4ESEA

The crystal structure of azoreductase from yersinia pestis co92 in complex with fmn.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
201
structure length
193
Chain Sequence
b'AMSKVLVLKSSILATSSQSNQLADFFVEQWQAAHAGDQITVRDLAAQPIPVLDGELVGALRPSGTALTPRQQEALALSDELIAELQANDVIVIAAPMYNFNIPTQLKNYFDMIARAGVTFRYTEKGPEGLVTGKRAIILTSRGDLVVPYLRLFLGFIGITDVEFVFAEGIAYGPEVATKAQADAKTLLAQVVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FMN-dependent NADH-azoreductase
molecule tags Oxidoreductase
source organism Yersinia pestis
publication title The crystal structure of acyl carrier protein phosphodiesterase from Yersinia pestis CO92 in complex with FMN.
rcsb
total genus 67
structure length 193
sequence length 201
ec nomenclature ec 1.7.-.-:
pdb deposition date 2012-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4eseA00
1QRDA 3GFRA 3FW1A 2GSWA 4CETA 1YDGA 4C14A 4YALA 2X2OA 1OBVA 4PTYA 4LAFA 1JA0A 2FLVA 2FVXA 2V9CA 3EDOA 3EYWA 1J9ZA 3GAMA 1CZOA 1XT6A 3ESZA 1AKTA 3HLYA 1AKRA 1CZLA 3NLLA 3O2NA 3OWHA 4Y9RA 3ZHOA 1T5BA 2FAXA 1XI2A 3KAQA 1YCHA 4LTDA 3F90A 3NHUA 4ZVLA 5TGZA 3OJXA 4NULA 1T0IA 3OWXA 1C7FA 2OYSA 3NHSA 3K1YA 1CZNA 2M6SA 2MOKA 2XODA 5BUCA 1WSBA 4U7GA 2M6RA 1H66A 4Y7CA 3B6JA 3NHWA 1I1OA 2FCRA 3HR4A 4GR9A 4YQEA 4YAUA 3N39C 2KLBA 3W7AA 3N3AC 3SVLA 5FA6A 1YOBA 1FLAA 3QFRA 3W79A 2QWXA 4QOIA 1DXQA 2R96A 3B6IA 3NHLA 4QOGA 1CZHA 5NLLA 3S2YA 3TZBA 1X77A 3U7RA 5A4KA 2X2PA 3NHJA 4LTMA 3N3BC 1FVXA 2V5UA 2MWMA 2ARKA 3QFCA 2FX2A 1FX1A 1SG0A 5LJLA 1QBGA 4QODA 4FGJA 2FOXA 3B6KA 1YCFA 3U7IA 4QOEA 4HS4A 4J8PA 1NNI1 4DILA 5EAIA 2Z98A 2Q9UA 5LMCA 5ULLA 2AMJA 3F6SA 2OHHA 1B1CA 4NLLA 3L9XA 1RLIA 1FTGA 4OXXA 5F12A 4R81A 4BMPB 1RLJA 2HPVA 3O73A 4QOHA 1D04A 1FLNA 1TIKA 3GFQA 1SQSA 4N65A 5F4BA 4ESEA 2OHJA 1XYYA 2Q62A 2D5IA 2WC1A 3QE2A 3TE7A 3UXEA 3GFSA 4XDGA 4D02A 4C0WA 1FLVA 1AKVA 1RTTA 2QX4A 1VMEA 2QX8A 3KEGA 3OX3A 2RG1A 1E5DA 4FGKA 3LCMA 5EA2A 3NHRA 5B3KA 5LJIA 1KBQA 3G5MA 4ZVNA 2QMYA 4ZVMA 4BMOB 2BMVA 1CZRA 4LTNA 1F4PA 1AHNA 3W78A 4QOJA 3W77A 4U7HA 1FLDA 4GI5A 5LBTA 1AZLA 3FX2A 4YAOA 1J9GA 5LBUA 4C0XA 1YKGA 2QX9A 1ZX1A 1J8QA 1YRHA 4F8YA 1AKUA 2ZKIA 1KBOA 4M0CA 4FGLA 1D03A 1QHEA 1BVYF 3OVMA 3P0RA 4ICIA 2BN4A 4Y9UA 1AG9A 2Z9BA 1XYVA 2BZSA 3FJOA 3F2VA 3F6RA 3OX2A 2A5LA 1V4BA 4PU0A 4DY4A 1H69A 2B3DA 3FVWA 3KAPA 1DXOA 1FUEA 1GG5A 1YCGA 1RCFA 5FX2A 1OBOA 2FZ5A 2Z9DA 1CZKA 2V5VA 3TEMA 1CZUA 4U7FA 4DIKA 5LVAA 1AKQA 1JA1A 2FDXA 3OJWA 1AMOA 3ESYA 5B3LA 2R97A 2QX6A 4H2DA 3B6MA 3R6WA 1AKWA 1J9EA 3NHYA 2HNAA 4LA4A 4CF6A 1C7EA 1DX9A 4XDHA 4YAWA 5NULA 2BPOA 2FZVA 4N82A 4C76A 3NHKA 2N1MA 5F51A 2QR2A 4H6PA 2XOEA 3HA2A 4HEQA 3NFRA 4S24A 1OFVA 3LT5A 4ZVKA 1TLLA 1WSWA 3ESXA 2MTBA 6NULA 3UXHA 3ES9A 1ZWLA 3NHFA 3K20A 5FUQA 1QR2A 4GQIA 2F1OA 2BF4A 1D4AA 4YAFA 2KQUA 2OHIA 3RPEA 5JROA 5EMNA 2Z9CA 4PTZA 4FX2A 4QOFA 3OX1A 5LLDA 3JSXA 3NHPA 1BU5A 1ZWKA 2HNBA 2MT9A 2W5UA 2QMZA 3D7NA 3L9WA 4N9QA 3KLBA 3FNIA
chains in the Genus database with same CATH superfamily
3EG9B 3RJZA 2G9VA 2Q4EA 4GXTA 4ZO4A 5DWVA 4U7WA 2HK7A 3EZ9A 3PXXA 1ZKDA 4FKBA 2CBZA 3RKSA 3TBKA 1R9NA 1A95A 2I2AA 3IQZA 4G1VA 4QDOA 4DNOA 2PUGA 1RU3A 1PQPA 1YS6A 1Y9DA 4OHRA 4H6XA 1RMTA 1TZ2A 2CB9A 4H7DA 2Z6VA 4L9AA 4UNQA 4WNCA 4RTQA 4JD5A 3A9CA 4XYEA 4RTKA 3KOUA 4HB4A 1NFQA 3AFMA 3LS2A 4DCMA 3DAFA 1LFAA 4J91A 4R54A 3H4TA 1U5CA 1MAWA 3CZPA 4TLEA 1RFLA 3GGDA 1C3VA 3A32A 3TLYA 5CAEA 2CLLB 1Y89A 5AKJA 3AESB 5DOZA 2WK1A 3FCXA 1Z56C 3FKJA 1D3AA 3FSEA 3P9ZA 2EQAA 2MMCA 4YAUA 3ANSA 1TTHA 3G8DA 1HFKA 1T5DX 2OV4A 1M1UA 3DDOA 5HFAA 3KWMA 3ZY3A 4DGSA 4KWTA 1XNQB 3HO1A 4K0KB 4XR9A 4BVEA 1N75A 4HFMA 2I9KA 3DR3A 2PSHA 5J5CA 5IS2A 2NW6A 3OP4A 1RVDA 2V6FA 3KV3O 4TKMA 4BB0A 2FRVA 4AROA 4BC0A 1CY7A 4JHXA 4R1MA 4MPPA 1YCFA 1TB4A 1R0ZA 2OD9A 4BGEA 2IPAB 4LQLA 4CLXA 5ULLA 4F11A 1S3IA 1A9SA 3NKLA 2XCTB 4BNJA 2SNIE 1OH5A 3ZJVA 4RNDB 4RU1A 3WFJA 1Z68A 2CT8A 5C1BA 1DJNA 4OUKX 4C0LA 3AHFA 3GFQA 1H1LA 1KI3A 1QFSA 4OYRA 4EY7A 5BN3A 1E9DA 4DV5B 3LNTA 1HE2A 3M6MD 1I4EB 2I03A 2ODWA 1IJEA 4LRSB 5AHWA 3X1XA 2YWJA 4HLUC 4MP6A 1ISFA 1OLXB 1VIDA 2FQYA 4CF5A 1YQWA 2AX3A 3IDZA 2OCGA 3W34A 1K0FA 1C4XA 3WFIA 5K6TA 2YV5A 4DZTA 4OQPA 4EDHA 3PQ8A 4R8RA 1NLYA 4NFYA 3HCDA 1WVMA 3RRXA 1I1HA 4RY2A 3D7MA 5B2ZA 3ZNPA 4EO9A 3WQQA 4AECA 4JLDA 3JD1A 2RGUA 4JA0A 2A6PA 3ZTYA 3L1JA 2J3EA 1GPJA 4QA9A 4DMFA 4PS0A 4K9KA 5SY6A 5FPHA 3AZOA 1IVSA 1VJRA 4LKOA 3ZX4A 3Q8KA 3A31A 4HAZA 2NSLA 3OEHA 1R37A 5ALMA 3SEFA 4DXDA 5HUHA 2Y9PB 1E32A 5EE5B 3UJ7A 3HYLA 2A9QA 1JBKA 3WGIA 1L5HB 2GEUA 3UAYA 2CF6A 1PD0A 4R0MA 3TSYA 4QDXA 4FWTA 3ZS9A 3R8FA 3THWB 1DPGA 1P0QA 4H0NA 4NJOA 4Y0VA 1XG5A 4D5EA 3BHMA 1KEVA 1YJCA 2EDCA 2J0UA 4UNNA 5DF1A 3RC1A 1HBJA 4KBGA 4YAKA 3TPFA 1N2HA 5IF9A 4LHYA 2I6GA 4MEJA 4EJSB 5GJCA 1GV0A 2KQUA 2BONA 9MHTA 4CNQA 3X1ZA 3TD2A 1BDMA 1GUBA 1H2RS 1DDGA 1H6BA 2EJCA 1DMRA 5FNVA 1N2ZA 4XTRA 1JJ7A 4YJ3A 2O7VA 3JPYA 1L7OA 3H2BA 1R74A 1ZAKA 4H1TA 4H7PA 1X1BA 4B3DA 3INRA 1IN4A 1SKAA 2C98A 2HJRA 4A6DA 4NENA 2E85A 4GQBA 1NVDA 2CHQA 2CVPA 2DBVO 1WLYA 4N7MA 4Y9RA 5EWLB 4C7XA 2WJ6A 4EG7A 4OX9Y 1C1HA 3WZMA 3NBMA 4MROA 3KV1A 