1EHCA

Structure of signal transduction protein chey
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
128
structure length
128
Chain Sequence
b'ADKELKFLVVDKFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHEY
molecule tags Signal transduction
source organism Escherichia coli
publication title Uncoupled phosphorylation and activation in bacterial chemotaxis. The 2.3 A structure of an aspartate to lysine mutant at position 13 of CheY.
pubmed doi rcsb
total genus 47
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 1996-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ehcA00
4PZ0A 4KFCA 3NBMA 2ID9A 2JBAA 4NICA 1Z2DA 1BDIA 1S8NA 2FXIA 4EYGA 4XARA 5EWLA 3I5AA 1LBIA 2FKAA 3E3MA 4Q6WA 2ZAYA 5JS1A 2MSKA 3LUCA 5IUKC 3OO1A 4YLEA 4D6XA 2A9OA 4MLCA 4RXTA 4MYRA 2MYNA 3GRCA 3KTOA 5FWXA 2PUEA 1I3CA 3N0XA 2B1JA 2PKXA 1ISSA 4RK0A 1ABFA 3LUFA 3RH0A 1ISRA 4RKQA 1JH9A 3DLBA 4OLAA 1NXXA 1DP4A 3GL9A 4F06A 3BRSA 4QICA 3H1FA 3KLOA 3QELB 1GCAA 3FFWA 1NY5A 3EDCA 2LP4Y 2QXYA 3QEMB 1USGA 1SXGA 4WWHA 1FSPA 4JAVC 3GT7A 3JVDA 1BDHA 1XHEA 4G0MA 3H5OA 2GI4A 3ROFA 5IULC 5CNIA 2WY2D 2PMCA 4Y9TA 2PUCA 4Z4GA 1URPA 3T6KA 1ZY2A 1Y1LA 5KQGA 2JVKA 2L17A 2TMYA 3CHYA 4MPTA 1E2BA 4QPJC 1JX6A 3HCWA 4IGAA 1JFSA 3H5WA 2F8TA 4G0OA 5KQPA 4MGEA 5CNJA 3OLZA 1A0OA 3A3KA 4MR7B 1H9CA 2FMFA 4Z4FA 3ROTA 2L18A 2R25B 3CNBA 3Q7RA 1QPZA 1Z12A 3MA0A 1E6KA 1DRJA 4KVFA 3HS3A 4WT7A 4YRZA 1ABEA 3DBIA 4RDCA 1QMPA 3IP9A 1Z2EA 3A0UA 1BAPA 4RY9A 3A10A 3VNAA 3F73A 1ZGGA 1EWTA 1QO0A 2YHBA 5KQMA 1E6MA 3Q15C 2WJAA 2PUDA 4ZMRA 1QNLA 3T8YA 1U2QA 1AB6A 1IIBA 5CHYA 3GYBA 1Z16A 3QLVC 2NT3A 3KS9A 4MRMB 2MYPA 5KI6A 1VPWA 1PHRA 2NZVG 3KSMA 1DCFA 1M5UA 2QSJA 5JNWA 4EYKA 4MS1A 2VUIB 8ABPA 3KKEA 3Q9SA 4TN5A 1SXHA 4XASA 4CBVA 4YV7A 4LE1A 1QQBA 3NNNA 1DCKA 4W5QA 4WXEA 4XAQA 1Z25A 2P4UA 3CFYA 4MR8A 1APBA 2FW0A 1FFSA 3RVQA 4N76A 3KJXA 4EUKA 4G86A 3O74A 5B3JA 2FQYA 3QLUC 4DN6A 1WETA 3A0RB 2PUGA 2XDYA 2LPMA 3FFXA 3GA5A 3JY6A 3CLKA 4HYEA 1QP0A 3G1WA 1C0EA 2QU7A 3F6CA 1MB3A 1Z17A 1DBQA 5KQLA 4LX8A 5EWLB 1JYEA 4TMYA 4S04A 1EFAA 2PLNA 2CHFA 3JPWA 3LMKA 4MR9A 5TPWB 4D6YA 1R8JA 5I4CA 3OM0A 3B2NA 4NQRA 4G97A 1BVHA 4KREA 3OO0A 1JYFA 2DRIA 5FBHA 1L5ZA 2H3HA 3H5IA 4YO7A 1EHCA 4KPYA 4RXMA 3HZHA 1ZDMA 2CD7A 1USKA 4E7PA 3T38A 4LRQA 2Q5CA 4IILA 3NHZA 1ZN2A 1NXPA 1ZHHA 3QEMA 4S05A 1RZRA 3GBPA 4LDAA 3OQMA 1PUXA 1LJUA 4GPAA 2QVGA 3K4HA 4HNSA 3JVIA 3LUHA 3O1HB 4LDZA 5IEJA 1NXSA 3L6UA 2FN9A 1TMYA 1GLGA 3N0WA 4F11A 3BILA 3I42A 1D1PA 2WB4A 1A2OA 4KK4A 4XFKA 2I6FA 4EY3A 5DLEA 1RZRD 4EGSA 2FN8A 2J48A 4GNRA 5EWJA 3LUJA 4RXUA 1JBEA 3G85A 4XXHA 4EVQA 1PEYA 3CG0A 3HV2A 3EQZA 4TLMB 3H1EA 3O21A 3RVSA 3KYJB 2VK2A 3FFTA 4IMIB 4W5RA 3H1GA 4Z4CA 2HQRA 4HNRA 2IDMA 3RVNA 2VYCA 5BQ3A 2GWRA 3Q7SA 4RSMA 2FLKA 5FBKA 2PUFA 2IYNA 1P2FA 2GBPA 1AB5A 3IPCA 2E4XA 4RY0A 4KQ9A 1YTUA 3NHMA 4Q6BA 4NCBA 2FLWA 1FQWA 1TM2A 1F51E 4Z9BA 5DTEA 4FE7A 4JA2A 1PNTA 1XHFA 2QZJA 3TMYA 2L19A 4MR9B 5JNSA 4E7OA 5TPZA 1P6UA 1MAVA 4RK6A 4MQFB 4PYRA 1CHNA 4UHKA 3JPYA 1VLZA 3KHTA 1PEAA 1SRRA 3IP6A 3N8IA 3QK7A 3OQNA 3EGCA 3D02A 3M6MD 3MM4A 3OLVA 3OM1A 3MMNA 5IBQA 5HM6A 3URMA 1YMUA 2JCGA 3RVLA 5TQ0B 4NCAA 4EVSA 3H5TA 3H6GA 3FDFA 2AYZA 1F4VA 5IUJC 3FMVA 3HO1A 2HPHA 3QLUA 3UKJA 1KMIY 3Q7TA 3CTPA 1J56A 5E3JA 3UUGA 2FMKA 4KK3A 3HUTA 4G0XA 5EWJB 2FQWA 1MIHA 3O2JA 1NXVA 1YS6A 4RV5A 1HEYA 4ETIA 4WZZA 1SXIA 2E4UA 4IRXA 1JWLA 1TVMA 3SNKA 2E4ZA 3KCNA 3SM9A 1GUBA 2JVIA 4H3KB 5TPWA 5ABPA 3SG0A 1ZGZA 5PNTA 1P8AA 5BR1A 2NZUG 2IPNA 2R48A 4MQEA 1JF8A 3EODA 4RU1A 2A9RA 2AYXA 1YMVA 1JHZA 3NNDA 4G0ZA 4HNQA 2NT4A 4PE5B 2JRLA 3LUDA 4EYQA 4G0QA 3LFTA 4RK4A 1W25A 3KYIB 1FFGA 4KV7A 3EQ2A 2F8SA 1ZH2A 4IMJB 5DGCA 1E6LA 4JB0A 3N75A 3TD9A 5TPZD 4TLLB 2FMHA 2P9HA 7ABPA 3RVRA 2A9PA 3O2SB 3KG2A 3LOPA 3H75A 1M5TA 3R0JA 4KQCA 2H0AA 3OLWA 3C3MA 4MQFA 2PAFA 3MQ4A 3JS5A 4OBBA 1A04A 3QX9A 3RVJA 3NNSA 3CZ5A 1L5YA 3GBVA 2FEPA 5KC8A 2PUBA 3T95A 3RVOA 4F12A 4F8JA 2QW1A 3OLYA 1MB0A 1W9HA 3BREA 5T3YA 4ZPJA 3TO5A 1JFTA 4Z4IA 1OXKB 2HQOA 3RQIA 3H5LA 1KRXA 2ID7A 4XLTA 4YCSA 1D4ZA 1KRWA 1KGSA 5ED4A 1CEYA 3BRQA 3K9CA 1QP4A 2WWVD 3EULA 1QP7A 1YK1A 1C4WA 2CHEA 1DBWA 2IPMA 1LK0A 1GCGA 4ETMA 1NXTA 5TQJA 4RK7A 5JNTA 5GOTA 4FB4A 3CG4A 3DLHA 5IUNC 4O1IA 2R4QA 3RVKA 1XWWA 3OMXA 1P6QA 3HXMA 2LBPA 1Z13A 4JP1A 1SD5A 1Z26A 2PE5A 4ML3A 5EWMA 5FWYA 2HQBA 4QYMA 3F6PA 4P1ZA 4H60A 1DBPA 4WUTA 3QX8A 2PJUA 4MAAA 3MF4A 4YGXB 2IPLA 1QQAA 5KC9A 3VNBA 5IC5A 5C5CA 5BRAA 2OENG 3OMWA 2BGGA 4EYOA 5TQ0A 5JS2A 3N0RA 1RXEA 2MSWA 3N6VA 1Z18A 4Z4HA 1T34A 4RS3A 4OATA 4RK1A 3RVPA 1M2FA 2E4VA 2IPAB 3HDVA 3LUGA 4RZSA 1VKRA 4W5TA 2A9QA 3GV0A 4MS4A 4F3TA 5CNMA 4Z4EA 1MVOA 3RVMA 3OQOA 1DC7A 1K66A 2FEKA 2FQXA 4PEVA 3SY8A 2WJWA 4L4UA 4LE2A 2YHAA 5DCLA 5KWSA 3I45A 1EWKA 4O5AA 3P9YA 4FE4A 1DCMA 4MS3B 4EVRA 2FEWB 1YIOA 2WMYA 2CWDA 3H5VA 3IP5A 4N47A 3D8UA 3OLXA 1GUDA 1USIA 3CS3A 3DGFC 4H3HB 1FFWA 3HSYA 4O1HA 4MQEB 4P98A 5CNKA 1ZH4A 2HSGA 2JB9A 4RK5A 3LKVA 5F64A 3FGZA 1VRVA 2E4YA 3SAJA 4ZJPA 5TE9A 2LIVA 1U8TA 4JB2A 2QR3A 2JBAB 4KZKA 4Z9AA 3C97A 1B00A 3F7NA 4LE0A 3N53A 