1EHCA

Structure of signal transduction protein chey
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
128
structure length
128
Chain Sequence
b'ADKELKFLVVDKFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHEY
publication title Uncoupled phosphorylation and activation in bacterial chemotaxis. The 2.3 A structure of an aspartate to lysine mutant at position 13 of CheY.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signal transduction
total genus 47
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 1996-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ehcA00
1QMPA 3CKMA 1OXBB 1VLZA 2GX6A 4DN6A 5TPWB 1HEYA 1D4ZA 2IPLA 1TJYA 4OTZA 4MR8A 3Q41A 3F7NA 5FBHA 1BDIA 1DG9A 1R8JA 1URPA 5DCLA 1JLKA 2FMHA 3EJWA 4WXEA 4KVFA 3NNNA 2E4UA 4RK5A 3IP6A 4RY0A 3N6VA 4IRXA 3O2JA 1JL3A 3FMVA 2QSJA 2L18A 3NHZA 5JS1A 2PUFA 3C97A 3O2SB 2M98A 1DC8A 4PE5B 1NXVA 4ZYLA 1M2EA 1Z2EA 3I42A 3HV2A 3LMKA 3G1WA 4KQCA 4H3HB 4G97A 4KK3A 4KFCA 4MGEA 1LJUA 2FN9A 3C3KA 4MR9A 4RDCA 1PNRA 3H6HA 1JF8A 4WWHA 1EWVA 3HSYA 1D1QA 3I5AA 5GOTA 3TO5A 5JNTA 1C4WA 5DGCA 5TQ2A 1YK1A 2MYUA 3ILYA 4MR9B 4EVSA 1DZ3A 4XFKA 4CBVA 2R4QA 2GKGA 3QLVC 2LPMA 5TQ2B 1APBA 2NZUG 5CNIA 3RVSA 1WETA 4LDZA 3C3WA 1DP4A 3KYJB 1JWLA 2QXYA 4MRMA 4G0ZA 4W5NA 1NXTA 3LUGA 3H5IA 5EWMA 4MQFA 3MA0A 1VRVA 4FE4A 3KJXA 3MIZA 1S8NA 2YHBA 4MRMB 1Z18A 5CNKA 3OQMA 2H3HA 4XXHA 3N75A 3LUFA 1QKKA 1DBWA 3KG2A 5EWMB 5C5EA 2GI4A 3IPAA 4EVRA 1PUXA 1K68A 6CHYA 1GCGA 2E4VA 3IP9A 5JS2A 2NT3A 4F11A 3HM9A 3EULA 1FFSA 3BILA 3H5LA 2HQBA 4YP9A 5JNRA 2JVKA 3ROTA 4OLBA 3O21A 3VNAA 4ZMRA 3QX9A 1DBQA 1YS7A 3HDGA 3LOPA 4WXMA 4RK6A 3K4HA 1D5WA 4ML3A 4G86A 3SQNA 3TX6A 5D2CA 5BRAA 4LE0A 3RVPA 1E6MA 3EGCA 1D2AA 4XARA 3GRCA 3KTOA 2VUHB 2PAFA 3MMNA 4GNRA 1LBHA 2NT4A 2DRIA 4IMJB 3GWGA 3M6MD 1TLFA 4WUTA 4NQRA 1ZGGA 2QZJA 1NATA 3CS3A 4WT7A 2V0NA 1M2FA 3GT7A 3NNDA 2FKAA 3O1JC 3TB6A 3H5WA 3I09A 4Z9AA 2IYNA 3EDCA 2PL1A 3H5OA 2WJAA 3L6UA 3CLKA 1NY5A 1MB3A 1MVOA 4N0QA 2B1JA 2R48A 4YO7A 1RPJA 3QLUC 1Z15A 4N0PA 3CTPA 5DLEA 3S99A 4Q6BA 1EHCA 5HSGA 1Z12A 1ABEA 3RQIA 2ZAYA 1Z17A 1YVUA 4G0PA 2VK2A 2JCGA 1IIBA 3O1HB 1RNLA 4GPAA 4HYEA 4YWHA 4JB0A 3SAJA 3OQOA 3O75A 5IUJC 1W25A 1YTUA 2FQXA 1ZY2A 3N8IA 4RKRA 2LP4Y 4Z99A 3B2NA 3NNSA 2QV0A 5KQMA 1QO0D 3E61A 1EFAA 4H60A 2XDYA 1ZH2A 1BA2A 2WMYA 5IX8A 5IEJA 2W42A 3MYYA 5TE9A 4XLTA 3FGZA 3IDOA 3EAFA 3FFXA 2PUDA 1DCMA 3ILHA 3JS5A 4PYRA 3OLXA 2RJNA 1ZAYA 2L2QA 1JDNA 3R0JA 2HQRA 1JYFA 3L49A 4FB4A 5BRJA 2JVIA 3OMWA 5KWSA 2PUEA 3MM4A 2HQOA 3KYIB 1XWWA 5JNUA 3OM0A 4Z4IA 3N53A 5HM6A 1Z2DA 5FBKA 2FSPA 5HQJA 1JX6A 4MAAA 4F06A 1CHNA 4JASB 3LUKA 4PICA 1A04A 2OENG 1DCKA 2IDMA 2IPNA 5TQ0A 3HVRA 4RWEA 1F51E 4RY9A 1RXEA 3T95A 4F12A 3F73A 3JVDA 3OO0A 2JRLA 4G0XA 3FFTA 3CZCA 5EWJA 4F3TA 5ABPA 2RJOA 1MIHA 4N03A 2NZVG 5TQ0B 1FFGA 5EWLA 5KQGA 3A0RB 1BDHA 3UK0A 1M5TA 1BVHA 2GBPA 3FDFA 4LX8A 4QYWA 5JNWA 3H1EA 2P9HA 5EWJB 2FQWA 3KLOA 5EWLB 2PUCA 2WWVD 4ZJPA 2RDMA 4O1HA 3KS9A 3D8UA 2A9PA 6ABPA 1I3CA 2CHFA 5GQSA 4MYRA 1QPZA 1ABFA 4HNRA 1YIOA 5TPZA 3HK2A 1ZDMA 4RK7A 3KLNA 3NHMA 4TLLB 3CU5A 2FEPA 4IGAA 1NXWA 2FEKA 5E3JA 1XHFA 4MQEA 3CHYA 3K9CA 4Z4GA 3RVRA 3JTEA 3O1IC 4TN5A 5T7BA 3A3KA 2IOYA 3MF4A 4KRFA 1E6LA 4RK4A 1K66A 2J48A 2PUGA 3QLTA 4Z4HA 3OLWA 3RVNA 4MQEB 4RSMA 3RVLA 3VNBA 3F6PA 1SXHA 2A9OA 3GL9A 1USIA 4NCBA 3NBMA 1NXSA 2JBAB 3QLVA 4KPYA 3LKBA 3CRNA 2WJWA 5CNJA 3LUHA 3HXMA 4NCAA 2VYCA 4YR7A 3HCWA 5KQLA 5F64A 1DC7A 3BRQA 3Q7SA 4B09A 5FWXB 2CD7A 1NXOA 5FWYA 4QYMA 2FLKA 1MB0A 4OBBA 4MLDA 2IPMA 4YV7A 7ABPA 1BAPA 2A9RA 3M9WA 1Z16A 4JA2A 3DZDA 5KC9A 2LIVA 3OLYA 3EODA 1NXPA 1U04A 5FWYB 2FW0A 4KNYA 2YHAA 3CZ5A 4LE1A 1TM2A 4RKQA 1T34A 4PZ0A 3QEKA 1AB6A 1JH9A 4L85A 3Q15C 3OQNA 2F8SA 4Q6WA 4KREA 2FQYA 3C3MA 1B00A 2CWDA 4S04A 1U2PA 2B4AA 1SD5A 3GYBA 5DTEA 1DRKA 1U8TA 2FN8A 1OXKB 3P9YA 1Z26A 3BBLA 2QVCA 1RXIA 4M88A 2IKSA 3G85A 1A0OA 1ISRA 1SXGA 2AYZA 2E4XA 5B3JA 3QEMB 1TVMA 2MSWA 4LZLA 4MS3B 3T6KA 3QELB 3LFTA 4FE7A 1AB5A 1YMVA 3JVIA 1PEAA 2E4YA 2FMIA 2MYPA 4NICA 2R47A 4UHJA 3D02A 4G0QA 4Z4FA 1A2OA 2QR3A 8ABPA 1ZESA 4QPJC 2X7XA 1E2BA 3MQ4A 1QP7A 1JYEA 3JY6A 4NV3A 1GUDA 5TQJA 3T38A 3H1GA 2NUBA 3TD9A 3Q9SA 4IMIB 4RZSA 5T3YA 1P6QA 3N0WA 2AYXA 2HJ9A 5CHYA 2FTKE 4PEVA 1NTRA 3GV0A 1RZRD 4JB2A 4YLEA 1FSPA 1VKRA 5BR1A 3N0XA 3QLUA 4D74A 4MPTA 1QQAA 1VPWA 1DBPA 4OLAA 4O5AA 2ZWMA 3OLZA 4EVQA 2WB4A 3EQZA 3KKEA 3H6GA 1ISSA 1BDJA 4G0OA 4DADA 4DQDA 4MS1B 3A0UA 3OO1A 4Z0NA 2PUBA 2QVGA 2F8TA 1JHZA 3M9XA 1QP0A 1FFWA 1U0SY 3OMXA 2ID9A 2IPAB 1FQWA 2LBPA 3RH0A 4YRZA 4W5TA 1H9CA 2QU7A 1CYEA 3DLBA 4KQ9A 1Y1LA 2LUOA 4OATA 3LUDA 4KV7A 4RV5A 3IPCA 5IEBA 3TMYA 3UUGA 4D6XA 4EGSA 1SXIA 1PHRA 1XHEA 4HNSA 3GBPA 4N47A 4E7OA 3CG4A 3DGFC 5KI6A 4Z4EA 3Q7RA 3LKVA 1Z13A 2JB9A 2KYRA 2Q5CA 3GA5A 3LUAA 3LTEA 2N9UA 1D1PA 1DRJA 2PLNA 4LRQA 1ZH4A 2ID7A 3SY8A 1GCAA 5CNMA 1M5UA 4MR8B 3QK7A 3QX8A 2JK1A 5TPZD 1P6UA 5KQPA 2WY2D 2FMFA 4D6YA 4YCSA 1MAVA 1EAYA 4RU1A 2O20A 4N76A 3RVMA 2CHEA 4KK4A 4W5RA 2FXIA 3A10A 5IUNC 2JVJA 3KCNA 4OG2A 3HDVA 1J56A 4RXMA 1F4VA 3UKJA 4HNQA 2PE5A 1DCFA 4RXUA 