4RHFA 2LDXA 2VAMA 3FFTA 4TXJA 4OF4A 3SY8A 1OR8A 2ATVA 4Q47A 4BKRA 16PKA 3ILSA 2Q6KA 3HFRA 2ZZNA 4EUEA 1CRLA 2MOKA 5DX1A 1M8GA 3ZVLA 3LFHA 2HF7A 3MSCA 3ND8A 4KOEC 2KHZA 1Z36A 1DFGA 1X3SA 1F6WA 1LBSA 4GKKB 2Z95A 1CF2O 2FKNA 3IVXA 5LOVA 1TD1A 2HF2A 2ZJZA 3FCCA 3JRNA 3LF1A 2XYRA 4GHWA 4H77A 4WZBE 1GITA 1NBWB 4L08A 2OKGA 4KQFA 3DVAB 5FWXA 1ZESA 3FPGA 3LYLA 3VOTA 2XVMA 1D0SA 5BOVA 5K7SA 2CGEA 8MHTA 1ESCA 1G6Q1 3L8MA 4HTFA 4J8PA 4CEHA 1ZP6A 2BRUA 2HYIC 3LXXA 2MSLA 2CCJA 1K89A 5AI0A 4FFVA 1EPUA 1RCUA 2AOTB 2PAAA 3DMTA 5DM60 1CIJA 4XQCA 4CKZA 1WDMA 3RNOA 1Q7RA 1W1WA 2Q6LA 2VTVA 4UASA 5DBIA 1SXIA 1G17A 2H1HA 4KIUA 4QPCA 1T35A 5AVKA 1NZDA 1ZK0A 1YL7A 1H42A 3ENKA 5KMGB 1X38A 5BQPA 1X94A 4PONA 3ROKA 2UYGA 1IHXA 1EA7A 2HJHA 1QV9A 1RRGA 1FFWA 1FLVA 1XQ1A 4PLPA 4W63A 4NOMA 3R8CA 2CL5A 4AD8A 6PFKA 4NK4A 1UOQA 5JWRA 1UBTS 3VPAA 1CUXA 1F8GA 1DBSA 2D5BA 3H11B 2UYCA 1X7ZA 1DMSA 2VBGA 3K70C 2BLLA 3E4CA 2HSWA 3AWDA 3B7PA 4RJTA 3MTDA 1UXHA 3SJAA 1WETA 5BV8A 3GLFA 4B6OA 1DP4A 2H4WA 4HNAA 4L9SA 1U81A 3VPBA 4RF4A 3RTEA 5ALUA 1GTG1 2C7GA 4Y9UA 3LRTA 5JH7B 4INOA 3KTDA 2LKCA 1KMMA 4R01A 1QF7A 1GFWA 1SK9A 3JQGA 2HRZA 1Z6QA 2GFQA 2I6QA 1VI6A 2F17A 3U2QA 4U5QA 4AX8A 4WKBA 3OZAA 1CNFA 2ILTA 3ASVA 1W48A 5CCEA 5LXTA 4XGIA 2ZR7A 4HDCA 4CUJA 3JQAD 3ADBA 1C7ZA 4GZ5A 4ARCA 2B83A 1NW5A 3KKPA 1A4UA 4HEHA 2R97A 2NAPA 1P0IA 4YP5A 4IUYA 4EQZA 4CF6A 1TJ4A 4MQ4A 1C4OA 4Y2PA 3GRYA 3MRXA 5MN5A 2UUAB 3RK0A 4CL3A 2R7NA 3RNLA 2FCAA 1BA3A 4IV8A 5AXCA 3A6ZA 4BO4A 2WUEA 2WJIA 3CIFA 2P27A 3ESXA 4RFLA 2QUHA 2FQXA 1TCVA 3D3JA 2H85A 3LOUA 2X9LA 3NHFA 3M8KA 1IJFA 1K6XA 5CVCA 5GINE 1SA0B 3WNZA 2QYSA 5HMMA 1SZPA 3L1HA 1PBNA 2UZAA 3H2ZA 4ZI3A 1SHLA 4YAEA 5DK6A 3W2IA 4F7DA 2QRPA 2O57A 3OY7A 1CQIA 1WBJB 2CW5A 5AD1A 4D80A 2ID9A 2VYND 3FIJA 3IAFA 1IQUA 4UZFA 4YALA 2WMYA 4E5VA 2WKRA 5C2JB 1ZPDA 1RS0A 3NTUA 2GD1O 3NOXA 2QLBA 4OGWA 4W6QA 3TOVA 1ZKMA 2TYSB 1G8YA 3GJ6A 3BMQA 1Q1BA 3SZ3A 1JR3A 3DLAA 3MINA 3MWJA 1AKRA 1IVYA 2XE7A 3D02A 4HVAA 3Q7PA 2XXBA 3C6KA 5ARDA 4DCNA 3P19A 1SURA 3C7AA 3MGCA 2C0CA 2D5CA 2PL5A 4ND2A 3NETA 3RG2A 3TXXA 2QZSA 1SOWA 1W5FA 1Z75A 3HB4X 1SCKA 3OQBA 2ZCJA 1MDBA 1RWPA 1H4SA 3WLAA 1P6UA 1KJYA 1K2VN 1XZJA 3P32A 4W5HA 3EUWA 4WLEA 1HL7A 2E2WA 1L5FA 2AIRA 3OMLA 1AA9A 4U7GA 3A6PC 3FNQA 1TJ5A 3JATB 1LX6A 3PFCA 4YAJA 4QECA 3WY9A 2JGKA 3ZY6A 1XYGA 2O2YA 2VZEA 1FTSA 2W37A 3QHAA 3TRJA 2JH3A 2C8JA 4AYTA 4JBLA 4GZ6A 1A82A 3HXKA 3OTGA 3WLMA 4KPYA 2DSNA 2DMRA 2VEDA 3Q9NA 1AY0A 4YCSA 3CVUA 3SBDA 3GAFA 3JR7A 1TD9A 1E9VA 5AMXA 1Q57A 4BO7A 3MCZA 3NAZA 1R0RE 2IIQA 5KYTA 2RG7A 4CYMA 4J1TA 2BLNA 1RLUA 1GPYA 5E2IA 5JCOA 2G40A 4ZYYA 4BWFB 2YUIA 4NARA 2B2CA 3CSDA 4FHEA 1EBFA 5IM4F 2BBSA 2CFSA 4TQUS 4BBAA 5ADWA 2YKGA 2CLHB 3WLHA 5TF4A 1GUYA 4FZ5A 1NF8A 1ZCFA 2G17A 2IP2A 2IYOA 2YFQA 2FZEA 4ZC8A 1I14A 1NUQA 2R62A 1QO9A 1DQPA 1SCAA 2QGFA 1AGRA 3G68A 2ZR8A 5KYNA 5LQKA 4UTPA 1PWHA 3KSZO 3N75A 4CI0B 2XUFA 1XD2A 1BIFA 2BKVA 4KQ1A 1ABFA 1S3GA 3GQVA 3QKRA 2D54A 3M4YA 2B0JA 4RHTA 1QO0D 5INTA 4OJNA 3WIUA 2GASA 5TSDA 1D4ZA 1JHPA 2JB9A 4LRXA 4EPVA 2X22A 1HTWA 1YL5A 4JY7A 3Q10A 1SY7A 4HB0A 4X1KB 3J81k 2D5LA 4INZA 3A0UA 5CTJA 4CG3A 1L5LA 1K1EA 3IPAA 1MX1A 1MVNA 4QPPA 1CNMA 1R7RA 1LW6E 3F6RA 5ITZB 1FTNA 3E3NA 1IEVA 3EQZA 1NVTA 4BMXA 1U98A 1VXOA 4AKSA 2H48A 3JZDA 5A3QA 2J4DA 4YMIA 3HFGA 5GM1A 1LX7A 2Z5FA 1XRLA 4D25A 1G63A 3GAAA 3H1GA 3WL7A 1CZUA 1UZNA 3GP3A 1PD1A 3WICA 1B73A 4C3VA 4NJMB 2QLTA 4D57A 5BSFA 5HHTA 2ZJFA 1F8XA 4H2DA 5KYVA 3LYAA 5KREA 3I6ZA 1IQRA 3NEPX 4FN5A 4R5HA 1ONOA 1PNVA 2OV2A 3D0KA 4IMPA 3BDIA 4RKWA 5CTAA 6REQB 2OECA 1FW8A 3QE3A 4B75A 4JNCA 4HQKA 2PG3A 3B53X 3ET5A 3UT6A 2AOXA 2HA5A 1DC8A 2XHZA 4GW3A 3H7IA 1EVLA 4YCBA 4R71A 3THYB 1E77A 3I37X 4UVEA 4EP1A 3K16A 3T5CA 2XNJA 1XRMA 3SF0A 3JZIA 2ZWAA 2J87A 4MVJE 4XX0A 3K94A 1LCIA 4FP9A 4MAMA 2BWJA 2YJNA 3QPWA 1E3LA 4A7PA 5I5GA 1H0SA 1S89A 2OHFA 2P2LA 1A72A 2QSUA 2W48A 3A1CA 3FNIA 1LF0A 2EZUA 2ZIXB 3AHCA 2H07A 3EQ9A 2B94A 3N2KA 3UWMA 4UMEA 5THXA 3LT0A 2Q07A 5GJVC 4P84A 4AMZA 1T29A 4K9LA 2H1WA 2IHTA 3C3AA 3HVHA 2XT9A 5IANA 1PJLA 1DRWA 2CKMA 2DOKA 4JENA 5I8ZA 3TEJA 2JBWA 3RIEA 5IDYA 2OV1A 1DTEA 3D59A 1A8SA 4W4TA 2C5HA 1P2BA 3OD1A 3OZTA 3SFZA 3QVUA 3ZG6A 1RKXA 2GM9A 3NU1A 1PDWA 1R2QA 1KYVA 2C8KA 3KKOA 4FINA 1YCDA 3W8EA 1EBUA 1ULTA 2ODBA 3A36A 4B6PA 3D0OA 1ZGBA 1K7SN 1SEVA 1SNYA 1YOBA 4AXBA 3HO8A 5ESDA 5LKRA 5KJCA 3KSBC 2Z3WA 4KXMA 3RSHA 2H1OA 2QY6A 1B6GA 2I4LA 3KL2A 4Q3BA 4MEAA 3TM5A 1WEHA 1N0HA 1QUEA 2B9EA 2Z6QA 2RCNA 5GAJA 3X2SA 1FX1A 1Z2CA 4ZCLA 1U7TA 3HL0A 3NW9A 1JSZA 4LBZA 1YZYA 1V71A 3EVGA 4OOFA 3HKBB 4OSEA 3N8NA 4Q4AA 1FVFA 5CNIA 2VKQA 1OROA 3O6VA 4D4HA 1U0EA 4AMUA 1U7XA 2FJPA 1I2CA 2C88A 5U4XA 1UEJA 5LB2A 3SFTA 4E3ZA 4LYHA 1UJNA 1OY1A 3SHTA 4RY0A 4PWYA 1WKBA 5H8WA 4MW9A 2BD0A 5KJFA 1ZICA 2AFHB 3H65A 4MRVA 4TZ0A 1T9KA 1UAAA 1G38A 3FYUC 4HH3C 4DLLA 3K09C 3R1IA 4C0SA 2ZRIA 5FLYA 1PZGA 3E22B 4INAA 3N58A 3NHBA 2HXGA 1NM5C 2XBMA 3T35A 3TSAA 4BOYA 1KMHB 4BO2A 2QTZA 3GEGA 5B4VA 1Q19A 1CZRA 4FCWA 4JYZA 4Y6LA 2NU7A 3VKHA 2GLTA 4OJTA 2YC2C 1YS1X 3I6BA 1W46A 3U1TA 3KQSA 3FCOA 3ABIA 2A4MA 4CL0A 3FDIA 