3CZCA 3TX6A 1D2AA 1JL3A 5EWMB 3CKMA 4OG2A 4KRFA 2RGYA 3M9XA 2M98A 3C6QA 1U04A 2QVCA 4D74A 3HEBA 3LUAA 1YVUA 3ILYA 1CYEA 1TLFA 1BDJA 3JTEA 3O75A 4YR7A 4NV3A 4OTZA 1DRKA 1UDRA 2V0NA 1OXBB 3MYYA 5HQJA 4JASB 3E61A 2B4AA 3M9WA 4Z0NA 6ABPA 1BA2A 3DGEC 3L49A 3HUUA 1ZAYA 5B3JC 4YWHA 3HJFA 1NXWA 1DZ3A 1JDPA 1YS7A 3QLTA 4B09A 1DG9A 3IDOA 1LBHA 1LJLA 3MIZA 4LZLA 4YP9A 3HVRA 1QKKA 3CRNA 4MLDA 3O1JC 1M2EA 1DC8A 1ZESA 5TQ2A 4KMRA 2O20A 3QEKA 2FVYA 1D1QA 4PICA 1NATA 3I09A 4W5OA 2X7XA 4RWEA 1Z15A 5C5EA 3Q41A 3UK0A 1QO0D 2NUBA 3EJWA 2VUHB 4Q7EA 5GQSA 5FWYB 5JNVA 2MYTA 4OLBA 1D5WA 1TJYA 1K68A 3W9SA 3LUKA 2M1ZA 4W5NA 4DADA 4IF4A 3H6HA 1U2PA 2GKGA 5FWXB 2MSLA 4WXMA 2W42A 4ZMSA 2GX6A 1RNLA 3GWGA 2ZWMA 4QYWA 3CU5A 1NXOA 2N9UA 3SQNA 2HJ9A 3HDGA 2RJNA 5HSGA 3EAFA 4N0PA 4ETNA 1PNRA 2LUOA 1JFVA 3QELA 3S99A 4DQDA 2PUAA 3HK2A 1ZVVA 2R47A 2IKSA 5BRJA 4MS4B 3IPAA 2FTKE 5D2CA 3HM9A 3QLVA 3DZDA 4MRMA 2PL9A 1EAYA 3LKBA 5JNUA 3BBLA 3TB6A 1YK0A 4N03A 3O1IC 4UHJA 2JK1A 4M88A 1JDNA 2MYUA 2RJOA 4G0YA 1NTRA 4MS1B 4RY8A 5DKFA 4Z99A 9ABPA 3C3KA 4MS3A 2L2QA 2FSPA 4YS6A 1ZITA 5T7BA 1DJMA 1RXIA 2KYRA 4MR7A 4L85A 2PL1A 3O2QB 4MR8B 1RPJA 2FMIA 2RDMA 2IOYA 3ILHA 4JOQA 3IP7A 4G0PA 3KLNA 4RKRA 5IEBA 1JLKA 2OQRA 5HKOA 2WRZA 2E4WA 3C3WA 2JVJA 5JNRA 5IX8A 4N0QA 5TQ2B 6CHYA 4KNYA 1U0SY 3LTEA 4N41A 2QV0A 4ZYLA 1EWVA
chains in the Genus database with same CATH superfamily
3IBCA 1SCIA 3R6TA 2JBAA 4PAGA 5HS6A 3C7DB 3W90A 3V33A 3A6HA 3KPYA 1Z4MA 4PYIA 5KTNA 3IEVA 4NBNA 4E3WA 3MQ2A 4D8XA 1S2IA 2BGJA 5BPFA 4WNIA 3PF8A 1FL9A 4ND5A 4NF2A 5EKSA 3UMYA 1WDLA 4Q1AA 1Z6XA 2HKIA 4KYTA 3RF7A 3O4FA 3AVXA 1CE8B 4JJZA 3LC2O 5FWXA 2WZDA 4BB0A 5CEJA 1OASA 2ZJ3A 1MRZA 3PEUA 1N1DA 1CSEE 1U6KA 2G8LA 1HZZC 4OHZA 5KKCA 4BZZA 1WDWB 1DQSA 3WQBA 4CQLB 4UPVA 4FTWA 1NXXA 3TAXA 4ZV4A 5IJ0B 1T1RA 3H1FA 4FUQA 2C92A 1H2EA 2FNAA 5JSZA 4ZAWA 4P4GA 5CK5A 2FPOA 1BMTA 2FP4A 4L73A 3JVDA 1ES9A 2BR4A 1SU8A 4MI3A 3RVDA 5CT8A 1T3LA 1MRNA 2NVBA 3VC3A 1MX1A 2W2KA 5EIBD 2REBA 2LGJA 3FVRA 5H68A 4X71A 3ZW7A 5DE3A 4EJ6A 4B3JA 1YUBA 4XZ3A 2PFSA 1H1LB 4L0MA 2AD1A 4MVCA 1YFKA 4C4XA 1KO8A 3C4JA 5HUQA 2XWPA 4R0VA 3NM4A 5J59A 2A7QA 5ICMA 2ADOA 5AVJA 4QLBA 4OXXA 4P0TA 1H93A 2NU8A 1YB7A 4HCJA 3ROTA 3N76A 4J0FA 2FGJA 3CNBA 3QJYA 1NT4A 1Z12A 4GMHA 5FCDA 1OU4A 3USZA 1EIWA 2QL7A 3TXYA 2FEOA 3IBYA 4IMPA 5D85A 3SMVA 4XI9A 3MTQA 4JELA 3T0IA 4LHYA 4ZI3A 4V1CB 3IIKA 5THKA 4U6NA 2P3LA 1YDEA 2PRZA 1ZUHA 1QMPA 2MSDB 4HEHA 5ICGA 5L3VA 3NS7A 4FFNA 3SCZA 2WVJA 3BZWA 1VBKA 3RO7A 3NC0C 3ES9A 1O9HA 4AJOA 3GPIA 4LZOA 1XLTC 3JRNA 4D1YA 2Y4NA 1XD2A 1S3IA 1A97A 4PAOA 1XLTA 4UU0A 4EB3A 4O2RA 5IPFA 2YJ3A 3CRVA 4HV4A 3A2LA 5KEIA 1RAFA 2M6SA 5FYQA 4OAQA 5B57C 1TMGE 1VIDA 2P41A 3NJ4A 1T4MA 4GX5A 2ZJYA 4LMPA 5KKNB 1J99A 1Y1PA 3KB1A 3KUXA 4N7MA 3ZE1B 7AT1A 5ECWA 1WDTA 4X64B 4AKGA 5KYTA 2C88A 3RS4A 1YZGA 1GTSA 4GXTA 2Z4TA 1J8QA 3RUAA 2ZBUA 3BKXA 2E1RA 4IIJB 1ISMA 3LPLA 4MS1A 3VVMA 2Y0CA 5KAMA 5KDDA 4KXUA 3IEXA 4K9LA 4E11A 4MITA 2GEVA 4XAQA 2QGZA 3CFYA 2NP6A 2BH9A 4D9CA 1FFSA 3ESQA 4C4ZA 1GPAA 3ZCSA 2O0JA 2JD2A 3V7WA 3O74A 5CGQB 5B3JA 1G66A 1K2WA 1EK0A 1GPBA 1NVAA 2XOXA 3OUZA 3QXSA 5T8KA 4HG2A 3ZNOA 3N39C 1UR5A 2CZQA 3UJCA 4EPVA 3PNMA 3UH0A 4Q4HA 1EGHA 4YALA 4RZUA 2G09A 3CLKA 1RQNA 3UHAA 4EHDA 1A7UA 5EIBC 3V8PA 1KMCA 3G1UA 4KKXB 1GP2A 3DL2A 2ORVA 4H4CA 4ZAFA 1DOAA 3OF2A 4BTVA 5KQLA 4BXOA 2WMDA 1ZX1A 1M7GA 4I50F 2ONZA 1JYEA 4QTXA 5DNAA 1ZCBA 3W79A 4G07A 1EK5A 1JB1A 1IXKA 3TLAA 4G1EB 3LOQA 2NO9A 4D82A 4E21A 5LUAA 3SMQA 4C2UA 1RLUA 2BH2A 3HCPA 2VPIA 4YAWA 4BKPA 4MPRA 1ECFA 5C8YB 1XCOA 3GNTA 3OO0A 5LYJF 4PS1A 4OJNA 4UU7A 3R7SA 3CVYA 4QDKA 1PR0A 3HMKA 3JAWB 1PSZA 2C0QA 2WLTA 3WBJA 4DJAA 4TMZA 1M8FA 4LRQA 5BWLA 1FZTA 2FFBA 3AFMA 3CNEA 1ZN2A 4GQAA 5FR1A 4S05A 1SVOA 2QYOA 3D4NA 2QUZA 4JLJA 2RGEA 3KYDB 4NLLA 2RGGA 2Z04A 5K0CA 1PUXA 4XOIA 4TS4A 2FPGB 1F2VA 5EL0A 4OHFA 2BHRA 5DP2A 4ZZIA 4G4SO 4OSEA 4FN4A 1D1PA 2WB4A 3VHQA 2FE4A 2ZIGA 4IXMA 4D80A 2AD5A 4YR9A 1JA1A 1VYUA 2OBFA 3HEAA 2UZIR 1R6XA 1F1BA 1RYNA 2A84A 5JBNA 4Z7QB 1FVFA 1GSIA 3CH4B 2CCGA 2B61A 1AKUA 3CG0A 3CXUA 3ZIDA 1W85B 5CDFE 3ZC3A 2R8YA 3DOCA 5C8DA 3I9JA 3D7LA 4IV8A 3MT0A 4ZQCB 1C14A 4IMIB 4MIEA 4J9VA 4OHPA 2JAWA 3FD8A 1V3UA 4HNRA 4JBYA 2PKYX 3H83A 3RVNA 3PXGA 3TIGA 4CKWB 3A6PC 4RSMA 3RANA 3MINA 4GKBA 2E1PA 4L4ZA 1GPWB 3Q0TA 2JG3A 2YXNA 2E18A 4F96A 2PBFA 2QSZA 1EP2B 4UE3S 2FWMX 1Y4UA 1Z07A 3AIKA 3L07A 4NCBA 3WG9A 2FLWA 1DL5A 3ED1A 3DYVA 2G71A 4M89A 4LY9A 5ECDA 5GZ1A 3E9CA 4MB0A 1KZ7B 3TX2A 2JCSA 4KC0A 3H0EA 2VDQB 2HQSA 3KZMA 4MJXA 4MWZA 5EERA 4P4NA 2R3SA 3I04M 5MGBA 4P22A 3T3HA 2C4KA 2HF2A 3EIXA 1S3FA 5HZMA 1NVMB 3O82A 1ORRA 2CVHA 2YVQA 3C15C 5HF8A 4RDXA 5JQGB 3MMZA 2XB6A 1SRRA 1RCUA 4R9RA 4LOAA 4NFHA 3OLVA 4AMYA 3VHRA 4QQKA 4HDCA 4WBNB 2FA9A 3ODGA 1D04A 2WFAA 5CA0F 3ESXA 5ALXA 2Q0SA 3OZIA 1CUZA 3GZJA 4OXYA 4XA8A 3AILA 3O31A 1IWPB 1N9ZA 2IU4A 2IITA 2YZGA 4FEGA 4IUCS 5CJ2A 3ZLVA 4IDQA 1G3QA 2DQSA 3AB3A 4K9NA 1FDVA 4MJ7A 4UMEA 2DFNA 3HLKA 2AGVA 1JEQB 3HUTA 3W6NA 4CQMD 5THXA 3VVBA 1QORA 2XLBA 4IWXA 4PONA 4W4TA 3GY0A 5L3SB 1M74A 