1YMUA 1QQBA 5IULC 3EQ2A 2WRZA 1ZHHA 3JPWA 5C5CA 2JBAA 2H0AA 1CEYA 1JFVA 3KHTA 3Q7TA 2L19A 3H5VA 1JFTA 3H75A 1ZGZA 3HO1A 3SG0A 2PUAA 2MYNA 4H3KB 1L5YA 4S05A 4N41A 3BRSA 1KMIY 5FWXA 2FLWA 4F8JA 2MSLA 4Z4CA 5KC8A 4G0MA 4EYGA 4LDAA 3SNKA 4G0YA 4EUKA 4RS3A 4Z9BA 5JNSA 2RGYA 3W9SA 4ZPJA 1TMYA 3GBVA 4MR7A 3RVJA 3URMA 4QICA 4ZMSA 1GLGA 1USKA 1LK0A 3IP7A 4P1ZA 2FMKA 3HEBA 1KGSA 3HUUA 4ETMA 1KRWA 4RY8A 1QP4A 4MQFB 4ETNA 4Q7EA 4RK0A 5JNVA 2GWRA 4MR7B 2MSKA 1PEYA 3N0RA 4XASA 5DKFA 2I6FA 4Y9TA 4IILA 1USGA 2TMYA 2L17A 1DJMA 3QEMA 1LBIA 4MS3A 3QELA 5B3JC 1P2FA 4O1IA 1SRRA 2PMCA 3O2QB 1QNLA 1LJLA 4KZKA 1E6KA 4JP1A 1ZN2A 3LUCA 3IP5A 1ZVVA 5I4CA 3HUTA 3DGEC 1JFSA 3HJFA 1KRXA 3LUJA 2E4ZA 4JAVC 2E4WA 2QW1A 2PJUA 2OQRA 5IBQA 2FVYA 9ABPA 4EY3A 2FEWB 3JPYA 3T8YA 4YS6A 4W5OA 4TLMB 3I45A 1JDPA 3SM9A 4EYKA 5BQ3A 4IF4A 4XAQA 4RK1A 3C6QA 3H5TA 1JBEA 1W9HA 1EWKA 1NXXA 3O74A 4YGXB 2A9QA 3CFYA 4P98A 1UDRA 4MS1A 2R25B 1L5ZA 5HKOA 4TMYA 2PL9A 3H1FA 3HZHA 2HSGA 4MS4A 3FFWA 4WZZA 2P4UA 3RVQA 2VUIB 3CNBA 3OM1A 5PNTA 1U2QA 4EYOA 1P8AA 1Z25A 2MYTA 3RVOA 3OLVA 3DLHA 4L4UA 4UHKA 2BGGA 4MS4B 1ZITA 3F6CA 2HPHA 5IUKC 5ED4A 1YK0A 3BREA 1YS6A 4W5QA 4ETIA 3E3MA 3RVKA 3DBIA 1QO0A 2PKXA 3KSMA 1C0EA 4JOQA 4LE2A 5IC5A 3ROFA 1GUBA 1PNTA 2M1ZA 4RXTA 5TPWA 4MLCA 4E7PA 1EWTA 4EYQA 4KMRA 3HS3A 1RZRA 3CG0A
chains in the Genus database with same CATH superfamily
2BUCA 5BVGA 1O6CA 1OXBB 2NUAA 1C1DB 3WL5A 1YFZA 3OCYA 4PO8A 2FP4A 4EJSA 5J2UB 3COVA 5E7JA 3KSRA 5JR3A 5DM2A 3VSBA 1UXJA 2FGJA 4PNPA 5CT4A 5HE8A 1DEKA 3AEQB 2B20A 3LHFA 3F7NA 4DSNA 3NWPA 4AQYB 2QGZA 2HIHA 2X0NA 1T35A 4KHZA 4KVFA 4A9AA 1WHTB 1FLVA 1M7HA 3D6TB 3UJCA 2QQ0A 5M04A 2CLLB 5A2QA 3RE1A 2ZUUA 3GYGA 1SVNA 3O2JA 2UUOA 3COPA 2PQMA 5D87A 1JE1A 2IYRA 4LJAA 1E5LA 4LCJA 2AR7A 1E6UA 1G5FA 4OHUA 3FR8A 2MR5A 2VUTA 1G7SA 4IX1A 2V97A 1JMVA 3G1WA 1M2HA 1B1AA 4MCHA 2B6HA 3LLVA 2XQVA 3KE9A 3C6KA 4RPCA 3VR2D 4ZALA 2I3DA 2XCOA 1LVHA 1HEUA 1RPNA 4GZLA 4WNAB 2BFMA 3B9QA 3KB6A 5CJ2A 4YQEA 5TT1A 1BJTA 2GAFA 2FU5C 5AMXA 3CUUA 3O38A 4Q1CA 4HWSA 1Y7HA 1AE1A 4KPUB 3SZ3A 1R64A 1XVLA 2REQB 3FW1A 5AUPB 5HRUA 2R1ZA 3MB5A 2J4DA 3D7RA 1G9SA 2WV9A 3QLVC 4Z6KA 4UCQA 1TAUA 2VJQA 5JSQA 1GHTA 3DJFA 5CNIA 3WNDA 2JFFA 4DQVA 5I7RA 2VHQA 5L53A 1Q12A 3U4CA 4TV8B 2WVHA 3MMZA 2FSSA 3CRQA 4NENB 4RCVA 3ZI0A 5I6DA 3H5IA 1VPEA 1PLKA 3H18A 3ZU4A 5K8TA 4D2IA 2FSGA 3CLUD 5IAKA 2QK4A 2I7XA 4QUHA 5EE3A 3CLSD 1V1JA 1AQLA 4REOA 5AM3A 4KXLA 2PJDA 1C0PA 3SP1A 2OLEA 1RQGA 4AMVA 4XXHA 1AK9A 3T5MA 2QYOA 2FH5B 4MRSA 1MA3A 2KJQA 3EIHA 2MDTA 2FRXA 1PQUA 5KYTA 3ZU6A 3M5CA 4IUBS 5AW2A 4MOWA 3U56A 2EIHA 4EVRA 2C1XA 2HZBA 4HXFB 3V46A 3AHDA 3NIBA 1HTBA 1F9AA 4EB0A 2QZSA 2Q7DA 1IMJA 4F11A 3H2IA 3OIVA 2WU3A 2GILA 3AR5A 4UCFA 5F2OA 4M1MA 2QP9X 2YR0A 3U19A 4GLFA 4HMQA 1JEQA 2X3YA 1KJWA 2XYGA 1PCXA 3CCBA 2V7BA 1DTEA 1NE2A 1NJ1A 3D2CA 2HMVA 5ENZA 1Y1QA 5KSPA 4HGOA 3T3MB 1DMSA 2BTOA 3RS4A 2XECA 1OBVA 2ALJA 1FL9A 3FYUC 5DNEA 4MEAA 5F7ZA 2OLJA 4V2UA 4X61A 4LHVA 3U0BA 4NONA 3TLCA 3GLFA 4MGYR 1YB5A 1QGOA 4DTCA 3U49A 3N5KA 1IY0A 2HV8A 3L6UA 4FDAA 4DBZA 2JS7A 4YPFA 2Z6UA 2XMRA 3SSAA 3V7YA 2AK2A 3D7NA 4WDRA 4J1SA 1GNQA 3RYCA 1SIUA 4YO7A 2X15A 3COSA 5IWAB 2OO3A 2QRUA 3P9RA 4J49A 5DLEA 3E9MA 1Z12A 4Q3AA 3DZCA 2ZBRA 1B4DA 1LW6E 1E5TA 1NBME 3G89A 2F1JA 1J00A 4X97A 3PDUA 4C0JA 2PO5A 4QJIA 5FBZA 4ZCRA 3OCXA 3PEFA 4AFNA 2IZ7A 2Z95A 4JB0A 4M1ZA 4GOND 1PFQA 4GSLA 1RKBA 3RRFA 1Q92A 5CFZA 4Y2HA 2R8ZA 3N8IA 3TLGA 2Y1DA 2D0PB 4CF4A 1FDTA 1D9XA 1XD2B 4MW1A 1Y6JA 4Q5IA 4LVCA 2RHOA 2VK8A 1BA2A 2WMYA 3OA2A 4GM4A 5IEJA 2GJSA 3L6OO 5BXQC 2NSDA 5GV7A 4MUMA 4OLFA 2GSDA 3DDNA 4ZJZA 5IVPA 4G5OA 2LD4A 4KB5A 1S02A 2WJIA 3KYDB 2R8EA 4G5HA 4I8DA 1ZMXA 4LDQA 3SHFA 5DN6A 2HQRA 2GCEA 3PFWO 3UM9A 4C0QC 3H1AA 1XKQA 3QBJA 4MYTA 2IK8A 1Z4IA 4EFMA 2BRUA 1FTSA 4BWVA 5KYUB 5HQTA 1TA9A 1L5VA 2YVKA 1QJ4A 2X9GA 2B69A 3KOWA 3KSAC 2FG7C 1DC4A 1JG7A 1P7ZA 1QO9A 1U0TA 4LJ7A 5A4DA 1US8B 1ZSNA 3M34A 2NV0A 1D5CA 1PR1A 1QO7A 1B15A 1VYVA 3M3HA 4FYVA 2Z5GA 3GD7A 4P5DA 1ONOA 5LZ2A 1D07A 2NZ8A 2AFVA 2R1VA 5CH5A 3TR0A 2WAXA 3L5OA 4H4EA 2QG4A 3DMFA 2GEBA 3WGYA 1W46A 5L40A 3AWDA 3RLFA 3CZMA 3DOCA 2R6AA 5JE8A 3ZWMA 1PJRA 3LA6A 4CM3A 3BL8A 2BMVA 3HJRA 3HR7A 4F12A 3OO0A 5C51B 5EFOA 4YT2A 4EL5A 4BU1A 3I4LA 1B41A 2ZULA 4UM9B 1GQ2A 5KQGA 3TK1A 1L8AA 4MROA 2OCDA 2ZI6A 3QSGA 1P7CA 2HLDD 2JHGA 2P9HA 2Q6LA 3EFEA 2FZLA 3MTDA 3SC3A 1IJBA 3IAAA 1IRIA 3JQQA 3P0JA 4WDQA 4NCIA 4OO3A 4AKIA 5DM1A 4DJFC 3RIEA 1XDGA 1NR5A 2QTTA 1TTHA 1U7ZA 1ZMOA 1V35A 3L7CA 4LVUA 1Z6GA 5LXTA 1CUDA 2AN3A 2JHFA 2OGSA 1T2NA 3CC8A 4KSCA 3TRDA 3ZKWA 1UUFA 4CG3A 4DSZA 3TG8A 1H93A 1H8HD 2J9ZB 1OTXA 3ENQA 3NHMA 3QBVA 3WSVA 3CU5A 2KQUA 3GT0A 2DUMA 3NJ8A 4IGAA 4LHYA 4XVQA 4AN4A 4DUYB 2IHBA 1GM5A 1TT5B 2VKQA 3HJHA 4IJMA 1R0BA 4XOIA 1CP2A 4G37A 4YJFB 1ATIA 4B4KA 3VU1A 1H8ED 1I51A 1NW8A 3HABA 4HAZA 3TYXA 1OFGA 2QW8A 2ZRPA 2Y99A 2ZYGA 3S1AB 3UUFA 4C43A 4Z4HA 2FR8C 2YL2A 4MGIR 4CR8A 5D00A 2MINB 4IH1A 2QUJA 3FJYA 3RTAA 2WG1A 3EUWA 1PWXA 2IBMA 4N82A 3ZU5A 3WIDA 4BV8A 4IXTA 5L3QA 5MFPA 3IEMA 1AX9A 3GL9A 1VIDA 