4OUDA 3AL2A 1I4TD 1EVEA 4M7OA 3CG4A 3ZY2A 2B37A 2HZBA 2WDZA 3BILA 4E30A 1M3SA 4D0GA 1JR3D 1GZSA 2J6HA 2W8ZA 3CMMA 3HVUA 3KAPA 4B0OA 2APJA 2ODEA 3QV2A 3LPLA 3H5WA 2HXYA 2FZWA 5DP1A 1XXLA 5G41A 5LQUA 1ACJA 2FMKA 2X4GA 1DUIA 2EFCB 5JH7A 1TYCA 2J5XA 3H9QA 2AHRA 3OFND 3OZ7A 4ZOQI 3RS9A 5ALXA 1PEAA 5AW5A 1NPYA 5I4CA 5ICGA 3DV0A 2FZ4A 3VV3A 3ET4A 3AF5A 4RY9A 5IT5A 1GPMA 5A1TA 4RWEA 1YXMA 3HLTA 5JVDB 1A04A 1ZNQO 4PPYA 3IT3A 1R18A 1M2JA 2PAFA 1SB8A 4AWXA 4EB6B 2IU4A 5DSTA 1Z5WA 3HJGA 1BTOA 2BHLA 1KYIA 3C3XA 4FBMA 1TAUA 1FNBA 3IBSA 3UA3A 3F7OA 3KZKA 4GO1A 3AUUA 3KLBA 2GJ4A 6ABPA 3T54A 1XEAA 2NXCA 1NY5A 1ZNXA 2YTZA 1T6XA 1UWKA 3I6YA 3JQ8B 2H5JA 3QYJA 3AY7A 3AR5A 4EF4A 3BRQA 2NWQA 3ZDEA 4MR9B 5ALHA 5ALWA 4Z7OB 4WJZA 3BRSA 4QSHA 2AKYA 2VF7A 5G4KA 4CMJA 3QH4A 3C6QA 4HNUA 5CFQA 2VAXA 3CR7A 3QMPA 4II7A 5F2EA 3C7CB 4R8KA 5EQDA 3ON5A 2BSAA 3AERA 4DBZA 2AHOA 3KKNA 4DUGA 2PJRA 2PJZA 1Q1EA 2JJYA 3N2KB 4CM9A 3P2JA 1Q0ZA 3BF7A 3ZGNA 4KBFA 5AVSA 4BP1A 1MX3A 1HSOA 1ZITA 1T25A 3BFXA 2VDUE 1HH4A 3G2QA 3HYRA 2FWIA 4HWSA 1MPXA 1P4HA 1P0FA 3EXG1 2HEGA 2ZM5A 1Z33A 4FHGA 2Q2VA 1KYYA 3H05A 4AU1A 3KQWA 3LZDA 4HDAA 1Z28A 5G2OA 4JV5B 2V7PA 4KO1S 1CZHA 3RUAA 3HUFA 1V4NA 2A9KA 1DO2A 2ON6A 4DMHA 2GEVA 3OKPA 1T2CA 1ZGJA 3MB8A 4O1MA 2OGWA 2VC2B 4A8JB 1BH6A 1I7NA 3T52A 4FIDA 4CUZA 4UFPA 3RFVA 1LSJA 2R8XA 5CNJA 2Y93A 3EWNA 3LIIA 4GPTA 3UA4A 1NE2A 1B4DA 4E88A 3SDSA 3T1TA 4EI8A 3M4NA 5K0LA 3SYMA 4QWMA 4I1SA 5E4FA 3SLGA 5GJBA 4OXRA 5CVJA 5KWJA 2XMRA 1VGVA 3G5LA 2CNWD 4ER7A 2LIVA 4RXTA 3VI3B 1OB2A 3DMDA 3H2IA 4IVPA 3GNLA 4F92B 3LC1O 3OZXA 2I55A 1D0IA 2VBFA 2ZYTX 4Q48A 4Z9FA 2Y4OA 4R2JA 3WGYA 1Y7HA 5JC8A 2YW2A 3H5IA 2XZLA 2ZI7A 4H3VA 1JKXA 2WF8A 1E8DA 1BMQA 1JZSA 3WYAA 1NLZA 1H1DA 2CLMB 1XKTA 4O4JB 3ZGXA 2XMGA 4PC6A 2I6FA 4ZTBA 1XRQA 3UAXA 4UXJA 1DTWB 4DIFA 3V6MA 3QF7A 3BD8A 2C9MA 1WSAA 4WINA 3IT1A 3FTEA 1KJ8A 4AJEA 1E4VA 3BICA 1YS9A 2J4FA 1VHWA 4YP9A 5IG2A 4ADSG 5ISMA 4HWTA 1RRVA 1Z2AA 2OWEA 2ZYHA 1Y3FE 3K0FA 1J97A 4TXNA 4X1IA 3QJYA 1BWPA 4TTSA 5AUQA 4D82A 4V1CB 1EDDA 2PWBA 5FPSA 2QSJA 4J1TC 2YASA 2J9ZB 3UK0A 3ESYA 3WMWA 3DM9B 3UM9A 3DR5A 2PGLA 3QFSA 2MJLA 4AJOA 1FNDA 4WERA 5JO9A 1LTQA 4AS2A 4QQNA 1ODTC 4I50F 3DBOB 4F9FA 5FAKA 1B3BA 1A5TA 3CURA 2C2GA 5JCJA 1L7AA 2OBXA 3BRWD 1P81A 1NJFA 1QIKA 3Q2OA 4UAGA 2GTHA 3D6FA 5ALGA 2CXTA 2E4YA 1DAFA 4PPNA 5LD2B 5REQB 3W8DA 4RVFA 4PC1A 2J46A 3PX2A 4ND5A 5IBRA 6REQA 3CZ5A 4DNFA 5JHGB 3U49A 1A9XA 1F6BA 1N8KA 1KEPA 4KIFA 4PYQA 4EFDA 3QPVA 2YRWA 1MU0A 1K8QA 2VCHA 2GKSA 1T6NA 3IUPA 3PJDA 1RLTA 3HKEA 1GVNB 2CD7A 1CVIA 2EKDA 1R15A 2ENUA 1OTXA 2NT4A 3OIGA 1FUUA 4JCOA 1IJKA 3TINA 1SU6A 3U1VA 1Z7EA 3TZLA 2CLEB 2VDNB 1S0UA 3DP7A 4IEIA 4LX8A 4DZRA 3K71B 4S3MA 4YRAA 2JVIA 3KAQA 2AFHE 5GADl 1B74A 3BXZA 4NYJQ 4I6GA 1RYYA 3OQMA 2A7XA 5EKDA 3O83A 5EZQA 4XYMA 3D5EA 4IL5A 4FVTA 4PQFA 2E5LB 3FGNA 1NNSA 2ZETA 3SD7A 4RPKA 2B4KA 3W9UA 5LU9A 1D1QA 2D5AA 1TX4B 2FP4B 1DIOB 3CKKA 3VC3A 1H4TA 1UANA 1WQ1R 2I87A 4I55F 3MBIA 3RW9A 4BV2A 3KJIA 3QOXA 4F97A 5G3ZA 5L3SB 2WYWA 1A8UA 5A4KA 3HU3A 1AKMA 3PUZA 1GM5A 1EDZA 2BZGA 4IDNA 3B3FA 5KHOC 3LCUA 5P8WA 5FA5A 3P9XA 3E4DA 1NQXA 3KU4A 2PANA 2NV0A 5FOUA 3HNRA 4OQQA 2J5QA 4BNNA 4B74A 4QT4A 2HLDD 4MB6A 2LW7A 3IEXA 5EHZA 2XCRB 2EATA 2X6TA 3LFUA 4HTAA 3U9LA 5FFFA 1SHJA 4R2LA 1I4OA 1SBHA 4ZT7A 4LGMA 2OCBA 2XXAA 1JLHA 1V4VA 3W8RA 4DLSA 5IBQA 1QH0A 3JZAA 3Q9LA 1SU8A 2FW6A 2QVZX 3EAGA 4DYHA 1WS6A 2QD3A 5B3KA 3ZDFA 1U4SA 2HCRA 1F4VA 1XA4A 1MIOA 1JUDA 1G7SA 2ERXA 3GDWA 4FYXA 3BMQB 1VKZA 1WLSA 3F98A 2JLCA 1F48A 1NJ1A 2B20A 3C4VA 4KXFB 4Q4LA 3UJPA 1AZLA 2R6FA 3DMGA 4C5AA 1JEYB 2MSKA 4ETMA 2VQEB 3E2IA 2GNPA 2ZYRA 5FWDA 5LMNB 3H9JA 1D2EA 1FRFS 2PQ0A 2R66A 2YWCA 1BAPA 1DDIA 1OASA 2GZMA 3WAKA 4EB0A 2IE0A 4ZIRB 2I33A 4LFBB 3GOHA 1JF8A 1G59A 2FPWA 4CVNA 2YXPX 3C98A 1QRTA 1WZEA 2YZMA 3BG5A 4IV5A 3BMOA 4ZARA 4RF5A 3UGTA 4HWPA 3WNBA 5FX2A 1E2BA 5FTNA 4RA9B 1JDBB 2Q6VA 1N5MA 5K3DA 2CNDA 1O2DA 1TLFA 3HG7A 4UHJA 3OQPA 9ABPA 1E0AA 2BFWA 4FDVA 1X7YB 2R47A 1OAOC 2AXQA 1FQOA 1R88A 4JOSA 4MKFA 2Q2WA 3CH5A 4CL2A 3CLKA 4R3UC 4OFBA 1COWD 2RMKA 2YVLA 3ZLJA 4RV4A 4X44A 2RONA 3FWNA 2WTEA 2RHWA 3LQ1A 1Q6ZA 4NECA 4RM2A 5D1NA 1NM5A 2V6IA 4G97A 4MA4A 2B8EA 4QUEA 2HV8A 3U39A 4YUWA 3GRUA 3EQ6A 2ODAA 4W9NC 4BNIA 4BO8A 3LUAA 2EW8A 2F1RA 2Q1XA 2A5GA 2X41A 4MUFA 1U7OA 4FEGA 2H17A 3NRJA 3OC6A 4YV7A 4E4YA 1A7JA 2P9CA 1E7MA 4EB6A 3EWIA 4PQRA 4OCZA 1PJQA 1HO3A 2V9CA 3EYWA 3EW7A 3E8XA 1JIKA 1SMKA 1W6RA 1XT6A 4QD3A 4ZQCB 3O3NB 5CVDA 1QX4A 1Z06A 4B9EA 3GGPA 4LWQA 3TLZA 4F3KA 1I01A 2E55A 1GNQA 4PVDA 2VP3A 4ASUA 4RPGA 2C4NA 1J5XA 1LNQA 4A8TA 4CDRA 4DDUA 1C7FA 2ZDHA 2V7UA 1UCFA 4G1BA 1KAMA 4BNZA 4NQRA 1TOAA 4L4UA 4F45A 3HCFA 3KYCB 3CX6A 1A50B 2GRUA 2ZSAA 4NEGA 6LDHA 4JEMA 4Z3DA 4KX3A 1ZD4A 1F4LA 2FN9A 1Y7IA 3DWEX 3HYNA 3JD2A 4YQEA 3HR4A 4JJ4A 4AMBA 2ID7A 1PZXA 4B6GA 1DG1G 3COPA 4FFLA 2P91A 4KCGA 3AY6A 2QG9A 2DVMA 2XWBF 2I80A 1CUUA 1T3GA 2JI7A 1QGED 3IDOA 3IP3A 5JXHA 3GARA 1DBVO 1WZUA 3CX7A 3DZFA 3PUKA 1OXXK 1FQKA 5EIWA 5K51A 3S2IA 4BLWA 3K6KA 4ENSA 1EQ2A 4ZVPA 3ECAA 4RK1A 1KJZA 2GCEA 2OV6A 4RV5A 1F8FA 3GHHA 4LRTB 5F4ZA 