1HEYA 1VJRA 1YACA 1QTNA 2M9MA 1PWZA 4IWNA 5AJXA 1V43A 1AKNA 4R05A 3VZRA 3THWB 2XA9A 2O7QA 5C1BA 5FV4A 2GAOA 1W36C 2IEAA 4B6OA 3P97A 1RHUA 2I33A 4OKNA 4OK5A 2D2IA 4B33A 1N9GB 1OUMA 2ZXFA 3QKRB 1Y8CA 3EXG2 3IA2A 3MPUA 5DTJA 1IMOA 2Q5HA 5EIAA 2P6RA 1N5DA 4RHTA 1M8PA 5EP3A 4Q18A 1DCTA 1YMVA 2R5NA 4NBLA 4BWGA 5K0EA 4MRAA 4QYIB 5ERYA 1C7QA 1Z7WA 3VR0A 1I2ZA 4GZ3A 4XYLA 4FHDA 3RG2A 2F8SA 1IPHA 3H11B 4F2DA 3GLGE 4II3A 3BVPA 4GQBA 1V5GA 4WBXC 4EGJA 5ELMA 3JQ7B 3QX7A 5D00A 1HDZA 4FFDA 5I4KA 2A4KA 1LXCA 2J0VA 1NF2A 1PFWA 1VIYA 1H3EA 1AK2A 2JASA 2WKQA 3CNOA 1E3QA 2QN9A 3GFFA 4LNUB 2A0WA 3NRCA 4M54A 1I80A 2QAGC 3NNSA 3LSYA 4Q4JA 3JATA 4TUYF 3BGWA 1X13A 5FOUA 5JAPA 2ZJOA 3P45A 5J4YA 1KFJB 3EC7A 1ZPDA 5BRNA 3W5HA 2WSIA 1H0RA 3L46A 2VTDA 2Z2JA 4PANA 4QODA 3RC3A 3RVOA 3W7AA 1J23A 1JG7A 3JYNA 3GJTA 2IYRA 1YAHA 4FS8A 2YZNA 3PXAA 2BCEA 3WI7A 3T12A 1B8NA 4RJIA 4A6DA 1V8FA 1GNLA 2DJIA 1ZLYA 4UJ5A 5JQGF 1DBWA 1TW3A 2YFHA 2ET6A 3JASB 4UU8A 2IPMA 3KNZA 5BWMA 4LK3A 3EGVA 3N2ZB 5IH3A 4BTEA 2JFVA 2BHTA 3TL6A 2IHKA 5K9ZA 3OJXA 4BO6A 3ZN2A 2A5DA 3K72B 1H2ZA 2IWRA 4GF5A 5I7RA 4KP7A 2GAIA 2HWYA 4RKFA 4UUMA 4UHHA 2DFLA 3FCCA 2PE5A 5FO0A 2RC6A 3WK8A 4BKOA 4G1UC 5A1JA 3GJYA 5BVHB 1VDMA 4EFMA 5J5AA 3LZ6A 4TV9A 4DA7A 4C7XA 2PX5A 5BUSA 2NQ2C 1QQAA 2YFQA 4DLXA 4TX1A 2ZKLA 3HR8A 3FI9A 3FMIA 1Y4ZA 5L40A 4DLBA 1KK1A 2HHLA 3OMWA 3SX0A 3TPCA 4EYOA 4ID9A 4MW0A 1NSFA 4WKOA 4ZEOA 2Q49A 5JS2A 5I3CA 2MSWA 5F4BA 2P68A 3INRA 3GDFA 1JEYA 3EDYA 3TLGB 5AICA 5LCXA 4RW0A 1QHNA 1A5TA 5BT8A 1A8IA 1CZHA 3HUDA 3B5EA 4YUYA 3RVMA 1P7VA 3ZS9A 1HNNA 1V1RB 1LJ8A 3V1TC 3I0NA 1CVRA 4D3FA 2X22A 4ZFNA 1AQYA 3FUCA 3GIDA 3I92A 5ILQA 3F8WA 2HPAA 1NG9A 1JZTA 2Y8EA 1A9XA 2JFYA 3HZZA 3X2FA 4HYYA 4BFZA 1C3OA 4Y67A 2VDUE 4NE7A 3IXLA 3WKEA 1NC1A 4D5GA 1OFUX 1L5GB 2QUHA 5GVRA 4BBPA 2RHGB 3PDJA 1E7RA 3U5ZB 4NNOA 4TSKA 1O2DA 3RE1A 1JTVA 2ZYAA 3VO1A 5IX8A 2AOTA 2WD9A 1KI8A 2WB2A 1GAJA 5LA6B 2CFIA 4AZVA 1RT9A 1JTEA 1R5BA 4LF9B 1DBRA 3WXBA 2HZBA 3F1KA 3ZDYB 4A0RA 5HIJA 2V8OA 4AO7A 5EJEA 4I3HA 1ENZA 2CSXA 3IH5A 3DBHA 1FW6A 2QLTA 1Q0PA 4FFLA 5GINE 1ZHOA 1CS0A 1J0DA 2H2GA 3KDAA 1G1MA 3AETA 3GI1A 4OGWA 2J0UB 1O96A 3N53A 4QDUA 4A8PA 3ILXA 5H81A 1DG1G 2BL4A 4C7MA 1HYBA 1L7AA 4IV0A 4JCCA 2ONCA 3DYBA 2I03A 4BRWA 4EA7A 2EP8A 1R6VA 2WK1A 1J0EA 3WKCA 2Z2YA 4K81B 5KTMA 4RKYA 3TZLA 5B58C 4E2ZA 1I4LD 1QIEA 2IOQA 3VR6D 2I1QA 1XZGA 5EMMA 2YBDA 3EMVA 3KZXA 3HKCA 3KVVA 2EBUA 1BA2A 2CT8A 1E5XA 5EP2A 2W2XA 1DRUA 2IYEA 1U8XX 1DE0A 1Y7HA 4O29A 5LP6F 1YJXA 1EP3B 2OCIA 3D7NA 3I01M 1A4RA 4W8OA 5EHIA 4DCOA 2ZVDA 3M7IA 4BUCA 4R3UC 2O1SA 4L51A 1N57A 1U8EA 2B7CA 2OUKA 1N0VC 2V58A 4FI3F 4IHQA 4IOMA 4L6AA 4LSMA 5DI3A 2ZBFA 2VG8A 5LVAA 4RTJA 1ULHA 2JH3A 4BLWA 2PWYA 1D1QA 2CCJA 1OX5A 1A72A 1ETHA 3IP1A 1HMPA 2Y9PB 2YXPX 3FWHA 4IH1A 5IHXA 4S12A 4HQ0A 1XZIA 4G5SA 1P29A 4D41A 1VA5A 5CA1B 1QCZA 1E1LA 1X92A 3AEKB 2NVUA 1TM7E 3Q3GE 1KEWA 2OHGA 3NO4A 2CEAA 1GL7A 1XVUA 3W9SA 4JLUA 3GRPA 1EDEA 4KYUA 4RTMA 2OXCA 3GMSA 1Z4IA 3ELWA 3GLRA 5G4LA 3E7PA 4XCXA 5FH9A 5GIPE 3EEBA 1DKUA 3GEHA 1YTLA 2AEEA 4L9WA 4F91B 5KOYA 4QYWA 1EZ1A 2SKDA 5H3LA 1M2OA 1A8PA 3SQNA 4BRZA 5ISMA 1CQJA 3T4UA 4L4XA 3EXFB 5J5CA 3DO5A 3W34A 1RTTA 2GEJA 5F5LA 1N6PA 3RIEA 4DQDA 3SZGA 1G0NA 3FW1A 1U7UA 5FHRA 1JXMA 2CN1A 2AOXA 2G77B 4LHWA 4LXTA 5CCDA 5CCEA 3QU2A 3ORYA 3HM9A 1RMQA 4MKIA 2GN0A 3QV1A 3U56A 3C6ZA 5JJKA 5DGHA 2YX1A 3BBLA 1CZUA 3KLBA 3TOCA 4J3JA 5DYTA 3H0CA 3OQ6A 1CNEA 1JDNA 3SDBA 5C2JB 3RIYA 2XUIA 3OIVA 1JIVA 4RORA 1X7WA 1HQDA 1IUKA 3TN7A 4MPJA 2Q0XA 4AF8A 1PQ4A 1U2GC 1GKLA 2PL1A 2Y1FA 4D9KA 5K8TA 5BOVA 4OHKA 3TLEA 1WQ3A 2OORC 1CQPA 1XLUA 2QXUA 4OU5A 1F6DA 5J1TB 1F0YA 2OQRA 1X1TA 5JISA 1CK4A 1E3JA 3BF7A 4X6XA 3ZXUB 3BT7A 3QXXA 4I8DA 3GLGB 1ZJ4A 1LRKA 2ZATA 3HCBA 4FQ7A 4XARA 4EAQA 2XTAA 3M5PA 4U8GA 3B3GA 5AW3A 5EIXA 4ZYZA 1EJ6A 3MHPA 5FO1A 1OX4B 2FUG1 3DO8A 5EIFA 4Z6KA 5CYGA 4F4DA 3EZFA 3GRFA 5EWLA 5IJZA 1UDWA 1N2IA 2ZGVA 3WOHA 3AY6A 2QD3A 5T6MA 4AT1A 4HNTA 4UBMA 1A71A 2I8LA 3A9CA 2CVFA 4KQXA 2H0RA 2MYNA 4DA9A 3KP1A 3E4DA 1JHMA 1I3CA 1YOVA 1NBME 1OA0A 2HAEA 2R79A 3JZFA 1K2VN 4PG5A 3WQRA 3N8HA 4B48A 3TRHA 2VJQA 3G0GA 4L50A 1VDZA 4PAWA 4EUHA 8GPBA 2CMHA 3IUBA 2ZI9A 3EUAA 4N40A 5KHOC 1ISRA 4H0NA 1Z5UA 1U7PA 3RKRA 4OLAA 1LF5A 3IOBA 4F06A 3GH3A 1D09A 4V3CA 4LI3X 1EJ2A 1XNHA 2JHCA 2ZSUA 5DTRA 1B76A 1T2UA 1UZAA 2F8MA 1C41A 4GYJA 4PRLA 2OWEA 4U1RA 4UZSA 3C70A 1AHPA 2BFEB 3GT7A 4A4DA 1Z3IX 2HCRA 4ZVPA 1NNSA 3R9KA 3CEPB 2DWCA 3RIMA 3VDXA 4ZEMA 5ITSA 2JGNA 1OX6A 3G5LA 5KWEA 1TK2A 2VP0A 1WVMA 3OZ7A 3VU1A 1VHJA 5IVDA 4DPKA 3DA8A 3AUYA 4AZSA 1NULA 1UC4B 2JD0A 3OJ0A 3T06B 1NN3A 4S1WA 5DM4A 4AY5A 3LXRA 2OECA 1DJPA 1N2GA 2HEIA 4CKEB 2C04A 2FPSA 3KR0A 3W2TA 4NBWA 1QHFA 4LJ9A 1SUIA 1E2UA 1U2SA 1A0OA 1NAIA 3EG9B 4L5JA 1FMJA 4R1LA 4UTXA 3TE7A 1SEPA 4MHTA 1OA1A 1F8UA 2R25B 2FEAA 2O23A 3AF2A 3OZFA 1X39A 4JLAA 5EJ6A 1CNFA 1UFRA 2WAOA 5DCYA 5KQRA 4N82A 5CCXA 4RZQA 3WYEA 3DFKA 1L8QA 2W6IA 1D6MA 5K4GA 1YZKA 1IBCA 2AV6A 4JUIA 2WHPA 1BAPA 2YV5A 4QXMA 4DBVO 5BP7A 4CIYA 3QVGB 4OHMA 4ZEWA 3JQQA 4CU5A 3WGZA 2I29A 1I2DA 2I80A 