3V9PA 1BX0A 1ZM7A 3E9NA 1NW9B 1Z75A 2VJLA 3LC1O 1NE7A 4YRTA 3A9VA 1J2YA 4NJMA 5DHPA 3ZI7A 1HLFA 1QX3A 1UKAA 2HDOA 4FOSA 2EC5A 3EWSA 4MHOA 1KAGA 3WZ2A 2JDIA 4CM7A 3F3MA 1Y6GA 4A0RA 4X71A 3KZNA 1UEXC 1KOJA 2IELA 5DBFA 1GNPA 3DBHB 3H19A 3AXTA 4ICIA 3USCS 4ISCA 4J4TA 4ZTBA 1U4SA 4MLDA 3ZIDA 1GTRA 2W90A 1EIWA 2O9JA 4NE7A 2JAPA 3V1KA 3ZGVA 2Y92A 3P9XA 1YQGA 3S2SA 2YMLA 4AO8A 1DRUA 1DJQA 2Q3DA 4KO1S 4C6RA 4D0GA 4CEJB 4NYIQ 5DTMA 3VSCA 2HSEA 5NLLA 4YR9A 4PZ0A 1G20E 2Z9CA 1NF9A 4IIXA 3NALA 1RVDA 4HQ6A 4Q4HA 3TCXB 1TKBA 5EP1A 2P3QA 2GCNA 4HRXA 3ORRA 3QKRB 2HJGA 2DFKB 1IULA 2I22A 2V6BA 1YRAA 4IKEA 4PC1A 3ZHXA 3ZNOA 1GG2A 1U8TA 2FN8A 2RH5A 1Z26A 1ZWLA 3HVKA 3ZE7A 1P5JA 3BJEA 4CTOA 3QE9Y 2W6ZA 1TVMA 1ZEJA 5FFFA 1ZVQA 1PVOA 2FR1A 1R66A 4G0NA 4UCWA 1R5JA 2R66A 1X7YB 1NSFA 1W8IA 3BDIA 3M4JA 2X0KA 2MYPA 2J6IA 4XCVA 2NYVA 3BAFA 3LP5A 1ZESA 1NDQA 4JX8A 4QT4A 1A9SA 1I7DA 1E4EA 3WE7A 2DBQA 2JJ1A 1M5RA 1YL7A 3KYCA 1PF7E 1JXOA 4GSYA 1CBUA 3RUPA 3U4QA 2DUUA 2Q9AA 4EKNB 5BV0A 1SQSA 3ECCA 5T3YA 4BNDB 3R9XB 2AOTA 3ZWAA 3PKJA 2G7MC 2XLBA 2Q21A 2WV7A 4IM7A 3N59A 3CXRA 3CF0A 3HB1A 5BR1A 5CG2A 1E2JA 2YCLA 4OIMA 3CH6A 1PL7A 1PT5A 2DVMA 2I6TA 2VNSA 3EIUA 3R6TA 4NZPA 3H6GA 1AKRA 4WN3A 4AG3A 3IKVA 4Z0NA 1JSZA 5AQ1A 4IHJA 4X90A 4M22A 1RXVA 3WGLA 2W6MA 3WJ1A 1ONSA 1WSDA 4JELA 1UBRS 5THKA 3L4KA 3ZWXA 4HD8A 1TJ3A 3DO8A 3EDRA 1JLRA 1L5QA 3ESQA 4IO1A 3U44A 4DJDC 2QRLA 4HZGA 1LNZA 1FQWA 2LBPA 3KTFA 3HB5X 1P2GA 2HNAA 3RLIA 3K70B 1Y1LA 2LUOA 2WD9A 1YONA 4NABA 2A4MA 2D8AA 2E7ZA 2FPRA 1UCFA 2FJ0A 3LC0A 1XJQA 2C94A 3KPYA 4HNGA 5AW5A 4C7KA 2F48A 4MQMA 4Q34A 3ND8A 4V0OA 5GP1A 3COWA 4UNNA 1XCPA 4R7TA 1FVXA 3GGDA 3DGFC 4FGWA 4AMGA 4JCOA 4D7AA 4BVGA 1HQKA 3TLYA 1Z13A 1ZINA 3C5HA 3MCAA 1RWQA 2QAGC 4BJ6A 1IM2A 5EVCA 1K7CA 1T0PA 1TKAA 1Y8QB 2XUZA 4AJEA 1AA6A 3ZN2A 1XVTA 2BE9A 4GQAA 5EE9A 1B6RA 1X7XA 2PZLA 4IBOA 4XTCS 3ZGNA 2CNWA 3AEKB 3IC5A 3K6RA 4OAPA 1SD2A 3WYGA 2WDPA 2H4HA 5A5VA 1NYRA 1CZHA 3E05A 4EY8A 4TRRA 2Q29A 4HMOA 4V0KA 1SU7A 4HLUC 1CSEE 4GMDA 2GBGA 4KAXA 1WY7A 2PX4A 3OF2A 3MCTA 2RMKA 4CLRA 4AZTA 4R51A 1UJ2A 2XA2A 5G1PA 3W6ZA 1S4QA 4BO6A 3RUIA 1PE0A 1I24A 4FU0A 4N54A 4ZEXA 4MVWA 4MW2A 5P8WA 1M2GA 1J56A 1MPTA 4RXMA 4FB5A 3BH7A 4MARA 2NWQA 4JEUA 1PFGA 5E6SA 4QOSA 1O9BA 5AJXA 5E1BA 3UJBA 3EQ2A 1AKYA 1NJGA 4YJGA 4YRMA 5C2JB 1SKYB 1YR2A 4AG5A 3VZDA 5CG1A 1U3DA 1L4KA 3NT4A 2Q0XA 3T7RA 2BDUA 5B1IA 4CDRA 4IWYA 3WIBA 2ZBEA 3ADBA 1HT2E 4W1RA 2BH9A 2J3EA 1A8HA 5K1ZA 1S2NA 1V11B 4H3KB 3VHRA 1NPYA 1GKLA 3URKA 4F8JA 5IT4A 1Q14A 2AUTA 5ALXA 1EX7A 1FOEB 1XP5A 2J33A 3BWCA 1T4DA 4G0MA 1XR3A 4J2OA 4S0ZA 4POOA 1Z5VA 5K0CA 3R7FA 3JAWB 2XE4A 4DR1B 2ZUSA 3KKKA 3HB7A 3AW8A 1QTNA 2CXOA 5EHIA 5EE5B 4BWGA 4KR6A 1IXKA 2VL7A 4PAMA 4RQAA 3RU9A 4QICA 4CF7A 5G1NA 2IV7A 1CQZA 2YJZA 5CD9A 3IP7A 3DP7A 5CFNA 3HEBA 4N6GA 5ENDA 1FPQA 4KXMA 3WI7A 4ATNA 1NMEA 2WQZA 2YJ6A 3NPAA 2OTCA 4DMUB 5CEEA 1FFHA 1QPBA 3K0FB 2WJZB 4JBWA 4MR7B 1KPHA 3FPFA 4FHFA 4MCAA 2WAAA 3ENKA 2ZE5A 1PEYA 1NBHA 3VKFA 2TMDA 3LIIA 3DWIA 2BFPA 1EM8A 3A4IA 4URUR 3AYZB 4Y2GA 2G1JA 3CCCA 4Y9TA 1H1LB 4EPYA 4ZXFA 2I6GA 4OGWA 2XOKD 1R0WA 3P2OA 1KU6A 2OCPA 4HH3C 3IVXA 3SKXA 1SIWA 1EKXA 1VXOA 4KE8A 1CQJA 5CW1A 4ZT4A 3SIXA 2ZB7A 4BEJA 3TZLA 1EM6A 5AT1A 1SRRA 2HKIA 2ORIA 3C41J 5F7JA 3WLFA 3Q9UA 4CT0A 3GJTA 1J70A 1WXEA 1W59A 3QA9A 2QD5A 3BMNA 1QKIA 3AVYA 1JIVA 2EFHB 5IG2A 4I55A 3SOZA 1G8MA 3DA8A 3OE4A 4JHLA 1FY2A 4KYVA 1FDVA 1P7VA 2ZZKA 2W0SA 4NHEA 1W0KA 1KYQA 5FPQA 1IFXA 2EWVA 4PLCA 4DMCA 1RYMA 1RHUA 1JLHA 4R8VA 2R7MA 2JGKA 2ODAA 2OP1A 1SULA 1VLMA 3LWZA 4G8CA 3Q9NA 3GARA 4BB0A 1EU1A 1QPGA 1NN5A 4PNZA 5K05A 3GDFA 3KKOA 2I2DA 3ESCA 3DLAA 3Q3JB 1ZBQA 2B1IA 3KJHA 3QFSA 1UDRA 3FSJX 2D1QA 3IPYA 1Z7YA 3I2YX 3L9XA 2R25B 4HEA6 4YP5A 3TE6A 4HS9A 3LW8A 2VRCA 3H1BA 4KR9A 4HNTA 1HK7A 1ZEMA 3GEDA 4ZV7A 3C7TA 5K3DA 2GERA 1SBNE 1Q1EA 2XXAB 1O97D 1W2WB 1W581 5LB4A 4B7ZA 2DR0A 5IYZA 2V6MA 3KT3A 4Z1MD 2Q5JA 2XXJA 1IQ0A 1U2QA 4DLPA 2O6HA 1Z25A 3OZXA 4BFVA 1L4EA 3PBKA 2L42A 3EXHA 9GPBA 2B2CA 3KKQA 1U7TA 1CR1A 3QI2A 3RSCA 2X77A 3QVVA 3VPXA 1Y3AA 1B0ZA 4IINA 1TQ4A 2IIVA 3VO1A 4EELA 4OB7A 4I3HA 4NBUA 5EIEA 1Z2NX 1KEEA 1QO0A 2WG0A 4H4DA 3IQHX 3HJCA 5DSZA 1JKJB 2Y1CA 3ANMA 3F3SA 1W6RA 4GF5A 4RNCA 2D6FA 4ZEMA 3L93A 2RGDA 3HCAA 5DM70 4YP6A 4D80A 3PCXA 5HF8A 1J39A 2V65A 3ZBPA 1ZSYA 2ZBGA 1SXJA 3JQ8A 1XVUA 3DO6A 4FUQA 1XVAA 1ZGCA 1UOQA 4M98A 1J7KA 1FDUA 4MSUA 3OQHA 4U2BA 5I01A 3WLPA 3BWXA 4NS1A 3EGWA 4L8YA 5EUMA 1XX6A 4ASUD 5AVTA 2WVGA 3LPAA 4LYHA 1CG6A 5EMLA 2NUAB 1OH7A 3MFYA 1HMYA 2FP4B 3L1HA 5TMEA 3TCNA 4LV6A 3ZYCA 4HAVA 4EJSB 1G7RA 1JDJA 3HBFA 5ECYA 3W7BA 1U6KA 1X39A 4WLVA 3K2IA 4RY0A 2K7ZA 1HYGA 2C1EA 4M9ZA 3SBXA 2ODTX 2YASA 3U26A 2ZRJA 1ZZEA 4ES6A 2PKQO 2PUFA 2Q0SA 1ISGA 1RAGA 3COYA 5JI2E 3RSLA 1PEKE 2GXUA 4G5GA 4R05A 1DIAA 1I2DA 1RLMA 2C42A 4BEBA 4F04A 3RFUA 4PIVA 5DK6A 3VMMA 4W6QA 3GXBA 5HCIA 5CDFE 4DFDA 3CEHA 1U7HA 3SSNA 1P33A 2HPZA 2Y27A 3CVVA 1G66A 3IV7A 4G2NA 2ZBUA 5TS3A 3TI9A 1L6RA 3UPUA 1JPVA 2OB1A 3IPXA 16PKA 1O08A 3TNJA 4OI1A 1RLOA 3L8GA 3OH8A 4ZCSA 1L7XA 1EE2A 1U4NA 3FRHA 1LDBA 