3ZVRA 1EGHA 2J4CA 4MVWA 1KDTA 1P7CA 1YZFA 4BMDA 5LNK1 4JLUA 1XCMA 2PL3A 3LO8A 3WYFA 2NX2A 1GPH1 4R9RA 2PCLA 5BW8A 3LT2A 3IXLA 2NO9A 4MKIA 2XAUA 1I0LA 3UTCA 3L3BA 3OF2A 2XZTA 5HZGA 2PTHA 1F51E 2H2FA 4G5FA 3YASA 2DFKB 4ZV4A 3NTRA 2WKPA 3PPWA 4C0WA 2OO7A 3O8DA 2BP7A 2P6OA 2WJJA 4RPIA 1PR0A 3VAYA 3CU5A 2PIAA 1SVSA 3TOZA 1XZDA 1P7PA 2B34A 3ITKA 3M1LA 4NPAA 1DOAA 1SC3A 2BMVA 2QAGB 1ULAA 2QZPA 5F1YA 1LBHA 3BSSA 1AA6A 5HTOA 2GSDA 5F7JA 3H2GA 5LBUA 3T12A 3A6KA 2BGIA 1JYEA 1YRHA 4KN9S 4QNMA 3KZVA 1V25A 2Y0CA 4KNVA 2W4IA 3OURA 1PFQA 2ZTVA 3HZHA 3PRJA 4HQNA 1K5GA 1USVA 4C7VA 4CKCB 2QVLA 4OOEA 1FZTA 2X4DA 3UMCA 3Q88A 4NNJA 5FYQA 4LJLA 2X0DA 1GR1A 1KHHA 3C3WA 4X3OA 3LNCA 1C30A 3FUTA 4YCCA 1J5EB 4QU5A 2PVPA 1AKQA 5T41A 2W42A 2VJAA 1PAUA 2H65A 3NVKI 4OREX 2P3QA 1MXFA 3T9BA 4MDFA 4UCWA 1NBMA 1XZKA 2C2MA 2H3HA 3D7LA 2IS6A 4MQEA 4EZEA 3NC4A 3LBHA 5AKIA 5KYYB 1V16B 1CVLA 1JH9A 1CDZA 4KQ6A 1ZI8A 3BF8A 4KQMA 4QPZA 1U5AA 1G8FA 1WY7A 3BIOA 5A62A 1X1TA 2VZ8A 3AEYA 3D9QX 3A8TA 3ONFA 2XGJA 3N6VA 2AG0A 1Z6ZA 2MSWA 3E35A 3NWEA 4OXKA 3VDQA 1G19A 2P0EA 1WCV1 5JNLA 2JK0A 4ZQHA 3Q11A 4D2IA 3EXFB 3GJTA 2CSUA 4Q5IA 1GUFA 1TGVA 3AR2A 3CKMA 1P1BA 1P2GA 3G89A 3LL7A 2HBRA 4AN1A 4COKA 1OX4A 1E1NA 2REQA 4K40A 4OGKA 5TMDA 4FFWA 3K6RA 1TQ6A 1O77A 2DH5A 5DJ5A 1YRQA 2ZRNA 1CT9A 3LX8A 5JTTA 4RQBA 3ZHOA 2R1VA 4EPRA 4R1TA 4Y2HA 4TVKA 2PZKA 4DMLA 5AW1A 3UC5A 3FPBA 2CHUA 1WMAA 3BJRA 3IJEB 5DT2A 2FNAA 4F96A 1M2VA 2ZRMA 4BZPA 2ASVA 2C2KA 2QT9A 3BMNA 2A9VA 3ED5A 2H1CA 3SM3A 3UV7A 3BH7A 1Y3CE 2OAQ1 2O3JA 4CM1A 4JHLA 4S1WA 4N3AA 4W99A 4TYQA 1OBHA 3CEPB 4LX0A 2QA5A 2VDQB 1KDRA 4RACA 1ST3A 4IJKA 3DJYA 1KJQA 1C1XA 3ICQB 2WIFA 4BNLA 5LA6A 4IQGA 4IWYA 4ALLA 1PL8A 3BAZA 2GHRA 1W2HA 1X9GA 2VT2A 1VI2A 1V9LA 3O75A 4KJZA 5B6JA 1BFUA 5I7FA 1L7BA 1JQEA 1DX6A 2Z98A 3PR3A 3OJ0A 4L0MA 5ECGC 2C94A 2DT8A 3U5ZB 2UYQA 3B78A 2WOOA 3BKXA 5HFNA 3RFTA 3WHPA 4XI9A 2X2FA 5K0JA 1Y9EA 3COJA 4XR4A 1RLIA 1W5AA 3GUCA 4FDLA 4HN9A 5IVIA 5HMLA 5TQ0B 5AHOA 5M3BA 3T6KA 3HCBA 4X5OA 5KPDA 1CQPA 3AF2A 5IEBA 1QOPB 2PSSA 1FYXA 3C6BA 2VH2A 3TSCA 4PYNA 4EVIA 1CUAA 3C3BA 4LYJA 2NLOA 5ERXA 1SXGA 1H0RA 2H54A 5JCXA 3A9TA 4YUYA 4NDAA 1G8SA 4XARA 1S9HA 3GX1A 1VKRA 4P4SB 4TSFD 4ZCQA 2JGNA 4B8WA 5TJHA 3QV1A 1NMXA 3IEUA 3DQPA 3OZEA 1GJRA 1ODJA 1OWNA 1U2GC 2OCAA 3BH6A 3LQ2A 4JSTA 1G5HA 3EXAA 1MEOA 4KU4A 1I9CA 1IE3A 1AK2A 4DRZA 1WHTB 3NIDB 3PUIA 3C48A 4EOGA 2ADFA 3MCAA 4PF1A 1C9MA 2BUAA 4XZ3A 5TPZD 3RJMA 3BCSA 5IZ4A 5MGBA 1OYOA 2AA3A 4F71A 1SC1A 1KORA 1BE1A 3FNRA 1FJHA 4PGAA 3HA7A 5K3BA 1DJMA 1KS2A 4RPHA 1NXSA 1UKVY 4CCAA 4F04A 4HNGA 2V1XA 3VTKA 1L1EA 3HJAA 4KE8A 4ON9A 1G6KA 4U3JB 3RE1A 5KVSA 4PAOA 3THYA 5JPDA 1VXRA 4Y1RB 5FNZA 4IJWA 4EJSC 1CJKC 3CUSA 2O2JA 3A9VA 2ZAYA 4CQLA 4RDXA 1DV1A 1RACA 4JDUA 1NC1A 2XNHA 3GGOA 2FW0A 5FORA 5TVKA 3SX0A 4TZKA 1P1RA 2NUTA 1MV5A 1EX1A 4J0HA 4BMYA 2YYYA 1IM8A 5IABA 3KO8A 1CP3A 4WLVA 1NKTA 3QVLA 4HLUA 4WNAA 1T2FA 1XZ8A 2WWXA 3S27A 4URVR 2H52A 2PBZA 1XVLA 5EJEA 1HXHA 1OXKB 2A3NA 1IK6A 2BHRA 1J22A 1EGMB 1Q95A 1Y37A 4LBWA 2R6ZA 3AH8A 5KSOA 4KQEA 2CJWB 2HO4A 4YP1A 3OZDA 1CUFA 3D6HA 4GSLA 1Z6GA 2W2TA 1U3GA 1WIWA 2IYUA 1KYQA 4X95A 1SPXA 4C0BA 5HZKA 4F9GA 3GDOA 1E3EA 2Z5GA 5T3UA 1GUZA 2C61A 3HV0A 5F1KA 1GQRA 4D74A 2XDWA 3K4QA 2WQZA 4AG6A 2FEOA 3QUAA 4BNXA 3A70A 4AJHA 4BXOA 5TPWB 2OC9A 3T7CA 4GICA 2EAUA 1HDZA 4Z51A 1P9WA 1SUFA 4C6SA 4Q7KA 3TDKA 1WMFA 2RKWA 4JLVA 5D51S 4DC0A 2ST1A 3NT5A 3GT0A 2PFKA 2XODA 3WWPA 3OO0A 1CQJA 3IYLW 3ZCVA 1XZGA 1VDZA 5TXGA 2PZJA 3GRRA 4TV9B 2ORED 1YZGA 4KZPA 3T1NA 1O6FA 3VO9A 4QUGA 1G20B 5JQGF 1MMFB 1F60A 1G4AE 1YDHA 2EZ9A 3MWEB 4QOIA 1D09A 3L02A 1N2IA 2HK9A 5E2BA 1WZIA 2XDQB 2BFFA 2BR5A 2I2FA 2VH1A 4UQLA 4BYMA 4LUCA 3SXUB 1EK6A 2JZCA 3Q41A 2BKEA 2IGTA 4GEGA 2COUA 2XUDA 5DXFA 3VKWA 2Z57A 4RULA 3GGGA 3L7BA 1J1UA 2CEKA 2CFOA 1TLTA 3PNBA 3DLBA 1YDEA 2JI9A 2G0AA 1I6KA 1ETHA 3AEUB 1WP4A 4QJ3A 3B89A 3P4UA 1W8IA 3PJEA 4NZYA 4KUHA 5GZ6A 3HKCB 2OO5C 2A5DA 2HPZA 3AI2A 4BMPB 4Q4CA 5A4FS 3KS9A 1LS1A 1VJTA 4G67A 2QPLA 3ZGZA 4RD0A 2QRUA 1BXZA 1SB9A 3KOZA 7MHTA 1QC5A 2JBAB 4EG5A 1GV1A 3SJ7A 1LRJA 3QYPA 1RRPA 1QFMA 3BXEA 4DJTA 3VVLA 4DWVA 2GD2A 1PNOA 1EX7A 2I3BA 3HXLA 1JZQA 3GLQA 4MHSA 3ZWCA 3C1AA 4B6EA 5GP1A 3VV2A 4GX5A 3G5MA 3INGA 1TO6A 2P65A 3REGA 2UVQA 3N2GA 1NVMB 5JDCA 1U2RA 3OIWA 2XECA 4LYDA 2NZJA 3S28A 3W4KA 1OU0A 2ECPA 1A1VA 2ICAA 3QVGB 3RS0A 6AT1A 4OLBA 4KQ2A 5L6MB 1GIAA 3GUZA 5ELMA 2GK6A 5IMSA 5JBIA 1I2BA 4M3NA 4MP8A 3FRJA 4FFOA 2F6RA 1DI0A 2P5SA 1JIJA 3CV3A 3ENVA 3AL3A 3Q6IA 3AV3A 4DR3B 4ID3A 1UDBA 1EVJA 4UM9D 4FNMA 1CF9A 2EHJA 2R7AA 2YMPA 3MCTA 3N53A 3AY3A 3DE3X 4A92A 1AO0A 1B14A 3HPQA 3MWFA 2GZHA 1IZ8A 6CHYA 2Y67A 2TSYB 3RV4A 4CIYA 3PGLA 3JQ9A 5D6NA 3SBXA 4Z4EA 1C9DB 2C4TA 2GZ2A 3H5RA 3M3PA 4L2IA 1KPGA 1CUDA 2BRUC 2FEMA 1Q16A 5AW9A 3R3SA 1FRQA 1RFGE 5J5AA 2AWNA 1MJGA 3GPIA 4D9JA 1RQ7A 2HRQA 4CTJA 1QG0A 2V9ZA 2DWCA 2V7QD 3TIIA 1WV0A 3T5TA 1NUPA 4WKCA 1GPBA 4QULA 5KQMA 1QDEA 2ADOA 1ZMOA 4IKPA 4KXVA 2FLWA 3THSA 3TW8B 3UOWA 3EN0A 1HDIA 4BN0A 4Z4GA 4M21A 2RGGA 4BQIA 4QFBA 5IUKC 3K92A 4MZXA 4A3SA 1UIRA 3REOA 4PSCA 3OZSA 3E7XA 