1ZN9A 1WF3A 2EGHA 4W9NA 1T4CA 2PSSA 2CE2X 2WVAA 3TNDA 3NUGA 4DCSA 4PBRA 3L0ZA 4RGBA 3KS9A 1G5IA 2H1FA 1Y48E 1ZGCA 4BVHA 4PAQA 3OJOA 1V8ZA 1VPDA 4K6CA 5M7EA 2GZ3A 5L7YA 3UAOA 1DCFA 3TW8B 5KYXB 2G1JA 4L8GA 2VC2B 2MINB 3LCUA 1E3LA 2SNIE 3ZIUA 1KO5A 3ZK7A 1PNOA 3V97A 3DG9A 1QQBA 4MCAA 4K87A 3I73A 4YXFA 3SI7A 2OAEA 2AUTA 2Y77A 3C5WP 1DXYA 1UOOA 2P4UA 2PT6A 4JXKA 4LEIA 2O3UA 4O5OA 1DC3A 4O02B 4RPCA 1QX3A 1Y3HA 1ZSNA 2G4LA 1Q7CA 1CG6A 2V7UA 3HBFA 4NZZA 4O3FA 3N87A 2AFIE 4V0ME 3S2SA 4WN3A 3TDMA 3K0AA 2C8LA 4HRXA 1D4OA 2H4ZA 4OP1A 4L74A 2FK7A 1VMKA 2J85A 4Y1FA 1HT3A 2VZ9A 3R6GA 3GJ4A 5EZ6B 1ELOA 1SIUA 1E5LA 1JDZA 2QSYA 4H6PA 3R3JA 4KGDA 1V0JA 3A0RB 2XDYA 1GQOA 1UC5B 1E4OA 1SPXA 1RIIA 2VP6A 2GZAA 3JY6A 3NBFA 2GPBA 5EJ9A 1CZRA 1K8QA 4IGEA 2QU7A 5DW0A 5EMLA 4BB6A 1VG1A 1U0FA 1UM9B 2YKGA 3C39A 3HFJA 1N2ZA 4YECA 4TMYA 4TVBA 1RE1A 4DIFA 4OP3A 1ZD5A 1PSWA 1PJSA 1GNSA 2GPWA 2QUKA 2YOHA 5FWDA 4D3YA 5T4EA 4CKBB 4F1WA 5ARBA 4AN4A 3E0QA 3RD5A 4FIDA 1DFHA 3GFQA 3KHKA 3TQFA 2EWWA 4YJHB 1G63A 4QO7A 1C3EA 1TPYA 2GTIA 4V3BA 2Q6TA 4AJ4A 4YO7A 1NJ6A 1YB6A 1C9KA 1EHCA 1TLLA 4JYCA 1AJEA 4XEUA 1TCBA 4GLBA 3WRYC 3AR2A 3I4LA 4IDPA 4M7PA 3CVUA 1A9OA 1I10A 1IHYA 2B0CA 4CG1A 3EGDA 3GJ5A 3WLIA 2RI6A 3Q2KA 4HTFA 4A6EA 4ECEA 2QTMA 1ISPA 2J7PD 2PX3A 2Y0BA 4KACA 1HETA 3BMOB 3RARA 3NPAA 5TMEA 4ZK6A 4LDZA 4MYDA 5CGZA 4Y6SA 1E9DA 4FMBB 1K8ZB 2FPLA 3BXHA 3TW0A 5EP4A 1ORDA 2AQIA 4QAJA 4F11A 4C4YA 2DBYA 2AXNA 3BE5A 3HABA 1GN9A 3A4NA 3UHPA 4Y1RB 3SKVA 5IRCD 5CBKA 1TRHA 2RHDA 5H59A 2QA5A 2FU5C 3G2QA 2WHEA 2F1KA 3G85A 2RHRA 5D86A 3JZDA 2OGTA 1FPMA 4CV2A 1OVGA 2J3JA 2XRFA 4J1SA 3KJGA 3H19A 3RRBA 3RYCB 4J1TC 2H9AA 2RGNC 3DFMA 3FTEA 2H4XA 2OZEA 3GDGA 3HA2A 2V7WA 5ALRA 3BWCA 1EVIA 2G5CA 2W5UA 1Y6JA 4U2FA 3PD1A 4WCFC 3QPUA 2ERCA 5JAOA 1ZA1A 3RG8A 4C0QC 5JT1A 2IEIA 1QLJA 3QV2A 1SMKA 1DQRA 4NK4A 5EXPA 4M36A 4U2EA 4ZHSA 1QU2A 1N6NA 1Q1ZA 2VNAA 3IURA 3SXUB 3AF0A 4DCGA 4IY1A 1TO1E 3IPCA 2W2LA 3O4RA 3IP8A 4YAFA 5HW0A 2X5KO 1PYOA 1JIJA 4Q6BA 5ELXA 2QM8A 4EHBA 4FSXA 3HNPA 3T4XA 4HWGA 2R6AA 1S4MA 4LXIA 5GADl 1NU8A 3ZZNA 3CLVA 1IWOA 3NDIA 3U16A 1K6XA 3EARA 2DCMA 1B42A 4QXRA 1WA5A 2C84A 1M8JA 2IX3A 4HJXA 4YRDA 5DWVA 5C3UA 4JLPA 2ZRPA 4E5VA 3ESRA 5KNCD 2WKWA 3PUZA 3RNOA 4ARZA 1O58A 2IXEA 1BFKA 2G9UA 4GEKA 2PSFA 5TJHA 2ECPA 3SX2A 1GZ6A 2FZKA 4OGGA 5A5GA 5HK9A 3OM1A 5IBQA 2CHGA 2VP2A 3A32A 3KAQA 3PSHA 2CDBA 1YR3A 1MC1A 3EFOA 4EAAA 1GSHA 2JFGA 2X9QA 3A6KA 3DCIA 1QS0A 3OZUA 4QFDA 3GLFB 1C7JA 2AYZA 3G5AA 1QHHB 4LGCA 5CX1A 5BWNA 1LLUA 2H52A 1M6WA 2ZK7A 3BSYA 2B6NA 4DVGA 4EQZA 2GM4A 4DQVA 2ZE7A 5IJXA 2B99A 1QC5A 1SCJA 1Y4AE 3T9BA 4B6FA 3OM8A 1UZMA 2E5WA 3PA8A 2H11A 1HT0A 2FMKA 3RKUA 1T9GS 1VE3A 2YL2A 3QKIA 2AOUA 1NMXA 2XH8A 4KXWA 1NLUA 1NXVA 2BRUC 1W8IA 1KDVA 1G3UA 4W1SA 6AT1A 1T9HA 3E1KA 4FXOA 2PX4A 1IOZA 4JZKA 2VL7A 3W06A 1U6IA 1FFEA 4B40A 2BUAA 4QYXA 4C14A 2Q7DA 1KYQA 4LZJA 4X6YA 1MN6A 2B83A 5JWRA 4DUPA 4WKBA 2H1WA 4NONA 5DI9A 2OO5C 3TZBA 5PGMA 4M87A 5PNTA 4EB8A 4LYJA 4XW2A 2XBMA 2AR7A 3NC1C 4ARSA 3L7JA 5M3BA 2IF2A 4H4EA 3O3NB 4X91A 6YASA 1J2EA 1F8GA 1N2CE 2FYTA 3GEEA 2LV8A 3UG7A 5CEFA 1SVLA 2D1TA 3A1DA 4J07A 4KGXA 1JILA 1Y33E 1EYZA 4RK4A 4X44A 1YQQA 2MMGA 2I78A 2RH8A 1H94A 4GVLA 2ZR7A 3KYDA 1N0UA 2ZJ8A 3N75A 4M49A 3V8QA 1PZXA 1TM4E 3ZGXA 5KVCA 4ND3A 5HQ3A 2HQ1A 1TFUA 2QAIA 1PYGA 1T5BA 1ANKA 1EBBA 4FYYA 3CCFA 4ZOBA 4HWTA 4BAGA 4C4TA 1D1SA 2GGSA 3DE0X 5DSZA 3MQ4A 3OT4A 1NUPA 1B15A 3HY6A 3D7MA 4Y2SA 3ZTTA 2XMGA 1UBSB 2ECOA 2IF0A 4Y0AA 2Q21A 3G9UA 4DJTA 2ZSJA 2WJGA 2XECA 1RMTA 2TRSB 2FVXA 1SA0A 3PWSA 3ZS8A 3FOEC 3PZRA 3FIUA 2FWPA 1ZXXA 1QGAA 3VVCA 1T2EA 2CLOB 5CTAA 3Q1LA 4BFCA 4JYPA 4E1BA 1XPJA 3KQPA 4ZOLB 4YJFA 4FBGA 3GARA 1BHO1 4ASUA 3KUUA 2QT9A 4G8BA 3TO5A 3MJDA 3CF4A 1P1FA 1XAJA 3JR3A 1YCGA 3STWA 2Y0EA 2J0QA 1NASA 7REQA 4IVPA 1O0BA 1L5WA 1CEYA 3NEYA 3JSXA 3NQ41 3C3EA 4HB0A 4DA0A 2I71A 1OIXA 3DZBA 2UZ0A 1QFZA 2RONA 1G7SA 1T5OA 3ND5A 2JLCA 1RFGE 4ETMA 2P62A 3R1IA 3A7EA 2E37A 4PQFA 5J9FA 1CVLA 1MO4A 4FQ8A 4JYMA 4O1IA 1WD5A 5E4YA 4BLOA 4JHLA 3RVKA 5DNYB 3KZKA 1Y3CE 1YVEI 1BEUB 2LBPA 4QDOA 4X24A 3WB9A 4NOJA 4KITB 3Q5DA 4XGIA 3S29A 4HAVA 2KM1A 4I36A 1XPUA 1SUEA 1B1AA 1GYPA 4Z49A 2RAVA 5DN6A 4C30A 1J42A 2J3KA 3TJRA 2JLVA 3O3MB 3RDPA 3V2UA 4JLNA 1OXTA 5AJWA 3VYTB 1LVGA 3N58A 1P2UA 2FZWA 4ALNA 2OHVA 3ZLJA 3K30A 1BE8A 2NSYA 1T15A 1RXEA 2DBRA 2GA8A 5G0VA 3T3IA 4HB3A 4LGYA 5CT4A 1UWLA 1H5QA 5K3CA 3WLRA 1L4KA 1K6JA 1SC4A 3LDFA 4PHCA 2R96A 3SFVA 1V1JA 3NC4A 6PFKA 3ZEIA 4D4JA 4ZVKA 3OQOA 4HNGA 1MHPA 3N70A 4KU4A 4WESB 2AG1A 3TLXA 1NI4B 2FQXA 4PEVA 2WJWA 1UZNA 4BX3A 1ZR2A 2XMCA 3CC8A 3NFYA 5AQEA 1GT91 3MCZA 5DFAA 3ORSA 3J80A 3F9CA 1N2XA 3O8NA 1XD8A 3A05A 4JWKA 1YQEA 4GKJB 4BNVA 4RTQA 3OLXA 3S81A 1U2GA 2XEXA 3CS3A 4QU5A 2GVZC 1ZCAA 3AC0A 3R5KA 4DBZA 4JR0A 4MQEB 4JI1B 4OO3A 1GPNA 3FOCA 2D0PB 4AMBA 2YMQA 2A67A 1U3TA 1PZNA 5LKAA 3RAFC 3CIFA 4NE9A 4URHA 3AUTA 5CDUA 3GO4A 1BD3A 1RPTA 3VRHA 4KO4S 4N5HX 1J5PA 3EWAA 1XZQA 1Z28A 2GJSA 5B6IA 1HH4A 5BPHA 3K6SB 3TG2A 1YQDA 1PF7E 3FHLA 3GHYA 1E63A 3OEEA 4JJIA 5KWJA 4YTEA 2X7HA 4DCVA 