4DIUA 4HNUA 4ZI7A 5LMNB 3CUTA 3RPEA 2D4HA 4B6OA 1SIOA 4HX2A 2VO1A 3C3WA 4BJ1A 3K9LA 3QW4B 3GLRA 1KYTA 1CIPA 4UHDA 2D7JA 4X65B 5GGYA 1ILWA 1NXTA 4ND4A 2VG8A 1QDLB 1WKBA 2QXTA 3HYSA 4PHGA 4RAOA 1RRGA 3MS4A 4UCXA 5C8YA 1L4HA 1MC8A 4ZHQA 4AG6A 3ZVKA 4CM6A 3PJDA 1KYZA 3EXFB 3QUBA 4Y9UA 2B8EA 4KJXA 3GLHE 1Z18A 3JR3A 4FSXA 4HEQA 1AZSC 2X0DA 3GLKA 3MELA 3DFMA 4DV7B 5JISA 3AUJB 1P1FA 1O5IA 4N0EA 3WQSB 3PA6A 5D3QA 2QT1A 1T5DX 2PMDA 2GPJA 2YV1A 4L3VA 5JD3A 4P32A 4E3WA 2WJYA 9MHTA 1Q1NA 1ZOLA 4N7MA 1QFXA 3IVMA 3VPCA 4KMOA 3N2IA 3PCRB 3IQEA 4JDUA 3MJRA 4Q7LA 4D4HA 1K8YB 3ZNPA 2Y1XA 3L2OB 4BMVA 1P45A 4YASA 1UH5A 1Q6YA 2JGNA 3HO8A 3C3DA 5A3SA 3FTQA 4ZKEA 1XZMA 4HTFB 4II3A 4L8GA 3VYVA 5JARA 4L51A 2J0QA 4ZYWA 1OIVA 1YQQA 1C1XA 2Z6AA 2ZVJA 1ZCZA 3RRYA 3GRCA 3AKYA 1UFRA 4AI6A 2D8MA 1G1AA 1JEQB 1MABA 2GZHA 2LTAA 2V5AA 3I9FA 4PTLA 4TL6A 1P0PA 4UEKA 2ZUBA 2XEDA 1RWXA 2XUQA 3V6LA 3GMIA 5K8LA 3DFZA 1EYZA 2PHZA 4WT7A 3UA4A 4Y2RA 1Y89A 3H5WA 4O33A 3ZCXA 4U2CA 4BPRA 5C9ZA 3ASZA 2Q45A 4LC9A 2PYDA 4I36A 3WWOA 4H7IA 3ZDEA 4P54A 2FQQA 3OUUA 4A0FA 3IULA 4U9IS 1JHXA 1KF0A 3WSTA 1PUJA 2EARA 4H77A 1OF1A 5ARBA 4PW0A 4QM6A 2I4NA 3HEMA 3RG2A 3C5WP 1N0WA 4HQ0A 5JPIA 4OHKA 3W3AH 1NURA 3RRNA 4CQMD 3QU9A 4YT4A 1MAAA 3B1FA 1Z17A 3DL2A 3HCDA 4G0PA 1C9DB 1UODA 2C1ZA 4LNUA 4JK3A 4Q19A 5AHKA 2V7EA 3B78A 5A4AA 1AH2A 1YTUA 3HBNA 4J3JA 3T52A 3RBZA 5K4HA 1BWRA 1XA0A 1SJ9A 5EUCA 4H60A 1ETHA 1Z07A 1N7JA 5D5HA 5T4HA 3KSZO 2GXSA 2ZJYA 4KQIA 2HU5A 2WINI 3OJLA 4OL9A 1OGJA 1Z08A 2FPIA 4GR5A 1SVLA 2OWEA 1LBQA 5HDBB 4IDBA 2XODA 4C0AC 2QBYB 2J9RA 2VBIA 3L49A 3AETA 4PR3A 4N3BA 2ODEA 3UJ7A 2DY0A 3GFTA 4FMPA 5HS4A 3WA6A 1FEZA 3SE7A 3JZAA 1N6HA 3FNEA 4HR7A 1UPAA 1E8MA 2OYCA 1XWWA 5J9FA 1HL3A 2C2ZA 1A9XB 1BNCA 1CULC 1PDWA 3LBFA 2C0QA 3QBEA 4X20B 5EMKA 5FBKA 4KOAA 4BP3A 4NSNA 1P72A 5HQJA 5K20A 2HFJA 1TIPA 5DP1A 5JBNA 3DYBA 1AKTA 1GYRA 4R2IA 5T6MA 1OI3A 4Y7CA 1Z4JA 3UANA 3WIUA 1GA4A 4B4OA 2VOEA 3CNOA 1AS2A 3LZCA 4M53A 1BHQ1 4MTCA 3WXBA 3DEHA 3NKFA 4RF2A 4R1QA 4RMNA 2JGEA 2WUVA 3SZRA 3EEYA 2Q6IA 2CL7X 1U2GC 2R1VB 3HJUA 4DYVA 1H5UA 1TAHA 4L9RA 3ICQB 2RSLA 1FFGA 3I4CA 3I9V1 2Y76A 4ARCA 2YNMC 1BVHA 1BDMA 1YFJA 1NF8A 2BEKA 3F5QA 2CDBA 3N70A 4BNIA 4KQ6A 3NGXA 1YR8A 4CW7A 1T5LA 2D1YA 1G2OA 3TTWA 2FPOA 3KLOA 1E1NA 5CJJA 3VNSA 4PVDA 2GO1A 5B64A 1T2FA 2HBRA 2YWCA 1QK4A 3TQIA 4NCXA 4LF9B 4OCZA 2ZRHA 3R8FA 5JD5A 4NBTA 3H3JA 1ULUA 1PJ3A 2X14A 4EW1A 2KBEA 3FR7A 3H7IA 2YWGA 3M1YA 3OOHA 1I2CA 5FTKA 1YBVA 4D4LA 3FPKA 1NXWA 1RRKA 4Z9XA 2CVPA 4F3YA 3BMCB 2V3CC 2HO4A 1YTLA 5T7BA 5FIUA 1PD0A 3MF4A 3N2KB 4Y9DA 2P8JA 2G40A 2ZIVB 3MCZA 4LECA 3R8CA 1E3LA 3UHPA 3JAKB 4N5NA 1NV9A 5K9ZA 4PAGA 4UUPA 4E21A 4REQA 1GGHA 4P53A 1YHNA 3RCBA 1ZCFA 1Z47A 2JC3A 1E77A 1F20A 3W4KA 2ILTA 1GSIA 1T1EA 2G1KA 1G3RA 3L7NA 4NEGA 4NJEA 3WLAA 5C7LO 1A9TA 4EA9A 4U6QA 4HT3B 1PNOA 2JBAB 1XVVA 5CLFA 2HY7A 1O54A 1RI4A 4MI6A 5CNJA 1HWYA 3A26A 4M49A 1SB9A 1CE8A 3RU2A 5L3QB 4DGQA 1KH3A 2AE1A 3LT2A 4TSKA 3F2IA 4G65A 1P0FA 2NO1A 1R74A 4JYBA 2YQZA 4FMDF 4NJMB 2CV1A 4X24A 1H2FA 2CNLA 2GJ4A 4P31A 4Q24A 5FWYA 4WH0A 3BFPA 4COOA 7ABPA 5ESXA 2PZFA 2B21A 1BH6A 4D9EA 3DZDA 5JVDF 1Y0BA 2WYWA 4ZZ1A 1GT91 1YCDA 5ALEA 1QGUA 4I1PA 3OLYA 3EODA 4RH1A 5ALPA 1IHPA 2PT9A 3K0AB 4BQRA 2B8TA 1HSOA 2CL5A 2ZYUX 3HB0A 1YZUA 2B36A 1HV8A 3G9QA 1JH9A 1L7EA 2OFWA 4CKZA 1FE8A 4OY3A 4MP3A 5J4HA 1KC1A 5EGNA 5BR7A 1EBUA 1M7GA 2IS1A 1M1YA 4HB2A 1ZISA 4JLSA 1MGOA 2GD6A 1NWCA 4JLMA 4FHCA 4JC8A 4M88A 3KHUA 4RDXA 4RMGA 4L8WB 2I6QA 4NF2A 5B3JA 4A15A 4OHWA 3QEMB 3RS2A 4L2IB 4LZLA 4NOKA 5B1HA 2HJVA 2IOQA 2QJFA 2X40A 5E3IA 2UUBB 3JZFA 1PEAA 1U2EA 3OIGA 4HXYA 5LQKA 1G8YA 2ZUTA 2R68A 4TTSA 1OSNA 1C7RA 2X7XA 3M4NA 4I50A 4LDPA 4BN4A 1GUZA 1O95C 3B89A 3KR1A 4BFYA 4NV3A 3WLKX 3ZWOA 4D97A 1GL9B 3CTMA 1BVRA 1IZ8A 1DU4A 4EB8A 5CT9A 2KW5A 3ZK7A 2JJQA 2ZG6A 3MJVA 1L3IA 3VOBA 1BFKA 4XM1A 1V25A 4ZRMA 3RB8A 5JDIA 1E4EB 3DZJA 2XPCA 1FU7A 5SV2A 5G4KA 1ZRSA 4L5AA 2R7NA 1RHRA 3KYCB 4FZJA 4GVLA 5AOCA 3U4QB 2YN0A 1YO6A 4PC3A 4P5EA 4NPCA 1TK2A 1S3IA 5CH3A 5KYNA 4IMRA 1KFKB 5SYMA 3DKRA 3UB4A 1KI6B 4AKEA 3FPJA 2AOTB 3DKKA 4TUYF 4JVOA 3M81A 4QBHA 5LMCA 5K3AA 3KKEA 1AS3A 3DTVA 4MS1B 5SICE 4KAJA 3TDKA 1GQRA 4ER7A 1CY6A 1CCWA 3G8AA 3IHKA 1H66A 1G6OA 1U28A 1PQWA 1DAFA 1DDGA 3CF4A 4PBTA 3PYXA 3J7AC 4IH9A 5FWAA 1QAOA 4RVCA 4LQ4A 3IAHA 4C29A 4YAKA 2VCEA 2WIKA 4UBOA 4EHKA 2J0VA 1QLWA 2NUPB 2WU0A 1VHJA 3I0MA 5DP2A 4TKVA 2WPDD 4JQSA 1ZPDA 1PHRA 5JG7A 1LPBB 3VYTB 3OZBA 3D2LA 1ECJA 1KK2A 4YA6A 3UHAA 4MJLA 3ZWQA 1QQ6A 4TM7A 3R0IA 4CKXA 1X7ZA 3WL6A 1NUQA 1SC4A 2IEGA 4RWZA 1EUYA 1S6YA 2OGZA 1N2CA 2VN8A 1TGYA 2B1GA 3S2YA 4TYYA 3TIIA 1Y6QA 4OHBA 4HAIA 4CWAA 1ATZA 2NX2A 1CUHA 1R5BA 3K05A 2XKAA 1GFSA 1E3MA 5TPZD 2F1RA 3U1TA 2YVAA 4D9HA 2BEVB 2H2WA 4LOLA 2GUGA 1H3FA 3VPSA 1FJ2A 1X7XB 3L8FA 3PU6A 3IRUA 4DCGA 1Q7RA 4C5AA 1RQXA 4MB6A 2BGMA 1E79A 3LXUX 1R9GA 4UPDA 4YY3B 3QU5A 4K3VA 3E8MA 4OG2A 1G98A 1OE0A 3OE7D 2YHIB 2DPLA 5DOVA 5FOVA 4BECA 5JSFA 1D4AA 3E9YA 2JFXA 3PGA1 4OBXA 1C1HA 5HKKD 4GWGA 4BKRA 4YRRA 3A14A 5FLKA 4F60A 3NV9A 4Q15A 5AJVB 3NRJA 