3LT1A 3DMHA 2C7QA 4WPGA 2CXOA 5BQFA 3AJ8A 3QU7A 1SCIA 4D6YA 2WIBA 4IGAA 5AJWA 3RC2A 1JXOA 3CJTA 3GCDA 3EX7C 2RFLA 4PXAA 4OHOA 2C4WA 1IU9A 1P4JA 1YB2A 3ZQ6A 1YI1A 1Q1ZA 2J5RA 4KLNA 2PS0A 2TRSB 5TS2A 1N78A 4DQXA 3AFNA 4FUQA 2LCQA 4R6XA 3DLHA 3CH7A 1HDXA 3FOCA 3ZWAA 3RH0A 3EF1A 3KSDO 4U9UA 3TECE 1MC1A 1OILA 2J3IA 1SK8A 4AZSA 1VLJA 2VATA 5EWLA 4E33A 3HRIA 4RLHA 2QN1A 3IMGA 2XCIA 1A2BA 5ITVA 4HRXA 4H7KA 1KDPA 3SYNA 2N75A 5K5EA 3LY8A 1DPFA 5H4GA 5H81A 3ZR4B 2FSGA 3QOYA 1WUHS 3M49A 4MPRA 3R9WA 1EFDN 2A33A 3F5DA 3IIMA 3QUSA 2YV1A 3SZMA 1L4MA 2A1TS 4XGRA 2W6IA 1V6CA 3CF6R 3GDGA 1JS1X 1VLHA 2IZ7A 4Q0MA 3LI2A 4Y2TA 1EUDA 2ZAMA 2X0KA 2YWXA 3CLHA 1DEAA 4HNSA 4I55B 4LSGA 1S4QA 1MD9A 2H1VA 2VEOA 3ROMA 2R8EA 2PSDA 3VR6H 4Q6WA 4OGFA 3AU9A 3W5BA 3IIEA 5DFAA 1BKYA 4AO8A 1TADA 1BXKA 1EE1A 3B6ZA 3BXFA 5C7LO 4ZQGA 4PRLA 2HRDA 2BEWA 3ZGVA 4G81A 2LIPA 3QW2A 2CL6X 5IDXA 5LJIA 4Q15A 1G7CA 2QMYA 3FTCA 3EDRA 3CLRC 1JMVA 3BWYA 1SC4A 1KFCB 3D7SA 4H1VA 1D2GA 2MYTA 4ECEA 2XCUA 1KQFA 2OZLB 3BXHA 1A88A 3O8OB 5C53B 3GZNA 2GZAA 4J2TA 1YVPA 1JG4A 3HDTA 2FQQA 1TMYA 2HK8A 1XD2B 2L17A 1R8XA 2PRKA 2JFWA 3B9QA 1OV4A 1QTNA 2R11A 4KH0A 2ONJA 2Q3HA 4IKOA 3CISA 4OQMA 3HP1A 1KO7A 3PF8A 1LGYA 3PQEA 4MV3A 4U6NA 4UU0A 3WWOA 1P2UA 4R1UA 5ESRA 4B85A 1RZRA 1D1TA 1NF2A 2B4YA 4FYHA 1ORTA 3QJ5A 4IDBA 3UK2A 2GAAA 2QTBA 2PMKA 1TEXA 1NVVQ 1MW9X 2C3OA 3P2MA 4CKWB 2K6GA 4ZFNA 4KTTE 4HN4B 2VLIA 5F7OA 3AM4A 5TR9A 3O5AA 1CY0A 4H6PA 5FO1A 3RSLA 2QV7A 3LZ6A 4A0QA 4YRPA 3X1WA 1YRAA 4LV5B 3ZJ4A 1PJ2A 1B23P 3KLNA 2V54A 4IVRA 1PTJC 5JI3E 3IVCA 3PXEA 1JHVA 4WY5A 4JX8A 3KYIB 1R4ZA 5GY7A 3WOVA 2G28A 1T1RA 2FSVC 1VGRA 2F2TA 2AJBA 2FJ0A 4BTEA 4L02A 2W83A 4BAGA 3F0TA 1VL8A 2BV3A 4ASUD 1U2GA 1QHGA 3EZXA 2GF0A 1PWXA 4OQNA 5FXMA 2OV3A 4D6XA 4F6RB 3RVSA 5EHIA 2GXQA 2JAWA 1L5KA 4K1LA 2EFJA 1KR5A 3CTMA 3OAAA 3Q6MA 2HI0A 3K0EA 5LA6F 1QAOA 3IV7A 3WLFA 3IVRA 2A8YA 3NORA 1M7HA 1GLVA 5CEEA 3FDZA 2XSZA 5IAOA 2NZWA 3FWHA 1UADA 3GHYA 4E4RA 4ETNA 2OBFA 4M8NE 3I62A 1VPVA 3ROZA 1VHJA 2VDOB 3WA6A 2FOLA 3S2ZA 2EBUA 3H9CA 3RHTA 3AJEA 4K9DA 5EP3A 5DX8A 5HIKA 4BQOA 5FL7D 1V6SA 4J1NA 3UWSA 1KERA 5IXSA 2HJGA 2ZXEA 5ALQA 1G98A 2X1MA 2ZRPA 1D4OA 4YJHB 3VC1A 1UUFA 1YQDA 1RWWA 2A78A 3CPSA 1UMBA 3DEKA 4PNPA 1A4IA 5KAMA 3RFCA 3WIVA 2BFBA 4YRQA 4L8FA 3EG9A 3ELDA 2NUPA 2JBHA 3MT0A 1AGXA 4NCKA 1L6IA 1ILEA 5F51A 3N3BC 2PX3A 5LU8A 4O59O 5TEVA 5KYYA 3QXXA 3VVMA 4L5BA 5CVTA 1T2VA 3ZE1B 1H2BA 2O3RA 1TVCA 2CJXA 1V5EA 3H5OA 3KUXA 2QYOA 3LPDA 2VK1A 1K8XB 2MHCA 1X8JA 3CR8A 3VI4B 3R7DA 1DIRA 5HNKA 3NPMA 4PXSA 5IT9A 1V3VA 3V3KA 1U7UA 5DLPA 3RFUA 3QWAA 3EA5A 3WGZA 4YLYA 5A7GA 4DBLE 2AGVA 3SYLA 3H86A 2ZAIA 3T9DA 3EZ7A 4NXMB 1NAIA 1RZVA 2XMCA 3H8SA 3QWHA 4PRYA 5AOBA 2YDXA 3KB6A 4Z7JA 4ZTZB 1X1DA 1N6OA 5EXPA 1JJFA 3UH1A 3R0VA 4AUEA 1CF4A 5ICCA 2GCIA 5E9AA 1BRMA 3AF3A 1ZGZA 2FPIB 4RQUA 4BB6A 3L8FA 3S40A 3V33A 4B31A 1O7JA 4FBGA 3OF3A 1MT0A 2WWRA 3PIRA 3ACBA 5AW6A 1YRWA 4GMXA 3K8OE 1G3MA 1Q0RA 3NC0C 2FPSA 3V7UA 2ZKIA 3L0BA 4JODA 3W2TA 1NC3A 3A6LA 3KHUA 1UC5B 2BN4A 1LC0A 4CLDA 4D9FA 4ZTUB 3JD0A 5LLSA 1OH7A 5HRAA 2LTAA 1R0WA 4M76B 1H0KA 2OCKA 2XDAA 1PFWA 1QORA 1NN0A 5BRAA 3ZDBA 2V7XA 4CF7A 3GJ0A 2ODNA 3HPRA 3ZI7A 2I2DA 3AMVA 3UB3A 1PZMA 2CL0X 3ZJUA 3C6ZA 2D1SA 1VKOA 3PCTA 4QBKA 5JEEA 1PJ3A 4IICA 4FC7A 2VJNA 2YR0A 2XUKA 3E05A 3CUVA 3WDLA 4EB8A 3I2HA 3E9EA 2VJOA 3OBBA 1ZU4A 2OFWA 2WICA 5A0TA 5T5QA 1NXTA 1F0NA 4DSAA 2E48A 4YMHA 4XIYA 1M8PA 2ORVA 3WLOA 5I7SA 2DCMA 1ZXXA 1MO5A 2I4OA 2YOFA 3WDSA 2F9LA 3O95A 5E0KB 3O90A 3KOXA 3PKIA 1V8OA 4KIWA 5IW8A 2C96A 1OLSA 2NXNA 3WMXA 2UZ3A 1Q7EA 3I9V6 5E9JA 5E3JA 5JSQA 3GLIB 4KFCA 3EZ2A 3OEWA 3U7RA 1H4QA 4NZNA 4QT0A 4AJ9A 4DR6B 4LXUA 1MRNA 4WA7A 3KKKA 5CYFA 1GQQA 1PDOA 4H7EA 2FV8A 1H8HA 4UTNA 4U2CA 5KUTA 2WYUA 1Q83A 2VIIA 3MUNA 2OPHA 1Y0BA 4QOSA 1A76A 1SBZA 2C0PA 5JU6A 3HN7A 1I30A 1SGWA 1TMGE 2WAOA 2P2DA 4UULA 2G04A 3MNFA 1XROA 1SUAA 4ILKA 2CXPA 1W73A 4JLSA 1WW3A 3MT9A 1XZFA 5HXAA 3CC8A 2NU9B 5L45A 2I3DA 1E3JA 3H99A 4L7QA 3OOJA 4BFTA 5CDSA 1NP3A 4NCXA 5A2QA 3DZIA 1XZCA 5F1PA 5CB0A 1L7XA 3ZY5A 2FPKA 5M7EA 3X1KA 1DQZA 5KNCA 1DG9A 1ZGGA 3PDCA 1GGNA 1FUKA 3WSVA 5KS2A 1T9GR 4U3JA 1Y1PA 1GZHB 2C2YA 4B47A 2ET6A 1HEUA 1WUYA 1ZD9A 1M2KA 1HC7A 1OIVA 1XQ6A 3TQQA 1E4EB 4X84A 3WGLA 4F06A 2AWOA 4F5EA 4CMIB 4UUQA 1AF7A 1U31A 3ADKA 3JARB 5B2FA 1JXAA 1NR5A 2B8WA 5C35A 5IZCC 1QIGA 2ORWA 2O8NA 2ZTMA 4O4HB 4DV6B 4GKBA 4H3HB 3TNYA 1ZR2A 4CCYB 1XTTA 3L9XA 1TQ2A 2H3EA 3PEUA 1GP2A 3Q2KA 1PGPA 1T3HA 1VE7A 4LF7B 1QNLA 4BZZA 1CJSA 4QBGB 1E20A 4TT3A 3ODPA 4L0QA 5BSMA 2DBZA 1UJMA 2IE8A 1S96A 4AJIA 2JL1A 1PWEA 2RHOA 1L4GA 3U7QB 5EA2A 1ZMXA 2EP7A 1ZM9A 3DZKA 5JZMA 1ZDMA 2A30A 3H3JA 1GNLA 1ZW6A 2VRBA 3M82A 4UHFA 4UM8B 1DAHA 2BFNA 4HJXA 4MJ3A 2HCBA 2AX4A 2O0LA 3GJ7A 4LWOA 2ZRCA 3E22A 3QBDA 1AXRA 3VYTB 2D0IA 4BLTA 1RXEA 3MAAC 4QO8A 2QRNA 3P0IA 5KNBD 1SUSA 4ENUA 1RI3A 2R4QA 4M99A 6GPBA 4D9HA 2AEMA 2W8BB 3OZRA 3NI2A 4P58A 2YN2A 2XQGA 4LG1A 5JS8A 1PSWA 1RKQA 3CO5A 3JALA 3N2ZB 4TV9A 4UTVA 4GMDA 4XEHA 3WIDA 5FBVB 5FNVF 2WMNB 4UCXA 1UWLA 1NV9A 1G6OA 1Q7TA 2G8LA 1SXJD 1COWA 1R6VA 3VHXB 3GEMA 5JMOA 3GVHA 