4J9UE 4P5PA 2H9YA 5I51A 1GU7A 2Z5VA 4ZOAA 2O8FB 2V3WA 4WFKA 5F77A 1HDGO 5FTWA 4E5YA 1GRNA 1TJ4A 5KSPA 3TIFA 2FJ0A 4M60A 3UV6A 3KSDO 2ZRAA 1OQAA 3HEBA 3IMCA 4HPJB 1PT8A 3I23A 4P4SA 3KEQA 1P33A 3UA4A 1Z38A 4E07A 1UBUS 4RULA 1T0HB 2GCOB 1DRKA 3CRZA 4LHSA 5I7WA 2NU7B 5E4FA 5F2EA 2PXCA 5LJIA 4PINA 3W9YA 2J9GA 3EK2A 1JHQA 1QRAA 3QUSA 4DOMA 1DKPA 5B4UA 2WG0A 4Z0NA 2FW6A 3LGXA 5ARCA 5B3JC 4QRDA 3WLAA 3UMJA 5AJVB 4R3NA 4IZIA 1FJHA 1NZDA 1GNTA 4QTZA 1X38A 1HUQA 1KI2A 5K3FA 3SHQA 4CMJA 1X7ZA 4IDFA 4PGFA 1HA3A 3HVRA 5KTYA 1NQOA 1U0NA 1NRIA 4IIGA 4LRUA 1HI9A 3C85A 5HF9A 3L7OA 5IC6A 5AVWA 1M6HA 1ZESA 5TQ2A 4C0KA 2A3RA 1X14A 5GY7A 3DONA 4CFSA 1DHTA 3BSSA 4FW8A 5K99A 5CEEA 2QLFA 3TLCA 3GLTA 2IY9A 2XHEA 5HCIA 1BKSB 1XK7A 2W00A 4RWEA 3SC2A 1VJ1A 3DP9A 5A3RA 3COYA 5FDFA 3PSAA 3VU9A 2YHIA 5FPSA 2IP1A 1R0KA 2R6ZA 1QO0D 5HUHA 3RHSA 3GH1A 3L7LA 2FLVA 3IR6A 3QFRA 1U2RA 4MRSA 5GTDA 2JF0A 3EW9A 3H9QA 1U65A 3W3AD 1Y3BE 3H0KA 4KJZA 1N5LA 2PT5A 3W7BA 3T3EA 3ZIAD 3OAAA 1II8A 5F7ZA 5FWXB 4OU4A 1RWBA 4RA6B 4U6QA 2B20A 1F2TA 3PDCA 1WXGA 3C2QA 4HOYA 4IXNA 1Z3CA 1O5TA 1OVMA 1TOAA 1E0SA 4QLOA 1AZLA 4AZTA 3IVAA 2JGFA 1AC5A 3P9RA 2XUQA 3WAGA 1JIKA 2RKWA 1IOWA 1AK1A 1KY3A 1LC3A 2IIQA 2R47A 2V5VA 4KMSA 1IY9A 4UULA 1ZVVA 2QW0X 2WHQA 2A5YB 3FSGD 3G8YA 2A94A 3H2BA 3HPQA 3LX6A 4HXEB 4HN2A 4D4LA 2FSVC 2JW5A 2GBIA 3QLVA 2R00C 1PD0A 4ZDJA 2I1LA 2NUPB 5D3MB 3WL8A 3IIEA 5KTSA 1YK0A 4WZAA 2ZBVA 1IBMB 1U7DA 3AFGA 4QGGA 1H1LA 1F8FA 3LBAA 2B69A 3B9PA 1GGEA 1W52X 1K5DA 1U8CB 1OMOA 2ICAA 2JLAA 2IUYA 3U26A 3MJFA 1PP4A 1D7AA 2KWIA 1ESCA 1VMDA 1EE9A 3FRIA 1E0AA 2FPMA 3OIGA 4LPKA 3DBLA 3LBYA 1QF6A 3D6NB 5LA6A 2Q6KA 3OFJA 1BQ3A 3T4EA 3BGOS 3LYLA 4WK2B 1VE7A 1JBKA 2Y9MB 1EUCB 2CVQA 5E9QA 1TA9A 3NR2A 4R8VA 4HNVA 3GELA 1ESEA 1BU5A 2QV0A 3N8KA 4ZYLA 5L45A 4N41A 2O8DB 5CW1A 1JHYA 2ZAMA 5CVJA 3K4PA 3VNUA 2GYWA 2I3BA 5HKBA 1E3MA 5A0VA 5BV0A 2X6RA 4EHAA 3CCBA 7MDHA 4LJ7A 3W2HA 3KOWA 1MO3A 1GZVA 1ZVJA 1G6OA 2YW9A 3VDNB 4BAUA 1THGA 4CEHA 2XNDA 2JLWA 5FOVA 1IC6A 2PV0A 1YRBA 1LLQA 4L6IA 2PGDA 2B1JA 2Y05A 3IAHA 4AAYA 1WHSB 3W2GA 1YUNA 5KYUA 3O2NA 2JL1A 4QARA 3S1SA 2B7BA 2IEGA 2IHJA 1OZAA 3C74A 1N3IA 3FFWA 4IH4A 4JC0A 4JIMA 4XTRA 1USGA 4JAVC 5ALWA 1NV8A 5FUVA 2NW6A 3FGPA 1RWOA 2A9KA 4N3GA 5IULC 2WUGA 3WDSA 3WO1A 3WMGA 1H0HA 3RWMB 1J2UA 1DTSA 3T9FA 3D8RA 4M1SA 1P4SA 1L0BA 1ZUD1 2XPCA 3RAGA 4F56A 2JGAA 1FDOA 4Q21A 2G7ZA 5H16A 1ZVQA 5LPNA 3PDHA 1JX6A 1P0PA 3L8DA 1PEDA 1NMZA 2POCA 1Y63A 3T5CA 3U49A 3PUHA 1XU7A 4QVKA 2ST1A 3WKDA 1MEEA 2F8TA 4HSGA 1MVLA 3OLZA 4OP2A 3LPDA 2FPRA 4U3JB 4NS4A 1W85A 3TTWA 1KY2A 3X0DA 2FMFA 5INTA 4UTZA 5TXGA 3AEKA 5BURA 2L18A 1FRQA 2SKCA 4KE8A 3SHFA 2XF2A 2NO0A 3SGLA 4I4TB 3U9TA 4DPMA 2PS9A 3KQYA 2QUAA 5DYNA 3V1UA 2G6BA 2OG1A 2VXYA 2EKBA 4HDKA 1V8PA 3LLUA 4EJSC 3BWVA 3E84A 4EHJA 2R6CA 1E98A 3WGIA 1FSSA 2FDXA 2RBGA 3JAWA 3ANTA 1HFEL 4J76A 5LQSA 3WGVA 5I6DA 3NDBB 4KH1A 1KFCB 5KQMA 2WHXA 1YHYA 3B1ZA 1CRLA 2NZ8A 1JQDA 3L1UA 1G98A 1VQ1A 3P0HA 4P86A 2QX9A 3JVUA 7MHTA 3CT6A 2IH5A 3GUHA 2EZUA 2I3AA 3HH8A 4XRRA 3GOQA 1RW4A 5ENVA 3RV4A 5K8VA 2IS4A 1KHHA 3ZJYA 2ZDGA 3QVXA 3E0XA 3O92A 4FX2A 2MYPA 3RFCA 3LQKA 5C18A 2AJCA 3G7SA 4AIRA 4PLPA 2VJYA 3QHQA 3SR4A 1O08A 1EDOA 4IIYA 4U7TB 5FWAA 2OFPA 5JSHA 4PCVA 4JNKA 3BL5A 3B2QA 3EGOA 3I58A 3KKEA 2I99A 5CMLA 1HDEA 1ULZA 1LVHA 5GONA 1IK4A 4BNHA 1EM8B 1HLGA 1YB2A 4UVHA 5IG2A 2QE6A 2A1UA 3VNSA 3IULA 2WU4A 3JWPA 4UU1A 3PWKA 2QP4A 4PBTA 1RJFA 1UBKS 3WHIA 3IB3A 3TAUA 3RVQA 3OCXA 2IIBA 4E14A 3PQ2A 2E85A 4P7BA 3I2IA 4E15A 4INAA 3JR7A 1SC1A 2I6GA 4HAXA 3D6MA 4CKWA 2X77A 1SHKA 2ORWA 2WTXA 3UCFA 1LS6A 1WETA 1EFRD 3V4LA 5JYEA 2YXDA 3AKZA 3HQ4O 2R8OA 3UM9A 5B36A 1TVKB 3CA8A 3PKJA 4TYQA 5JCJA 4CF3A 3C4QA 5IZCA 4MSUA 3NHBA 4ARCA 3NHSA 4R2IA 5FLEX 3RT9A 2XCSB 1VPVA 2PCLA 1W36B 1P31A 2GVDC 1GCOA 4M2LA 1FVOA 4U2BA 4PX9A 1RRCA 2CCKA 2AWOA 4JVMA 1CZNA 5CITA 3EH1A 3C5HA 2Q4TA 2OLJA 1YXMA 2VSQA 4MW6A 4QDJA 3ZHXA 5H02A 3QKRA 1E9SA 1G9SA 4BWFB 2XX3A 2KQUA 4NFSA 2Q4EA 1O95C 3OFND 4B4DA 1JYFA 1SULA 2BBTA 2PZMA 2XUOA 4BLVA 1IFXA 2N3ZA 2PMFA 3CUTA 4IDGA 2WWTA 3F2IA 4M0LA 2VA9A 4JJKA 4PZLA 4C4PA 2A3NA 2Q5CA 3GVIA 5D01A 5EXEA 4FM9A 4CG0A 2WJVA 2QLLA 4IS3A 4MUIA 5E7QA 5L9AA 3GBPA 3K70C 2IU6A 3OQMA 2P35A 4YDSA 1GDTA 4Z8XA 1Z4JA 4IWYA 5IKOA 2ABWA 4HZUB 4JJ6A 5JFGA 4RMGA 1WF6A 1W4CA 2HJWA 3F6SA 3LC1O 1YDWA 1I24A 4KK4A 1P1IA 5EZ5A 4RENA 3BCRA 5J2TF 2QYTA 1WSWA 4V39A 2FN8A 4HN9A 2EL9A 1GPKA 3IDZA 4KIWA 2VWHA 3LWDA 3OURA 1I5RA 2O8BA 4QUEA 2YRWA 3DOHA 5J2TA 4FEYA 1NE7A 4R2KA 4A36A 4ACBA 1FX0A 3L6DA 5K3SA 1KR2A 6ADHA 2ZYIA 4JHXA 3D9QX 1E8DA 3AZOA 4RPLA 4YREA 3UHFA 4Z4CA 4YFYA 3SJUA 4U5XA 2W83A 4JBHA 4WNAA 4JR1A 1NYQA 2FLKA 2GUGA 3LWZA 4ZEVA 1NP6A 1NNUA 1P62B 2H5LA 4EY8A 1Y1RA 2VH1A 2ODAA 4QTYA 1M1ZA 1TI7A 2R8PA 2HFJA 1JQAA 1THZA 2AIRA 2Y67A 3FWZA 4N7BA 3CUEF 2GPTA 2I6UA 4FCVA 1LW6E 3L7DA 4KCGA 4S1OA 2XUPA 1II9A 3WNVA 3E4CA 5BT9A 1JNYA 4LRTB 2HSWA 3AF4A 3ND6A 2X41A 5U4XA 3HCCA 4BLRA 4MR9B 3DMGA 3G2OA 3CX6A 1FMLA 2G0TA 1D4FA 3HZOA 3MMXA 2EFJA 2PYDA 3CN7A 3H9JA 1XZFA 4KHZA 1ZGAA 2Z6VA 4PYRA 4FR5A 