2HMYB 2NO6A 3ADCA 3THYA 3GA7A 1T91A 4Q02A 1KMCA 1KMMA 3ZBTA 5KX5F 4KXVA 2AMFA 1DG3A 3U61B 3ESXA 3MOGA 2L19A 4GMKA 2AJTA 5E6SB 1QIFA 4P2GA 2O2HA 3HO1A 3QF4B 1M2WA 2ZJ2A 3DOJA 4YJGB 1MT0A 4QRIA 2YUIA 1E9SA 1Z5UA 3SYTA 4N41A 2HNBA 1CQXA 4HZUA 3NU1A 5FWXA 3SEFA 2V7TA 3LJKA 1YE5A 2WWRA 3FDZA 3DDOA 3OTQA 4IDCA 4LC0A 4Z9YA 5BRNA 1SEVA 1UAAA 5A0VA 4JROA 2B2NA 3IOBA 3V42A 1GGJA 3LNTA 4ZMSA 3EXIA 2REXB 4IAOA 1MJ5A 3FH0A 3UMMA 2R4UA 3LBNA 3QV2A 5CX1A 1KYYA 5F12A 2BFDB 5J5AA 3BKXA 4FD3A 1JTEA 3CUYA 4G09A 3IUNA 3LSYA 4YRLA 3C70A 4P7FA 3RWOA 3VU0A 4Q7EA 4IDQA 2IP4A 1QK3A 2ONKA 4J16A 4E08A 1HX7A 2XYQA 4RBNA 3ZW9A 4B6PA 2XVMA 1VBKA 3RUHA 4E70A 5JD4A 2YX1A 2H1OA 1Z4PX 2C98A 2J9YB 2JFUA 3EVEA 3S2IA 1AZLA 1USGA 4DA9A 1NKSA 3GI1A 4REMA 1S2MA 4KFSA 2Q28A 4Q4JB 4A03A 3WMXA 4X6UA 3FETA 1JB9A 1XZLA 2P9JA 5HHTA 2YDXA 3P0EA 1ZMRA 4D25A 4FFDA 1EM8B 3H6KA 1AHIA 1DI0A 4H1UA 2J5KA 3LUCA 3KXPA 5ESDA 4NP6A 1YV9A 1YB4A 1JFRA 4M36A 1CQJB 3KV3O 4V0SA 4CEHB 2FY8A 5AW9A 5TRTA 3U5ZB 2G0TA 5K0EA 3WRXA 3QF7A 2QX9A 4HUJA 2DX7A 4M7OA 1F8XA 4YAFA 2ZREA 4FKBA 4FLFA 4HQOA 2EWWA 1U2DC 3AF2A 1XO1A 4IIHA 3RV4A 5LQDA 2HW8A 1OFIA 3ABRB 4IV0A 2M2IA 4G5QA 3QXSA 4HPJB 3DNPA 3EFOB 3I45A 1ESMA 2YXNA 4MQLA 4IF4A 4NV0A 1N78A 5AOVA 1PJ2A 3SLGA 3RUFA 5JRJA 3H84A 1W9HA 3ZGOA 2OD9A 1VQ1A 3F8SA 3HPRA 5ED0A 1F38A 2RIPA 3DLTA 2Q3LA 4Q1VA 4XR9A 3JYHA 4ZK6A 3IV9A 4FT4A 3JZIA 1E2DA 1G9XA 2B6NA 2HBYA 3G2HA 4XUDA 1XVIA 4PLTA 3IUPA 3KLMX 3I92A 3D7KA 2XB2A 1CUFA 3PVCA 4QKQA 3V4SA 1ZNWA 3U16A 4X66B 2HR1A 3RBVA 3O31A 4DWOA 1VI2A 3OM1A 4B3RB 1ZMTA 4WFIA 5J4VA 3RVOA 3UTCA 3N9IA 4Y6RA 2P2SA 3A2LA 1UDAA 3PPWA 2ZUFA 3OBIA 1YK0A 1RM0A 2PZEA 1RFGE 3GDGA 4R1TA 3RG8A 1IZ7A 2PLAA 1PNTA 2IWRA 5TPWA 3PDCA 2OQ2A 3SXUA 1ZD1A 2VSXA 2ABWA 2G5GX 2UAGA 2AE2A 4MDEA 1QMPA 3AUUA 1KEEB 2BEWA 1XL1A 1TRKA 3Q8WA 3RC2A 2AJLI 3PITA 1DKQA 4IYJA 5KSZA 2OP0A 3ORQA 2YW2A 3C6YA 3NBFA 2RHWA 1AHNA 3R0XA 1E7YA 3Q41A 1SXJB 2A59A 4YECA 3T7EA 4OK6A 3U2QA 3ZXIA 4AW9A 5EJ4A 4HFJA 2OO5C 1VIAA 2VWQA 3K0CC 5DCLA 6GPBA 2I2CA 2AZTA 1NNUA 5JCJA 4Z4QA 3KC2A 2WE8A 1RPTA 1XLTC 2DQZA 1XYYA 4FE3A 4TT3D 2XNDD 4FXOA 1XDSA 3KDAA 5EUQB 2I2WA 3AYXB 2D1FA 1N32B 3B5EA 1AGRA 1CUBA 1DXHA 5AJZA 4B7XA 3FMVA 1IONA 3GAZA 1K8XB 4URZR 1Q0LA 3EY9A 1Y4DE 3L79A 4B76A 3OP1A 4YI3A 3G2LA 1ZW6A 2QDXA 3NRBA 3P1JA 4C14A 5LUAA 5GJVC 5KPDA 3MJSA 4XLLA 4C7BA 5BSTA 1YS4A 4PLPA 3BBPA 4RPGA 1SZJG 4BVKA 4MGEA 3DTTA 3EGDB 1ZW1A 2G08A 1VJDA 2QW0X 3KR0A 2I3AA 2ZR9A 3CV3A 1Z7GA 1F7UA 4JMPA 3SVLA 1J4AA 1H0SA 3GY0A 3EF1A 5IU6A 4Y6OA 3AF3A 5DHSA 1T1RA 2FFHA 4BXOB 3VHQA 4HXGA 2F9MA 4UHFA 1BCRB 2D2XA 3TZHA 4ND7A 1H4TA 5COQA 5LCXA 3ONVA 2BH2A 3QFCA 3WQQA 3ZDRA 1UT8A 2H7VA 2WKWA 1PTJA 4LDZA 5ELXA 1FK8A 1SOAA 3CF2A 2AFIA 1G0OA 1DUVG 4YUVA 3VR4D 2P2DA 4L8FA 4LV8B 1YL5A 4ABTA 4V39A 3JASA 3TFWA 2C2HA 1W76A 1DO8A 2GO7A 3H2ZA 2WKRA 1FXWA 5FEUA 3IFSA 1P19A 4HUQB 5CU7A 1T5SA 4UAUA 4BV9A 4NE2A 2AJCA 3C1TA 3F49S 4NZOA 4XQGA 4CODB 1QBGA 4ZHQB 1ZHOA 3NYIA 3QFRA 4LDJA 4MKRA 4PGMA 5L8VA 3ZC3A 3SS9X 3CZQA 1T3LA 4R41A 4W7SA 3UFBA 2YMPA 2C07A 5JQGA 2SNIE 2YWJA 1OI2A 2BHLA 4D1YA 1D6SA 2Q8PA 5KTSA 3Q88A 1USUA 4CL2A 3BC1A 2O8DA 1JQLB 1RI2A 2PKEA 3IGFA 4BRZA 2WQ7A 1P1HA 4FNOA 3GGPA 3QZUA 2LCFA 2PX2A 4GLOA 2XE7A 5HILA 1JV2B 1QFYA 3QX9A 2JJ2D 4J8PA 4WXMA 4TS4A 5GWXA 4RELA 3TPZA 1N8SA 1A3CA 4O4JF 4IFTA 3F3KA 1KNXA 3ADPA 4KFRA 4RJLA 4WVLA 4WZAB 4OQPA 1JQBA 4Y0NA 3H4IA 2ZUVA 4QDKA 5SZIA 3HDTA 4B83A 5B58C 3KTOA 1Y63A 1NVXQ 3IUSA 4O63O 1KJQA 3DLCA 2GH1A 3E35A 3EGXB 4GNRA 3LRPA 4LXXA 3HA3A 4N9WA 4BNNA 3PNSA 4DR7B 2P5YA 3PVZA 4OYLA 4XZ3A 3SE0A 2DBYA 2H0RA 2UZ1A 3W2IA 1FF9A 5AI0A 1VHTA 2VDPB 2BHSA 4XX0A 3RTCA 1UAGA 5GIOE 4OPMA 4P4SB 2CXHA 2KPOA 2IYTA 1MABB 5I4KA 1FDSA 3PNOA 4RJ2A 2UUAB 3WR5A 3AR6A 1Y5LA 3KL2A 5KVQA 1B26A 2AF4C 3W34A 3TGWA 1KIMA 5BWNA 4C4RA 1SQFA 4RHEA 4CM4A 1HE1C 3KZKA 2B25A 5EEHA 1Z8FA 2B2XA 4MWOA 2BFCB 1H0HA 3F6BX 5HTOA 1BZYA 4MUXA 3OHSX 3DKIA 4GPAA 4PLYA 5EIOA 4HYEA 1C14A 1SG9A 2VCYA 3B60A 4OQQA 4JBIA 4RD6A 2I62A 1ODCA 1COWA 4X64B 1DBVO 1A2BA 3MWDA 1JQDA 3AINA 3NG1A 4YNBA 1WPQA 1SZPA 3AERA 3S1LA 2VZEA 4W8HA 3RC7A 2J9FA 3PXDA 3TINA 4D45A 5TE9A 5CAEA 2UUCB 3FUXA 1BHSA 2EBFX 2OUIA 2ENUA 4QYIA 1BGVA 1N6RA 3FLEA 3HBAA 3NKLA 5ICFA 3F9CA 1J8MF 1FDRA 3OLXA 2VPQA 1X14A 1CDEA 1G4AE 2HWXA 3ONWA 1MORA 4MVJE 2W6QA 2QGNA 3R0JA 3OQIB 1KEWA 1UBUS 2I7CA 2FPIB 2WTNA 4BNVA 4PF1A 5E1OA 3SWWA 3D31A 2ZJ5A 3IRVA 1N9GB 1FFCA 2HQOA 2ODNA 3UXEA 4EP1A 4LQCA 5B2ZA 2OVFA 3RHSA 4F46A 3ZGLA 4YPOA 4LZPA 2Y1OA 5HM6A 3K6SB 4Z5XA 1XAJA 2XJ9A 4QM7A 3AETB 4AN0A 1T4MA 4F06A 1UBEA 5I7SA 2P4SA 4OJNA 2WZBA 1KDTA 2HF8A 1E3EA 2IKQA 1PNQA 2P5TB 3PFIA 4KTVE 5L3SB 3GNQA 4UUAA 4KBGA 1K06A 1N2BA 2ERYA 2ZB3A 4C06A 2WWYA 3GG9A 2ZTSA 1YU6A 3A3YA 1YJXA 4I1RA 1VPLA 4ID9A 4PYNA 5FT9A 2IDMA 3SX0A 2FKNA 3ONFA 3LGAA 4GMXA 4UFPA 3OP4A 2F1IA 2NU7B 3N74A 3F73A 4RVSA 2JRLA 2FMTA 2WF9A 2QQ5A 2RGWA 4RKFA 2VT2A 5AVOA 1TAGA 2BZ0A 2VTEA 1ECPA 3DOFA 4U2FA 1UJ4A 3QWHA 5HYVA 5EWLA 1V6AA 3A0RB 3OKAA 4L6AA 4OP3A 5HBRA 4BE9A 3IEUA 4K5QA 4LCBA 4QYWA 2P2ZA 2BD0A 3F4LA 4K1XA 3I64A 