3LHDA 3ESCA 1Y8CA 5FTLA 3W6PA 3WV4A 4H1HA 1SHUX 4DLVA 5T3YA 2HIGA 3LQFA 1E2QA 3G5AA 4URZR 3R7FA 3EPHA 2XUOA 2WHRA 5MFZA 2X7JA 2JJQA 3UK7A 3L1KA 5KC8A 3DXYA 5KTRA 1DKLA 3WWZA 5BYKA 2Z43A 4TYMA 3IEMA 3P4XA 1J20A 2H11A 1R9JA 2JK1A 4HZUA 3RIXA 5BMVB 1ICIA 2BDEA 3RS3A 3G9QA 1X7XB 4WXMA 3AEZA 4LFCB 1F2UA 3RBZA 5C3UA 2VDWB 4CETA 1UPXA 2MCFA 3VJMA 2OK7A 2EKLA 4EPYA 1I7PA 1RPNA 3HEBA 4K9SA 1WY5A 1R0CA 1XDWA 4G65A 5CR9A 1EP2B 4XWTA 5EIBC 4NZMA 4GECA 2A14A 4HC4A 4IZ6A 4IXTA 5H02A 4GMFA 1SCUB 2HHCA 4JQYA 3H9UA 1XF9A 2D0OB 3TRHA 2X19A 1EE2A 1FYFA 3OJXA 2FG6C 2PVSA 4I50A 4IUDS 1SG9A 2HNKA 4MB0A 2ZT5A 4LZLA 4UDXX 4DCCA 4ZREA 3S1LA 4CTNA 1CZNA 4QZVA 1S2DA 3IBGA 3AKDA 3QKUA 2Z58A 4GYKA 3DW1X 4CI9A 4EUNA 2OZKA 3BCHA 5A6VA 4QJ5A 3M1IA 4R2IA 5K8TA 1PCXA 2PYDA 1JNYA 2QSZA 5HFJA 3IRUA 1VLVA 1V39A 2B4RO 5CMLA 4M0MA 3JX9A 4Q66C 2OYCA 1U2PA 4IG4A 4K9OA 4QOGA 1KMQA 3FNEA 1U99A 1J39A 1WB4A 3ANTA 4JI7B 2G9UA 1IPEA 1P61B 4AT1A 5JALA 4XUEA 1O9BA 1EJ6A 2PEZA 4YRTA 3AJRA 5EIHA 4BNWA 2I78A 4OBEA 4B71A 1FJXA 3T06B 1M1ZA 1RWXA 4AKIA 2FSVA 2DTEA 2ZTUA 3QXJA 3L1VA 4I2NA 1UR5A 3ULKA 4EYOA 3ZIDA 1TPYA 4JBNA 4B2IA 1KH2A 5HP4A 1E6KA 3NTOA 1B0ZA 3O4GA 1PX2A 2FG5A 4JKYA 3T1OA 1RAGA 2WKQA 1QH1B 3KPJA 2C1EA 4N65A 2V1UA 1NUSA 1WXDA 1KDVA 2ATCA 3ETDA 1H3FA 1YGYA 3KZNA 3O8BA 2EWMA 1IZZA 4X54A 5KTOA 2Y92A 5GV7A 3PLRA 2PBLA 1FUYB 4NCJA 4Q7LA 2NVUA 3Q5EA 4R9UC 3NJ4A 1G2PA 2RGDA 4CGYA 2VHZA 5EQJB 1J9GA 2NTYC 1BGXT 3O3MB 4IR7A 2I67A 1T4CA 5LD2C 2Q3CA 3FTNA 3AF6A 5DLDA 2VSFA 3AP3A 4EITA 3JYHA 3NBAA 5EXEA 4IFIA 5CB6A 1XYVA 2A9PA 2VRCA 3GQBB 4EA8A 1I13A 4I9GA 4AKGA 3I32A 3BBPA 3N8IA 5KCZA 1K6IA 1KU6A 1G8GA 3FPKA 3I9FA 2Z0MA 4QRIA 2GPYA 3B1JA 4RZIA 4WZZA 3WGMA 5B4TA 2FRDA 2VUIB 4KAXA 5BVGB 2XUZA 4XAQA 4C22A 2QP3A 4ZU6X 3GH1A 1PFGA 1OBFO 1ST2A 4XFKA 3ESBA 5JPIA 1LB1B 5F9MA 1FQWA 2VF4X 2Z2KA 2RC6A 4BVFA 1K4MA 3OT4A 2Y0BA 4CQMA 2R85A 3PDIA 4NP6A 5AJTA 1US8B 1WWKA 5G4LA 2EF1A 3NONA 3OLVA 2UV8A 3QPDA 1JVSA 3SX2A 4CODB 3A27A 2Q0HA 4BE4A 1SIOA 4NDNE 3ZYCA 2ZSBA 4H60A 4C6RA 3PNPA 4RIFA 2QQGA 5KNBH 1KL7A 1RXYA 1X86B 3RV3A 3WLSA 1CLUA 2FFJA 4J1SA 2KS6A 2AYZA 1T9CA 1VP9A 2ZBDA 3K20A 1M7BA 3A1EA 3QFTA 4XLTA 5EIEA 1O6CA 2PKXA 1GQFA 1B8UA 3V2HA 3BZWA 2O06A 1JH8A 1PDVA 1V7PC 4ILEA 2D1TA 3RUEA 3RBVA 3R3UA 1NDQA 3PLAE 3JYNA 5J2UA 2WM2A 4OAOA 5F9HA 2CZGA 4UEKA 4MGHA 1APBA 3JQPA 4KL8S 1U9YA 1H9CA 3GG9A 2GF2A 1MRZA 1VBFA 3HCRA 4YI5A 5IDWA 5LQJA 1O0CA 4KR3A 2O8EA 2A92A 1PLLA 5JS6A 2JFFA 3K1TA 1VI5A 1YCHA 4WLNA 3SOPA 4A8PA 4V0OA 1AQNA 2GMWA 1MB3A 1T0IA 1EFRA 2GJKA 3V5NA 4HT3B 1KSGA 5CDFE 1XUOA 1W36D 3REQA 4OK5A 1IG0A 4MXDA 3CLTD 5JJIA 2OP1A 4MTLA 3EGEA 5EXXA 1EZ4A 4TLLB 1SXQA 4IIDA 4M1TA 2V4ZA 3MJHA 2D06A 3CT6A 3IB6A 3OESA 4XVHA 4BASA 1FXUA 1H2XA 2JFNA 2IXFA 4BE7B 4D9BA 3EDMA 3BN3A 2ATIA 3EH1A 1J2JA 1Q1AA 2AFIA 4P4SA 3CW9A 4EM6A 2NU9A 5EFZA 2IOQA 3RAEC 4JI2B 4CF3A 4YQZA 2V5UA 4Q3KA 1H0HA 2LDBA 1FDTA 4LNHA 1KY4A 1XPUA 2R7KA 2C5EA 1V0JA 3SIXA 4U1RA 4AXXA 4F85A 4RH0A 1SBCA 1CV2A 2FDRA 4NBLA 3ZIUA 3KWFA 5HUJA 2O6LA 5EIBD 1E63A 3KVYA 1SKYE 4N5IX 1DOZA 5ELLA 1D6NA 4ZQEA 5HIIA 2V3CC 1RLJA 2EJVA 1JJBA 2W0SA 3ONDA 4CMIA 3AXTA 4ARAA 2YJ6A 3F5FA 4E13A 3ZDYB 1U28C 4P5DA 1EU1A 2AW3A 4JIGA 4M8LA 1EE9A 4IH9A 4UBJA 2X5KO 3C0KA 3B3GA 2WJYA 1ZA2A 4ABYA 4ENQA 5BSHA 1T0JB 2FUG6 1PIWA 1G9XA 3C1TA 4UPVA 1L1QA 1R5OA 3AKCA 4OJYA 1T15A 3W5AA 2AJCA 2BUCA 1JHMA 1RI4A 1TM2A 2J45A 2PX4A 2RHCA 4XRRA 4X91A 2V7TA 4PLVA 4RYLA 5LBTA 5IRCD 1O95C 1H9AA 1O0BA 1ZX1A 1QPGA 2VXBA 2WWWA 3K9LA 2TMKA 2FLKA 1QVWA 3O94A 4TKUA 3OA0A 4DWOA 4TWRA 1W36B 3U9TA 4PO1A 1HYEA 3HR8A 3T7AA 1N2SA 3W5UA 3X1YA 1MHPA 1DZ3A 3P9KA 3WAJA 1NBMD 5KKCA 3CZCA 4XIJA 3VPXA 2OKCA 3QEMB 1A9TA 1KMCA 1ZK2A 4RD4A 1FUEA 2PV7A 4FFMA 3RREA 2BCGY 4JVLA 2AR7A 2VDLB 2QAIA 1U0OC 3BTVA 5F2KA 4C21A 4PLCA 5J4KA 3B13B 1OC2A 2BFBB 2GO1A 4O4LB 1CUCA 5KYXA 4IZHA 3UT0A 3VXKA 2I22A 4RVHA 3DP9A 3AVYA 4MVCA 2ZJOA 2J09A 2JKZA 2ZJ0A 1P4AA 2DHCA 5J4LA 1BEZA 2HA0A 4HWKA 2QAJA 3ZVKA 3P27A 1XQVA 3GGCA 2V4MA 1ZRSA 1VPEA 4C7OB 4M88A 1GYQA 1Z39A 1C0PA 4K6OA 1ZAYA 2E89A 1TF5A 1ECCA 1BYUA 2ZYGA 3PFBA 4NICA 1G1MA 5E38A 1DKMA 4B6QA 3NGMA 5BV2P 3A26A 3BMCB 3WIBA 2HGSA 4NZOA 2WZCA 3TLXA 1O9GA 1XV5A 4UUOA 1PGNA 3ME5A 1QHYA 1XBTA 1UQRA 3G8YA 1DBIA 4XASA 4ZKDA 5KOYA 4TMZA 2ATEA 1FRNA 2ZQ5A 2JLVA 1F2UB 3Q40A 4WLUA 1SKBA 5ERYA 5BWOA 3MHTA 4FEEA 4NQZA 1V26A 1BGVA 1PNQA 2XGMA 3H8WA 1QE0A 3KPWA 4E94A 5K0ZA 4IOLA 1CJVC 3NHSA 1KP9A 1JT2A 2O7SA 4Z7NB 3DDWA 4XQGA 2BH2A 1PP4A 3CLTC 4YCAA 4BNKA 3A4TA 1D6JA 3OLZA 4J0EA 1SIBE 1VFPA 3KCQA 4RHYA 4I50B 5J5VA 3SMVA 4R83A 4J16A 3JQFC 5E6SA 3Q2IA 2WFLA 4G5QA 1GTSA 5ELXA 2HMAA 5H0IA 4OAPA 2D8MA 1KKLA 1OXMA 1REQA 1T2DA 1Y9AA 3DZHA 1GUDA 5TIIA 1U2DA 5KNLA 3UJ3X 1W4LA 3BXPA 1MB9A 2AN1A 1WPXA 1HT3A 4AM8A 2E5FA 3UHJA 4B1FA 4AZ0A 3P9YA 4Z6KA 1Z8FA 3IV6A 3DVQX 3S44A 5A0FA 4ZCTA 1Q0HA 4FOTA 4P93A 3HCEA 4TMWA 1DCMA 3BE5A 1XTRA 3PBKA 3KKLA 2EJUA 1F2DA 3RJTA 3HJNA 1KSFX 2YICA 3V97A 1TCBA 3CE6A 1RWMA 4OMFG 3FYHA 5K0NA 1NU8A 4JJ8A 4CIDA 3M5WA 3IV9A 1PYDA 4FQ5A 2RB5A 1ADBA 2I54A 5EUQB 4WOPA 4OGGA 1EWKA 1OV6A 4PCLA 2VDRB 4P98A 4LSWA 