4XTCS 5FA8A 4DQXA 2HCBA 3FZEA 1TD9A 3KHTA 1F6BA 3KL4A 4YC7A 3HU3A 4EO9A 4Z53A 3SBXA 3OX3A 1DO0A 1VCIA 2FSFA 4F4UA 2C3PA 1XXLA 2J3IA 1KIAA 2O2EA 2Q3CA 2QN1A 4R1PA 1L7VC 4TMKA 4BNXA 1KO1A 2NUAA 5JH7F 4NCAA 4EVSA 1WZNA 2CJYA 2G5TA 3FDFA 4Z1MA 2VRCA 3TPZA 5CFPA 2DHEA 1W5TA 2A2ZA 3AFHA 4F4FA 4FUTA 2M6LA 3O7WA 1U2ZA 3ZQUA 3K9BA 3FWKA 1Y7TA 4B8YA 4DAEA 2IXGA 3K0HA 3LYAA 3Q7TA 4PZ9A 2BMDA 2FH5B 3GLHB 4QDXA 2BRUA 2HC9A 3C3CA 1WOYA 2VF5X 3F3KA 4ENPA 2JFWA 5AXAA 1O54A 4TTRA 4G09A 5I7OA 3UOAB 3IYLW 4GM4A 2RH5A 3BN3A 4JJAA 4HXGA 3WGOA 1PJCA 2Z08A 3ECSA 3QKTA 5LIPA 4E46A 4CMEC 3K8QA 2G1UA 2DMRA 5ABPA 3IUNA 3SZ3A 3KUKA 4IR7A 4XGRA 4BB9A 4QGBA 2C5GA 5CDHA 2NZUG 1PFGA 1SWWA 1FTSA 1H4TA 4RGVA 1V8OA 4JI8B 4J6EA 4NYJR 2AOTB 4DLRA 3FTDA 3MJCA 4HNQA 3FOBA 4F97A 1LRLA 4JQSA 2JFZA 4GMKA 5AHKA 1ATZA 1G2QA 3PS9A 3OU6A 4K9PA 4QNRA 5K09A 2ZLBA 2A78A 1AMUA 2QDXA 3AETB 1CJSA 3OOEA 4DCJA 1Y34E 2VK8A 4A15A 1TKCA 4OHCA 5JJIA 1BH2A 4QLAA 4JL8A 3FBTA 4XWGA 4NKRA 4Y1RA 2XQGA 3DVQX 4O63O 4X61A 3UAGA 3QE9Y 3E6AA 3LUBA 3RC1A 3AG6A 1ECLA 1JLRA 1TE2A 1WHTB 2IVZA 2VAPA 4J2OA 1CJUC 1TUIA 2Q8QA 3ASYA 4HNHA 4YUAA 5FWNA 5IANA 5KC8A 3IKJA 4EMSA 2GYUA 1V2HE 5AIBA 3X2SA 1HT1E 1T5SA 3FNRA 3FFBA 4GD3Q 4Z4QA 1MB0A 3PQDA 1ZJWA 4KH0A 1E4EB 3AUKA 4BOYA 4BFLA 4UPEA 2KLBA 2W4IA 2ACEA 3CX4A 4NX2A 1KZYC 5KSWB 5L53A 2X2FA 5ED4A 4QPCA 1UP6A 3AW8A 4XD2A 3VGPA 2QWXA 5LBUA 1JEAA 2IYFA 4M0DA 5M2QA 2WWVD 2XD9A 4S3MA 5IJAA 1C4WA 1E1QA 1OFTA 3BIFA 4MVJD 1BHQ1 4PRZA 4YB8A 5CYPA 3U4CA 3WV4A 4ARIA 3PUVA 3CV3A 1LWNA 4H1WA 2OO7A 5JNTA 1KP9A 2BEUA 1B3BA 2XBLA 3DLHA 3BE4A 2VZEA 4U7JA 4CQJA 1KEEA 3KJQA 1EIZA 1GD1O 1EUDA 2YN0A 4KXLA 4C78A 1XZLA 3NWJA 4MQLA 4QTTB 3TLZA 2VTBA 2Z6QA 2WEKA 3A9RA 4DMUB 3EWSA 4R1TA 2BKVA 4KDRA 3A1CA 2XOKD 4S1TA 1QO9A 4ARZB 2K7FA 3SZLA 3ITDA 2HTEA 4HYTA 3UK7A 4DJ5X 1B0AA 1VA4A 1IY0A 4KFUA 4RTRA 5HOQA 1NMEA 2XV1A 4OLJA 2B94A 3VNBA 3UMRA 3N2IA 1QGUA 3EPHA 1UEIA 2J08A 1V11B 1E79A 3ZIAA 5IYZF 5BOSA 4ZU3A 1BD4A 3L7BA 1ONBA 3AV3A 3D7SA 4G5RA 1YULA 3VOSA 4WINA 2ISQA 2B5OA 3VMFA 4ZVUA 3LW8A 3HDVA 3PWTA 3QPWA 4RZSA 1YI0A 4DLPA 2F55A 3AP2A 1WWKA 3LGSA 4Q37A 5JDCA 3D6UA 3WISA 3LA6A 1L4FA 2ZR0A 4KVGA 4JUDX 4FDUA 1BMQA 4Q3AA 5AW0A 1GZHB 5DTIA 2DWPA 2QJTA 3ZH9B 2GBLC 3BGSA 2EF1A 3WFJA 1UK7A 3OPVA 3SSMA 4FGWA 4JP2A 3BMCB 1JE1A 1ND6A 1N7HA 4U7DA 1QZUA 4Q9LA 3M5DA 4FE4A 1B4DA 3BCHA 4LDJA 4GLLA 4MH0R 3MCUA 2X2PA 3H5VA 4N47A 3SQOA 5LZ5A 1USIA 4RFVA 4A91A 3IXMA 2Q5JA 4YJ2B 2QGNA 3NWBA 2PQ0A 2X42A 5CNKA 2C99A 4B6EA 3BIJA 4V03A 1R18A 2XXBA 3QG5A 3GLIB 3P9IA 4M9UA 3TG8A 3IL2A 2Z9DA 2YJ6A 1NHWA 2GJ8A 4PU0A 3ZV4A 2IV3A 4JDUA 3NDPA 4OUDB 4MW9A 2A0FA 3ZV5A 5BNWA 1D4AA 1I4TD 3ZI4A 2A5GA 1Z6QA 5M29A 4EPWA 1KYTA 2WSBA 5BW8A 3MS2A 3FWNA 4ONEA 2JIZA 5CUQA 3SU8A 3PR1A 1QHGA 4LF6B 3G0CA 3ND9A 3VM6A 3HYLA 1U0LA 1GYRA 2BI4A 3A2MA 3KJIA 1AQNA 4OQMA 1N25A 1QE5A 4FYPA 1C1HA 1BDJA 2EATA 5C31A 4JT8A 5JG7A 3QBDA 2H4FA 4ZCSA 3GT0A 1N5JA 1SA0B 1Y37A 1GFIA 1ZOOA 3MYYA 3FTFA 4JASB 3VHXB 2WF6A 4XX0A 1UADA 1K0UA 1CUYA 1MDBA 3I9V6 3MFYA 5CM2Z 5F1OA 1FTQA 1RPAA 1NJ8A 1U02A 3OZCA 5D6NA 5DH9A 2BFCA 3H16A 3R3VA 3IVCA 4FP9A 1SBTA 3BD6A 3ZV6A 4TTPA 5ICCA 3GEBA 3S1LA 2UUAB 3PHCA 4NBUA 4PG7A 2XIJA 1YQ9A 3GJXC 5BV8A 2BGMA 1AM4D 2MHCA 4M1OA 5GMOA 5F23A 3H9CA 4EKIA 3LQ4A 1V5FA 1IULA 5LP6C 1KDOA 2DYKA 1SCNE 3QEKA 1KO4A 1UMDB 4FNGA 2A5LA 2HSEA 2WZBA 1C7IA 3LUPA 4NZMA 3T3PB 3JD3A 1ZL0A 4TV8F 4D0SA 2XGJA 3AHCA 1VJCA 3DUFA 4NAUA 2FR1A 3BK1A 1JI0A 3AUXA 3DJYA 5IVKA 2YNMD 1VE5A 4WAUA 5FNZA 1ODCA 5K8LA 4A6PA 4C7BA 3KWMA 4K5QA 1WCWA 2AEFA 2OPHA 1FUIA 3BD8A 5IBCA 3Q8MA 2P5TB 4ZZ3A 2CC2A 3FBGA 3H6HA 2OZKA 3PI6A 3R9IA 5EE3A 1XZEA 5C5DA 1XA3A 4ZMSA 5JO0A 2WWYA 1BU8A 3HBJA 2EZ8A 2VFAA 2ZWMA 3LPMA 1NW9B 4HHEA 5I9IA 4L8VA 2Q9BA 2PKRA 2YVUA 3S27A 3EASA 4F6RA 4F4CA 1Q0ZA 5DPMA 2ZTVA 4DLVA 3HCEA 5DM60 4PLTA 4TTQA 3V7UA 8LDHA 2XTJA 3C7CB 5E6SA 2FTKE 2BFPA 1DS6A 3PHIA 4KN5A 1PKXA 1Q7EA 4BLSA 1M3SA 1SZJG 3RS5A 3ET4A 3A04A 2CLEB 2G72A 4RH3A 3AEQA 1DEOA 1HE8B 1NVFA 3E3NA 1MAWA 3NHKA 3PFKA 4N03A 4J0HA 4P58A 2DPYA 4D57A 3HA7A 1KE2A 5DSXA 3HDYA 4RY8A 4ETWA 1JJAA 2ES4A 4G5XA 3ZD8A 1FDWA 2L2QA 2PLAA 4J2TA 4YS6A 4BFXA 4EQ6B 2R4UA 1IY1A 3EG9A 1A9TA 4LOIA 1BHSA 3Q0IA 1T1JA 1LSSA 1L8OA 3B36A 3LDGA 4OM8A 4P81A 4EA6A 4I1PA 4B2YA 2YJNA 3ILHA 1YJ8A 4TSRA 1KMHB 3FOAA 3J81A 1JLKA 3UWPA 3ZWBA 4KQIA 2BTEA 4KE9A 3R9XA 1F06A 1T4GA 4BKQA 2YICA 2QORA 5DNVA 3MERA 4F2GA 3FMPB 3OOYA 1WCIA 1RAIA 1UWCA 3X2EA 5A4AA 3GCXA 1Q12A 1FNNA 3PXEA 5BV1A 3QVGA 3U9SA 1KMQA 4K0KB 4IGIA 2QE7A 4O2AF 5IHPA 1GRCA 1LTKA 2A0KA 1JHAA 2HJSA 4CM4A 4DNPA 1RYZA 3OTIA 3PXUA 5CAEA 4YRKA 4MKHA 1ZS9A 5I5GA 5JAMA 1D03A 1T4CB 2G9RA 1G1AA 3GNLA 1RACA 2ANBA 3TH5A 2WF9A 1HE1C 1E1QD 1HLFA 1IQ0A 1B2RA 1RC8A 4EMUA 3KTOA 2F3SA 3ZJUA 3W04A 5MDHA 1O0SA 4NL4H 1OXXK 3C1OA 4KQFA 4YCDA 3WRWA 1Y1KE 1VFNA 2PKXA 2EHDA 2MINA 3O90A 2HDHA 4J43A 3S2GA 4M55A 1XPOA 4CW7A 4K1XA 3HGQA 3HKEA 3ZWOA 4PG6A 4AKHA 2WJ4A 3IAAA 3QVVA 5DBIA 3BRSA 2P8JA 3PLNA 3QWHA 4EFDA 4W9MC 1SKYE 1Y3FE 3SHOA 4WKNA 4L75A 2EJVA 2QQ5A 1L1FA 1CIVA 3T7IA 4AWBA 4TLBA 2PBRA 5F3WB 