2FQWA 2V8BA 4NESA 1R15A 3F67A 3UJ6A 4BO7A 1ORRA 2IP2A 5CCXA 2JIRA 3GC6A 2REOA 3RVDA 2IW3A 2CXNA 2WFLB 2QRJA 3HLTA 3JVVA 4RLQA 5EHQA 4A2QA 4N9QA 5J5CA 3G2JA 3HK2A 3GRFA 1HDIA 5DI3A 3WGKA 3DT8A 2Z56A 4ITVA 1Z35A 2YBEA 3TFOA 4CPDA 5E3JA 1NL3A 2CLMB 1E1RD 2OSVA 4PFKA 1NMZA 3MCVA 2L69A 3PD1A 4FOOA 1N5OX 2BUBA 2GCGA 1E69A 3CHYA 3RVRA 1T2UA 3O1IC 1W73A 2HF2A 4TN5A 2J5XA 5KYWB 4FFNA 4NMWA 2WSSA 2Q6TA 4B8WA 2GHRA 4DIBA 2IEYA 2PUGA 4IWXA 1DKMA 3WRYC 3IUEA 2P6PA 2POCA 2PPVA 1IDOA 3B3AA 1GU0A 4RSMA 4XWGA 5EESA 5BORA 4BGIA 1TTQB 2P9GA 5F5LA 4E4TA 4BZQA 3HFRA 3OJOA 1XZKA 4OJMX 4IEFB 1IOZA 3PD7A 4XPZA 1GAWA 4KQFA 1MHPA 5IASA 1J21A 2OXIA 1JQ3A 1AT1A 2AMLA 4REQB 5ITWA 3PE4A 5AM1A 5DT2A 5ADWA 4YIHA 3IDAA 1SBTA 1K88A 5E9AA 2OFFA 3WB0A 5JZVA 4NJEB 2WWIA 4UDXX 1WDKA 2LCIA 2YJ4A 4ZQFA 3MZ0A 3SYNA 4Q9DA 2XAUA 1HO3A 1NXOA 2IUSA 4Q7QA 1NUSA 1W35A 3GJ6A 5TY0A 4ERXA 2HDWA 4EM6A 4JA2A 1UXOA 2JH3A 2X23A 3QE0A 2BMWA 4TTPA 3RD5A 2DC1A 4MNTA 2HMAA 1G8PA 5JXIA 4CCWA 4KWIA 4NYMR 1WXFA 5FWYB 2CD9A 2FW0A 4HUTA 3A8TA 4EIWA 1TVKA 2HD4A 3CW9A 4I4NA 4X0EA 3RKUA 1V6SA 5IKXA 4LZAA 2BGTA 3ABOB 3UUWA 3ZCPA 1IBKB 4AP6A 1NI4A 1KFBB 1J1ZA 2P9FA 3FUUA 3FMGA 3B3GA 3E6AA 4MWDA 3G17A 2ZZNA 1X1SA 5H02A 2D0DA 1HLPA 2VPIA 3HP4A 3QPBA 3KOXA 5KNDH 3G85A 1W36B 4UARA 3MUOA 5LOVF 3O73A 3G2MA 3LPLA 4XQCA 2MSWA 4G84A 3RK4A 1WXWA 4EA8A 3T6KA 1VL1A 2A5FA 2H8GA 3H17A 4IOLA 4N8EA 1OT5A 4XB2A 4BZXA 4D41A 3N8HA 2FMIA 4XDYA 1WBDA 3I62A 2EFGA 4G36A 4MV9A 1A2KC 2QR3A 5D7NA 5BT9A 1TK3A 3TW8A 1N33B 1F9EA 1LQ2A 1R8SA 2V3WA 2DSNA 3DEKA 3QW2A 3TR6A 3S44A 4K9NA 4TQGA 4MVJD 3ZR4B 5IKPA 5IANA 3K32A 4I19A 1YJ5A 4I50B 1T9BA 2VDWA 1P91A 4DL9A 2XMPA 1XDZA 5DMXA 5MN5A 2W9XA 1WCIA 3BFVA 1ECBA 3SNHA 1CERA 1M8FA 2BZGA 2J5QA 3L40A 1V3UA 1ZCAA 2QS9A 3B9BA 1DIOB 3HI6A 3L92A 4GT1A 4LTNA 4R0MA 4FFOA 1OZFA 6LDHA 2FK8A 1JVNA 2PYIA 3KZCA 2F4VB 4KU4A 2PXAA 3RUEA 4MRPA 4GH5A 4DADA 2BBOA 4JBYA 3Q5EA 1JZSA 3ABSB 4M6WB 4OXNA 4PSVA 2GWHA 4WN9B 3WHIA 1MKYA 4BAGA 3NGMA 2PUBA 1RAHA 2LKCA 3KQNA 3FPBA 2IIPA 1XMPA 2VHVA 3A4VA 1I2MA 1UBLS 3OCJA 1QP0A 2QJRA 2RG1A 2ID9A 3A11A 4D9GA 2Z09A 5JALA 1NASA 1POWA 2H1CA 1WB9A 5COBA 1XTZA 3OY2A 2WSLA 1DBSA 3LCCA 2OBBA 2I76A 4EZBA 5BQPA 3VV2A 1C7FA 1I32A 3L6EA 3ER9A 2DBVO 2WWXA 3T4UA 1EFVA 1QWSA 4LBYA 2BGRA 2GVDC 5K0NA 4EUSA 3ZNQA 4J6FA 3N6XA 4TKVB 3O90A 4GI2A 5JHHB 4G5FA 4WPGA 3C6BA 1ZO8A 2D2EA 3STUA 4CLOB 4MVJF 2H1HA 3B1JA 1ZH4A 1H6AA 2FPGA 3T7AA 4DLKA 1X7ZB 2ZM5A 3GZNA 1GCAA 4DJJA 2C2OA 1C5KA 3BCHA 4B6RA 4B3GA 4BFSA 1N2CB 2H9IA 2I3BA 3OQBA 1V1RA 2AEEA 4QOJA 1FC0A 1RXSA 2TSYB 4MIYA 4XWYA 2GPNA 3NOQA 5T8KC 4DA7A 4LJRA 5K0TA 4L07A 4QOHA 4YP1A 4M4SA 3I4FA 5KDOA 3QUCA 4N18A 2GPBA 2YOHA 4RAQA 3ZWBA 4YDQA 2JVJA 5IUNC 4JMLA 1Y1RA 5KIAA 5DIFA 3ZUGA 5EJ7A 1LSSA 2CFOA 3ZBUA 1MIOA 1QQBA 2GYWA 4BGEA 1WDMA 1QDEA 2W4MA 3ZCQA 5KU7A 3IESA 1NRXA 3EYAA 3EZNA 3A3NA 5C34B 2AV6A 4DXHA 4ID3A 3Q7TA 2XV1A 3PGXA 4H31A 3HVHA 5AKYA 3E58A 3IT0A 4AJKA 3ENZA 3L1VA 1PT9A 1IZ9A 4JITA 3IO3A 5D5PA 3THYB 2OLKA 4M0UA 2A78A 3DFIA 4IDNA 2TMKA 4HVTA 2ZDQA 4YUXA 2O8BA 1U8XX 5BN3A 5T5QA 1BYIA 1E8NA 1YC5A 3KQQA 4E4YA 5FQOA 4RZQA 1ZIYA 2DT5A 2E1PA 3JWGA 2NSYA 4YDSA 1ZCBA 1RW4A 3REGA 1EB9A 1NN1A 4A2CA 2ZI9A 1CUZA 1GLGA 3FDZB 1USKA 4YCCA 3ADOA 2A9FA 3DF7A 3FYTA 5LP6C 3ZV6A 1TCCA 3CNHA 1E98A 2PGXA 3E5RA 2AB0A 3QY0A 4MQFB 2I4IA 1VMKA 2G88A 4NZZA 2QM8A 4Z53A 3EXIB 4BTEA 3VBCA 3HA2A 5CX1B 3N28A 1Z0SA 1V2HE 1PDVA 2UZ4A 1OR8A 4R2MA 5DKFA 4C03A 2ZSAA 1T5OA 1XELA 1CUJA 4G07A 3K1AB 4GEKA 1QV7A 1PGOA 2CK3A 5A04A 3IKLA 3HP1A 4IJVA 3VZPA 221PA 3P8ZA 2A3RA 1X13A 4D9JA 5GY7A 1IHYA 1U9YA 4QSHA 3PC6A 4O2BA 1RWWA 5DCUA 2ACWA 3PWKA 3ZCTA 5B7QA 3AG6A 1E18A 5I4CA 3PYMA 4YGYA 3GR6A 5JEDA 4DR3B 1GKIA 3X1DA 1DQZA 2C5FA 1UAYA 1JFSA 3JQGA 2EG9A 5JMOA 3LUJA 1QIJA 2EW8A 2MJLA 2O2GA 1PJSA 2SECE 3GQVA 2G1UA 3FUTA 3WSWA 3ZY4A 2UYGA 4XLZA 4BB6A 2PJUA 5SY6A 2ZXFA 3NR2A 2VAXA 5DHTA 2IYLD 4YS6A 4EDFA 3K16A 4J94A 1ISFA 3GLSA 3UB2A 3ZWDA 4CIBA 4HFMA 1X2BA 2ID4A 3W9YA 3K6SA 3BS4A 2GEUA 2Z6VA 1M67A 2WJJA 4CRWB 4HDOB 5JCZA 1DT3A 1J23A 3ED1A 3R40A 4K2HA 2IYZA 1U81A 3WL7A 3ZDZB 4PAWA 1Z6AA 2I2AA 4WMLA 4C08A 3LQFA 4CIVA 2XGJA 3F6EX 1FUIA 1RC0A 1GARA 1UJMA 1XEAA 3OTGA 2DULA 1QE5A 4KWTA 2HSGA 3GQBA 3VDXA 1J09A 5HUHA 2B83A 2A1TR 2BWJA 2JPDA 3EVTA 3HN7A 3QHQA 5BYBA 1VLQA 2M6LA 2ERCA 1CU1A 1X80B 5JMTA 3ZLTA 1CZNA 1KRHA 4F9TA 4UHKA 3GZJA 3OKFA 3X2SA 2AKEA 3V4LA 1QKJA 4MQ5A 5IUKC 1B43A 5LA6B 4D9FA 5DLYA 1SN7A 2CV0A 2HSJA 1RTTA 3I9OA 3E3MA 3FRIA 4KO2S 3RYIB 2FLVA 4LE2A 1JT9A 5HCUA 1W94A 3QEBZ 1P7WA 2F9FA 3OD1A 2ZANA 3O8CA 4EHBA 1YZQA 4M83A 4MLPA 4MWCA 4A91A 3HS3A 3L8YA 5BMVA 1GZ4A 2V5UA 5F4BA 5KJCA 3GP8A 4GI3A 5KYKA 3MCUA 2WLTA 1ZKMA 2WMNB 1VLZA 2QNRA 4HQKA 5CH8A 4QASA 3R6WA 5EJ2A 5TPWB 2JGMA 3R24A 5FTLA 2I7VA 2OHHA 4BP8A 2IH4A 4JJFA 3K73O 1K98A 1ZM2A 1CUCA 2G9NA 1O89A 2FW1A 4O3MA 2WTEA 3QOXA 2N1BA 2D0IA 4L5YA 2BEWB 3BTUA 4MIEA 1JLKA 3EJWA 4Q3DA 2Z2ZA 5IJAA 3UAOA 4XYMA 4S2UA 3ZWKA 3WBKA 1MJFA 2OA0A 3ELUA 1U0HC 4QNRA 2YC2C 4I66A 4P81A 5EJAA 2ANBA 3BSSA 4H7FA 1K7YA 4HLNA 2DKFA 3NHZA 4C0XA 4R1LA 