2XVXA 3RS5A 1QS0A 2JCGA 4C88A 2CUKA 1WXXA 4YS6A 2OWDA 3FMIA 1VBMA 5SZHB 1AZWA 1SRQA 3PFKA 3RS2A 4ZMSA 3EPLA 1KAGA 3ONEA 3K05A 5KEIA 3FX2A 2GGSA 4X8MA 4BVLA 3ZNNA 2FN3A 4NE9A 1P9RA 2ONYA 3ZHCA 4AJ2A 4WRRA 2FPGB 4FSDA 3VU9B 4CT4B 1Z8DA 1OMOA 3OFNA 1KVRA 1BS9A 3VTZA 2XV1A 4E2XA 1ONSA 3UPTA 2GJAA 2FF7A 2ZE8A 1JHAA 1GOTA 5H4HA 1KTIA 1BSVA 3G2OA 3CONA 3OIYA 3H4MA 2OZEA 2EZ4A 4X8LA 5HIJA 3UQYS 5DOVA 1KP2A 2O3SA 3A9WA 3H19A 2QD4A 2ZT7A 3DBHB 1HFJA 1UFRA 1ZL2A 4J90A 3GP8A 3SHVA 1AT1A 1JQKA 3N7TA 4ZXFA 1Y9JA 4G0XA 4KYVA 2GKGA 5DN9A 1SU4A 1V3TA 3PC7A 4MRPA 4UE2A 5BXQC 1PF7E 1UM9A 1T8SA 5B37A 4BMZA 2BUBA 2WJVA 3WIEA 3M0EA 621PA 2PUVA 1WVGA 3DV2A 1V2GA 2A9RA 3PUWA 3KFLA 6NULA 3B5IA 1IUKA 1ECLA 1POWA 4CQMB 1NX6A 4Q24A 1H6AA 4GQIA 2JIOA 4OI1A 1M1XB 3HACA 4HNVA 3LUJA 2ORYA 2XT6A 2NIPA 4X20B 1WPRA 5C4MA 3EY4A 1V9CA 1TJNA 3ZBTA 5JOQA 3MWKA 4H16A 4DT1A 5JWHA 4C7OA 3GFRA 4JYCA 4K9QA 4TWZA 4D8XA 1L5YA 1H6CA 1Z15A 4MYDA 1NYTA 2NO0A 2OY0A 3K0BA 4KMSA 4F84A 3FPHA 3MPUA 4QGSA 2HH9A 1N5DA 3OOHA 1JLLB 2OHGA 1RJWA 4R0VA 1H05A 2QVCA 3O0TA 2OILA 3FDFA 4H3SA 1D2NA 2Q2OA 3I6IA 4JWTA 3DE1X 4Y1FA 3ZHBA 3GLFB 2HSJA 2PUWA 2FRDC 4ZN6A 2OZVA 3LO5A 1NSYA 4M38A 2P69A 1GPLA 2HTEA 3IUBA 3ED1A 2Z56A 1NOJA 4PZAA 2G1AA 4MTCA 2W2QA 2OK8A 4AJNA 2L18A 2XADA 5FUYA 1SCBA 1W581 1AHPA 2AE1A 4YAIA 4BQNA 3BMNB 2VA8A 3OU2A 1FSFA 1IHDA 3RSCA 1JBQA 2W6JA 2Y6UA 3DT6A 3UMBA 3AR8A 3NATA 1A2KC 2QXYA 2R5WA 4HDSA 5FBHA 3O8OA 5I9IA 3AVTA 4EHNA 1S2GA 2YCBA 3X1DA 3ORQA 4B4VA 4RH1A 1WVIA 5A03A 3WHLA 1PVDA 1NL3A 5LZ9A 4B82A 1ZONA 4PHFA 4K87A 1N0IA 1JG7A 1UZAA 4KG7A 2JA2A 3R77A 5E3HA 3WL5A 2Q5EA 5HW0A 2ZIWB 3K9BA 1T0HB 3VNVA 2FGJA 3NDRA 1XDZA 1KEUA 3JV7A 2LD4A 3TSOA 2C4KA 4MARA 3LA6A 3I6MA 4CKWA 1N2GA 2PS9A 2FWNA 1YB1A 2Q21A 3AIKA 3MPOA 1C0IA 3RJ9A 3U4MA 4C0HA 5IH7A 1E2GA 1CCWA 3KKMA 1T5IA 2H57A 5K3CA 5C32A 1XNHA 4ED9A 5HRCA 3FJ1A 4OA8A 4JJIA 2B99A 5JXWA 1NMYA 1T4MA 5K8IA 1PK8A 4ZQBA 3E2PA 2VDVE 3GCZA 4REMA 5JAPA 2R9VA 3O8QA 4BU1A 5FH9A 4OATA 1KAEA 4TM8A 3OZFA 4MICA 1ZXLA 3EWAA 1PJCA 2FXIA 4M55A 1S8NA 2Q41A 1UWCA 5CCBA 1U8AA 2QW1A 3COWA 1ZD2P 2M1ZA 2RH4A 4JR2A 4GP9A 1GT6A 1LSOA 2JCBA 1LPNA 3B1VA 2PT5A 3HRHA 1KHTA 3D8TA 3CNOA 3IJRA 4P2BA 3RVQA 3IELA 4XUDA 4URWR 2P75A 3B9RA 2GBLA 2XRYA 3DCIA 3O47A 2BGNA 1YFLA 2QL5A 3BD9A 1TKCA 2SCUA 2IYYA 3HFJA 2QDKA 3KZXA 3R3VA 4YB8A 2VSOA 5E1DA 1LC3A 1YU9A 2J41A 1EIZA 2IIBA 5JNSA 3U3JA 1EXDA 4ZAZA 3PRHA 3RUDA 4B40A 4HMOA 1POXA 2H5IA 3FSGD 3WP0A 5BN4A 4RTRA 2B5OA 5I9NA 4KR6A 3W05A 2R79A 2D8AA 1H2ZA 1FA9A 1N8SA 4Z4IA 1ZD3A 2LCFA 1ZIYA 4XM0A 3RAGA 3TVTA 3UKDA 4HP8A 1NHWA 1JHZA 3EFEA 3L49A 4L7VA 4R31A 1QRDA 2E3JA 3PC6A 2GN4A 4YC7A 4E14A 5KU7A 5HJ2A 2P2SA 3M81A 2B92A 4FFSA 1J8VA 2NVUB 2HV9A 4AF6A 2VJCA 1R6XA 4C2UA 4CHGA 1TL7C 3TUIC 2VS1A 3ZU3A 1G8JA 4YFYA 4DB4A 1LVUA 2Z8YM 1XHFA 3EEYA 3S7TA 4CKXA 5SZJA 2ONZA 3SXJA 5LM3A 4ZALA 3IXQA 1T4CB 1UFOA 2A9JA 1VRVA 1XQYA 7YASA 3EGOA 1XMOB 1GTL1 3DS8A 2H1FA 3O2QB 1F7UA 4J2HA 2X9GA 3DVAA 3F7MA 2BFFB 2V5AA 2KLHA 2GF9A 4D44A 3S1SA 2COEA 2D74A 4BV3A 2PH1A 3O8RA 4NESA 3L4BA 3ZZNA 3ZE6A 3FHTA 3KCNA 3OFJA 4LOKA 5BQ5A 4YUAA 4KMOA 4R0NA 5CVVA 1DCKA 4HUTA 4KHZA 2JFGA 3C7KA 2L69A 1Q44A 3SJBA 5BNWA 2G9QA 5H16A 1JDSA 5JNRA 4NAHA 5SICE 2OB2A 3U6BA 1Z5OA 4ZK6A 3JQ7B 4HEA6 1ZUWA 4Y8VA 2WFLB 1WBDA 5FQOA 4TGLA 1B0PA 4HDRB 4P6VF 4G4SP 3FYUB 1EXWA 3V8MA 1U7WA 2W2KB 1ZEMA 2XI4A 5EGNA 4HX9A 1UBGA 1NJ2A 3SN6A 3QKSB 1Y5IA 2RHGB 4PG6A 2RGBA 2V59A 3VR3D 4RDHA 1GL3A 1CRPA 1JTEA 4IINA 4IIGA 4ID9A 1G5QA 1YBMA 2K7ZA 4JT9A 3CVYA 1BDHA 4D8UA 3M89A 3HKCA 3QBVA 1YU6A 2CFCA 3NP7A 1XLTC 4PV7A 4OIMA 5HUQA 4LF8B 3NV9A 4C4XA 3L41A 3LVQE 2XVYA 3FVTA 4N0EA 4TMTA 4MWOA 4Z0PA 5KWIA 1KC1A 1CP2A 1THMA 2CKDA 1L8LA 2XLCA 3LXUX 4IY1A 4JSRA 2WABA 5DM4A 3U3OA 4UCQA 2P9GA 3CSSA 2CHVA 1MKYA 1YK1A 1E1DA 1YNOA 1K6JA 2IUSA 4RVNA 1DHRA 5B58T 1H2YA 3IJPA 1ULZA 1M6VB 4OB6A 3MUOA 5IYZA 3RUCA 3AUSA 5H3LA 1ZU5A 3WI7A 2FSPA 3DUFA 1D8TA 2Z2YA 4WFIA 2UU9B 4H31A 2NTJA 2V5VA 4XLZA 3URKA 1A3CA 4BKQA 4DEYA 3UCFA 5C8XA 1USIA 1RYMA 3O0DA 4K86A 5TE9A 4ZYZA 4A5SA 1REQB 1MGOA 3B1FA 3H2YA 5H59A 3ENZA 2W9XA 4D79A 5JNWA 5TC4A 2PMBA 1JEOA 1LK0A 4XX0B 3SDZA 5JCPA 3WJ2A 4BFZA 5EP2A 3DH0A 4C43A 1JKIA 4R16A 5KWSA 1ENZA 1KXZA 4ZZ2A 4MQ5A 4Z4QA 3T3MB 4O3MA 1B00A 4CIWA 4DTCA 1Z74A 4POOA 3L8HA 1NJ6A 2IDJA 3WLNA 5I7WA 5GONA 4WVFA 2ZRGA 1CY8A 3FGOA 1QRSA 1C1YA 1MQAA 4ALJA 3EVDA 3MGGA 1K8YB 5K99A 2B9VA 2QR3A 3HBMA 4OP2A 4ZDWA 3ZHVA 1OBCA 3PEEA 3BGDA 4MK4A 3F9IA 4PE5B 4AJ1A 2J7PA 3FBWA 1NY6A 3AR4A 3ICVA 3BJEA 4FN4A 2IYRA 3K5IA 4CM7A 4JLOA 3JARA 1ML4A 3FUCA 3PFFA 1AB5A 1JECA 3TUZC 1U0JA 4EKYA 3CF4G 4Y9DA 3D54D 3PXDA 4RW0A 3IBTA 5CXUA 2G9NA 4MMYB 2VPIA 4EEKA 1QIFA 4FS8A 4TUYA 3MRTA 2AEJA 4RK0A 1EWTA 4W7IA 5LC1A 4MW5A 3V7WA 5JS1A 3NBFA 5HEKA 3QU4A 3PNQA 5A1JA 2QU8A 2WJHA 1XXHA 2AK2A 3QVTA 3ZHSA 4BO1A 2KLBA 3GPBA 4MI9A 2G4VA 2ZXFA 4PYOA 5L6LB 2ZRQA 3ETGA 3WA7A 1DO8A 1XJQA 1EQUA 4RK5A 1YI8A 4J6EA 5JAQA 1Z4MA 2PFSA 2OORC 2WJPA 4MRMA 3HSYA 1PTJA 2I2CA 2WB4A 1S1MA 4B80A 4CRWB 1GKKA 1ODCA 1SG0A 2VP4A 4PO9A 4CF4A 2OP0A 4IQ8A 2NV2B 1YB5A 4BQFA 2AQHA 3ZE0B 3A4LA 