VMMA 2ASEA 1BDBA 1QBKC 4V39A 2NNLD 5DB4A 3HCWA 1ACLA 3C6KA 4Y9DA 1A9YA 1G6HA 2GASA 5KYGA 1YJ8A 2PZMA 3JAKA 4TXNA 2C7QA 2AR7A 4WNAB 3UK2A 1E9AA 3QEOA 4Q15A 3GEGA 5DYTA 2Y93A 3GP5A 3RJZA 1S4MA 2GEDA 3E1GA 3A25A 1G17A 3D7RA 5I3CA 3PPWA 1IBKB 5K3EA 1SXJE 3MGKA 3UTDA 4ZAZA 3CZ5A 2OGTA 5C7LO 2R8YA 3C6BA 3GJ0A 3ZCSA 1GGMA 4HGQA 1SCKA 3QX7A 3ROKA 3W8RA 5AFSA 3DYVA 1DADA 2AX3A 3NGLA 5HP4A 1PJLA 5L7YA 1NVFA 2IY8A 5TQ0A 3QJYA 3HUDA 4R51A 4CKWB 4I1PA 1F2TB 5DSZA 1Q1NA 4V0OA 3UHOA 1OGJA 5LP6F 3KZXA 4TXHA 2GZDA 3CEHA 1CY0A 4EMBA 1Z5WA 4ND1A 4YP5A 5LKAA 4UQOA 4E22A 1KR5A 2HADA 1U1FA 2R7LA 4I4LA 4TKMA 2DWQA 4PX3A 2PWBA 5JDCC 3SE0A 3T7EA 3V55A 1RJEA 1N5DA 2XA1A 5KI6A 5CLHA