3RTBA 2O0KA 2QLNA 3L7IA 3RF6A 3ZD6A 4LKOA 1Z2EA 2VF2A 3I2HA 3I8OA 3LMKA 4R1MA 3G5AA 4NR0A 3IVCA 2Y2UA 3NAQA 4A6PA 3ZHQA 3B5JA 1JF8A 4FUTA 3JQBA 4JUBA 3N8NA 5DEIA 4ZO6A 4CETA 2OO7A 2WHEA 1PL0A 1KFEB 3BCUA 4FSDA 1DHRA 2CCJA 2Q1XA 1D9ZA 1SVIA 2HLDA 1DX9A 3GN2A 3ML1A 3NTVA 3PUZA 1TC2A 4XSGA 1ZIOA 3H2JA 2ZR7A 4WY2A 1PSZA 2CF6A 4O8CA 4V2IA 4TTIA 1CRLA 2V7QD 1WETA 3MB8A 3R6GA 4TOIA 2GZ1A 1RXUA 3VNVA 3V8BA 4IDPA 3B2QA 3P97A 4BQNA 1EUCA 1LY1A 2C58A 2QI9F 4XUCA 3CVXA 2CDAA 2WJPA 2AR9A 2C2KA 3BH6A 3NT5A 2FOXA 2I1QA 4DDKA 3OWHA 5IJWA 3TTUA 1P74A 1LLUA 3LRXA 3AC0A 3N76A 2NVBA 2PX6A 1LRKA 2CUTA 4XGKA 1K6EA 4EKDA 1H8EA 2Z8XA 3DWFA 3EZFA 4LXHA 1XXHB 2PS9A 3JASB 3WY9A 4E5YA 1PX0A 1E6WA 3FF4A 4M8LA 2H51A 5KREA 1I0ZA 1BKDR 3LU1A 4CLHA 5EIAA 1EPUA 3FSGD 4X85A 5HMLA 1GL3A 3E2PA 3NWJA 1FYFA 3FYCA 4YJ3A 1RQLA 2TS1A 4HWKA 4DQUA 3EN0A 3QKUA 5AWFC 1PJLA 1X7DA 5JQGB 1NHGA 3HCOA 3QM1A 5CDHA 4ZQHA 2IU6A 3Q8KA 4OLBA 4ALKA 4C20A 1G41A 2VJNA 3DOUA 1P1IA 1B42A 3AP1A 1Z83A 4C6SA 5GIPE 5F73A 3KZMA 2VXYA 1PS0A 2O8DB 3N8GA 4Q3LA 1X42A 5AKGA 3RVPA 1TM4E 4RL4A 3R3JA 1Q11A 1SU8A 4L95C 4XARA 3INTA 3WKCA 2OV6A 2Z30A 4LNAA 1DWOA 4F96A 1SHJA 4JEHA 1OA0A 10MHA 5AVQA 2VXOA 4WXYB 3TJMA 2HT1A 4OK3A 1E1CA 4WK4B 1C8VB 3EZ6A 1DAIA 2ST1A 5ES4B 5IABA 3NNDA 5IP5A 3RYTC 4R84A 1T2VA 4HBGA 4KNVA 1XTJA 3FWKA 1NBEA 1VLLA 4J91A 5A6SB 1TAQA 1FMFA 1JPNA 1N1MA 1NY5A 1WUTA 2UZ1B 1E32A 1OAAA 3GXOA 1L5LA 3WGGA 3RASA 1NBMA 2ZIEA 5JD6A 4XKJA 2TRSB 3P9ZA 3V3KA 2D0OB 4Q48A 4BO8A 5KMGA 2WWHA 2O06A 3SZMA 3TXXA 3BRWA 2ASEA 4GKJB 5CT5A 1R0CA 1JHYA 1F8GA 1TUBA 3P5SA 2WT8A 3QTTA 2ZROA 4Q4DA 4QGGA 1MW9X 4A2PA 1JHMA 4NLLA 1ZY2A 3C74A 4FNAA 4OD0A 4R1UA 2A7XA 1EFAA 1OLUA 1ZH0A 4GKVA 4K6FA 4MGHA 3OIFA 4LOIA 4P84A 5CTJA 3WFZA 2DR2A 3H87A 3HYLA 3QJGA 1NY6A 2NU6A 4JUCA 1JMYA 3JD1A 3VYUB 4MV4A 2ADMA 3W8NA 1G3IA 4LGVA 3AERB 3R3WA 1RD4A 2BKXA 2J9FB 4MDHA 4J76A 4QYIB 2GF0A 4UBKA 1EFPA 1ESEA 2ETXA 2GHTA 3OICA 2AVNA 2R8RA 5UKDA 3EQ8A 4S1NA 3N53A 4X1KB 2PVSA 1GGEA 3F9IA 1L5MA 3UXMA 2FQ1A 1JPJA 5C46F 1OH8A 3CGWA 8GPBA 1I3NA 2HNKA 3VH1A 1CHNA 3EOBI 4LHWA 1JB1A 2VSOA 5EKSA 1DGQA 2V8OA 4PICA 3VI3B 3T4EA 1D1SA 2QTMA 3RTEA 2RKBA 3FCXA 2CC2A 2CSXA 3NCTA 3RFVA 2X8BA 1KXJA 1G8SA 2QE7A 3L8MA 2EU8A 3KBOA 3AHEA 2HRRA 2HPAA 3FFTA 4NOLA 4LVNA 1R4NA 3GEGA 3TL2A 4B80A 3EA5A 3B7WA 2OCGA 4JI8B 3P32A 4RA9A 1I2AA 1K5PA 1CUXA 1TNDA 1K5HA 1BDHA 2QJOA 3PL1A 4HGRA 4U9HS 4A6DA 3WBFA 4TVBA 1BE0A 2GBPA 4QTUB 2R6JA 4GOJA 4RMIA 1YUMA 1GPNA 2FUCA 3V4ZA 3EAQA 4B3BA 4F2HA 3EZ9A 4IJWA 3CR8A 1U8FO 3QHPA 5EWLB 4YK7A 4CM5A 4DRXA 4E09A 2PUCA 2RDMA 1YSCA 2CUKA 1Y5NA 3JV7A 3RJ5A 1ZQ1A 3ROGA 5GQSA 3V7NA 3W2EA 5GJCA 2RHGB 2ZXEA 4DSOA 3QBTA 4B46A 5JASA 1VTKA 1U7UA 4LGYA 4R9SA 4BMOB 1JIIA 4BO2A 5K8UA 3EPLA 3BJRA 1D8AA 1C7QA 2JIQA 3FOCA 3FROA 2B34A 3I9KA 3SS7X 2IUTA 1EFRA 3ITNA 3K9CA 4ZOLA 3HKCB 3OX4A 1DJNA 4IQ0A 3D1JA 3GJXC 1XQ1A 3I9JA 1MBZA 1H3EA 3NYRA 3MRSA 5FNVF 2ORWA 2W0MA 4L78A 2Z0MA 1DS6A 1QGYA 2C9BA 3BXGA 2MU1A 1DVRA 1XOIA 2DFLA 1F2TB 2BSQA 3NDIA 1Z7BA 3U7JA 5KUTA 1UZMA 2VTDA 4MVJG 4YEDA 4WOPA 3R7SA 1GR0A 2L82A 4TSFD 3S2ZA 3TW4A 4E5DA 5LMZA 4X62B 3T06B 2BHTA 2KM1A 3Q4GA 3T3HA 1C0IA 1RAAA 2Z04A 3GPDG 3LUHA 4YCJA 5AM5A 4KYTA 3E0QA 3EC2A 5F64A 2YOFA 3O8OA 1UJ5A 2FN3A 3DPSA 3G2KA 3LK7A 1C3LA 2GGSA 4ANFA 1SWVA 5JEEA 2R2GA 3X0DA 2CD7A 1M6NA 1RLIA 2CF5A 2PKWA 5T67A 2FCAA 2DAPA 1DX6A 5EIHA 1FRVA 3RAPR 3I6QA 1T10A 1N2GA 1HDOA 3FAZA 2XBUA 1G20A 8OHMA 1FTYA 5D6OA 3D64A 3C1OA 3NEJA 3P26A 1TD9A 3IKTA 1U0NA 2A5LA 2RHHA 2CLCX 1AB6A 2ZUDA 1HRDA 3KQHA 3Q15C 4OM8A 4NDAA 4N65A 4UTOA 3VZCA 1U2PA 4UREA 3LQ2A 4M0LA 3E4CA 2E37A 1UZNA 1T2DA 1TVKB 4JJKA 3LC7O 2XOKA 1KE2A 3WIEA 4N7BA 1PFVA 2QVCA 4ZYZA 4YRNA 1A0OA 4MMYB 1ZYUA 4HC4A 4NG5A 1JR2A 2PH1A 3GA0A 3R23A 5BWMA 3R7BA 3RGGA 3EF3A 4WZBB 2PDAA 4FE7A 1P2DA 2BMDA 3H1TA 3MHTA 4RNDB 3LDAA 1LI7A 1TQHA 4TTRA 2W6JD 5U9CA 1E2BA 3HI4A 1JFFA 1QNFA 4QBFA 1J0XO 4DQ0A 1GU1A 1BKSB 3DKPA 1XBTA 1PP4A 3I0NA 4KQ1A 4OLHA 3L0IB 1VSUA 3I1YA 2NUBA 2O1WA 2ZIFA 3OC6A 4PCLA 4DV3B 1B8OA 3UG6A 2DF8A 2IZ6A 2VAVA 3KTAA 5A7HA 5KNLA 3A6PC 2YBDA 4LWZA 5ALGA 2XB6A 1NTRA 1IY1A 1OBOA 1BFUA 2WICA 2R1TB 1YWGO 2RGEA 3F96A 5JMPA 3L04A 3PNYA 5JTUA 5AUOB 3T7CA 4G89A 1GTMA 2VDWB 4U2DA 4DF3A 2WA1A 3QTBA 1KYIA 2RBKA 1E0SA 2FPMA 1WCIB 3EQZA 1ZXXA 2PG3A 1XEFA 3VVMA 4C7MA 1PSWA 3LNCA 5TARA 3SQMA 3TOSA 3QEJA 3RJTA 3C4JA 5LNK6 1TDJA 3C0KA 3IURA 5MN6A 5AJTA 3LCVB 7MDHA 2QRQA 3CPSA 2IY7A 1FDWA 3L3BA 2O54A 3ANNA 1CYEA 5HBGA 1QS0A 2J4FA 2ZSKA 1LCIA 2FZVA 1B74A 1ESDA 3ACBA 2OCKA 3GLTA 1MENA 3ZZ0A 2D54A 1S0UA 1NT4A 3AVOA 4R68A 2QLFA 5CM8B 2W6NA 3IDQA 1X7GA 1E7MA 4K0KB 5GPBA 1RI5A 4BV3A 4RJIA 3HSKA 3WMRA 2R8BA 2ATCA 3W0LB 5A6VA 1YQTA 2GJ8A 1OXUA 4FGKA 2JB9A 1JJBA 1KZYC 1X1QA 2IY8A 2XHEA 3G8DA 3KE8A 1KDYA 1KZ4A 3FFAA 3CO5A 4H1VA 4DTIA 1X8KA 2PLNA 4RIGA 2Q3BA 4G24A 4M76B 3F1LA 3JQAA 2GXAA 5KSWB 3L05A 4ASUA 2L0XA 3QK7A 4EJ2A 4AJOA 5KTMA 1N1DA 1HOTA 2JBHA 5IAAA 5BR4A 2OC9A 1QOZA 2Q1YA 2GZ3A 1RQRA 3R9IA 3NHFA 1MW8X 1A1VA 1M2OB 4W5RA 1V1RB 1L5NA 3KCNA 4HGZA 4M21A 3OT4A 1RXCA 2VJBA 4HLQB 2QLMA 3QP9A 