2GHQA 1S2OA 5IT9A 3ROKA 2JANA 2G76A 1Z8HA 3NV9A 5AW6A 3ZVKA 3L6BA 5EUCA 3UQYS 3QU7A 4JVLA 1UOEA 3LBHA 3PCXA 5JAQA 3SZRA 8OHMA 4BNNA 1TAUA 1SB9A 2IT1A 3G0OA 1QH9A 4EUNA 2VSXA 4CGYA 2NSDA 721PA 1M1UA 2AN3A 3IP3A 3L05A 2VDPB 3AY0A 2TECE 2GJKA 2PLFA 3UUFA 3O5AA 1W1UA 2G9QA 3ZWPA 1J9EA 1GQQA 3G8BA 4EW2A 4L3VA 5JFOA 3V7YA 5HQTA 3QLJA 1OILA 5I8ZA 4CKCB 1JLLA 2JARA 3LP8A 4QUJA 2BEJA 1HR0B 2I8CA 2MR5A 3A9SA 4HNAB 1K5HA 1WMDA 2JPDA 1CB0A 1F2TB 5FOTA 2RI1A 3ICVA 3KD2A 1PR9A 1Q1NA 2CB9A 5GM1A 3WTBA 2QZ4A 4DGQA 3P2YA 3QVJA 4AJKA 4YAKA 1GXSA 2NZWA 4P5DA 3MIIA 3EVDA 3VNAA 2X9LA 1W73A 2VHXA 1X94A 1RFLA 1FQJA 4MUJA 1R0LA 5LBTA 3PQEA 4EB0A 4Q1FA 4F1JA 1K06A 2R751 2GO1A 3ACDA 5HKKA 1RQ7A 1T2FA 4LDRA 1PFVA 2ZPUA 3C6MA 5EP1A 3R2JA 4HAOA 2IXFA 1WNFA 4PQEA 3E9MA 3CEMA 3N5KA 1HEUA 4JOBA 1KDYA 1TT5A 2Q9UA 5JNWA 1BCSA 1ZN7A 2WU1A 4PPQA 4NPAA 5JANA 3HI6A 4MIOA 1U8UA 1PCXA 2KJQA 1DCKA 1IN8A 3KB6A 4UUPA 2IV2X 1P61B 1LPOA 1Z25A 4EZIA 4B3MB 2Y99A 3R7LA 4RX1A 5GZ3A 5BSMA 3T9CA 1XVTA 3NI2A 5AK0A 3FSRA 1E92A 3LPNA 3FM9A 3L92A 4GUAA 4KXNA 4M9CA 4UQOA 4WY2A 3PHBE 3ISTA 5DT2A 3WP0A 2PKEA 1C9YA 4C6SA 4FGSA 1NMYA 4R0NA 4YDQA 5KSZA 1GGJA 1B26A 1BWRA 1G7TA 1LFDB 1X7XB 2WUFA 2YH2A 4RO0A 3MCVA 5JLAA 1K9SA 4KXXA 4HYEA 1MQ9A 2VXBA 3DE6X 3EVTA 4NWIA 1SVWA 1Y1QA 2W0MA 2EX0A 3Q11A 1ORIA 2K4MA 2WHYA 2Q29A 3LT2A 4LZPA 3KKNA 2W37A 3DMDA 4OF4A 3UFXA 5HOEA 4JQZA 1ZWKA 3ZJ5A 2FZ4A 2CLCX 1ILWA 1NBHA 2GETA 2HEGA 4DSZA 2Y1OA 1HWYA 2ZUDA 3PDIB 5JS7A 3IAXA 1P0IA 1Y5MA 1K3UB 4YA6A 3C6BA 3KELA 4HXYA 1FP6A 3ZDFA 1M54A 5F1PA 2FWIA 2PV7A 1MBZA 4YJ3A 3DTYA 3MTEA 5AKHA 2H07A 5EESA 4DDKA 4NJMA 3SXJA 1XJQA 5FYDA 1EX9A 4HDMA 3SSNA 1PUIA 2I2WA 4X3PA 2P9JA 3KOXA 1H0SA 3MCAA 2ZJAA 1SG0A 3EBOA 4P54A 1YC2A 4JJFA 1GGNA 2XYQA 4ZIRA 2UZ4A 1T1EA 3WDLA 2PYZA 4AJPA 1EP1B 5CTJA 1BRTA 5TVGA 1R9NA 2VHEA 2XDQB 4XUEA 1B2LA 1S7CA 1YA8A 2IGBA 3P52A 2D1FA 3THRA 1DADA 1YD7A 2AOUB 4U2CA 3FHJA 3CKLA 1JBEA 3QLEA 1NFFA 4J0CA 4RMHA 3ZHSA 1P73A 1XTZA 3H1EA 1HLPA 1K7SN 1MJNA 3KYJB 2RHBA 3NPMA 4I4TA 3IPXA 1VCNA 3SDZA 1T1SA 2EKLA 5CYOA 2IDMA 3GAMA 2GQ0A 4FMDB 1W1WA 2XMRA 1BVYF 3Q7SA 5FBKA 4PZUA 3QTBA 2CNDA 2IBSA 5ECYA 1NJ5A 2ZULA 2E4XA 4GZMA 4EI2A 4G1CA 3LBFA 2AMYA 4P84A 4YWJA 3K8ZA 4BTLA 1PAUA 1T5DX 5ALDA 4UNQA 2O0MA 4AY2A 1SM4A 2AEMA 2GYYA 3B1WA 4ODIA 4EG0A 4QRIA 3MWGA 1TTPB 2X0RA 3GJSA 1PSDA 3I4CA 3AKEA 3EXEB 3O9MA 5IS2A 2LDBA 2RHOA 2FCRA 3PNVA 2ZM5A 1EFRA 2ECFA 3M6FA 1ZI6A 2REQB 5AKYA 1KYWA 4KFRA 2YWJA 3DNFA 4U2GA 4C22A 4M7OA 2C54A 3LHFA 3T7JA 3C8MA 4B76A 3MM4A 3E1GA 4IG4A 4Y2UA 1JMKC 1ID1A 3L41A 3URMA 4ZRMA 2EBFX 4O59O 1YMUA 1VHQA 2JCGA 2XMPA 1YZVA 2HCFA 3GCZA 3MJEA 4OJQA 4U7WA 5ALEA 1YZLA 4RMIA 5LZ8A 3RROA 3FMVA 3HCAA 4H59A 2PK3A 1AOXA 1VL2A 2J1LA 4G5YA 2BUCA 1XL0A 1C2TA 3RV3A 5EE9A 3DOOA 3PTLA 3CTPA 3K0FB 2CK3D 1SIWA 5BO5A 4P92A 4AXXA 4B3RB 1QQTA 3K9NA 1AN9A 5ER6A 5DBHX 2PQ6A 2YVLA 4G25A 1RP1A 2CGEA 4N39A 1UJNA 4X63A 3RFVA 4CM3A 1TVMA 1G6HA 2YWGA 2ZTLA 5AXCA 4FYKA 2P0AA 1F17A 2G70A 1P8AA 5EJ8A 1BVUA 3IEUA 1I9GA 3DYIA 1BJKA 2CLDX 2HI0A 3MINB 4RL6A 3PNBA 1JR3A 1GG8A 3A4TA 3DTTA 3IJPA 4LQ4A 3UCEA 3VR6A 4OHRA 4BN0A 4JGGA 1I36A 5EJ7A 4G0QA 3ZZ0A 1CUJA 3ER8A 1L7NA 3CEHA 2D06A 2FOIA 2FJUA 3TDNA 2IXBA 2WJIA 3K73O 5NLLA 4CMCA 5A9SA 1QIDA 2A1TR 5KNCH 1IH8A 1RVV1 1UBFA 2WJHA 1RWVA 4IHJF 1H3FA 4HZUA 3AL3A 4D0RA 3T7EA 1DOZA 4KQCA 4R84A 4RMJA 5EJAA 3LCVB 4E3ZA 4GXRA 2BEVA 4B2LA 3THXA 4MQFA 2HK6A 3IIJA 1F7VA 1L5RA 4C6RA 5JWOA 4XDGA 4PFJA 4GBED 3QBEA 3TJZA 2GCOA 1JWBB 4FEEA 4ZYVA 1C1DA 5CB6A 2PR7A 2PUBA 4LXQA 4MLPA 3T95A 2QRVB 4UDYX 4LJ4A 4NHOA 3ZDXB 1GRRA 3ITNA 4M6WB 1TGYA 2HWUA 2EERA 5DLDA 1OXUA 1ZMBA 3SVTA 4JLBA 2Q3BA 3KQSA 3JQ9A 3QYFA 1ONNA 9LDBA 1QE0A 5BVGA 2BP7B 3ABZA 2DLCX 2IHBA 4M22A 2AFRA 2C96A 2XNDD 4GOXA 4URZR 3ZTYA 5JCOC 4MWDA 1Z6ZA 1IE3A 1L9KA 4R9UC 2JLYA 1JEQA 1M1NA 4YYEA 4NZOA 1JXAA 2CJFA 2G1AA 3VR5D 3MRSA 2P27A 4CHTA 3MLAA 4ESVA 2QE7D 1AKEA 5LD2C 5TY0A 1UAGA 1FQOA 4J16A 5F5NA 4PPNA 1WMAA 1TCUA 3DEZA 3FOWA 3WIVA 2YXBA 4FCTA 1PWEA 5AK3A 1Z0DA 2UUBB 3OE4A 3DM5A 3VU9B 3AF6A 1SD5A 3QEOA 3CVXA 4ZQIA 5DT9A 1GEEA 2EJWA 4KDFA 4D3XA 4QASA 2VZ0A 4LKOA 2ZRDA 2ARKA 4ILEA 1TQ4A 3DS8A 2PD3A 4TYPA 4W8HA 1HZZA 2F67A 5KTKA 1IZ8A 1XRNA 3A14A 1JHPA 9GPBA 3P96A 3SOZA 1W88A 3OHMA 2GZDA 5LQUA 1T6YA 5CG2A 3QHAA 3RSQA 1V96A 4NZPA 1DARA 1UH5A 4R1OA 3N8GA 5AW1A 4PQYA 3FCOA 3HN6A 3GV0A 1JKJB 2I4NA 2Q5EA 1ESZA 1X1BA 1DWOA 3B2EA 3HB4X 3MFQA 1FNMA 4L28A 4S24A 3RS0A 4EITA 2CDRA 4IZOA 3WNQA 3ZXIA 2O5EA 3E5NA 1NVVQ 4KB5A 4FLFA 4CZ2A 2WSLA 4MRNA 4EJFA 3EEFA 1FYXA 4WZAB 3WL7A 1Y8RB 2GM9A 2JGJA 4TZ6A 1QJ4A 5KWSA 4RIIA 1EWKA 1X1AA 4O5AA 3IEIA 4F5DA 3ZHQA 2UZ1B 2YIMA 4N3BA 5EHQA 3NOQA 4IDHA 1A7AA 3BRWD 2XB9A 3MT7A 1LLCA 2CWDA 4H7PA 2G5PA 4RCVA 4EVRA 2W93A 5JH7A 4K86A 3ICQB 2PRJA 1WEHA 3NBUA 4IBOA 3NBZC 2XITA 1FFWA 1Q1BA 2POQX 1XTVA 4LDQA 3REQA 3MLBA 4HQOA 1I5EA 3AB8A 4YRIA 4CV1A 1IXZA 1GAXA 1A9RA 1E3WB 1N7JA 2Q4OA 2RHLA 3IHLA 3IT1A 3K7EA 3OT1B 4RA6A 4YDRA 3B52X 4OAOA 5J4HA 1I3KA 1XFAA 5TE9A 3R8XA 2CXNA 3JAKB 4LA4A 4BV2A 5JYBA 1LX7A 3R0IA 3B9QA 4G1BA 1C0LA 4GZLA 