1SXJB 1FFAA 2BGJA 1RTKA 2J9XB 4JC5A 3KQYA 1Q7CA 2V6MA 4OQXA 4S1PA 1ZN8A 3TFQA 5F5XA 1EFKA 3RT1A 3SX4A 1JQ5A 2B7BA 3DL4A 1NBOA 4NU8X 2PJUA 4L3OA 2YRXA 3WC4A 4L75A 4G1FA 4G8BA 4IIBA 4DIBA 2OT3B 3SHOA 1X8KA 3TTVA 3GD5A 2JGIA 4IMJB 1ZUNB 3UXEA 1TCAA 4IIHA 2JRCA 5FDFA 1UT6A 1HYBA 1ZHOA 1OAAA 1WM1A 2J6CA 1ZUIA 4JBYA 2JNWA 2HWKA 4MVJM 1UMCA 4Y7DA 2VLBA 5JVDF 1Z29A 4MUBA 1VTKA 5A3VA 4OXQA 3KLMX 3ROFA 3RUPA 1CFZA 1VRCA 3I30X 4IH1A 3VVCA 3W9YA 1TU4A 1R4MB 2ZATA 2HU5A 3LIPA 4NSNA 3TTUA 4AS1A 4X62B 3HGQA 4KLZA 4C7MA 2UYHA 4OHZA 5C18A 4JLMA 4LBVA 3IHWA 5KWEA 3N8HA 1RM0A 1C9JA 3U7HB 1GNRA 1TW3A 4IG9A 3PR2B 2P1ZA 4F72A 3K7EA 2H5LA 3BS4A 3AETB 1NN3A 4V0QA 1RIIA 2OBLA 3P9PA 4KMRA 4QHTA 3R3ZA 3ZJ5A 2WU3A 5FCDA 4QUBA 1NLUA 1RP1A 3HCAA 4R5MA 1GXSA 5FI1B 3Q8LA 3GVCA 5FB3A 4DCVA 1RKVA 4GG1A 5DTJA 3TXAA 3EIQA 5IBPA 4L3VA 1FU8A 3A4MA 3PQDA 3KETA 4ZVQA 3QTBA 4MUAA 4NL4H 1V43A 3NAMA 2DLNA 2IQ5A 4NBVA 5JATA 1RIFA 1TYAE 4Y6GB 2VKTA 4BP3A 5CFLA 5ALRA 2X58A 3EFBA 5HTKA 4HX5A 1D5WA 3ACCA 3FHJA 4HH4A 4OO3A 2BL4A 3BRWA 2GLXA 1SQ0A 1XEWY 2Z8ZA 3QVJA 3SQLA 4B44A 1KWGA 4D0RA 5HE9A 5I7HA 1KEKA 1U65A 4LHEA 4PZZA 2O4UX 4BNVA 2GSWA 1KDZA 3FNGA 1L1RA 4AN4A 2QZZA 1KYZA 2GAJA 4HBZA 2E37A 2OPBA 1YS4A 3LUBA 3Q5DA 4DG9A 1YQQA 4GPAA 4X41A 3FZGA 4LOIA 1E2LA 2CV0A 1E79A 1CZLA 3NLLA 2D2XA 4QAQA 1KI6A 3B7WA 5F7XA 1P6QA 1EJ2A 3DTVD 5DLYA 5KYUA 2WB2A 5LQNA 3CN7A 4D6PA 2CV2A 1Q0TA 3HJFA 5K4GA 3OTOB 3D8SA 4F3TA 1UDAA 3U7FB 1ZH8A 2CD9A 2BR3A 3H83A 2P4UA 2QTMA 1FW6A 1SVNA 1Y5LA 1OTYA 3I28A 2B1QA 1UBSB 3VZQA 1FRZA 2F3UA 4PIMA 3QVKA 3OQIA 2EHDA 4K6MA 4FYVA 1KQOA 4ZEOA 1EYZA 1N6RA 4DIUA 2Q3FA 3RDPA 4P0TA 4UVIA 4JH0A 6YASA 4H4EA 4EG4A 3HI6A 5B53A 3CX8A 1H94A 3WG9A 4GKAA 3D8RA 3LGXA 4U5XA 3AESA 2G71A 4RTNA 2ZITA 4MW0A 3GLHA 3A7EA 4GKVA 5D1HA 1CU1A 2GCOA 4LJ5A 1NW9B 1SN7A 4JL5A 5DNUA 4KAJA 4R40A 4YN3A 3KOMA 3TQIA 2DKOA 4QLBA 1LDEA 4YO8A 2WFAA 1SXPA 4CDGA 2VK2A 2ZUBA 5ER6A 1A5SB 1FDWA 5KTTA 4RQTA 1RXVA 4P3NA 1LI4A 2H7YA 4I3GA 5D5QA 1A5ZA 5IAEA 5KYWA 1EFPA 4ZI5A 1A9RA 3ORFA 4FTWA 3WK7A 4Y6SA 3FE2A 5FOVA 3P9NA 5BSRA 3PC2A 3PCXA 2DTDA 3R0ZA 1WQ4A 2B1GA 3P2YA 5AHXA 1AKVA 5AVVA 3R4VA 5CT8A 1JSLA 4Z0HO 4EGJA 2UZ1B 1BHO1 2EU8A 2X42A 3TZKA 1SCJA 4V0MA 3WMFA 4KPUA 1FDOA 3IVMA 2AN4A 4BNMA 2ECFA 2H2WA 5DGCA 1VG8A 1XN1A 4DJEC 3EZ6A 2PLRA 4FI3F 2ZUFA 4TYPA 1DCFA 3Q3GE 3GR6A 3OMXA 3ZIAD 2HSZA 1IY1A 2G9RA 4BUCA 4TKVB 1M8FA 1NIJA 3TRIA 3SP1A 4CMEA 3PEFA 2A7QA 2UXCB 3D64A 2ZDQA 4QG3A 4CM4B 2J7PD 3ZDCA 3EVTA 2ZSHA 4LRUA 3ZBQA 3J7AC 2HHJA 3U4QA 5B1IA 5KNDD 5C8VA 3VKVA 1KBZA 2NVBA 1QZUA 2BM0A 2FDXA 3A1TA 2FW9A 2OESA 1XMSA 2DQ4A 2NXJA 3G2IA 4QU9A 4RL6A 5JXIA 1B6SA 2FX3A 1YWGO 4BL5A 4CMKA 2K7FA 3RIYA 3AYXB 4J0FA 1C14A 4YJKA 1LUAA 4NV0A 4UW9A 4AUKA 1V7ZA 3LDFA 4MQLA 2AXEA 1DBRA 2VSNA 5KTSA 4ODIA 1NFFA 1Y82A 5TB5A 1NLFA 2VCEA 1HRKA 2RAPA 3HYCA 4KNWA 2BM1A 1RWNA 2BSXA 2NNWB 2PGIA 3LQKA 3N5CA 4U7PB 5G4KB 1WW2A 1D0VA 4PTZA 4EGAA 3EA4A 2O7QA 2WKWA 4GI7A 4DQLA 4BLPA 2FW7A 5FUWA 4J4HA 1Z0UA 2HC9A 1EDOA 2GYYA 1JMKC 2GVZC 2IXAA 1NNEA 1Y7TA 3CUEF 4LRYA 2FSIA 4CJXA 3MW8A 4TT3D 3W4IA 5GONF 4WBNA 1OPRA 4Y9TA 2XBUA 2WHPA 5CURA 1N5OX 2Y1DA 2R6AA 5CIQA 4DWWA 3N2LA 3M4XA 5BYJA 3EPPA 4F2PA 2R8BA 2NOAA 5C7YA 3ZV6A 1OU4A 2YIVX 1PJRA 3TDNA 1Z2NX 4Q4HA 4TXLA 4QYXA 4DLKA 3PNLA 1Y81A 5E8RA 4M0LA 2YUTA 5AUPB 2NO6A 1BXRB 4QTYA 1II0A 1I1OA 3NG1A 1TMKA 3VO1A 3OZUA 4KI7A 2QQ5A 3LKZA 5EWJB 2DG2A 2Y76A 4R3NA 3Q7RA 4PGFA 2PUTA 3B6IA 3F6YA 3IP6A 3SOZA 4B6SA 5K05A 2O8FA 4BAUA 2PKEA 5CLFA 1L4BA 3AILA 3AR9A 4GEKA 3P7MA 4YPVA 3SR3A 4AY6A 5B1YA 3OQIB 3FAKA 2O1SA 4FB5A 2SCUB 3P0JA 4Y2RA 4V0ME 4A26A 3IT2A 2VJKA 3ZXSA 1II8A 3PQ6A 1V11B 4TPKA 3T5PA 3CB4A 1PVOA 3O73A 1HURA 4LJ9A 2ACWA 3CT4A 3K9GA 4WEQA 1R4NA 4TXHA 3K0AB 4CEHB 2BEVB 1H8HD 2IOHA 2ODQA 1CS0A 4LVUA 1XZPA 2I99A 3GJ5A 4AG3A 3TE7A 1T2NA 3Q0EA 1V3UA 1S6YA 2BY4A 2IDZA 2ZIEA 2MSDB 2BJVA 4EAQA 1AO3A 4FKZA 3I83A 4MIOA 4OYYA 2F3QA 1AQUA 4RX1A 3ADDA 2B78A 4BP9A 5E9QA 4CHTA 1H5UA 1YJ8A 2EFGA 3H0EA 4MUKA 5L3RA 3TOCA 3WTBA 2WJZB 3L6RA 3S4YA 4C7KA 4QUIA 4UC0A 1AK1A 1EWVA 3VDNB 1BHJA 4YGXB 2WQ6A 5KVVA 2Q5CA 4AJ4A 5DDIP 4I2VA 4ZQIA 1DC5A 4IRUB 4PU0A 2Y05A 3TL3A 4QGFA 1YMQA 1R0YA 5FR1A 4MGIR 3IKMB 5IVKA 3E81A 4R1PA 3R7BA 2FDCA 3NYQA 1GY8A 3RKRA 3HY6A 4MVJA 4BMCA 4CIVA 1CQZA 3IMFA 2QTGA 3A4IA 4ERXA 2C97A 4JFRA 1QSGA 2IDKA 3S3TA 5CLLA 5IK2D 4O29A 4GC9A 3I53A 5DYYA 1R50A 1GZ4A 1VG1A 2YXLA 4QU0A 3TD6A 4M7RA 1LV8A 3DMYA 4HYTA 4YQYA 2O48X 2GOYA 1ABEA 4EO4A 1CUWA 4GR4A 4QVKA 4C6TA 2WYVA 1JEQA 4BHTA 1GU7A 3DAOA 1HT2E 3QVXA 1FNMA 4YPOA 3C6YA 1MB4A 1Q3HA 1Z4NA 1NRWA 2QG4A 3GLKA 3HKEB 3I9JA 3VUEA 5IPFA 2P9HA 3DBVO 1J5PA 3QENA 5AKYA 1GEEA 2YWHA 1W2WB 1TECE 1CDOA 3UENA 3C3CA 4Z86A 3PRKE 4TTVA 1BJRE 4TS9A 3UN1A 4P35A 2XE4A 2AC4A 5DI3A 3LFTA 5KKNB 4ZRNA 3A2LA 1RZUA 2E9SA 3HDQA 4LAFA 2UUBB 1KOGA 4MUIA 4TV9F 4YRBA 2CF5A 1YR8A 4Y2VA 1OX6A 3C3DA 4GPIB 5DYGA 4V0SA 3SICE 1QQBA 1D2HA 2XRFA 1SIUA 4KK3A 1EIWA 3BWMA 3KEQA 3F4BA 4Q01A 4UUBA 2YFHA 4IOKA 2FA9A 1MO3A 2Y1GA 2IZ1A 1QQ7A 1OI3A 4E11A 3BWVA 3G23A 3GJSA 3RU7A 4DHEA 1S3SA 1YONA 4X7MA 1WEKA 5JANA 1MZPA 3GJYA 4X85A 4RPCA