1KZ6A 1OZ0A 1UBOS 3E3LA 4IHAA 4K81B 2IFTA 3GRPA 1YMUA 2O4CA 4BYMA 2WC1A 4QE3A 5DGDA 3QI7A 1M8GA 2OBLA 1IE3A 2YN4A 2JFYA 3FLBA 1SPXA 1I4WA 2XYVA 2H0AA 4I3FA 4QO8A 3U6KA 3O3CA 4AMBA 1YQEA 1MIOB 1RIIA 3DH0A 1JFTA 3UGTA 4JGIA 2XNCA 4AO6A 1Y7IA 1Z4QA 2P2LA 2ZP1A 5AQEA 2JIOA 1HPLA 2B7LA 1EBBA 3NIFB 3QVKA 2MSLA 2UYQA 4OMUA 1D6NA 1LX7A 2FFAA 4GO1A 1VJ5A 2CLOB 4O2RA 1UQTA 5H82A 1BMFD 4EMUA 1OZAA 2OL4A 3PP8A 4EPVA 1YVEI 3ZW7A 4B0PA 4X41A 5ECDA 2EATA 1KK1A 3D3QA 1BX1A 1V96A 1FRNA 4QOIA 2P0EA 3I76A 3LXMA 4JY7A 4LOKA 1O96A 1L5GB 5FV4A 4X8HA 2AW5A 1TYAE 2G1PA 4Q7MB 5AVKA 1QHEA 2PZBA 3HYTA 1VRCA 3PHHA 1NVAA 2IT1A 3GRKA 4X63A 3EOAI 1INLA 3FYHA 2ZJOA 3N0RA 5BUQA 3EGOA 3KJIA 2NADA 4JJ7A 1VHQA 3G8CA 1LDYA 3DVRX 2ZTLA 3AUFA 3I72A 3R76A 4V24A 1IY9A 4HBZA 4CU5A 1G8GA 4IWNA 1XAGA 2EFYA 4KZKA 2B9VA 1GKUB 1ARZA 4RX1A 1LA2A 1YB2A 1GU7A 3AIKA 3B85A 1ACJA 4RD4A 3RF7A 3VYSB 4C9BA 4RVDA 4RTSA 1MAHA 4GPIB 1RMYA 2E4AA 4U00A 3E27A 3KXLA 1QORA 1IJKA 5KWJA 3T34A 3DMTA 3E22B 1J5EB 4C4XA 1OAOA 4JSRA 4M0CA 4PHHA 1Q77A 2QW1A 3ODGA 4G6ZA 4JSTA 4OU4A 1QIMA 3L6DA 4F86A 1ITZA 3LE8A 3LHIA 1T3SA 3JPYA 2OD7A 4ZO9A 2BMJA 3CT6A 3K15A 4R2HA 2B7CA 3PXGA 5BQ3A 5F35A 4ESOA 4GRAA 4UVDA 2PU7A 5IKEA 1V5GA 1A9ZA 4BLTA 4MUGA 2TYSB 3GLFE 5BNTA 1D2MA 2PZAA 3ACCA 3U37A 2X5OA 3ANSA 4BUZA 4EO4A 2C7QA 3IAS6 1QTIA 5FJIA 5IM4A 2C77A 2BRUC 2OPBA 1QH0A 2Q0QA 4WCFA 1CUWA 2Y9PB 4GUAA 5FTNA 1P9NA 5AO9A 1YQWA 1EZZA 1GN9A 2IUFA 5NULA 5M2QA 3BULA 4CR7A 4WTOA 4MINA 5IH7A 1F0KA 1RCTE 2GJKA 1VGRA 3C3JA 2CLSA 4CQMA 4ZRDA 4PC6A 2X4IA 2NM0A 3TLKA 1UBMS 2ZOSA 2QJWA 3NM6B 3BXOA 3QPWA 3VUFA 5L45A 4P3NA 2RAFA 1U8UA 1SGWA 5FF9A 4JT2A 5EQDA 4BMXA 2JGRA 3KO8A 2J6BA 1P75A 2VJDA 3OJWA 2OKGA 3RVKA 4MV3A 4ARBA 2H8KA 4KVGA 1XTTA 2I33A 1G7TA 3YASA 2CMGA 1OAKA 1PW7A 4KEAA 3T3NA 1EMDA 1MUUA 2VP9A 1IUNA 1C7EA 1XRRA 3KD3A 3N7AA 1XZBA 4LYAA 4AY5A 1OWNA 4KZPA 2CJWA 3PNMA 3V8NA 4CMCA 5HKAA 2A5DA 1FIUA 4R01A 1RRPA 2JFNA 2ZT5A 3F8WA 1E2HA 4G8BA 2GX6A 3A9WA 3K2QA 1S1MA 4EB6B 4RTMA 3UV3A 4JLDA 2XTMA 4MUJA 1AGPA 5T57A 4YAOA 3WO0A 1RPZA 3OJXA 3ZD8A 5CITA 4HXEB 1K6IA 1TMOA 3M83A 4PLWA 4XR4A 4G1EB 2YRFA 3AU9A 3OFND 1XJ5A 2XZPA 1D7AA 1WQ3A 4M1WA 5EN4A 4L27A 3CONA 1WBBA 1GTJ1 1WUIS 1E20A 2C5HA 3SYMA 5B5SA 5IARA 5CDFA 2H54A 1MQSA 1FX1A 1NXVA 3WMFA 1F0NA 3UFXA 4QGAA 1SRQA 3C7CB 3V1NA 4EB3A 4X1YB 2C99A 3O3OB 1P2VA 4KAFA 1J9GA 2IV2X 3HSYA 3E1KA 3PICA 4ZEVA 2HA3A 2W8BA 4GI7A 3UK1A 4Z49A 3NI2A 2PBRA 3IEKA 2HHAA 1IEWA 3ZGYA 2CY0A 2UZ3A 1PWEA 2YY5A 4B6SA 1Z68A 4IMPA 4CV1A 4FYIA 4NAHA 4CKWA 4WOKA 2VH5R 3W8RA 4CIYA 4CBVA 1LDMA 1AZWA 1HT0A 3F90A 5JVDA 5FL7A 2W2XA 1NW3A 3DF9A 3H11A 1J20A 1SC1A 2QG6A 2ADOA 3PDIB 4UMFA 3BD9A 2IHKA 5K6TA 1JWLA 1OTYA 4C7OB 3KEQA 1K2VN 3G23A 2HHJA 4D43A 3GLHA 5A7GA 3N0TA 4EHJA 4X7RA 5E4FA 3IMGA 4TL8A 3PHBE 1DIBA 4IW3B 1Z5WA 3MA0A 4WOBA 2F3RA 2EZ9A 2NXJA 4FE4A 5DM0A 1M6VB 3B3JA 4ZFNA 2IBTA 4QU9A 1UBCA 1Q0TA 2CLFB 2XKKA 2AN1A 1EUCB 1Y5IA 4N3GA 2H3HA 3NDBB 1Q74A 5EP2A 3W5IA 4OGLA 3ICVA 2ZPAA 3LQKA 2VT7A 2XQGA 3UEOA 5IJ9B 4QGHA 1MDFA 1N4AA 4DBLC 5A5GA 5FXMA 2E0IA 3G0DA 2AK3A 2MSEB 2JIBA 3SMQA 3L7LA 1U5CA 4HVLA 1M9NA 1Q3HA 2HJWA 4OFZA 4LF4B 3AHFA 1K7SN 2BGKA 3IJEB 4YP9A 4BIMA 4EGCB 3KETA 4NI5A 3TE7A 2C8LA 5EIXA 1YXMA 2CFCA 2HXGA 3CSUA 3O21A 4W9NC 4ZT3A 1YJCA 2ZZMA 3LWDA 5H3HA 2PRKA 2VHTA 1ZMBA 1NKTA 3QE3A 1Q7BA 3GRAA 3HXPA 3FVQA 1PJZA 4TKUB 4XGIA 3PEWA 1NM5A 3V8QA 3EB9A 4DCNA 4ENVA 1SBYA 1RKQA 1DINA 3ES9A 1MX3A 8ADHA 2I1WA 4LYGA 3LOUA 2HWUA 3DV0A 3GWGA 5AM0A 1UMCB 4DUZB 4HO1X 4ADSG 3LBHA 4TUYA 3BVPA 2V0NA 3BH0A 5DASA 2FR0A 3CLRC 3BIWA 5KHAA 4LMRA 2GPYA 2WSBA 4P4UA 1E9AA 4OXKA 4ZCTA 1O58A 2GAOA 1MVOA 3NDPA 3OTOB 1QZTA 1XZDA 2GPSA 3ZD9A 1CB7A 1IXZA 1G19A 3Q5DA 4KQKA 4HB0A 1RPJA 2QAIA 3A28A 4RCYA 2WAMA 5E2AA 3TD2A 3CTPA 3ZZNA 1G291 4FJ0A 4JJAA 4RPKA 3R7WA 4ZAGA 4BVJA 3ONEA 4PYQA 1NT2A 1T8UA 2EXXA 3S0JA 3TSYA 1U63A 5EIWA 4MDFA 3OT1B 5FPYA 3TL6A 4K46A 5JAPA 5JPDA 5A7FA 4YWHA 3QNMA 5BP7A 3GP5A 3ZH9B 3R5XA 3DVLA 2EJUA 4CV0A 4CMBA 3ZQ4A 4DCPA 2P6UA 3UH0A 2ZT7A 2P7HA 5ALVA 2JFHA 1YFKA 3B2NA 3PHLA 5BN5A 3U7HB 1ZUWA 2XUOA 5HKBA 3UAWA 4HH4A 4KN6A 2CJXA 4U39A 3FB4A 3NETA 3TIGA 2BL4A 2OHOA 4JXJA 4QDXA 1RRMA 1DCMA 3G7NA 2PUDA 2HOQA 1G16A 1ST3A 3GVPA 3P5BA 2WUEA 3BWMA 2LDXA 1R6BX 4HDRA 3S3TA 1X19A 2X58A 5ER6A 1ZK3A 2EZUA 3PF9A 2V7PA 2X19A 1AS0A 1B93A 1TD1A 2IYUA 1OC2A 2QX7A 3DM5A 3FE2A 3FZEA 3OMWA 4BNMA 1TIKA 4LG1A 3AR8A 3QV1A 1WUJS 4E22A 5ALJA 3SSOA 5CFOA 5KDDA 4NZNA 1W47A 2ZB2A 2P4EA 3IODA 4UQPA 3AQIA 4MWTA 1N2HA 3FVRA 4DMHA 3DD5A 3TKLA 1M34B 2C4HA 3GEPA 1E3WA 3TEMA 4N01A 1W4LA 1NVEA 2HZ7A 5FTJA 3ZQJA 1LVUA 4JX9A 1A04A 4ENSA 5F2NA 4IFBA 5HUJA 1GZUA 2GB4A 1K0FA 3ZYZA 2X8LA 3CJQA 4EG1A 5KX5A 1QE3A 1I7NA 1P62B 3GNLA 3TH5A 5INTA 3CT4A 4D79A 4XYGA 1XCLA 5AKJA 1ZRNA 2IWHA 4CQLB 3ETJA 1TPYA 3FKQA 1RYDA 3KR9A 3LBAA 3EJ6A 2WPDA 4DA0A 4IRMA 1ZOOA 1B14A 4N48A 4DW8A 1F1JA 3HUDA 1IEQA 1MPXA 3OPNA 3ETHA 4FEEA 1GZSA 4LJ8A 2F1HA 2FRDC 4NNPA 4OHMA 1ULSA 4O0LA 2XMBA 4HPWA 4XUEA 1R4NB 3D0OA 5ICCA 1Y1SA 1QHYA 3KKLA 4MMZB 4Q9JA 2GESA 4RA9B 1BJRE 3KKZA 3KS9A 1RP7A