2B9EA 4YIHA 4WKGA 2IOFK 2JI7A 3ZGYA 2Q9AA 4KRFA 2BHSA 1PTJC 4R1SA 3KFXA 4EY6A 1E18A 1YVPA 2DT5A 1G8HA 2JFQA 3EIOA 1RYYA 3MJHA 3F4KA 4ND8A 2OFOA 2IHNA 1OXSC 3IXQA 2PKWA 3CLUD 1CFZA 1JB9A 3FVTA 1EEXB 2B4AA 3NT2A 3TZQA 2AKYA 4QUDA 2AKEA 1B74A 3G2LA 4RPGA 4EKYA 5EPOA 3GGCA 3T54A 1CEEA 1A50B 1SKBA 3BJEA 1GTMA 4E6PA 1ZAYA 4JP5A 3E05A 3E2IA 3GD7A 2I76A 4PVCA 3TPFA 5KYKA 1ISGA 3WIBA 4N65A 3UMBA 4BVLA 6LDHA 4FKBA 1XRMA 3IDOA 1LBHA 1QOQB 3EVBA 2YY6A 4H9GA 3LSTA 3ER6A 3EQ7A 3B3FA 3RYTC 2CNWD 2ZQ5A 4GC5A 5C81A 1GM5A 4P4TA 2Y1DA 3TCNA 4EABA 3M5WA 2NTNA 1VYTA 4CJXA 1A9XB 2YBEA 3ZU4A 3MS7A 2BEWA 3WYCA 2FDRA 3DE4X 3ORFA 3OF3A 1WXFA 2R6JA 3SHTA 4EK9A 2V4ZA 3LLVA 3BK7A 3I9KA 4P3XA 1QIHA 2P9TA 2Z0MA 4R3WA 4X20A 2GLTA 3F1LA 3RREA 4X1IB 1QBGA 1V2GA 3C3YA 2EYUA 3AR4A 3RT1A 1BO6A 3LQ1A 4TYNA 1AN0A 5KNCA 1P5RA 1GZ4A 4PS0A 4Z51A 2I66A 1U7XA 3OTQA 3PT5A 3SOPA 1GT6A 2N9UA 5IAEA 1G0OA 1KK0A 2AN4A 1ZM9A 2G4CA 2ERXA 2QG6A 1YCFA 3ANXA 3KT3A 3MCTA 5DP1A 3FYTA 2EJTA 5H9WA 3HVHA 3DL7A 2AL7A 5JXGA 1KYYA 3EAQA 3IJRA 4JFRA 2HO5A 3IRVA 4YP6A 5L3SA 3R9WA 4TZTA 4QZVA 1AZSC 2AE2A 5DBEX 4ZAZA 3WLFA 4FNAA 3K1JA 2JI8A 3LKBA 1I4WA 2XTMA 4RDIA 5JNUA 3MAAC 2V59A 4BFSA 1NURA 3B70A 3DE2X 3K1YA 3K5PA 2EKZA 2QMEA 5E9WA 3SC3A 3T5TA 2MMCA 3TI9A 3OTGA 1JR4A 4YV1A 5DNUA 1ZOIA 3K05A 2BI7A 3H9GA 4LFAB 1NTRA 4G1VA 4ZQHA 3K09C 3PEVA 1JG1A 4AJJA 1VPTA 4HRVA 2ZR8A 1WLSA 3MSXA 1RQGA 3EIQA 5JE8A 4JB8A 3WFZA 2F9LA 4U3JA 3ZU3A 2EARA 1SBNE 3EQ9A 3PHJA 4OOFA 1EQAA 3P2EA 4HVAA 5CJJA 4CGZA 3QKWA 1UOQA 1MB4A 3NAGA 3HCOA 5AOAA 5FADA 1SN7A 1XDBA 4AWAA 2WHRA 5IABA 5AJYA 3ENZA 1JKFA 3GR6A 2O57A 3QJGA 5DNEA 1R37A 5I4IA 4A0QA 5JNRA 2GNAA 4PTZA 4NESA 1HRDA 4L57A 5TRTA 1YOBA 4FYWA 4F5ZA 1A7JA 4OUDA 1MZVA 2ZSAA 4F7WA 3QVKA 1YK1A 5E2BA 4CN8A 4US2R 1QG6A 3G0BA 4AY4A 1CJKC 4LXUA 4ZI7A 3KETA 1BDIA 1PQWA 1YS4A 3L0CA 1QZTA 2FXIA 1MH1A 4FGJA 4F72A 1KJNA 1YL5A 3KFLA 2J07A 3NTQA 5ETJA 3J7AC 4AB1A 3ODPA 1IOLA 2PIAA 4LBZA 3EIEA 3E3MA 3G2NA 3VKHA 2HJVA 1SD2A 4XCVA 4DR7B 4D45A 1SO8A 2NU9A 2W48A 1SR8A 3JQFA 2Q9CA 5A3SA 2IHZA 3Q5GA 3TVTA 3UNXA 3I1IA 4NARA 1ZIXA 1LLFA 4XGNA 1ODFA 1Z6YA 2XXJA 4AFNA 1FVHA 2X5NA 1R8QA 3FCXA 1M67A 4JYAB 5ILOA 4QYTA 4R5MA 4B83A 4D98A 1NLFA 3QUAA 3PQ4A 1W34A 4IEEA 4A1OA 1E5DA 3I39X 2H8GA 3ENVA 2JK0A 3NYRA 1MX9A 1XF1A 2HRDA 1U4NA 2YVAA 3RB8A 4ED9A 1DMRA 2P30A 3ZNNA 3F6BX 2TMYA 4CQMA 3ZLUA 1U2TA 2IZOA 1JFTA 3RODA 3JX9A 1R9JA 1UMDA 4UFPA 3L0IB 3I28A 2P2DA 3AXTA 1Z4NA 2GZHA 3RABA 4K2AA 1ZMRA 5KQPA 1FLDA 2PMKA 1Z0SA 4KO1S 4MQMA 2DLNA 2BJWA 2QLJA 2XUKA 1Z56C 3NRBA 4QBGB 4ZQBA 4QGAA 1OYWA 1QCYA 4A0FA 3O95A 4RAOA 3OCUA 2D6FA 1BGWA 1V71A 2Y1LA 3PXXA 1R16A 1E6KA 1UQTA 4IFEA 4DLAA 4MUFA 2BFDA 3VMMA 1RBQA 3B6EA 2UYYA 4M0UA 4IXWA 2XF8A 3L4JA 3L18A 1Z2EA 4YFVA 3P20A 3O7MA 3N28A 1E6CA 2IK8A 2E87A 2PSDA 5EY5B 2VJMA 4FZVA 1EX7A 3Q6MA 2PG3A 3WYFA 1OBVA 2PPVA 4DA8A 2YZKA 1RJWA 2XVAA 2CFOA 2D1RA 4N7JA 4Q12A 4S35A 4ZOQI 1DWPA 3LX5A 4HGOA 4B79A 3IMGA 2GD6A 4NR0A 5DXFA 3O94A 1C1XB 4FE3A 1KIFA 1QNLA 5HIKA 3E27A 2IXTA 1OXMA 1Z16A 4I55F 5LP1A 1GR1A 2IHTA 3DFUA 4FOSA 3KQKA 2CUNA 4G5HA 3GT3A 4J7XA 1VL8A 4XJVA 4DCUA 2CFCA 4GDFA 1Z5NA 2IZ5A 1H1DA 5AKGA 4RTOA 3KKLA 2VUIB 5SV2A 3KTAA 1N6KA 4IICA 1UDBA 1MHTA 2AHRA 3UGJA 1N2CA 1VFPA 4RANA 3ELDA 3GK3A 1PYDA 3K5HA 3GRYA 4MI6A 2XVYA 5JZBA 4WI1A 1RSZA 2CZCA 5BN4A 1HDXA 1FDTA 1JHOA 4PVDA 1Y5IA 2Y68A 4Q4LA 1KWKA 3WMEA 1HE2A 3LL4A 3T52A 4RTNA 3K8OE 1LWOA 3WLEA 2XB2A 1OPXA 2HUNA 2K2QB 3Q5EA 4B3GA 3CT4A 2J9YB 1INLA 1D2HA 2FE1A 4CKEA 3PJRA 4F46A 4UEJA 1FDSA 3TNJA 1OAKA 3TOZA 2J32A 1B6TA 4A03A 3ZGLA 1JDVA 4C3ZA 2QQGA 3THYB 1CJMA 2HD4A 3N7AA 2QPOA 2Q1WA 3E70C 4WNYA 1Z7EA 2ZYSA 3GJQA 3KWFA 2O05A 1E2PA 2PX8A 3JPWA 2X14A 1DJOA 3PX3A 5FFMA 1QDEA 2GCNA 2B4TO 2W6ID 1G291 4IHJB 3GG9A 1HE3A 1YT5A 5FI5A 1V1MA 2Y27A 4ZAXA 3DXZA 4ISCA 3DZGA 2IJGX 4PHHA 1Q95A 3RYIA 1S4QA 3HKEB 4QU0A 3TE6A 2YCLA 2OXRA 2NXNA 3W78A 2Y3IA 3OIUA 4KAFA 3GA0A 3HC7A 5K0ZA 2P4QA 2RHCA 2Z5GA 1E1MA 4GPAA 4RVUA 3E7FA 1XJ5A 4NOLA 4Q7JB 2QMYA 3B6ZA 4DG5A 4Q39A 5DRTA 5IEJA 1K86A 1DFGA 2EEZA 1KA9H 3PL5A 4BPRA 2N1MA 1A2OA 4ZRNA 2J67A 2E4AA 4G4IA 2ZI6A 1IXRC 2DUWA 4LQCA 2RD2A 4IYRA 2ZDHA 3C3JA 5B1YA 2QAGA 1RS0A 3NHUA 5HE9A 4HAIA 1PEYA 3MGBA 1O77A 5TNXA 3EQZA 1ZM3A 5G0SA 4TLMB 1VPEA 4AURA 5EVJA 3WDMA 4YJKA 3H13A 2WIFA 3VSCA 2DEUA 2WNHA 5HDBB 3KE8A 4CKCA 1M0EA 1JLLB 5BQ3A 1OFVA 5CXXA 3QHPA 2IUEA 2WU8A 1P39A 2R7KA 5C1DA 1J5EB 2F6RA 3O73A 4L7QA 4RY0A 4Q0MA 3V8MA 2CV2A 3R23A 1G5TA 5F52A 2HU8A 3INTA 2AG8A 1NF8A 3NG1A 2IXAA 1G3MA 1A95A 3GRUA 4MV1A 4A16A 1OREA 2CXUA 1OGJA 4TMFA 4YRAA 3JALB 1TM2A 2V65A 3D4OA 3A9UA 5E2AA 1ENPA 5EJGA 1EJ0A 5KJFA 3PIIA 1MAHA 5JNSA 3C43A 4ZT2A 2GF2A 3FPHA 4F3CA 5JV5A 2OR3A 3N59A 1DAEA 4L2IB 3EXIA 5HDQA 2NP7A 1GARA 3WKAA 3K2EA 1P6UA 2A35A 2BSAA 1OAAA 4YJDA 3TTXA 3M4YA 3ZZTA 3TTSA 1N2BA 3RSHA 1N5IA 3W2FA 1MLDA 2ZBRA 4KDCA 5REQA 2DOKA 1PFQA 4R5HA 4JI6B 1LA2A 1NUSA 1WE2A 3VH4A 4QGHA 4BBZA 5HM6A 2B2XA 1CUSA 4WN9B 1E58A 1SVSA 1Q92A 4MUEA 2B78A 3TLYA 1YA6A 4QEZA 1XMQB 1GNQA 5C51B 1P3JA 5ICEA 3LGAA 5KZMB 2P5YA 5DLYA 4OFWA 4NEGA 5EAIA